3BZ5A

Functional domain of inlj from listeria monocytogenes includes a cysteine ladder
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
450
structure length
450
Chain Sequence
TLKAGQTQSFNDWFPDDNFASEVAAAFEMQATDTISEEQLATLTSLDCHNSSITDMTGIEKLTGLTKLICTSNNITTLDLSQNTNLTYLACDSNKLTNLDVTPLTKLTYLNCDTNKLTKLDVSQNPLLTYLNCARNTLTEIDVSHNTQLTELDCHLNKKITKLDVTPQTQLTTLDCSFNKITELDVSQNKLLNRLNCDTNNITKLDLNQNIQLTFLDCSSNKLTEIDVTPLTQLTYFDCSVNPLTELDVSTLSKLTTLHCIQTDLLEIDLTHNTQLIYFQAEGCRKIKELDVTHNTQLYLLDCQAAGITELDLSQNPKLVYLYLNNTELTELDVSHNTKLKSLSCVNAHIQDFSSVGKIPALNNNFEAEGQTITMPKETLTNNSLTIAVSPDLLDQFGNPMNIEPGDGGVYDQATNTITWENLSTDNPAVTYTFTSENGAIVGTVTTPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and standardized geometric analysis of InlJ, a listerial virulence factor and leucine-rich repeat protein with a novel cysteine ladder.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell adhesion
molecule keywords Internalin-J
total genus 147
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bz5A02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3bz5A01
4BV4R 2Z7XB 4Z79A 4ECNA 1PGVA 4ECOA 4R6AA 3BZ5A 1KOHA 3E2JA 1M9LA 4YEBB 3E4GA 2V9SA 4C2AB 5GMGA 2FT3A 3G06A 4NKGA 4M7EC 4CILA 4GT6A 3OGMB 4ARRA 5AWCA 1O6VA 2O6QA 4U7LA 4XGOA 2Z62A 5IYXC 5AWDA 5IJCA 5LFNA 3O53A 4UFRA 2Y5QA 5AZ5A 4R6JA 3M18A 2Q4GW 2P1QB 2XWTC 4FDWA 4G8AA 3UL7A 4H09A 4Z64C 5GMHA 1XWDC 1O6SA 1FQVA 3G3BA 4GLPA 4R6FA 3FAWA 4Z8GA 1QYYA 1KOOA 2RR6A 2JQDA 3ULUA 3RIZA 5IJBA 4KXFB 2XOTA 4RCWA 3VQ2A 3JB9j 1NM4A 4XSQA 3G3AA 4QXEA 2WQUA 4WP6A 1M42A 2A0ZA 4V2CA 5GQRK 3WPBA 4P8SA 1OZNA 3E3ZA 3O6NA 4WYKA 4PERA 3OJAA 4L3AA 4BSSA 3RGZA 1FS2A 4EZGA 2WQVA 1ZIWA 2Z64A 4LSCA 3OJAB 4J4LA 3KJ4A 3ULVA 2V70A 4FS7A 2V9TB 1OTNA 3CIYA 5CMPA 1XECA 4MN8B 3W3NA 2Z81A 3OGLB 2C9QA 5B0NA 2R9UA 3RW6A 5B4PA 2ASTB 4R09A 1DS9A 4PSJA 4AY9X 3RFJA 1OTMA 4LXSA 1U0ND 3C6NB 3G39A 4BSRA 4C2BB 2WQWA 1M10B 2C9RA 1P9AG 3FXIA 4NKHA 2OMVA 1OGQA 2P1NB 2OMWA 1M0ZA 2WQXA 4QBZA 4HQ1A 4L3FA 4PEQB 1W8AA 4IM6A 1D0BA 2P1PB 3P72A 4Q3IA 3RW7A 1WWLA 2CA6A 2JE0A 3ULAA 2O6SA 3WPIA 4K17A 4KT1A 3BCDA 4U08A 4R08A 3BC9A 2IFGA 3DZEA 2YA1A 2Z63A 4U06A 2O6RA 3WPFA 3REZA 3UN9A 3ZYIA 1FO1A 4Z94G 5B0TA 2OMYA 4FMZA 4CNMA 4LI1A 3WPHA 2ID5A 5AWAA 5ICUA 2Z82A 3CIGA 3W3MA 4Y61B 4Q3GA 5FTTB 2OMZA 3WN4A 4R07A 1DCEA 1XKUA 4U09A 4V2EA 3UL8A 2RA8A 4B8CD 5HZLB 1O6TA 4FD0A 3W3JA 3BCFA 5IJDA 1M9SA 4R0AA 1G9UA 2ASSB 3WPDA 4I6JB 3PMHG 1DFJI 5A5CA 5HDHA 3RGXA 3VQ1A 1SQ0B 3C6PB 4V2DA 4PKIG 1LTXA 3A79B 3WPGA 3RFEA 1XEUA 4R58A 4M7EA 2Z66A 2Z7XA 1GWBA 3C6OB 4CC4A 4TZHA 4CNCA 1IO0A 3GOZA 4LSXC 5AWBA 4AQ1A 2P1OB 4QC0A 1Z7XW 1A9NA 4LSAA 4LXRA 3WPEA 4RWTC 4CP6A 2C9PA 3E6JA 3M19A 4LI2A 3ZYOA 5GS0A 3WPCA 2OMTA 3OGKB 3CVRA 1JL5A 1OTOA 2JE1A 4MQWX 4XOSA 2UZXA 2Z65A 4ARNA 1XCDA 2OMUA 1YRGA 1OT4A 4OQTA 1K5DC 4FCGA 4AW4A 4PQ8A 2ELLA 4FHOA 4R6GA 2RA1A 1K5GC 2BNHA 5GMFA 3ZYJA 3FAXA 1H6UA 1LYQA 2OMXA 4Z61C 2WFHA 4RCAB 1FT8A 4R5CA 3G04C 4BSUA 2BEXA 3W3LA 3W3KA 4P91A 1H6TA 1P8VA 1P8TA 2UZYA 3RJ0A 1IX2A 4J0MA 3W3GA 5D3IA 1A4YA 3SB4A 4R5DA 4CC4C 5CMNA 1OOKG 3TSRE 3UL9A 4LSXA 5GS2B 4KNGA 3RFSA 2P1MB 4Q62A 3ZYNA
chains in the Genus database with same CATH superfamily
4HFUH 1DQML 3QJQB 1OK0A 1A8JH 3BVDB 3NABH 2XHNA 5GSVA 1NCDH 2A9NH 3KWWA 5DEJA 5GMGA 4WJ5B 2Y1AA 5C08D 2PW2A 4MQTB 1BVZA 3F58H 3TVMC 1XF4A 2CHZA 2YOCA 1IM3A 1RXLA 3M1BA 4YUEL 3G6DL 3KM1A 1SHMA 1JXFA 4FQJL 3EYUL 2ZT9C 4R6FA 1KTRL 3FXIC 3ULVH 2Y7NA 2ZCKL 3DWTA 5JOFB 2XOTA 1CGYA 3RVXC 2P48B 5ES4B 3JB9j 3OSVA 4J3OF 3VFOA 4OV5B 2PXYA 3Q2LA 2YXWA 4AVIA 5DTFA 5JPNA 1S78C 4FQXB 1J0YA 3NP3A 3MNWB 1ZHKB 4RETB 1OTTD 4WTZG 4GRWB 1XGPA 2HJKA 1RJZB 2EH8L 4M7ZB 4ZFZB 1D5MA 1YEIH 1V55B 1P5VB 2BXZA 3LKNA 2CUIA 2XIDA 1Z3GL 4HPOL 2DQUH 1E4JA 4S1QL 2A9ML 1KJ2A 5FYLL 1PG7X 1SHWA 3RGVC 3KG5A 1QHOA 5T1LA 4PRAA 3CAFA 4B53A 2KS0A 5DRZB 1CLOL 1WICA 2YA1A 3JYBA 1B4JH 1U8PA 5DUMH 3NJXA 1ZCRA 2UZYB 1NCCH 4FFZH 1URLA 2PR4L 4L8SA 5EN3A 4U1LB 4DF9A 4ETQB 4R84A 5HYEA 1FG9C 1RVFH 3EGDB 4WI8A 4JFWA 4IOFD 4E42A 3DDGA 4I2XE 1B0GB 5DMGD 3ESOA 2H2SD 3KH4A 4UT7H 2Y69B 5I1GL 4U6HB 1FE8H 4XPBH 1AQ8A 3E8UL 4TZHA 3CLEH 3ZHNA 2AJ3B 3R0MA 1H8SA 4LSTH 1M6OA 3LS4H 3BLBA 3QG7H 3WE1A 4N2GA 4NUJB 3T3MF 4F7EA 3AGWA 1SEBB 2OP4L 4R58A 2HTLD 4LSRL 3D39A 3GOZA 2A2QT 4N2KA 5J13B 3FQUA 2OMTA 3DSNA 2QZQA 5ID0A 4U1HB 5D1ZC 1ZHNB 5IR1A 1MZZA 1SQ2N 2HRPL 1Y6MR 3BVXA 4OFQA 2VO5A 3JV6B 4HKBB 4KH2A 3FN0L 4PUBL 4QRTA 4U1JA 2FGZA 1IBGL 4DOHE 3EO1A 3I6KA 5HVHC 1AS8A 1MREH 4QCIA 3DJRA 1UT9A 1BVLA 3BKMH 3SKMA 5GXBB 4RMBA 4NJ9L 5EOQL 5DQDH 3Q0HA 5HPOA 3EADA 3GLEA 4Z3JA 3KPLB 4HWZA 1TXKA 4RFOL 5D71L 3FW6A 4R4FL 5C0BE 4JO1H 4EIGB 3UYOD 1WBXB 2ZCLH 5L6YH 4ZOCA 4Z3EA 2BO0A 4XBGA 1SF5A 4HP5A 4OM1H 3KEHA 1MCBA 1U0QA 3UZVA 5HYQB 5IJKA 1BMWA 2RACA 1OY3B 1I9IH 3NRQA 3JT0A 4X4ZA 1T0NA 3PPEA 2A0ZA 1X5JA 3PP3H 3OKDB 2XNAB 1EQWA 3OKDA 5D1ZD 5E08H 1RZKL 4HUMB 1X9QA 4HXAH 1H5BB 1R9FA 2BVYA 4PJDE 5I73B 5IVXA 1PYWA 2J21A 1SDDA 3ECUA 3EJCA 1JGUH 4WNJA 4WWPA 5LBGA 2AFNA 3HRZB 4FNUA 4W81A 4CKVX 3GINA 2QPSA 1PKQE 3U9PL 5CD5D 1OP4A 3TFKD 4QYOB 5GS3A 5MEQA 2GSGA 5E1AA 1YC7A 5F2FA 3RAJL 1FORH 1KLUB 4U1NA 2CRZA 3BH4A 4WIQA 4Y1TA 3TOPA 1MELA 2DMBA 3PDDA 3RWCA 1P7KB 2P5WA 1XF3A 5EO9A 4ZS6D 3BP7A 4QOKA 2VB5A 1U21A 3EO1B 2VMCA 3MROB 3SD2A 4QRRA 1OEZW 5L88H 2L7EA 3DRTB 1YCSA 1PX4A 4P5KB 4WFED 2J4WL 3H9YA 4MA3B 1BBDH 1VFOA 4IHOB 1XKUA 1UM4H 1BX2A 1O6TA 3N9GH 4UQEA 1Z5YD 3CDZA 3BPLC 5F9JA 3WS3A 3IJEB 4JPKL 4XCCL 3U4BH 4AYDC 4XNMB 1MCPL 3ARDC 1IC0A 2OYPA 1TZIA 5DURB 2K7PA 3GMLB 1E5UI 2YD3A 3BH9A 3WY2A 4AJ0A 4PKIG 4AK1A 5DSCA 1HAUA 4J3XA 2P42B 1X5MA 2ZKMX 1IZKA 1UASA 5AZUA 4DP2X 1MHPH 1GAFH 5DJAB 5I1LA 2CU9A 5LAPA 1CU4L 2BY2A 1SDYA 1Y18B 3RB7A 4JNXA 4KJWC 1ACXA 2SEBB 1JPST 4APXA 1HSBA 2OSLA 4X2UA 5JQ6H 2WWMD 1T4WA 3IRZA 1AACA 2X6MA 2UYLA 1WE5A 4C47A 5C7XH 4OIIH 3CC5A 1UOWA 3WNIA 4WK0B 2QVFB 4K3DH 4OB5L 5CIPB 2Y36L 1L9MA 3NFSH 5DQJB 1LO5A 3G6AA 4C58B 4KTDH 5DVNA 2Z92B 3QJVB 4OZGE 4N68A 4QXUH 5AVQB 5JIQA 3E1F1 4JKNA 3QDGA 4C59B 3W37A 1W0YT 2VKWA 3OGMB 3G3LA 4ENED 3V6OE 4PM1A 4N24A 2G4GA 4UDUB 2Q6WA 1HE7A 5F1OB 1B0RB 4OZFG 1XGPB 1M05B 4AE1A 4G7YL 2FK9A 4S1SH 3QEUA 4JZNA 4RZCA 1OOAA 3LZFL 4XBPA 2PTTB 4JO8A 3UAJD 3LHAA 5CJQH 1AOHA 43C9B 3WPBA 1KCVH 4U4IA 1FLRL 2ITEA 1DVTA 3UROR 1QLEL 2PO6D 1G7HB 5LCVH 3TLRA 1IO4C 5E8OB 1PIGA 2JQAA 4FMKA 4G3YL 4XE5B 1PZAA 5D2LA 5EUOB 4J4LA 3GXPA 4M3JA 4W9IC 5FGBC 2AZAA 1GMIA 3A22A 2DLTA 2CKBL 2AJVL 3AG2B 5DJ6B 2QKIA 1EZUA 5FCUH 1N3NA 3NSCA 3V4UH 3NCCB 1KXHA 4MTMA 2ZD0A 1PLCA 1KFAH 2NYZA 4L3FA 2VGLM 1OM3H 2F54E 2ZX6A 3WJMB 1A7OH 5FM5M 3W0WA 4X4YB 1QHPA 2BC4A 1NA8A 3QG6B 5GZOC 3QNZB 5MENA 2BVPB 1VDGA 4ZX3A 3HC3L 5HYSB 4AY0A 4GKSA 4RX4D 2NRDA 3EKCA 5FDYA 4ZOBA 2PO6A 1UD2A 2TRHA 3R8QA 2R15A 3UTQB 3VFRA 5CCJA 1OE1A 4K8RC 1MQKH 3AB0B 3MGOA 5EF0A 4XGZB 4OZ4B 1MRDL 4WHCA 5BQDA 4RESB 1C08A 4PJEF 1S7UB 4XCFL 2XTJE 2V9RA 4LL4A 4KVNH 4L2LA 4UDUA 3KHOA 3DGGA 2G3ZA 1NFIB 5CJXC 3FSWA 4WI7A 3V6BR 1HQ4B 5KVEH 5DD1H 1DVSA 3LS4L 2AK4D 1OHZA 1QBMH 4EIBA 1OPGL 1RHHB 2Z65A 4P2OA 4X9FA 4PQ8A 5JZ7D 2JKIS 3SJVA 4FN0A 5EZJA 3AS1A 3C5SA 2MCPL 3POHA 4G8IA 2CM5A 4MB4A 3FU9A 1RUML 3BSZL 4GI8A 3TCTA 5HI5C 1YMMD 4HEME 3KPSA 1I7ZB 2CBMA 1GC1H 3G5XB 3PV7A 5DC2A 1R5IA 3L48A 2ZYIA 3W9EB 3W3GA 3DYPA 2QGDA 4EOWL 5L9DL 2VMJA 2C26A 2L4OA 3MRPA 4Q62A 3L9EA 1ADQL 4C83B 4OM0H 2EC9U 4U1GC 2CLVB 3IJSB 2NTSP 2VLRE 4XCYB 1UJ3C 2FH6A 3GHEH 3KXFD 3MRMA 5F8RC 3TJEL 3BQUB 3QO0B 1HXKA 4HGKC 1HHIA 3ZIMA 1IQWL 3MBWB 2BM3A 5KAQF 3J7HA 5SWSB 5CZKA 4XNMA 1PJ9A 1BVOA 4CJ0A 1FYTB 4L0ZA 5F9JB 1EEYA 1YLBB 4IRZL 2H0FA 5D96C 5I1CL 2OMZB 3VXUE 2X87A 3NEOA 3UJTH 4FQHB 3TNMA 1G7PB 2LAGB 4WDIB 4QHKJ 1OGAD 4ZMXA 5GQRK 2WANA 3RPBA 2VDKH 1X5AA 1CE1H 1GYCA 1GTFA 5HVFB 2XN9E 1F4XL 2HSIA 3DKHA 3DURB 1FZJA 5I26A 2YC1A 3OMNB 4R0LC 4QIRA 1CF1A 5J8OA 5HHPB 3F6JA 2YUWA 3DVGA 4IK7A 2MCG1 3UTOA 3REWB 4EI6A 4UUJA 1ZLSH 4PJDB 1CE6B 1QI5A 4XH2A 4MAYC 2OMWB 4UWQB 3EF7A 4ELMB 5D6CA 4G59C 1JBJA 4PJGB 4MJ2A 4X5WA 3SYOA 2X9XA 3ABMB 3MAWA 3CFKB 3UZEA 2BIIA 2G0LA 5A2CA 5FOBB 3OJ2C 4NCC2 4NPYA 1BCIA 1SDDB 4XN4A 2NXZD 2E9WA 3ROOB 4YHNB 2AK4E 3CZUB 3QG7L 3GEFA 3NIFB 1KF9B 2NOYA 5IP4A 1KGYE 3FB6B 1NGPH 2D7TL 4X8JA 5E24E 2D2OA 3HMXL 5E9AA 3QI9D 3B7TA 4NBZB 2IPTL 3OR6A 1VPOH 3HI6H 1CR9H 3GDCA 3OPZL 4M8RA 1S9YB 2BOBB 4WHYH 4YDIH 5C70A 2UUDH 3L4UA 3EYOB 2Y3AA 2OJZL 3ISWA 1GW0A 3ARBA 1DJGA 4ES8A 4BXSV 3VWKB 1DFXA 4MWFA 4KROD 3SBPA 1N12A 4AZ8B 5SWZD 3MACL 2VIRA 2DOCA 1IAMA 3VCLA 3B8SA 3U36B 3U4EA 5C09E 4L4JA 2EDBA 3ZVVA 2HT2D 1E5CA 3V6OC 1KG0B 5F6HI 3OGKB 5FYJD 5KANI 3NPSC 4LSUL 1GAFL 4G6FD 4QCIB 5AYQA 2NXYD 5F96L 5HHNB 1GVIA 4C56D 2R29A 3JV4B 5JOEA 5HYJA 1J18A 2WBWB 3EFDL 4I0PB 4RFOH 4RMTA 4GB9A 5DQ9A 1QSFA 3T6QC 4CDGC 5F7YC 1GYVA 3RFSA 4M8QB 4XWGH 4Y5VC 2LU7A 1OVZA 2DD8H 2XN9D 4IGBB 3REVB 1PZ2A 1AQDB 3APFA 5AL0A 2X2YA 3FB8B 3I84A 4YNYA 2Y7QB 3RX8A 4BDVB 1TO5A 3S3PA 5D1ZB 3QIUC 1HKLL 4G6AC 3UO1H 1E6OL 1OSPH 2E75C 2E9GA 4NUJA 4IDLA 3SGDI 1L7IH 5I16B 3G08A 3VRLE 3QJHB 2DQHH 2WIMA 1JGUL 3T9WA 1MF2L 3DX0A 5CJBA 2N3JA 3ZKNC 1KNOB 2Y6SC 3ET9F 1JZFA 3R8BB 2VXQL 4Z0XA 4JN1L 1OAXH 2ZUQC 1F3JA 2DEWX 1CUOA 1KCBA 2ZXCA 2FJHA 4R7LA 4WI2A 4NOFA 2HUHA 1KCWA 5G2NA 1G6VK 4UZSA 1Z7JA 2AEWA 3LXUX 1XR8A 2XWBB 4K9EL 4N2HA 1XGRB 2H6PA 3LMJH 4M3KB 5E8NB 1JF5A 1VFAA 3B9KB 3QUYB 1EHAA 4M5YH 4ODSH 2X4OB 4KI5C 2DQCH 4MDJB 3U2SA 1DSYA 1ZANL 1SLUA 1BM3L 3ZTJH 4HQ1A 2WWKT 2GI7A 3OWEA 2JKTM 3LRHA 1DFBL 4JFPB 4HIXH 2IFGA 3N0AA 4A66A 2CO7B 2CAKA 3SCMB 3ZSTA 3QCVH 4Y2LA 5I8CA 5TFSH 1A3QA 2OR9H 5LO7A 3MRLB 3PFUA 1VZGA 2ZX5A 4E2OA 5HJ3B 1OT1A 2YMTA 3BCFA 3FQTB 3KJ4C 3O2WH 4ZTPH 1CDBA 1I1FA 3C6SA 5EZPA 3RI5K 3MA7A 4P2QD 3NK3A 1NMAL 4OCRL 3QUGA 1P4LA 3LXCA 4I13B 2D9CA 1TEFA 4IRJB 1XF4B 2EEDA 3F7KA 4YHOH 1ZT1B 3CZJA 4POZC 4WJ5A 4ZTEA 1MJJB 2GQHA 4PW4A 4HLZG 3R06A 5C08A 3UTTB 4APQC 4KHTL 5AW2B 1MFAH 2Z93A 4YSCA 3K1DA 1SOQA 4PG2A 4K7PH 5EZLB 4AGQA 2NUTB 1Q9LB 4AH2A 4JM2B 2CO6B 2YPLD 3FAXA 4XCNB 5G4NA 2ZKYA 5EBLA 1XTLA 3KCPB 4D3CH 2YPLB 4XXWA 2AK1L 1P7HL 5DJDB 3L5IA 3SB4A 1FVCB 5DUPL 2P1MB 1LP9B 1QNIA 2K8MA 3QEGH 4JE0A 4R3SB 3VJ6B 1LEGA 3BOVA 4Q9QL 2V2TA 3KGTA 2WLMA 1WAAE 3BUIA 4X42A 4EOWH 1UWXH 4LOVA 2LVEA 2MH4A 2BHYA 3PV6A 4LVEA 3MBED 4OM0L 2X6VA 1A14H 3D07A 3HS0A 4JHAL 4YSTA 3X11A 4X7SH 1B4RA 3FTGB 4OZGB 3BIKA 2I26N 4E5XA 4GNKB 1XBDA 4GFXA 3CK0L 5IFJA 4PJ8A 1HXMA 2AJVH 2NR6D 4GRLD 4JZJB 5I9QC 1U8QA 5J9PA 1IBFA 5KVMC 1CQKA 3PPSA 4O4YL 1KIUB 2ZE0A 4X5RA 3WXWH 2VRKA 2GK2A 3X2QB 5JPMC 3X14A 3FUDA 2CG9X 3C5ZD 4FFYH 5AW7B 4PPTA 4YVUA 3UBHA 5HHVH 2WP3T 2ZCKH 5EF2A 3QCTH 4AXWB 2BVTA 3RUGF 4UDTB 5IHWA 1KXQE 4NGHL 2XZAH 1KWKA 1N9PA 4WNQA 5IB4B 4L3CA 4DCQB 2W07B 4LQFL 1OTSD 5I71C 5IV2B 3S96B 3MBXL 5KOVC 2XN9A 4KQ0A 3ARED 4XVJH 3SB3A 3CXHJ 4Y19A 2HFTA 1U3NA 4AVHA 5AB2A 1EO7A 3AREB 3UTPE 1E2VA 2DMCA 2X9ZA 5IVXF 1JYXA 1QSFD 2V7HB 4JAMA 4ZBJA 3FU8A 4NNYB 3NCFB 1Q1JH 3WUZA 4DP4X 5KW9L 1MLBB 5C86A 1WYJA 3WN4A 4U6VH 2APBA 3PF2A 4BFNA 3B56A 2VXSL 4R0LA 1TZOA 3WPDA 3T6VA 3T09A 5IEKA 3IDXL 3WHE1 4RWYH 5CLXA 2WGXA 1S9VA 3B34A 4JFHE 5I5JA 3VFNB 4WU7B 5JXEA 1I3RA 4KMTL 4QHNB 1NINA 2BCKB 2E8YA 3P30H 1RVFL 5B1KA 2BWIA 4AMKL 3NJMA 1LK2B 1PY9A 3DX9B 3SPIA 3HNSL 1JS4A 3J07A 1NGYB 2MCMA 1WTGT 3OAYH 1HQRB 5FA4B 1PNDA 3T2PA 3P4LA 5BJTB 3WUWB 5KBNC 2A0LD 5JXEC 2DDQL 3K4AA 2P24B 1SNRA 5EORH 4GW1A 1XVSA 1OB1B 2D0FA 3ELAT 3NJLA 5INCA 5DLML 1E2ZA 5CEXB 3TO4A 1KEGH 4K3JH 1WPCA 4R83A 5HGHA 1BG9A 1S9WA 3S5LG 5C2BH 4PJHF 4NCDA 1YY8B 2YRZA 1QTPA 5IQ9A 5TPWH 3I02A 4CSTA 5IBLD 3ZE1F 5G4MA 1T0PB 5K9JL 5ALCH 1KMGA 3TYFB 4NKGA 1ETZB 1KXQA 2EIKB 2BNUB 2IMMA 1A7RL 4NQDB 4X80H 3L1EA 3TTSA 1LGVA 5FXCH 2ITFA 2NY2C 3F85A 3V0GA 3F04A 4C56B 3L4ZA 1MHEA 3AT0A 3QUZA 4GSDH 3ABKB 5IWLA 1HCZA 5I74B 25C8H 3BKML 2P5EE 1ZLSL 1N67A 4F7CA 2R8SH 4P8SA 3FTWA 4ONHA 4KVCH 4JHBA 4NPKA 3HG2A 1FO0A 2VLME 3HG1E 1JZGA 1JGVL 1S7WA 1NJ9A 3M7FB 3CIYA 2FWOA 3BZDA 5EU6D 4YDNA 1K9TA 1EXUB 3DXAB 1GOHA 1SXAA 2XLLA 3HB3C 3CFCL 3FQRA 1W15A 3U6XA 2Q7AA 3F7LA 4EIZC 3PS6A 4MJ5A 1IAIM 1UD6A 4WKZB 3TZVB 4ZPVA 3S5YA 1AGDA 2XN1A 1IAII 3V7AE 1EX0A 4RMUA 4YDIL 2OJZH 1TQBB 3M7OA 2F7IA 1KWGA 3KPNB 5F7AA 3QDHA 3LQAC 5C0CB 3L3DB 2G2PA 4HCFA 1JOIA 4PHXA 1LEGB 1RJCA 4WW1B 1PLGL 4HHGA 1BOGA 1ONQA 1RCYA 2C4FT 4MNHA 4NENB 3U30C 4LOEA 2FEDC 3VFPA 1DANU 3EGSB 3T2NH 4Y9CA 5F88B 3CNKA 3K0YA 4KRPB 2V5YA 5HD8C 3IDYB 3AXHA 4G6KL 1MI5E 4JM2A 3L5WA 2NUTA 1JHTA 4QAMB 1JUFA 3OZKA 3ABGA 2ICWA 5FS5A 2EUXA 1ID2A 2GJRA 1NAMA 4AUJA 2VDQL 3NH7L 1NC4A 3FQXB 5DD5H 1T3FA 1O7SA 4EBQH 3TEUA 4FXLA 2IH3B 5E6IB 3AMLA 4XBMA 3P4MA 4ZW8A 1QABA 1LDSA 4GAYA 1U2CA 3SZ6A 2WZ6A 3SBRA 1KPVB 1OSZB 3FFDA 1EFXD 4PYHA 3CUPB 2BSSA 2DH2A 4AYGA 3F65A 3HC0B 4Z76A 3ZQXA 4NZTH 2ZTBA 3CSYB 4HHAB 1Q8MA 1MF2H 4RFEA 5EF3A 3CSBA 4IKJA 4JHZA 3LEVL 4TQIA 1T03L 2ZUVA 2CO7A 4JFSA 2BP5M 3AITA 1FNLA 3ATDA 4TL4A 2EDDA 5KSAC 5CUSH 2DRUA 4JKMA 3U9UB 4N25A 2DM4A 3T6ZA 3EG9A 3VB8A 4PJFA 2CIKB 3MUGB 2FX9H 2EIZB 4FG4A 2EO7A 1JF1A 3C8DA 3QWNA 4JM4H 3U46B 3C60B 4JB9H 4MJHA 4DIXA 1AKPA 3RWHB 2YUZA 2ENYA 1U36A 4KXFB 3C60D 3TTYA 5C0EB 2NNAA 4WU5A 2G2RA 4MA8L 1XGRA 2H6PB 3O2DA 3QH3B 4H5SA 3TO2B 4AZUA 2WKOF 4XNDA 2VC2B 4G9DA 4JCMA 3CH8A 4LOFA 3IXAB 4NXKA 4N0UA 4K55A 1BIIB 3BO8A 3GJFA 5ESAA 1FL3A 3ULUD 2YPVH 4N3TA 2ENPA 3M17B 5KUMA 1QMUA 3JWNE 4PWGA 5AYUH 2LLNA 1FVDB 1B3JA 4Z0XB 2BNQD 3GF8A 4S1SL 4HT1H 1JZ3A 4I85A 1AGCA 2F1EA 4HJEA 4PSJA 1R5VA 1U2HA 5J6GB 5TFSL 3C2SA 3I9GH 4R2GB 4X5LA 4F9LA 2ATPA 5IW6B 1OF2A 1WC7A 4KX9A 1BQHA 1NLDH 3AQZA 4OCLC 4AGPA 5FA3B 1BJ1J 3B7SA 4N9GB 1E42A 2W95A 4NS0A 4Y2DD 4GQQA 5ABAA 3RWIA 3NJJA 1DVFD 4PVLA 3WEXA 3E6HA 1ZT4A 4FNLH 5AENA 1FNEB 4AEEA 5HGAB 2V3DA 3BC9A 1NMAH 1KLFB 3HE6D 4OCRH 4OFIA 1J48A 1PG7H 5K9OA 2WC7A 3NK4A 2D4FA 1Q9OB 4N2BA 5HDQH 5T5FL 3WDJA 4DSYA 4FMZA 4Y4FA 3BISA 3IFPA 2JIXD 4HH9A 2OJEB 1IAIH 1PX8A 4IMLA 5FW6A 3S34H 2IBZX 5IKCB 1KC5H 1HOEA 1EJOL 5GRWA 5C0IB 2G9HB 3P4OA 2QMKA 1F45A 1NTDA 3RWJA 3FMGH 5D7JB 4HU8A 3QS2A 4FC3E 4L4VB 2D3NA 1G87A 2RH0A 2WUBL 4HJ0C 4WY7L 1K5WA 4PRPB 1T2JA 1DDTA 1AZVA 3WFEH 3RY5A 2ADJB 4WTQA 3SHSA 3VI4E 1WIUA 3AY4A 3SE6A 4ISVA 4JFDE 1PU0A 5LBSA 2E5EA 3FSAA 5AZEH 3OKEB 1ZJAA 1RZ8A 1D5ZA 4JPIB 5B38A 2ZUSA 5FFLA 3DBXB 4IRJC 4N87A 3F8UB 3S5LA 2V33A 4ODHH 3VW3L 3BFQG 3I9PA 3S88L 2H2PD 1A3LH 4LCYA 3MODL 3NZ8B 4BK8A 1HH9A 4LGPB 1FZMB 4P4RA 3LD8B 4R7NB 5AAPA 4TV3A 1R46A 4AQ1C 3NTCL 3VQ2C 1XGQB 4LBAA 3BSZH 2WVUA 4CILA 1MWAB 3BDYH 3D09A 4O4YH 1A6UH 4MGXA 5F7EH 3L5HA 1EZLA 2X53A 4XO5A 2WQSA 5DFWH 4M48L 4X8CA 2YXVA 2Z0BA 3DA0A 1X44A 1CDGA 3LV3A 4FFYL 2XYBA 5AB1A 3RIZA 5HHVL 1UM6H 3CFQA 4RCWA 1JRHI 1FGVL 2WQAA 3CTTA 3T8XB 2CO4A 1JCKA 1JERA 1JFQH 1GGIL 1G6RB 3MNVB 2PW1B 4PJEE 1GZQA 3B9AA 3VXRD 1NCHA 2Z31C 4MVBC 5C0BD 4BSSA 2VJ8A 4HAKA 4U6XB 4WO4D 2YA2A 2X7LB 2HB0A 2X4NA 3H42H 5CU5A 3TN0D 1OP5H 2VABA 1J11A 4HS3B 2XWTA 2ESVE 1NFDE 4N22A 5CJOL 4KJWD 1BOYA 2BWQA 3D33A 1ZPLA 2NNXA 1LL1A 3TWYA 1YEFL 2UX7A 1JTPA 2BINA 2VDMH 1O7DE 4NIYE 3LSOB 4P59L 5GISL 5BQ7A 3TESA 4EDXB 1QYGH 4MNGE 2CA3A 4N0YH 3SYPA 1D9KB 1DANT 3DZEA 3ZKXC 1JN6A 4LKCB 4PS3A 3IJSA 5D5MA 3REZA 1JTTA 4R96B 2XT1B 1BD2E 5D9SB 1FGNH 1BF5A 4IRZA 3V52H 5BUAA 4AM0Q 2RMNA 1J12A 3LAFA 4NUMA 3OMZA 4FXKA 4QNPF 3RQ3A 1CI3M 5J1AA 4IJ3B 5IVNA 2NY7L 4G8IB 1FVEA 5A2AA 1PZ3A 3NACH 4ZT1A 4NN6C 4KK5C 3KYOB 4R7DA 1AY1L 1SEQH 3FO2A 1E4WH 1RHHA 4HSAC 1K3ZA 2WTRA 3QI9B 4NZFA 4B27A 1LO4H 4FQLL 4Y7OC 3QORD 2VE6A 5E00A 3WPEA 2EDJA 5SX4I 1XWVA 2JJVA 4JREC 1L6PA 1NFIA 2DB8A 2NZ9D 5E94A 5K9KB 3IE9A 3V0IA 2NT1A 1F2QA 2R83A 3MUHL 1G7IB 5TPWL 1UGKA 3HFML 3IAPA 4OUUA 2ICCA 5ITFB 4LXFA 3NSDA 3JT2A 2OMXA 5JHBA 4FABL 4IIQA 1A7RH 1NL0H 3LQAH 5SWQA 5KAQG 2HVKB 2VL5A 1AGBA 2WINB 1I4FB 2GAZB 3T0VA 4Y2NA 4IRSB 1L9OA 4WI9A 1CGXA 3QIWA 4YZFE 1I1CA 5GJTH 4LSUH 4JL1A 4OLUL 5CSGA 3TA3C 1ZD6A 3VXUA 4TRPH 4FKHA 3GSNL 4N3UA 4WK2B 1BQRA 3P9MB 5AG9A 1MY7A 2YBGA 4U0RC 3ZX1A 3GXMA 2APVA 4H7VA 2FBJH 2XV0A 5B7MA 5HYFA 4EDXA 2QHRL 3VXPA 4MHHI 4OD3H 2NY3B 4XP5L 1UWXK 3UCRA 1JGVH 3DRQA 3HBPA 5KSAD 3FQNA 1XXFC 4Z1PA 2XWRA 1T20A 1ADWA 4FF9A 1CMOA 1OB0A 3MQIA 3NCXA 3QZWA 2PXYD 4OGYL 4EKJA 5C8JA 5FGBA 1S9KC 4JFTA 1HKLH 3UO1L 3E7JA 3IKCB 4GXFA 3GSUB 4W9LC 3T8MA 4APQA 2D7MA 4P5TC 3VXOB 2NMSA 2Y2YA 2GJZB 5C07E 4KDWA 4MJ4A 4N1CA 4QT5A 4AW7A 5A40E 3ORJA 1EFQA 2EYSA 2WIIB 1H3PH 4AGLA 5EC2B 3RFZC 3FO0L 2XFGB 4B9KC 3GS4A 2VM4A 4P5RA 4HGMA 2IPUG 1AR1B 1ZTXH 3NOIA 5AYUL 2QPUA 5C71A 2V2XB 4XN1A 2ZSVB 4G42A 4FYTA 3UTSB 4ZAKB 1BPVA 3EJTA 2V9UA 3QDJE 4PEQB 4ES9A 5KSVA 2WVTA 3GD1C 4HIQA 5KZCB 2NQDA 3IKKA 2QSQA 2PWFA 1F97A 4PIRF 3UIZA 2EP6A 1OT2A 4OZFA 1IIKA 5HD8D 3F7QA 4GG8A 1G9MH 4XXDB 1L9QA 2YD2A 3RL1A 1NPUA 1FZMA 2DLFL 2DQCL 4KXBA 4ZS6C 4DPAX 1UWEL 5B4MC 3AQYA 2N01B 5T3XD 1PG7L 4ILDA 4DN3L 1HINH 3PQYD 2AK4B 3PXLA 5EU4B 2GBUA 1DFBH 2YJQA 1DBJH 3PQYB 2O4EA 3HN8A 3BEWA 3X13B 5E1IA 5KVDL 5CBAA 4CGTA 4KPHL 3RUGB 5AVXB 5HVHB 1O7VA 4HGWA 2HFGH 1U95B 1KC5L 3J8F7 2OR9L 3ZDZE 4ZTOL 2NQCA 2NY1B 1HIML 2CXKA 1UKSA 2FWSA 3AJ7A 4XP6H 1SQMA 3JUYA 2HUEA 1W0WA 5KYWB 2COVD 1XCDA 1QSZA 2OMUA 2R7EA 1HKFA 3SDXB 3WKMH 2R1WA 2A6IA 1T03H 2ELLA 4O51B 4WGVB 2A1WH 3BESR 1DVFB 4LNRB 4PCSA 2EXTA 3P4OB 4UAOB 4GO9A 1H3XA 3ZYJA 4HK0A 4BCXA 5FECB 5CHNA 3KXFB 3I6LE 2QQKL 1KYOJ 1T4KB 4NNXA 1MVYA 3WS3B 5F3BA 1X4YA 3F84A 4JB9L 2JXMB 3V0HA 4KZ0A 4YO0A 1ZPUA 2GITB 3U7YL 4KJPD 4ZFOA 3S88H 2VDNB 3U82B 3HZMA 3ILDA 1O6VA 1H8OA 1Z1WA 5JOPD 1ADQA 4P3CH 3FTVA 3LRSA 1UD8A 4UFRA 1JGIA 1TZHB 4ZUWB 1NCDL 2DTSA 1QW8A 3SY0B 3VXME 3WTSA 4OLVL 1WFTA 4HWBA 5CLWA 3UBXB 3F58L 2XY2A 2WZPD 3JUZA 1CL7L 1PKQB 2Y2TA 3CDFA 3DARA 4IBZA 4PRPD 1P7QB 1Q4NX 4N2OA 3TBYB 2WCGA 2EDTA 2F19L 3WYRA 2VLRD 2AERT 4Y4KB 3CH1A 1FVDA 4Y9BA 1FFNA 5DZJA 3SDCB 5AVTB 2FZ3B 1JAEA 4G7VH 2YGPA 3FN9A 4XTRD 1JV5B 4AQAB 1CO1A 1M6UA 2VXUL 3FT2B 4A1RA 1K72A 3IFLL 1BIIA 3GJFB 2O5XH 4BHUI 3L9RB 1IBYA 3BP4A 3SDDA 3ENEA 1IBDA 4XO8A 4DQOH 4TTDD 2B5IB 1EBAA 5KSBF 3QSKB 4KWUA 4TUKH 1HOCA 5T5FH 2FR4B 4QHKI 1EZSA 2CRYA 5DJXB 3S3SA 2EIZA 1G5AA 2K9UA 2EH8H 3MUGA 4HPYH 1W8AA 2LOEA 2DYPA 3DX1A 4NI6A 5ETUB 5CBEA 5C09B 4WUKL 3BE1L 1NBCA 2J6EH 3QWRD 2OM5A 4NP4H 4F2MB 3ULVF 4JUSA 1FG2A 5DHVH 2VLKD 3EOBA 5FDWA 1U8JB 2M2DA 2K6WA 4FZ8H 2ENQA 5E5LA 4ELDA 4RNRA 4UBDC 1M2VB 2HVBA 2RA8A 4Y8DC 4HZ1A 3O3DA 1RJYA 3VFSA 3QNXA 4PVMA 5D72H 2IH9A 4XVJL 2YD8A 1I3UA 4JDTH 4WWKB 5BV7B 1GA2A 4WO4B 4DGVL 1XV8A 3W38A 4M9OA 3CZLA 1DQQB 1SVCP 3NYKA 4WO0A 5JZ7C 1QFOA 5AZEL 3T0XA 1I8MA 1TVBB 3BPNC 3WIAA 4MMXC 2NY7H 5DJCB 3U4KA 3DHUA 3UP6A 4PJEB 3HA0A 3D3VB 4WW2C 3MODH 1YEGH 3D39B 4K9JA 4LAQH 3FYIB 1N6QL 4NKOB 1O9VA 4F7EB 1JD7A 5IQLA 2R23A 1HWWA 3QDMD 3EJSA 3RWDB 2CXGA 3N1GC 5JHDA 4I0PD 3KPQB 2GHWB 1NLBH 4ELKA 4EUPB 1EHXA 2NDGA 2HRPH 4AMKH 4EVNA 4L48A 7PAZA 5E23A 3UYPA 1GGTA 4R5DA 4M5SA 3KBHE 4F33B 1UA3A 1ONQB 4NENA 2H0EA 1WT5C 1L6XA 3LQAL 4WK4B 5DS8B 2WLIA 1ODUA 4HIHA 2JCCE 4X7CC 3RPIB 3D30A 3NGBC 4YDKL 5KYYB 1RK1A 2G0KA 4Q14A 4ZDHA 1HDMB 5AAMA 2Y1VA 3CVHB 3HHSA 1I1YB 5FAAA 4LQ1A 4MD4B 1F4HA 4NJ9H 2GSIA 3T2LA 3TZVA 1WF5A 2XWEA 3QJZA 3ZN6A 1HWGB 3QQ3A 5LXGH 3QORB 5D4JA 5FHBH 4PREA 1M7UA 3RWEB 4EPSA 2WNGA 2GT9B 3O45B 1N5YL 3EOTL 5FFOA 4UV7L 5IM7B 2P5EA 4X6BB 4WNSA 1IBBA 2X4QB 3LS5L 3QZPA 3VI3B 3WEBA 2R39A 2WXFA 3P0YL 3SGKA 1DVXA 3TO4C 1N64H 2PYFB 2Y72A 3TU6A 4KRPD 4KXAA 2F2HA 4PV1C 4YLQT 4J3OC 4OGQC 2J8UB 5C08E 4DKEL 4ZI8A 1CLZL 4B9IA 2GBAA 3TBSB 1FC1A 5I6KA 3T8VA 3G39A 1T21B 3MJ9L 4NKHA 4LRIC 1RZGB 3RWFB 3TIEA 1YNTA 2AEIT 2ROYA 4ZXBC 4X5PA 4Z7QE 1P4UA 5E6ID 2QADC 4DGYH 3ARFA 2JKSA 5GGVL 4U49A 1DLHA 3DUSB 1ZLWK 1AZZC 1A6AB 3FBQA 4OFVA 4QHUA 3CFCH 4WV1C 1XIWA 1YY8A 1GSMA 5T5NF 5L8JB 1A7NH 3V9CA 1G7LB 2AQ2A 3VMPA 4FXGC 5L8KB 4LVNC 5A2FA 1AOZA 2MQGA 2G5UA 1RIHL 5EZIL 3DGDA 1SYVB 5TDOA 2ZP0T 4N0FA 1BBDL 2EVIA 3LNHA 3QCUH 1UM4L 1JGDB 1USZA 1T7ZA 4NRZA 4YIQA 4MYPA 3IGLA 4PJHB 2HCZX 2XWJA 3SKOB 5F7WC 3ABLB 4FA6A 1NL0L 1XF2B 1HQRA 1EAPA 5F89A 2CLRB 4F15B 3GSRB 3L3OC 4RBPH 3STZB 3VDAA 1G7QA 3WJJC 2CHXA 4NN5C 3V4VB 4DZBB 4PRBA 4OLYH 1IAOB 4MA1B 4P57A 3OKMA 2JKNA 1J86A 1I3RB 3QRGH 2X0VA 3W1ZA 2IJ0C 5DJ2A 1AANA 4UZUA 2CIIA 3OAZK 1S9VB 4TRPL 5GGTA 1MFMA 2BNHA 1S2EA 3WN5A 2GJJA 1VEPA 1XGTB 4OZFH 4WHTA 3FFCA 4U3SA 5JDJA 5D1XA 4OD3L 3WHXB 1GPOH 4NAQA 3QUXB 4TPRH 3WBDA 1KCLA 3ZO0A 4AITA 1NCTA 2WXKA 3BGMA 4HUUA 5EA0L 3MLYL 4FXTA 4B3VA 5B39B 3ECWA 3B8YA 2ZQKA 1GGUA 4NRZB 4YIQB 5ANME 3EJYC 3Q8BA 4YEBB 5EU5A 1ED3B 1U3HB 5FYJH 4GP4B 1SJMA 3DX4A 1NC2A 3H9HA 1T6BX 4JG5A 1THCA 2DJMA 4WEEA 1JG9A 2CD0A 1TSHA 2L7QA 4KKZA 2OMBA 3D0VB 2HKAA 4IRJD 4KC3B 3G3BA 5IB4A 1A6AA 5L7XH 3DMMA 2ZXGA 4IRSC 3TJHD 3RVUD 1F4YL 2IEPA 2HKFH 3F01A 4NCC1 4TNWK 3L4WA 5JPMA 4W93A 5AVYB 3WIIH 4EMZA 2D7OA 2X1OA 1RZGA 1DEDA 1W6LA 5C0AD 4H4NA 4CADA 2XZCL 3MN8A 3ZTCC 1QLEH 4Y4HA 1Q0XH 1RZJC 5E2TL 5LJYH 4ZQKB 2Q3AA 2O61B 1UWEH 5IW3A 2DBLL 2A6KA 1JHLH 2BVOA 2K8QA 2IWEA 3II3A 2WMPB 3LH8A 3BW9A 4DN3H 4PJ5D 3QUYD 4BK4A 1CD9B 2CUMA 2E6QA 1N0LA 2CR0A 3FOLA 3AU0A 3CPLA 2YGNA 4FLRA 3N41B 3IVKA 3QQNA 1X4XA 5B0TA 2OMYA 4U1MA 1C8PA 4ODUB 5ICUA 3JZ7A 3GLZA 3P0GB 2XBZA 3NA9H 3TX4A 2UXGA 1KGCE 4BH7B 2GSMB 2FHCA 3HHSB 1G9UA 4FZ8L 4HK3N 3DJZA 3O11A 2WUCH 2YR3A 1OGTA 4UQCA 2BIOA 1HT6A 4GYBA 4LCWB 3LQMA 5D72L 1JK8A 1FHGA 2OYLA 3OGOE 4PMEA 1MCJA 2ZKHL 4Y5VB 3O3AB 4NKIL 5GRXG 3SPJA 4EVNB 2PWDA 2C9PA 3L3GB 2WN2A 2GPZA 4Z0BL 1DQTA 1MJJA 3LIUA 1SFDA 1Q72H 1YZZA 5FO9A 1WZLA 3LN5A 4ZFOL 1JSYA 3FUJA 3MKGA 1BBJB 1TYRA 4DP7X 2A74B 2BDNL 4RA3A 5IF0B 2HX9A 3U0WH 1DVZA 1X5ZA 5EU3B 1IX2A 3LH2L 2OL3B 1WFOA 4JG0L 4HJ1A 1DCLA 5I1KL 2FEDD 2Z8SA 4DKDC 1I8MB 1F5WA 1ERNA 3HZ3A 2Z7XB 4H0GA 5J11C 1PGVA 5D2NE 3JWOC 4P2AA 1EEUA 5J7CC 5C0FA 2VOTA 3HZYB 1A9NA 1WFMA 4A2GA 3US0A 5D1QA 3QNXB 3FYEB 4JDEB 3QDMB 1YEWA 3LRMA 4LP8A 3L4CA 2P44B 5IROA 1PVHA 4F2MA 4X6CE 3VM5A 1A8ZA 4WP6A 5JMRA 2J8UF 2OMNA 4E9XA 1ICTA 4EZLA 5CBEB 2DYPB 4HC1L 1MY5A 3BAXA 4M6NL 1HYRC 1E2WA 3IMRA 5L4IA 3T3ME 4FQQB 3NDZE 1WG3A 4GUPB 5IJKC 4CMMA 2B08A 3MRIB 1G9HA 4Y4KA 1S7XA 1UM6L 1TPXC 4GY4A 1FGVH 1P7QA 3RVUC 1N64L 1KNOA 4ANUA 3MRQB 3QEQA 3SDDB 4LXSA 3BQVA 4XP1H 3OKKB 3L5XL 1FLTX 5ESVB 2V3FA 3SY0A 1FH2A 4OLEA 3LPOA 1G7JB 2IH1B 5CFHA 4FEMA 4G8FA 4YHPB 1A9EB 2P9RA 4ZW5A 1MFVA 4YNYB 3NJHA 2W65A 2VJ0A 3L2NA 1BAWA 1JFHA 3RL2A 4BE5A 4IGBA 3REVA 4Z7QB 4Q58C 1S7SB 3QFJA 2NY0C 4AGOA 1IC7H 4LAJH 1GGCH 1ML0A 5GISH 5ID1B 2X89D 3G6JB 2H5UA 4JM2C 1YEGL 5KSBB 5FYKD 1N6QH 4L4TA 4N0YL 1LQSR 1A7NL 1E4KA 3ML8A 1IGIH 5HHNA 4OCXL 3AM8A 4OLXH 5I8KH 2AEQH 2R7EB 3ARQA 3CE1A 5EZIH 2GK0B 5AAWA 3B43A 5HDRA 1VENA 5C0GA 1HFUA 1KG0A 2HX7A 3WFBL 5I0VA 2FLRT 2RFXA 2EYRA 2EC8A 1GZHA 4H0LC 3S35H 3M1OA 2OCFD 4Q0XL 4MMZB 3NCYS 2KZWA 1PKOA 3WFDL 1IBHA 5DYFA 1CD8A 1KCKA 3D06A 3VWKA 4O51A 1EO5A 3NACL 2MPAH 2WO3B 4L2YA 2XG5B 1E4WL 5DJZA 4WO4C 1L5GA 4OKVB 5DC9B 3GM8A 3INUL 4FA8A 3BPNB 4OJCA 3HE7D 4X6DB 2CO2A 4A39A 2DQFA 4F7TB 1V05A 1P8TA 4BFFA 2O5ZH 4WEBH 2FSEA 2FAUA 4KUCD 2F53D 4DK6A 1RSYA 2X3CA 3EOTH 5IBLC 4YSUA 1OP9A 1VSCA 1FSKB 3LS5H 3PU7A 4JRXA 4AVKA 1CICB 1HCFX 3HI1A 1IB5A 1IJNA 3ULVD 3QB7C 4PJXB 1KB5B 1IGJB 5GJTL 1B4LA 2AV7B 2LLLA 4N5UA 4UT6H 4DKEH 5HY9B 1MWOA 5E70A 1OWRM 2F54B 5HGBB 1NM4A 1SJHA 3GSNH 4PJCA 3IE4A 4LCCC 3RX7A 4X7FC 1KBKA 2WIIA 4G8GE 2L7JA 1DQDL 4WYKA 1UD3A 2X44D 1OAUH 3ZMNA 1INEH 5IOPA 2B8OT 5GZND 1OAXL 4NKDA 3P77A 4GT0A 1BZDA 3QZWB 32C2B 4L4TE 1HHHB 1UFGA 4MSWA 5JW4M 2VQTA 3WNLA 3O6KL 3FQ4A 2YK1H 4XX1E 3B7YA 2QGEA 4DGIL 1NCBL 4P2OC 4OD1L 2AXGB 5FLUA 3ARDB 3MV9B 4GRWF 4UQDA 2IANA 2XYCA 3D9AH 4LLYB 3FHQA 5LHDA 1FV1A 4PWJA 1H3PL 5AKVA 5C8JB 2XKNA 4GAJL 1G1CA 3DV6B 4FCHA 5BRPA 3P9MA 3CZFA 4JFUA 3VXUB 5E0FA 4AGNA 1T0MB 2A5UA 3FH5A 2N1TE 3ZY7A 2QKIC 3OR7B 3EAKA 1L3NA 4FADA 2X6CA 1F02I 1E5AA 1IE4A 3QIWB 3CXFA 3GXDA 4LSSL 1UJ3A 3QP3A 2YRLA 4JX0A 5E1HB 4HS8L 4HG4J 4XXWC 2OMXB 4KK9D 3WFHA 3PUCA 5M95B 4LE8A 3HMWL 4ELME 3IB4A 2Q20A 2YGVA 3QPXL 3JWNG 1NDGA 3KPRD 1DUZB 4LO9A 4FKEA 1AGBB 3RRQA 1I7UB 4NLAA 1EXGA 4PJ5B 5HYIA 4PB9L 3OMAB 2JJUA 1T0OA 4Z0BH 1I7UA 4NWTH 5L0QC 5KJRL 1F90H 1SXBA 2UY7A 2VWEE 2W9LA 3KLDA 1NGWA 4A04A 4B9JA 4J0MA 3CFBA 3H56A 3BZEB 4FQIL 4ANVA 5E9DE 4G8GD 1X5XA 1VACB 5JXAH 3EH3B 5HGDA 2EILB 4NWUL 3WFHB 4MDRA 1JN6B 4DGUA 4YDJA 5CLYA 3RJOA 3ASOB 2M26A 4PGCA 4BFOA 4WEMB 5FWQA 2B4CH 2PWHA 1FV1B 4FXKB 4MXWL 2J12B 3U1SL 2FDBP 3VXSD 4A6YL 2A9AA 2R1XB 1SHSA 1NAMH 3HZVB 1OGPA 5GMHA 2IG2H 4Y9EA 3PL6D 1O6SA 2C3XA 2R0LH 5BRZD 3PWPE 3OR7A 4JO2L 3DVNB 1F2XK 3BHBB 3DXAE 3MRNA 2VN6A 2HPOA 1JPGA 4PJGE 1YEEL 2ERJB 2EIEA 3DX7A 3IDGB 2CMRL 4X7EC 4P46B 2XKNB 3LZLA 5ICYB 3RJQB 2FYYB 1T5XB 1HN1A 3AROA 1YQVH 3P77B 3DROA 5C6TH 1EAQA 4P3CL 1H6EA 3FN3A 4JJ5B 1G7HA 1ACYL 5EMYA 2ZOKA 1KYDA 3TBTA 3R4RA 1R1CA 3D51A 2YJLA 2A83B 3ALPA 4LASH 2Q10A 4XPHH 3P3UA 5DMKA 1CL7H 3MOAL 4M6NH 2XWTB 4ZSOE 3WXWL 1A4KA 1H15B 2R27A 1J9RA 1MI5A 4JZOB 2F19H 5DS1A 8PAZA 2VABB 1IGJA 1R3HB 4Z77A 1M10B 2WY3B 1WBYB 2X4NB 4QKTA 4QPEA 1ACZA 2G3NA 1J5CA 2WLNA 1BYOA 4YXKL 3H6AA 3X1EA 1SOXA 4NGHH 4BQ6A 3PJNA 4X8XA 5DEFA 5FGSA 5AVZB 3VH8B 5K9QG 2DTMH 2QT6A 5SWSE 1SXNA 4NM4H 4R08A 4FQXC 2F54A 5HGBA 4MJJA 5JTWA 3D34A 3B4NA 4OI9A 3SE9L 1G4MA 2KZKA 3BLPX 4F7TA 3GS7A 3Q8AA 2VISA 3W3MA 1A7QH 4M7ZC 3B1UA 1DVUA 4PJ7B 3SBWA 3LB6C 4BWTA 4OW6A 1YO4A 3SGEI 4MHHG 4OJDH 4L3ED 1T66D 3FTSA 1FFPB 2MPVA 1Z6JT 4LEXL 5E9DA 3QEHA 3PMHG 3RGXA 3BVWA 3GBML 4RFNB 4PV9A 3QO1B 2CDGB 4YS4A 5I17A 2APWA 3P3RA 4ZS7H 4L0PB 4YDLB 1I8LC 4RWYL 4O2FB 3FT4A 2XA8H 4OCXH 4UIMB 5C3IA 4OKVA 1L5GB 4KV5E 4L4VA 1U9KA 3MU3A 4L9DA 4F9LC 5F72S 5EOCH 2IWFA 4Q9BA 4BQ9A 3EW3B 2X6AA 4HAFA 5CLZA 4PRHB 5AVSB 2JNZA 4XVOA 4RMRA 3SJVE 1T22A 3AU1A 3U6XS 4N8VB 1YN6B 5FV1L 5LQBL 2RFXB 2N0KA 3IFPB 5C0GB 5F9WC 3ZYNA 4FLQA 5D7JA 1IKFH 3VSUA 4NBXB 3DRTA 4NZ8A 3DK0A 5TF1L 3ZZ1A 5B8CC 1G0YR 3E6HB 1I1AD 4MZIA 2JVUA 3TYGH 2C7FA 3HS8A 5BS0E 5LFNA 3UTSE 1OAJA 1XSJA 3TBWB 2IGLA 4R6JA 5DD0H 4Y4FB 1Q9OA 4V1DD 4WI3A 2NDFA 4F2FA 2DLGA 2GSGB 5E1AB 3W2DL 3QWQB 1KENH 4A38A 1RIVH 1AO7A 1HILB 4HXBL 4YHPA 3SE8H 4ZXBA 4UIKH 4PJCF 3TXAA 1AGFA 5I30L 3O8XD 1Z3RA 4UINL 2ATPB 5IW6A 4B0MM 1XH1A 5B3JF 4AYSA 4P04A 1P5UA 1HHKB 3V5KB 1R5VB 4RGOH 1CCZA 3ARBC 2X2JA 4CNIB 4U3XA 3HE7B 3GSOA 4IRSD 4BZ1A 4OSUH 1ZGLM 5B7FA 3HHMA 2B20A 2AJZA 3S2AA 3BO8B 1F3DJ 1JZDC 1EA9C 3P0YH 4OFYD 2YK1L 3H9SB 5DWPA 4G9DB 6PAZA 1WWLA 4W9DC 3WGVB 1EHKB 1OXYA 2AJXH 1HAWA 3ZQWA 4N90E 4AM0B 3RGBA 3D0LA 3WO3B 3OC5A 4EE2A 2NXYB 3H85A 1TPXB 4JKPH 1ZS8A 3WFCL 4R97B 2Z82A 4R07A 3RGVD 4V33A 3Q6GL 2HLEB 4PJFB 4E41A 5T5FA 3UMNA 1DFJI 1PFOA 5C0FB 1AG0A 1QFWI 1DL7L 4HG4K 1Y0LA 3WHE0 4GAYB 1B0WA 1A7BA 1NBZB 2C1OB 2MPAL 5E4OA 4EO5A 4JDZA 3LN5B 4HS8H 4XOEA 3CSYA 2JI2A 2PMZA 4NQED 4XT1C 5T3XE 3UTPD 5CGYC 5JNYB 3U79A 3V6FB 1JIBA 1U30A 4ANXA 2L7UA 3D6GA 5DJYB 5BS0D 2ICWB 3OX8B 2IADA 3TVMA 3CZKA 4Y5XA 3TBVB 4C4BA 4ZW3A 2F53B 3N1PC 4QTIH 5ECGA 4KTGA 3T4AC 5KBDA 1FP5A 1A0QL 5IUCA 4BH7A 1B0GA 2PR9A 3R1GL 2WOBA 4ADGA 2VLJE 1NAMB 4JKKA 4MJID 5HGGS 1INQA 1L9SA 1YNLH 4RAUA 3L3DA 4NZTL 4TVPL 3T6XA 4JL2A 3O11B 1GIGH 3T0WA 4GSRA 4PRAB 4A2FA 4MCYA 3GLAA 1A47A 5H37A 3VGFA 3VFPB 3H3BC 3W5NA 4MNHB 2BVOB 3B9KC 1E3FA 1SXZA 2KPWA 4EN3C 5J6HA 4Z7OB 4ABUA 4CRPA 3IVKB 5LN4A 3CFJA 1K8IA 2X1XR 2Z91A 1OLLA 3FOLB 2AGJL 2NY1D 2VDLB 2DQGH 1WS7A 4Z78A 4H8HA 3S97C 5IHZA 2WMPA 3HE6B 2I9LB 4WSKA 4PCTA 5T1KB 2E7MA 3C6EA 4ONHB 1KT2B 2FT6A 1K5NB 2J1YA 2WCSA 3RYMA 4MMYB 2C5DC 3MJWA 5BZWB 3DXAA 5KS9A 3EFOA 4X6EA 4B9CA 5ILTL 4GIPD 3DMMB 1U0ND 3C6NB 3BXNB 4QRPA 1R24B 2B0SH 2EEBA 4BWUA 1FO0B 4HLJA 5AWNH 3KGRA 3KWXA 1P0SE 3R18A 4FZEL 4K8RH 2OX5A 4K8RD 1U33A 3E9TA 5AZ2H 5C0ND 4NUGL 1X5YA 1XCTB 2RTTA 4D9QE 5C1MB 3TYFA 4NIKB 2Y6SD 1ED3A 1NBVL 2KUTA 1CFVL 2YD7A 3BMWA 3S8WA 3UN9A 1Q0XL 5E2TH 2DMHA 3SDAA 3O2DL 3VFTA 2NW2B 1E40A 5FTTB 2XACC 3QW9A 2LABA 5KBLA 1HTYA 5HDQL 4RDBA 1QR4A 1YUHB 4GW1B 1Z9MA 3OTTA 5E2WH 2QFRA 4L5FH 3DJ9A 3WN5B 1IVTA 4I3SL 3UG3A 4U2YA 4BGLA 4MJIE 3GFUA 1Z9SB 4DP8X 3BN3B 3S34L 2Z66A 1A02N 4AV5A 5M7QA 3RDTD 1DR9A 1NGYA 3CBKB 4EI0A 1CI5A 1B2WH 1FJ1B 3NFNB 3FFCB 4U3SB 1MXDA 2VAAB 3CVRA 4XNUH 2YMXL 4KQ4L 4J3VA 3D18B 2EE9A 4OZGF 2WUBH 2IAMC 2HLAB 4X0NA 3RHWK 3FRPB 3QYMA 4TULH 4CN1A 3KLHC 1GYAA 4Z8FL 5KG9A 4KQ3H 2X09A 2JE8A 3ZO9A 4YLBA 1RSFA 5ERWA 1AAJA 1BJMA 2A4EA 2PCPA 5AG8A 5ADPH 1N0XL 3ROLA 4QHUB 2YLHA 2ZYRA 4HJGA 4LLQA 1YEEH 1MFDH 5LQBH 4MD0A 5EUOF 3BAJA 4MAZA 5I8OH 2Z8VC 1XF5B 1D5XB 2AJUL 3KWTA 5C6TL 3DYOA 2H2SC 3L3KA 4M29A 4PRHD 2CO3A 4RQQB 1UURA 2Y24A 5L0QB 1AI1L 3C2AH 5IV2A 3RNQA 3ZRCC 5D1QE 1C12A 3VWJA 4WJKB 1T21A 3IU4H 3SZKC 1CDUA 4KHXL 1R19A 3KYNA 2O6EA 1IBZA 3ARFB 4GUOA 5IHUH 4NO5A 5FYJU 2ORBH 4TTDC 4V2CB 1F6AB 2C3GA 4QKXB 3VGDA 4HZLB 4DAGH 4KNQA 5GRYA 3VI3A 4DCQA 2C4FU 2X9WA 4NM4L 5H4ZA 1DJSA 1IEBB 5ABZA 4GW4B 1ES0A 4WWOA 1G7MB 2B1AH 3ULSB 3QQ3B 4P5TA 4NKMA 4OI7A 4KKQA 5C6PB 1DLFL 5A43C 2GSIB 2OFQA 3BP5A 3AY4C 2HN7B 1BQHG 4W9CC 3EDFA 4KKAD 3X1BA 1KBPA 1QI4A 3PWJA 5A6LA 3QIBD 3IF1B 1PD1A 2O6RA 3RUGE 3UJJL 1QYGL 1QNZH 3H9SE 4R3SA 4ZX5A 3VJ6A 3ZXAC 2VO8A 1OD9A 4P4KA 4W9FC 3CHXA 4JFXA 4EZMA 1CTOA 5AW8B 4B8CD 3LKPA 1FC2D 4HFWA 4MCYB 2MIZA 1I85C 4AENA 1MUJB 1X9LA 3I3DA 2PPAA 1HDMA 3N43F 3RU8L 4OI8A 5EOCL 1TVHB 2H1PH 3Q6GH 3U7WL 1CICD 2VL4A 1BYNA 4P49A 5KUKA 5D7LE 3AY2A 1L9NA 2Y1YA 4P05A 3TCLA 5GGUB 5IMLB 1OQXA 4J8RA 5EULV 1A6ZA 2F7PA 5HDOA 2J1XA 2J25A 4WWKD 4LFHG 1WZKA 4OLZL 4OGZA 1GGCL 3N42B 4IOSA 1BQLH 3PXJA 5JHDB 1KGJA 1MRFH 4P5MA 2GFBA 2V0AA 2V8MA 3BVNA 4TYUA 1C7SA 2NY2B 2R23B 5CZVH 4AQOA 5J5EA 3MA7B 5B7EA 2WAQA 3BUQA 2FJGB 3N55A 3K2KA 5F9OH 5IFHL 3HFMH 3BEVA 3MRFA 3BZFA 1RJYB 4TSCH 5H2BA 3MJ9A 4L1SA 1R3IL 3RWGA 2DM7A 1R0AH 4E9SA 4H25A 4B41A 4H8VA 5E5MB 3WFDH 5I8CB 4FQPA 2BNRA 3BUPA 1VGEH 3QQ9C 3SCMA 5EWIH 1BEXA 5EEUA 4RGMB 3QJFB 4XBEL 2DJUA 1BFTA 4HXBH 2B3IA 4LHJB 5AOJA 2DEYX 1URZA 5D5MF 5D7IF 5C09A 1S7QA 2VTFA 4HJUA 4A68A 3KPPA 5I2IB 3QAQA 3DTXB 5F1NB 1QEWA 3RA7H 3SDYH 5FO8A 1S5IH 2Q5BA 2ZXEB 4HKXB 4CBZA 3EOBB 3FUNA 1VERA 4GKOA 2FRGP 4WEBL 2R0ZL 1UUNA 1J5OH 2D31A 4WW2A 43CAA 2MFNA 3LOWA 3VFGH 4QNPE 1E8ZA 3H9SA 5EU7C 1EJ6A 1QZNA 2OZNA 3QIUB 3UGXA 2EE3A 1F3JB 4GAAA 1RP9A 4AYFB 2JB5L 4BIKA 4M7LT 4KRNA 1ZV2A 1K4CA 4YSDA 5DR5H 1HHKA 3V5KA 3DECA 4JKPL 1MWAH 3L13A 5D7IB 1DQDH 4DN4L 5AW4B 3L08A 4PJHE 2Q76A 4LGSB 2CDEA 1V3KA 4M7KL 3ES6B 1RD6A 2XY1A 3HZMB 4Y2DB 5F71A 3KJ6L 4N2EA 1DJIA 2H4EA 3TPKA 1AKJB 2WLKA 3GKWH 3TURA 3RVWD 3O6KH 5JLZB 5LNGA 1YN7A 1NCBH 4NQEB 2OQJB 3STBA 5E6IC 2VDLL 4XMTA 1MRCH 4B9ZA 4HBQA 2ESVD 4D94A 4ZD3H 3FO1A 5AW6B 1KJ3L 2M83A 2EADA 2VXVL 4LNRA 1AQDA 3MREA 4XZ4A 1PJWA 2YFOA 3CHSA 4FHJA 4IU2B 3WU1A 5D2LE 4YBLB 3SCMC 4I3SH 2PWEA 3C09B 4LLDB 5F3BB 1OARL 1LWRA 1MSPA 1F0LA 4C57C 1IFHL 1BWWA 4KXZI 1EMTL 1KIPB 4NN7C 4YAQA 1JL5A 2P5PA 3V9FA 4BM7A 3D05A 3PDOA 4AW4A 1RV6X 3OSKA 5HTSA 3QJRB 1UOVA 4KI5E 4LSPH 2FEJA 2WXQA 3CFMA 2O6CA 4MXVF 1A3ZA 4XNUL 1QQDA 1GMEA 5EIQA 4X4XB 3V5HA 3QPQD 5IGXH 5AOZA 3QJOA 4TKWA 4XO4A 4W9GC 3SSGA 3D0AA 2KMWA 5I17B 5MI0B 3F3HA 3CLWA 4PV9B 3B7UX 2EIMB 1ND0A 2YSSA 3GIZH 2B9AA 2MJWA 1WK0A 5A6MA 2FJSA 4OLWL 1CXKA 1LO3H 4ZPTA 5F0PB 1CT8B 1CFBA 4GUCA 5FOBA 4QRSA 2QR0A 2KERA 1IRAY 3U7YH 1V7ML 3VXTA 1Q9WB 5IJCC 4JM2F 1A5FL 1QBLL 1KOOA 3D2UD 3GS0A 5DRXB 3WL9B 1NBQA 5JXAL 3SKJL 4OZFB 4XPTL 3QNFA 4MKMA 2ZOTA 4RGND 5FO2A 3UBXG 4XSQA 3DVGB 2FVNA 3IFOB 1HCVA 2NNRA 3GBEA 3STLA 5HHPA 2B4CL 1UQSA 6TAAA 3U1SH 1TUPA 2QDVA 3DURA 1U8HB 5B1AB 5AZ2L 4ZAKA 2FB4L 3IKCA 3CU1A 2R0LL 5JHDE 3CSPA 1I7TA 2D7PA 1J1XH 2VQ1B 4UUJB 3IFLH 5AOLA 1FYTA 3QDAA 5EC2A 1DEEB 1X7QB 4ZMVA 3QGVA 4Z7UB 1J8RA 1YNKH 2X4TA 2WYHA 4Q89A 2YARA 4QYAA 2IC2A 4X0KB 2BZDA 3NN8B 4JG9A 4JJ5A 3C5XA 2CUHA 5E4EB 1QFWM 1T2QL 3DROB 4RBPK 3SOBH 1G7PA 4WDIA 5LDSA 4QAWA 5CJXA 4PP2A 5ICYA 4OCSL 3LZOA 4LMQE 2DW5A 4XHJD 2QPEB 2ODIA 1DLFH 1HE8A 1JPGB 4OJFH 2CLVA 4HPHA 5I18L 1HESA 2H0JA 4UM8A 4OFKA 5FKPA 1OAKL 5GJSH 4C83A 5B39G 2HTKD 4K07A 4ADJA 4F91B 3CX5J 4I48B 3AQDA 1KPUB 5D1XE 5D1QC 1HH6B 2WINA 4L9LB 4YHLH 1H19A 1IFGA 1EO8L 2VW4A 1U8KA 2ZJSL 1E3ZA 3U0PB 4JO4H 4QRUA 5LLIC 4D0DB 3C5SB 3IWVA 5HDLA 1EV2E 1KCSL 1G7IA 4P3DA 4AJWA 2EDWA 4KQ3L 5D2NB 2BJMH 1MOEA 5CXPA 4CVXA 4WFEE 3R7RA 3O4LA 3OKNA 4FL4B 3QARA 1FFQA 4N20A 3ZKMC 1OCWL 3DX8B 2EKJA 5E5UB 3V2AR 1H3TA 4AQ1B 3FO2B 4URTB 2OK0H 2DQTL 3RZCC 1F8TH 2JKRM 2NX5E 5GGQH 5ITFA 2J71A 5I1HH 3T08A 2X5PA 1RZIA 2VH5L 3EHBC 2ZUUA 3QE5A 5IFAL 3W3LA 1N10A 4BFGA 4FRWA 4OFPA 3PABB 3V5DA 3RKPA 2G60H 1DUZA 3V9EA 5GS2B 2X2UA 5K1JA 2GIYA 3QHTC 3CQQA 1NFDF 4D0DA 5GS2H 2F7QA 3P9LA 1WFNA 2YS4A 3PREA 3A47A 4Y5YA 1R0AL 4FE9A 3QJUB 5DEGA 2WWKO 5J1TC 3V0FA 1EHLL 1QRNA 3NEXA 3MGOB 4R4BB 3PJSA 1GGYA 3VFRB 4I48A 1TYJA 2BOLA 1WCQA 5TJWK 4LCUA 3M18A 5LBVA 1S3KL 5KJ7E 1SBBA 1AZNA 4LZKA 3B3IA 2YXMA 3M1CA 1NCGA 1S4IA 1IU1A 4G5ZL 3QDJB 4YHZL 5HYSA 1H3GA 3KW7A 1A1NB 1I3GL 1W80A 3DIFB 3KPOB 4XMVA 3KAAA 1U93B 5KYXB 5D7EA 2AI0L 3RGVB 3IN2A 4JRYA 3WLWD 4ALAH 3ESMA 1KY7A 2H1LM 1HWHB 3BVUA 1J5OL 3EHBD 4X99A 4MAYD 1OTNA 1J0IA 1GW6A 1M3IA 4LP4A 4XBPB 3W3NA 4XCEA 3CDGB 2C4XA 1EUUA 1QSFE 3BT2L 4NB7A 5KEZA 32C2A 1IGFL 2X12A 3H1ZA 4OFDA 1KYOK 3P3TA 2WO4A 3CMGA 1IGMH 1Y6KR 2X7LA 2NXZB 5E8OA 1D5IL 3RX5A 3F7PC 3A6CL 4TNWF 5CZXC 3NAAL 3STLB 1XH3A 1MG2C 5D7SL 5ANHA 3TJHC 2QV2A 1FL5B 2YD0A 2CSPA 2ICES 3QDGB 3WMSA 4Z7NF 3QIUD 4RGOL 3ZGIA 2IF7A 5DO2D 2WTPA 3FULA 4JFYB 3PNWA 4Y16A 5F7NC 5GHWH 4CMHC 4M7KH 3UAEA 2Z1PA 1NAKH 2XZZA 6FABL 4WFGE 5DVKA 1Q9WA 4X83A 1ZY9A 2GJ6B 2NCMA 1CG9B 3KPRB 4ABVA 5KVEE 1FQ9C 3IEAA 2QR0B 4X6FB 4YFDB 4Y5XC 4KROB 3AUVA 4FXGA 1A9BA 1MWAA 3AS3A 3BLKA 1B9KA 3EO9H 5IHHA 1PX3A 4KNSA 1XIWC 1AQKL 3KGSA 5IGXL 4F8QA 4UB0H 5B3JE 1MRCL 4OY9A 1YJDH 3KZ8A 4Q9RH 3EFFB 1GZPB 2VN5A 4NYLA 3AGVA 5I75C 4ADIA 2FGWL 1EDQA 3ZOAA 3LPPA 2B59B 3L1OH 3OF6A 3DBXA 3GI8H 1UOLA 3TA3B 4AQEB 4KTEL 4WHDA 3HAEA 1A9VA 1AMXA 5TE6L 3VGAB 1U8NA 4RSVA 2DL2A 3FC8A 1EGJA 2ITDA 3RWJB 4FMFA 4JQXA 1OARH 4APXB 3IFNL 4BFJA 1XFPA 2LU5A 1U41A 1H6UA 4KRPC 2C9XA 1FNAA 5GS0L 5L8LB 2V6HA 2HPTA 5G4OA 3QRGL 4P91A 4ZSOA 1AKJD 3FUFA 2YEVB 3CDZB 5ENWA 3IPBA 4M8UA 2G5BB 1CF8H 2I7OA 4BA0A 2WM0A 3C5ZB 3SQBB 2ADYA 2J2ZB 4KY1L 4LPYA 5LUMA 1GPOL 3TEYA 2WOYA 3GMLA 5AALA 5E2JA 1VKXB 4OF7A 3D08A 1NWPA 3FCGA 3NIDF 4JFEA 4QTIL 1K4DA 1T1ZA 1M7IA 2Z62A 1ZA3A 4B95C 1QBBA 1P9MA 2OJEA 2X3BA 4XN5A 1KLUA 2YPVA 1NZRA 1VHPA 1LNUA 2ED8A 1S7SA 3KVDD 3UEZA 5BRZB 1FQVA 1MCWW 2CGRH 2CQVA 4XN2A 2JQDA 2CJTA 3M88A 3VQLA 4BA8A 2YAFA 1V54B 3OB0K 4UILH 4P46D 2DF3A 3HRZA 1A9EA 2YGQA 3LEXA 2ZKXA 1YEHH 4CC1A 3QFJE 2WXRA 4N9GA 3MR9B 3N85L 4UOJA 2EDEA 3DO7A 2YKKA 1U8IA 2V17L 2P80A 2NX5A 3EBIA 5DD6B 4PJ7F 2V9TB 1BG1A 5I1AA 2FIKA 4ERSL 3LNEA 4WU5B 5CFAA 1JWMA 5E2VH 1CYWA 1SXCA 5C3TA 2VSCA 5HYQA 5DI8A 5ADOH 5GZNC 4HWEH 1KZQA 1JF1B 2WP3O 1OGAE 4MA7H 5D4IA 2CIKA 1PTZA 2GJPA 1KDJA 3AS0A 1L0QA 3H54A 3WTWA 4KT1A 4RMQA 1UXMA 2V37A 3IRCA 1URIA 1RK0A 3SKMB 4BE6A 4ZFFB 2J1ZA 2C34A 4OCSH 4W4OC 3WPHA 1WCBB 1QEWB 1W8OA 2DWEA 4JRLA 4HHAA 3CIGA 4HDIA 2WWOA 2IALA 2BMKB 2BWDA 4MXQD 2YPLE 5FGCB 1N6UA 4U09A 4ENEC 3ZU8A 3KPLA 4HWZB 1KBGL 4YLCA 5C0BB 1TMQA 2X42A 4HH8A 1WQVT 2DLEA 3T71A 3Q05A 2D3JA 3FB7B 4K23L 3UTTD 4HETA 3VTTA 2BNRB 1TQWA 3NZUA 1XEUA 3TH4T 5LBSH 4RFEB 3ZDZF 1HK6A 3HJEA 3AMKA 1X7TA 4DERA 5HDBE 2UY6A 4F5CA 1QHQA 1XAUA 4YH6A 3WCYA 1E9QA 1AXTL 1F42A 4LEBA 2E47A 1HL5A 2GBTA 4R5VA 4QRTB 3H3KA 3BKCH 5H35B 3WJLC 4L5FL 2V5SA 3KYKL 1LHZA 2QTVA 2ETWA 3BVNB 3TONA 2P26A 2AKRA 5JW5B 4O2EB 2FT8A 5D6DA 3RJ0A 3ABZA 3K4DA 2OK0L 3COOA 3S36X 5IB1A 1V7MH 4XNZB 4Y5VA 5I1HL 2E4TA 3OJDA 1B2WL 5EC1A 4J8RB 3IXTA 2DJSA 1CIDA 3QXAA 3SDCC 1KOHA 3SKJH 3CN0A 3DV4A 1U8PB 3MNDA 2HG5B 4OQTL 5GRJL 2AQ1A 3DIVA 3V0JA 1IM9B 4C56E 1SBSL 4G1EB 2W5PA 3VA6A 3D4YA 3GO1L 3LRGA 4YE4L 4DVRL 2OA9A 3ULUE 1KEML 4RMSA 1SYSB 4GRLB 4P4KB 3Q5OA 4IDJL 3V6OA 3DO3A 3U7AA 1U8OB 3MNZA 4JCLA 1D5MB 3KPNA 2OR7A 3HVDA 1YAIA 4KAQH 3RZCA 3IK2A 4XZUA 3PWJB 3HAEG 2VERA 2UZIH 2AJUH 1NCIA 4GI6A 1U58A 5DUBA 4X98A 2QSVA 3K46A 4IBTA 4OBSA 4YHZH 4OCYL 2Y7LA 3K6OA 1I3GH 1FFOA 1T2QH 2RQ8A 4PWEA 4J6IA 3GHBH 3UC0L 3FRPG 1G7MA 5MERA 2AW2A 1MW3A 3MFFB 3R19A 1RJZA 1AC6A 5I18H 4JLRB 2HJKB 1JXKA 5DZAA 3FUEA 1K8DB 2Y06L 2LAAA 3QUMA 3V0EA 4HUVB 3FTYA 1WEJH 3HCVA 4G9FA 3MNWA 4PU2A 3ULUC 4FFZA 3ESPA 4WWKC 2XWCA 4PRID 1CDHA 1E4XH 1UT1A 2LW3A 1MCOL 1TU2B 4XP4L 5F97E 3F2LA 1BVKB 4PRIB 2Z31B 3L5XH 2X4PB 5BW7A 4L8DA 5KBMA 3FU5A 3OXRA 4YDVB 3KYNB 3OPUA 5JOFA 2HT4D 3I02B 1T04A 3HFFA 1NFKA 2W0PA 4GW5B 4YDZA 4UCFA 4XN8A 1ZXKA 4R8WH 3ZTNH 4Z3IA 4H8WL 4NQDA 3FS9A 3HPJB 1OK8A 4TLUA 3UXFA 1XF1A 2ASSB 2DQTH 3RKDC 1F8TL 2ADIA 1F13A 1MHPL 1TZGL 4U3HA 1I85A 2XG4A 4JEGB 4A55A 3N44B 1N8OE 2W9DL 2N59A 3CG8A 1ZHBA 2C7UA 2YAQA 4E9LA 5HGHB 5L2JA 2P47B 3GSQA 4OZHB 5BXFA 2UZPA 3Q3GB 4EI5A 1A6WH 4XMUA 2AEQL 1YPZE 4ORZC 3D4GA 1MJ7L 4MJIB 5IG7A 4XVUC 1QLFB 3CVHL 4FXKC 1C5CH 4HWBL 4P23D 5GZOA 2NYYC 2QLVB 3DIDA 1F6LL 3DETD 3MGAA 4JFOA 5FA4A 4G1MB 5D70L 4BUGA 2GEEA 3DVFA 4K2UL 4ZMYA 2BRQA 3FZUC 4P5SA 2AQSA 12E8L 1TTRA 4ZO7A 5DRNB 3NZSA 4QXUL 5CWSB 1FAKT 5EEWA 2MHAB 4N0UE 1WO2A 1MCSA 4GP5B 2ERJC 4W68A 3LHPL 4XNQB 3SKOA 4TOYL 4H2AA 3HG4A 3VX0A 4PGJA 4LF3A 4W6XB 4XC3L 1XDTT 4N0FB 1NEZB 3GRWH 4N5ED 5EU6E 5JORB 3ETBJ 4UI2A 2WB1A 5EEZA 2G4EA 5K93A 1D5RA 3O53A 1M4KA 2WQ8A 3MV7A 1KN4L 2CKNA 3EHBB 3M8OH 4FDWA 4GINA 3K6SB 3QRFM 3EXLA 2PPFA 5GRUL 3SGEH 5T1DH 3AZUA 2VLJD 2AV1A 1NQBA 5DZLA 4JPVL 1BLNB 4UDTA 5EIIG 4O02B 3JWDH 4B60A 2OV0A 1NGXA 2AQ3A 5MP6H 4A67A 3E2HB 4ATTA 1YNTB 2VLJA 1FIGH 2ESVB 3NAAH 1KIUA 1CXIA 1DZBA 4KZDH 1A6PA 4WI0B 2V70A 5IQNA 3K91A 1HX0A 1UD4A 3C5JB 5DK2B 1IC5H 4UQ3A 1INEL 2YUVA 3HC4H 3CHOA 4K94H 5IFJB 4MMYA 1A7OL 3B2DC 2TSBA 3WUWG 3BUYB 1BJ8A 1KT2A 2JELL 3B6SA 3OZ9H 4I3GA 3SGKC 1S3RA 5F9AC 5T1KA 2PYFA 3GMOA 2P1NB 1CC3A 3K3QA 2F0CA 2A3TA 3GMNB 3JTSB 2VT0A 3GGWA 1V8HA 1S6NA 1G9NL 1QWNA 1XMWA 2XQBH 2Y5TB 3O45A 2DV6A 2X1PA 3NCJH 2JB5H 3ESVF 1AHMA 2QSCL 1HXMB 2C3VB 4WFFD 4B97A 5IHBA 1HL4A 3AWFA 5DRNA 4QTHB 2CKBB 2WXIA 4WGKA 3ZLQC 1PY4A 4P23A 2IPUK 3OAWA 3H7BA 4OZGA 2NYKA 3QDGE 4AMXA 3RVVC 3I2CH 4MD4A 1M53A 1OTUD 1PY0A 2B2XH 4K5OA 3O6FB 4XPAL 1C7TA 2ODHA 3BJ91 1X5GA 3HKZA 3O6FD 3H7LA 4YSPA 2V2TB 4NQSB 4GSQA 4GPVA 1J8HD 4AIZB 4PI0A 2XKUA 5L4JA 2W9EL 5GS1A 1MW0A 2NPLX 4K23H 2VDLH 2J8UE 1OAZL 5C08B 2CJSA 1QSEA 1UADC 2XX0A 5LBSL 1RUMH 4ZD3L 5IT2H 1LE5B 2XU9A 5IQ7L 4F3FA 1GC1L 2CO6A 1SRDA 3UACA 3P69A 1DE4B 4JY4B 4FCGA 4Y5XB 4KROC 3ZDYE 3WEOA 3DJTA 3TVMB 4KDTC 1ESOA 2YWYA 1I7RA 2I24N 2ZWSA 2HJFA 4GW5A 5DJYA 3X3FH 3NIDE 4DVBB 5EEXA 2ITCA 1ADQH 2Z93B 4CW1A 4Y4FC 2YZ8A 3BAYA 4PJEA 4QRFA 2CCWA 3PAVA 5I75B 1Q9KA 1NPJA 1MFEH 4I89A 3SOTA 4BZ2A 2Q8BL 3S4SA 1EJFA 1NANH 2GYSA 4QWWD 2C1OA 2VWEC 3L6FB 3MRGA 4M1GH 3ZE2E 1IGCH 4PFEA 4ZW7A 1RP8A 2DQ6A 3IGAA 4QJ5B 3UPRA 1K6QH 1YEHL 1AXSB 1BVNT 1D7CA 3HI5H 3CQFA 3NIFE 1EK3A 1AQHA 2RALA 2VZTA 3MRLA 1S46A 5MERB 2JJTC 2F74A 3CFTA 5HDBF 5CS7A 4GQPH 3B9KA 1AD0B 2BP3A 3MX0A 2UWEB 2XVLA 1TENA 4WUUA 1PNCA 1BD2A 2R2BB 3HNTL 2AJZB 2XTLA 1OO2A 1QOKA 1SN0A 1KTCA 3BZ4A 1U8OA 3ZKMD 2XIIA 1YQVL 4P48A 2CBPA 3GSOB 1WT5A 2D3VA 2F08A 2PXYC 4TM9A 2FECI 3ZDXB 4CNIA 1NKGA 1G43A 1QX1A 5DHXB 4XX5A 5CGBA 3BP4B 3V0WL 5DEZA 2XX1A 1VRSA 3HLAA 4JR9L 2C8NA 5J3HC 5EIIA 4UT9A 2XICA 2GTWB 2PETA 1O75A 3QXAB 1WGVA 1JPSL 2NSQA 2R69A 3O3BA 4ODXA 1SPDA 3CH1B 1E8XA 3DOSA 4WKXA 3FB8A 4BDVA 4HUNB 1BD2B 4G2AA 3MV7E 3B2PA 5J13C 4ZMNA 2B5IC 3I74A 3G08B 2P52A 4D8OA 5TD4A 1NPNA 3RX9A 2ENJA 3BKCL 5H37G 4O00A 4WCYL 3WJLA 1E9QB 1UUSA 1B88A 3DPDA 5SWZB 4XVTH 1PPIA 2I5YH 4R8WL 3VAEA 3KL5A 1QRKA 1AXSA 3CVCA 1R17A 4W6WB 3T0ED 1N18A 2R4RH 1KV7A 2F5AH 1YN6A 4KNTA 3UZQB 5AVWB 3DX2A 1T22B 1ZRUA 4ZS7L 4D0CB 1F11B 4AEIL 1F3RB 1WFJA 2XPGA 1SHXA 2X4RB 3IAGC 1DQKA 5BV7L 2MMXA 4M6AA 2Z0UA 1JWSA 1YHPA 1GKOA 1W0WB 2J1WA 3SE4C 4Z61C 5DC0A 1P8VA 3K74B 5AB0A 3ZHKA 3CZNA 3MRRB 2VR9A 4ZMWA 3FTXA 1DN0B 5HI3D 1KEMH 4OIAA 4JG1H 1MZYA 1UATA 5FCSH 1XZ0A 3L7FB 1RUPH 3D52A 4MMXB 1LE5A 1FI8C 1E6OH 1OSPL 4N86A 3EDDA 3IM1A 2PN5A 4Y2OA 1L7IL 3BEWB 4LLMA 3HAEH 3X13A 4TLKA 1MCCA 2O5YL 3QNYA 1L9PA 3MV8D 3QEHB 4FMVA 3PWLB 1IKFL 2F18A 4XNXH 4LMQI 3CX5K 3DC0A 1NKOA 3OR6B 2FIKB 4FLOA 2J72A 4PJGA 3MA9L 2BSTB 3DTDA 3ZZLA 3TYGL 3MV9E 2ZSWA 4XNYL 4BQ8A 1FNFA 3WO4B 1RY7B 1TDQA 1TTBA 2E4FA 1BIHA 2ZF9A 3L3HA 3E3ZA 4NQXB 5H8DA 2X1WL 3W2DH 3VQ1C 4X5WB 3QZWG 1ASPA 1MCOH 3BAEL 3FRUA 4YOKA 4ZUUB 3UTSA 3RTQD 2Z31D 2Q86A 3E0GA 5DK3A 2LU4A 1JHKH 1BM3H 2NR6C 2OKMA 2BH0A 2Q3XA 4GRLC 1D5BB 4JFED 4JVWA 2XKSA 4AY9X 2H41A 2A6JB 1K4DB 4R2GD 5SWSA 1MJ8H 2AI0H 3Q43A 2BSED 2H45A 3EJUA 1FNHA 3DXAD 3GSUA 4UQ3B 1YEDA 1ZA6A 2YQ3A 4M93B 5D7HA 1X4ZA 4LBEB 1EVTC 3X3GL 3BPOC 4UF7C 3VFMA 4MNQD 3DX7B 4M02A 4K5PA 4U06A 3GUTB 4PRNA 4KUZL 1CGVA 3A4AA 5B1JC 2VSMB 1TJMA 2RD0A 3O2WL 3BWZA 4N2FA 1M56B 1UM5H 1XZWA 5EU6B 3OLIA 3VXNA 1DCEA 1F41A 2DICA 1A6WL 1Q1PA 1B2YA 4G6AD 4WJG3 2F8OA 3HNVL 4NFCA 5GGVY 1AXIB 1BHGA 3MLSL 3QS3A 2WHVA 3TA3A 3HBGA 3QQ4A 3G04A 3WLBA 3N1FC 4MJ6A 2B59A 3S3DB 2B2XL 1MFAL 4HCRL 1E8YA 5FYLE 1FCGA 4I1RA 1I4FA 2GAZA 5LKNA 4M62H 1NUDA 1JMZA 2G3XA 2F7RA 2HKHL 3KBEA 5SWQB 5GS0A 4RCAA 4LLVA 2QEJA 4FXGB 1K5DC 3MLUL 1R75A 1JGLL 2AK1H 3SYAA 4EN2A 2P8MB 4MS6A 3SO5A 4AT6A 4H1LB 1A65A 4Y16D 2VLLA 2FEEI 4TVSa 3RY6A 3WSQL 5ITBH 5K9KA 2H6OA 1T7VA 1ZSDB 5MEOB 1PAMA 5INDB 2GIXA 1N7MH 1NCWH 3UTQA 2BY0A 1FL5A 1IC4H 4CNCA 4QRRE 2IQ9L 3CVBA 4KBPA 5LCVA 3ULVL 5HHMB 4X4MA 4ZFQA 4LI2A 3GIVB 3E4GA 1C08B 4MA1C 4X6DE 2QVTA 2BS8A 1JZJA 2P7TA 1ZHBB 5GS0H 4GSXA 4YXHL 4BFRA 1TOXA 2BC4B 3HEIB 3WJMA 4IOFC 4M1GL 2Y5QA