3BZ3A

Crystal structure analysis of focal adhesion kinase with a methanesulfonamide diaminopyrimidine inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
276
structure length
259
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPLAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Antitumor activity and pharmacology of a selective focal adhesion kinase inhibitor, PF-562,271.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 259
sequence length 276
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bz3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bz3A01
5E8WA 4BBEA 3VRZA 4OAVB 3D5VA 1PXKA 2HZ4A 3KF7A 3OHTA 1SNXA 2RFNA 3DKGA 4QP4A 5A4LA 1VYWA 4YBKA 3NMUF 4BZDA 4ZLZA 4WUAA 2QO9A 4X3FA 4ERKA 4XBRA 5DNRA 3QQGA 5HIDA 4O82A 4BCJA 3PVGA 2YAKA 3N51A 3O17A 4MD7E 3R7OA 4LV8A 3SDJA 1Q3DA 3VW6A 2F9GA 5ANIA 2DYLA 4BTKA 3AD4A 4ITIA 1BI8A 5TOZA 4V0GA 3S95A 3NUUA 1P2AA 3SVVA 3LCTA 4QMZA 4R1VA 3PUPA 1A06A 3AGLA 3R28A 4YU2A 4TTHB 5HE1A 1M7NA 2Q83A 4DH1A 2PUPA 3SXSA 5C8KA 1WCCA 3EHAA 1VZOA 2QOHA 3TKIA 4FV8A 5AP7A 2UUEA 4PTEA 2P2HA 2YAAA 4BGGA 1GY3A 4EH3A 3FY2A 4D4VA 3LM0A 4EH5A 5HE2A 4FIEA 2IZSA 3POZA 4NCTA 4L3PA 3V5TA 2BALA 2QHMA 5HG7A 4QMNA 3NRMA 4FL1A 3AMBA 3UJGA 3QQHA 2XIZA 3CXWA 5CENA 3BU5A 3OWJA 2R3MA 1CKPA 3WF9A 4TY1A 3NSZA 2ZV2A 3FYKX 2C0TA 4RJ3A 4CSVA 3VS2A 3MY5A 3QD3A 1RQQA 4C37A 2Z02A 3R8PA 1YWVA 4FT3A 4U79A 2F4JA 5HO6A 3VS0A 3VJOA 3EZRA 3QCQA 2ETKA 2Z2WA 4OTDA 3KCKA 4C02A 4HVSA 5HGIA 3RJCA 5BVDA 3QKMA 2PZYA 3TI1A 5BYLA 4CTBA 2VTRA 4HGTA 3FLYA 4DGMA 4H3BA 4I0SA 3GEQA 3BE2A 1ZYLA 4YR8A 3I6WA 2HW7A 5GINE 2Y8OA 3BPRA 3OP5A 2YCFA 3VN9A 1QPEA 3UNKA 5E92A 2A19B 4NM7A 3RAHA 3C51A 4IVAA 4NIFA 5JFWA 1F3MC 4CZUA 3KCFA 3TWJA 5FD2A 4WNMA 3GCPA 5EI2A 4MQ1A 1YXXA 4RBLA 1DI9A 3VQUA 2ETRA 4JNWA 3E92A 4OAUC 2BAQA 5ETIA 1REKA 3R7VA 1PYEA 3L8PA 3LE6A 4JJRA 3ATTA 2WTKC 4IEBA 1JPAA 5CI7A 1QL6A 2J9MA 3P4KA 4FVRA 4D2TA 2X81A 4G3EA 4QYGA 4DITA 5LCJA 4FT9A 2WTDA 3QX2A 1BL7A 4BCPA 3RAKA 2Y7JA 2X8EA 3CCNA 3R02A 4YHJA 1URCA 2ITXA 3LAUA 4DFXE 4HCTA 4R5SA 3V5JA 3FMJA 4DH5A 1PXOA 2WHBA 1OIQA 2E9PA 4NYEA 5EOBA 3EZVA 4AWIA 4IFGA 3NDMA 4CFNA 1ZLTA 4A4OA 4FYNA 2OG8A 4WG4A 4IX5A 5DPVA 4FG7A 4F63A 3KREA 4ZZOA 4P2KA 4UV0A 4WUNA 4DH8A 3QYWA 2YM7A 1SMHA 3EQHA 4S34A 4JAJA 3UYTA 1IASA 3FXXA 4MK0A 4QP7A 1YHSA 4IWPA 3WARA 1XH4A 2YM4A 4JT3A 3KXGA 3MVJA 3PPZA 2PTKA 4GK3A 4LM5A 3D14A 5C4KA 4YSJA 4USFA 3PIXA 5I9XA 4O0RA 3W10A 3LFBA 4BKYA 4FE2A 5IZFA 1E9HA 4IWDA 3O8TA 4P5ZA 1IEPA 2KULA 5EM6A 3H10A 4DBNA 4JR3A 3RCDA 3PWYA 3PYYA 5IH6A 3ANQA 2PVYA 3ZC6A 3MBLA 1EH4A 3PXZA 2FSMX 4QP6A 5IA3A 4FEQA 2PY3A 2HXQA 1KV2A 3MFSA 4G2FA 4X7QA 1P14A 2J90A 2OFVA 3HAMA 1JLUE 1OB3A 4BIDA 2HELA 3QRJA 1O6LA 4QO9A 4XG6A 4FVQA 5LVPA 4Y95A 5FEEA 2VTOA 4Z7HA 4UY9A 4JDHA 1PXJA 3C0GA 3CQEA 4ANBA 3QAME 3VS1A 4EORA 2ZDTA 3AMYA 4TL0A 4O7TA 4NW6A 3BV2A 4J8MA 4DFBA 2YIRA 4BCHA 5FDPA 5CF6A 2ITWA 5BMMA 2W5BA 3BX5A 4XBUA 4FTNA 4DGLC 3PVWA 4YNOA 4BKZA 1R78A 1RW8A 3BRBA 3IECA 3MS9A 3DTCA 3H0YA 2WOUA 4FEXA 5LJJA 3ZRMA 4PUZA 1JSUA 4XRJA 5C9CA 4E7WA 2F7XE 4F6WA 2OZOA 1MRYA 4O2PA 2P3GX 4YC8A 1XH7A 3DXNA 2GNIA 3ZXZA 5I9WA 2XH5A 5H8BA 2OF4A 4G34A 4KNBA 3CTJA 3LFSA 3EQPA 5EHYA 5DEYA 3R71A 3NWWA 3PXKA 3DBDA 5J7BA 3ODYX 1E1XA 4FNYA 4W4YA 5AA8A 4Y83A 4YTHA 3VF8A 4MXZA 1J91A 3FZTA 3SAYA 1H0VA 3W2RA 2WQMA 3BE9A 4EHVA 3HV5A 2FSOX 3UZRA 4NU1A 2WPAA 3SLSA 1OKZA 2BVAA 1YOJA 3MSSA 4JDIA 1U54A 4FSQA 4ZS4A 2XNMA 2C5VA 5E8ZA 4CQGA 3PFQA 4DH3A 4H1JA 4DBXA 3F5UA 1OITA 3Q9YA 4M67A 2NRUA 4AACA 2WIPA 1FOTA 2YA9A 4IXPA 4RX5A 4FZAB 2G2FA 4FSZA 2XIXA 5IMXA 4YJQA 5EYDA 3KA0A 3UG2A 5EQEA 3I7BA 5IQCA 4EZ3A 3TJCA 5DN3A 4U3YA 3U6IA 4IVCA 1XH5A 2UZVA 3LLTA 4AOJA 5ICPA 3ZZWA 5JZJA 2PVLA 1WBTA 4MNFA 1W98A 3NX8A 3M42A 4BDAA 5HX8A 4BIBA 3UOJA 3D7TA 5AX9A 4D9UA 4EH4A 4JLCA 3NYXA 4QD6A 2PVNA 3ZONA 4X2NA 3KC3A 5HLNA 3UQCA 5B7VA 2B0QA 4BWXA 3C13A 3UBDA 4HOKA 2Y9QA 2XRWA 4PMSA 3PRIA 4HCVA 5FM3A 4CG9A 2O5KA 4G16A 4WNOA 3VQHA 5HX6A 4PY1A 4YZCA 3PY0A 4GYIA 2OKRA 5IQGA 2PE0A 5CT0A 2I1MA 3ODZX 4U41A 2VGPA 3MY0A 5LCKA 3RM6A 2B7AA 2PMOX 4AP7A 4HGLA 5JN2A 5EG3A 3JY0A 3MJ2A 4D55A 3PA3A 1S9IA 3PLAE 1ATPE 3ROCA 1STCE 3A7IA 4CMOA 4BI2A 2JEDA 4F0FA 2O65A 4DGOA 4IDTA 5IH5A 3W33A 3H9RA 5BVFA 5J9LA 1I09A 4EK3A 2W4OA 2O8YA 3WZEA 3CJFA 5KZIA 2ESMA 2H8HA 4O0YA 4RLLA 5GIOE 3CIKA 4C35A 1H1QA 2W1GA 4IAZA 3EN4A 3ZLWA 4F0IA 2YLEA 4L9IA 5EFQA 1R39A 2BRNA 1Y8GA 4IB1A 2R3JA 2JAVA 5KX8A 4TWCA 3TZMA 2YITA 2UW0A 4LQMA 1W84A 1PMVA 3OG7A 1KE5A 2J0JA 4RMZA 4DE4A 3VC4A 3KULB 4YO4A 3LJ0A 3P9JA 4MCVA 3E8CA 2J0KA 3LKMA 4YO6A 2QU5A 4F1OA 1PXMA 1JWHA 3HMIA 3JPVA 4FKPA 2V7OA 4AQCA 4P7EA 4H3PA 3TXOA 4TYEA 2W1IA 5M4UA 3DNEA 1JKTA 4MXOA 3U4UA 4DCEA 4BR3A 4DINA 3E8NA 1TKIA 5M08A 4ZOGA 4IM3A 2XM9A 3ACKA 4FTJA 4J98A 3R7UA 4EK4A 2IZRA 3LFQA 4FIGA 4JX3A 5IUGA 3C0IA 5IUHA 3CKWA 3SRVB 5B0XA 5HBEA 2W9ZB 3A7FA 2QHNA 3JVRA 2XUUA 2WAJA 5KZ0A 2OH0E 4WSQA 1UU8A 1YDTE 3EKKA 3G33A 4D5HA 2E9VA 1NW1A 4Y8DA 4IAAA 5DLSA 4ALWA 3R6XA 2QKRA 1K3AA 4FV0A 4R6VA 4B8LA 5AP6A 1BKXA 2CCIA 2JITA 2VZ6A 4M8TA 4MBJA 4FKIA 4V05A 4BF2A 5TR6A 3KMWA 3UC4A 3DS6A 4KD1A 3EFJA 3DK6A 2X8DA 3CY3A 3QUPA 4CYJA 5G1XA 2IVUA 3L9PA 3NAYA 4W9WA 2R5TA 5EW9A 1H1SA 3WZJA 1OKVA 4FTQA 2XJ2A 2WU7A 3K3JA 4MXXA 5CEIA 4I5CA 2C1AA 5DFPA 1LP4A 3D9VA 4P5QA 4F7JA 1M2RA 1R0PA 1OBGA 4PDYA 3MJ1A 4CMUA 4O7LA 1M2QA 2YJSA 3G6HA 3WF5A 4WG3A 4FBXA 2R3HA 3NW6A 1E1VA 2V0DA 3F3WA 2UZUE 4H05A 2W05A 3QQLA 3FMMA 5BNJA 1IAHA 2YZLA 3MH1A 4FL2A 3ZOSA 4ZSEA 4QMPA 3M1SA 3M2WA 5DR6A 3DB8A 3QTRA 4QTDA 4RX7A 5AWMA 3F88A 5T68A 3RKBA 2EXEA 3R21A 4BGQA 1F0QA 4L46A 5AAFA 3O96A 3ZZEA 4FTAA 4O0XA 4UBAA 4YC6A 3LMIA 3QTUA 5FP5A 3U87A 3VNTA 3VS6A 5A4CA 1YWNA 2CGWA 3TNWA 4WSYA 3LXPA 5M57A 2YACA 3RM7A 1MRUA 2REIA 4RVLA 3EOCA 1H0WA 2WMQA 3BYSA 2YWPA 1H8FA 4L44A 4M69B 2ZB0A 3FQHA 3VBTA 3EWHA 3UG1A 4APCA 4IIRA 1OECA 4JOAA 5JFVA 3LCOA 2EXCX 1Q99A 3O51A 3QZFA 3W8LA 4A4XA 1G8SA 4UMPA 3GC9A 5EDPA 4I94A 1A9UA 2JLDA 3WBLA 2XJ0A 2X6EA 5DH3A 4FEWA 2OJ9A 4KS7A 2WO6A 3BGZA 1WFCA 3BLRA 4O6EA 4WT6A 5ACBC 2I40A 3B8RA 4JBVA 4RSSA 2XIYA 3UE4A 4B6LA 3SGCA 2ACXA 4F6SA 1UKIA 1UV5A 3MV5A 2A2AA 2OWBA 5FEQA 3KVXA 4MTAA 3RWPA 3ZDUA 3TNQB 4K33A 4JBQA 4XS2A 2HOGA 3BBTB 3C0HA 4RIWB 4RIYA 3NPCA 3KKVA 4N6YA 1DAWA 5FM2A 3WI6A 5KNJA 2CKPA 5CSXA 3MIAA 3R2BA 4FKVA 4FVPA 4ZJJA 5BX0A 4YLJA 2GNJA 3R83A 4BGHA 4EOPA 5A9UA 3R22A 4PPCA 3F5GA 4UWCA 5FG8A 3VUDA 3WOWA 4WNPA 2C4GA 2ZV9A 5HQ0A 5IQAA 4OW8A 3NNUA 1VEBA 2ITQA 2RL5A 5HTIA 4CV9A 2W1DA 4O84A 3RHXA 4EZ5A 3OF0A 4EOKA 3LQ3A 3WYXA 3F7ZA 3OXTA 1Q41A 4AZTA 4MH7A 2IVSA 2WIHA 2HWOA 3KB7A 4CYIA 3HDNA 2XVDA 3COKA 2WXVA 3ORMA 5DGZA 1XH8A 4WRGA 4O7YA 2PUUA 1MP8A 5HIBA 4NW5A 3NUSA 4BI0A 5F94A 4NKAA 5D41A 3MIYA 3P86A 4C3PA 2HIWA 3R7IA 3AT4A 4QMXA 5CTPA 2PVRA 4IZ7A 4WIHA 3FC2A 2GCDA 4UB7A 3PIYA 4IHPA 2X1NA 4MD8E 5TO8A 5DI1A 1YI4A 3ZEWA 2Q0NA 2VO7A 4KINA 3T8OA 4PL5A 4IQ6A 3RGFA 2QOIA 3I5ZA 3O2MA 4QMLA 3A4PA 4CFFA 1P4FA 2W5HA 3F3UA 4S33A 3F3TA 3K3IA 4YP8A 4KRDA 4LMNA 4X3FC 3U6JA 4IE9A 3AC2A 3RWQA 3EYGA 2HYYA 3MTFA 4EOSA 5AM7A 5KBRA 4R7IA 4MF1A 5J1WA 4YJNA 3ETAA 3CEKA 4APPA 4Z16A 4PRJA 3BYOA 3TNHA 3BHUA 3QL8A 4QOXA 5HI2A 5M56A 1Z5MA 1YDRE 4AT4A 4DEAA 5GJFA 5BYYA 3QQUA 2BFYA 3VUTA 4PDPA 4RZVA 4F64A 4FSRA 4F7SA 2Z7RA 4ASZA 4IM2A 4Z3VA 2PZPA 2BIYA 2UZBA 4OTPA 3VBWA 5M09A 2YISA 4UX9A 5AR8A 4C57A 4O0SA 4LOQA 4ZP5A 5CAOA 2OK1A 3DJ5A 2VWBA 3CTQA 3AGMA 1ZOEA 3ZBFA 4J97A 2P33A 4NEUA 5CALA 1CSNA 4OBQA 3C5UA 3SX9A 2WTIA 2RFDA 3AT2A 4QMVA 2B53A 2YDJA 5HO8A 1K9AA 1OL1A 4ZK5A 4LMUA 1JKSA 2BZJA 3V8TA 3VIDA 4F08A 2Z7LA 5J5SA 4DTBA 2W7XA 1PYXA 4IDVA 4FT7A 4U97A 2QLQA 3SA0A 4H3QA 3S3IA 4C8BA 3LCDA 2H9VA 1CKJA 4OT5A 5DR2A 3NGAA 5JRQA 2XNPA 2PK9A 3G6GA 2JBPA 3ZSIA 3EFWA 4JBOA 4WBBB 5KUPA 2GQRA 3UPZA 3HYHA 2BMCA 5CEPA 1ZZ2A 2BCJA 2VTMA 4LGGA 2C5XA 1Q8UA 3SG9A 3LM5A 4QMOA 3RNYA 1L3RE 1OGUA 3ORLA 2BZIB 2LGCA 4AOIA 4EUUA 5J79A 4ZY5A 5FUTA 5J9YA 5FTGA 3WZKA 3HA6A 3W8QA 4ZMEA 1U4DA 3ZS5A 5FLFA 2WNTA 5GZAA 1XBAA 4IMYA 4PNIA 4O83A 4A9UA 4BVUA 4QMWA 4EK5A 4NFNA 4C4FA 2BFXA 5HIEA 5J7HA 5CU3A 2OZAA 5KMJA 4BBMA 1H1WA 2FSTX 2JC6A 3KK9A 3OVVA 3RI1A 2IVVA 2WTVA 3DAJA 2OO8X 3TTIA 5CF5A 5JGBA 4OBPA 1WVXA 5CAQA 5HBJA 2PVMA 3IW5A 5JSMA 4BIEA 2R3IA 2B9FA 4D5KA 3TG1A 3R1QA 2DS1A 5AP2A 4UZHA 2R3QA 4KIOA 3RPVA 4DEEA 2P55A 5HESA 3GT8A 5CVHA 3FMNA 1Q8TA 2W4JA 4GT4A 4K9YA 5AA9A 5HCYA 2PMLX 5FBNC 2VO0A 4AE6A 3REPA 2JGZA 3Q3BA 1GNGA 4QQCA 3ATSA 5AP0A 4CD0A 2J5FA 3II5A 4RIXB 4HGSA 4ZSGA 4R7BA 5GZ8A 5AUZA 2IZUA 3KGAA 4GS6A 3BWFA 4YLKA 5BYZA 3W2QA 3DBEA 5E1EA 3PZHA 5AP5A 3ZC5A 3IGGA 2E9OA 3F2RA 2C0IA 4FNXA 4OR5A 4M3QA 5B2KA 1RDQE 4U9AA 3O23A 5DT3A 4EKKA 2RFEA 3OOGA 3G2FA 1RJBA 4XV9A 1ZMWA 5BVNA 3DBQA 2OIBA 3G9LX 4F65A 2RSVA 1R1WA 2WMBA 4GW8A 3HMOA 2EWAA 3VUMA 4ACDA 4CV8A 4D2SA 4BDBA 3NYOA 2VNWA 4I6QA 2GHGA 1PMNA 3C9WA 3IDPA 4K0YA 5LMAA 2WTWA 3R8VA 3DBFA 4TYHB 4DT9A 5IDNA 2XK9A 2Y6MA 3JY9A 4HYUA 4OUCA 4Z55A 2HZNA 3E93A 2GDOA 3C4ZA 4II5A 5TT7A 2JFMA 2XKDA 4ZEGA 5L2IA 4ALUA 4WD5A 3QGYA 5CZIA 4FTLA 4OTWA 3EH9A 3QQKA 3GBZA 2XRUA 1W83A 3TDVA 5ANJA 2VO3A 3EQCA 3DB6A 4OTRA 5KKRB 3NNWA 4YGAA 3DAEA 3RPOA 3LW0A 1PJKA 3F3VA 3NZ0A 5A46A 4NFMA 4IZ5A 4IB0A 4UMTA 3C4CA 2J2IB 3U9CA 4AA5A 3QTSA 3WILA 3PXRA 4FGBA 4U80A 2W17A 3LXLA 4GCJA 3R9DA 3FKNA 1J7LA 1YVJA 2XEZA 2DWBA 3DQXA 4Y5QA 4GUEA 3LIJA 5FP6A 3BU3A 2QOCA 5KMMA 1NVQA 2VWWA 3Q5ZA 5T3QA 4O1OA 4HNFA 3KY2A 3TACA 3ENMA 2OJFE 3NNVA 4EQCA 4IZAA 4E4NA 1NVRA 5A4TA 2E9UA 2JKMA 4L7SA 3I81A 1UVRA 4FKSA 3UIUA 2XS0A 3NW7A 2BIKB 1UU7A 2C5YA 2GS6A 4ZTLA 4NT4A 5BUIA 4XG2A 4A9TA 5L8KA 5BQ0A 1CM8A 4J96A 1O6KA 5CS6A 5IDPA 4QP2A 4DF3A 1HOWA 4IB3A 3VHKA 4H39A 3PY3A 3PSDA 4BYIA 1YRPA 4FMQA 3D7ZA 3ALNA 4C36A 3GC8A 4CLJA 2GTMA 4I4EA 2RIOA 4F1MA 3PVUA 3UP2A 4QP3A 2QR8A 2HZIA 2IO6A 3QBNA 4PMTA 4R3PA 1YXSA 2QC6A 1YXVA 1M14A 1SVEA 2Q0BA 4GG7A 4UMUA 4PMPA 3FDNA 5HEZA 1XHAA 2VNYA 2HCKA 3MPAA 3R9HA 5LMKC 1Y6BA 2XMYA 3ZCLA 4JI9A 5H8EA 1UNGA 3VBVA 2NNWB 1JVPP 5CSWA 3RPSA 4TWOA 4AS0A 4EL9A 5L3AA 3F61A 4FSMA 2QODA 4L3JA 4XOYA 4AG8A 2AUHA 4GG5A 3A2CA 2VN9A 3Q52A 4X2GA 3TV7A 1YKRA 1ND4A 1H25A 4G9RA 4MBLA 2J0MB 4FG9A 4GIHA 4F1TA 2P0CA 3ULZA 1ZOHA 4G3FA 3OTUA 5E91A 3IOKA 4CFVA 3F7WA 4I5HA 4N4SA 4FUYA 3DKOA 5AR3A 5CANA 4N6ZA 3DCVA 1OIYA 3WIKA 4YURA 2C6OA 3G0EA 4EEVA 4IJ9A 2Y4PA 3QYZA 4PV0A 2VGOA 4HW7A 3MPTA 5AJQA 4MXYA 2EXMA 3EYHA 3P1AA 1SM2A 4IWQA 4ID7A 2CLQA 2OXYA 3OROA 4USDA 3CGFA 4EOLA 2RG6A 3QC4A 4D9TA 2SRCA 3E7OA 3OWPA 4U5JA 3ZM9A 4EHGA 2J51A 1OKYA 1SVGA 2PVKA 5KBQA 5EHOA 3U9NA 1A48A 3R9RA 3ZO3A 4CRSA 3GU4A 2BDFA 3HAVA 5HZNA 4R78A 2W9FB 3V6RA 4HPTE 1OUYA 2QONA 4KIKB 1IG1A 4UEUA 1ZOGA 4QMYA 5HG8A 3LFNA 2GS2A 1Q8WA 4E6CA 5LVLA 4EZ7A 3DTWA 4DN5A 3W18A 3FZ1A 3GFEA 5EH0A 2ZV8A 3PE2A 3WZUA 3G0FA 3PPKA 5KHWA 4FC0A 4I23A 4XV1A 1KV1A 4BHZA 5EKOA 4C4GA 3H0ZA 4MNEA 5CAVA 5C27A 2PSQA 5HVYA 3PSCA 4QMMA 1WVWA 2QOFA 4AN3A 4D0WA 3C4WA 3ZUUA 4E5BA 4LUDA 3QRTA 4DA5A 4J7BA 4EYJA 2PZRA 4CNHA 2XBJA 4KIQA 4RQVA 4QMTA 1FGKA 3P0MA 4F6UA 1W82A 2R3GA 3DU8A 1JQHA 3QD2B 4KB8A 4FOCA 4I3ZA 5KMIA 4CLIA 4UMQA 4ZTRA 2NRYA 3P7CA 4J95A 4AA0A 4TPTA 3DK3A 2A1AB 4H58A 4FGRA 4YPSA 4MVFA 4LGDA 3BU6A 2R4BA 2JD5A 3CE3A 1KOAA 4U45A 3UNZA 2VTLA 5CSPA 2VAGA 4G6NA 4L67A 3E3PA 3R1SA 3EB0A 3U4WA 3W16A 3DQWA 3R8ZA 3Q4UA 5IISA 2C0OA 3QX4A 1ZY4A 3F69A 3EL7A 4I22A 2ETMA 3D4QA 2ITTA 2XEYA 4E5AX 1BL6A 1PMUA 2BHEA 2VTIA 3L8SA 2B54A 3QUDA 4I5PA 3KQ7A 4RQKA 3TL8A 3E64A 4KWPA 4RFMA 4RWLA 3NVMB 1GJOA 4DEDA 3ZLSA 5IA4A 3MFTA 4MQ2A 4QYFA 5CAUA 2C3LA 1M2PA 1LUFA 3R00A 3TTJA 5A54A 2YDKA 3IW4A 4GV1A 5IF1A 3W2OA 3KRJA 3SG8A 3KVWA 4NL0A 3H3CA 4FZFB 5FQDC 5IG1A 3FV8A 4ZJIA 3UO6A 4TKSA 1ZWSA 3O0GA 3OMVA 1UA2A 5M4IA 4TRLA 4B4LA 1WZYA 4U6RA 4GK2A 2R3RA 5IEXA 1U46A 2UW9A 2X9EA 5H2UA 3TKHA 4GFMA 2UV2A 3W55A 2AC3A 2YIXA 1FVRA 3NUAA 1U59A 3EQIA 5D7VA 4HYIA 3LCSA 3QXOA 2FGIA 2PWLA 3GQIA 1UWHA 2ITNA 4LGHA 1HCLA 4G5PA 4ZZNA 3UODA 4O38A 5D11A 3E3BX 2BTRA 4AX8A 4GKIA 3IOPA 3E8EA 3SC1A 5FBOA 2W06A 3F66A 4UWBA 1SNUA 2GNGA 4EK6A 2R3PA 5BUEA 3ROYA 3DOGA 3QC9A 1NVSA 4BTFA 2GNLA 2UW6A 3BCEA 5EW3A 1KWPA 5BMSA 3N4VA 3CS9A 3GNIB 4BBFA 3NLBA 3PVBA 4FKQA 3OWLA 4FNZA 4H1MA 3ZFXA 4IFCA 3V5PA 1V1KA 4C2VA 4JVGA 4GEOA 4YTFA 5HG5A 5GZ9A 4FT0A 4BCKA 3IW8A 3BKBA 3BWJA 4FG8A 4BYJA 3V51A 5LMKA 2PZ5A 2GMXA 2BRMA 4IADA 3UVPA 5JQ5A 2CJMA 3IG7A 4EJ7A 4FTTA 5CVGA 5C03A 4E4LA 4RFYA 3ZTXA 2B9JA 3N9XA 4ZTNA 3R7EA 1WBPA 3HMPA 3ZO2A 4ACCA 4XLVA 4L53A 4ACGA 4ZLOA 4S2ZA 4F0GA 1KUTA 1RE8A 5ANKA 3BI6A 3HUBA 5DBXA 4EOIA 3AT3A 3PJCA 4PL4A 3KRXA 3WE8A 5JFSA 5FXRA 3OFMA 5AR4A 4WA9A 3D94A 4UXQA 2X2KA 1ZYJA 4RGJA 3QHRA 4C4IA 4TN6A 3S1HA 5ITAA 2F7EE 3H30A 5K0XA 3GCQA 3O7LB 1WVYA 4O86A 4MXAA 2C30A 4Y46A 1FMOE 4FX3A 3FXWA 2ZOQA 2WMUA 4F9WA 4E1ZA 5E8VA 4BCMA 1TQMA 4O1PA 4RVMA 4KSQA 2GFCA 4AZVA 3RK9A 3VRYA 4NZWB 4IAYA 4O7NA 4FTUA 4DC2A 3Q9WA 4EOOA 3F5XA 3UIBA 4CFUA 5F20A 5K4JA 4FODA 4A9YA 1PMEA 1PW2A 2OJIA 3CQUA 3KMUA 5CU6A 3UNJA 4A07A 4B7TA 4KRCA 5J9ZA 2CGVA 4B9DA 3FSFA 3W32A 3ORPA 5BPYA 3ORTA 4FI1A 4PNKA 2QI8A 1FMKA 1Q97A 2GNFA 2HY0A 4FKJA 2X0GA 3EMGA 1ZZLA 3KL8A 3VVHA 3BZ3A 5L2SA 4MEDA 4EK8A 4EWHA 2QU6A 1GIIA 4GVAA 2X4ZA 2CKOA 3CD8A 5AR5A 3U6HA 4FEUA 3OT3A 1OIRA 2G2HA 1GIHA 3ORKA 4YJOA 1HCKA 3LFEA 3FZRA 4KIPA 4HCUA 2VV9A 2NO3A 3MB6A 2CKQA 5HCZA 3EQRA 3WF8A 5AFVA 2XNNA 3PJ2A 4CT1A 3I0QA 3NS9A 1B38A 2JFLA 5DG5A 2CLXA 4AGDA 3O71A 3BIZA 2PYWA 3VWAA 3QTQA 4MYGA 1V0OA 3QQJA 2OU7A 1UNHA 2PL0A 2ZMDA 3QWKA 3UOHA 3EJ1A 4O7WA 2QNJA 3I5NA 3P23A 4TT7A 1J1CA 3EN7A 2G15A 1Q3WA 2C3IB 2QQ7A 4X2KA 1QPDA 5G6VA 5H9BA 2W99B 4AOTA 4NM3A 4FF8A 4PPBA 2EUFB 5C01A 4EC8A 5L8LA 2VWIA 4YJRA 4AXAA 4S30A 1QPCA 5H3QA 3WYYA 4BDKA 3ZMMA 4OGRA 5IMEA 3FL5A 3P7AA 2UVXA 3IGOA 3DKCA 3O8PA 4ONAA 4TXCA 2IW9A 3ZSHA 4A9SA 4XLIA 4QNAA 4E73A 4HZRA 2WTCA 1CMKE 5HBHA 2X39A 4LL0A 5AR7A 3SV0A 4YLLA 4O91A 5DWRA 2J5EA 3EKNA 4NJDA 4UYNA 4XP2A 4R77A 4W4WA 5IA2A 5LVNA 5C4LA 4JG7A 1ZAOA 4RRVA 4YBJA 2X7OA 4RA4A 4FIFA 5FTOA 4K11A 4D4YA 4LOOA 5KMNA 4PWNA 5JRSA 2YM6A 3OBGA 3PXYA 5IPJA 3BLQA 3NUPA 4KSPA 3LXNA 2JDTA 2PUNA 3FLZA 4DG0E 2VTPA 4JRVA 1BX6A 3ZH8A 3F6XA 2YM5A 3QFVA 5F95A 5M55A 4DGNA 5JKGA 3FI2A 2GQGA 4OTQA 3HRBA 5K3YA 4DLJA 2H34A 5KE0A 4AW2A 4FK6A 4DHFA 2YABA 4R3RA 3RHKA 3ZSGA 4DG3E 3KRLA 3FMKA 1FQ1B 2O2UA 3ZEPA 2QG7A 3QKLA 3F2NA 3G51A 4XOZA 4JL9A 3LJ2A 1XBCA 5CYIA 3TT0A 1V0BA 5AV4A 2WGJA 2R9SA 4TWPA 3ORZA 2XZSA 5EKNA 2XKCA 3LMGA 3TZ7A 5KHXA 4JG6A 5AM6A 2OXXA 3Q04A 4EYMA 4DEHA 2YJRA 2W1CA 2WMWA 4MBIA 5A3XA 4HNIA 3FLNC 1ZMUA 4JQ7A 3UO4A 4AW5A 5AUXA 1IA9A 4RX8A 4AGWA 1DI8A 3FZSA 3PG3A 4LFIA 3D2IA 3D5XA 3Q4CA 4NKSA 3OEFX 2VWVA 4L8MA 5TE0A 3A99A 1JBPE 2FB8A 5L2WA 2J4ZA 4GRBA 3MDYA 4IBMA 3WE4A 4RJ8A 1MQ4A 3ELJA 4HYHA 3FI8A 4DT8A 2BILB 4GU6A 2CHLA 5DT0A 5J87A 5ANDA 2RG5A 4CEGA 3SXRA 3H9OA 2XNGA 3UMXA 2AYPA 4MWHA 3ERKA 4ANOA 3BYUA 4AU8A 4C4EA 3W2CA 3GVUA 2CGXA 4IVBA 2IZTA 5TKDA 4ENXA 4HVDA 2Z8CA 5A4QA 5M44A 3P5KA 2XJ1A 4OTIA 3RVGA 4F99A 5F1ZA 3BEGA 3AG9A 1GAGA 1MRVA 5E8XA 3RP9A 4ASXA 3O50A 3MYGA 4FTKA 3GP0A 2ZV7A 1ZXEA 2W4KA 4KS8A 3A7HA 2G9XA 4C58A 5CASA 3QA8A 3R9NA 2JAMA 3FBVA 4MWIA 5L2TA 2WOTA 2DQ7X 1VJYA 1Q8ZA 2VO6A 4X3FB 4XP0A 5L4QA 3NVKI 4WBOA 4FICA 4UMRA 4YHTA 2XK6A 4C59A 3TM0A 4AT5A 2JKKA 3PP0A 2UZLA 4PTCA 3RK5A 3JUHA 4TYJA 3F9NA 3BHTA 4AAAA 3BHVA 4KBCA 5JGAA 4I1ZA 4EBVA 5LWNA 5I9YA 2OIDA 2X7GA 4EOJA 3CGOA 3H4JA 4V0GB 5CEQA 3QA0A 5E1SA 4D1ZA 4WOVA 5K5XA 3IW6A 4ALVA 1LEWA 4DYMA 3TUCA 2BAJA 1TQIA 4FKGA 1OM1A 1CKIA 2BPMA 3GU8A 1PY5A 4E4MA 2E2BA 4RVTA 4RWKA 5LWMA 2PMNX 4CTCA 4K8AA 5IA5A 4ANMA 2C3KA 3COHA 3GU6A 2GHMA 2GPHA 3Q32A 4YJSA 3WF7A 5AAGA 5KMLA 4FSWA 4Y73A 3V8WA 5HU3A 5K4IA 2F49A 4Q2AA 4ANQA 1G5SA 3E5AA 3R63A 3EN6A 2PPQA 3KXXA 3DPKA 3PJ8A 4RC4A 3ZXTA 3COIA 5AP3A 3NUNA 4BKJA 5D9HA 1W8CA 3LCKA 2B4SB 4ARKA 4TWNA 4QPMA 3BLHA 4HPUE 2Y4IB 3VUHA 4OTFA 3OD6X 1KE7A 1GZ8A 3OUNB 2ITVA 2XA4A 5KCVA 1WBSA 3ITZA 3RK7A 4IH8A 1NA7A 3D83A 4L3LA 5I5ZA 1UKHA 4JAIA 4B8MA 3MH2A 5IEVA 4CCUA 3LVPA 4XYFA 3EQBA 3ZO1A 5HO7A 4FZ7A 2C6DA 3F5PA 2YIWA 4EHZA 3CBLA 2BR1A 4TYGA 4RJ5A 5A4EA 3UYSA 4BDIA 2C6IA 3GC0A 4C62A 2GSFA 4A4LA 3PXQA 1OL2A 4P4CA 4QRCA 4NIFB 5L2QA 3R1YA 5L6PA 4QP9A 2UZDA 3D5WA 2VTNA 5CSVA 3T3VA 5I9VA 3OOMA 3MW1A 2QG5A 4ORKA 4EONA 4CMTA 1J7IA 4F9CA 4BC6A 2W96B 3T9TA 1H1RA 3EQDA 3KULA 5J1VA 3UZPA 1YWRA 4F9BA 3GUBA 2VRXA 5DOSA 3UZTA 2QO7A 3FQSA 4QYHA 4XJ0A 1PKDA 4ANNA 2JIUA 5AUWA 4BCNA 1KOBA 4FUXA 2OIQA 5DMZA 2XM8A 5HNIX 3A61A 3CQWA 5JH6A 3ORNA 3SD0A 2JDSA 1V0PA 3NAXA 3UPXA 2WQEA 2XB7A 2JDVA 2C47A 1BYGA 3V01A 2YFXA 3BQCA 4G31A 3L8VA 3I7CA 4YPDA 3R9OA 4AGUA 3TUDA 3Q9ZA 3UQGA 2WQOA 3ZLXA 1YW2A 2NP8A 4EH2A 3BV3A 4V01A 4S31A 5HCXA 1H28A 4J99A 3W2SA 3SRVA 4N0SA 3V5LA 1FGIA 3FZPA 3DKFA 4WRSA 3ULIA 4MAOA 3R7YA 2WMVA 3HMNA 3JR1A 1U5RA 4O22A 3ZRKA 1VYZA 4O6LA 3QHWA 2XNOA 2YHVA 2IG7A 4ERWA 3VUKA 4JDKA 2C1BA 1FBNA 3DZOA 1KE8A 5ACKA 3ORXA 3S4QA 1H24A 3Q6WA 4F70A 1WBNA 4JQ8A 4QP8A 3QWJA 3BELA 4R3CA 3RPYA 3OXZA 1JSVA 4PF4A 5EYKA 3V8SA 2O64A 2XKFA 4IANA 2OW3A 2WMAA 3GENA 5AV0A 1J3HA 4RJ4A 4MF0A 4C2WA 4CGAA 3PPJA 4CFXA 4F4PA 4O7VA 3MFRA 4GUBA 2F57A 4Z7GA 2PHKA 4IAKA 4M66A 3KMMA 4AN9A 2VX3A 3QF9A 1R3CA 1Q62A 4XRLA 3DJ7A 3SOAA 3FL4A 4HVIA 4FKWA 3UQFA 5GJGA 4O0TA 3RAIA 3FY0A 3QQFA 1H01A 3EN5A 5CF4A 3FUPA 5LQFA 4E93A 2PULA 5IA1A 2H6DA 1IRKA 4TNDA 2BHHA 3BHYA 2V7AA 1K2PA 4U42A 4XG4A 2I6LA 3HL7A 3PRFA 4Y72A 3PSBA 4M13A 5EW8A 4I92A 4E26A 3SQQA 1ZYSA 4AW1A 5CF8A 2R7IA 3TZ9A 4RJ6A 4D4SA 3RALA 4EBWA 1YI3A 4M69A 3MY1A 2VWYA 2GS7A 1GZOA 4FKOA 5DYJA 1Z9XA 3EFKA 4I0RA 4RZWA 5HD4A 4E8AA 4DFZE 5C26A 4ZTQA 2YDIA 5CEOA 2X2LA 4XEYA 3V6SA 3CPCA 3QD4A 3C4EA 3PDTA 3PY1A 4D4RA 1PXNA 4JIKA 4BL1A 5TF9A 4FIHA 4OLIA 5M07A 3GXLA 3UMWA 2CNVA 5CNNA 4GKHA 3A60A 2Y0AA 3BQRA 3CY2A 5FGKA 3HLLA 1APME 4RIWA 3KU2A 4DGGA 2UVYA 3UTOA 4FSYA 4EOMA 4EH6A 3KEXA 3OS3A 2JBOA 1Y91A 2XK3A 4AZFA 1BI7A 4CZTA 4E20A 3UO5A 5HICA 4QMSA 3NIEA 4X0MA 2ZYBA 1FINA 1U54B 3R0TA 4I4FA 5CXHA 2C6EA 2J0IA 3FQEA 4C38A 4YSMA 4JBPA 1GZNA 4XG3A 5EI8A 4ANSA 3LLAA 4XMOA 4J71A 2VWZA 5CX9A 2XIRA 1QMZA 4HJOA 5AIKA 5HVKA 3DNDA 5EDRA 4CQEA 4RFZA 3UVRA 2XKEA 3UOLA 1UNLA 3VHEA 4EQMA 3VW8A 5JFXA 5KKRC 5LMBA 2YWVA 3G90X 4IVDA 4JX7A 3E62A 3KF4A 4IACA 2WKMA 5CWZA 3KFAA 3A8WA 4QPSA 5A6OA 3QLGA 3R01A 4FSNA 4MXCA 4PDSA 3RPRA 3RZFA 3E7VA 4ACMA 1Y6AA 2RKUA 4AE9A 4GL9A 2JIVA 5HOAA 4O7ZA 3D7TB 2NPQA 3HVCA 3KK8A 1T45A 2JKOA 3ET7A 4BFMA 1YI6A 4Y5HA 4YZBA 3U8WA 4IX4A 3I6UA 5J5TA 3POOA 3ZUVA 3TNIA 3VAPA 4G6OA 4BDGA 1LEZA 5GNKA 2GU8A 3NUXA 4RG0A 5HU9A 5AUUA 4NTSA 1ZYCA 2Z60A 4RVKA 3D15A 1T46A 2QVSE 5AAEA 3EQFA 4LI5A 3TIZA 1TQPA 5ETCA 1OL6A 2F2UA 2HENA 2IVTA 3K5UA 4GJ2A 5DR9A 5K0KA 3B2TA 3GCUA 2E9NA 3IKAA 2XF0A 5IQEA 3B8QA 5BVWA 2YLFA 4EQUA 4E6AA 3UIXA 3OCTA 4JRNA 4ZSAA 3ZLYA 1OI9A 4A9RA 5IA0A 5E90A 3TN8A 3GB2A 5HNGA 1BMKA 2G01A 1BUHA 1O6YA 2UVZA 5EM7A 3D5UA 4ZTSA 4FV3A 3W1FA 1P4OA 3AD5A 3I1AA 2R3LA 1Y57A 3HZTA 4YTCA 1OKWA 3OW4A 2WTKB 4CKJA 4XUFA 4FKLA 4ITJA 1H27A 2IPXA 3O8UA 2X2MA 3OTVA 4FKRA 2HAKA 4AT3A 4C4JA 5AIRA 2WEIA 2OJGA 4GVJA 4LOPA 1XWSA 2RF9A 5M51A 3HV3A 4E4XA 2UZEA 4QYYA 4RC2A 4YTIA 1OZ1A 4RA5A 5FXSA 3G15A 4V04A 3CD3A 4RJ7A 3PXFA 4D0XA 4R7HA 3C5IA 1ZRZA 2BDWA 1NXKA 2IWIA 4D2VA 2WMSA 3QZGA 4M15A 4IZYA 4U44A 3Q2MA 1J7UA 4XHKB 1JAMA 4KKHA 2XNEA 5DHJA 4XX9A 2WTJA 4M12A 4PQNA 3TV6A 4PDOA 3NIZA 3FLWA 2XYUA 3EN9A 2C5OA 5D10A 4PX6A 2ONLC 5E8TA 1H26A 2P2IA 3ANRA 3FMDA 2B9IA 4FYOA 4G6LA 4I24A 3TZ8A 2OFUA 3Q5IA 4L7FA 4BRXA 4F9AA 4A7CA 2WMRA 2JDRA 5DVRA 4D2PA 4O7RA 1FVVA 2YCSA 3PLSA 4ZJVA 5EYCA 5AUYA 5CT7A 3HGKA 3Q9XA 4OT6A 4ITHA 4YJVA 5FWKK 4NJ3A 4R1YA 3LFAA 2UW7A 3N4TA 3MTLA 3FZOA 5JZNA 4FT5A 5LXMA 2X7FA 4M14A 5E4HA 3ID6C 1H08A 5LARA 1JKKA 3KRRA 4ZS0A 4BY9E 1YXTA 3BHHA 3OXIA 3HECA 4FEVA 4AZWA 4NUSA 3S0OA 2GNHA 2ZM4A 3IW7A 4NTTA 2OXDA 3ZO4A 3QKKA 3HA8A 5JT2A 3R1NA 3LFFA 3DFAA 4DH7A 4GYGA 4E6DA 3GCSA 1W0XC 1W7HA 4O21A 4BCOA 4FA2A 3HX4A 3MGYA 4GJ3A 2CMWA 2XYNA 3UC3A 3VBXA 5L6WL 2I0EA 4YMJA 3GI3A 3MVMA 4JXFA 2I0HA 1LPUA 2EU9A 2VUWA 5CU2A 4MHAA 1J1BA 1OMWA 3O7LD 4ZXTA 4RIXA 1H1PA 1REJA 4FK3A 5E8UA 5L8JA 4PMMA 2YCRA 3BBWA 1P5EA 2R3OA 4FTMA 1OL7A 4IX3A 5E9EA 1KSWA 4ZSJA 1YHWA 3P78A 4G5JA 5BVOA 2OSCA 5E8SA 5IQFA 4XH6A 1ERKA 2UZNA 3E63A 4G3CA 2FO0A 4PTGA 5EK7A 4UN0C 4BDDA 4U40A 4IB5A 3MH3A 5FRIA 3SOCA 4QP1A 3MB7A 4YZNA 2QR7A 3FYJX 2O3PA 3IO7A 2WQNA 5AUTA 5HNBA 4LUEA 4WHZA 4BZNA 3MI9A 4IAFA 2PU8A 3FJQE 4GK4A 5C8MA 3I4BA 1GOLA 4M7IA 2CNQA 4FZ6A 4EC9A 4O81A 2VTJA 2YM8A 3PWDA 4KKGA 4RC3A 5ANOA 3GU7A 3NEWA 2YCQA 4CZYB 2CDZA 4QQTA 3R8UA 4TYHA 5I9ZA 1DAYA 2YEXA 2ZAZA 3VUIA 4QMQA 2VTQA 3IQ7A 2PE2A 4QQJA 3EIDA 3VF9A 3AQVA 4W4XA 4BHNA 3HP2A 3Q96A 5AADA 1ZARA 4I6BA 5JEBA 3A7JA 5LOHA 3DDQA 4XP3A 5JMSA 2FUMA 5H8GA 2YERA 3GQLA 4D58A 4RIYB 2W1EA 1XH9A 3QRIA 2VX0A 2XCKA 3LPBA 2VTHA 4NM0A 3QLFA 4FV9A 1PF8A 1MUOA 2Z7SA 4C33A 1QPJA 2CPKE 2JKQA 4M84A 4DCAA 4QT1A 1M52A 3NCGA 3QCSA 3GOKA 4N57A 4N70A 3MA3A 3DK7A 3UP7A 3PE1A 4NSTA 3CLYA 4X3JA 3FMHA 4DTAA 3AC4A 3I79A 2ZMCA 3OY3A 3BYVA 3LXKA 3ZU7A 4P90A 4Q9ZA 3FI3A 2C69A 4JIAA 3C50A 4O0VA 3CPBA 4U3ZA 2CGUA 3OY1A 4O0WA 4W9XA 5ETFA 3TEIA 3VBYA 2ZVAA 4CRLA 3TUBA 1OPKA 1URWA 5HG9A 2OH4A 2BRHA 2PVFA 5C1QB 5IU2A 2VTTA 1BLXA 2R0IA 3FAAA 3SW4A 4ZLYA 3LZBA 2CSNA 4NH1A 3AOXA 5DT4A 5GIPE 5A14A 4J8NA 4I0TA 3AC5A 4YZMA 5BVKA 5AUVA 3DV3A 4CXAA 2PMIA 3QUEA 5J8IA 3MVHA 4M97A 3S2PA 2CKEA 2UW4A 5CZHA 3E8DA 2WFYA 3AC1A 4X6QC 2XIKA 2B52A 4LYNA 4ZY6A 3TNPC 5KO1A 3NCZA 4AN2A 2QO2A 4FIJA 3AC8A 5JGDA 2PUIA 5IQIA 4O27B 3QALE 3HUCA 2I0VA 2XNBA 4QMUA 4EHEA 1F5QA 2V22A 2YZAA 1O9UA 4O96A 1OPJA 3H9FA 3D0EA 4YZDA 4ASDA 4FV4A 2J6MA 2PVHA 1TVOA 4BWPA 3BYMA 4W8EA 2UZWE 4UXLA 5CQUA 3RINA 3VS7A 2W5AA 3GCVA 1YQJA 3GOPA 3SXFA 2X8IA 4FSUA 2ZDUA 3I60A 4NM5A 2C68A 5E7RA 3DT1A 4ACHA 4DFLA 3GGFA 2IW6A 5HTBA 4ENYA 1JKLA 2ERKA 5AX3A 3BEAA 3G9NA 2OJJA 3EFLA 4WNKA 2HWPA 1KE9A 3FLSA 4ANLA 2WB8A 4G17A 3FHRA 1PXIA 2O0UA 1WAKA 3AC3A 1WBOA 1ZY5A 4GFOA 2BKKA 5J95A 4KA3A 3QRUA 4YHFA 5GJDA 2UZTA 4K77A 4I6FA 4PP7A 4CVAA 5HTCA 4L01A 5AEPA 1X8BA 3C4XA 3QZIA 4I5MA 4GMYA 5AP1A 4AGCA 3T9IA 1GZKA 1PKGA 4BZOA 2ONLA 1OIUA 2Y6OA 4UYAA 5DRDA 4IM0A 1YHVA 4X2FA 4XV2A 5ANGA 3Q2JA 1SVHA 4L45A 4R5YA 3CJGA 3WF6A 1IR3A 4CT2A 4YJTA 1XO2B 3DGKA 2EB2A 5B2MA 1OL5A 3DDPA 4DFUA 5K5NA 4O2ZA 2HY81 4G3GA 4Z9LA 2C6TA 4OTGA 4ZTHA 3NR9A 1JOWB 4K1BA 5AP4A 3PG1A 5CEKA 3VS4A 3BGPA 3FI4A 2PE1A 4RIOA 2J0LA 1R0EA 2VTSA 2BZHB 3P7BA 2IW8A 3VULA 4KAOA 1OVEA 1UU3A 1FPUA 2ZM3A 4X21A 3OW3A 5EHLA 4I41A 3OUKA 4W8DA 4BN1A 4Q5EA 2W0JA 4DAWA 2P4IA 1DM2A 4KIKA 2ITYA 2C6MA 2QOKA 2OZAB 1UWJA 3DY7A 4BDFA 3HV7A 4W4VA 5DE2A 4BDHA 2G2IA 4LRMA 1YXUA 1Q4LA 3EL8A 3T3UA 5AV3A 2UW5A 2VTAA 3HKOA 1Q61A 3FSKA 5EI6A 2LAVA 4KUJA 3KXMA 3VUGA 4K2RA 4UALA 3OZ6A 5EOLA 2VWXA 2C6LA 1MQBA 1H00A 4FTIA 4BCQA 2C3JA 2YN8A 2XK7A 1VR2A 4IC7A 4IJPA 4RWJA 1XR1A 3VS5A 4LL5A 3MWUA 2GHLA 4HGEA 5I4NA 2BROA 2V5QA 3VBQA 2FH9A 4NK9A 5F9EA 4YJPA 3RCJA 2ITZA 5IKWA 2C6KA 2PZIA 3IDBA 1UU9A 2BUJA 3HMMA 3DLSA 3FWQA 5FDXA 3TCPA 3LHJA 4EH7A 5DA3A 4YUQA 1G8AA 4U43A 3RBWA 2XP2A 4QNYA 3PIZA 5CVFA 2GQSA 2I7QA 4ZMFA 1NY3A 1YOLA 2OICA 4F7NA 2WELA 3FKOA 3QGWA 4D28A 4M0ZA 3F3ZA 4BDCA 3I0OA 4IC8A 3ENHA 2IJMA 4HVGA 4HVHA 4L00A 3F82A 4MX9A 4XG7A 4ZY4A 3QTIA 3THBA 2QOOA 2X4FA 2R2PA 3OBJA 3QTWA 5CQWA 3UOKA 4DLIA 2X9FA 2BRBA 2FVDA 3B2WA 4TYIA 3FC1X 4AUAA 4MKCA 4BI1A 3S00A 5L6OA 4U0IA 3BGQA 2BAKA 2BDJA 2FA2A 1AGWA 3JXWA 2QKWB 3DZQA 5EDQA 2FSLX 3MPMA 3MVLA 5BVEA 3AD6A 2PVJA 3UVQA 4HZSA 2B9HA 5CNOA 2WD1A 1U5QA 3V04A 3DAKA 2ITOA 5D12A 5IQDA 4IWOA 4Q5HA 3DXPA 5KMKA 4DG2E 1KE6A 2I0YA 4FV2A 3C1XA 2OBJA 3FE3A 3FKLA 3RZBA 5E8YA 1AQ1A 3DBCA 4RWIA 2A27A 4YC3A 2HK5A 2WU6A 2ITPA 2XCHA 4F7LA 1I44A 4B0GA 4AZSA 2B1PA 2HZ0A 5CU4A 4BB4A 2CCHA 4DEBA 5EQYA 4OBOA 3R8MA 2A4LA 4XCUA 1JNKA 4FR4A 2UZOA 3TIYA 3RMFA 4U8ZA 5HHWA 5I3RA 3Q6UA 1CTPE 4O0UA 3KN6A 1PRYA 4D1XA 3QU0A 4Q9SA 2XK8A 1ZMVA 3ACJA 4XNEA 4D2WA 4AFEA 3PTGA 3C7QA 3ZHPC 3HV6A 2YM3A 3MESA 1L8TA 2VD5A 1PHKA 4BICA 4CCBA 3Q60A 4NWMA 2B55A 4IX6A 4A06A 3VJNA 5DRBA 4C3RA 3HRCA 3LFCA 5B2LA 4U7ZA 3V5WA 3CP9A 3R04A 2WMTA 5CSHA 3CKXA 3SHEA 3DFCB 2F2CB 4C4HA 4J53A 2AC5A 4EUTA 5CU0A 4AFJA 5JK3A 2QD9A 5HD7A 3NUYA 4K6ZA 1QCFA 4BTJA 4D2RA 5EM8A 2WEVA 4RPVA 3COMA 2BZKB 1AD5A 4F9YA 4IAIA 3NW5A 2QOQA 2BTSA 5I9UA 4CKIA 3PA5A 4E6QA 5C8NA 3Q4TA 1SZMA 3D2KA 2R3FA 4TW9A 5I0BA 2EVAA 1DS5A 5A6NA 4LRJA 3W2PA 5BUJA 5M4CA 3FPQA 4ZIMA 4DFNA 5CXZA 2VWUA 5F4NA 3U55A 3FHIA 2OF2A 4EOQA 3FEGA 2QOBA 4JG8A 4LRKA 4ZZMA 4ASEA 3UDBA 3SKCA 4EJNA 3QRKA 5FTQA 2CN5A 2A0CX 4FL3A 4FTOA 2KTYA 3KXHA 3QTZA 1M7QA 4PPAA 2X6DA 4FZDB 4PL3A 4WO5A 5HKMA 3FXZA 5IH4A 4RX9A 2W1FA 4I93A 3HNGA 1ZYDA 2J7TA 3DJ6A 3IDCA 3PJ1A 4XG9A 4XV3A 4BWKA 4DTKA 4ZAUA 1IAJA 2GFSA 3AXWA 1OUKA 5ETAA 4C0TA 4BCFA 4EWQA 1FVTA 4QPAA 4UZDA 3OCGA 2VX1A 5EYMA 3HDMA 3TKUA 2RGPA 2UW8A 3JVSA 4H36A 4JR7A 3C4FA 2G1TA 4GT5A 5KMOA 4Y85A 1H07A 4YNEA 4JDJA 3OCSA 4MD9E 3NYVA 3RTPA 2J50A 4G9CA 2EB3A 2QLUA 5I3OA 1GIJA 3A62A 1Q5KA 3LJ1A 3VS3A 3MFUA 4FOBA 4C34A 1B39A 3JYAA 5T6KA 3L9MA 4RT7A 3RAWA 1PXLA 4ZTMA 4RLKA 3QCXA 2YIYA 4CFMA 1B6CB 2WZJA 3OT8A 3LOKA 3CC6A 3M11A 4LV5A 5CI6A 3ZM4A 5JQ8A 1NT2A 3HEGA 3GC7A 4KBAA 2R7BA 3V3VA 5IQHA 1G3NA 2ZB1A 4I21A 2RFSA 3TJDA 3JS2A 2XBAA 3HP5A 4HYSA 3UGCA 2QOLA 5D1JA 3DXQA 1WBWA 4AW0A 4IW0A 4QTEA 5EQPA 2ERZE 3F2AA 3ZFMA 5FEDA 3SW7A 3LFDA 3FMEA 2F7ZE 3RNIA 2W1ZA 2V62A 4NCTC 2UW3A 3OWKA 4S32A 1XQZA 4L43A 4X2JA 3NYNA 4L42A 2BKZA 3K2LA 3IONA 5LVOA 5EM5A 4QTAA 3G5DA 3FMLA 1WBVA 3QZHA 3HRFA 4FTCA 5AV1A 4E3CA 5M53A 3L9LA 4DEIA 1OBDA 3P79A 3L9NA 4J1RA 3KXZA 4G3DA 4GIIA 2Y4IC 4M68A 4BCIA 3R73A 5CY3A 4GFGA 2JIIA 3PZEA 4JQEA 3UIMA 2R3NA 4FSTA 4KKEA 3IPHA 2Z7QA 4MNEB 3U51A 4TZRA 3A4OX 2GTNA 2HW6A 3AMAA 4QYEA 3ZFYA 2H96A 3FPMA 4FKTA 3CSVA 4DEGA 4G1WA 5AR2A 4C61A 4FV5A 1IA8A 2XK4A 2O63A 3A8XA 3IS5A 4C7TA 1Y8YA 1S9JA 4FTRA 4OTHA 2CNUA 1PXPA 2R64A 3MA6A 2OLCA 4FKUA 5M06A 2FYSA 4CFWA 3IK3A 3KRWA 1Q24A 3KXNA 4FIIA 4USEA 4XG8A 3PA4A 2R0UA 4B99A 3DLZA 3PJ3A 4GSBA 4D1SA 2ZM1A 3E88A 4L6QA 4DFYA 4QQ5A 3MN3A 2YIQA 3PP1A 4EKLA 1YDSE 3ALOA 3GU5A 5DIAA 3A7GA 4LG4A 4PP9A 5HORA 2WQBA 3QCYA 3MH0A 4GU9A 4WKQA 3OCBA 4FV1A 2CN8A 4M0YA 4TNBA 1XJDA 3QTXA 3QD0A 4BDEA 4ZSLA 4BDJA 2V55A 4AZEA 3R2YA 1YOMA 4R8QA 3ZRLA 2IN6A 4I20A 3ZDIA 4I6HA 3K54A 5IEYA 2QURA 2ZJWA 1XKKA 3U54A 5CLPA 1CDKA 5GHVA 3FLQA 4L52A 1XBBA 4FV7A 4UWYA 5IUIA 4EH9A 3CTHA 4K18A 5HLWA 3WIGA 4CKRA 1Z57A 3KN5A 1XH6A 5CAPA 5LVMA 5HLPA 3LQ8A 5D7AA 5CEMA 2ITUA 3R30A 3ZBXA 3K5VA 4C3FA 2HXLA 5DEWA 2OI4X 4QTCA 3N4UA 2C5NA 4EH8A 5M4FA 4AA4A 4FNWA 2R3KA 3R7GA 4GH2A 2VU3A 4KABA 3ZUTA 4E5WA 4KBKA 4GT3A 2WMXA 2W1HA 4YJUA 4X6RA 3ZYAA 4U81A 5HE0A 1M17A 3DA6A 3R8LA 4BTMA 3LQ5A 4AF3A 4BCGA 5AV2A 2BRGA 3P08A 4FV6A 1JSTA 3WZDA 3VO3A 3OEZA 3CR0A 3L8XA 4EI4A 5AMNA 4JS8A 3Q4ZA 4YZ9A 3Q53A 5ANEA 3GFWA 5FXQA 3QXPA 5K9IA 3EQGA 4WG5A 5IQBA 2DUVA 3L1SA 4J52A 1H4LA 4L68A 1SYKA 2QCSA 3V5QA 3HV4A 1OPLA 3ORIA 3TV4A 4QTBA 1Q8YA 3TDWA 3NNXA 5HVJA 5HE3A 2JDOA 2OGVA 4CG8A 1WMKA 3E87A 4O7SA 3OC1A 3LMHA 4F09A 1LR4A
chains in the Genus database with same CATH superfamily
5E8WA 4BBEA 3VRZA 4OAVB 3D5VA 1PXKA 2HZ4A 3KF7A 3OHTA 1SNXA 2RFNA 3DKGA 4QP4A 5A4LA 1VYWA 4YBKA 3NMUF 4BZDA 4ZLZA 4WUAA 2QO9A 4X3FA 3TYKA 4ERKA 4XBRA 5DNRA 3QQGA 5HIDA 4O82A 4BCJA 3PVGA 2YAKA 3N51A 3O17A 4MD7E 3R7OA 4LV8A 3SDJA 1Q3DA 3VW6A 2F9GA 5ANIA 2DYLA 4BTKA 3AD4A 4ITIA 1BI8A 5TOZA 4V0GA 3S95A 3NUUA 1P2AA 3SVVA 2IF8A 3LCTA 4QMZA 4R1VA 3PUPA 1A06A 3AGLA 3R28A 4YU2A 4TTHB 5HE1A 1M7NA 2Q83A 4DH1A 2PUPA 3SXSA 5C8KA 1WCCA 3EHAA 1VZOA 2QOHA 3TKIA 4FV8A 5AP7A 2UUEA 4PTEA 2P2HA 2YAAA 4BGGA 1GY3A 4EH3A 3FY2A 4D4VA 3LM0A 4EH5A 5HE2A 4FIEA 2IZSA 3POZA 4NCTA 4L3PA 3V5TA 2BALA 2QHMA 5HG7A 4QMNA 3NRMA 4FL1A 3AMBA 3UJGA 3QQHA 2XIZA 4DHJA 3CXWA 5CENA 3BU5A 3OWJA 2R3MA 1CKPA 3WF9A 4TY1A 3NSZA 2ZV2A 3FYKX 2C0TA 4RJ3A 4CSVA 3VS2A 3MY5A 3QD3A 1RQQA 4C37A 2Z02A 3R8PA 1YWVA 4FT3A 4U79A 2F4JA 5HO6A 3VS0A 3VJOA 3EZRA 3QCQA 2ETKA 2Z2WA 4OTDA 3KCKA 4C02A 4HVSA 5HGIA 3RJCA 5BVDA 3QKMA 2PZYA 3TI1A 5BYLA 4CTBA 2VTRA 4HGTA 3FLYA 4DGMA 4H3BA 4I0SA 3GEQA 3BE2A 1ZYLA 4YR8A 3I6WA 2HW7A 5GINE 2Y8OA 3BPRA 3OP5A 2YCFA 3VN9A 1QPEA 3UNKA 5E92A 2A19B 3NFFB 4NM7A 3RAHA 3C51A 4IVAA 4NIFA 5JFWA 1F3MC 4CZUA 3KCFA 3TWJA 5FD2A 4WNMA 3GCPA 5EI2A 4MQ1A 1YXXA 4RBLA 1DI9A 3VQUA 2ETRA 4JNWA 3E92A 4OAUC 2BAQA 5ETIA 1REKA 3R7VA 1PYEA 3L8PA 3LE6A 4JJRA 3ATTA 2WTKC 4IEBA 1JPAA 5CI7A 1QL6A 2J9MA 3P4KA 4FVRA 4O4DA 2X81A 4G3EA 4QYGA 4D2TA 4DITA 5LCJA 4FT9A 2WTDA 3QX2A 1BL7A 4BCPA 3RAKA 2Y7JA 2X8EA 3CCNA 3R02A 4YHJA 1URCA 2ITXA 3LAUA 4DFXE 4HCTA 4R5SA 3V5JA 3FMJA 4DH5A 1PXOA 2WHBA 1OIQA 2E9PA 4NYEA 5EOBA 3EZVA 4AWIA 4IFGA 3NDMA 4CFNA 1ZLTA 4A4OA 4FYNA 2OG8A 4WG4A 4IX5A 5DPVA 4FG7A 4F63A 3KREA 4ZZOA 3PUFC 4P2KA 4UV0A 4WUNA 4DH8A 3QYWA 2YM7A 1SMHA 3EQHA 4S34A 4JAJA 3UYTA 1IASA 3FXXA 4MK0A 4QP7A 1YHSA 4IWPA 3WARA 1XH4A 2YM4A 4JT3A 3KXGA 3MVJA 3PPZA 2PTKA 4GK3A 4LM5A 3D14A 5C4KA 4YSJA 4USFA 3PIXA 5I9XA 4O0RA 3W10A 3LFBA 4BKYA 4FE2A 5IZFA 1E9HA 4IWDA 3O8TA 4P5ZA 1IEPA 2KULA 5EM6A 3H10A 4DBNA 4JR3A 3RCDA 3PWYA 3PYYA 5IH6A 3ANQA 2PVYA 3ZC6A 3MBLA 1EH4A 3PXZA 2FSMX 4QP6A 5IA3A 4FEQA 2PY3A 2HXQA 1KV2A 3MFSA 4G2FA 4X7QA 1P14A 2J90A 2OFVA 3HAMA 1JLUE 1OB3A 5BV3A 4BIDA 2HELA 3QRJA 1O6LA 4QO9A 2ZFYA 4XG6A 4FVQA 5LVPA 4Y95A 5FEEA 2VTOA 4Z7HA 4UY9A 4JDHA 1PXJA 3C0GA 3CQEA 4ANBA 3QAME 3VS1A 4EORA 2ZDTA 3AMYA 4TL0A 4O7TA 4NW6A 3BV2A 4J8MA 4DFBA 2YIRA 4BCHA 5FDPA 5CF6A 2ITWA 5BMMA 2W5BA 3BX5A 4XBUA 4FTNA 4DGLC 3PVWA 4YNOA 4BKZA 1R78A 1RW8A 3BRBA 3IECA 3MS9A 3DTCA 3H0YA 2WOUA 4FEXA 5LJJA 3ZRMA 4PUZA 1JSUA 4XRJA 5C9CA 4E7WA 2F7XE 4F6WA 2OZOA 1MRYA 4O2PA 2P3GX 4YC8A 1XH7A 3DXNA 2GNIA 3ZXZA 5I9WA 2XH5A 5H8BA 3W0QA 2OF4A 4G34A 4KNBA 3CTJA 3LFSA 3EQPA 5EHYA 5DEYA 3R71A 3NWWA 3PXKA 3DBDA 5J7BA 3ODYX 1E1XA 4FNYA 4W4YA 5AA8A 4Y83A 4YTHA 3VF8A 4MXZA 1J91A 3FZTA 3SAYA 1H0VA 3W2RA 2WQMA 3BE9A 4EHVA 3HV5A 2FSOX 3UZRA 4NU1A 2WPAA 3SLSA 1OKZA 2BVAA 1YOJA 3MSSA 4JDIA 1U54A 4FSQA 4ZS4A 2XNMA 2C5VA 5E8ZA 4CQGA 3PFQA 4DH3A 4H1JA 4DBXA 3F5UA 1OITA 3Q9YA 4M67A 2NRUA 4AACA 2WIPA 1FOTA 2YA9A 4IXPA 4RX5A 4FZAB 2G2FA 4FSZA 2XIXA 5IMXA 4YJQA 5EYDA 3KA0A 3UG2A 5EQEA 3I7BA 5IQCA 4EZ3A 3TJCA 5DN3A 4U3YA 3U6IA 4IVCA 1XH5A 2UZVA 3LLTA 4AOJA 5ICPA 3ZZWA 5JZJA 2PVLA 1WBTA 4MNFA 1W98A 3NX8A 3M42A 4BDAA 5HX8A 4BIBA 3UOJA 3D7TA 5AX9A 4D9UA 4EH4A 4JLCA 3NYXA 4QD6A 2PVNA 3ZONA 4X2NA 3KC3A 5HLNA 3UQCA 1XMLA 5B7VA 2B0QA 4BWXA 3C13A 3UBDA 4HOKA 2Y9QA 2XRWA 4PMSA 3PRIA 4HCVA 5FM3A 4CG9A 2O5KA 4G16A 4WNOA 3VQHA 5HX6A 4PY1A 4YZCA 3PY0A 4GYIA 2OKRA 5IQGA 2PE0A 5CT0A 2I1MA 3ODZX 4U41A 2VGPA 3MY0A 5LCKA 3RM6A 2B7AA 2PMOX 4AP7A 4HGLA 5JN2A 5EG3A 3JY0A 3MJ2A 3ML1A 4D55A 3PA3A 1S9IA 3PLAE 1ATPE 3ROCA 1STCE 3A7IA 4CMOA 4BI2A 2JEDA 4F0FA 2O65A 4DGOA 4IDTA 5IH5A 3W33A 3H9RA 5BVFA 5J9LA 1I09A 4EK3A 2W4OA 2O8YA 3WZEA 3CJFA 5KZIA 2ESMA 2H8HA 4O0YA 4RLLA 5GIOE 3CIKA 4C35A 1H1QA 2W1GA 4IAZA 3EN4A 3ZLWA 4F0IA 1G8KA 2YLEA 4L9IA 5EFQA 1R39A 2BRNA 1Y8GA 4IB1A 2R3JA 2JAVA 5KX8A 4TWCA 3TZMA 2YITA 2UW0A 4LQMA 1W84A 1PMVA 3OG7A 1KE5A 2J0JA 4RMZA 4DE4A 3AKLA 3VC4A 3KULB 4YO4A 3LJ0A 3P9JA 4MCVA 3E8CA 2J0KA 3LKMA 4YO6A 2QU5A 4F1OA 1PXMA 1JWHA 3HMIA 3JPVA 4FKPA 2V7OA 4AQCA 4P7EA 4H3PA 3TXOA 4TYEA 2W1IA 5M4UA 3DNEA 1JKTA 4MXOA 3U4UA 4DCEA 4BR3A 4DINA 3E8NA 1TKIA 5M08A 4ZOGA 4IM3A 2XM9A 3ACKA 4FTJA 4J98A 3R7UA 4EK4A 2IZRA 3LFQA 4FIGA 4JX3A 5IUGA 3C0IA 5IUHA 3CKWA 3SRVB 5B0XA 5HBEA 2W9ZB 3A7FA 2QHNA 3JVRA 2XUUA 2WAJA 5KZ0A 2OH0E 4WSQA 1UU8A 1YDTE 3EKKA 3G33A 4D5HA 2E9VA 1NW1A 4Y8DA 4IAAA 5DLSA 4ALWA 3R6XA 2QKRA 1K3AA 4FV0A 4R6VA 4B8LA 5AP6A 1BKXA 2CCIA 2JITA 2VZ6A 4M8TA 4MBJA 4FKIA 4V05A 4BF2A 5TR6A 3KMWA 3UC4A 3DS6A 4KD1A 1VLRA 3EFJA 3DK6A 2X8DA 3CY3A 3QUPA 4CYJA 5G1XA 2IVUA 3L9PA 3NAYA 4W9WA 2R5TA 5EW9A 1H1SA 3WZJA 1OKVA 4FTQA 2XJ2A 2WU7A 3K3JA 4MXXA 5CEIA 4I5CA 2C1AA 5DFPA 1LP4A 3D9VA 4P5QA 4F7JA 1M2RA 1R0PA 1OBGA 4PDYA 3MJ1A 4CMUA 4O7LA 1M2QA 2YJSA 3G6HA 3WF5A 4WG3A 4FBXA 2R3HA 3NW6A 1E1VA 2V0DA 3F3WA 2UZUE 4H05A 2W05A 3QQLA 3FMMA 5BNJA 1IAHA 2YZLA 3MH1A 4FL2A 3ZOSA 4ZSEA 4QMPA 3M1SA 3M2WA 5DR6A 3DB8A 3QTRA 4QTDA 4RX7A 5AWMA 3F88A 5T68A 3RKBA 2EXEA 3R21A 4BGQA 1F0QA 4L46A 5AAFA 3O96A 3ZZEA 4FTAA 4O0XA 4UBAA 4YC6A 3LMIA 3QTUA 5FP5A 3U87A 3VNTA 3VS6A 2XANA 5A4CA 1YWNA 2CGWA 3TNWA 4WSYA 3LXPA 5M57A 2YACA 3RM7A 1MRUA 2REIA 4RVLA 3EOCA 1H0WA 2WMQA 3BYSA 2YWPA 1H8FA 4L44A 4M69B 2ZB0A 3FQHA 3VBTA 3EWHA 3UG1A 4APCA 4IIRA 1OECA 4JOAA 5JFVA 3LCOA 2EXCX 1Q99A 3O51A 3QZFA 3W8LA 4A4XA 1G8SA 4UMPA 3GC9A 5EDPA 4I94A 1A9UA 2JLDA 3WBLA 2XJ0A 2X6EA 5DH3A 4FEWA 2OJ9A 4KS7A 2WO6A 3BGZA 1WFCA 3BLRA 4O6EA 4WT6A 5ACBC 2I40A 3B8RA 4JBVA 4RSSA 2XIYA 3UE4A 4B6LA 3SGCA 2ACXA 4F6SA 1UKIA 1UV5A 3MV5A 2A2AA 2OWBA 5FEQA 3KVXA 4MTAA 3RWPA 3ZDUA 3TNQB 4K33A 4JBQA 4XS2A 2HOGA 3BBTB 3C0HA 4RIWB 4RIYA 3NPCA 3KKVA 4N6YA 1DAWA 5FM2A 3WI6A 5KNJA 2CKPA 5CSXA 3MIAA 3R2BA 4FKVA 4FVPA 4ZJJA 5BX0A 4LDTA 4YLJA 2GNJA 3R83A 4BGHA 4EOPA 5A9UA 3R22A 4PPCA 3F5GA 4UWCA 5FG8A 3VUDA 3WOWA 4WNPA 2C4GA 2ZV9A 5HQ0A 5IQAA 4OW8A 3NNUA 1VEBA 2ITQA 2RL5A 5HTIA 4CV9A 2W1DA 4O84A 3RHXA 4EZ5A 3OF0A 4EOKA 3LQ3A 4JMQA 3WYXA 3F7ZA 4DDGA 3OXTA 1Q41A 4AZTA 4MH7A 2IVSA 2WIHA 3KIOC 2HWOA 3KB7A 4CYIA 3HDNA 2XVDA 3COKA 2WXVA 3ORMA 5DGZA 1XH8A 3AKKA 4WRGA 4O7YA 2PUUA 1MP8A 5HIBA 4NW5A 3NUSA 4BI0A 5F94A 4NKAA 5D41A 3MIYA 3P86A 4C3PA 2HIWA 3R7IA 3AT4A 4QMXA 5CTPA 2PVRA 4IZ7A 4WIHA 3FC2A 2GCDA 4UB7A 3PIYA 4IHPA 2X1NA 4MD8E 4O4BB 5TO8A 5DI1A 1YI4A 3ZEWA 2Q0NA 2VO7A 4KINA 3T8OA 4PL5A 4IQ6A 3RGFA 2QOIA 3I5ZA 3O2MA 4QMLA 3A4PA 4CFFA 1P4FA 2W5HA 3F3UA 4S33A 3F3TA 3K3IA 4YP8A 4KRDA 4LMNA 4X3FC 3U6JA 4IE9A 3AC2A 3RWQA 3EYGA 2HYYA 3MTFA 4EOSA 5AM7A 5KBRA 4R7IA 4MF1A 5J1WA 4YJNA 3ETAA 3CEKA 4APPA 4Z16A 4PRJA 3BYOA 3TNHA 3BHUA 3QL8A 4QOXA 5HI2A 5M56A 1Z5MA 1YDRE 4AT4A 4DEAA 5GJFA 5BYYA 3QQUA 2BFYA 3VUTA 4PDPA 4RZVA 4F64A 4FSRA 4F7SA 2Z7RA 4ASZA 4IM2A 4Z3VA 2PZPA 2BIYA 2UZBA 4OTPA 3VBWA 5M09A 2YISA 4UX9A 5AR8A 4C57A 4O0SA 4LOQA 4ZP5A 5CAOA 2OK1A 3DJ5A 2VWBA 3CTQA 3AGMA 1ZOEA 3ZBFA 4J97A 2P33A 4NEUA 5CALA 1CSNA 4OBQA 3C5UA 3SX9A 2WTIA 2RFDA 3AT2A 4QMVA 2B53A 2YDJA 5HO8A 1K9AA 1OL1A 4ZK5A 4LMUA 1JKSA 2BZJA 3V8TA 3VIDA 4F08A 2Z7LA 5J5SA 4DTBA 2W7XA 1PYXA 4IDVA 4FT7A 4U97A 2QLQA 3SA0A 4H3QA 3S3IA 4C8BA 3LCDA 2H9VA 1CKJA 4OT5A 5DR2A 3NGAA 5JRQA 2XNPA 2PK9A 3G6GA 2JBPA 3ZSIA 3EFWA 4JBOA 4WBBB 5KUPA 2GQRA 3UPZA 3HYHA 2BMCA 5CEPA 1ZZ2A 2BCJA 2VTMA 4LGGA 2C5XA 1Q8UA 3SG9A 3LM5A 4QMOA 3RNYA 1L3RE 1OGUA 3ORLA 2BZIB 2LGCA 4AOIA 4EUUA 5J79A 4ZY5A 5FUTA 5J9YA 5FTGA 3WZKA 3W0RA 3HA6A 3W8QA 4ZMEA 1U4DA 3ZS5A 5FLFA 2WNTA 5GZAA 1XBAA 4IMYA 4PNIA 4O83A 4A9UA 4BVUA 4QMWA 4EK5A 4NFNA 4C4FA 2BFXA 5HIEA 5J7HA 5CU3A 2OZAA 5KMJA 4BBMA 1H1WA 2FSTX 2JC6A 3KK9A 3OVVA 3RI1A 2IVVA 2WTVA 3DAJA 2OO8X 3TTIA 5CF5A 5JGBA 4OBPA 1WVXA 5CAQA 5HBJA 2PVMA 3IW5A 5JSMA 4BIEA 2R3IA 2B9FA 4D5KA 3TG1A 3R1QA 2DS1A 5AP2A 4UZHA 2R3QA 4KIOA 3RPVA 4DEEA 2P55A 5HESA 3GT8A 5CVHA 3FMNA 1Q8TA 2W4JA 4GT4A 4K9YA 5AA9A 5HCYA 2PMLX 5FBNC 2VO0A 4AE6A 3REPA 2JGZA 3Q3BA 1GNGA 4QQCA 3ATSA 5AP0A 4CD0A 2J5FA 3II5A 4RIXB 4HGSA 4ZSGA 4R7BA 5GZ8A 5AUZA 2IZUA 3KGAA 4GS6A 3BWFA 4YLKA 5BYZA 3W2QA 3DBEA 5E1EA 3PZHA 5AP5A 3ZC5A 3IGGA 2E9OA 3F2RA 3NFGB 2C0IA 4FNXA 4OR5A 4M3QA 5B2KA 1RDQE 4U9AA 3O23A 5DT3A 4EKKA 2RFEA 3OOGA 3G2FA 1RJBA 4XV9A 1ZMWA 5BVNA 3DBQA 2OIBA 3G9LX 4F65A 2RSVA 1R1WA 2WMBA 4GW8A 3HMOA 2EWAA 3VUMA 4ACDA 4CV8A 4D2SA 4BDBA 3NYOA 2VNWA 4I6QA 2GHGA 1PMNA 3C9WA 3IDPA 4K0YA 5LMAA 2WTWA 3R8VA 3DBFA 4TYHB 4DT9A 5IDNA 2XK9A 2Y6MA 3JY9A 4HYUA 4OUCA 4Z55A 2HZNA 3E93A 2GDOA 3C4ZA 4II5A 5TT7A 2JFMA 2XKDA 4ZEGA 5L2IA 4ALUA 4WD5A 3QGYA 5CZIA 4FTLA 4OTWA 3EH9A 3QQKA 3GBZA 2XRUA 1W83A 3TDVA 5ANJA 2VO3A 3EQCA 2NYAA 3DB6A 4OTRA 5KKRB 3NNWA 4YGAA 3DAEA 3RPOA 3LW0A 1PJKA 3F3VA 3NZ0A 5A46A 4NFMA 4IZ5A 4IB0A 4UMTA 3C4CA 2J2IB 3U9CA 4AA5A 3QTSA 3WILA 3PXRA 4FGBA 4U80A 2W17A 3LXLA 4GCJA 3R9DA 3FKNA 1J7LA 1YVJA 2XEZA 2DWBA 3DQXA 4Y5QA 4GUEA 3LIJA 5FP6A 3BU3A 2QOCA 5KMMA 1NVQA 2VWWA 3Q5ZA 5T3QA 4O1OA 4HNFA 3KY2A 3TACA 3ENMA 2OJFE 3NNVA 4EQCA 4IZAA 4E4NA 1NVRA 5A4TA 2E9UA 2JKMA 4L7SA 3I81A 1UVRA 4FKSA 3UIUA 2XS0A 3NW7A 2BIKB 1UU7A 2C5YA 2GS6A 4ZTLA 4NT4A 5BUIA 4XG2A 4A9TA 5L8KA 5BQ0A 1CM8A 4J96A 1O6KA 5CS6A 5IDPA 4QP2A 4DF3A 1HOWA 4IB3A 3VHKA 4H39A 3PY3A 3PSDA 4BYIA 1YRPA 4FMQA 3D7ZA 3ALNA 4C36A 3GC8A 4CLJA 2GTMA 4I4EA 2RIOA 4F1MA 3PVUA 3UP2A 4QP3A 2QR8A 2HZIA 2IO6A 3QBNA 4PMTA 4R3PA 1YXSA 2QC6A 1YXVA 1M14A 1SVEA 2Q0BA 4GG7A 4UMUA 4PMPA 3FDNA 5HEZA 1XHAA 2VNYA 2HCKA 3MPAA 3R9HA 5LMKC 1Y6BA 2XMYA 3ZCLA 4JI9A 5H8EA 1UNGA 3VBVA 2NNWB 1JVPP 5CSWA 3RPSA 4TWOA 4AS0A 4EL9A 5L3AA 3F61A 4FSMA 2QODA 4L3JA 4XOYA 4AG8A 2AUHA 4GG5A 3A2CA 2VN9A 3Q52A 4X2GA 3TV7A 1YKRA 1ND4A 1H25A 4G9RA 4MBLA 2AEGA 2J0MB 4FG9A 4GIHA 4F1TA 2P0CA 3ULZA 1ZOHA 4G3FA 3OTUA 5E91A 3IOKA 4BJJA 4CFVA 3F7WA 4I5HA 4N4SA 4FUYA 3DKOA 5AR3A 5CANA 4N6ZA 3DCVA 1OIYA 3WIKA 4YURA 2C6OA 3G0EA 4EEVA 4IJ9A 2Y4PA 3QYZA 4PV0A 2VGOA 4HW7A 3MPTA 5AJQA 4MXYA 2EXMA 3EYHA 3P1AA 1SM2A 4IWQA 4ID7A 2CLQA 2OXYA 3OROA 4USDA 3CGFA 4EOLA 2RG6A 3QC4A 4D9TA 2SRCA 3E7OA 3OWPA 4U5JA 3ZM9A 4EHGA 2J51A 1OKYA 1SVGA 2PVKA 5KBQA 5EHOA 3U9NA 1A48A 3R9RA 3ZO3A 4CRSA 3GU4A 2BDFA 3HAVA 5HZNA 4R78A 2W9FB 3V6RA 4HPTE 1OUYA 2QONA 4KIKB 1IG1A 4UEUA 1ZOGA 4QMYA 5HG8A 3LFNA 2GS2A 1Q8WA 4E6CA 5LVLA 4EZ7A 3DTWA 4DN5A 3W18A 3FZ1A 3GFEA 5EH0A 2ZV8A 3PE2A 3WZUA 3G0FA 3PPKA 5KHWA 4FC0A 4I23A 4XV1A 1KV1A 4BHZA 5EKOA 4C4GA 3H0ZA 4MNEA 5CAVA 5C27A 2PSQA 5HVYA 3PSCA 4QMMA 1WVWA 2QOFA 4AN3A 3W0OA 4D0WA 3C4WA 3ZUUA 4E5BA 4LUDA 3QRTA 4DA5A 4J7BA 4EYJA 2PZRA 4CNHA 2XBJA 4KIQA 4RQVA 4QMTA 1FGKA 3P0MA 4F6UA 3UDSA 1W82A 2R3GA 3DU8A 1JQHA 3QD2B 4KB8A 4FOCA 4I3ZA 5KMIA 4CLIA 4UMQA 4ZTRA 2NRYA 3P7CA 4J95A 4AA0A 4TPTA 3DK3A 2A1AB 4H58A 4FGRA 4YPSA 4MVFA 4LGDA 3BU6A 2R4BA 2JD5A 3CE3A 1KOAA 4U45A 3UNZA 2VTLA 5CSPA 2VAGA 3W0PA 4G6NA 4L67A 3E3PA 3R1SA 3EB0A 3U4WA 3W16A 3DQWA 3R8ZA 3BL9A 3Q4UA 5IISA 2C0OA 3QX4A 1ZY4A 3F69A 3EL7A 4I22A 2ETMA 3D4QA 2ITTA 2XEYA 4E5AX 1BL6A 1PMUA 2BHEA 2VTIA 3L8SA 2B54A 3QUDA 4I5PA 3KQ7A 4RQKA 3TL8A 3E64A 4KWPA 4RFMA 4RWLA 3NVMB 1GJOA 4DEDA 3ZLSA 5IA4A 3MFTA 4MQ2A 4QYFA 5CAUA 2C3LA 1M2PA 1LUFA 3R00A 3TTJA 5A54A 2YDKA 3IW4A 4GV1A 5IF1A 3W2OA 3KRJA 3SG8A 3KVWA 4NL0A 3H3CA 4FZFB 5FQDC 5IG1A 3FV8A 4ZJIA 3UO6A 4TKSA 1ZWSA 3O0GA 3OMVA 1UA2A 5M4IA 4TRLA 4B4LA 1WZYA 4U6RA 4GK2A 2R3RA 5IEXA 1U46A 2UW9A 2X9EA 5H2UA 3TKHA 4GFMA 2UV2A 3W55A 2AC3A 2YIXA 1FVRA 3NUAA 1U59A 3EQIA 5D7VA 4HYIA 3LCSA 3QXOA 2FGIA 2PWLA 3GQIA 1UWHA 2ITNA 4LGHA 1HCLA 4G5PA 4QDEA 4ZZNA 3UODA 4O38A 5D11A 3E3BX 2BTRA 4F78A 4AX8A 4GKIA 3IOPA 3E8EA 3SC1A 5FBOA 2W06A 3F66A 4UWBA 1SNUA 2GNGA 4EK6A 2R3PA 5BUEA 3ROYA 3DOGA 3QC9A 1NVSA 4BTFA 2GNLA 2UW6A 3BCEA 5EW3A 1KWPA 5BMSA 3N4VA 3CS9A 3GNIB 4BBFA 3NLBA 3PVBA 4FKQA 3OWLA 4FNZA 4H1MA 3ZFXA 4IFCA 3V5PA 1V1KA 4C2VA 4JVGA 4GEOA 4YTFA 5HG5A 5GZ9A 4FT0A 4BCKA 3IW8A 3BKBA 3BWJA 4FG8A 4BYJA 3O5AA 3V51A 5LMKA 2PZ5A 2GMXA 2BRMA 4IADA 3UVPA 5JQ5A 2CJMA 3IG7A 4EJ7A 4FTTA 5CVGA 5C03A 4E4LA 4RFYA 3ZTXA 2B9JA 3N9XA 4ZTNA 3R7EA 1WBPA 3HMPA 3ZO2A 4ACCA 4XLVA 4L53A 4ACGA 4ZLOA 4S2ZA 4F0GA 1KUTA 1RE8A 5ANKA 3BI6A 3HUBA 5DBXA 4EOIA 3AT3A 3PJCA 4PL4A 3KRXA 3WE8A 5JFSA 5FXRA 3OFMA 5AR4A 4WA9A 3D94A 4UXQA 2X2KA 1ZYJA 4RGJA 3QHRA 4C4IA 4TN6A 3S1HA 5ITAA 2F7EE 3H30A 5K0XA 4AXDA 3GCQA 3O7LB 1WVYA 4O86A 4MXAA 2C30A 4Y46A 1FMOE 4FX3A 3FXWA 2ZOQA 2WMUA 4F9WA 4E1ZA 5E8VA 4BCMA 1TQMA 2IEWA 4O1PA 4RVMA 4KSQA 2GFCA 4AZVA 3RK9A 3VRYA 4NZWB 4IAYA 4O7NA 4FTUA 4DC2A 3Q9WA 4EOOA 3F5XA 3UIBA 4CFUA 5F20A 5K4JA 4FODA 4A9YA 1PMEA 1PW2A 2OJIA 3CQUA 3KMUA 5CU6A 3UNJA 4A07A 4B7TA 4KRCA 5J9ZA 2CGVA 4B9DA 3FSFA 3W32A 3ORPA 5BPYA 1ST4A 3ORTA 4FI1A 4PNKA 2QI8A 1FMKA 1Q97A 2GNFA 2HY0A 4FKJA 2X0GA 3EMGA 1ZZLA 3KL8A 3VVHA 3BZ3A 5L2SA 4MEDA 4EK8A 4EWHA 2QU6A 1GIIA 4GVAA 2X4ZA 2CKOA 3CD8A 5AR5A 3U6HA 4FEUA 3OT3A 1OIRA 2G2HA 1GIHA 3ORKA 4YJOA 1HCKA 3LFEA 3FZRA 4KIPA 4HCUA 2VV9A 2NO3A 3MB6A 2CKQA 5HCZA 3EQRA 3WF8A 5AFVA 2XNNA 3PJ2A 4CT1A 3I0QA 3NS9A 1B38A 2JFLA 5DG5A 2CLXA 4AGDA 3O71A 3BIZA 2PYWA 3VWAA 3QTQA 4MYGA 1V0OA 3QQJA 4QDVA 2OU7A 1UNHA 2PL0A 2ZMDA 3QWKA 3UOHA 3EJ1A 4O7WA 2QNJA 3I5NA 3P23A 4TT7A 1J1CA 3EN7A 2G15A 1Q3WA 2C3IB 2QQ7A 4X2KA 1QPDA 5G6VA 5H9BA 2W99B 3PFYA 4AOTA 4NM3A 4FF8A 4PPBA 2EUFB 5C01A 4EC8A 5L8LA 2VWIA 4YJRA 4AXAA 4S30A 1QPCA 5H3QA 3WYYA 4BDKA 2AQXA 3ZMMA 4OGRA 5IMEA 3FL5A 3P7AA 2UVXA 3IGOA 3DKCA 3O8PA 4ONAA 4TXCA 2IW9A 3ZSHA 4A9SA 4XLIA 4QNAA 4E73A 4HZRA 2WTCA 1CMKE 5HBHA 2X39A 4LL0A 5AR7A 3SV0A 4YLLA 4O91A 5DWRA 3BL7A 2J5EA 3EKNA 4NJDA 2X0PA 4UYNA 4XP2A 4R77A 4W4WA 5IA2A 5LVNA 5C4LA 4JG7A 1ZAOA 4RRVA 4YBJA 2X7OA 4RA4A 4FIFA 5FTOA 4K11A 4D4YA 4LOOA 5KMNA 4PWNA 5JRSA 2YM6A 3OBGA 3PXYA 5IPJA 3BLQA 3NUPA 4KSPA 3LXNA 2JDTA 2PUNA 3FLZA 4DG0E 2VTPA 4JRVA 1BX6A 3ZH8A 3F6XA 2YM5A 3QFVA 5F95A 5M55A 4DGNA