3BZ5A

Functional domain of inlj from listeria monocytogenes includes a cysteine ladder
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
450
structure length
450
Chain Sequence
TLKAGQTQSFNDWFPDDNFASEVAAAFEMQATDTISEEQLATLTSLDCHNSSITDMTGIEKLTGLTKLICTSNNITTLDLSQNTNLTYLACDSNKLTNLDVTPLTKLTYLNCDTNKLTKLDVSQNPLLTYLNCARNTLTEIDVSHNTQLTELDCHLNKKITKLDVTPQTQLTTLDCSFNKITELDVSQNKLLNRLNCDTNNITKLDLNQNIQLTFLDCSSNKLTEIDVTPLTQLTYFDCSVNPLTELDVSTLSKLTTLHCIQTDLLEIDLTHNTQLIYFQAEGCRKIKELDVTHNTQLYLLDCQAAGITELDLSQNPKLVYLYLNNTELTELDVSHNTKLKSLSCVNAHIQDFSSVGKIPALNNNFEAEGQTITMPKETLTNNSLTIAVSPDLLDQFGNPMNIEPGDGGVYDQATNTITWENLSTDNPAVTYTFTSENGAIVGTVTTPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and standardized geometric analysis of InlJ, a listerial virulence factor and leucine-rich repeat protein with a novel cysteine ladder.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell adhesion
molecule keywords Internalin-J
total genus 147
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bz5A02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3bz5A01
2BNHA 4R6FA 3BCDA 3GOZA 2V70A 4R5CA 2Z64A 5B4PA 3M19A 1P8VA 1SQ0B 4AY9X 3ULVA 4CC4A 4AW4A 4FHOA 4WP6A 3RGZA 3REZA 3ZYIA 4U08A 1DCEA 2P1QB 1M42A 1O6VA 3OJAA 4PERA 3E3ZA 5AWCA 2O6SA 4CILA 3PMHG 4FD0A 4LSCA 3BC9A 4CP6A 4LSXA 4QC0A 3OGMB 1DFJI 2JQDA 5LFNA 1K5GC 1W8AA 3C6NB 1Z7XW 1OOKG 4G8AA 2OMVA 3RW7A 4R09A 4R07A 3RGXA 1M0ZA 4R6GA 5FTTB 4ECNA 1G9UA 2JE0A 2ASSB 4TZHA 3JB9j 3UN9A 2P1OB 4L3AA 4BSRA 3WPDA 3CIYA 5IYXC 1H6TA 4P8SA 3FXIA 4H09A 4BSSA 3W3MA 3VQ1A 4LXSA 2Z66A 2C9QA 4U06A 1K5DC 3TSRE 4V2CA 4C2BB 4Z64C 4Q3IA 4Z79A 3W3LA 4M7EC 3RJ0A 4Z8GA 2BEXA 2V9SA 1M10B 4HQ1A 3G3AA 3RFJA 4ARRA 3W3GA 2UZYA 2ASTB 1A9NA 2Z65A 3WPEA 3C6OB 4R0AA 2UZXA 1O6TA 3ZYOA 3WPHA 4XGOA 2Z81A 4Q62A 4KXFB 1A4YA 3FAXA 2RA8A 4BV4R 2OMXA 2WQUA 3O53A 5AWBA 3P72A 1OZNA 1GWBA 1OTOA 4P91A 3RFEA 4BSUA 4ECOA 2OMYA 5GS0A 1P8TA 1M9LA 4LI2A 5AWAA 3CIGA 4WYKA 1FT8A 4EZGA 2FT3A 2CA6A 3UL8A 4J4LA 5AWDA 4V2DA 2OMUA 4GLPA 2XWTC 1OTNA 3OGLB 2P1NB 5IJCA 3W3JA 2R9UA 5D3IA 5AZ5A 4R58A 2OMWA 4UFRA 4Z94G 2JE1A 3OGKB 4FCGA 2Q4GW 1JL5A 3ULAA 4MN8B 3UL9A 5GMHA 3DZEA 3BZ5A 1XEUA 1FQVA 1OTMA 1XKUA 3CVRA 4I6JB 4XOSA 2Z63A 4PKIG 4M7EA 3FAWA 1WWLA 4GT6A 3WPFA 4RCAB 4OQTA 4AQ1A 1OGQA 4V2EA 4CC4C 5A5CA 5IJDA 3G04C 2P1MB 1OT4A 1D0BA 1PGVA 3C6PB 1XWDC 3M18A 4K17A 4L3FA 5GS2B 3G06A 5IJBA 1XECA 1M9SA 3RW6A 4U7LA 3W3NA 4YEBB 3ZYJA 3O6NA 4ARNA 2OMZA 2V9TB 1QYYA 3E4GA 3KJ4A 4J0MA 1IX2A 2O6QA 2ELLA 3OJAB 3BCFA 2ID5A 4KT1A 2RR6A 4LI1A 4LXRA 1DS9A 3E6JA 2Z62A 2C9RA 3WPCA 5B0NA 1KOHA 4KNGA 4R6AA 4PQ8A 2O6RA 1FS2A 2Z7XA 2WQVA 5HZLB 3ULUA 3WPGA 1KOOA 2YA1A 4NKHA 2Z82A 4Q3GA 4QXEA 2IFGA 4CNMA 4LSAA 3RFSA 3ZYNA 2WQWA 5GQRK 2C9PA 4R08A 4MQWX 3E2JA 4Z61C 1IO0A 1XCDA 3WPBA 1FO1A 1LYQA 2Y5QA 1YRGA 2OMTA 2P1PB 1U0ND 3VQ2A 3UL7A 4RWTC 4R6JA 3A79B 4RCWA 4XSQA 5CMNA 4LSXC 3WN4A 5B0TA 4PEQB 4R5DA 2XOTA 1H6UA 5ICUA 2WFHA 4C2AB 2WQXA 2Z7XB 4IM6A 4PSJA 4B8CD 1O6SA 3W3KA 4Y61B 3WPIA 5GMGA 3G39A 4NKGA 2RA1A 1LTXA 3RIZA 3G3BA 1NM4A 2A0ZA 4CNCA 3SB4A 4QBZA 4U09A 4FDWA 5HDHA 1ZIWA 4FMZA 5GMFA 4FS7A 1P9AG 5CMPA
chains in the Genus database with same CATH superfamily
3RY6C 3X11A 2IANA 4MWFA 3FRPA 3I6GB 1TJMA 1G7LB 2I60L 5IB1A 3WIFB 4B9JA 1B6UA 1T20A 2QADC 1NBQA 2HJKB 3O9WA 3T2QA 4JHBA 4I18C 1JNNL 5CIPH 1DUZB 5DQ9B 1E6OH 3MACL 1KLFA 1YJDH 4PJHB 4UT6A 3UPCA 4IIQC 2G30A 3LH9A 5EU6E 1IC0A 3CIYA 3A4AA 3EO0A 1T89A 4H09A 1YEGH 2OMNA 1OGTA 2QHRH 2EVFA 2B5IB 4E9TA 2AEWA 2NPLX 4FX5A 2BP8B 1KJMA 3NCMA 4GXUN 4KTEH 2H32H 2R1WB 3NIGE 1JCVA 4HXAH 4XAKD 3Q2NA 2HX7A 4PH8A 5EULV 1QAWA 4ZPTA 2WXJA 5KSVA 5EEZA 1XF4A 4DEPB 1XR8A 4Z7OE 2PYFB 3D69B 3FQRB 2DH2A 5KJRL 3L81A 4FTVA 5IB5A 5JO5B 5H4ZA 1A4KA 5T1DL 4XNXH 5CZXC 3TVMD 5A6IA 4MCMA 3SE4C 3VFMB 2IXQA 1U8MA 2NY0D 3RWJB 4A39A 5E7FA 4GSXA 5HYIA 4LK4A 1B0IA 3QUZB 4RDQG 1K4CB 2HN7B 2IFFH 3QDAA 3SKUD 1BA9A 1S6NA 5JW4R 3QUGA 3RA7L 1K8IA 5G4OA 3F83A 2BCKB 1AG0A 4JUSA 5IMOB 4FI7A 4KFZC 2HKFH 1GZPA 5AFAA 3HNTL 2OMVB 1WAAA 2HX8A 4NQCD 3ULVC 4JFEB 1WCBB 1IIIA 1M7IA 3EF7A 4BFOA 4M5ZH 3SKMA 5EZJB 3BAEL 5L4IA 3LQAL 4M6NL 3REWB 5IFHL 1KB5L 3GKWH 4GSDH 3D85A 4KQ4H 4QEGA 4D9RD 3EFOB 4FXGB 4L8CB 3GLEA 2Z7YA 1VFBA 3AGWA 5CZVL 2UUDK 5HI4C 3SKNB 2XLLA 4HSQA 3G04B 4NENB 1X5GA 4KMTH 3SDCA 25C8H 3TYFA 4F7MA 2ICWI 2IFGA 1R3JA 4ZJ9A 1E3ZA 3UTQA 3I9AA 4QHKJ 5D72H 1DBJH 3GXNA 2DYSB 4KK5C 4QT5A 1HHHA 1N64L 1U93B 3OPZH 1Q72L 2MQCA 1FZJB 3TCXA 5EA0L 1KOAA 2VLLA 4K15A 2AQNA 5I1IL 2FLMA 4MLIA 4PRHB 3EYQC 3FFCA 2Q9OA 3JTBA 2JI3A 3W0WB 3H85A 1KCUH 3RGVA 1KJ2B 1M3JA 3O2VH 4N0RA 4YDKH 1EHLL 2ICEB 2X3BA 1IEAA 1BGXL 3K6DA 4D0DA 5DUPH 3D39E 4M1DH 2DWDA 2Q86A 2NR6C 3QJFA 4OZHE 4DP5X 5GGVL 1NAMA 5IMMB 1I9IL 2LV4A 5T1LA 3WN5B 1PFOA 3U36B 4CJ0A 5AZ2H 3QWQB 2ZKWA 2OZNA 3ATAA 5DTFA 1GSMA 1T0MB 1UH3A 2NY4B 4H2CA 2X9ZA 2XXGA 3L5JA 4QYAA 3UJJH 4LXSA 3MV01 3MCYA 3TYGL 1J8HD 1KFGA 2DTMH 1EEZB 4OKDA 4LRIC 2K78A 4FQQA 3KLHC 3POCA 3GMNB 5I30L 4MJID 4UINL 4BXSV 3VFGL 3IVKA 3DV6B 3WAJA 3U82B 4HUCA 3IU4L 3FU6A 5I0ZA 3QHZH 1PKQA 4WWKA 4Y2DC 3IAQA 1Q1PA 3OB8A 3F2LA 4JZJC 4EOWH 3VJ6A 4DVRL 2WNGA 4V1DA 4YBLB 1KZYA 1MAML 2DWEA 2X3CA 5TF1H 4M7ZB 3U4EB 4P99A 3KR3H 1N5YL 5C0RL 4E41B 2N59A 4CKVX 1V05A 2UWEE 3UJIL 4JKKA 1SN5A 3OSVA 3QO1A 3VFWA 1IKFL 3WV0A 5I71C 2X3AA 2JE1A 1IGYA 3GZKA 3UO1L 5I19L 3CLEH 5L2KA 1PEWA 5MERA 2I32A 5SWZB 2BY1A 5IM7A 3FNKA 3BMWA 1BOYA 4PEEA 4XPHL 2Z6FA 2WWMC 4B6ZA 1LP9E 1HKLL 4X4KA 5DEJA 4WFFD 3KLQA 3T4YA 3MRHA 5DJXB 3QRLA 5ID1B 3ZX1A 3VRJA 2JTYA 1KIRA 3BIAX 1GJWA 2R4SL 4U7KA 4CMHB 5I6OA 3GK8H 1QUNB 1PDKB 2Z4TA 3A3YB 1X5IA 3JWOL 3LQAC 1UB5B 4EDXB 2V2WB 4HAGA 3GM8A 4C58B 3W5NA 2PCFB 2VIRB 2IWFA 1A1NB 5IB2B 3OAUH 2XA8H 2GAZB 3ARDA 4M29A 2NY6B 4NUJA 5IBUG 4BA8A 4YO0B 4U2YA 2XBZA 4S1DD 3CD4A 1HH9A 4PJIB 2VMDA 4BKLA 1A8ZA 1QKZL 3GNMH 2I7SA 4R26L 3SQOH 4W93A 3SDAB 1BQSA 1NMBH 4PJFE 3ETSA 1YNLL 3MJ9A 2N1TE 4K3EL 1JFHA 3MJ7B 5TE4H 1QLEB 1TZ8A 5DURD 1FNLA 3W3KA 1UZGA 2QZ5A 3VXSB 2ALWA 1K85A 1EZLA 4ZFZB 4S2SB 2A6DA 3L54A 1D2PA 3WGVB 2CJ3A 1BQUA 4UQIM 5C3IA 3HEIB 1RPKA 2J6EL 2B1HL 2E86A 3NIFE 5DC9B 2VMJA 3WSQH 3UG3A 5JDJA 1RV6X 3AXLB 3SDXE 4X4YB 3WDJA 5EZLA 3ARVA 3PQYD 5DMGD 4EZLA 3AW5A 3CK0H 4NXSA 4RWHA 1F58H 4PG2A 4Y4KD 3RVWC 4R09A 1KACB 1P7BA 4ZMTA 2PNDA 3O4LB 3LEVL 4F58H 4KROB 1D5IL 1I1RA 5CEXA 3ZTJG 1GAFL 4JW3A 4FQJH 4XNYH 1DANT 4FI6A 1CBVH 5EZPA 4NYLA 1SJHB 4XE5B 4R7LA 3ULVF 2GBVA 4LOUC 1VADB 4Q6IC 5IMLB 4R0AA 4M00A 3MTXA 2FB4H 2H5UA 4PLKC 1IGIH 3FAXA 4O02A 4MJ5B 2HT4D 2FBOJ 3MREB 4Y9BA 4P91A 3RFEA 2X42A 1G9ML 4WUUB 5KWYC 4Z0BH 1I1AA 4AQAA 3FU7B 5EC1A 5KN5B 3FPXA 3B5HA 2ADJA 2J57A 2FIKB 3O4OC 3UIZA 5ITBH 1X7QA 2NY5H 3QRGL 1A2YA 4QNPE 1F4WH 3ROLA 4FXGC 2YPLD 3K4DA 1WBYB 1UOVA 3O4LE 4H88L 1XGYH 4PS3A 2AVFA 5I76A 4YFDB 5EPMA 3SKOA 4KRMB 1IGJB 3ZVVA 3DX7A 5BRZE 3OKOA 3S3CB 3CZEA 1CS6A 4KJYA 2DAVA 2XTLA 3LNDA 2AS5M 2R8SH 2LLNA 4FADA 1JHTA 2CBMA 5GJSH 2BVOA 3TBTB 3BP4B 3ARGC 3BYYA 3OLGA 4K8RL 4OLWH 5DD1H 4K3HA 1ECYA 5DHYB 1LP9B 4LL9A 1ULVA 2OZ4L 4Z7NB 3MRIA 3ROLB 3U25A 2DWDB 3P77B 3JVFC 1E8ZA 3MUGA 4MAUH 4K3DL 3GSVB 5IVXE 5GS2H 4KXAA 3GMRB 4M6OH 4XXWC 2J55A 1PLGH 5AW6B 5TQ0L 4AIEA 4WUUA 3JVGC 1RURL 1FHNA 2QKIC 5KN5A 3BVTA 4XVUC 4W9CC 3N41F 4R5DA 2VC2B 3TH2T 4B41A 4NKDB 2YAOA 2CGZA 3L7EB 1FBIH 4FNTA 4P5MB 4O51B 4Y61B 5GGRB 3V0VB 4JG0H 5D1ZA 1NM4A 4AUJA 3P3TA 4X4XB 1ONQB 2WXQA 5DJ2B 3RFZA 3DURA 1WZAA 4HA1A 2WTRB 3HRZB 2APFA 5AYUH 1SFDA 2VQTA 4FZEH 2BNHA 3QIWC 4OM0H 1O7SA 1WTLA 3P1VA 3KWUA 1R3KB 4CUCA 1R1CA 3EJQA 5IW1A 4OZHA 1AD0B 4Y9FA 3HPLA 1DBAH 2QVFB 1Y0LA 2Z8RA 3OXRA 5IQLA 5E8EB 1CF8L 2JK5B 4JM2B 1XH3A 2HT4C 1J8KA 3K46A 1RK0B 4Q2ZB 4BV1A 4GKZB 4MD4B 5ESVB 5HJGA 3DECA 2VDOB 1XQ4A 2Z4QA 3IMUA 2R1XA 1HHHB 4N2IA 5F1IB 4G3YL 2IPTL 4PJCA 1A6AA 5GRZA 4IOFC 4Q3IA 4LKCB 4LU5H 1YEKL 1A7BA 3N44B 1L9RA 3MRQB 4P23A 5CZKA 3CHQA 3VNZA 5DJZB 2Z93B 3F6JA 3LN5A 4MMXA 1W0WA 2X9WA 4A2DA 2VO8A 3A6BH 3RHWK 1U8LB 1Q38A 4B96A 1D5MB 3O4OB 4WY7L 1UGKA 1JVOA 2OJEA 2ZP9A 3ECUA 4ANXA 5IWLC 5LG1A 1P84J 1AR1B 3JWNH 1OO2A 3AU1A 3PQYB 4RIRB 3WTSA 4I3SL 1BPVA 1WFIA 1P8TA 2ZOOA 3MDJA 4KI5C 5I6MA 3DPDA 1YY8A 1R3KA 2P1NB 1CE6B 5AKTA 4R58A 1YNTA 3F5WA 2IH3B 5CMAB 1BXXA 1VESA 3LN4B 4XP5H 4YUEH 5E8EA 2JQZA 5EIIB 3B34A 4Z7AA 5IIEB 4JPVH 4BDVB 1HNGA 4JZNA 4OQTA 4PBXA 4WW2C 3ZHDA 1OGQA 1FRGL 2H1LM 4K9EC 4OGZA 3V0GA 3OKDA 1N4XL 5D7SL 5IROA 4XWOC 4ADGA 4NPYA 3VM5A 3FYIB 4ERSL 1F1GA 3MOAL 4JGUA 4E9XA 5JDSB 2OMZA 2ZSWB 1SPDA 1UWFA 4Y1AB 1KTLB 3L5IA 1G7QA 3M7FB 4G6FD 3SE3C 2WO2B 4UNUA 3QDMD 4NUGH 1QBLH 5JPMB 4JRLA 4XODA 2V17H 1D7BA 4ZD3L 4RMQA 4WAFA 4Y4FC 4YOKA 1RZ7H 1VAHA 3IRPX 3T8VA 2AITA 4N1EA 3N5AA 4RWTC 4M5ZL 3R7RA 4LO9A 3RAJH 3F84A 2EILB 3OD3A 3FT4B 4GS7C 1WYJA 3ULUH 2V3EA 4PY7B 5DD5L 4NJ9L 2TAAA 3GI9H 3VXOB 4TQIA 4M61B 1DLFL 3WL9A 5ANME 1KBWA 1K9TA 4HT1H 3H0TB 4F8OA 1R3HA 3UJIH 3ARBC 3D2TA 3UJTH 1A6ZA 2RIKA 4NNPH 3TNNA 4FQXD 4XPFH 2X05A 1JZ2A 3PWUA 4JCWA 5FLVA 1J1XH 4NPYB 4ZSOA 2X4NB 2ZOWA 3VD5A 2ADYA 1JWMB 2B3RA 2FWLB 4S0HA 3QJOA 4JQIA 5CSZB 1AI1H 1G87A 2J73A 4XNYL 1V3JA 4ZW7A 1SUHA 2QSCL 3GTVA 3UTTB 4HGKC 1I9IH 1ICTA 3DRQA 2J6EA 3L13A 3CAFA 1RJCA 3FMGH 5IHZB 3WEOA 4N0YL 43C9A 2BVQB 5E24E 1NFDF 3BZ4A 3OXSB 5CEZE 1BD2A 3CU1A 5D4JA 1GR7A 3N41B 5D2LA 3JXAA 4L8DA 2EYRA 1BMWA 3KS0H 4HF5L 3MV8A 3S34L 1MHHA 3RFJA 2F8VA 1TMQA 2VZTA 3C8KB 5C0FB 2ZWNA 5CD3A 1UH4A 2CCVA 3CQPA 4L48A 5GGQH 4Q62A 4XCEA 4LASH 4OCYH 3NN8A 5T1JA 1KULA 2MNJB 2WWMD 5JW3L 2AVGA 3KGUA 4QAWA 3UYPA 4WO4B 1SMDA 3LS5L 1WV7T 3GBLA 4K94H 5FKAB 5JOEA 1HSAA 2Z92A 3Q44A 3PABA 4JY5H 4OT1H 5EEWA 4KMTL 5EBLB 4N2BA 4HW6A 5HY9A 2B1OA 4R5XA 4WF7A 1IC1A 1QW9A 1SF3A 3WS3A 1WWLA 3MV7D 3KW7A 1IBBA 1NA8A 4XN7A 1CL7I 2NSMA 3IBEA 1SLUA 4NQQA 3CDFA 3KHOA 3H9SB 1AGFB 2V9TB 1CG9B 3EXLA 1EMTL 2W88A 3ARGD 3UL4A 4NN5B 4Y19E 3FQUA 2H0JA 1N9PA 2KH2B 2E9IA 5FW7A 2XG5A 4X5XA 2IALA 4PV1C 3K74B 2H2SC 4LCCB 1HWHB 1IM9B 1U0ND 3FUFA 3V6OE 4MXQD 4YSTA 4YHPA 1IL1B 3WG7B 3RIFF 1USQA 2C7UA 1H6UA 1S7SB 1LEKA 1LEIA 1EQWA 3BPNB 4K3JL 3V9FA 5I6LA 3QIWB 5KSVB 1DJZA 4FFTA 2IH9A 2Y25A 1VZIA 3K72A 4I77L 3NQKA 1DBAL 3QT2A 2DL9A 3GC3A 1H8LA 4KUZH 4YFLI 1RHHB 3PQYE 2IG2H 1A7OH 2R56L 3QZNA 1BSIA 3FONB 5INDA 5LNDA 2DQIH 4XMLL 3C6NB 2EKSA 4MFHA 4I1PA 2CG9X 5ID1A 3QA3B 5HPMB 5F7NC 4DGIH 5FFOA 5ETUB 3TIEA 2FO4B 4XPTL 4UOJA 2V5YA 5FUZH 5FM5O 4YDVB 3U7WL 2YPKA 4QRRA 1T0PB 5I8OL 1TQCC 4YS4A 3WTVA 2V2TA 4XXDB 4LFHG 3VWJD 3KLDA 3ULAB 4P2RE 3T9WA 2AABL 3LD8C 5CCHE 4PTTA 4R2GB 4M7LL 1GOGA 4U1HA 4Z7NE 3VU1A 4HIPA 1TTCA 1ZV9A 2A6KB 4RGNC 2AQQA 2P5WE 4P57A 5KANI 1U9KA 5D2LF 4XMVA 9CGTA 3Q05A 3ULUL 5AQ0A 2P1YA 3CXFA 4N86A 2G60L 3K8MA 2VLRE 2A6JA 4IIQB 5CIPA 2VQ4A 2F7QA 1CGTA 3H55A 4MA8L 5DEZA 1GPOH 4QHLA 4WW2F 3TA3B 3B2VL 3L3OA 1W9XA 3EOBB 4OLYH 3DX4A 4HX1B 2BNQD 4JM0A 5KOMC 1AZCA 5DJ6B 4D8PB 4LI2A 2FK9A 5AD0B 4Y4HC 3B3BA 2XV2A 4CSZA 1SY6H 3ABGA 3IM1A 4F24A 3H8NA 3P4LA 1WGVA 4Q9BA 1BECA 5IJCA 1K2DB 3NFSL 3WFHB 3BLBA 1P53A 3CMGA 2DM4A 1CK0L 2WNXA 3WIHL 4RMVA 3BJ91 5IMMA 1ML0A 4TNVK 3VXRB 5C7XL 4ODSH 1RMFH 2HTLC 4PR5A 4IU3B 3TX4A 2E3VA 5CZXD 1K5NA 2EDXA 3VXNB 4MDIA 1EBAA 2ED7A 4B9PA 1G5GA 1QKZH 2ICEA 2YRPA 2C9UA 3C2AH 1TQWA 5I66A 4TL4A 5F3BA 4OCRL 2Z0BA 3VG9C 4P5TB 2Q8AL 5EOTA 2BHZA 2EDHA 3ILDA 4PJEA 4PJEE 1NANI 3IDNB 3QW9A 1JNLL 1HDMA 2NOYA 1SJHA 2VDLL 3ARBA 5HHMD 4DWHA 4F7TA 2EXSA 1U8IB 3P4MA 2M2DA 5B7EA 2DLTA 5F93C 4FLSA 5FYKD 4IBZA 3C5SA 2VXQH 4O2FB 5KS9B 4NN7B 3VMPA 4AW7A 5E9AA 1Z66A 2PO6C 1JGDB 3JYBA 1IQWL 1QW8A 1WITA 2GFBB 2OV0A 3OR6A 4HOXA 2IDTA 4RFOH 3SDCB 1MFDH 1T5XB 3AXLA 3HB3C 4LXFA 3MLWH 4JFHE 4X9IA 1NMCB 1BBDH 2B4CC 2R29A 1WFOA 4XVSH 1GOHA 4PJ9A 3S2AA 2IBZX 2EYTA 3FN9A 4P2OD 4F8PA 1MFEL 3EOTH 2A38A 5CS7A 4PGBB 3REWA 3SD5A 1S7UB 4AMXA 4JPWH 1J8RA 3F7RA 4NQSB 5FO8A 3CSBA 1I8KB 4PI0A 4J5VA 1ECZA 4QWWC 1T21B 4BSVB 2A73B 3AAZA 1BXVA 2QGBA 4KDTC 1WAPA 5KSUA 2BCKA 4EAEA 4LLQB 2IBBA 4YNYA 3QRFM 2RAMA 4CMMA 1E4KA 4YC2C 1IKOP 3DJZA 5BZWA 1NCTA 5C0CA 4UTAL 1A3QA 2VITA 4OFPA 2F53B 1FPTL 2VR5A 4M5YL 3TA3C 3RU8H 5I1EL 5JLZA 3FU7A 5EC1B 4M7JL 4EUPH 4K7FB 3VU2A 2JI1A 3JBG7 2FZ3A 1WC7B 3LZNA 4JFPB 4KUZL 5EBMB 2G2PA 2XZQH 1BZEA 1BX2A 2X1WL 2DQGL 3ULVL 2RACA 4X4ZA 1KN4L 1DVQA 2X6MA 4LSUL 4O58L 1S9KC 3RB7A 1XGRB 1GWBA 4ECOA 4DGIL 2IQAB 3FUJA 3MNZA 1DDHB 2GBAA 4KX9A 2O6CA 4ZFOB 3WIFA 5J9PB 4YPJA 3HCVA 2OTWA 4QXGH 2BWQA 2GG1A 2YLKA 1DLFH 4KKCD 4LF3B 4TLSA 1MCPH 3GSQB 3PS6A 4ETQA 3RGVC 2EVJA 3F7KA 5HYJB 4BK5A 4M8UA 5EZLB 3VWKA 2BS8A 5C6TH 1FH5H 2ZQKA 2E74C 4M93C 1CDYA 1OCRB 1XDTT 2RR3A 4PTUB 5FYJH 5TFSH 2G3MA 1XD1A 1NPJA 1TZGH 3MRDB 4G70B 4AJVA 3C6LD 4P8QA 3VXMD 1ACYL 2XTJE 2Z4QB 4ZW5A 1RSFA 2YEZB 3ZW3A 2IF7A 1NCWL 3JWDL 2FBRA 1J0ZA 3H4HA 4J4PA 4PRPD 3CC1A 1OB0A 3B2VH 1YEHH 4FG2A 3H9YA 1BVOA 3X1EA 2MCAA 5E03A 2AJ3A 1RUQH 3Q8BA 2Q6WA 2P5WB 2LU3A 4FRWA 1UA7A 4GSQA 1EMTH 4GRWE 5LBSH 2R9HD 4APXA 2Z65C 1UURA 3CDZA 5MEOA 3EYFB 4XB3A 1SXNA 5LCVH 1EO7A 3KCPB 4Z95H 1CLZH 1E5UI 3ZSTA 3ESMA 4TSCL 3TIDB 4LIQE 4QTIH 3UEQA 3SCMA 4HIEB 3NK4A 1RKRA 1MHHB 5EOQH 2P5WA 2K7QA 3ZXAC 2UV3A 1BFVH 1C5DB 1UKSA 1ZHBB 2DQTH 4XPTH 5FUZL 5K59F 1A1OB 5LG6A 3AG3B 3CFEB 1JZ5A 3C6SA 3ZO0A 5JHLL 1MVYA 3CFIC 5F1NA 5B1AB 2EICA 4GI9A 1F6AB 4ZFFA 3WHE1 1E8YA 4I9WE 4OCLC 2XG4B 4RESB 5HI3C 3SEPA 4R2GC 2C3XA 1EEYA 5TDNA 3IJSA 3MXWH 5I8EB 4QC0A 3J8F7 5CBEA 2G9KA 3MRIB 2G75B 3L48A 3V4VH 4Z7UB 5I0XA 2VMCA 4GPVA 5CU9A 1QSFA 3TO4C 4M4RA 1KCSL 4LVNC 3HR5A 5FCSH 5GS1C 3RDTC 4BE6A 5D1ZC 2QVMA 1I53A 4HU8A 4HT1L 2MKWA 4E9QA 5EO0B 3CFUA 4DPAX 4UBDC 5EO9B 3QULA 4DCQA 4PJAB 4LVHC 2WUBL 4WEUD 2AXWA 3NG5A 4DIXA 2COVD 4AGMA 4GG6A 4GG6E 2HFEA 4NQDD 1DSYA 1CL7L 3QUZC 4G6KH 1XIWB 5CNHA 2GJRA 4PRDA 1JDAA 4LT7A 5HGAB 5F96H 2GJZA 5JIKA 4S10A 1AP2B 2NTSP 4HWEL 3D0LA 1CPUA 3RL1B 5L4MA 3ZU8A 1BG1A 1F3DH 4BRVA 1SBSL 4G8FA 4HWBL 4JANB 3KPPA 5TDOA 1TKWA 4WNQA 2IGTA 1GKOA 2K7PA 2VWEC 4NZRL 1NC4B 3H42L 4FYSA 3VUAA 3DIDA 3CXDH 3WY3A 5EOCJ 5JOFA 2Z63A 2A4EA 4X9HA 4EI6B 2EACA 3LAFA 3WIIH 2R2HB 3OWRA 3T65A 4FE9A 3M18A 3GHPA 3RRQA 3X2QB 4Z7WF 4TVPD 1F5WA 1R9FA 4X6BA 4WZ9A 2DWSA 2DQEL 2CU9A 2AEOA 5HGBB 3VSUA 3X12A 3OLIA 3HUJE 3ZN6A 2R1WA 4C4BA 1PY0A 1KCVL 4UTCA 4AKPA 2Y5EA 4K94L 2P5ED 2AJZB 4QRQA 3W9DA 3WEMA 4CNMA 3EYSL 1SOKA 5BV7L 4F8NA 4RQQB 3EO0B 5I1JL 3WTUA 3PGCB 4F2EA 1SHXA 1RZIB 2YRLA 4AIOA 4QI3A 3EF4A 2DQHH 3K6SB 1YEJL 1RZFH 1TZIB 4I4WB 4LE8A 4LZKA 3QFJA 5ICUA 1U8JA 4J39A 2VLRD 5K69A 1VACB 3NQIA 3IFOB 2ATAA 2X53A 4KTEL 1KENL 2PW1A 3MRQA 4P23B 3STZB 1JDCA 2BSED 3SYAA 4JRYB 3ZTJH 4ZNCD 4YHLH 5I5RA 1I31A 4XB7A 5F70A 4I1NB 1OB1A 3FF7A 5DJ0A 3TBYB 3V4UH 2HVBA 1MJUH 2XWEA 3UBXA 1XH1A 3O2WL 4K23H 3ZJAA 4JGJA 2DI8A 3ESNA 2W9DL 3MGAA 4H8HA 4KRPB 5KVDE 3ZYIA 1UM4L 2XVBA 5KANG 5KG9A 1HDMB 5E9DD 2E5EA 2XPGA 3MRCA 2NY2D 1Y1DA 5GS0L 2CJTA 4YAQA 4KTDH 3WLWC 4UNIA 3B2UD 2VLJB 4O2FA 4V2BA 4KC3B 2DICA 3ARGA 3V8CA 1HOEA 4JFSA 3NN8B 2VDLH 5CN1A 1UM6H 1XIWC 2F19H 1RJZB 3I50H 3QDME 4UM9A 3SDYH 4HZLB 4KTGA 4O5LH 2D7PA 3KYMB 1F90H 2YGPA 1KMGA 1F1DA 5M95B 4XXWA 4FG0A 3MGTB 4PJDF 5I8KL 1AGEB 1R3JB 5I1KH 1OGPA 3DYPA 4CU6A 4WYKA 3VI3F 1K5NB 3KPTA 1SQ2N 4I1RA 2GPZA 4NAJA 4QRRD 3VG0H 2WWOA 1XZWA 3WEBA 1F6FB 1FL6A 3D05A 4PWEA 5C1MB 1UATA 4LLMB 3TM6A 5SX4H 3X3GH 1UB6B 2VXUH 1FQVA 4LEXH 5SWSD 1G4MA 4TQHA 5EU6D 2OCJA 4FABL 2W38A 5EUOE 4J3BA 4UCFA 4PUBH 4KKBC 3GXPA 5JW4Q 1HH6B 5AAPA 4DTGL 5EDSA 1ANUA 1WISA 1FH5L 1UXMA 2V8LA 5C0AE 4NP4L 5TFSL 1O0VA 3BKJL 5DZVA 1A4CA 4GUOA 2A6JB 2EDBA 3QH3B 6FABH 3EDEA 4KZDH 4BDVA 1E5YA 3IVKB 1MLCA 3EJJX 3SDAC 1P4BL 4U3HA 3ECWA 3W11C 3QNZA 2P9RA 3FH8A 1U8KA 4Y1AD 1BW8A 1VCBC 4G6AD 3V5KA 3BXNB 4IW4C 4AQAB 1INEH 1MY5A 1MSPA 4P23C 5DUMH 2LLGA 4WDIA 1MWOA 4DK6A 5AB9A 4NGHL 3FT1A 1JVLA 1YQVL 1DHKA 3QEUB 1A14H 3PGFH 1MELA 1F0LA 3IETB 5HDWA 3ME0A 3TIEB 3MV8E 4XNUL 5GS1A 1H0DA 4O2EB 4KJWC 3QG7H 3QJHB 1H6FA 5DI8A 1YECL 1XF2A 1PKOA 4HG4K 1JYWA 3AFLA 4Z7QB 2MTPA 1XH0A 2X2JA 4EN3D 1NEUA 3MO1A 4MMYB 5TTRA 4BCXA 2EZ0D 5DHMC 2A9NL 5FUCC 1D7FA 3LIUA 2W80C 1EFXA 3KPLB 3MRJB 5IQNA 4HFUL 3UAFA 1GS7A 1N3NA 2RH0A 4WNQB 4Q97A 1M7UA 1HT6A 5F7KC 4J3TA 3TBSB 2Y4SA 3IDJA 3S48A 5E08H 4M3HA 4W68A 4JDTL 3GMOA 1EFQA 2AJXL 3NSXA 3GEFA 1TQCB 2ZJSL 4YHMH 4PJ5E 2CO1A 4U6VH 5IHLB 4U06A 2YAFA 3OHXB 3SE3A 2LVCA 3EOTL 4ZS6C 4JHUA 1BMGA 1FV1A 1TJGL 1QI4A 3C6EA 4LSSL 2VR3A 3ALXA 5FDYA 1SRDA 2FUTA 3EFFA 3SOBH 1RK1B 5SV4A 2GJ6D 4CVZB 3QUHA 4O2EA 1SOQA 2V2XB 3N55A 1AQDA 4F7CA 4WHDA 1XH2A 4GOSA 1TETH 2E27L 2FQEA 4J3OF 4JFFA 4YDKL 5EOQL 1EHLH 4ZZKA 1FLTX 1IAOB 4HIHB 3P9MB 2NNCA 4KVNH 3K4AA 1NGWB 3V0WL 4LPYA 5CBEB 5ABAA 1JERA 4CA4A 1X5HA 3S0PA 3C08H 2Z7UA 4KKAD 4PM1A 3RHWF 4RGOL 2VN5A 4NIYE 3SBPA 4NZRH 4WI0A 1HK6A 2Q7YA 4P3WA 3PWUB 4BFKA 5DFVC 5C0DA 3WLBB 1KTCA 4V1DD 1J8HE 2EKSB 3LS4H 1DLHB 4L3CA 4UNVA 3U6XS 1KGIA 4HEPA 3WIIL 4NM4H 5FO7B 1OQOA 3LKPB 5INCB 2O6QA 3MLSH 4UNTA 3B56A 3MV8B 3RPIB 3AVEA 4LPWA 4ZDHB 4HK0B 2NXYB 4WWKD 1RK1A 4NKHA 1A9BB 2DQCL 3B2XA 1CCZA 1CQKA 2PW2A 4J1UA 3HBGA 3MPCA 5F9AC 1ZA3A 3LKOA 3ZIMA 4D8PA 4DN3L 1MAMH 4HUUB 4M6MH 4TUUA 3PFUA 2OMUB 1PTZA 4L3EB 1FO0L 1JN6B 1Q9KA 4GW5A 4FZ8L 1ZHKA 4UV4H 3KYOB 5EO0A 2JJWA 2MHAA 4PCYA 5ICYB 1MCSA 4N2OA 5CIPB 5DZLA 1U95B 4QIRA 3I6KA 2VDPL 4RAUA 3TZVA 3TTYA 2OBGA 1UD2A 1UKTA 3SOTA 1DBKL 2AEQL 2GUOA 4D0CA 4PIRF 3L3JA 1C8QA 3B1TA 1DQDL 1R34A 3EKCA 3HN3A 3GDCA 2PO6B 1ZA3B 2WWKT 2IIJA 3LKOB 4X4ME 1FFPB 1IBGL 3SB4A 3OKOB 1LE9B 4L29B 2HRPL 4ONGL 5JDSA 2COQA 1CD0A 3NCYP 1EZUA 4XMUA 2ERJB 3D4YA 5JUEL 3LKPA 1QTPA 3FSZA 1X5FA 3KEDA 1G7JA 1PZCA 5IBUB 4YBQD 4J6RH 5C0EA 5FA4A 2W9DH 4YQXL 1DP0A 1OE2A 2VRQA 1MPAH 2BSBA 2EDTA 4H5SA 5GRYA 4AT6B 4PJGA 3PWPB 4FP8H 1MCKA 4Y88A 5ES4B 1FP5A 3OB0K 4XI5D 3VXNA 3V95A 4AMKL 4KDWA 4M1CD 4BH8A 3RTLA 5JHLH 1OCOB 1TZOA 3D39A 1X6NA 2XY2A 4LFHD 1J88A 5CILH 2L3BA 3BIKB 4OY9A 4PRHA 1FAIL 1T5XA 2WLZA 4YBQC 3SGEH 3HUJA 5T3XH 1RUPH 3GIZL 3PGDB 4HU2A 5T5FH 2HFTA 2IALB 1OAYH 4JJ5B 1GCYA 4LLUB 3VGAB 4PJ8C 2YD3A 5AW2B 1I7UA 1ILSA 4JE0A 3T77B 4DW2H 3VD1A 1X4YA 3JQOB 4BK4A 2J1KA 1IAIH 2I07B 1VKXB 4IBQA 3BH9A 1SYVB 4MCYB 1MCOH 2FATL 3PNWB 4Z7IA 4IRZL 1BQ5A 1DJHA 4I48A 2ZXEB 2JLPA 3TA3A 2VJ8A 4XVUD 5TDNB 1IJNA 4MX7A 3L7FB 1EJOH 2YQGA 1Q0YL 3S37X 2CCWA 4X98B 4OF3A 4YEEA 1JZ6A 1KDJA 4QY8B 2DKUA 3H7BB 4Q2ZA 1P4BH 4DP2X 3TBYA 4QDGA 4YJZL 1C5CL 4GUCA 3FT2B 2YMTA 3MA9L 5BW7A 1Q9LA 5DGRA 5JPMC 1PSKH 2QQNL 1CBVL 3ARFC 4X7TA 3D1MC 3OJAB 4N5ED 1TG8A 2GSMB 4E9YA 4PW9A 3MO1B 5I1AA 1T4KB 3B8SA 3T04D 4HVBA 5DRZB 3QK0A 3MV8D 2CHNA 4XCYB 2OR9H 3RWJA 4LRNL 3UGEA 1EV2E 4D0BB 1XL6A 1P6WA 4I9WD 1KXTA 5D93C 4FHKA 2XKSA 3ZYZA 4X8JB 1C16A 3RBSA 4U6HB 4UT9A 4K7PH 1YUHB 4OCWH 4YDMA 2ZNXA 4QTHA 3E9UA 5GMGA 1LTXA 1MCNA 1Z5LB 3CFCH 2CHZA 1KFAH 5F7WC 3SO3B 1JZ4A 3S5LB 5GISL 1J8SA 4DGYL 3C60C 1ZGLB 1LDSA 5TK2A 4JR9L 3FS9A 4OAWA 3TBWB 4IEFA 4O02H 1OTSC 1NMCC 3ERXA 4JAMB 4MCZA 2FRGP 4A04A 3AROA 1UVQB 4P5MA 2K4WA 1M42A 2N7AA 3NA9L 4CU8A 3JZYA 5FWQA 2A9DA 1UT1A 4HQQH 4A55A 4JJHA 1KEMH 3VFWB 4M1GL 1RVFH 5KSBF 2ICEC 5K39A 1TJGH 5L0QC 3SDDA 5G55A 4ESKA 4ODXB 3DPBA 3ULUC 1EGJL 1OP5K 3SGEI 2YD2A 1U8QB 5KYXB 3Q01A 4WV1B 3BE1L 2IPUG 4G1EB 1RZKC 3O3EB 1UXSA 3QP3A 2ENPA 4MZRA 3FT0A 4XWOD 4Z9KB 3QQ9C 4W70A 4WSGA 1IAII 4GEJA 3PL6D 1XB8A 2VDPB 4CN4A 1MVFA 1EHNA 4L5FL 1ITCA 5B3NA 2X41A 2HX9A 4N87A 4NC2B 1JZJA 1O9VA 4R7VA 5AWNH 3R8BB 3TT3H 5GS2D 1IM3B 1WD9A 3L4YA 3PHQA 3RVTC 3DIFB 2Q86B 1SNRA 5JIHA 1OAZL 2C4FT 3EG9A 3LRHA 3BUIA 2DQEH 4FFYH 4NUPA 4MCZB 1LO2L 5DC2A 1PX4A 1UWYA 5SWZE 4RDQF 1OXYA 3LMJH 2NY0B 1S9VB 3ESOA 3N40P 5K9JH 5KSUB 2MPAH 4ZAKB 1EEYB 1GYAA 3RY6A 2CLVB 3FU9A 3QH3A 4MASA 2AXFA 4PKIG 2CHWA 5I5MA 3QI9A 4YAQB 2GJ6A 3DJ9A 4KK8C 3BGFC 3HHSA 4MKTA 3I6SA 4GW1A 3PHOA 5IEKA 1C8PA 5GS2B 4V2CB 1I7TA 2G3ZA 3BPCB 2NXYC 3JTSB 1PF3A 2YGNA 4PWIA 2VAAA 5I6PA 1AZVA 1M2OA 2F2HA 4IMKC 1T5KA 4A63A 3E8UL 2Z91B 1RUPL 3GIZH 3MLTA 3EAKA 1DS9A 3FTZA 1E5AA 4B3EA 1THCA 3O3DB 5I26A 4ZPVB 3FU0A 3UGUA 1C1EL 2ADFH 1CXIA 5B39B 1AC6A 2BVPB 1J12A 4ZRGA 2OMYB 3S3DB 4OJFH 5HDRA 5D7JD 5D96C 4C47A 4WO4A 4KNQA 2AERT 3I3BA 5HTSA 1U30A 2BJMH 2VSKB 3WTTA 1XX9C 4JFFB 1AQKL 4UWQB 4FQXC 1S5IH 3IAPA 4ZFOA 3UOAB 5J9PA 3VDBA 5BVPL 1I7ZA 4XNDA 4XAWH 1M6OB 1X6LA 2JI2A 1IFRA 1K72A 3D39D 1D9KB 5AVXB 3X14B 4BSWB 5C0FA 3TESA 2G2RA 2VQ1A 5ELIA 4YN3A 2GEEA 5LNEA 1T1XB 4XXDA 2FJGA 3NGBB 4APQD 4DUVA 3E2HC 5AKSA 3H9SA 2ZCZA 2OP4H 1UM6L 3CZGA 3BT0A 4AV4A 4R5CA 5I5IA 1CTMA 4BWWA 4JEGB 3P69A 4RMRA 4BK5C 3L4XA 4LQ1A 2WCGA 3UYOD 3ULVA 1JNNH 4ZMXA 1CO1A 1TCRA 3K71A 1XF4B 2CHDA 5SV3A 5BOZG 5ADOH 3MOBL 4KO6A 3VFOB 3WO4B 2IC2A 3WJMB 5JOFB 2EDOA 2CR6A 3MYJB 4GP4B 4MJIB 3FFOA 1XCWA 4GG8A 3D0AA 1H19A 4R5VA 4ZMZA 4R2GD 2IVFC 2BEXA 2HVJB 3IDGB 3LPOA 4QGTA 2GUOB 4O2CA 4DN3H 2Z65A 1AZZC 2WVUA 1QP1A 4Y9GA 4X5XB 4YR6A 3TO4D 3BKYL 1E9OB 4KK8D 2FBJH 5T8IA 5GS3A 3N06B 5ESAB 2ZUWA 2HUHA 3MUGB 2FT3A 1RZIA 3NOIA 3HI1B 4PJXB 3N42F 3F6LA 3ZRCC 1OEZW 4KI5D 1MRDH 1WLHA 2H6OA 2IFFL 3LVEA 4PJAA 4N5UA 1XGUB 3DBSA 1CYGA 5F9JA 3UTSE 1FNGA 5ICZB 4KVNL 3VG9B 2AGJL 2CIKA 4K3JH 1A6WH 3U2IA 3QS3A 2IWGA 3U46A 3O11B 2ZD0A 4F27A 3E0GA 3DARA 4FC3E 1CR9L 3TJHD 2M1KA 2WYZA 3LV3A 1JRHI 4GKNA 2L7UA 4KKNA 1VPOL 1NAML 2CDFA 5A3IC 1RERA 3SDDD 5CSBA 1V55B 4E9RA 3W3NA 3GMPA 2EECA 3QUZD 3WJLC 5C07E 1MUJA 4IK7A 1P7KA 1WWAX 2DJMA 3G6JE 1OARL 4AXWA 4ZXBD 2CUMA 2ZPKL 2MCMA 3UC0L 1MAJA 1U8CA 1H3XA 3LRLA 3WI9A 4BD4A 1T3FA 5DS8A 2EXYC 3C08L 4DP7X 3RVVD 2Y5QA 1K2DA 5CILL 3QFGA 5D9SB 1EO5A 1L9NA 3D2UA 1NEPA 3ARPA 4WFEE 4K7PX 2R7EB 1FE8H 3SDDC 4OIAA 4D9LL 12E8H 5KEZA 1H3PL 3GBNL 5JXED 1E27B 3VXQA 3SSGA 3N50A 1GXEA 2EQDA 3GMLA 3IE4A 4WTQA 5CINL 3R1GH 3DKHA 3S5ZA 2D7QA 1AC0A 2VZOA 4LLQA 4YNYB 4U6TA 1ASOA 4QRBA 4XO8A 1EBPA 2FATH 3QZLA 5GMFA 1HIMH 5LBSA 3FO1B 1P9AG 5D7EA 1BJ1J 4MDIB 4HJUA 2D2CC 2OJZL 2JCWA 4H7VA 4WI0B 4E9WA 5KYWB 1RZGA 2VLKE 3O3AB 2EC8A 5DO8A 3C6LA 3R19A 5FGRA 4PPTA 5I0WA 1FO0H 4HBCH 4PV8B 1MI5A 3G5XA 4MX7B 2E7MA 1NDGA 1CVRA 3FUMA 1MH5B 3IFNL 3V5DA 3N40F 3QNXB 3FCGA 3UAJC 2NZ1A 2VM9A 4LGSB 4A67A 2V7NB 4GQZA 2DWEB 4F2ME 4MAYC 2XTJC 2CA4A 4L4TD 4V2CA 4TNEA 4I89A 5D1QE 1BEXA 3HCVB 1M10B 2ORBH 2XWRA 4TSCH 2MKLC 1QFWI 4FFZH 5EN2A 3IETA 2JJTA 4GAFB 3TFKC 3GMLB 2H26B 2N56A 3T0ED 3CFBA 2H45A 3ISYA 1JPGA 3DSNA 1G1OA 3D25A 5FYKE 4LOFA 4EZKA 3IF1B 2UXVA 2D7TH 2IAAC 1G9HA 5KVGH 4HLEA 3BW9A 3QUXC 5DSCA 1ZKAA 1ZT4B 3MLSL 1RPQA 2YAQA 4PCKA 4MQXD 1GGYA 1SXSA 2GTWB 4D94A 2F54D 2R23A 1G7JB 3PV6B 5DI8B 1OCWH 4FQXA 2EUWA 1ZS8A 1DL7H 4E9SA 3CVIL 5JQIB 3P73A 3WTYA 5C0CB 1OIOA 3G04C 5DYOB 1TFPA 2F15A 1HEJC 3C8HA 8FABB 2O5YH 4K55A 5C0BB 1XECA 4F93B 3GHBL 3H7LA 4BINA 4IBLT 1T6WA 4BSVA 5KZCD 4NT6B 2I9LB 2YLHA 4FFZA 3F7YA 2R23B 3PV6A 4W1TA 5DUBB 1A6TB 1XF5B 2LHAA 2JB5H 3BN3B 4IOSA 1KV7A 1UASA 2ZCHL 3L5XL 3KPNA 3MNZB 4PRNA 3FO0H 4PP1C 4G1EA 2OQJB 2OSLA 1HS6A 1QG3A 4L37B 4P4KC 1NC4D 3NCJL 3PCYA 1N2RA 4ODHH 4FFWC 5DRXB 1A6TA 1XF5A 2WQXA 4DPRA 1MLCB 1MQKL 2QEJA 1HCZA 4YHIB 3CXHK 4NNYB 2QKIB 2B9AA 3IDGA 4U09A 1L7TL 1HE8A 2XIBA 3O6MH 1DEEA 4NO0A 3NSDA 4P04A 1QYYA 7FABH 5CEXB 2Q7YB 1R5IA 2BSSA 4AW4A 1F00I 3KPSE 3WLBA 4HCRA 4M8VA 3ULSA 2Z91A 3KVPA 1T7WA 4X9GA 3P0YH 4FD0A 4PJBE 4Z7WE 3VXUB 2NY6D 2OP4L 2Z92B 2K4AA 4JDEA 2CKNA 1D6VH 3CTTA 4YHOL 3LSOB 1MDAA 4IBYA 5JIMA 3B2MA 1IEBB 1MJ8H 4LHUD 3DETD 3RWCB 5D1XC 1URZA 3T4YB 3UTPD 4C8XA 4YHPB 4TTGA 3VQ1A 1J0HA 2MJWA 3EYSH 3VVVA 3KVDD 4UUJA 4XMWA 2VR6A 3S8GB 3OHMB 5E6RB 1JPST 4JX0A 4Z77A 1BBDL 2NR6D 3MJGX 3WMSA 3WPHA 4H20L 3FN0L 4APXB 1E4XL 4L4TB 2CO6A 5I28A 2I26N 1KBPA 1KY6A 3HC0A 2AGJH 4LHUB 3VWKD 1M9LA 3TYFB 1TZHB 1RPUA 1ADQA 4POYA 4CDGC 3SBQA 4J2QA 3ABLB 2J56A 5AOKA 5MEPB 4EBQH 1AOZA 1P7HL 1RUKL 1MXGA 4FFYL 3UTTA 1RUML 3NDYE 4NFCA 3HNSL 5KBPA 2HMIC 3BZ5A 1NZRA 3TBSA 1JGUH 1OF0A 2PYED 2DLFH 2NW3B 4CC4C 4FA8A 3EYOA 1IFHL 3FRUA 2TRYA 3BKML 3B3IA 3LZFL 1DO6A 1WBZB 2LT9A 2WZAA 1TIUA 3GHEL 3WY1A 4WHTA 1OAQL 5C0AA 2I9TA 4EQ3A 3EGDA 2AK4A 3GIVA 1WTGT 3CFKA 4DEWA 2R0WH 3WPCA 3E6HA 3D3VD 5DZAA 3GLAA 5C0EB 3PY9A 1VACA 3BDBA 3CG8A 4XR8C 1E9OA 3H53A 4GAGL 4L1DA 1G1KA 4MQTB 3WY4A 4PJCF 4DO4A 1ADQH 1KEGL 5J4MA 5IW6A 2NY1D 3D07A 2BDNH 4EN3A 3V6BR 4IRJA 3HI1A 4X8CA 1AP2A 4NAMA 2VZSA 2G9HB 2AV7B 2L4OA 4LLWA 5D7KE 1CDCA 3HNVL 3L3GB 2WXMA 4GG6B 4BH7A 5BW7C 1SMAA 3EYQD 3UAJA 4EI6A 4KMLB 1CGWA 1F13A 3ARFA 4XOBA 5B1BB 3HHMA 4PRAB 2BP5M 4N0UA 1IO4C 1GGIH 1JK8B 2XWTA 3NIDE 4HJIA 1CL7H 4LSRH 2P3YA 3AITA 1R33A 4FQ1H 3B3IB 5TE4L 1HEHC 4LLDA 2CUAA 2YRZA 4HS6B 4HS3B 1UACH 3B4NA 1CD9B 3QEHB 2YIHA 1NBYA 5LBVA 4B0MM 1IGYB 3ARXA 4RLDA 1REIA 2Y2YA 3QCUH 4U31A 3SE9L 2A6IB 5ALBH 3UBFA 3GSNB 2FO1A 4YSPA 1A6VH 1HHIA 2BVUA 5LCVL 1DQMH 1P5UB 2J8OA 3ABMB 5F97E 4FNUA 3V0HA 1MQKH 5HYJD 2GFBA 1WHPA 3LPGA 4FXTA 4QXWA 4UMGA 1GJIA 2GJPA 4WW1B 5BO1H 5FOJA 1CDIA 5IJKC 3KL5A 3PNRB 2N4IA 4D8OA 1RU9H 1WVZA 1Y6MR 1YQVH 3ILPB 1JRHL 2P43B 4ATTA 2MQ0A 2LR4A 3AS2A 5IB2A 3O3BA 5FYKH 5BRZD 2ZF9A 5C0BE 1R24B 4PW3A 3BHBB 1CE1L 4WJ5A 3KLSA 3V4VA 4PJ9D 2P7TA 4NKOB 3VX1A 3ZE0E 5EFIB 4IK6A 5KYWA 4TNWK 4D0BA 2WMPB 4P4RA 1N8ZA 2VAAB 1KB9J 2YGVA 2X0VA 5HHNA 3BAJA 1KLGB 3LIZH 5K1VA 4XVJH 2H0FA 3GHBH 3KPRA 4J4PD 2KPNA 4YXHL 4XCNB 4WCYL 1QBMH 4GP8B 2Y7QA 1FRGH 2W0PA 4AT6A 4BFNA 3CH1B 3CZLA 2BOCA 1RI8A 1Y07A 1IGFL 5I9QB 2GB2A 5L2KE 3TZVD 3DDFA 5D9SA 4WUKH 3BCFA 4XVTL 4NSKB 4PLJC 3UCRA 1UCTA 1OSPL 3TJEL 1X9LA 3PWJB 4JBSA 4BZ2A 4JO3L 4Z78B 5ANHA 1OCCB 2HP4A 2YK1H 1U8LA 4CU7A 4FA7B 1GZQB 1XVSA 4LVOB 2VISB 2YMXH 2JJSC 3AU0A 1KBGL 1NEZG 2GKIA 4M61A 4P2AA 2WLMA 4Q9QH 4S0SD 3H0TA 1FNSL 2ORBL 1R19A 4GP5B 2IXQB 2I07A 5C09D 3VB8A 1VKXA 4FFZL 3B2PA 4PJXA 4HUNB 5F1IA 3CMOL 5DJ8B 5EIQA 3FZUC 3FYEB 4DEUA 3H42H 3W9DB 4DPBX 5JPNC 3SQRA 2CIKB 1MY7A 1WT5A 5E8DH 4ICWA 3U36A 1JPSH 4GQPH 3QYNA 5MENB 5GJTH 5IT2L 5F3HA 2A74C 1MI5E 2MOVA 1RIVL 4MXVE 1F11A 4H44C 3EH2A 1BEYL 3NGBC 4PGZA 4U1JA 4YSRA 5T3XE 3CIAA 4AYMC 3QNZB 2W0FB 1GSKA 4LCIL 4LF3A 2NW2A 2ILLA 4HUMB 4FZEL 5HJ3A 2FT7A 5E1GA 5HJDA 3QWOA 1DSWA 1IZKA 1BZDA 1QLFB 4L3ED 4BM7A 1P7QA 1S9YA 1MVUA 1H6TA 3T0EA 1S7QB 3QUMA 5MI0B 4H4NA 1AR1C 1KCRH 3D08A 4ZS7H 2K8MA 4H0HB 3TPUB 1S7VA 2VN7A 5ANMB 4B9ZA 3HS8A 4LSTH 1Q9WB 4GIOA 4BWUA 1KENH 3LTVA 2WSDA 4PY7A 4LSRL 4A2EA 4U3SA 3IEAA 2B08A 3FOMA 4QF1B 4TV3A 4XN1A 2YKLH 1JTTA 3FHAA 3TVMB 1JHKH 3VA6A 1A8JH 1MFBL 4N1HB 1I7ZB 2BNQB 5DMKA 4PP2A 4DEPC 4CJ1A 1MIEH 4LDEB 4BFJA 1YEEH 1FYHB 3QIUB 1QYGH 8CGTA 1AZUA 2EABA 2VN4A 2AI0H 5DHXB 2CIIB 2Z34A 3ML9A 5GRWA 3AT9A 3UABA 2AJUL 3MLXL 5ID0B 4P9ML 4ZDHA 5I15L 2R0WL 3QR0A 1NDGB 1VDGA 3QQNA 3BP7A 2NCMA 2G2RB 3HZMB 5BZXA 4YHYC 1IEHA 4UF7C 3DHJA 3S35H 2J8HA 1CLVA 1CICB 1KGYE 5L8LB 4RX4D 5HD8C 3NACL 5F1OB 4M4PA 4Q6YA 3WUWA 5HHQA 4V1DE 1QSFD 2YZ8A 5KVEE 3NMEA 4LCVA 1KCLA 5KSAC 2EVHA 3MFFA 4RBPK 3S97C 3N1FC 3TV3L 4JPVL 4L18A 1HZHL 3LJ3A 3MRRB 1W8EA 1B2WH 5IFAL 1I9JL 5DHEA 1LNUB 1CE1H 4U6YA 3CJJA 1ZLWH 4ZOAA 2GY5A 3C75A 1G4RA 3GZQA 3RNKB 3SKJL 4HJ1A 1CXKA 2GCYB 2Z8SA 4OTXL 3FJTA 4FXLA 2FIRT 3ZL1A 1TTRA 2J4WH 4KUCD 4TF4A 4X6DE 2Y1YA 1DEDA 2MEJB 3KBEA 5DO2D 1PCSA 4UUJB 4XNAA 4WEMB 4PJFB 3ELAT 3I9GL 5GS0D 4GUPA 1ZDSA 1AY1H 3PWLA 2AXFB 2H8PA 2Z31C 4MMXB 3EXJA 3V5KB 5EU6A 3T3ME 3QG6A 3DK2A 2OAAA 4CADB 3B9AA 2AQ2A 1H8SA 4R6FA 4PQXA 1AXTL 4FXKC 5D8JH 2B0SL 1JIBA 1SBBA 3X13A 4FHOA 1JFQH 2RBLA 5HHOA 2E75C 4EJ1C 3LRSB 5GHWL 5GSRA 1LP9A 3GI9L 1GTNA 5HGDA 5GS0C 4JRWA 4KH9A 3I85A 5IGXL 2E0PA 3U46B 5EMYA 4Q9QL 2BRQA 3GRWL 4I87A 3WE1A 2I5YH 4N4YB 2UUDH 3G7TA 3VX0A 2D3JA 3INOA 5C07D 1FG2A 2Y36L 4N2DA 1ZDQA 1JWSB 4Y1TA 1S46A 2C9QA 4NGHH 4LLWB 5AVSB 1ZHKB 2ISDA 1A14L 1ODUA 1M57B 2OSLB 3KM1A 2MMXA 3QIBA 5FYLE 5TDPB 2FECL 2VXSL 1E9PB 2FE0A 4XPAH 1K4DA 3Q0HA 4IYKA 4KUCF 5D1ZB 4L8BA 4OLUH 4OCNC 1A9BA 3HI6H 3C6LC 3O53A 5ECGA 1LE5B 4Z78A 2ICWA 3UIYA 1FVCA 3Q5OA 3QCTL 4R0LC 1JN6A 1MCCA 1XWVA 4H26B 4U1NB 5DDHA 1L9SA 3JSSA 1MWAH 2EDDA 3CN4A 3QA3A 3QIWD 4LSVH 1E9PA 3SYQA 4EBQL 4DH2A 4M9OA 1XO8A 1SJXA 2WQAA 2ZIDA 3I3DA 3ZE2B 5JW5A 3E6HB 4I6JB 1FNEA 3S37L 3QIUD 1JZ7A 5KSAB 3SYPA 2NQCA 5ALCH 3Q1SH 3U1QA 2RFXA 1XAKA 3H6JA 1DFBH 3QJTB 1AO7D 1G7HA 3G6JA 3RGVB 3RW6A 3U0PB 3ZE1E 1FF5A 3W9EA 2EDNA 3DROA 3VACA 1IUZA 2O1AA 3HNTH 1JUFA 5LN4A 2VLJE 5J06A 3V79C 3GHEH 4HCGA 2MWCA 4GLRH 4NXKA 4U1LA 5IUCA 5FB8A 1T2QL 1SMOA 3Q9QA 4HH9A 4NO5A 3ZTCC 4PVBA 3SQBA 5DJYA 2LW3A 4CSSA 2JKWA 4R83A 5J5EA 3A5VA 1P69B 3FCSB 1BD2E 2V7HA 3B7UX 1IGTB 2IPKA 3QDJD 5C71A 4HEPG 1TMCB 1XCDA 2CR0A 3OKLB 4LPUA 2ZT9C 4F5CE 2AKRB 5FV1L 2IJ0C 3MLPA 4HKBA 2EIJB 3GM0A 4UQ9A 5BNXD 1MCWM 4XPBL 4I85A 1OAZH 4MZIA 1EAPB 2XC8A 3D34A 1BEYH 3LH8A 5DC4B 2VZVA 3NCBB 3G9AB 4QXTA 4RRPM 3UTTD 4LP5A 1UWGH 3ZDYB 1MJ8L 5LXVA 5K9KB 1YEGL 3BCDA 3HFMH 4MCYA 5F3BB 4DP0X 2E7LA 4AEIL 4AJWA 4JDZA 3RX5A 1JUFB 1U92B 2BRRH 2NY1C 4JPIB 3O2VL 1Y7VA 3QQ4A 5LUMA 1WUNT 4OCMC 4MVBD 1UACL 1M0ZA 5JHDE 3MLRL 1KJVB 1SFHA 3EADA 4RSYA 3IN2A 4NUMA 1IGCL 2ZOKB 4MBRA 5C3LD 3BSGA 1L9TA 3B1UA 4DGWC 1UQSA 4S1QL 4XNZB 4Y5YB 4OLXL 3ZDYE 5KBKA 4X4XA 3RFZB 3BO8A 5KTEL 2UZYA 1X7SA 5GS1B 5DZ9A 1PPIA 4O51A 4WUUE 5DD3H 1R3LB 4MAYB 4JM2F 3ARWA 5JW4M 5B7FA 1MCEA 3ZZQA 4A2GA 2DLEA 3I6LD 4ZUVA 3ULUE 2F54B 2X4NA 3ARSA 4TN9A 3ZIYA 4LEOB 4P5RA 5IQ7H 1SVCP 3WN6A 2C1OA 1ED3B 1Z7JA 3RL2B 4XVJL 4MA7L 4XMPL 4XO4A 5J3HC 4EN2A 3PWJA 1XGTA 4G1MB 4UAOB 4HLZG 1WWCA 3Q5YA 1GGCH 3EBHA 2JQMA 3FB6A 5I19H 3A24A 4JAMA 4P9MH 4XPAL 2HKHH 2NTFB 2PPCA 1ZJAA 3KJ4A 4DFIA 1WWBX 2F8OA 5C07A 2AV1B 3CZSA 1I85A 1J11A 3G5VB 3X13B 2VL4A 2UZIH 1NCNA 4P3CH 5IM7B 4R90L 3ZY7A 4GFXA 3FCBA 4OVUA 1PY9A 3BZFA 5JHDD 5T5FL 3ZYNA 2WQWA 4TLTA 4D2NA 3DYOA 4XBPA 5ICXA 3D5OF 5DLML 2ADIB 4BUQA 3QRBA 1YC7A 4ICXA 1XZ0A 1D7DA 4FKKA 4NERA 4CBZA 4PGEA 3NCEB 2Y7LA 4JFQA 5EZIL 1KTRL 3LNGA 4QHMB 2FT6A 5E8OB 1LILA 4HC1L 1DN2A 1JJUA 2Y23A 4HJSA 1SJEB 1F4AA 5K1JA 4BJLA 1JZ8A 3UAAA 1E2ZA 5FK9A 2VLMD 1IT9H 1K4DB 1R46A 4KY1H 2WKLA 5HVHC 4FQ2L 4N1CA 4GNKB 4WEEA 2VERA 4HOZA 5FDWA 1DR9A 3KWWB 4JRYD 2VOTA 4NNXA 2XWXA 4OKVA 1NFAA 3UZQB 4ENED 2JMRA 1BYNA 4XC3L 1HCVA 3BUYA 5LGJB 3FBQA 1WHOA 1E28B 3INUL 1ZLVH 3NFNA 4EUPB 3ARZA 5B39A 4X7FC 5FYLL 4EDWL 2IDUA 3O3DA 3AG4B 4R6GA 4U3XA 3WSQL 5BOJA 1J9CT 1BPLB 2LAAA 3QQ3A 3FB8B 1HZHH 1QQDA 3CN1A 2D7NA 1TJHH 1RHFA 1JNJA 1Q0EA 2NXZC 3H2QA 3TIDA 2D31A 2VDNB 2VT0A 3AREC 2HJFB 4P4RB 3PWLB 1YMME 1RSYA 2CK2A 4YPGA 3AY4C 1AFVL 1UWXK 2P5EE 5D6CB 2DQJH 4FMFA 2WHVA 3I75B 1ROWA 4OZIE 1OTOA 1FVEA 5D5MF 3ZZ1A 1NMBL 1U91B 4P4KA 5CINH 1ZLWK 1THAA 3GSOA 4AY0A 5IR1B 4OJFL 2G9HA 4OR1A 3IE9A 2XETA 4WUKL 2QFPA 4DGUA 1S7XB 1OTNA 1E4XI 4IRJB 3OMNB 1MIEL 2HLAA 4LDLB 5BVJB 5ECJE 3D9AH 2FSEA 5EUKB 3DRQB 5BPPA 4ZMNA 5IVZA 1BDYA 3VGDA 2ESVD 3DURB 4NOFA 1DVSA 4KX7A 2WXHA 4PJ7E 3OAZK 2YMXL 4WFGE 2AQ3A 4BKTC 4HKJA 3HB3D 1CD1B 4R26H 3SQOL 4Z76B 3LKSA 2WP3O 3GJFA 4LNVA 5CLXA 4YHKH 4EIZC 1Z9OA 3NACH 9PCYA 3FHQA 2D4DA 1S9WB 1E2VA 5HHOB 2CMRL 1AAJA 1B9ZA 3X1NA 1XB3A 4WW2B 2FQFA 2DMGA 2FNBA 3P30H 4I0PB 4I3RH 2Z62A 3VD2A 1WAEA 4WTZA 4TVPH 5D1XA 1L6XA 3VJ6B 4NQDE 4QD2E 3RZCD 4YWGH 1IKFH 2X4UA 1K3IA 3L9EA 1LE5A 3FQTA 3GS0A 2H8PB 1RZJH 4BFGA 3LXCA 5ERWB 1OP3H 4LAJH 4HEME 1JHTB 3E3QC 3EGXA 1QHPA 3KE0A 1BLIA 2G5BA 4OU3A 3IMBA 1WSST 3RVXC 2OW6A 2H6UA 3UMNA 2HSIA 2X4UB 2QADD 4AI7A 5KVGE 1A65A 4HK3J 4Y16C 2ZOLB 4JUTA 1MJUL 3X1GA 1DLHA 2DS4A 3DX7B 5AOZA 5IQ9A 4H1LA 1I7RA 1OAUH 4KVPA 2OX5B 2VLKD 3Q2LA 4UQ3B 3ECVA 2FEDC 3KM2A 3OKNA 4B9YA 32C2B 1UWGL 3IDNA 2VKWA 4KRNA 1M05A 1BFVL 3T4AB 4AUYA 3S96A 2PPDA 5CUSH 3O0LA 4PRAA 3SE6A 1OOKG 1YNLH 3LN4A 4AH2A 3MGTA 3CH1A 4JO8A 4KV5E 5EIIA 1QFUH 2NY3C 3EYVA 4IDJL 1OT1A 4XBGA 1ZK9A 1SQMA 2JCCB 2WVSA 1MOEA 1AGDB 2WQ8A 4C57C 4IU2B 3V7AE 1BREA 2BZ7A 4NJ9H 3N3EA 1LK2B 4YBLC 4X80H 5KYUA 3D4GA 2P24B 5D7IE 5E9DE 3WXWL 3MV7A 3K80A 2QV2A 4GXVH 1G6RL 4CVUA 2PW1B 4IRJC 3STZA 3G08B 4YVNA 3HG1B 5AWBA 1B6DA 4AZ8A 4BQ8A 4X8GA 1J1XL 4AEEA 1H6EA 3ASNB 1FT8A 1QNZH 3WY2A 2XN9D 4LKCA 4OLWL 4OI9A 3EYFA 4R6UA 4F33A 3M7OA 5IBTH 1SDAB 1M9WA 2F1EA 3IGUA 3G5XB 3HZVA 3T0EC 4CVXA 1AJ7L 3HG0A 4F7PA 4MDJA 3E2JA 3NIDF 1I9JH 3TVMC 1K6QH 2BY0A 2JK5A 2VXVL 4JM2A 1H3PH 3GBNH 1U36A 2NSXA 2ZYIA 5CCKH 3K0YA 3KLHD 3S37H 5HJ3B 4S1SL 2PXYA 4MRBA 4NKMA 2CSPA 4BQBA 2AAVA 4Q74A 2UYLB 5DVOA 4WO4D 4J23A 2NUTA 4YE4H 3OR7B 4WI6A 5J11C 3BP5A 3DX6B 1QRNE 4HMDA 2Y9RT 3QUML 1U8NA 4OF8A 1LWHA 2B16A 4QTFA 5B8CC 4F2MA 1FAKT 4FS0A 2QT6A 1QSZA 3DUUA 1FVCB 2EDEA 1FO1A 1U3HB 4JHZA 1DDHA 4NN5C 3ZE0B 3BAXA 4R6JA 1SHMA 3IJEA 4LSPH 4OT1L 3VI3B 1ERNA 3BZ4B 3SPGA 3CLFL 3PREA 2B1AH 5KSBB 3DVFA 4HAFA 1CFQB 5IGXH 3DV6A 1P4IH 3CVHA 5FUCE 1ACCA 4G82A 1OPGH 1OGAA 2HG5A 2YEQA 4FQHB 4LLYB 2EIKB 2N0KA 2M26A 5LVEA 2PWGA 5IFJB 2B14A 2LFGA 3IMRA 3PXLA 4KOCA 3QJZA 5SWSA 2MNWA 3BP4A 3OAYH 5CJBA 2CLRA 4OLZL 4OZFA 5E2UH 3RGZA 4KROC 4PD4J 4ANKA 2C1OB 1RULL 3Q6GH 3GSQA 4ZX3A 4HFUH 2O93L 2O5ZL 3UAEA 3WL9B 2CHXA 1Z7XW 3STLA 1IVTA 4TNFA 3V4UL 2Y7QB 1KYDA 5HXMA 5DYFA 3DMMD 1CFMA 2VDMB 5C0AD 1U3YA 1YPZA 1YEIH 3P4OB 3TEZA 3CSTA 2KYIA 4JQVA 4YSUA 3D0VB 3LKSB 5E6SB 4GINA 3ULUD 2E7CA 2XN0A 4UT7H 2WD0A 3V0DA 1LXMA 2K6ZA 3VI3A 4TULH 1AMXA 2G0LA 5JZ7D 4MS8C 3MBEB 5SWSE 1MFAL 7PCYA 1PFCA 2I24N 1VFMA 1QLFA 5DHVB 1OSYA 2DQMA 3MUHL 4LSQL 5GS0A 4J3UA 2CM6A 3OMAB 4ERSH 5D1XE 1W8NA 3NUKA 2F8XC 1DQJB 2N3JA 1P7QD 2F08A 5FHBH 5KW9L 5LXGH 1JCKA 1NFDE 3ZKQD 2JVUA 4F1ZA 5KAQF 5L4FA 5LKNA 1RZKL 3RVXD 3HG1E 2F7PA 2YA2A 5FUOH 1FJ1B 3AQZA 3R18A 4ODUB 4HUKB 3ML8A 1MJ7H 4N8VB 1Y18A 4JQIL 4QYOA 4RCAB 4DKAA 1QVOA 4IKLA 5F0JB 3UP1A 5A7BA 4IMLA 2GT9B 3QQ9D 4UYQA 2FJGB 5DA0B 3G06A 4MXQC 5I0DA 5I16B 1PLCA 2JWYA 4X80L 5A2CA 2F58H 4Y89A 2O5XH 4ZFGH 4MNQE 5LNGA 4ZODA 3IGAB 4LPXA 4LI1A 2YD7A 3MV7E 4KNGA 5C08E 3DO4A 5EIIG 4ZFQA 4N0YH 4GRLC 3B7SA 1I1FB 2J2ZA 3UTTE 4AM0Q 3Q1EA 5H37A 5EU5A 5JHAA 1PZBA 5BQ7B 3ARFB 2P48B 1VLXA 2C9PA 3MMEB 4NKIH 4DTGH 3F7VB 5MEPA 2H47C 3EUUA 1SHSA 3EOAA 1UZ6E 3KWWA 2FD6L 4HIJA 5IOPA 3BOVA 4HOMA 2PCPA 5EV7A 4DKFH 1BQLH 3DXAB 5IJBC 5C7XH 4IU2A 2Y1VA 3HFFA 4JE4B 4JO4L 3FOLB 4NX0A 4YO0A 1UH2A 3BISA 2AEPL 4AJYV 4A7GA 2OULB 2P24A 2A0ZA 2Q2EB 1I7TB 1FNHA 3JV5A 5E1QA 1Y18B 4DK3A 1HJBC 5CMPA 4G7YH 2N0MA 4E0RA 1TVBA 4PG9B 4TNWF 2XIDA 2IOMA 1AGCA 4X6BB 3COOA 3NVQA 4HD9A 3W9EB 3B37A 4JRXA 3SZKC 3TEWA 2NY3B 4PERA 2XX0A 2NCEA 5C07B 4Z7QE 5EOCH 2QZQA 1D9KD 3B9KD 4G6JL 2W9EH 3F8UB 1VFUA 4QRUA 3N9GH 1TVBB 2ATPA 3B7RL 3TBVA 1LO4L 1HVXA 2BFGA 2Z1KA 1V3KA 4APQA 3O8XB 4CRPA 1MCBA 1RJLA 4GXFA 5I82A 3M1BA 3QJQB 3NP4A 4PGEB 4Z79A 3NCJH 2AV7A 3EOYG 3T0AA 2EDQA 2VLKA 3NEEA 4H13C 2ITDA 4TYUA 1UFGA 1IIKA 4LLVA 5C0CD 3K72B 3C6OB 1E90A 3RY4A 1GW0A 5AL8A 3RL2A 2WQRA 4HJGA 4UB0H 3C60D 4AXWB 4IM8A 1CFVH 2A6KA 1DQVA 1HILB 1HL8A 1KB5A 1QEXA 3UERA 3ZQWA 3CIGA 7FABL 1T20B 2WBXA 1GVIA 3PDDA 4S1SH 3CFQA 4DQOL 3H1ZA 4J8RB 1OL0A 4N6QA 3IFLL 1J9QA 3IJEB 1VIWA 5EEVA 3W39A 3T0EE 5EORL 4UTBL 5CJQL 5IK3B 4DVBB 3KWTA 4BZ1A 4KKRA 5IBTL 2XWTB 3OLDA 4F1SA 1YMHB 3TCLA 1Q72H 2X40A 1OANA 3FUEA 3MBED 5HHPA 3RWHA 4LLYA 3NCCB 2ZAIA 4FERA 1YAIA 3GUFA 1BIHA 3MA9H 1VGEL 4MWFB 3GBMH 2CH8A 3OX8A 4JFDD 4PWKA 4ZAKC 3QEQD 1AVAA 5E94A 3VRIA 3V0WH 4ODSL 3DX0A 2P46B 1WFNA 3QPXH 1RZGB 4EKJA 1UGNA 3OAUL 3B2DC 3CX5J 4GRWB 3Q2WA 3QHFL 4Z7UF 1PQZA 3ULUA 4FN0A 2LAGB 5LGYA 1KGCE 3DJTA 4L23A 1KBKA 2DJSA 2ZICA 2E7BA 4XNMB 5CEYB 5D6CA 1A7RL 5AW0B 2P7TB 5A3ID 4BFEA 3I75A 3V0AC 4KQ4L 5L4JA 3GSWB 3QR1A 5JPNB 2PF6A 4KKLD 5B38G 5JNYB 5IR1A 1QUPA 3HZYA 2NDFA 4H8WC 1C5BH 1CDJA 2AK4B 3PL6A 4I2XE 3OG6B 4A7QA 1ZWIB 4U2ZA 3CN3A 3ASOB 2PLTA 2WSPA 5G2NA 4PSJA 2VDQH 1KTJA 5JMRA 4BEIA 3N1GC 4G7VL 1S3KL 3I6LE 4KRPD 2AI0L 4P49A 4CNCA 5HPOA 4M8RA 5D4IA 3BUQA 2XBTA 3NBNA 1BXUA 1UD8A 1JRHH 1KIPB 1OTTC 1NFIB 2FWSA 3EFOA 4FXGA 5D6DA 1IE5A 3KYKL 3RIKA 1FYTB 1VFBB 4N2HA 3U4AA 3FULA 4NZ8A 3FSVA 4ZTOH 2BHUA 3FB8A 4U4BA 3QHZL 1DDTA 4CILA 1H5BB 3JZ7A 2UY7B 4JLRB 3D18B 5AVUB 4PRIB 3VWKB 3QAZB 5DJYB 4NKIL 4U0QB 1VEOA 4ETQB 2YC1B 1TT6A 2V3DA 3FTYA 4TKWA 2A9MH 1DN0A 3G08A 4X5PA 3UADA 5HHXL 2EEBA 1PY4A 4N0CC 5KS9E 4QF1A 2O5ZH 5IVXF 5T5FA 5DMYA 4JO4H 5FGBC 3VRJB 4C2BB 5DMKB 4JFQB 1D5XA 5LAXA 3TO4B 5I0VA 1RFDL 2SEBA 4AVIA 5T5NF 4Z8GA 5C08B 4ZTEA 5AAWC 3HBQA 4WO4C 3WPEA 1ETB1 4N5EC 2IAMA 4WFGD 5BCAA 5EN3A 2VWEE 1CBJA 3UCQA 3D48R 2XHNA 3S3JA 4NBYB 1BLNB 1KPVA 1EXUA 3P4NA 5LN8A 2IDQA 3RIFK 1MFDL 3L9RA 1PX3A 2W1NA 5E4EB 3GUTA 4GT7A 3LDBC 2IMMA 1FL3B 4XHJC 3V6ZA 3MGOA 3PWVB 2EEDA 1W72L 5EEUA 1AJ7H 3QWOB 2PCXA 1PW3A 1WQVT 2W9LA 3FCTA 3GGWB 2CUHA 3FAWA 4TOYL 1SXZA 5GZNC 2O6DA 4GO6B 1T2XA 1S9XB 4WQOA 4PYHA 5H4YA 1Z9SB 4XOAA 5KBDA 2FGWL 4KFMA 1GPOL 3HE6D 5F88A 5F7EH 5JIDA 5DVLA 3BEWB 4HXBH 1S7UA 1XMWA 4U1SB 5FO8B 2BSCA 2PWHA 4KZ0A 4UTAA 1GY1A 2RCSL 2AXGA 3A6CL 5FYJL 4KO5A 2WNKA 4NRYA 4OIFA 3U6RA 4KKZA 4XZUB 5IIEA 1SY6L 3BGAA 1YEIL 2WXFA 1KGUA 3DTUB 3O0RL 2EE3A 1T0NB 2X0UA 4XXCC 5KVFE 1GHFH 3IYLW 4HCIA 5FYKL 2DYRB 3EO9H 2DLGA 3IGKA 2D0HA 4MQWX 3DSFH 2HVKB 4MMZA 3R06A 3B8YA 3BLPX 2FB4L 3DGDA 1CZ8L 1JK9B 3EJYC 2PXYD 4FQLL 2NX5D 1PKQE 1T7ZA 2JFCA 3DBXB 3QULB 3ARBD 3BAYA 1S7XA 4NUQA 2WFHA 3BN9D 4LSUH 4O58H 2ROXA 4JY6B 3TYGH 2BVYA 2FEDD 3G39A 1AR2A 1TQTA 2EIZA 1ZLUK 1CF1A 1XTMA 2QADB 4PJ7B 1EH9A 5E7BA 1UZ8A 3WKPA 3LCYA 1ZJBA 5BV7B 3BWAB 3IU4H 4KVCL 4YDNA 2RHEA 3EJYD 1JPFA 1R5VA 5L2KD 2ZOTA 2HLAB 2NUTB 4MB3A 2CGRH 5E8PB 3ZHFA 5A7EA 2J71A 3M6DA 3O8XC 1MW2A 2HWZH 1YN6B 2IQ9L 2VDKH 4MNHA 3AT0A 3QDGD 5I1JH 1BHGA 2W59A 3MCG1 2NLJB 2UZXB 2J25A 4N3UA 3A21A 2XJLA 4KXZI 5E9NA 3F58H 4JN2A 3WENA 1PJWA 2JTDA 4G3YH 1AXSB 1DBJL 2GSIB 4NZTL 4A2HA 3LPWA 3EH4B 4Z3GA 1V7NH 4NQDB 2DYPD 4ODBD 3EUDA 4Q14A 4Y4FA 2DKMA 4WDIB 5D1XD 3FQ2A 4YE0A 2E9BA 5EA0H 3RJ0A 3U4BL 4DT2A 1F58L 4R0LB 4DJMA 2X4SB 2IMNA 4YHNA 4NQCA 2VDOL 4E5XB 3THML 4ADJA 1OAXH 4IKJA 2QR0A 1RIUH 2QMKA 4F91B 5MEQB 1T4KA 5BV7H 4QTIL 1AACA 1PG7X 2UWEB 4HLJA 1G7MA 5AWDA 1QFWL 5AOLA 1T83C 4G8AC 3C09C 5DWUL 4Z3TA 1Q9KB 4GW5B 5EUOF 4DUWA 2ZXBA 4KI5E 1EFXB 3KPLA 3DROB 4UDUB 5FHBL 1HSBB 2OFQA 4FCGA 4HS3A 3W5MA 2W95A 1D6EA 1P4LB 2Q4GW 3ULAA 4P05A 4ANWA 1DQTA 1XR9A 5FM4A 3CVRA 4FF9A 4ZW6A 5C08D 4WUUD 4A7VA 1Q1JL 1IGIL 1NLBH 3GB7A 5I24A 5DD0H 1XCTA 2O6PA 4K7FA 5HPMA 1G9MH 2XTSA 3TU6A 3CVDA 4FGMA 1WDAA 1UKQA 3F7LA 1YMMB 3QFJE 4HC1A 4OZGE 1BZ7B 4X5QA 1S78C 4JRXB 5GSRB 3F05A 1F4WL 3V4PA 3QUYA 1X44A 2E47A 4NN7C 5I6XB 1WZKA 5JZ7C 1B9KA 3FUHA 3MNMA 1ID2A 4NC0B 1XR8B 3FUIA 4Q3GA 4KTDL 2C3WA 4F7EB 4ZAKD 4EOWL 5J11B 1D9KC 3PDOA 3I2CH 1IAOA 4HIHA 2X1QA 2DKSA 2KZKA 2WUBH 4C56B 4E9LA 3VQ2A 3LHPL 1B2YA 1AO7E 1X5YA 1RJZA 4H26A 4JG5A 4RMTA 4UM9B 1KPRB 5IB4B 3CFJA 4LEOA 3QIBB 2XOTA 5H37H 1UC6A 5K9QI 3CHOA 4LEXL 5SX4I 4IGBB 1HYSC 5FFLA 1MREL 1VADA 3IKKA 4U1IA 5D1QB 1GYWA 1W0WB 1NAKH 4FHJA 3P3RA 4Q58C 3FB7B 1TSRA 3GQFA 4XBEH 2CWRA 2I9TB 2GTZA 3QNXA 1N6QH 3NJKA 1E9QA 4EVNA 3OVUB 1Q0XH 1U2HA 1A02N 5AAMC 4O9HL 2WBJA 1CLZL 3BC9A 2A4ZA 1A2YB 1Z6JT 1UT2A 5JOPD 3VFVA 1W8AA 5CO1A 3QG6B 4FLHA 3U30B 3HC4L 1D2OA 1H15A 4JG1H 4JM2D 5DFWH 4DOHB 1RCYA 1UM4H 1R3LA 4Q6KA 3N1QC 2WKOA 1TLMA 2X88A 2DQTL 3H56A 2MHAB 3E6FA 1SDDB 3FFDB 5ICYA 2XKNA 3GJFK 3QNYB 3QS2A 5LQBL 4Z8FL 4LSDA 4X6CE 1U93A 2KLRA 5FW8A 1ZHBA 4RA0C 4GLRI 4AIXA 3C09B 3IGFA 6FABL 1ZLEA 2WTRA 4P46B 1MDTA 3VXQB 1Z5LA 4JHAL 5E4EC 3ZKND 2Q10A 4X6EB 2P80D 4I0CC 2AJZA 4QRQB 4XN4A 4QXTB 1OQXA 2EIDA 5F7FA 1N6UA 1FQ9C 3CVHL 2X4TA 2CBTA 1AXTH 3MRKA 2J6EH 1T3FB 1A0QL 3KS0J 3MV9B 2K1MA 4M6OL 5DS8B 4E42A 1KCKA 3C5ZC 3SPCA 4QWWD 1U92A 4ALAL 1Z32X 4PS4L 4XMKH 4OD1H 1F45A 4PRHD 2PPFA 2VL5B 4YHLL 3BFOA 3IRCA 1YYLH 2XQYA 3MRCB 2X4OA 4QRSB 3QWRA 1KWGA 4HX1A 1GZHA 2VW6A 2H3KA 2ZUSA 2V0AA 2IAND 1AKJD 1SZNA 2F54E 1MCHA 3BRDA 4YDJA 3BKCH 1PAMA 3VFPA 1CQYA 1AHKA 3FC8A 1UJ3A 1UZ8B 3NABL 1V3LA 1G9MC 2YO3A 3OKNB 1AGBA 1I4FB 1RIHH 4IRJD 1CGSL 5TE7L 1ZXQA 4UOW0 4MNQD 3ZHKA 1UZ6F 4ZFOL 1MG2C 3CN2A 2F74B 2OS7A 4PRDB 1A4JB 5DJCB 1SBSH 3RJDA 3LNHA 5EF2A 1FYTD 2ZTBA 3EDKA 4A6YL 5EC2B 1BVLB 1LDPH 3GT6A 4PGCB 3QCTH 2R2BA 4Z0BL 1AFVH 3I02A 2XN1A 2BNQA 3OHXA 2R69L 1EEZA 1KXQA 1T1WB 4MHHI 3S4SA 2C1PA 1GYVA 1JV2B 3LOWA 2ETWA 5BVJA 2UZYB 2BY2A 2JJUA 3VGEA 1SEBA 4KHTH 5HI5D 2IGFL 3MX0B 2OXHA 4HFWA 4TNVF 1M2VA 2LU4A 4OUUB 1DE4A 4RAHA 3P9WB 2O72A 3RFRA 1SJMA 2ZYSA 4AQZA 5HDHA 4WY7H 1SLXA 4MS6A 1XSIA 3CFBB 5DJXA 1EXGA 1SM3H 1UXWB 2AV1A 2F61A 4JZOA 1ZT7A 3KLAA 1EZVY 2CO4A 3V9EA 2VGLM 5E5UB 4KXCA 4IRSA 3WXVH 5MERB 5HYJE 4X6CF 3APCA 3P02A 5LFNA 2JKXA 1PNCA 1RLBA 3W0WA 3WS6A 1OKEA 4MAUL 1SVBA 1PD6A 4IS6B 4P46C 3LNEA 3N6YA 2X4PB 3DJRA 2UYLA 1YUHA 4BZYA 2YKKA 4G43B 4H25B 2PCPB 2XI9A 1ZLSH 3MOAH 4G9FA 3TOPA 2C3HA 3FQ4A 3DVGB 5TJWK 1EXHA 2FH8A 3TV8A 2K70A 2J2ZB 3ZBMA 4MJ4A 2WC7A 4JFED 2J3SA 2ZCLH 5DEGA 3NP3A 4UDTB 5LDSA 2NNAA 2Y07L 4XCCH 1UQSB 4BZ2H 4XTRC 1GC1C 1RZ7L 3BUDA 4HUUA 2KKQA 4KJWD 3JYCA 2QSQA 4WNSA 4Z94G 5EZIH 2VABA 4BELD 2Y3NA 1Q94B 2R7EA 4H0IA 3VGFA 1HN1A 4X6FB 1DVFB 5H2BA 1T7YA 4LARL 1JMZA 4OIIH 3VB9A 4S2SA 5C0IA 3RVTD 1X9QA 4KI1A 3VTMA 4Z3EA 2Z64C 1OHZA 3LS5H 5C9KA 4KZEH 2WPGA 1KSRA 3NA4A 4WENB 5D2LB 4ACTA 3O81A 4MXWL 4XH2B 1DVZA 3RDTD 1NIDA 4ZMWA 3NSJA 2FCBA 4L1HA 4ZD3H 1JWMA 1KLUB 2NNRA 1ILUA 3ZPDA 4AL8C 1DVFA 5H2BB 3QBTB 4UIKL 1OCWL 4WIQA 2H2SD 1ZWIA 2WK2A 2YN3A 4MNGA 4JY5L 4QHUB 5IMKB 3MROA 4QRPA 4K71C 2XZCL 4WVRA 3U9UB 4IHOA 3DIFA 1JHLH 5T5NG 3WHXA 1Z9NA 5IHBA 3EG9B 4PJ7A 4MA8H 2WW8A 4K5PA 2VXUL 1XMEB 4LSSH 3U7YL 3UL7A 4G8EB 3DX8A 1FFOB 5IJKA 1VRSA 5J1AB 3D0VA 2KBGA 4J8RA 4BZ1H 3GXIA 4P57B 3D33A 3ZDZF 3N0PB 2J1YA 4N0FA 4M7LH 5ITFA 4BYHA 3EFFB 1DUYA 4TTDC 4ONFL 5FGCE 1GGIL 3GS7A 2AJYL 4AENB 1N7ML 2PMZA 3LV3B 5GGQL 4DGVH 2OI9C 4EXKA 3C9NA 1F3JA 1XL4A 1ZVNA 2DMCA 4NM8L 5J57B 2FUQA 4PGJA 1WFTA 3GMPB 4KTYA