3BZ3A

Crystal structure analysis of focal adhesion kinase with a methanesulfonamide diaminopyrimidine inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
276
structure length
259
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPLAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Antitumor activity and pharmacology of a selective focal adhesion kinase inhibitor, PF-562,271.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 91
structure length 259
sequence length 276
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bz3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bz3A01
4PP9A 1J7IA 3AOXA 2PMOX 4FUYA 5IG1A 4RIXA 3A7JA 3NPCA 4HGEA 1ERKA 5T3QA 2UZLA 3R7VA 5BVDA 5K0XA 4I1ZA 4DBNA 3OUNB 3ZRMA 1OIQA 2PE0A 4QMVA 4QP2A 4I4FA 3TKHA 5IUHA 3UVPA 2BRMA 3DK6A 2OLCA 1ZY5A 3QX4A 3BU5A 3COIA 1YKRA 4I0TA 4H05A 3AMYA 3WOWA 5EH0A 3N4VA 2XKCA 5L2QA 1TQPA 2C47A 2IVTA 3I4BA 3TTJA 3QRUA 1F3MC 5BMSA 4FOBA 2I0EA 2V55A 3FZ1A 1OECA 3OG7A 1ZAOA 1R1WA 3OTVA 5AP1A 5CEIA 4USEA 3SRVA 4FZAB 1PYEA 2X0GA 3KRRA 5HD7A 5T68A 5HBEA 2VO0A 2X8EA 4BDHA 5BVKA 4XG9A 3UVRA 3QXOA 5LVOA 5GJDA 4NJDA 2ZYBA 2OBJA 2YM8A 3C4FA 3UODA 4PDOA 3F3TA 2JIVA 2IZUA 4CTCA 1LPUA 4S34A 4U6RA 3POZA 4C36A 1QPJA 1JKTA 2WXVA 1PXIA 4S31A 5AM7A 4RLLA 4BC6A 3IOKA 2YLEA 3M42A 4HCUA 4ZY5A 4XOYA 1TQMA 3BQCA 3ULZA 2X6EA 4BVUA 4EEVA 3VHKA 4AW5A 5ANDA 3TIYA 3VUHA 1U54B 3E62A 2C0IA 5JQ8A 2IWIA 5ANJA 3GEQA 3BHYA 4FEXA 3GNIB 1IA8A 3B8QA 3LM5A 4IM0A 4O1OA 3UC4A 3ZXZA 5CF8A 3UIBA 4DLJA 5CASA 3DBCA 2B9JA 3DDPA 5K5NA 3CPBA 2B1PA 3C5IA 4IW0A 4FKQA 5CT7A 3TNPC 5LARA 3RCJA 4OBPA 3QUEA 3EL8A 4FV6A 3TM0A 5AR8A 2UW4A 4QYEA 2XIKA 3IKAA 3G0FA 3QCSA 4O1PA 3CP9A 1BUHA 2I0VA 4ITHA 2F7ZE 2H8HA 4F6UA 3PJ1A 3S4QA 4KSQA 4GG5A 4OT5A 2R3QA 3U6HA 4X2FA 3VWAA 4ZMEA 5ETCA 4E4MA 3CKWA 3PFQA 3GQIA 4O7RA 4GYGA 3RPVA 1XQZA 2VAGA 5L8KA 1O9UA 4FKUA 2WMVA 3QTIA 4BIEA 4ERKA 2BRHA 3ERKA 3HV3A 4FBXA 3DBEA 4YJPA 4EOQA 3NUXA 2W1DA 2C3KA 3MH2A 2J5EA 2ITNA 2UW6A 3ANRA 3QRTA 4N57A 3HA6A 3ENHA 4QOXA 4EZ5A 3F5UA 4FV2A 3TN8A 3MESA 3OCGA 3GP0A 3OBJA 5IQBA 1YI6A 3F3VA 4U43A 4FIJA 3EZRA 3UBDA 3C0GA 3HRCA 1V1KA 2ITTA 3BEAA 4CFMA 3IW6A 3VHEA 1J3HA 3C1XA 4AZWA 4J97A 3UYSA 2UZTA 4KABA 5J7BA 4I41A 4AOJA 3PA4A 5JRSA 4GK2A 5FM3A 4QMOA 5G6VA 1MUOA 2J0MB 2JAMA 2GTNA 3ZO4A 5IEVA 1CSNA 3UZPA 2RFEA 2BALA 3GU6A 2XM8A 2XRUA 4C38A 4CD0A 4CXAA 3IDBA 4JG6A 1OL7A 4JRVA 4H58A 5D9HA 4G34A 4LQMA 4QMUA 1WVWA 2BAQA 3R02A 2FSOX 3GC7A 4KWPA 1Q4LA 5IMXA 1LEWA 5M57A 4CFXA 2JDSA 2R3RA 1Q97A 2VTRA 4NYEA 3UGCA 1WBTA 3IW7A 4IM3A 5EFQA 1JAMA 2OF2A 3MJ2A 4I24A 3A4OX 3UIMA 5M56A 4QP1A 3FY0A 4FKOA 4BBEA 4I6QA 3R1NA 5BVOA 3FLSA 4BWKA 5GNKA 2PMLX 3Q3BA 4QT1A 5J5TA 1YXTA 5LVMA 1ZRZA 4IX6A 4C4GA 3NUSA 5HIEA 3DQWA 3IDPA 4CFNA 4EK8A 3PY1A 2PTKA 4UEUA 3UZRA 1OKWA 5GJFA 2BHEA 2ZV9A 4TPTA 3IO7A 4HCVA 4G3FA 3OWLA 2W4OA 3Q5IA 3FXXA 3GT8A 3VULA 3ZTXA 2FO0A 4CFVA 4ZSLA 2HAKA 3PXFA 4MTAA 5LMAA 3RPSA 3KXHA 2BDWA 4ZTRA 4L8MA 5C8MA 4ZSEA 2XJ0A 2R3PA 4I21A 4RVMA 2HW7A 4H1JA 5DG5A 1M2RA 1KE5A 1ZXEA 2G15A 2I1MA 2OZAA 4ASZA 4HYIA 4UYNA 3V6RA 3QKKA 5L8JA 4ACGA 2XUUA 5HO8A 4G3DA 2IPXA 3HUBA 4O6LA 3DXNA 3ZXTA 4RA5A 3P4KA 3R8MA 5LCKA 4DEEA 4I3ZA 2E9VA 5HCXA 1PRYA 3AD5A 1BL6A 2GPHA 5H2UA 1CTPE 4A7CA 1KE6A 4EHEA 5AUYA 4YTFA 4M66A 3S95A 1DS5A 3HGKA 4IIRA 4MNEA 2CN5A 4I5HA 5EOLA 2QOLA 5CU3A 4PTCA 3RKBA 4PDYA 4FICA 3LHJA 1FBNA 3LMIA 3E7OA 3Q60A 4L53A 4CFWA 3G2FA 3KY2A 5B7VA 3GUBA 3JUHA 4TKSA 3WE8A 4PV0A 4G6LA 5FTGA 4BCJA 4MF0A 3C4ZA 2ONLA 4OLIA 5AR5A 3ZC6A 4N6ZA 2AC3A 3VO3A 3E92A 3ZFXA 4B99A 4DH5A 2VNWA 1YHSA 3I60A 4CVAA 5EDRA 2XEZA 4L44A 3TZ8A 3DJ6A 3TNQB 1P14A 1P5EA 3COHA 4ANBA 2HZNA 3VS3A 5CU0A 3FY2A 2Q0BA 4AUAA 4II5A 2HWPA 2NP8A 3EH9A 5AIRA 5HLWA 4BTJA 1H28A 2UZUE 4QMYA 2GHMA 3BE2A 4W9WA 1S9IA 4O83A 3MPMA 3KMMA 4TZRA 4FIFA 3ZLSA 1YHVA 4ZZNA 4FTNA 4CKJA 2G2IA 3R63A 3GXLA 4BYIA 5LOHA 4IHPA 3C50A 3F88A 3QLFA 3QU0A 3R9HA 5L6OA 3PIYA 3QQGA 3VBTA 2R3NA 5GINE 3BX5A 1H1SA 1F5QA 2V0DA 5A4CA 3GFWA 3D14A 3UG1A 2YIRA 4YJTA 4HW7A 5FRIA 4M69B 2OJGA 3G9NA 5AUZA 2BZHB 3BLQA 3FLYA 3KQ7A 4NU1A 1WBVA 3EFWA 3ZFMA 3PA3A 1J91A 4A07A 1OPLA 3EQCA 2WTVA 4IZAA 4YNOA 5DA3A 5KMOA 5KX8A 5EYCA 2QC6A 4JR3A 4TYEA 3SOCA 4UBAA 4DFNA 1OPKA 1RDQE 3I81A 4HVDA 1H1QA 2QR7A 3AMBA 3VQUA 3RPRA 4KIKA 2I40A 2GDOA 1OZ1A 4EUUA 4JL9A 5AIKA 4AFJA 2ZM1A 1NVQA 2C0OA 3LXLA 3NW6A 3U8WA 3ZLWA 4R77A 4MXOA 3HV6A 4RX8A 4FTLA 3NMUF 5DT0A 4FSWA 2XK8A 3KF7A 2R3GA 4BCOA 1JVPP 4YJQA 4BY9E 1IRKA 4CRLA 5FBOA 4AXAA 4AZVA 2EU9A 4LGGA 1GY3A 4X3FC 4BB4A 4D4RA 4YO4A 2XK6A 2YDJA 5AP5A 4F7JA 2ITXA 1GNGA 4L7SA 2BAKA 2ITUA 3MSSA 2YN8A 3FV8A 3CGOA 4H39A 5FGKA 3CS9A 1PMEA 3DJ5A 1XHAA 2F9GA 3HDNA 4O2ZA 3N4UA 4AT4A 2XNOA 4FSNA 4JDHA 1GIJA 2GHGA 4RFZA 4LRMA 3PXKA 3P7BA 3R22A 4BCHA 5JFXA 1LEZA 4D4SA 2XZSA 1JKKA 4NJ3A 2AC5A 3CD3A 4DTAA 2VWXA 3PPJA 5LVNA 3MFUA 2J0IA 2GS7A 5DGZA 3RINA 1WBNA 4G17A 4FKTA 4AOIA 3EN4A 1LUFA 3FL5A 1ZMWA 4FV8A 4F63A 2YISA 4FA2A 3OFMA 1QMZA 3RPYA 3DFAA 3MTLA 1BX6A 3QZHA 3BV3A 2QOHA 4NZWB 2I7QA 3H10A 3KK9A 3ORIA 3D5UA 3Q9WA 4FR4A 2QNJA 3QQUA 4FC0A 3VBVA 4CFUA 3THBA 4L3PA 5L8LA 2VN9A 3GENA 4FSUA 4H3PA 3PP0A 5B2KA 1M17A 2PE2A 1VEBA 4KRCA 5IF1A 1REJA 2HOGA 2VWUA 3CQEA 4FV7A 5M55A 4YU2A 2WTDA 1Y6AA 4GMYA 3MIAA 3MW1A 4H3QA 3PIZA 1W98A 5ETIA 4BDFA 2G01A 3OW3A 3EYHA 4I5PA 4W9XA 4S30A 3R83A 4P4CA 5EDPA 3JXWA 4IM2A 3A8XA 2F4JA 4O6EA 4R1YA 3DTCA 4W4WA 4FEWA 4B0GA 4R6VA 4YC6A 3UO4A 3LQ5A 2PHKA 1OKZA 4CV8A 2B9HA 4K11A 3EQHA 4UMRA 3ODYX 5HG7A 3RNYA 5KMIA 3PYYA 3DKCA 5CALA 3IOPA 5AMNA 1E1XA 2YM5A 3EL7A 5HTBA 2FSMX 4OBQA 4ZAUA 3E88A 3KXXA 2JGZA 3C4EA 4JOAA 2IZRA 3MGYA 2WHBA 5LVLA 3UO6A 4IVDA 4DG0E 5M4FA 5CVGA 3S1HA 4MH7A 1K3AA 4WG3A 1OBDA 2QURA 4EC8A 3D7TA 2OXXA 2WMUA 3A62A 3LFFA 4J98A 3V51A 4EONA 1SYKA 5CTPA 5IMEA 4TWCA 1UKHA 3JVSA 3PPKA 3SQQA 4F0IA 4A9RA 4IB0A 4R8QA 2HZ4A 4J71A 1UVRA 2A1AB 3V8WA 4D0WA 1YXXA 3H0YA 3OOGA 3VJNA 3QC9A 4CFFA 5EK7A 4O7YA 2G2HA 4K9YA 4QQTA 4DCAA 4BCPA 5L4QA 4HYSA 4D5HA 5HLPA 4TWOA 2YIYA 2PSQA 4MXZA 4UXQA 3TXOA 2VUWA 1SZMA 4YJOA 5GJGA 3D5WA 3G6HA 4NCTC 1DI8A 3CJGA 2R3LA 4L3LA 3PTGA 5IEYA 2J90A 2XP2A 2C0TA 1KE7A 3AD6A 3F6XA 2WIPA 3O17A 3HUCA 5J9YA 3R7UA 5HG5A 3QBNA 4C35A 2WFYA 5EG3A 2W96B 5CSXA 4NKAA 4UV0A 1G8AA 3BHTA 3GFEA 4HGTA 4C62A 4DEGA 3R9NA 2HENA 4DFYA 2W05A 3UQCA 2NPQA 5CF4A 1J1CA 4XG4A 1U59A 3PJ3A 3EMGA 1KE9A 2C68A 4FKJA 2B0QA 4FNWA 1BMKA 3JY0A 4RJ3A 2ZAZA 4OTPA 2ITOA 3U51A 3ZOSA 4B9DA 4BDEA 3UNKA 3NVMB 3R01A 5KMKA 4AGDA 4KIPA 4HPUE 3LMGA 4FSZA 3F5PA 2ZV7A 2JDVA 3D83A 3IG7A 3ZHPC 3COMA 4XH6A 4EYJA 4MNFA 5IA0A 4IE9A 4YZDA 4F9AA 1H0WA 4XG7A 4D2RA 2C3LA 3DNEA 4O0UA 1NVRA 3FPQA 3DKOA 2OKRA 3OCBA 3QTUA 2YM7A 3WZUA 5C1QB 5F9EA 5HG9A 2WQNA 1P4OA 3QRKA 2CJMA 4O21A 5KUPA 2UZOA 4FMQA 1Q8YA 4NEUA 2PL0A 4FYOA 4UALA 4FTRA 3I1AA 4DEBA 4I4EA 3L1SA 4L42A 3D2IA 2BIKB 2C6EA 2BMCA 3KULA 3NUUA 4R3PA 3UG2A 4ZS4A 5CWZA 5L6PA 2VO3A 2OICA 2XIRA 4FIGA 2YACA 4FKWA 3ZZEA 2QD9A 3FSKA 3ALNA 3BBWA 3UP2A 4ALUA 5M09A 4XG8A 4ASDA 3ANQA 4RJ7A 4MF1A 5CLPA 2WD1A 2Y4PA 5HU3A 2GFSA 2XCHA 5AJQA 5TE0A 4ZOGA 4Q2AA 4MXYA 3RZFA 2CPKE 2OIQA 3QUPA 4AZEA 5I9WA 4BIDA 4L68A 5ANEA 5AR7A 2V22A 1SNXA 2BIYA 4FG8A 4NM7A 4QMSA 4UWYA 4CQGA 1PKGA 5L2SA 3OUKA 4FSQA 1R0PA 2PVRA 5KE0A 4EZ3A 5E8YA 5AUWA 5IQIA 5AUXA 5JQ5A 5LVPA 5I9UA 4APPA 2IVSA 3D5VA 3TV4A 3GU8A 2X4ZA 2VZ6A 3HZTA 4BF2A 2PUUA 3CTHA 4JQ7A 1KV2A 4PX6A 3GOPA 3NLBA 1RW8A 5HX6A 2W7XA 3DA6A 5FP5A 4D55A 2SRCA 4ZY4A 2YIXA 1Y57A 1ZOEA 4L43A 4AA4A 4JT3A 3UNZA 2XBAA 4Z7GA 3O8UA 4C61A 4QTDA 4U81A 2QG7A 4FI1A 4UN0C 4BFMA 3LFQA 4KS8A 4FZDB 4NCTA 2ITZA 5BVEA 5FWKK 3TDWA 4AE9A 2JITA 3BU6A 4GW8A 2ZDUA 4KAOA 2VD5A 3LJ1A 3ORZA 4IVBA 3T9IA 3PY0A 3KL8A 5HICA 3BBTB 5L2IA 3KFAA 4XBRA 3B8RA 4J7BA 3CTJA 1PXLA 4WNOA 2W1GA 1FGIA 4K0YA 1MRVA 4JDKA 4KBAA 2WGJA 4QQ5A 5EOBA 4A9YA 3DT1A 4XYFA 4WBBB 3E7VA 4FTAA 4BCGA 2P0CA 4FTTA 5CSVA 2Z2WA 3GC9A 3QHWA 4FV1A 4U97A 5DEYA 5IH5A 2GTMA 3KRWA 5E8SA 5BUJA 4E93A 2OXDA 4EBWA 4EL9A 3R6XA 4G31A 2J0LA 2X1NA 3C0IA 4FEVA 2QHMA 5FG8A 5K9IA 3R04A 5C4LA 3LQ8A 3FI3A 1OIRA 2OIDA 3P1AA 3OXTA 2VV9A 4O7VA 1ZMUA 2R0UA 1R39A 2P3GX 4O0RA 4OW8A 3EN9A 2XNPA 4GUBA 2I6LA 4ID7A 4PPCA 1OVEA 3GCSA 3RWQA 4DAWA 1M2QA 2FUMA 1Y8GA 4OTRA 4KIKB 3DS6A 5B2MA 1XJDA 3TACA 3KREA 2YM4A 4F4PA 4QMPA 5HEZA 1G3NA 3QQHA 4E6QA 4DTBA 4PMTA 2GS6A 4FT7A 3FI8A 5BYYA 2XNNA 2XB7A 1M2PA 5DN3A 5J8IA 5CEQA 4DT9A 1YI3A 2OH4A 3AC4A 4RVKA 4M84A 3L8VA 3RTPA 1T46A 2OSCA 3VBQA 4AZSA 3PSBA 2QG5A 1VR2A 2XJ1A 3VW6A 2XM9A 4KBKA 3MH0A 4RLKA 4MHAA 3FZRA 5J79A 1OMWA 4FT0A 4HNIA 3RNIA 4EH4A 1U54A 3LJ2A 4GJ3A 4MWIA 3EHAA 3H9RA 4U40A 4JDIA 3RK5A 3R0TA 3F69A 5DI1A 1AQ1A 3DKGA 1WBOA 4YHFA 2IZSA 3KF4A 3UDBA 4PNKA 2VWYA 4O0TA 4PPBA 3QTQA 4RIWB 4RWLA 5TR6A 5CNNA 3UIXA 2B53A 2WMAA 4GRBA 2VX1A 4L3JA 5DPVA 4ZLZA 3IONA 4O0WA 3ALOA 1GJOA 5HNBA 1IG1A 4WA9A 1SM2A 1CKJA 4BZNA 4HCTA 4AW0A 1OPJA 2XYUA 3FMHA 5DIAA 2C1BA 5FP6A 3ZLXA 4C8BA 5IQHA 2Y9QA 3MB7A 2HELA 1YOMA 4QP6A 3G9LX 4MBIA 4XP2A 2IW9A 3PVUA 4QP3A 3EQRA 2JKOA 3VJOA 4F64A 2YZLA 2GNLA 3FLNC 4BCNA 4RT7A 4C2VA 5M51A 2GNHA 1XBAA 2PMNX 2ZJWA 3NNUA 3NZ0A 4JVGA 4FSMA 4E5WA 5CANA 2Z7SA 3W10A 4KBCA 3KEXA 4MBJA 4PQNA 4DFXE 5J1WA 3A7FA 3F66A 3SGCA 4XLIA 2UVZA 1YDTE 2UZVA 3SX9A 2QU6A 3KRJA 4AAAA 3UZTA 4ZMFA 4FEUA 3HMIA 5HOAA 3SV0A 5JFWA 4AU8A 3SVVA 3FQEA 2IN6A 4MQ1A 4OGRA 2P33A 3EQGA 4IX5A 3UE4A 3ITZA 3PVGA 3UIUA 4RJ5A 4GU9A 2P55A 4CYJA 4FNZA 2GU8A 4KKGA 5I9VA 5C8KA 1OKYA 4RIXB 1UU8A 1WBWA 4WNMA 5HORA 2WQMA 3N51A 4X2KA 5IH4A 4NL0A 2E2BA 2VTTA 2J0JA 3IGGA 4IC8A 4FL3A 4JIKA 3MTFA 4DT8A 5CAPA 2OGVA 5E4HA 2UW7A 4RRVA 4XJ0A 3VUTA 5M06A 3OEZA 4DGNA 2P4IA 4F0FA 3D0EA 4IBMA 3K2LA 3F61A 4GT4A 5DH3A 4AACA 4WKQA 3DTWA 4MD9E 2PVFA 3G0EA 1Q3WA 2RF9A 2WMQA 4E4LA 4FTQA 4BGGA 3LPBA 1RQQA 3FC1X 3EQIA 2X8DA 5M4CA 4AE6A 1PJKA 2PWLA 4FVQA 5H3QA 3ZRKA 4MCVA 5DEWA 2W17A 4L01A 4YPDA 2HWOA 4NM3A 2ZV8A 4EI4A 4F99A 4O7WA 3BYOA 1W8CA 2X9EA 4KS7A 3R8PA 2GNGA 1PF8A 3JR1A 5DNRA 3NUYA 2E9OA 2IZTA 3OBGA 3UQGA 3L9LA 4RFMA 4P5ZA 2PZPA 3NYVA 2DUVA 3KGAA 4Y73A 3MH3A 3REPA 4QTCA 2XK7A 2ERZE 3FHRA 3QTXA 4ZSGA 1BI7A 2QOOA 4MX9A 4O2PA 3WF5A 1FMOE 5CI7A 4O81A 3I5ZA 3DZQA 4BHZA 4D2VA 4NKSA 5C4KA 4Y83A 4CZUA 3O8TA 3Q9ZA 3QA8A 1XH4A 3LCSA 4FNXA 1FQ1B 4R7HA 3BIZA 3C4CA 4IAAA 3WARA 4DH3A 4ALVA 4E20A 5LCJA 4WT6A 1JLUE 2JKKA 4V01A 5CAUA 4V0GA 1O6LA 3DNDA 2J4ZA 4FV5A 3QGWA 4S32A 5HVYA 3EIDA 4RBLA 3TKIA 3VQHA 4PMMA 4AF3A 4Z55A 3SA0A 3QRIA 5HNGA 1ND4A 5HO6A 5H8GA 4BICA 2CKQA 1H26A 4FT9A 3ZDIA 2QQ7A 1PXKA 4B6LA 2C6OA 3MYGA 4QPAA 4BKZA 4W4VA 3LFBA 4AT3A 1OIUA 4QMTA 4IEBA 4FK3A 2WTWA 3W2RA 2G9XA 3SW4A 3VS2A 2OK1A 5D1JA 2VU3A 4YJSA 4UX9A 4RMZA 4JQ8A 5HKMA 4WD5A 3KULB 4G9RA 4OT6A 3TTIA 3WF6A 4FTUA 4QPMA 4ZXTA 2VO6A 3UTOA 1HOWA 2R7BA 5AP7A 2ZDTA 3SHEA 4U80A 1DAWA 4KKHA 3W32A 5BX0A 1PHKA 1PXPA 3AGMA 3QX2A 3R8UA 1M7QA 3MA6A 4IX3A 3RPOA 3EJ1A 2VTLA 4L46A 4F9WA 4YNEA 2B9FA 2FSTX 1JKLA 3EYGA 4RG0A 2O0UA 3UPXA 3CSVA 1PYXA 4Y5QA 4IJ9A 4PRJA 3RAHA 4CYIA 2WQOA 3BHVA 4GEOA 4I0RA 2OZAB 2W1IA 3UMXA 4ARKA 5JK3A 2JDRA 3OVVA 2ERKA 3WYYA 5CYIA 4CMOA 1PXNA 4WBOA 2X2KA 4ZY6A 4F1TA 2R0IA 4EBVA 4QMZA 4RIYB 1S9JA 1M52A 4J1RA 5A4LA 4M15A 2OXYA 3VBXA 2YHVA 3F7ZA 2ITWA 3PUPA 5J7HA 4GK4A 4FYNA 2A2AA 4DFUA 4BDDA 4WNPA 3ZSIA 1GOLA 5IA1A 1CDKA 5HU9A 4ZTLA 4RWJA 4RC2A 4ACCA 3RHXA 3F7WA 3RM6A 3FI2A 1DAYA 3NCGA 3RAWA 4V04A 3V8TA 4F70A 1I09A 3O2MA 4XX9A 4JS8A 4DHFA 3HRBA 2ETKA 5CEKA 1URCA 3ZUUA 4AGWA 4IB1A 4DH8A 2G2FA 3NSZA 5DT4A 4CT2A 1PXOA 4YMJA 5IUGA 2Y6OA 4G6OA 4BI1A 4FGBA 4D2TA 4D4VA 1BKXA 4JLCA 3LFCA 4XG6A 4CCBA 4YURA 4FK6A 2XJ2A 3EKNA 4PWNA 4TN6A 5EHLA 1ZOGA 5BUIA 4OTGA 5BYZA 4MBLA 2XK9A 3C51A 3FPMA 4EUTA 1Q5KA 3I0OA 2BRGA 4P5QA 3BU3A 4E5AX 2A4LA 1XO2B 3CPCA 1ATPE 1SVEA 2BFYA 3CEKA 2WTKB 4EWQA 4AA0A 4FX3A 4G5JA 3RJCA 1JNKA 2W9FB 1GZKA 2XKFA 3QTRA 4TNDA 3G15A 4UZDA 5HCYA 2GQSA 2RG6A 1YXVA 3HV7A 4LRJA 1SVGA 2BKZA 3O71A 4X21A 5J95A 2W4KA 3PXQA 4F7LA 3Q2JA 2JLDA 4FKSA 2EB2A 3E8NA 3GB2A 4UZHA 2QLUA 3ULIA 3IW5A 5JRQA 1J7LA 3HVCA 2C5NA 2HXQA 4LV5A 3QD2B 4UMTA 4O7SA 1KSWA 2BZJA 4YTHA 3RI1A 1H1PA 3CY3A 2VWZA 4RSSA 5JT2A 2O8YA 4GK3A 3RBWA 1UU7A 4F0GA 2PVKA 3K3JA 2DWBA 3IQ7A 2VTHA 1WBPA 4FV0A 4R7BA 3LXPA 4ZSJA 2H6DA 2XKDA 2EWAA 3W18A 2WTJA 3FQHA 4XHKB 3EKKA 2ACXA 4JX3A 3MDYA 5A3XA 3V5PA 4P2KA 4W8DA 4BDBA 4D0XA 2BKKA 4EQCA 2VO7A 4U9AA 5J1VA 2XEYA 5M53A 3OTUA 2IJMA 2RGPA 4EK5A 2W0JA 3DK3A 1JSTA 3O7LD 2IO6A 3EOCA 3R1SA 4X3JA 4ANLA 2RFSA 2ZMDA 2VTNA 1UNGA 3NVKI 4C4JA 1YDRE 4HVHA 4UMQA 4YSJA 5ETAA 2IW8A 4AZFA 3IPHA 4QMMA 3ZZWA 4DH7A 3UMWA 4BDAA 4E1ZA 1NVSA 3FLQA 1H01A 3DV3A 3SLSA 4E3CA 3I6UA 4LV8A 5JFVA 3LCKA 3QCXA 4C37A 4WG5A 5JH6A 3PWDA 4XUFA 4YSMA 3BGQA 4HNFA 5FEEA 4AN2A 3LXNA 3HL7A 3DKFA 4YZ9A 1OM1A 2CHLA 3GCUA 3TZMA 4WUAA 4KKEA 5DWRA 3F3ZA 3VUDA 2XYNA 5EI8A 5L6WL 4BYJA 4QQJA 3ZS5A 3L9MA 5FXRA 4C4IA 2WEVA 1PY5A 3QXPA 4IADA 3FWQA 3I7BA 2R3FA 4JRNA 2O65A 4MKCA 1ZMVA 4XCUA 4Y95A 5CSHA 4HVGA 5BYLA 5C27A 3UC3A 5A4EA 2Y8OA 2QI8A 4BDCA 4XMOA 2C30A 4E8AA 4TY1A 5ANIA 5HD4A 4AN3A 5ICPA 4ZLOA 1OL6A 3AMAA 1QPEA 2ETRA 5KZIA 3ORNA 4E7WA 2F2CB 3BRBA 5C8NA 4V05A 4BRXA 4DFBA 2BDFA 4IFGA 2W99B 1W84A 3OMVA 3V5JA 3WIKA 5CQUA 2PPQA 3H30A 4FE2A 2BFXA 5J9LA 5FBNC 3TDVA 4FIEA 3CGFA 1EH4A 3DY7A 2H96A 2B52A 2YM3A 4O7LA 3CC6A 4BR3A 3HP5A 4O96A 1YXUA 3Q6WA 4CV9A 3TUBA 5BVWA 2XH5A 3R7EA 3TL8A 4DG2E 4QMLA 5IA4A 3KA0A 3PA5A 5L3AA 2X2LA 3OCSA 4RX7A 3UOHA 2CDZA 3AT4A 2KTYA 4LL0A 4WIHA 3NR9A 4IWOA 3FMMA 3W8QA 3E3BX 2BZKB 3JY9A 1A06A 4ZS0A 4EJ7A 2YEXA 4IX4A 4DLIA 3R2YA 2OJIA 4LI5A 4FL1A 2JFMA 2C4GA 5E91A 4B4LA 1XBCA 1L8TA 4A9TA 4QYFA 4IZ7A 3V3VA 3PZHA 1O6YA 2GFCA 4G3GA 5DLSA 4EH2A 4PTGA 4UMUA 1H24A 2BZIB 4F09A 1WBSA 4Y8DA 3EQPA 3NAYA 3L8PA 2DQ7X 5D11A 5AUVA 2UW0A 4MWHA 2C6LA 1FOTA 3E5AA 5CVFA 1H08A 2JFLA 2UUEA 4C2WA 3QLGA 4FIIA 3SKCA 4HGSA 4ONAA 2WMRA 1FVRA 1BI8A 3P5KA 5EQYA 2PY3A 5BPYA 3P23A 4AQCA 3RK9A 4FTMA 2REIA 3HAVA 4R5SA 3F5GA 1XH6A 3QQLA 4AA5A 4CNHA 1W82A 4WSYA 4DYMA 5HTCA 2XVDA 1ZOHA 3LFEA 4BTMA 3Q6UA 2YIWA 1H8FA 1JQHA 4O7TA 3PDTA 4C3PA 1OUKA 4V0GB 1P2AA 3UNJA 4NWMA 2PVNA 3WILA 1GZNA 1OGUA 2JIIA 4DTKA 2CMWA 2O3PA 3QRJA 2QOBA 4NFMA 4S2ZA 4W4YA 5BVFA 1LR4A 3H9OA 4C4FA 1KUTA 1YRPA 3T9TA 2A0CX 2UZEA 2JBPA 3QD3A 3R7IA 4U3YA 4DEDA 1TKIA 4ANNA 4KD1A 3DPKA 3QWKA 2C6KA 3HNGA 4IANA 5HLNA 3OY3A 4YR8A 1IAJA 2YDIA 3ZDUA 2ONLC 5HE2A 5E8TA 2WOTA 4WHZA 3FQSA 4DEIA 3LCOA 2IG7A 5AAEA 4XRJA 2XS0A 3SXFA 2BRBA 2CKEA 2Y0AA 1GAGA 5M07A 2PUNA 3KCFA 2UV2A 3LZBA 3Q4TA 1DI9A 3C0HA 4EH7A 1TVOA 4M13A 5LXMA 3HMMA 4DA5A 4TYHA 3PSCA 2W1HA 4OTQA 4QRCA 3BZ3A 5KBQA 3POOA 3ZO2A 5DHJA 2J9MA 3BYUA 4OAUC 3OT8A 1YI4A 5AV3A 1YOLA 2J5FA 3JYAA 4WSQA 3LM0A 1MQBA 4RX5A 4ITJA 3OC1A 2W06A 4RC4A 5H8BA 3RZBA 3GBZA 5HIDA 3W1FA 1WVXA 3TI1A 5KZ0A 3VVHA 3MVHA 3UO5A 5HE1A 3R9RA 3RM7A 1PMVA 2JDTA 2VWBA 1NA7A 3COKA 1JWHA 4YHTA 4E26A 5LMKA 5GHVA 3TWJA 3V04A 4A9SA 5L2TA 1GIHA 2J51A 5LMBA 3U55A 4YZCA 4XEYA 4E6CA 2C6TA 4YZBA 5AV4A 4FKGA 5D41A 4OTHA 2VX3A 3G51A 3C13A 2WEIA 1Q8TA 1UWJA 2BR1A 4YJNA 4O0YA 4ANMA 3Q9YA 1R3CA 2XA4A 4IFCA 3VF9A 1KV1A 4AT5A 3Q52A 2EXCX 4X2JA 4LOPA 3NIEA 2JKQA 4JAJA 2A19B 5C01A 4NT4A 5J5SA 2PUIA 3F82A 3TIZA 4XLVA 1LP4A 4O91A 3E8CA 3ATTA 4GH2A 2PVLA 3FXZA 4HVIA 2OFUA 4GV1A 5EW3A 3FYJX 4UB7A 3FYKX 4LUDA 2PMIA 4PUZA 3D7TB 4B7TA 4EH9A 5IQDA 3D94A 2NRUA 2RL5A 3FKNA 4EHZA 2YCFA 3S00A 2PZIA 3OT3A 2IVVA 3DAKA 3P9JA 4ZTQA 2X8IA 4BBFA 4CEGA 1SVHA 5H8EA 3VUIA 4D58A 4EH6A 1A48A 4F65A 5TOZA 4HVSA 4GJ2A 3FEGA 3FKLA 4XV3A 2FSLX 2R2PA 4GIHA 4FG9A 2H34A 1Q8UA 3QYWA 2VGOA 2W1EA 4LGHA 2ITQA 4FZ7A 1U5RA 2DYLA 3U54A 2V5QA 3CJFA 4YHJA 3R7OA 3LAUA 2PVMA 3ZLYA 4CGAA 1E9HA 4C7TA 3A7IA 2UVXA 3P7AA 4IVAA 2W1CA 3Q5ZA 3AD4A 2YWPA 4Z7HA 4Y85A 3U9NA 3QFVA 4L9IA 4GVAA 2RFDA 3SD0A 1BYGA 1QCFA 2CNVA 3BPRA 3QGYA 4RGJA 4FIHA 4EK3A 1K2PA 4N4SA 3CXWA 3DQXA 4XBUA 1YQJA 3N4TA 3TV6A 4ZIMA 4EK4A 3HKOA 4DINA 3HAMA 2UZBA 5AX9A 2UZDA 4DC2A 3EFJA 2X4FA 2WMTA 4QYYA 2HZIA 3LFNA 5CNOA 3CKXA 5GIOE 4U45A 4YLKA 1MQ4A 2XF0A 3OXIA 3NEWA 4G9CA 2NO3A 4K6ZA 4YPSA 4LL5A 5IA5A 5CY3A 5C9CA 4A06A 5EKNA 3LQ3A 1MP8A 5T6KA 4B8MA 2UZNA 3MY0A 4LMNA 4Q5EA 1V0PA 1R78A 1ZWSA 1IAHA 4FT3A 4U3ZA 1FVVA 1PXMA 2PZRA 3FKOA 4ERWA 3F5XA 3HDMA 2JIUA 3AGLA 3BYVA 3NX8A 4N6YA 3TNIA 3W2QA 3L8SA 4ANQA 3UPZA 2XMYA 1APME 4OAVB 4ZTHA 2JC6A 2ZB1A 3HA8A 4QNAA 4LGDA 5IZFA 3TNWA 1HCLA 5K4IA 2WMSA 1NXKA 4EWHA 2J2IB 3AT3A 5IU2A 3ROCA 3W2PA 3AXWA 3G33A 3MBLA 4GFOA 5CZIA 1ZZLA 5EW8A 4GIIA 3ROYA 3ZEWA 3H3CA 3NUPA 1DM2A 5HESA 2WTIA 4OUCA 3W16A 4ZZOA 2HIWA 2WTKC 4FKIA 2C5OA 2VWIA 4ASEA 3U9CA 4F6WA 4PL4A 3KKVA 5A54A 2WPAA 2V7AA 2VTIA 2CKOA 5IQCA 3EQFA 4PF4A 1WAKA 3PIXA 3U6IA 1QPDA 1YWNA 4CRSA 4CLIA 4RA4A 4L00A 2YABA 4JBPA 3U87A 2Y4IB 3DB8A 2O5KA 4F1OA 3Q96A 3DBFA 4U79A 4QNYA 3OY1A 4HGLA 4A4OA 3Q04A 4LM5A 4OR5A 4D28A 1L3RE 5IQAA 1PKDA 4TNBA 5DOSA 4EOOA 3UVQA 2PYWA 2RSVA 3R30A 4K1BA 3QQFA 4DE4A 4EOIA 4MVFA 4O22A 5DRBA 3WZKA 3U4UA 2CSNA 2R3OA 2IVUA 3SG8A 4JXFA 3ETAA 5DRDA 3UP7A 3NCZA 4BZDA 4EYMA 4FZ6A 2F7XE 5JN2A 4QP8A 3E8EA 3LFAA 1IASA 3E63A 3FMDA 4AGCA 3ZMMA 3HEGA 3ZM4A 4J8NA 3WYXA 4BCIA 2X81A 1KE8A 3RVGA 1OBGA 2B55A 4QQCA 2QO9A 3BYSA 4F9CA 4APCA 1ZARA 2PU8A 1Q8WA 5JGAA 4C3FA 3VBYA 3LCTA 4I6HA 3BEGA 4FZFB 3OW4A 1JSVA 2QHNA 4PNIA 4D1XA 2JDOA 4OTDA 5AEPA 3ACJA 5JEBA 2B7AA 4MAOA 2ZM3A 2EUFB 3A2CA 4X7QA 4YP8A 4WRSA 4G16A 4HJOA 4K18A 5FQDC 2BROA 1Z5MA 3GCPA 4RJ8A 2I0HA 2J7TA 1HCKA 1VZOA 3FXWA 5HHWA 3QYZA 4GKHA 4Z16A 2PUPA 3T8OA 4D2PA 4O7ZA 2VNYA 2VTJA 5AWMA 1FVTA 2Z7QA 5D12A 1UNHA 3TKUA 4ACMA 3IW8A 3TZ9A 4C57A 3FLWA 4DFZE 4QYGA 2HYYA 1M14A 4O27B 1H1RA 4OTIA 4BDKA 4YO6A 3LFSA 5FXSA 5AX3A 1UU9A 3PVWA 3ORKA 2OJ9A 2X9FA 2OWBA 1NY3A 2RKUA 4XV1A 5CZHA 3QUDA 1YXSA 1FINA 4FF8A 5GZ9A 2Y6MA 5E7RA 3VIDA 1CM8A 1GIIA 3Q4UA 3TEIA 3NAXA 4Q9SA 2E9UA 4HPTE 5M4UA 3NWWA 1OL1A 3GU4A 5E90A 3SAYA 1M7NA 3C7QA 2P2HA 1OB3A 5FEDA 3PLAE 3EN6A 3SDJA 3CY2A 3MPTA 4YC3A 3VNTA 2B54A 2JBOA 2YAKA 4WRGA 2BAJA 1URWA 1YWVA 2QODA 5A6OA 2WAJA 3BELA 3DFCB 5BNJA 3T3UA 3ELJA 2X7OA 3ZU7A 4IAYA 3RHKA 2VTPA 2OI4X 3P86A 4RJ4A 2GMXA 3KXGA 3GI3A 4FKVA 4NW5A 3BYMA 3KXNA 1MRUA 5KKRB 2PK9A 1FPUA 3A99A 3PPZA 4GYIA 4BI2A 2E9PA 2X39A 1FMKA 4JR7A 2XK4A 3AC1A 4YTCA 5TKDA 4LOQA 4RWKA 3KCKA 4RWIA 1GZOA 3E64A 5JMSA 4CG8A 3QF9A 3R7GA 5GZ8A 4QMWA 2R3MA 3PG3A 3R9DA 5DVRA 2UW9A 3R9OA 3VS4A 3KMWA 4BCMA 4PL5A 3WZJA 4ACDA 3ID6C 3MH1A 2JAVA 3SC1A 3P79A 3R2BA 1Y8YA 4W8EA 1XH5A 3IW4A 4ZTMA 4D2WA 4DFLA 4I6BA 4JBQA 3WBLA 5AA9A 4XG2A 5EI2A 2PVHA 1X8BA 4TYJA 5ACBC 4AW1A 3HECA 3OWJA 5AM6A 5EHOA 5I5ZA 1Q62A 3GC0A 4PY1A 4KINA 5EM6A 5K4JA 3DCVA 3FE3A 3ZRLA 4EQUA 2C1AA 4BCQA 4CKRA 1V0OA 5EYDA 3ZM9A 2CGVA 1Q41A 1JSUA 3I79A 5E92A 1STCE 3QL8A 3VAPA 5TO8A 2BCJA 4D9UA 4AX8A 2W9ZB 4IACA 4TW9A 4Y46A 4GS6A 4F7SA 4J53A 1PMNA 1ZYJA 2VTAA 3BKBA 3NNXA 4FT5A 4XG3A 3OROA 1YHWA 5CS6A 3VUMA 5HVKA 3LJ0A 4LUEA 3BQRA 4O0XA 4U44A 4GVJA 5AR4A 3V5QA 3FLZA 3FZSA 3A60A 5DBXA 3U4WA 3D15A 2C6MA 3BLHA 4QYHA 5ANKA 5BVNA 4FSRA 3JS2A 3PVBA 4DEHA 2FYSA 1ZLTA 1RE8A 1V0BA 4RC3A 4CMTA 5EM7A 5JZNA 4PTEA 4EKKA 3HLLA 2ZM4A 3EFLA 4QTBA 5TF9A 1VJYA 2WKMA 4IB5A 2ITYA 3CCNA 4L52A 3G6GA 1OUYA 5AP3A 5EI6A 1H07A 5BMMA 5CU6A 4EJNA 5IUIA 4ZTSA 1VYWA 3NW7A 5FEQA 3MWUA 3LE6A 4CKIA 3NW5A 2F7EE 1JBPE 1UNLA 4IH8A 3SG9A 3I7CA 4TTHB 4F08A 3TCPA 3QTZA 3WI6A 2J6MA 3SXSA 3R71A 3ET7A 4QD6A 4EOMA 5KMNA 4PDSA 4FTOA 4ZEGA 4BDGA 1Z57A 3BCEA 4GCJA 2F49A 4UXLA 3R8LA 5CF6A 1KOBA 5ANOA 4NIFA 3QKLA 4ORKA 3LMHA 4AWIA 3H4JA 3C9WA 2GSFA 2RIOA 3FHIA 3QZFA 2R9SA 3I0QA 4DGOA 2Q83A 4IWQA 3MN3A 2OH0E 2JD5A 5JGBA 4UWCA 4RZWA 2C6IA 4JBVA 5FD2A 5EYMA 3QTSA 5HIBA 4M8TA 4BWXA 3RALA 5IEXA 2ZB0A 3R28A 4G2FA 4NH1A 5J87A 5HZNA 2GQGA 4N0SA 4YGAA 3K54A 2QVSE 4I20A 5E8VA 5IDPA 4F9YA 4YTIA 1ZZ2A 4I93A 4TL0A 5L2WA 3FZPA 2Z7RA 2XK3A 4L6QA 4NM5A 4G1WA 3R1QA 4AP7A 4CT1A 5CAVA 4CTBA 3OWPA 3FL4A 3PXYA 3QC4A 4KSPA 3TJCA 1TQIA 4ENXA 3ORXA 1XKKA 3I5NA 4JNWA 2PZYA 2ITVA 4UWBA 2V7OA 5DR2A 3KRXA 2I0YA 3OEFX 3ZBFA 4FNYA 1PMUA 4IAKA 4DGMA 4PMSA 3H9FA 1UKIA 3VS7A 3DK7A 4A4LA 2YDKA 1SNUA 3Q32A 4X6QC 5AAFA 4MNEB 2C6DA 3KK8A 4IQ6A 5F95A 1NW1A 4H3BA 4EZ7A 2DS1A 5D10A 4BTFA 4NW6A 2XRWA 3AC8A 2OFVA 4G5PA 4G6NA 5B0XA 4ZLYA 5KKRC 1ZYDA 3QALE 3W55A 3UQFA 5FTOA 3D9VA 4IJPA 3HP2A 2R3HA 2WELA 1UV5A 2W5AA 2QONA 4C58A 3P78A 1B38A 1OKVA 1JPAA 4P90A 5KHXA 3UOJA 2BTSA 2QOQA 5EM8A 3FMNA 4RFYA 3KC3A 3QAME 4BKYA 4X0MA 4BHNA 2XBJA 2ZV2A 4IVCA 3QD4A 3TV7A 4DEAA 4DGLC 4M14A 4NM0A 5DMZA 3FMJA 5EQEA 4OBOA 3RAIA 5DFPA 4FL2A 3O96A 2R7IA 4O7NA 4U7ZA 4YLLA 4MK0A 3HRFA 3PZEA 4LYNA 4YJUA 5J9ZA 2CKPA 2JEDA 5IQGA 2BTRA 5FTQA 5HI2A 3D2KA 2X7FA 3IDCA 1IEPA 4AGUA 2YJRA 1MRYA 2NRYA 5HE0A 4F9BA 3C4XA 3L8XA 3NYNA 4EH3A 5HQ0A 5CEMA 4DH1A 2WQEA 4RVTA 3FI4A 3ORMA 2JKMA 5CENA 5EW9A 5HGIA 2Q0NA 4RVLA 4D4YA 2KULA 3VS6A 3A7HA 3U6JA 2YWVA 3ODZX 4XV9A 4RZVA 5HO7A 3AC2A 2VWWA 4R78A 3ZUVA 3KB7A 5I3OA 3ZC5A 2PE1A 4R3CA 3Q4ZA 4ZJJA 4AFEA 5CI6A 4NFNA 1I44A 3L9NA 4J99A 2PULA 1QL6A 5E8UA 4I23A 4YJRA 3GVUA 3MB6A 4FV4A 5I9ZA 3DOGA 4NTSA 4YJVA 5AAGA 4QP4A 2VTQA 4A4XA 4FG7A 3PXRA 2QOCA 1H00A 1Q99A 3CQUA 3FC2A 3HX4A 4E73A 2VRXA 3CBLA 5A4TA 2C69A 5FLFA 4FUXA 2BRNA 3W33A 2AYPA 4Y72A 1PXJA 3V8SA 4FV9A 2CLXA 5GIPE 2WO6A 3OOMA 4UY9A 3MY5A 1F0QA 4NIFB 4YZNA 5AR3A 2ZVAA 4CZTA 4EHVA 4DGGA 3PJCA 3ZSHA 4HOKA 4ZJIA 5EM5A 3NIZA 4M68A 4KIQA 2CLQA 4JDJA 2J50A 3DLSA 4LMUA 5CQWA 5IA3A 5EKOA 1Y6BA 2C5XA 3FUPA 2QOKA 4RIOA 4ASXA 3KXMA 4FSYA 3UOKA 3TG1A 3JVRA 3LKMA 3A7GA 2YLFA 4M97A 4RJ6A 3V5LA 3MFTA 4AZTA 3QQJA 3FMEA 5E1SA 3OWKA 3FZOA 3Q4CA 3SW7A 4C33A 3NUNA 3WF8A 2CNUA 3WF7A 5A14A 1B39A 2WU7A 4BGHA 5ANGA 4F1MA 4IWDA 4BCKA 4K77A 1AD5A 2QKRA 3NS9A 4TYHB 1YDSE 3JPVA 4JI9A 3WF9A 4D1SA 2WOUA 2CGWA 2WTCA 5AP2A 5E8XA 2EB3A 3LLTA 3NDMA 5BUEA 5HG8A 5CSPA 4DN5A 1XR1A 2QLQA 2F2UA 4EHGA 2YJSA 5IA2A 4NK9A 1ZY4A 2W5HA 3ZBXA 2W1ZA 3MVMA 2J0KA 2OZOA 5JSMA 4RQKA 4FKLA 4YLJA 3VRZA 5LWNA 4FVPA 3GQLA 3DBDA 5KNJA 3E3PA 3TUCA 3CLYA 4FKRA 5H9BA 2QR8A 2HCKA 4JG8A 2UVYA 4U0IA 3HV5A 1H0VA 3K5VA 5CU4A 5A46A 4QTEA 5CAQA 4QP9A 3ZO1A 4TRLA 2FB8A 2Y4IC 2YA9A 3I6WA 4LOOA 4FSTA 3RMFA 3ZYAA 4M3QA 3WE4A 1FGKA 5M4IA 4D2SA 4C34A 4FEQA 5IQFA 2QOFA 3SOAA 1XH9A 3HYHA 1YOJA 4KA3A 4AG8A 4IB3A 3SXRA 4EOKA 5IPJA 1W7HA 3MVJA 3FBVA 2YM6A 4GSBA 3VC4A 3F2RA 4XV2A 2XIYA 2YFXA 3OD6X 5AP4A 3FZTA 4MD7E 2XNMA 2XNEA 3G90X 3ZO3A 4CQEA 4RIWA 4TWNA 1B6CB 1H4LA 1YVJA 4ENYA 3V5WA 1JKSA 4MXAA 4A9UA 3TT0A 4WO5A 3RWPA 2YIQA 3DGKA 2RFNA 4TT7A 4WG4A 3ZFYA 1WMKA 1YW2A 2C5VA 3KN5A 3LVPA 4M0ZA 5D7AA 5KCVA 3ENMA 2BVAA 5CF5A 4W4XA 3K3IA 4O0SA 4G3EA 5C03A 4C59A 2R4BA 4JQEA 4S33A 5GZAA 1PW2A 3QZGA 4EOSA 5IH6A 3DU8A 5CXHA 1K9AA 3II5A 4I22A 1H25A 1E1VA 3C4WA 5FDXA 3CE3A 3S0OA 2A27A 3H0ZA 5K0KA 2O2UA 3VS5A 3GCVA 4CMUA 4O82A 3PY3A 1XH7A 4ZP5A 2R3JA 4MXXA 3BLRA 3FJQE 3Q2MA 2YCQA 5A4QA 1IA9A 5HBJA 2Z8CA 3QHRA 4AOTA 3R73A 2HY81 3A4PA 4ZSAA 5F20A 4X2NA 5B2LA 4R5YA 4KB8A 2YERA 3PJ8A 5CX9A 1GZ8A 1W0XC 4J8MA 4M12A 3C5UA 2YCRA 2LAVA 4QMXA 2R3KA 3OZ6A 3MPAA 3KXZA 1WVYA 4DG3E 5JGDA 3NUAA 5I4NA 5AA8A 4JBOA 3IECA 4JAIA 3QD0A 3O8PA 4NUSA 5CEPA 5LQFA 2Z60A 4HYUA 5CEOA 3DAEA 3PXZA 3DBQA 1KOAA 1VYZA 3PWYA 3ATSA 2E9NA 3FSFA 5DT3A 2BILB 2OJJA 2HXLA 4X3FB 5AUUA 4WOVA 5I9XA 2X7GA 2UW3A 2GCDA 5F1ZA 4J52A 4XP0A 5KO1A 2CCIA 2CGUA 4N70A 4L67A 4K8AA 3B2TA 2F57A 4WUNA 2XNBA 3HV4A 2VX0A 4USDA 4C0TA 4O84A 2ITPA 1Q61A 4F6SA 4DITA 5IKWA 3TNHA 4OTWA 3Q53A 5AADA 2W4JA 3KVWA 4X2GA 2GNFA 3MA3A 3LIJA 5JKGA 5KMJA 4EQMA 4X3FA 3PE1A 2GNIA 2XNGA 4IAZA 3R8ZA 4HZRA 5DE2A 4U42A 2LGCA 3EQDA 2W5BA 4JG7A 4XOZA 3G5DA 3CIKA 4LG4A 4Q5HA 4TYGA 4AN9A 2YAAA 2XCKA 3ORPA 4EORA 2FGIA 3IGOA 1XH8A 4FGRA 4R7IA 2XIXA 5KMMA 2VWVA 4D5KA 3FDNA 3RCDA 5AP6A 5A9UA 3AC3A 1H1WA 4RX9A 2AUHA 3KVXA 4D1ZA 4PL3A 5ETFA 2R3IA 4O38A 4BCFA 3TJDA 1UA2A 3O23A 5FXQA 4PP7A 3F9NA 5AV0A 4EC9A 3NNVA 2CNQA 4WNKA 2OF4A 3PLSA 4FV3A 1U5QA 2EXMA 3P7CA 4RPVA 3VS0A 5EQPA 1BL7A 2G1TA 4YZMA 3OF0A 2OG8A 2WIHA 5CU2A 5CXZA 3AT2A 3NNWA 4I5MA 1U4DA 4MXCA 4ZTNA 4F7NA 4TXCA 3OP5A 2EXEA 3MFSA 1G5SA 3OHTA 2HW6A 4P7EA 3ZONA 2GNJA 3FMKA 4E5BA 2WU6A 4IAIA 4IZ5A 3R21A 3BWFA 1J1BA 5HTIA 4E4XA 1OL2A 4GU6A 3B2WA 3EN7A 1WZYA 4C4EA 3AQVA 1SMHA 4ANSA 3DB6A 2NNWB 4EOJA 4CSVA 4JIAA 2X6DA 4XRLA 4E6DA 4CG9A 4FODA 5FM2A 4GT5A 4O0VA 4G3CA 5EYKA 4BIBA 2OU7A 1OIYA 3QQKA 4I5CA 1NT2A 5AR2A 3VF8A 1XWSA 3BI6A 1CMKE 3GCQA 5IQEA 2QU5A 2B4SB 3ZCLA 1BLXA 5EDQA 3O50A 3TUDA 2VTSA 4MYGA 4IWPA 4PDPA 4RIYA 4BBMA 3GGFA 4E6AA 2W1FA 4YC8A 3DXQA 3GC8A 4KRDA 5JZJA 4ANOA 2XIZA 4EH5A 4GG7A 4BZOA 4C4HA 3ORTA 5I9YA 4EH8A 2RG5A 1REKA 1R0EA 2WMXA 5K3YA 3Q9XA 3WIGA 2UZWE 3ZH8A 2ESMA 3W8LA 1T45A 4I94A 4YUQA 3HMPA 3CTQA 3R8VA 5E8WA 4IAFA 1OITA 5CSWA 4QMQA 4FTCA 4GL9A 4L45A 4KUJA 2CCHA 3D4QA 2HY0A 3ORLA 4I92A 4MD8E 4RQVA 3VUGA 2BUJA 3HMNA 5HCZA 2BPMA 1UWHA 3RAKA 2WMWA 2QOIA 5DYJA 2QCSA 3O0GA 2O64A 1YWRA 3KRLA 2GHLA 4BL1A 4C3RA 1AGWA 2C3IB 2Z7LA 3UOLA 4BKJA 3PJ2A 2OO8X 5IISA 4YBJA 2PVJA 1P4FA 4FTIA 4KIOA 4IXPA 4PMPA 2Y7JA 2C3JA 2WNTA 2ZOQA 1XBBA 3MFRA 3NYOA 3VRYA 3ZSGA 4E4NA 2HZ0A 1Q24A 3FAAA 5LWMA 5M44A 2WMBA 3LFDA 3FMLA 4Z9LA 2UW5A 3EN5A 3CD8A 3V5TA 3PE2A 4J95A 2B9IA 2WB8A 5AUTA 3UJGA 2YCSA 3KMUA 4IDVA 5K5XA 5A6NA 1Q3DA 4L7FA 3BGPA 3M11A 3MJ1A 3VS1A 3S3IA 2Z02A 5DR6A 4BWPA 5HX8A 4USFA 3EQBA 4ALWA 2UW8A 3E87A 1CKPA 3F2AA 4FOCA 4M69A 3V6SA 3UYTA 3D7ZA 3MY1A 3DZOA 2WZJA 4QO9A 5E1EA 3DDQA 3LCDA 5KHWA 3W2OA 2R64A 4QP7A 3BWJA 4IZYA 4KNBA 5FUTA 4QMNA 2BHHA 3F2NA 3F3WA 3ACKA 3QCYA 4MQ2A 5DR9A 2YITA 3PG1A 5LMKC 3AC5A 3VUKA 3O51A 3D5XA 3EB0A 4M67A 3PSDA 4TWPA 3W2CA 5ITAA 2OIBA 4B8LA 3CQWA 4XS2A 4LRKA 5AV1A 3TZ7A 2QO7A 3K5UA 4FTKA 2FH9A 4LFIA 2GQRA 3BV2A 4ZJVA 4NSTA 4XNEA 4EK6A 1Y91A 2ZMCA 3R1YA 2CGXA 1Z9XA 2BDJA 4OTFA 2V62A 3GOKA 5E8ZA 4ZK5A 3GU7A 1A9UA 3W2SA 4YBKA 4R3RA 4AS0A 3QTWA 5TT7A 3MVLA 3RP9A 1G8SA 3AG9A 4GFGA 2O63A 4GUEA 4M7IA 3R00A 4X6RA 5CT0A 3DAJA 5KMLA 3IK3A 4U8ZA 2VTMA 4EKLA 2CN8A 3MI9A 1QPCA 4D9TA 2ETMA 5KBRA 3VW8A 4IMYA 2VGPA 4FKPA 5HBHA 3EWHA 4UYAA 4BTKA 3PP1A 4DF3A 3LXKA 2VTOA 1ZYSA 3BGZA 4MEDA 3P08A 4K2RA 4ZZMA 1OL5A 3S2PA 3F3UA 2H9VA 3OS3A 3M2WA 3OXZA 3ZEPA 3E8DA 1ZYCA 4Z3VA 5IDNA 4FVRA 4BDIA 4GT3A 2EVAA 4CCUA 4M0YA 5AP0A 3ZUTA 4AW2A 5M08A 4CLJA 3A8WA 1ZYLA 5I3RA 3DJ7A 3BHUA 3O7LB 2OJFE 2QO2A 3P0MA 5BQ0A 3LOKA 5E9EA 3PRFA 3DLZA 4HZSA 2FA2A 2PZ5A 3A61A 3OCTA 4GFMA 5CAOA 3DXPA 3MV5A 5D7VA 2QKWB 4BI0A 4DBXA 4H1MA 2PVYA 2P2IA 3LW0A 3QCQA 4I0SA 4CZYB 2C5YA 3QZIA 4QTAA 1U46A 2HK5A 4I6FA 3T3VA 2X2MA 1J7UA 3NGAA 4IC7A 1O6KA 3SRVB 5F4NA 1OI9A 5ACKA 2XKEA 3NRMA 3QKMA 3WZDA 3E93A 4K33A 4H36A 4DCEA 5C26A 3KU2A 5FDPA 2WQBA 3EFKA 4FTJA 1IR3A 2GS2A 2R5TA 2FVDA 3N9XA 4IDTA 4JJRA 4TYIA 4UMPA 5G1XA 4EOLA 3M1SA 3LLAA 3HMOA 1JOWB 4Y5HA 1Q8ZA 3EZVA 5HNIX 3MIYA 4U41A 5I0BA 5HVJA 4XP3A 3GU5A 4BGQA 1UU3A 5JFSA 3MS9A 3VN9A 3IS5A 4O86A 3QA0A 5EHYA 4HYHA 4GKIA 5LJJA 3WZEA 4Q9ZA 4PPAA 3CR0A 3QWJA 4BDJA 4C02A 1CKIA 3BHHA 4EOPA 1W83A 2IW6A 3RK7A 5AFVA 4U5JA 4BN1A 1KWPA 2YZAA 5CVHA 1RJBA 3V01A 3RGFA 3BE9A 3KN6A 3PRIA 4J96A 4NTTA 1WCCA 5F94A 5HE3A 3NYXA 3R7YA 4ACHA 4ITIA 4JX7A 5AV2A 1WFCA 3L9PA 4R1VA 1H27A 3VBWA 2OW3A 4QPSA
chains in the Genus database with same CATH superfamily
4PP9A 1J7IA 3AOXA 2PMOX 4FUYA 5IG1A 4RIXA 3A7JA 3NPCA 4HGEA 1ERKA 5T3QA 2UZLA 3R7VA 5BVDA 5K0XA 4I1ZA 4DBNA 3OUNB 3ZRMA 1OIQA 2PE0A 4QMVA 4QP2A 4I4FA 3TKHA 5IUHA 3UVPA 2BRMA 3DK6A 2OLCA 1ZY5A 3QX4A 3BU5A 3COIA 1YKRA 4I0TA 4H05A 3AMYA 3WOWA 5EH0A 3N4VA 2XKCA 5L2QA 1TQPA 2C47A 2IVTA 3I4BA 3TTJA 3QRUA 1F3MC 5BMSA 4FOBA 2I0EA 2V55A 3FZ1A 1OECA 3OG7A 1ZAOA 1R1WA 3OTVA 5AP1A 5CEIA 4USEA 3SRVA 4FZAB 1PYEA 2X0GA 3KRRA 5HD7A 5T68A 5HBEA 2VO0A 2X8EA 4BDHA 5BVKA 4XG9A 3UVRA 3QXOA 5LVOA 5GJDA 4NJDA 2ZYBA 2OBJA 2YM8A 3C4FA 3UODA 4PDOA 3F3TA 2JIVA 2IZUA 3BL9A 4CTCA 1LPUA 4S34A 4U6RA 3POZA 4C36A 1QPJA 1JKTA 2WXVA 1PXIA 4S31A 5AM7A 4RLLA 4BC6A 3IOKA 2YLEA 3M42A 4HCUA 4ZY5A 4XOYA 1TQMA 3BQCA 3ULZA 2X6EA 4BVUA 4EEVA 3VHKA 4AW5A 5ANDA 3TIYA 3VUHA 1U54B 3E62A 2C0IA 5JQ8A 2IWIA 5ANJA 3GEQA 3BHYA 3AKKA 4FEXA 3GNIB 1IA8A 3B8QA 3LM5A 4IM0A 4O1OA 3UC4A 3ZXZA 5CF8A 3UIBA 4DLJA 5CASA 3DBCA 2B9JA 3DDPA 5K5NA 3CPBA 2B1PA 3C5IA 4IW0A 4FKQA 5CT7A 3TNPC 5LARA 3RCJA 4OBPA 3QUEA 2IEWA 3EL8A 4FV6A 3TM0A 5AR8A 2UW4A 4QYEA 2XIKA 3IKAA 3G0FA 3QCSA 4O1PA 4FRFA 3CP9A 1BUHA 2I0VA 4ITHA 2F7ZE 2H8HA 4F6UA 3PJ1A 3S4QA 3W0RA 4KSQA 4GG5A 4OT5A 2R3QA 3U6HA 4X2FA 3VWAA 4ZMEA 5ETCA 4E4MA 3CKWA 3PFQA 3GQIA 4O7RA 4GYGA 3RPVA 1XQZA 2VAGA 5L8KA 1O9UA 4FKUA 2WMVA 3QTIA 4BIEA 4ERKA 2BRHA 3ERKA 3HV3A 4FBXA 3DBEA 4YJPA 4EOQA 3NFFB 3NUXA 2W1DA 2C3KA 3MH2A 2J5EA 2ITNA 2UW6A 3ANRA 3QRTA 4N57A 3HA6A 3ENHA 4QOXA 4EZ5A 3F5UA 4FV2A 3TN8A 4DHZA 3MESA 3OCGA 3GP0A 1W2DA 3OBJA 5IQBA 1YI6A 3F3VA 4U43A 4FIJA 3EZRA 3UBDA 3C0GA 3HRCA 1V1KA 2ITTA 3BEAA 4CFMA 3IW6A 3VHEA 1J3HA 3C1XA 4AZWA 4J97A 3UYSA 2UZTA 4KABA 5J7BA 4I41A 4AOJA 3PA4A 5JRSA 4GK2A 5FM3A 4QMOA 5G6VA 1MUOA 2J0MB 2JAMA 2GTNA 3ZO4A 5IEVA 1CSNA 3UZPA 2RFEA 2BALA 3GU6A 2XM8A 2XRUA 4C38A 4CD0A 4CXAA 3IDBA 4JG6A 1OL7A 4JRVA 4H58A 5D9HA 4G34A 4LQMA 2XANA 4QMUA 1WVWA 2BAQA 3R02A 2FSOX 3GC7A 4KWPA 1Q4LA 5IMXA 1LEWA 5M57A 4CFXA 2JDSA 2R3RA 1Q97A 2VTRA 4NYEA 3UGCA 1WBTA 3IW7A 4IM3A 5EFQA 1JAMA 2OF2A 3MJ2A 4I24A 3A4OX 3UIMA 5M56A 4QP1A 3FY0A 4FKOA 4BBEA 4I6QA 3R1NA 5BVOA 3FLSA 4BWKA 5GNKA 2PMLX 3Q3BA 4QT1A 5J5TA 1YXTA 5LVMA 1ZRZA 4IX6A 4C4GA 3NUSA 5HIEA 3DQWA 3IDPA 4QEBA 4CFNA 4EK8A 3PY1A 2PTKA 4UEUA 3UZRA 1OKWA 5GJFA 2BHEA 2ZV9A 4TPTA 3IO7A 4HCVA 4G3FA 3OWLA 2W4OA 3Q5IA 3FXXA 3GT8A 3VULA 3ZTXA 2FO0A 4CFVA 4ZSLA 2HAKA 3PXFA 4MTAA 5LMAA 3RPSA 3KXHA 2BDWA 4ZTRA 4L8MA 5C8MA 4ZSEA 2XJ0A 4JMQA 2R3PA 4I21A 4RVMA 2HW7A 4H1JA 5DG5A 1M2RA 1KE5A 1ZXEA 2G15A 2I1MA 2OZAA 4ASZA 4HYIA 4UYNA 3V6RA 3QKKA 5L8JA 4ACGA 2XUUA 5HO8A 4G3DA 2IPXA 3HUBA 4O6LA 3DXNA 3ZXTA 4RA5A 3P4KA 3R8MA 5LCKA 4DEEA 4I3ZA 2E9VA 5HCXA 1PRYA 3AD5A 1BL6A 2GPHA 5H2UA 1CTPE 4A7CA 1KE6A 4EHEA 5AUYA 4YTFA 4M66A 3S95A 1DS5A 3HGKA 4IIRA 4MNEA 2CN5A 4I5HA 5EOLA 2QOLA 5CU3A 4PTCA 3RKBA 4PDYA 4FICA 3LHJA 1FBNA 3LMIA 3E7OA 3Q60A 4L53A 4CFWA 4AXCA 3G2FA 3KY2A 5B7VA 3GUBA 3JUHA 4TKSA 3WE8A 4PV0A 4G6LA 5FTGA 4BCJA 4MF0A 3C4ZA 2ONLA 4OLIA 5AR5A 3ZC6A 4N6ZA 2AC3A 3VO3A 3E92A 3ZFXA 4B99A 4DH5A 2VNWA 1YHSA 3I60A 4CVAA 5EDRA 2XEZA 4L44A 3TZ8A 3DJ6A 3TNQB 1P14A 1P5EA 3COHA 4ANBA 2HZNA 3VS3A 5CU0A 3FY2A 2Q0BA 4AUAA 4II5A 2HWPA 2NP8A 3EH9A 5AIRA 5HLWA 4BTJA 1H28A 2UZUE 4QMYA 2GHMA 3BE2A 4W9WA 1S9IA 4O83A 3MPMA 3KMMA 4TZRA 4FIFA 3ZLSA 1YHVA 4ZZNA 4FTNA 4CKJA 2G2IA 3R63A 3GXLA 4BYIA 5LOHA 4IHPA 3C50A 3F88A 3QLFA 3QU0A 3R9HA 5L6OA 3PIYA 3QQGA 3VBTA 2R3NA 5GINE 3BX5A 1H1SA 1F5QA 2V0DA 5A4CA 3GFWA 3D14A 3UG1A 2YIRA 4YJTA 4HW7A 5FRIA 4M69B 2OJGA 3G9NA 5AUZA 2BZHB 3BLQA 3FLYA 3KQ7A 4NU1A 1WBVA 3EFWA 3ZFMA 3PA3A 1J91A 4A07A 1OPLA 3EQCA 2WTVA 4IZAA 4YNOA 5DA3A 5KMOA 5KX8A 5EYCA 1W2CA 2QC6A 4JR3A 4TYEA 3SOCA 4UBAA 4DFNA 1OPKA 1RDQE 3I81A 4HVDA 1H1QA 2QR7A 3AMBA 3VQUA 3RPRA 4KIKA 2I40A 2GDOA 1OZ1A 4EUUA 4JL9A 5AIKA 4AFJA 2ZM1A 1NVQA 2C0OA 3LXLA 3NW6A 3U8WA 3ZLWA 4R77A 4MXOA 3HV6A 4RX8A 4FTLA 3NMUF 5DT0A 4FSWA 2XK8A 3KF7A 2R3GA 4BCOA 1JVPP 4YJQA 4BY9E 1IRKA 4CRLA 5FBOA 4AXAA 4AZVA 2EU9A 4LGGA 1GY3A 4X3FC 4BB4A 4D4RA 4YO4A 2XK6A 2YDJA 5AP5A 4F7JA 2ITXA 1GNGA 4L7SA 2BAKA 2ITUA 3MSSA 2YN8A 3FV8A 3CGOA 4H39A 5FGKA 3CS9A 1PMEA 3DJ5A 1XHAA 3W0QA 4AQKA 2F9GA 3HDNA 4O2ZA 3N4UA 4AT4A 2XNOA 4FSNA 4JDHA 1GIJA 2GHGA 4RFZA 4LRMA 3PXKA 3P7BA 3R22A 4BCHA 5JFXA 1LEZA 4D4SA 3ML1A 2XZSA 1JKKA 4NJ3A 2AC5A 3CD3A 4DTAA 2VWXA 3PPJA 5LVNA 3MFUA 2J0IA 2GS7A 5DGZA 3RINA 1WBNA 4G17A 4FKTA 4AOIA 3EN4A 1LUFA 3FL5A 1ZMWA 4FV8A 4F63A 2YISA 4FA2A 3OFMA 1QMZA 3RPYA 3DFAA 3MTLA 1BX6A 3QZHA 3BV3A 2QOHA 4NZWB 2I7QA 3H10A 3KK9A 3ORIA 3D5UA 3Q9WA 4FR4A 2QNJA 3QQUA 4FC0A 3VBVA 4CFUA 3THBA 4L3PA 5L8LA 2VN9A 3GENA 4FSUA 4H3PA 3PP0A 5B2KA 1M17A 2PE2A 1VEBA 4KRCA 5IF1A 1REJA 2HOGA 2VWUA 3CQEA 4FV7A 5M55A 4YU2A 2WTDA 1Y6AA 4GMYA 3MIAA 3MW1A 4H3QA 3PIZA 1W98A 5ETIA 4BDFA 2G01A 3OW3A 3EYHA 4I5PA 4W9XA 4S30A 3R83A 4P4CA 5EDPA 3JXWA 4IM2A 4DDIA 3A8XA 2F4JA 4O6EA 4R1YA 3DTCA 4W4WA 4FEWA 4B0GA 4R6VA 4YC6A 3UO4A 3LQ5A 2PHKA 1OKZA 4CV8A 2B9HA 4K11A 3EQHA 4UMRA 3ODYX 5HG7A 3RNYA 5KMIA 3PYYA 3DKCA 5CALA 3IOPA 5AMNA 1E1XA 2YM5A 3EL7A 5HTBA 4AAYA 2FSMX 4OBQA 4ZAUA 3E88A 3KXXA 2JGZA 3C4EA 4JOAA 2IZRA 3MGYA 2WHBA 5LVLA 3UO6A 4IVDA 4DG0E 5M4FA 5CVGA 3S1HA 4MH7A 1K3AA 4WG3A 1OBDA 2QURA 4EC8A 3D7TA 2OXXA 2WMUA 3A62A 3LFFA 4J98A 3V51A 4EONA 1SYKA 5CTPA 5IMEA 4TWCA 1UKHA 3JVSA 3PPKA 3SQQA 4F0IA 4A9RA 4IB0A 4R8QA 4BJJA 2HZ4A 4DDGA 4J71A 1UVRA 2A1AB 3V8WA 4D0WA 1YXXA 3H0YA 3OOGA 3VJNA 3QC9A 4CFFA 5EK7A 4O7YA 2G2HA 4K9YA 4QQTA 4DCAA 4BCPA 5L4QA 4HYSA 4D5HA 5HLPA 4TWOA 2YIYA 2PSQA 4MXZA 4UXQA 3TXOA 2VUWA 1SZMA 4YJOA 5GJGA 3D5WA 3G6HA 4NCTC 1DI8A 3CJGA 2R3LA 4L3LA 3PTGA 5IEYA 2J90A 2XP2A 2C0TA 1KE7A 3AD6A 3F6XA 2WIPA 3O17A 3HUCA 5J9YA 3R7UA 5HG5A 3QBNA 4C35A 2WFYA 5EG3A 2W96B 5CSXA 4NKAA 4UV0A 1G8AA 3BHTA 3GFEA 4HGTA 4C62A 4DEGA 3R9NA 2HENA 4DFYA 2W05A 3UQCA 2NPQA 5CF4A 1J1CA 4XG4A 1U59A 3PJ3A 3EMGA 1KE9A 2C68A 2ZFYA 4FKJA 2B0QA 4FNWA 1BMKA 3JY0A 4RJ3A 2ZAZA 4OTPA 2ITOA 3U51A 3ZOSA 4B9DA 4BDEA 3UNKA 3NVMB 3R01A 5KMKA 4AGDA 4KIPA 4HPUE 3LMGA 4FSZA 3F5PA 2ZV7A 2JDVA 3D83A 3IG7A 3ZHPC 3COMA 4XH6A 4EYJA 4MNFA 5IA0A 4IE9A 4YZDA 4F9AA 1H0WA 4XG7A 4D2RA 2C3LA 3DNEA 4O0UA 1NVRA 3FPQA 3DKOA 2OKRA 3OCBA 3QTUA 2YM7A 3WZUA 5C1QB 5F9EA 5HG9A 2WQNA 1P4OA 3QRKA 2CJMA 4O21A 5KUPA 2UZOA 4FMQA 1Q8YA 4NEUA 2PL0A 4FYOA 4UALA 4FTRA 3I1AA 4DEBA 4I4EA 3L1SA 4L42A 3D2IA 2BIKB 2C6EA 2BMCA 3KULA 3NUUA 4R3PA 3UG2A 4ZS4A 5CWZA 5L6PA 2VO3A 2OICA 2XIRA 4FIGA 2YACA 4FKWA 3ZZEA 2QD9A 3FSKA 3ALNA 3BBWA 3UP2A 4ALUA 4QDVA 5M09A 4XG8A 4DHIB 4ASDA 3ANQA 4RJ7A 4MF1A 5CLPA 2WD1A 2Y4PA 5HU3A 2GFSA 2XCHA 5AJQA 5TE0A 4ZOGA 4Q2AA 4MXYA 3RZFA 2CPKE 2OIQA 3QUPA 4AZEA 5I9WA 4BIDA 4L68A 5ANEA 5AR7A 2V22A 1SNXA 2BIYA 4FG8A 4NM7A 4QMSA 4UWYA 4CQGA 1PKGA 5L2SA 3OUKA 4FSQA 1R0PA 2PVRA 5KE0A 4EZ3A 5E8YA 5AUWA 5IQIA 5AUXA 5JQ5A 5LVPA 5I9UA 4APPA 2IVSA 3D5VA 3TV4A 3GU8A 2X4ZA 2VZ6A 3HZTA 4BF2A 2PUUA 3CTHA 4JQ7A 1KV2A 4PX6A 3GOPA 3NLBA 1RW8A 5HX6A 2W7XA 3DA6A 5FP5A 4D55A 2SRCA 4ZY4A 2YIXA 1Y57A 1ZOEA 4L43A 4AA4A 4JT3A 3UNZA 2XBAA 4Z7GA 3O8UA 4C61A 4QTDA 4U81A 2QG7A 4FI1A 4UN0C 4BFMA 3LFQA 4KS8A 4FZDB 4NCTA 2ITZA 5BVEA 5FWKK 3TDWA 4AE9A 2JITA 3BU6A 4GW8A 2ZDUA 4KAOA 2VD5A 3LJ1A 3ORZA 4IVBA 3T9IA 2XAMA 3PY0A 4F78A 3KL8A 5HICA 3BBTB 5L2IA 3KFAA 4XBRA 3B8RA 4J7BA 3CTJA 1PXLA 4WNOA 2W1GA 1FGIA 4K0YA 1MRVA 4JDKA 4KBAA 2WGJA 4QQ5A 5EOBA 4A9YA 3DT1A 4XYFA 4WBBB 3E7VA 4FTAA 4BCGA 2P0CA 4FTTA 5CSVA 2Z2WA 3GC9A 3QHWA 4FV1A 4U97A 5DEYA 5IH5A 2GTMA 3KRWA 5E8SA 5BUJA 4E93A 2OXDA 4EBWA 4EL9A 3R6XA 4G31A 2J0LA 2X1NA 3C0IA 4FEVA 2QHMA 5FG8A 5K9IA 3R04A 5C4LA 3LQ8A 3FI3A 1OIRA 2OIDA 3P1AA 3OXTA 2VV9A 4O7VA 1ZMUA 2R0UA 1R39A 2P3GX 4O0RA 4OW8A 3EN9A 2XNPA 4GUBA 2I6LA 4ID7A 4PPCA 1OVEA 3GCSA 3RWQA 4DAWA 1M2QA 2FUMA 1Y8GA 4OTRA 4KIKB 3DS6A 5B2MA 4FJVA 1XJDA 3TACA 3KREA 2YM4A 4F4PA 4QMPA 5HEZA 1G3NA 3QQHA 4E6QA 4DTBA 4PMTA 2GS6A 4FT7A 1G8JA 3FI8A 5BYYA 2XNNA 2XB7A 1M2PA 5DN3A 5J8IA 5CEQA 4DT9A 1YI3A 2OH4A 3AC4A 4RVKA 4M84A 3L8VA 3RTPA 1T46A 2OSCA 3VBQA 4AZSA 3PSBA 2QG5A 1VR2A 2XJ1A 3VW6A 2XM9A 4KBKA 3MH0A 4RLKA 4MHAA 3FZRA 3W0SA 5J79A 1OMWA 4FT0A 4HNIA 3RNIA 4EH4A 1U54A 3LJ2A 4GJ3A 4MWIA 3EHAA 3H9RA 4U40A 4JDIA 3RK5A 3UDZA 3R0TA 3F69A 5DI1A 1AQ1A 3DKGA 1WBOA 4YHFA 2IZSA 3KF4A 3UDBA 4PNKA 2VWYA 4O0TA 4PPBA 3QTQA 4RIWB 4RWLA 5TR6A 5CNNA 3UIXA 2B53A 2WMAA 4GRBA 2VX1A 4L3JA 5DPVA 4ZLZA 3IONA 3UDTA 4O0WA 3ALOA 1GJOA 5HNBA 1IG1A 4WA9A 1SM2A 1CKJA 4BZNA 4HCTA 4AW0A 1OPJA 2XYUA 3FMHA 5DIAA 2C1BA 5FP6A 3ZLXA 4C8BA 5IQHA 2Y9QA 3MB7A 2HELA 1YOMA 4QP6A 3G9LX 4MBIA 4XP2A 2IW9A 2X0QA 3PVUA 4QP3A 3EQRA 2JKOA 3VJOA 4F64A 2YZLA 2GNLA 3FLNC 4BCNA 4RT7A 4C2VA 5M51A 2GNHA 1XBAA 2PMNX 2ZJWA 3NNUA 3NZ0A 4JVGA 4FSMA 4E5WA 5CANA 2Z7SA 3W10A 4KBCA 3KEXA 4MBJA 4PQNA 4DFXE 5J1WA 3A7FA 3F66A 3SGCA 4XLIA 2UVZA 1YDTE 2UZVA 3SX9A 2QU6A 3KRJA 4AAAA 3UZTA 4ZMFA 4FEUA 3HMIA 5HOAA 3SV0A 5JFWA 4AU8A 3SVVA 3FQEA 2IN6A 4MQ1A 4OGRA 2P33A 3EQGA 4IX5A 3UE4A 3ITZA 3PVGA 3UIUA 4RJ5A 4GU9A 2P55A 4CYJA 4FNZA 2GU8A 4KKGA 5I9VA 5C8KA 1OKYA 4RIXB 1UU8A 1WBWA 4WNMA 5HORA 2WQMA 3N51A 4X2KA 5IH4A 4NL0A 2E2BA 2VTTA 2J0JA 3IGGA 4IC8A 4FL3A 4JIKA 3MTFA 4DT8A 5CAPA 2OGVA 5E4HA 2UW7A 4RRVA 4XJ0A 3VUTA 5M06A 3OEZA 4DGNA 2P4IA 4F0FA 3D0EA 4IBMA 3K2LA 3F61A 4GT4A 5DH3A 4AACA 4WKQA 3DTWA 4MD9E 2PVFA 3G0EA 1Q3WA 2RF9A 2WMQA 4E4LA 4FTQA 4BGGA 3LPBA 1RQQA 3FC1X 3EQIA 2X8DA 5M4CA 4AE6A 1PJKA 2PWLA 4FVQA 5H3QA 3ZRKA 4MCVA 5DEWA 2W17A 4L01A 4YPDA 2HWOA 4NM3A 2ZV8A 4EI4A 4F99A 4O7WA 3BYOA 1W8CA 2X9EA 4LDTA 4KS7A 3R8PA 2GNGA 1PF8A 3JR1A 5DNRA 3NUYA 2E9OA 2IZTA 3OBGA 3UQGA 3L9LA 4RFMA 4P5ZA 3KIOC 2PZPA 3NYVA 2DUVA 3KGAA 4Y73A 3MH3A 3REPA 4QTCA 2XK7A 2ERZE 3FHRA 3QTXA 4ZSGA 1BI7A 2QOOA 4MX9A 4O2PA 3WF5A 1FMOE 5CI7A 4O81A 3I5ZA 3DZQA 4BHZA 4D2VA 4NKSA 5C4KA 4Y83A 4CZUA 3O8TA 3Q9ZA 3QA8A 1XH4A 3LCSA 4FNXA 1FQ1B 4R7HA 3BIZA 3C4CA 4IAAA 3WARA 4DH3A 4ALVA 4E20A 5LCJA 4WT6A 1JLUE 2JKKA 4V01A 5CAUA 3W0PA 4V0GA 1O6LA 3DNDA 2J4ZA 4FV5A 3QGWA 4S32A 5HVYA 3EIDA 4RBLA 3TKIA 3VQHA 4PMMA 4AF3A 4Z55A 3SA0A 3QRIA 5HNGA 1ND4A 5HO6A 5H8GA 4BICA 2CKQA 1H26A 4FT9A 3ZDIA 2QQ7A 1PXKA 2AEGA 4B6LA 2C6OA 3MYGA 4QPAA 4BKZA 4W4VA 3LFBA 4AT3A 1OIUA 4QMTA 4IEBA 4FK3A 2WTWA 3W2RA 2G9XA 3SW4A 3VS2A 2OK1A 5D1JA 2VU3A 4YJSA 4UX9A 4RMZA 4JQ8A 5HKMA 4WD5A 3KULB 4G9RA 4OT6A 3TTIA 3WF6A 4FTUA 4QPMA 4ZXTA 2VO6A 3UTOA 1HOWA 2R7BA 5AP7A 2ZDTA 3SHEA 4U80A 1DAWA 4KKHA 3W32A 5BX0A 1PHKA 1PXPA 3AGMA 3QX2A 3R8UA 1M7QA 3MA6A 4IX3A 3RPOA 3EJ1A 2VTLA 4L46A 2AQXA 4F9WA 4YNEA 2B9FA 3EYGA 2FSTX 1JKLA 4RG0A 2O0UA 3UPXA 3CSVA 1PYXA 4Y5QA 4IJ9A 4PRJA 3RAHA 4CYIA 2WQOA 3BHVA 4GEOA 4I0RA 2XAOA 2OZAB 2W1IA 3UMXA 4ARKA 5JK3A 2JDRA 3OVVA 2ERKA 3WYYA 5CYIA 4CMOA 1PXNA 4WBOA 2X2KA 4ZY6A 4F1TA 2R0IA 4EBVA 4QMZA 4RIYB 1S9JA 1M52A 4J1RA 5A4LA 4M15A 2OXYA 3VBXA 2YHVA 3F7ZA 2ITWA 3PUPA 5J7HA 4GK4A 4FYNA 2A2AA 4DFUA 4BDDA 4WNPA 3ZSIA 1GOLA 5IA1A 1CDKA 5HU9A 4ZTLA 4RWJA 4RC2A 4ACCA 3RHXA 3F7WA 3RM6A 3FI2A 1DAYA 3NCGA 3RAWA 4V04A 3V8TA 4F70A 1I09A 3O2MA 4XX9A 4JS8A 4DHFA 3HRBA 2ETKA 5CEKA 1URCA 3ZUUA 4AGWA 4IB1A 4DH8A 2G2FA 3NSZA 5DT4A 4CT2A 1PXOA 4YMJA 5IUGA 2Y6OA 4G6OA 4BI1A 4FGBA 4D2TA 4D4VA 1BKXA 4JLCA 3LFCA 4XG6A 4CCBA 4YURA 4FK6A 2XJ2A 3EKNA 4PWNA 4TN6A 5EHLA 1ZOGA 5BUIA 4OTGA 5BYZA 4MBLA 2XK9A 3C51A 3FPMA 4EUTA 1Q5KA 3I0OA 2BRGA 4P5QA 3BU3A 4E5AX 2A4LA 1XO2B 3CPCA 1ATPE 1SVEA 2BFYA 3CEKA 2WTKB 4EWQA 1ST4A 4AA0A 4FX3A 4G5JA 3RJCA 1JNKA 2W9FB 1GZKA 2XKFA 3QTRA 4TNDA 3G15A 4UZDA 5HCYA 2GQSA 2RG6A 1YXVA 3HV7A 4LRJA 1SVGA 2BKZA 3O71A 4X21A 5J95A 2W4KA 3PXQA 4F7LA 3Q2JA 2JLDA 4FKSA 2EB2A 3E8NA 3GB2A 4UZHA 2QLUA 3ULIA 3IW5A 5JRQA 1J7LA 3HVCA 2C5NA 2HXQA 4LV5A 3QD2B 4UMTA 4O7SA 1KSWA 2BZJA 4YTHA 3RI1A 1H1PA 3CY3A 2VWZA 4RSSA 5JT2A 1TFFA 2O8YA 4GK3A 3RBWA 1UU7A 4F0GA 2PVKA 3K3JA 2DWBA 3IQ7A 2VTHA 1WBPA 4FV0A 4R7BA 3LXPA 4ZSJA 2H6DA 2XKDA 2EWAA 3W18A 2WTJA 3FQHA 4XHKB 3EKKA 2ACXA 4JX3A 3MDYA 5A3XA 3V5PA 4P2KA 4W8DA 4BDBA 4D0XA 2BKKA 4EQCA 2VO7A 4U9AA 5J1VA 2XEYA 5M53A 3OTUA 2IJMA 2RGPA 4EK5A 2W0JA 3DK3A 1JSTA 3O7LD 2IO6A 3EOCA 3R1SA 4X3JA 4ANLA 2RFSA 2ZMDA 2VTNA 1UNGA 3NVKI 4C4JA 1YDRE 4HVHA 4UMQA 4YSJA 5ETAA 2IW8A 4AZFA 3IPHA 4QMMA 3ZZWA 4DH7A 4MUQA 3UMWA 4BDAA 4E1ZA 1NVSA 3FLQA 1H01A 3DV3A 3SLSA 4E3CA 3I6UA 4LV8A 5JFVA 3LCKA 3QCXA 4C37A 4WG5A 5JH6A 3PWDA 4XUFA 4YSMA 3BGQA 4HNFA 5FEEA 4AN2A 3LXNA 3HL7A 3DKFA 4YZ9A 1OM1A 2CHLA 3GCUA 3TZMA 4WUAA 4KKEA 5DWRA 3F3ZA 3VUDA 2XYNA 5EI8A 5L6WL 4BYJA 4QQJA 3ZS5A 3L9MA 5FXRA 4C4IA 2WEVA 1PY5A 3QXPA 4IADA 3FWQA 3I7BA 2R3FA 4JRNA 2O65A 4MKCA 1ZMVA 4XCUA 4Y95A 5CSHA 4HVGA 5BYLA 5C27A 3UC3A 5A4EA 2Y8OA 2QI8A 4BDCA 4XMOA 2C30A 4E8AA 4TY1A 5ANIA 5HD4A 4AN3A 5ICPA 4ZLOA 1OL6A 3AMAA 1QPEA 2ETRA 5KZIA 3ORNA 4E7WA 2F2CB 3BRBA 5C8NA 4V05A 4BRXA 1OGYA 2BDFA 4DFBA 4IFGA 2W99B 1W84A 3OMVA 3V5JA 3WIKA 5CQUA 2PPQA 3H30A 4FE2A 2BFXA 5J9LA 5FBNC 3TDVA 4FIEA 3CGFA 1EH4A 3DY7A 2H96A 2B52A 2YM3A 4O7LA 3CC6A 4BR3A 1W2FA 3HP5A 4O96A 1YXUA 3Q6WA 4CV9A 3TUBA 5BVWA 2XH5A 3R7EA 3TL8A 4DG2E 4QMLA 5IA4A 3KA0A 3PA5A 5L3AA 2X2LA 3OCSA 4RX7A 3UOHA 2CDZA 3AT4A 2KTYA 4LL0A 4WIHA 3NR9A 4IWOA 3FMMA 3W8QA 3E3BX 2BZKB 3JY9A 1A06A 4ZS0A 4EJ7A 2YEXA 4IX4A 4DLIA 3R2YA 2OJIA 4LI5A 4FL1A 2JFMA 2C4GA 5E91A 4B4LA 1XBCA 1L8TA 4A9TA 4QYFA 4IZ7A 3V3VA 3PZHA 1O6YA 2GFCA 4G3GA 5DLSA 4EH2A 4PTGA 4UMUA 1H24A 2BZIB 4F09A 1WBSA 4Y8DA 3EQPA 3NAYA 3L8PA 2DQ7X 5D11A 5AUVA 2UW0A 4MWHA 2C6LA 1FOTA 3E5AA 5CVFA 1H08A 2JFLA 2UUEA 4C2WA 3QLGA 4FIIA 3SKCA 4HGSA 4ONAA 2WMRA 1FVRA 1BI8A 3P5KA 5EQYA 2PY3A 5BPYA 3P23A 4AQCA 4AXEA 3RK9A 4FTMA 2REIA 2IF8A 4R5SA 3HAVA 3F5GA 1XH6A 3QQLA 4AA5A 4CNHA 1W82A 4WSYA 4DYMA 5HTCA 2XVDA 1ZOHA 3LFEA 4BTMA 3Q6UA 2YIWA 1H8FA 1JQHA 3O5AA 4O7TA 3PDTA 4C3PA 1OUKA 4V0GB 3BLAA 1P2AA 3UNJA 4NWMA 2PVNA 3WILA 1GZNA 1OGUA 2JIIA 4DTKA 2CMWA 2O3PA 3QRJA 2QOBA 4NFMA