3BZ5A

Functional domain of inlj from listeria monocytogenes includes a cysteine ladder
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
450
structure length
450
Chain Sequence
b'TLKAGQTQSFNDWFPDDNFASEVAAAFEMQATDTISEEQLATLTSLDCHNSSITDMTGIEKLTGLTKLICTSNNITTLDLSQNTNLTYLACDSNKLTNLDVTPLTKLTYLNCDTNKLTKLDVSQNPLLTYLNCARNTLTEIDVSHNTQLTELDCHLNKKITKLDVTPQTQLTTLDCSFNKITELDVSQNKLLNRLNCDTNNITKLDLNQNIQLTFLDCSSNKLTEIDVTPLTQLTYFDCSVNPLTELDVSTLSKLTTLHCIQTDLLEIDLTHNTQLIYFQAEGCRKIKELDVTHNTQLYLLDCQAAGITELDLSQNPKLVYLYLNNTELTELDVSHNTKLKSLSCVNAHIQDFSSVGKIPALNNNFEAEGQTITMPKETLTNNSLTIAVSPDLLDQFGNPMNIEPGDGGVYDQATNTITWENLSTDNPAVTYTFTSENGAIVGTVTTPFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Internalin-J
publication title Crystal structure and standardized geometric analysis of InlJ, a listerial virulence factor and leucine-rich repeat protein with a novel cysteine ladder.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell adhesion
total genus 147
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bz5A02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3bz5A01
1DS9A 4ARNA 3WPIA 3E4GA 2WFHA 2OMXA 2Z7XA 4CILA 5LFNA 2O6QA 1PGVA 4PKIG 3BCFA 3ULVA 4PEQB 4ECOA 1QYYA 1IX2A 3RFJA 4U09A 2RR6A 2Z62A 2Z63A 3GOZA 2P1QB 2Z65A 1LYQA 4Z8GA 1YRGA 4R6AA 4J0MA 2JE0A 4R07A 3CIGA 2Z82A 1H6TA 4Q3IA 1XEUA 4C2BB 3BZ5A 3FAXA 4GLPA 4GT6A 3RW6A 4FCGA 3RFSA 3G3AA 4R09A 3G06A 4PQ8A 4LSCA 3G04C 3OGLB 2V9TB 3WPBA 3WPFA 3P72A 5D3IA 3RFEA 3TSRE 4UFRA 3E3ZA 4U08A 3VQ2A 4EZGA 1JL5A 4LSAA 3FAWA 1LTXA 3OJAA 3W3MA 4TZHA 4BSUA 4U06A 3ULAA 1FO1A 4Z61C 5IJCA 4KXFB 5AWAA 4LXRA 2RA8A 4NKHA 4C2AB 4LI1A 2OMTA 4RCAB 5GS2B 1SQ0B 5AWBA 3G3BA 1DCEA 1O6TA 4CP6A 2YA1A 4XOSA 4B8CD 3W3LA 3M19A 4R6JA 4G8AA 2R9UA 3W3NA 3C6PB 1XECA 2O6SA 1OTOA 3WPEA 4QXEA 1GWBA 4CC4C 4BSSA 2ID5A 1H6UA 4QBZA 5A5CA 5ICUA 4M7EC 5FTTB 3W3KA 4ECNA 1OTNA 1A4YA 3ZYIA 1M10B 4FDWA 4V2DA 4V2CA 2OMUA 5AWCA 2Y5QA 3RGZA 4V2EA 3DZEA 4OQTA 4P8SA 1DFJI 4Q3GA 4CC4A 3KJ4A 2Q4GW 4XSQA 2UZYA 1M9LA 3BCDA 4BV4R 5GQRK 2WQVA 4M7EA 2ASTB 3OGKB 5IJBA 1OGQA 1FS2A 3OJAB 3A79B 4FHOA 1P9AG 5B4PA 2OMZA 2Z66A 3E2JA 3WPDA 2Z64A 1D0BA 4R6FA 2OMYA 3W3JA 4FS7A 3BC9A 2A0ZA 3WPCA 1WWLA 1IO0A 5CMPA 2WQXA 4LI2A 1K5DC 2V9SA 4PERA 4P91A 1M0ZA 4WYKA 4Z94G 3WN4A 2XOTA 3ZYJA 4IM6A 4K17A 1U0ND 4MN8B 2BEXA 4NKGA 1NM4A 4J4LA 1Z7XW 1OT4A 1ZIWA 2Z81A 2P1NB 4Z64C 1XKUA 2P1OB 2C9PA 2C9RA 1M9SA 1OZNA 3FXIA 1M42A 2UZXA 1P8VA 4LXSA 3UL8A 2V70A 3C6OB 3RW7A 4Q62A 4WP6A 1KOOA 4Y61B 1KOHA 3UN9A 2WQWA 3C6NB 4I6JB 4PSJA 4R58A 2O6RA 5HZLB 3G39A 5GMFA 2JE1A 3RIZA 4KT1A 4U7LA 1O6VA 1XCDA 2P1MB 3RJ0A 3ZYNA 1G9UA 3SB4A 2CA6A 5GS0A 4CNCA 1A9NA 3UL9A 2IFGA 5AZ5A 5B0NA 1O6SA 4R08A 3ULUA 5HDHA 1K5GC 4HQ1A 4LSXC 2P1PB 3UL7A 4QC0A 3JB9j 4CNMA 5GMGA 2BNHA 3CIYA 4AQ1A 1FT8A 1FQVA 5B0TA 4R5DA 4LSXA 4RCWA 1XWDC 3WPGA 3CVRA 1OOKG 4FD0A 4RWTC 5AWDA 4YEBB 2RA1A 4AY9X 3WPHA 3W3GA 4R6GA 4R0AA 2OMWA 4ARRA 4Z79A 4MQWX 3VQ1A 3REZA 2C9QA 4BSRA 4R5CA 5IJDA 2FT3A 3RGXA 1W8AA 4AW4A 2ELLA 4FMZA 3OGMB 4L3FA 3ZYOA 2Z7XB 2JQDA 5CMNA 4XGOA 2ASSB 5IYXC 3M18A 2OMVA 3O53A 1P8TA 4H09A 5GMHA 3O6NA 1OTMA 3PMHG 4L3AA 4KNGA 2XWTC 3E6JA 2WQUA
chains in the Genus database with same CATH superfamily
4RX4D 2TSAA 2HVJB 3N06B 3H3PL 3FTGA 2OR8A 5IB5B 4YK4C 4ZMLA 5F88A 4LLQB 1VJSA 4QCIA 3VXMA 1CFSB 1SOSA 5LGHL 2OJ1A 4RGNC 4AYBA 2OL3B 4KOBA 4ALAL 1I1AA 5DTFB 3MUZ1 4IOFD 2ICEA 2E6JA 3FZUC 2YSTA 2DQGH 4AV4A 2YR3A 5DEGB 5F7EH 2ADJA 1VZGA 5CJQL 3SKMA 2P1QB 3NSFA 5FHAH 4TNFA 1MIML 3NCEB 3DHPA 2DQIL 4UDUB 2QEJA 3NAAH 5AZUA 3ASNB 3ESOA 1U6AH 4XPAL 1E43A 4FXGC 1ZHBA 5D1XC 35C8L 3ARDD 4JZOA 2XHNA 1S7UA 2VZ3A 1CBVL 4XI5D 5D7IF 3FH7A 2V3FA 4Q3IA 1XEUA 2XA3A 4M93C 1P1ZA 4FFZH 1MRFH 3FRPA 3L3DB 4BBWA 4XPTL 2XWJB 1IAII 3GMLB 1IQWL 1A2YA 3DBSA 5MI0B 3T8VA 4ZD3H 3U9UB 4DOHE 2RGSA 3QIUA 5AW0B 3VWJB 2DTMH 2ZG3A 1Z0NA 5FCUL 2FBRA 3CFDA 3EGDB 4A2GA 3RFZC 4EUPG 4HULB 4HEPA 3QCTH 2FTAA 5I75B 1DBKH 2AK1L 4PJXF 3ZOAA 5D3IA 3GSVB 3U4BH 1NGXB 1SF5A 1XSIA 5KVEH 1VADA 2NZ1A 3QPQC 5JHDD 1DLHB 2H9GB 4ZYKA 3E3ZA 1T0OA 5D72L 5I17B 5D1QD 3QFJA 4EDWL 1UD6A 1YMMA 3OMIB 3DX8B 3V7MA 4EI6A 2W65A 3X12B 1SY6H 3OJAA 2Z35A 2CM6A 1EEYA 1MCNA 5EUOE 5T1KA 3LQAC 3NZSA 4DVBB 1KJMB 3I9GL 4BSUA 1EEUA 1N4XH 4GBXC 4M1DH 4RIRB 1MJJB 5ERWA 3HIZA 5E5MA 4U06A 3MROB 2HX9A 1PCXA 5BQ7A 1U8KB 3BSHA 3CFEA 2A83B 1NBZB 3LKQA 4ZAKA 1JWSA 3IT8D 3QCVL 3MA7A 4KI5D 1NGQL 2NQDA 1BAWA 2DMCA 4WFGD 4WI2A 4XBGA 4YGVB 1F3JA 3IDJA 3QZLA 4DZ8B 1MCPH 1QAWA 1IB5A 1E2WA 4E9SA 2FEDC 5B1JC 3O9WA 2W81C 3IDNA 4LZKA 4G9DB 2HCZX 4RCAB 3RHWF 1KC5L 3F65A 3FPYA 5EO1A 3HNSL 4HC1L 1OALA 4M5YH 2XYBA 3K6IA 3ZDYE 4OCWL 4XP6L 2G5UA 4LLVB 1XEDA 1AYRA 2WBJB 4XVTH 3FF8A 1QFOA 5FCSH 5C86A 2G4EA 4NWUL 4BQCA 2P7TA 2VXQH 1F11B 5GGVL 5T5FA 4B8CD 4PGEA 4C47A 1K2DB 4OJFL 5EHFA 2BH0A 1XECA 1UFUA 3UH8A 5BVJB 3OLGA 2WVVA 5AVUB 1XF2B 1C5BH 2BNQA 1RVFL 5F3BA 3QFDB 4ISVA 3KJ4C 5LJYH 5AOLA 2DIJA 1X9UA 3W0WB 2ZAGA 1UJ3C 3CSYA 1YUKB 3IU3A 3KAAA 2UZYB 1BD2E 1VPOH 2Y2WA 1GL4B 2F2HA 5DWPA 5EO0A 4AWJC 5BV7C 3QH3A 2BRQA 5FGBA 3O6KL 3WN5A 3ABGA 2OZNA 3LH2L 4NAJA 3HN3A 3GZKA 3SE3A 3ZX1A 1XX9C 4NERA 3KH3A 5FO8B 3VFNA 4UQ3B 4HV8A 5DS2A 1C16B 4K5PA 3QNXA 5LCVA 2BOCB 4V1DA 1CT8B 4JQVC 4WWKC 3AMKA 3DSNA 4KJPD 2X70B 3L08A 4ES9A 4C83A 5AWCA 4W9GC 3DUHA 4OZIF 3KYKH 3ZL4H 1HWHB 4CW1A 4MJIA 2VMEA 5J6HA 5JPNA 1SVZA 3EYSL 3H9HA 3NH7L 1MFUA 4N3UA 1GGIH 4ODSL 4D0CA 4HGKC 1CGUA 4C54A 4QHUA 5D7JD 1QKZH 3HE7B 4S1QL 4XRCA 1OP5H 2DI8A 4ZSOB 3QJVB 3ZKXC 5IFHH 5ID1A 2WQVA 3GRWH 4PLJC 4K71C 3OGKB 5IJBA 1OGQA 1EVTC 3L4XA 4Y1AA 4JM0A 3NABH 5DD3L 1LE9B 4PVMA 1SOKA 1QFWM 4DEWA 2F68X 5DQ9A 4X0KA 5JIIA 3CLFH 2WIMA 4M9PA 2VN7A 3TL5A 3V79C 3MNZB 5IMOA 2VW4A 4I9WE 3WENA 4OGXH 4WTZA 3H54A 3KYOB 2Z66A 4FHBD 5E1GA 2Z64A 5LDSA 2WINB 1XSOA 2ZT9C 3NK3A 1Q9WA 3OB8A 1PZBA 3S4SA 1MHHB 4R90L 3QEHA 1U8IA 1IVLA 2V7HB 3FTXA 4PGBA 1ZJBA 2ZXWB 4MD4A 5F1NB 2AEQH 3AVEA 4FQXD 5HY9A 1EJ8A 1Q1JH 4FS7A 1GC1H 4OZGB 2ZCLH 3UBXB 2NY3D 4IRZA 3T2NL 2D2CC 1EX0A 5CWSB 1DUYB 3MRIB 4TTDD 5IUSA 5JTWA 2GY5A 2OZ4L 3MMEB 3APCA 3MRLB 4BFIA 4CUCA 5IMMB 1OT2A 1Q94A 2YGQA 2XRAL 3QQDB 3FW6A 5EU6E 5AVSB 3UBGA 4WW2C 3C8HA 3VU1A 2IDSA 4I3SL 4HLEA 5MP6H 1IEAA 1HDMB 3LPOA 4YDVB 4CMMB 1RIHL 4OZHF 1Z7JA 3T0AA 1NL0H 4UTCA 3ZYJA 4AK1A 4RRPM 4B41A 2XN2A 4TN9A 3BH8B 4DN3H 4WO4D 5FK9B 2A6JB 4TS6A 4K3EL 3N1PC 4PWEA 5DO2D 4NCC2 1CZ8H 1UASA 1OT4A 5FWRA 3ZE2E 3QQ4A 4MZ2A 3HMXH 3EJTA 3ULSB 4OFYD 2DW5A 4PG2A 1PKQA 1AGCA 4G6JL 4PMFA 3RBGA 4MDJA 2WXNA 2L3BA 2HVKB 4QRQB 3QDJD 2CDEA 3P77B 1LO2L 3RDTC 1P4BH 2JTYA 3BVUA 2NY5H 1TO4A 2NYKA 4PJ6A 1CUOA 4N2BA 4Y2DA 3TFKD 3C6OB 4KKNA 1PNDA 1GYWA 1YY8B 3MRGB 1BG9A 5I0ZA 3AS1A 1JTOA 1U2HA 4P23B 3KJ6L 1L7IH 2B4CL 1NAMH 5D1ZD 2BSRB 1QR1B 1USZA 4MA3A 2DEYX 3T6VA 4HUVB 1KWKA 5EF2A 4KQ3L 4GUQA 1T04B 4U1HB 5HGDA 2JJVA 3RB5A 1SJMA 4X8JA 4QXGH 4U1KA 2A4ZA 4PCYA 3GI9H 5EA0H 5IF0B 1U8CA 2ED7A 3U2SA 2UV3A 4A39A 4OFIA 3VNYA 2EH7H 1AR2A 4M5SA 4NBZB 1NMBL 1NSNL 3L45A 4QXUL 3NMEA 4H25A 4Q89A 3INUL 3S37L 1PZ5B 4BUHA 5L4JA 4B9PA 4GP8B 4OH2A 4P9HC 3L5HA 5T1MB 4IK7A 5HTSA 4DKAA 1OK0A 4MCZA 1XCTA 1JNNH 2D7TH 4XPFH 4MA7L 3GF8A 3K2IA 5KEZA 1QSEB 2W9EH 2JKNA 1TKWB 1O6SA 4WHYG 1J9RA 4QNPE 1NZRA 1UURA 3LXAA 2BHUA 1ACZA 4WUUD 3FO2B 4OLXL 5E9NA 4LBAA 4AEFA 5JHMA 1E4KC 1E2VA 3PIQA 1LEKA 3VFMB 5C0CB 3BGMA 2VDPH 4PJIF 3FKUS 1HXYB 2X6BA 4DETA 1A9BA 3SE9H 1S7VA 2XNAB 3F8UB 1JGUL 3P2DA 4YDLC 1S7XA 3AS2A 3CZNA 1E90A 3UPRA 3X3FL 5EULV 3SJVD 3DMMC 2VJ0A 3F5WB 2G9HB 2NXYD 5FOBA 1EZLA 3BDYH 3EJPA 2FX8L 3E8VA 4PRPA 3UYPA 4LCYA 3S96A 4FQJH 4EZLA 1RPKA 4G42A 3P4MB 5DT1H 5PAZA 3Q1SL 1QMUA 1J1XH 1FT8A 3RWHA 5EDSA 1R3IL 3MRQB 2L7UA 1U8HA 2CGYA 2DWYA 4N2HA 1OGAD 2LLGA 1A7RL 2Z1PA 5DHXB 3FTVA 4FD0A 4FFYA 5B39B 2XA8L 1NKRA 3GPEA 4Y5XA 3LIZH 2R2HB 3ZHDA 4A6YH 3K0WA 4PRNA 3KXFE 1KIUA 4RMTA 3BH9B 4AY9X 3DROA 3WLWD 4X99A 3AU1A 5ABZA 1JGLH 4X7TA 3H9ZA 4OT1H 3ZTJH 5DD0H 3U7AA 4QMEA 3ARGC 2ZX5A 1A14H 1UZ6E 4TVUA 3BDBA 1ETB1 1F58L 3UTTA 1AANA 4AKPA 5JHLH 3UTOA 4AV0A 5IZ7A 1E8XA 2OMVB 5KSUA 3OR7B 4FYRA 1KCWA 4B7IA 1TMCB 1IAOB 2YAHA 2ZX6A 5ANMA 3DTXB 5CLYA 1E8ZA 5I0DA 2DDQH 4D9QE 3MLVH 4DJMA 3V0EA 1WAAE 4PJHF 3W81A 2PPFA 3MVSA 3KHOA 4JFZH 2E47A 2JFCA 4TNVF 5FM8A 3T04D 1M4KA 3T77A 2V2TA 4F37F 5EEUA 5IROC 3HRZB 3OMNB 3S2AA 1V7ML 3ZMRA 1ZTXL 2FLBT 3DUUA 1OSZA 4LSQL 5IMLA 3BKCH 4A37A 5EZIL 2XLLA 5F1KC 3QDMA 4JHAL 4G9FB 1SXCA 3V0FA 4NFDA 3VD0A 4R0LB 1MEXL 3D8MA 5CLZA 4FQCL 1SLWA 5DS1A 4DN4H 5BXFB 5KSVB 5GZOA 1MW3A 1M05B 2NZIA 3D51A 3QZMA 4AY0A 3KPSE 2RJMA 2G3NA 2BNRA 2JJTC 2P8PB 3C9NA 4QT5B 2UY7A 5I0WA 3VXMD 1KDIA 1DQJB 2YWYA 5MEOA 3MJ9L 1FNSL 1FO0B 1SLXA 2QSVA 3QUMB 5MHSE 4EQ3A 2OR9L 4XTRD 2WQUA 2E6QA 4UINL 5EORL 3S3BB 3HLAB 3WFBH 5E00B 5J11B 5A2FA 1JXGA 1LO4H 3OKNB 4I7ZC 3DBXB 1KXQE 4J27A 3PNWB 1JYVA 2VZTA 4ZMOA 6FABL 1JGVL 1LK3H 4M7KH 2OSWA 5BOPA 1ED3A 3OAWA 4GG6A 1SXAA 4DNLA 3SPVB 5EC2B 3C5ZC 1NC4B 3G7TA 1F0LA 3QJFA 2VLJA 4YDIL 2NTFB 5FW8A 4Z7OE 5FYKU 4D8OA 3BUQA 5KYUA 4W4OA 1WGVA 3ZMEA 2WP3O 4YX2L 1AGEB 2P52A 1J10A 3WNOA 3CU7A 4TSAH 4R5VA 2WP3T 2X9ZA 2QL1A 3ZIMA 3P73B 3F7YB 4Y9GA 2QKIC 3QIUD 2EDRA 2XJLA 1DDHB 1DJHA 2VDKH 4YBLC 1R47A 4N2NA 1LP9B 2B59A 4GQZA 2YUXA 4FERA 4QPEA 3PY9A 3IE9A 3Q9QA 4ABWA 2WKOF 4GS7C 1OWWA 1TUPA 3ETBJ 1A6TB 5LAPA 1RZQA 2GSGB 3ARXA 3IAQA 3E9TA 3VH8G 3U82B 2VISB 4QXWA 5DLML 2C7UB 5EBGA 3OGLB 5H37G 5J1AA 3MCLH 2B1HL 3Q7JA 3C8KA 1B0GB 3SZKC 4X8CA 4KTEL 4KX9A 5CIPB 2J43A 1T5XB 3LPFA 4FXGA 2NY0D 4PJBF 4P57B 5D1XA 2B5IB 2WYIA 5T1KD 3TBTB 4NZUL 2FH8A 5TE6L 5GGQH 4Q0XL 2D0FA 4WK0B 2BJML 1W8EA 1YY9C 4KDTC 2XT1B 4QI3A 1HU8A 3SDDB 2C3GA 2H26A 3H3KA 3RAJH 4M8UA 1HAWA 1R75A 4ZTPL 1NEZA 4OQTL 3ES6B 3MLYL 4UZUA 3VXRE 3TPUA 3CBRA 2PO6D 3O9WD 3UG5A 1E4XH 2A3TA 3MJ7A 2Y36L 3U0PA 3HRPA 4J3SA 2DI7A 4JHZA 1T7YA 4WCYH 1IO4C 1WIUA 3N42B 5FYJE 4HU2A 1DEEB 3CZSA 2ROXA 2C7FA 3MLXL 4C2AB 5IFAL 3DOIA 5EOCL 3IFPA 2GITB 2R39A 4MFHA 4Q74A 4TVPD 4DP7X 2N0MA 4OI7A 3EHBB 4KZ0A 3FT4B 3H0TA 1CLZH 4I77H 2DQUL 2DEXX 4RFOL 5TE7L 4JR9H 3DRQA 3EYFA 2J5LC 1XGPB 4HKZB 1KXVA 2AQ3A 3WFDL 1QFPA 1KGYE 2NUPA 4ZS7H 4EZMA 1GJUA 5E4EC 5F6IC 3VG0L 4M6NH 1W72A 5DZOA 2PXYB 4DKTA 4H2CA 3NCFB 3GXNA 3UEZA 3F7PC 3MRRA 4XOSA 4ZODA 3CXFA 5ALCH 2Z31B 2C3VB 4TUOA 3O2VL 4KKLD 4XMUA 1IV8A 5DGRA 2WTRB 2VXUL 1RPUA 3TJEL 4P5KA 1JVKA 4KY2A 1OAXH 3KMDA 4KRNA 1R6VA 3D69A 5HHQA 5T3XL 2RHEA 3VWKB 2BXYA 1P4LA 1LDSA 3PV6B 3B6SB 5B1JA 3HZKB 5E6IC 5ICUA 3IMUA 3GFUA 2YMXH 3B1UA 1Q9KB 2NW3A 4LAQL 2D7OA 4QWWC 4GYBA 1VLXA 3CK0L 3TBWA 2B14A 3WO4B 5GGRB 1FVDB 1G7JB 3RGVD 4YNYB 3WD5H 4G8IB 3EOTH 3WY2A 4F33B 1I8UA 5KW9H 5L2KE 2WXKA 1G7IA 1RIVL 3ZYIA 2PN5A 4N6RB 2OYPA 1CI3M 5I1CH 5EOTA 2DQCH 1DBJH 1EDQA 1U93A 4HCGA 4TUUA 3VB8A 4Z5RB 1PBYA 2IGFH 1E4WL 1FJ1B 1RQ5A 3QZPA 5TDOA 3KJ4A 4Y1AD 1MCKA 4PWFA 3JUZA 3WNLA 1UJ3A 1D5IL 1UWEH 1DL7H 2KI6A 2XWBB 3F6LA 1E27B 2AI0H 3JWNE 5F71A 3RHWK 5ABDE 3O6FB 2PW2B 4GSRA 4HALA 3BCDA 2GW5A 2WLKA 2PCYA 1MJUH 5FECB 3O4LA 5BRZA 5C0RL 3V4VH 1B6UA 3RWIA 1MCOH 3GBMH 2N59A 3DJTA 4GRLC 1JD7A 3M07A 3NQIA 3B9KD 3OZ9L 4Y0GA 4M03A 1RMFL 5CGTA 3EFFB 1U8MB 2K3HA 1XF3B 4F7PB 5INCB 1ET7A 4NO0D 4WWKA 2BSED 3RWJB 1MELA 3VO0A 3BFOA 3G04B 4PB0H 4ZMAT 3F7KA 1BFTA 4JFFB 4GQRA 5BS0B 3UX9B 2VB5A 5DJ8B 4CL7A 2JH2A 3W3JA 2AV1A 3RZCC 3MV7E 1MJ7H 3BC9A 3DJRA 2PF6A 1BPLB 5DZNA 3VSTA 3LV3A 5CAYB 3DXAD 4JPVL 5IBUB 3E1F1 3EYQD 3DGGA 3ECBB 1UZGA 3BP6B 2SODB 1CQKA 4E0RA 1OSPH 2WBXA 3V5HB 3MBWB 1JV2B 3QIWB 3WJJC 4Q6YA 1JNLL 4OV6F 5FYKH 4MCMA 4B9ZA 1KPUA 2D31A 2Y1VA 4XN8A 4QF1A 2EDJA 3VTAA 4OZGF 1MWAA 5HDWA 2DM2A 3HE6C 2C34A 2K70A 1KCRL 5TQ2H 1QBLL 4N1CA 2F19H 4DUWA 2DLGA 1HZHL 4ADJA 2C4FU 1NUGA 5FPIA 3VGAC 1D9KB 5BO1H 4J3OG 1Z9NA 1AGBB 4OV5A 2B9AA 2GTZB 1BBJB 1F8TL 4EUPA 5IEKB 4UANA 2CBQA 3EO0A 1YEEH 1CD1A 3ME0B 1QVOA 1JF6A 1E5CA 1Z3RA 4BCZA 5FGCB 1Q72L 3I6LD 3QUML 4MHHI 4DO5A 5JW5A 2ED9A 4WENB 1GPOL 4MQTB 4PTUB 4HHAA 4LIQE 4NN5C 4ENZA 4LVNC 1U8LA 4ZFZB 2VQUA 5JXEA 2XX0A 4JDVA 5FA3B 3AQDA 4NUMA 4WW2A 1CTOA 5AAWC 2ZYSA 5DHYB 2DKMA 4X6CA 3MJ6A 4P2OC 3BPLC 4PWHA 4U2YA 4UILL 1BBDL 1R5IB 3PABB 5JDJA 3EYUL 3MRHA 4P2RB 3G5XA 4UNTA 4JFYB 4JG0H 1T4KB 3QT2A 3ZZSA 4NZRL 4HIHA 3DIVA 3M88A 3CDGA 3VD5A 4G5AA 1KIRA 4PREB 1BJ1J 1KJVA 2IH1A 3LTVA 2QFRA 4DGIH 5E1AA 4QEGA 1D5BB 5EFIA 4PGDB 4C56B 1CL7I 4P2QD 5I5JA 1L9QA 5EH1A 4WIQA 2P8MA 5KYYB 3FB7B 4R7NA 4TNWF 2LW3A 4GXVH 2F7IA 4XNXL 5F1OB 2JE1A 3BP5A 2GTWB 5AD0B 2MCG1 4KT1A 2FLRT 2IPUK 3ZY7A 4KXCA 3D30A 4G6FD 4XAWH 3UZEC 2DQGL 5F7EL 3UC0H 3RDTA 4FHKA 5BZXA 5FHAL 3UBFA 1NAMB 1X7TA 1DBMH 1UACH 4Y88A 2PYEA 2JELH 1TQBB 3PGCA 4Y7MA 3NAAL 3BFWA 2NUTA 4LE8A 3UP1A 1U6AL 1OM3H 4UT6A 4WV1A 1N12A 4QGTA 5D5MB 1PDKA 4E9RA 5EEXA 4FNQA 2XTJB 1JHKH 4K5MA 1XV8A 4FFZL 1MRFL 3FFDA 5H94A 3ZDZF 2BVOB 3LVEA 1D2OA 1XR8A 1QD0A 5GGUB 4NNXB 2DWTA 5AW5B 1UD8A 2VO8A 2UYLA 4N0RA 3SDXE 3T8XA 2R27A 4BH8B 4ZD3L 2I85A 2CPUA 5CO1A 5J0BA 4B0MB 4RMSA 1QRNA 2DTML 3D1MC 3S3JA 4LVOC 5CN1A 1MRCH 3QCTL 5GGVY 5I16B 4MLSA 4WJ5A 3ZTNL 4P2YA 4X50A 3RNQA 4OLUH 1CIUA 1DBKL 2WANA 4HWBA 3WJMB 2F53A 3U4BL 4H5SA 3S36X 5KVEL 4GT0A 3BYYA 2GC4C 1P9MA 1MLBB 2W60A 4AVIA 5IHHA 2GJPA 1E6JH 2X4TA 5LLIC 2QQQA 2O1AA 3UACA 1QSVA 1FFNA 3K6DA 4G6AD 5I1KH 3FT2B 5E8EA 1FRGH 1H3WM 1YUHA 2OXHB 3NEOA 2G9KA 3DX7A 3VQ1C 1JXKA 1SY6L 2JCCB 3PP4L 2DMHA 4UUJA 1JXJA 3V8CA 3IEAA 4OFVA 5E70A 1QBAA 3LQZA 3OHXB 4M1DL 1N4XL 3JWOH 4RCWA 4NQCB 1E4KA 4YC2C 3CVRA 4BH7B 4XBEH 5AWDA 3GINA 1T21B 1URIA 3TH4T 2CBMA 2EUZA 4YSCA 1EJOH 3N50A 4AYFA 1VGKA 4M6OH 4NHUB 2J71A 4HZLA 5T3ZH 1VKXA 1PX3A 1Y1UA 3MV8B 1MCPL 4J12A 2DZEA 3ZT6A 4YHLH 3EG9B 4JUSA 1SYSB 2FYYA 2BP8B 4M48L 1DJIA 2ZNWA 5CJOH 3OQ3B 3U48A 4M5YL 3CSFA 4J3OC 1J9QA 4KHXH 4JZNB 1UGNA 1XSJA 4IJ3B 1JWUB 2XQYK 4HS6A 4I9XA 1ZGLM 2CE6A 5BRPA 4A6YB 3I9IA 2W59A 3VXUA 5FR3A 1PQZB 5FV2A 5C0BB 2C4FT 4DWHA 1T1XA 1RULH 5D7HA 3KPOB 1AVAA 1R5VA 1UWGH 3NSCA 1G84A 1P84K 4KAQH 4UTBA 2D3JA 1C5BL 2IDQA 5EU7E 3CN3A 3SKNB 5DUPH 1NFDB 1DO5A 1WWWX 3L5WA 3R7QA 1P2CB 3SQBA 3WEOA 1ZHKA 3ARGA 1VPOL 4WUKH 3WS6C 5JPMB 4AEEA 3KYMA 4HCRA 4M56A 5AW6B 4KPHH 3EH2A 3UZVA 4B5EA 3LEYH 1WUNT 2R2BB 1QBMH 3IGKA 4Z7NB 1U3HB 2ZOKB 3SEPA 4P5RA 2EXWC 5I1LA 4WWNA 1TNNA 1D5MB 3Q0HA 5HHPB 5DEJA 1JK9A 4KK8D 2EYSA 4RA3A 1XF5A 2XWTB 3O3UN 2AQSA 3GSWA 43CAA 5BW7C 3P4OB 5IIEB 1ES0B 4JFEA 5IROA 3KYKL 3ZL4L 1J5HA 4JY5H 2ZE0A 1EERB 4MJHA 2ARJB 2FHCA 4WSGA 1GGIL 1XGRA 1XF4B 2EIEA 2O6QA 1DQIA 3J27A 1QKZL 3QAZB 3TN0C 5IFHL 2HJFA 1HT6A 4G8EA 4Y5VC 4TNEA 4MMZC 5HVHC 4PJ5A 5DJ0B 2GVYA 3GRWL 3QWRA 3KD4A 1CGWA 2H0FA 3IDUA 4N9OB 1HYRC 3AJ7A 3NABL 4XWOC 5K9OB 2WSKA 2FK9A 4IQHA 3SY6A 5CFAA 1EUTA 3SDAC 3D0AA 1RK7A 4BWWA 2COQA 3U0WH 3CLFL 3EGXB 2BPBA 4J0MA 2V0AA 4TNVK 1IQDB 4XH2A 8FABA 5KOMC 2W0FA 3DVNB 5KSBB 1BZDA 4OGXL 4F37K 1JPFB 2AQ1A 1CMOA 3VQ2C 3WY1A 4YZWA 3LKPA 3QEUA 2QVMA 4EN3D 2ZUSA 4MX7A 3MKGA 1FVCB 1XHHA 3L3IA 4BKSC 1Q1JL 2MNJB 1GC1L 3EBAA 2VWEC 2ZCLL 3C5ZA 3N0PB 4UM8B 4ZUUA 3MLTB 4FFWD 1BIHA 1I9JH 5D1XD 5CBAA 3U46B 2Q6WA 3SCMC 3L5IA 1GOHA 5HJBA 3VFSA 4K5NA 2V6HA 5AZEH 1IAIM 3DTDA 1NGYB 5C0DA 4MVBD 2HKAA 1LP9F 1V27A 5SV4A 2K0RA 1NDTA 1VFUA 4U4IA 5FYLE 2VDKB 5MP6L 1DFXA 5GRVK 1AYOA 4U08A 1NBQA 3GSNH 2QKIA 3VFPB 4NJ9H 1NL0L 2E27H 4Z9KB 1J11A 3GHEH 4HOMA 4PJGA 3IKCB 4HK3N 4CMHC 2F0CA 2VAAB 4O2CA 5J6GA 3QR0A 5CEZH 3CZEA 2IOIA 2G5BB 2FWOB 2WC7A 3CH1B 5EUKA 4DN3L 2UVEA 3ZN6A 3PAVA 3SGJC 1S7RA 4AENB 1CZ8L 4XO5A 1YEFH 2JKLA 4NO5A 1HSAB 3E6HA 4R5TA 2VSKB 2FJSA 1PZ2A 4ELMB 2WLMA 3HMXL 4UMGA 3C2SA 2WAHA 4GW5A 3V52H 4AV5A 5K69A 3HHRB 1DVSA 4XO4A 3PNRB 1A1OB 4NZTM 4LDEB 1V5JA 1NPUA 2IGTA 2OSLA 5E4IA 5CCKH 2D7QA 2EO9A 3DI3B 4Y4KB 3SE4A 2WTOA 4NKQB 4TUKH 1P4BL 2DM4A 2BZDA 2NY5L 4PJ8C 2BWIA 4LK4A 2CBTA 2GJ6B 5AWBA 2J2ZA 4EOWH 1WEJH 2B20A 2XVKA 2WVSA 1IGYA 4KDTA 4ZFFB 5B3JE 3PQYD 3Q05A 1TTUA 2IADA 3N42F 4LBEB 5IB2B 1JZIA 3MBXH 1L7IL 1NAML 3BPOB 2WVUA 1JUFB 2Y7QA 5C0JA 4XCNB 3MV9B 5ESAA 4FLHA 2Q2EB 5KS9B 2NOYA 5I0YA 2VN3A 4YFLI 2O6SA 2H3KA 3HHSB 3RE0A 2I60H 4QXGL 3LH8A 4XCFL 5D93B 2MTAA 5EA0L 3VFOA 4CC4C 1OPOA 1KENH 3TGXA 2B2XH 3WOVA 3L3OC 5AOJA 3LN5B 1S78D 3FPXA 2EH7L 3IPFA 3S35X 3U4AA 3OVUB 4GPVA 3QUYA 4KFZC 3HBZA 2X89A 5D9SB 2ESVE 5EU5B 3V10A 5E5LA 1YECH 3FRUB 2AJ3B 1KLGA 3NFPA 3HZVA 5IESH 1INDH 4CGTA 5AVRB 3ZRSA 2D7TL 1JNNL 5EF3A 1M10B 4RNRA 1Q8MA 4ELDA 5C0IA 4PW3A 4XMXA 4D8PB 4E9WA 2W9EL 32C2B 3C6LB 1KIPA 3AXLB 1A6UH 3CAFA 4GXFA 5JW4M 1NC2D 1KB9K 5EZLB 3WL9A 2AXGB 2DQ6A 3O4LD 4FKHA 5BRZD 2E59A 3L4ZA 4Q56A 1CS6A 1X5HA 4JFUA 4Y1SA 1GGYA 3BAWA 4MNHA 4OF3A 2IWEA 1G7MA 2DF3A 1T20A 4APXB 4MMXA 2CSPA 1A1NB 2JXMB 2VDPL 2YFNA 1WQVT 5E6IA 1HESA 2CKBH 2HA1A 3T0ED 2NY2D 4MA8H 3SE9L 2UUDH 4WWKD 4KO7A 2DH3A 5F72S 4Y19E 4F58H 2A6KB 2Q1EA 1MH5B 5HHVH 3K71A 4JFOA 4HQQH 3V0VB 3VUAA 3K8LA 1H3PH 5GS1B 2GEQA 3BDYL 1I7ZA 2DQMA 1W0WA 1TJMA 4ZO7A 2NXZB 4FQJL 5B7EA 2CR0A 4MQSB 2NX5A 5DT1L 5I6XC 5EF0A 4KROB 1J1XL 4QY8B 1HOEA 2JE8A 4ONHB 3BW9B 3ILQC 4AITA 3FB8A 4PP2B 4TLTA 3ZE1E 5HYEA 1R5WA 5L4MA 5CZXC 3U2JA 5SV3A 3V4VB 3EDEA 4LHUB 2FT8A 1S2EA 3LIZL 3KPNA 4A6YL 4GKSB 4L8DB 4NDMA 3JWNG 3O8XC 1WWLA 2DL9A 1T1YB 4EMZA 5F7DA 3CTTA 4KXBA 1JGLL 4PWKA 1E28A 3MU3A 2CUHA 4OT1L 4U6XB 5DD0L 1GCFA 4GRLA 3VGDA 2H2SC 4NQEE 2VDLH 3TZVA 4PGCA 2V8MA 1A14L 2ITCA 2VQ1B 4WYKA 3EOAA 3I75B 5E94B 4NXSA 3RB7A 2E74C 5JHLL 3BJ91 3VGFA 5EEYA 4DPAX 3GXFA 3PPSA 3M17B 3PHQB 3DVGA 3U1SH 4YSTA 4B7LA 4MCYA 4TQ8A 3UTSE 3TYGH 1NGPH 3GXUB 3WUZA 2DDQL 3MLVL 4PJFE 1B6DA 2CLVA 3CVBA 5ETUA 1WA1X 3VH8A 3LEXA 4AH2B 4JFZL 3TO4B 2HVBA 1RLBA 3RZCA 4J4LA 5JXED 3IDIB 5H37A 1G9EA 4IRJA 3C12A 4ZX5A 3RVXC 1BYNA 5FLUA 3BKCL 2W92A 3D3VD 3KLLA 5DYFA 3EJUA 3IETB 1CLYH 2P1OB 1ICTA 3F3HA 3G6DH 1R3JA 3RL2A 4DN4L 3HHMA 3WJJA 3UTPD 5B38B 4IMKC 4N68A 5CJBA 2JQZA 2C9VA 2CAKA 3A4DA 1OK8A 3L7FA 4M7ZB 3HE6A 3ECQA 5E7BA 4DCQA 2XQ0A 4W9CC 5C0AB 3EGSB 4HIIB 5KUKA 2XN9A 1QEXA 1J1OH 1RJYA 3JZYA 2HFEA 5CEYA 5T1LD 4CN6A 1YN7A 4K7PH 4U1IB 2BSCA 3E9UA 3MCYA 5E8NA 1UXWA 3WFBL 4KXZH 1LO4L 5IW1A 1HYSC 4PJDF 1NCDH 3NN8B 2H3NB 5HGHB 1LK3L 4DP1X 3QC6X 4M7KL 4L0PB 1E3ZA 4I48A 2IV8A 4JANA 1XZ0A 2JK5B 1L0YA 5AAWA 4RGOH 2DY2A 4NPYB 2P5EB 2FEJA 1OP3H 4E42A 5I1AA 4P2OA 3BSGA 3TJHC 3FONB 4HBCH 5DD5H 4YSUA 4XMWA 1C12A 1GJIA 5SX4H 5EUOA 4TSAL 4NKOB 3ZYNA 1S7TB 3QGVA 4LLUA 4QRUB 2CA6A 1TJHH 3FFCD 3AB0C 3DUSA 5FKPA 2X4OB 5IHUH 1PVHA 4G7YH 1IM9B 1DBAH 1WF5A 4RGMC 4XX5A 5IBTH 5JW4Q 3MLPA 4OZFG 4MXWL 5BRQA 4NOFA 5DUJA 3VXTA 1A47A 2VDKL 3ZJAA 2RR3A 2ZOOA 4LO9A 4M1GH 2AFNA 4TSBH 4RFNB 3C60B 3WNJA 4G43A 4IS6A 1KJ2A 3RWDA 4PBDA 3TA3D 5JOFA 4DPRA 4B9GA 1MQ8A 4L29B 3UZEA 1THCA 5H4YA 4HG4J 4JFXB 3TX4A 1E7UA 1QO3A 3WKMH 3MUGB 1NIFA 3MCLL 1SM3H 3RWFB 1S9YA 4GUPA 3CZJA 1AR1C 2VR7A 3O2DH 4JPIB 4KKPA 3CG8A 4JFSA 4MRCA 3NA9H 2A9AA 4KK6C 4EAEA 3FK3A 5GGQL 1QTPA 5I6LA 5F8RC 1Y18B 5TDNA 3X1BA 3IWUA 3QDHA 3DX0A 3RAJL 2HKHL 3S2CA 4TNWK 2AJXH 3JWNC 1NOAA 4WKZB 1BD2A 3PUCA 4RLDA 1A22B 2ICES 1G0XA 2DYRB 3CPLB 1GSKA 4YE0A 3C5JA 5E8OA 1E4XL 1DVYA 4CVXB 4JCWA 1XIWD 1IEHA 1N0LA 5DRZB 1QRKA 4WCYL 2VTFA 3HAEH 3LJ3A 4L1SA 4ETQA 5DVKA 3OJMB 1YRKA 4IBSA 2JCCF 1TQUA 2HRPH 4YIQA 1AD0B 4XR8C 4UNIA 3GSOA 3D7PA 3W0WE 4I77L 1CLZL 1P5UC 4HUXB 3EYVB 1KN2H 1BVKA 4NN6C 2DM7A 5C2BH 3D07A 4PY7A 1JIBA 1RIUH 4JO4H 4ZS7L 5DJ2B 3QWNA 2JV6A 3IGAB 3LOWA 3E7JA 4M6NL 2LAAA 1G9MH 3VQ1A 2GFBB 3ARZA 5KTEH 5L4FA 2BMKB 4KRPB 5DRNA 4PJCE 4QO1A 1NINA 4LU5H 5ALCL 5I0VA 3IDXH 4WU5A 2FT3A 4JN2B 4W9LC 3RWGA 1UD3A 2K7QA 3BQUC 2IFFH 3FQ2A 4U6VH 5BOJA 2HLFD 4YFEA 3D9AH 3IJYB 2H2PD 1OAXL 1C1EH 4MXQD 3H8NA 5CILH 3EO1B 2HLAB 2L7EA 2ADYA 1JYNA 1PY0A 5C07E 2X4RA 2F8XC 4XGOA 1BQLH 5G5DB 4AYSA 4M9OA 4HAFA 1NJ9B 2YMXL 2VMDA 1KCUH 2Z65C 3EJCA 5IV2B 4R7LA 3DYPA 1OWRM 4JFED 5AG8A 5DC9B 1JN6B 3OX8A 3NQKA 1OLZA 3WD5L 3MDJA 3EOTL 2OJEA 4K94C 5C0NC 5KW9L 2E7MA 1AS7A 1UOKA 3HG1A 1NFDF 1NUFA 3PG2A 3CC5A 4FNUA 4L3AA 4Z78A 3FU0A 5I1CL 5HYSB 5K59E 2O61A 2WKLA 4GEIA 1FZOB 5E2UH 3VRJB 3W39B 1QSFE 1DBJL 3DIFB 1QFWH 2MJWA 3IGUA 5J12C 4KZDH 1H15B 2PPAA 1ZVYA 4PJ5D 1GYCA 2IGFL 3QWRD 1HILB 3MZTA 4X2UA 5C92A 1OZTG 2ATKA 1AZZC 1FIEA 2AXWA 5D2NB 5EU6A 3FU7B 4PJAF 3ARBD 2WXGA 3HNVH 3L3GA 5HPOA 1UTDA 1ZT1B 3DO4A 2E46A 1ZVSA 1DL7L 4ZDHA 4FZEH 4XNZC 3MJ8A 2RH0A 1FNGB 5FO9B 3WS6A 2TRHA 5DEFA 3REWA 2NSQA 2YD7A 5B3SB 5DQDH 1MJUL 1XH1A 5BJTA 2ODIA 1E9QB 4YVUA 3V4VL 4AQ1B 2VDQB 4KNQA 1MCOL 3GBML 1MHEA 1D6VH 1U3YA 5IM7B 4OKVA 4UYPA 4EJ1C 3QEGH 1YRGA 2R0LH 5A3IC 1VCBC 4R8WH 4TKWA 4XN7A 3Q5OA 2F1BA 1ZT4A 3CIGA 3KM2A 4LVHC 1PG7H 1N6UA 1QASA 1TF4A 2DYPD 3GTTA 1RD6A 4PB0L 4JK0D 4F15C 5JZ7C 5J4MA 4EVNB 3KYNA 3ZE0E 3IN2A 2WXJA 4TM9A 2NMSA 2KLSA 4IHOB 1RSFA 3R0MA 1EH9A 1JF5A 4PV8A 1NMCC 2KDGA 2TRYA 1MJ7L 2JB6B 5I2IB 1R3LB 1EGJH 3LNDA 4MMZA 5KSBF 2AEPH 2YO3A 3FB5A 1TDQA 3D0VA 4LL1A 2WPGA 2IDCA 3DPBA 1YVLA 1OSPL 5C97A 3I50H 3M1BB 5BZWA 1ZV2A 2H7WA 4I18C 3DETD 4TL4A 5FYKL 2CIKA 5PCYA 4X4ME 2UZPA 1DVTA 1NCOA 2FYVA 1ACXA 3DHMA 2PP7A 2EDMA 4LKCB 2J1ZA 2WOBA 4K7FA 4PJEB 1DQLH 4N0UB 3VB9A 5TQ2L 2OK0H 3VQ2A 5IFJA 1JL5A 2F19L 2PYFA 4Z7VB 2NW2A 1UQSB 2MNUA 2LTQB 5ISZD 5BO1L 1DTUA 3IGLA 5DVMA 2ZNXA 2EDHA 2EIKB 3DHUA 3LMJH 3F7RA 4JY6B 1YEEL 3DVFA 1N8ZA 3QZWB 7PCYA 2P49B 4UU9B 5IQLA 2ZKHH 4F3FA 1T0NB 1FH2A 2VL5B 3R0NA 1JGDA 4CKQA 3SCMA 4UQEA 1E6OH 4HFWB 3T6QC 5I28A 3ECUA 2DWSA 4FNSA 4FKEA 3GSNB 2G2RA 2AXFB 4JG1H 4W6WB 5ESQB 4HKJA 1WBZB 4XE0A 3HB3B 2PTTA 2OMTA 5KN5A 2KZ1B 3FC8A 5DRWA 3PV7A 2FIKA 2A73B 4OB5H 2ICWI 3GKWH 3BZEA 2ZXDA 3WY3A 4AW7A 1KB9J 3F58H 3Q8AA 2BCKB 4DT2A 1FLRL 4MD5A 4XXDA 2NNAA 3H9SE 4JG0L 4B95C 3BKJH 3ILPB 4CSTA 2I5YH 3B8YA 4BK5A 1XGUA 2Y5TB 3SGJA 1ZOXA 4DGIL 5DK3A 2YEQA 3QUYD 2BVTA 4P4KC 1QSEE 3P69A 1A0QH 2HFGH 3CGTA 5EIIG 2X12A 2XDHA 3HFFA 2XPGB 4Z23A 4TTGA 1ANUA 2Y5EA 2P45B 1URLA 4YQXH 4GXVL 1G9NH 3N1FC 4JPQA 4IJTA 1LO3L 5KVDH 4XAWL 1I3RA 1Y07A 3DTUB 4XOAA 3UC0L 2E7CA 4PJ8A 5KS9F 4RQQA 1I4FB 1DBML 5AENA 1UACL 3LS5H 2F61A 2JELL 2DIAA 4G7RB 3ALWA 5KUMA 1M7DA 4X6BB 4ZMPA 4M43H 3V0JA 1UENA 4PUBH 1OM3L 1ZDQA 1CXKA 4GFXA 3ARDB 1BJMA 2ZUXA 3KXFA 4PB9H 4IBZA 1UWYA 3GSXB 4TMPA 5HDBB 2A0LC 4U0RC 5JIPA 1YDPB 5EU7C 4DZBB 1JHKL 2VXVH 7TAAA 1O5DT 3FJTA 4MGXA 3ZKSD 3GSRB 3GBEA 2C8NA 4HUNB 2RQ8A 1A6VH 3L4VA 3LPPA 1YNTA 3G5VB 3KCPB 4CC4A 3PJSA 1JZ4A 3BWUC 4X4XB 2K7PA 3T4AA 5D2LB 5JQ6H 2YPLD 3HZ3A 3MOBH 3UEQA 2QQLH 5IEHA 5GQRK 1OF2A 5IG7A 1MRCL 2VDRH 4NUPA 2QADD 1NFKA 1R3HA 2IWKA 1C5DB 4YFDB 4OLUL 1WAAA 3L95A 1D7DA 3A79B 3LDBB 3FNKA 2RTTA 1TTFA 1GXEA 3ELQA 3OLIA 5JHDB 1E6JL 2BVQB 3PWUB 4R97B 4QRAA 2EXTA 1NUNB 5I71B 5D1QB 2WM0A 5I1KL 4TVPH 1S7SB 1FRGL 3DV4A 4HH8A 5T5FH 5L88H 3RWCA 3SGEH 4RMQA 4Z7WB 4GMSH 4HJGA 2WZ5A 3WG7B 1N10A 1HNGA 2WCSA 4MZIA 5ENWA 2CKBB 2R9HD 2ZPKL 3CD4A 1Z9LA 4ZO8A 2O93L 2FT6A 3JWOL 4Y9FA 5DF0A 2EDTA 4JPKH 5FA4A 3TZVD 1U91A 4XBEL 3TO2B 3KPSA 4LLMB 1BQHB 2E9GA 4HHGA 1EJOL 2XC8A 4M6OL 1M71A 5T3ZL 5A7EA 1ECYA 2ZUUA 1IBYA 2ITDB 3SBWC 1WICA 1N0XH 1S9VA 2H8PB 5FF6A 4OR1A 3BZFB 5MEND 4FMKA 1WCBB 1M1XA 3O11B 4F7TA 4YHLL 4KJWC 4F7MA 2B8OT 3OGCA 1H0DB 3VFVB 4IBWA 1M0ZA 1DVFC 4PSPA 4Z94G 5CJOL 4DW2L 1S9WA 5GQBA 4U1SA 1P6AB 1KXQA 4GRMB 4NLAA 4DKEH 4JFTA 5LCVH 2WBKA 4KHXL 4YGAB 1ROCA 1J0YA 3ARWA 2Y7OA 4IRJD 4PJ9A 5CBEA 3VWJD 1QZ1A 4ELKA 4PLNC 1XGQB 4H8WH 3MJWA 4WFFE 1MVYA 3HOGA 3RIAF 1RULL 3WUWB 1X3DA 4IU3A 1UWGL 2DIEA 3HS0A 4KAQL 1BV8A 4GW1A 1IKNC 5KANI 1ZIWA 3O8XA 3V5DB 1K8IA 4ZS6C 1FGNH 2DQEH 2VLKE 1JGIA 3CQQA 2QSQA 4B50A 2FL5A 1NFIA 1AI1H 4HYTB 1K4CA 4GAYA 4CC1A 4GRWH 4P2AA 2E56A 4N0FB 4KPHL 5BUGA 3LEYL 3LB6C 4MMYB 1J9CT 1QBML 1KXHA 4LP8A 4P5TA 3L6FA 1G94A 1K4DA 3I3EA 4N0YH 1R17A 5CN2A 5ICYA 1P53A 4EIGB 3N04A 1I31A 3ZR5A 3CDYA 5ITFB 2R69A 4L9LB 1TENA 3C5XA 1L9NA 2DB8A 5FO7A 1KTLB 1BLNA 2CIIA 1S8DB 2FBOJ 3GMMB 1GS6X 4FI8A 3ORJA 5AL8A 1RZ7H 2V9QA 3CHXA 1YMHB 4PSRA 1TVBB 1U8OB 3LPWA 4HT1H 3U1QA 1AQDA 1U8JB 4RMBA 4JY5L 1RLWA 4PRAA 2EUXA 4M02A 1FGVH 1EIBA 4IRZH 4ZMTA 1YYLH 2LU3A 2HJKA 2Q0ZX 3GMPA 5D7JB 1OP5K 3AITA 1MNNA 5EN3A 1JZ7A 2BM3A 3VG9B 2EDWA 2KLRA 2PCXA 3AUWB 3CX2A 4W70A 4IMKA 2OLDA 4IBVA 5DJAB 1LL1A 4A2LA 1G7PB 4OGYH 2R7EB 1PZSA 4ZUSB 4L9DA 5E03A 4LXFA 3LZPA 3G5ZA 3MC0A 4M7LT 4AGQA 5E8PB 1YJDH 5E9DE 1FVEA 5E5RB 3TEZA 3U0WL 1I7TA 4Y5YC 3WFCL 3UL9A 4KKZA 1LWRA 2XVBA 3WSQH 4FA8A 5EOCJ 2AJYH 5DZAA 2J6EL 2A6IA 5J13B 3AY4A 4HQ1A 2A77H 2BERA 4HOZA 4LSXC 1REIA 3T0BA 1IBFA 2NY3B 1IFRA 2QR0B 4TNGA 1I9JL 1BGXH 1LMKA 1TOXA 3QJHB 6PCYA 2RALA 8PAZA 5KAQG 2GPZA 3ROLB 2GG1A 3CVCA 1WZKA 4AIXA 5KVGH 2F08A 1E9PB 1UEYA 4AZUA 4K73A 3S5LB 3BGFC 3HR6A 3K6SB 3T0XA 4MDIA 4QC0A 2MQGA 4LSRH 4NSKB 3VI4B 5JNYA 5IR1B 5LHDA 1N67A 2ZSWA 1BD2D 1F2XK 2EDQA 3OHMB 3MCKA 4XC3L 3GSNL 1N3NA 1CCZA 3QUXB 4NJ9L 2E27L 1KF9B 3GHEL 3L1FA 4RAVB 1T0MB 3PPEA 5T5NG 5A6IA 4WO4B 4QRPE 5CEZL 3SDCC 4Q2ZB 2YAFA 3HVNA 1KT2B 3UTQB 3NEEA 2FHFA 4O5LH 4R2GD 1YEFL 1R34A 5K1JA 2FO4B 3UCQA 4AI7A 3S8FB 3BO8B 4U3SA 4QUOA 4GAFB 1WYJA 1TLMA 5HJDA 1HQRA 3CFIC 3V52L 5L2KA 3NJVA 3KBEA 4LDLB 5CCKL 2ZWYA 3JT0A 3VE0B 5B8CA 4WHTB 4J23A 3F83A 4XNMA 2CJTA 4XPGH 5FGRA 4TUKL 3FTUA 2GABA 2UZIH 1DP0A 3G5YB 4LP5A 3GMNB 5FLVA 3U4KA 3PGDA 5DK2A 1H3XA 4EOWL 1WEJL 5I74B 4QRSA 3IJEB 4QIRA 5HD8C 1TTCA 3HUJE 3EO9H 3WY4A 1ONQB 4QLWA 5A43C 2D73A 4ZXBC 3MBXL 5D1ZB 1TZIA 4CN4A 3VXQA 3CXDH 4K9EC 3AWEA 4WHCA 4M4PA 5DSCA 1RZ8B 3HAEB 5DJYA 1ND0B 4HEME 2EDEA 4M61B 2FO8A 4PVLA 2B1AH 4FQ1H 2EACA 2YQ2A 4I9WD 4G82A 4NO3A 2FIRT 3QXUA 2CDGB 3MBEC 3RVWD 4D0BB 4FMZA 2I60L 2CJUH 4HJJH 4ZFOA 1NIBA 2EYRB 4P2CG 3KWVA 3BE1H 1KENL 2B2XL 2Z7XB 5I1DA 4YEFA 5DWUH 2H6PA 5DFTA 3E6FB 4HS3A 1K5NA 4KKBC 5GRJH 1P5UA 4MA1B 2ASSB 3JTBA 2AS5M 5I8EB 1YECL 3K4ZA 4FL4B 1LWJA 3H85A 4KZEH 1J0IA 1RK0B 5IESL 1INDL 2JKXA 2I9LB 4GI8A 2APXA 3MV7A 2EQDA 3DNKA 1FV1B 1AIFA 5H2BA 2CBOA 3VMOA 2VJXA 1AGDB 4OW6A 1M6OB 3E6JA 1AG0A 2BS9A 1CG9B 2K4WA 3BQUA 2IBBA 3D2TA 1XBDA 4FFYH 3V6OE 3PYCA 5LGYA 3VQMA 4JFFE 2NNFA 4ZPVB 2I32A 3GJFK 3MRBA 4EF3A 3UBHA 3KPPA 1GYVA 2HB0A 3QORC 2UWEB 4JY4A 1SJEB 2CKBL 2B9BA 2YXMA 4UT9A 5EBWA 4MA8L 3QQNA 5E4OA 4CVWA 3RFJA 2B4CC 2Z65A 4POUB 3SJVB 4OAWA 4F58L 3BFQG 5HHVL 4WEMB 1GZQB 4HUCA 3U0TB 4HQQL 1J8SA 1H8OA 3KGUA 3QJRB 2NXYB 5IW6A 1H3PL 3MRNA 3FUFA 4HKXB 3UL4A 3ZXAC 2WIIA 2L04A 2F7QA 4LPTA 4OY9A 1JZ2A 4HA1A 4JFQA 5F7LB 1OGAB 4JNXA 5MI0C 1J0KA 1ZSHA 4LCUB 1HHJB 1G9HA 1MY5A 1F02I 2GT9A 2VM9A 1RZFH 3L1OH 4N24A 2D3VA 4Y9EA 1R3KB 1FI8C 3CZFB 5LBSA 2Z4QB 1F6AA 4W93A 4IEFA 4J6RL 5HHNB 4NZ8A 3OKDB 2NYYC 2AV7A 1OCRB 3UBXG 1AZUA 3E2HB 3K74B 5I75C 5JOPD 2V9TB 3L1GA 1UB5A 5T3XD 4I4WB 2VDLL 4I89A 4AT6A 4OZFA 2GIXA 3KDPB 3BUPA 1JV5A 2YK1H 2LAGB 1RJZA 4Z77A 4LSVL 2IDUA 4YSEA 3FUMA 3U1SL 3IMBA 1S4IA 3A67H 3CVHB 3TYGL 1NGPL 5DI8B 1BJ1H 4M3JA 3AUVA 4J7RA 3CFJA 5DJXB 2FR4B 2Z4TA 4UM9D 1KDJA 3KNBB 3OXRA 4HJ1A 4JLRB 1MRDH 5KG9B 4YDZA 4KVCL 4WSJA 1ZMYA 1G7QA 1J7VR 4LLWB 2FUQA 4PJEF 5GRYA 1KYAA 5B4MD 3CFMA 3G6DL 3STZA 1ZJAA 1FFOB 1WK0A 1B4LA 2R1XA 2W0LA 4LL9A 4IKLA 4FRWA 2GK0A 3RJQB 5DS8A 4KH9A 3NSYA 4FEMA 1IIIA 2AQTA 3FTGB 2WBJC 2OYMA 1C8PA 5F88B 3SDXA 3VXMB 1FYTE 4C59B 3QYNA 5H35A 1J1OL 1VHPA 2MEJB 2CO2A 3UO1H 2BHZA 3NK4A 2N3JA 4XPBH 4X9BA 4K7PL 1TVDA 3GJFA 5D6CA 1I1AB 2Z92A 5F9JB 4E36A 1HQ4B 1QWUA 2N1TE 5ILTH 3NZ8A 4R6JA 4OCMC 2ICEB 5AB9A 2BW5A 1MI5E 5D5ME 1KGXA 1KCBA 1GWBA 3AXHA 5E23A 4PJ8D 1M1SA 2BO0A 4N8CH 4U3XA 4XZUA 1GRWA 3R7RA 3P9MB 3GS7A 4OJYA 4WVRA 1EZUA 1WS8A 2QLYA 3FQYA 3DIDA 2QQNH 3UJTH 1X44A 1LVEA 4RGOL 4BRJA 4X6DF 1CDCA 3PWLA 2WXLA 2NDGA 3WNNA 4BSVB 4QHLB 4HBCL 5DD5L 5L8KB 2QT6A 1IT9H 4NRXA 1JF1A 1U30A 3HPLA 1JK8B 1MVUB 1TJHL 1OTUD 3K4AA 3QDGA 5DD6A 5IOPA 3S8WA 5IHUL 2MMXA 1L6ZA 3QIUB 4G7YL 4H88H 1DBAL 3K1DA 3QJSB 4P3CH 2NY4D 5IBTL 2P46B 3N5AA 3CFDB 3JTTA 1GJWA 3FS9A 4M1GL 4TSBL 4LOUC 4K8RC 4D9QD 3ZRFC 1X7QB 4BIKA 3CXHK 3HE7C 1PZAA 4KNTA 1T1WB 3PWNB 4X4YA 5F7HA 1F42A 1HJCA 2WB7A 2CCLA 4NQCE 3I74A 2Y7SA 4HETA 1ORQA 2ITEA 5F3HB 4O02A 3X1GA 3WKML 2W65B 3HBPA 1SM3L 3MRDA 3OJAB 5ICXB 2Z35B 3DRTA 4WFED 4YEEA 4ZW6A 3BDXA 1IGIH 1WISA 3O2DL 2NY0B 2OQJA 3CC1A 3QO0B 3R4RA 4JDTH 5T1KB 1MIEH 1W72H 3NA9L 5ERWB 1VFAB 2D3LA 3SE6A 3ZGHA 4UNVA 2V2XB 3UERA 5D2LF 4G2AA 3CFEB 3QEQD 5B4PA 3ROOB 4JRYD 3LKQB 4ZAKB 4WSKA 3LQAH 2C3WA 3MA7B 1M3JA 1F3JB 2EVIA 2AJXL 3TBVA 1JP5A 1NFAA 4O2EA 2C1PB 1G5GA 2PO6B 2VDRB 3O9WB 2BNQE 5AALA 5MHSD 3LHPH 3Q1EA 3TH3T 1MNUH 4HLZG 2EC9U 2G3ZA 2HP4A 4KXAA 5EO1B 3QO1B 5C0BE 3SKUD 2OS7A 2JIXA 3RG1C 1NPJA 3FUKA 1CFQA 4HAKA 5EZOH 4Z7WF 4WEEA 4PJ9D 2HRPL 2P7TB 4PD4K 3L3KA 2I69A 3ILQD 4PGEB 3F84A 2OXGB 4KTGA 3G6AA 4X5RA 3WO3B 1KN2L 5C2BL 1GOGA 1RIUL 2DQTH 4AIZB 4JO4L 3RZWA 5I26A 4JO2H 1FIGH 4KI5F 2WVVB 4FG0A 1G9ML 1YC8A 5KTEL 1UC6A 4K17A 4UIMB 4Z7NE 2HN7A 5BMFH 2O5XH 2APWA 3GLAA 4LU5L 3CSYB 4XBMA 1NLDL 3GXDA 1CDJA 3IDXL 3IU3B 3K6OA 2JF1A 1TTBA 1UXSA 1MHCA 3RX5A 4U6VL 2IFFL 3QH3B 1JRHI 4XNYH 2VW7A 4N90D 3WN5B 3P9WB 5CHNB 3LN4A 3D9AL 1J0ZA 2WXIA 3DX9B 1C1EL 1NCHA 4UOW1 4P5TD 1FZMA 3SBWA 3SGDH 5CILL 2YLHA 5BV7H 4NB7A 4HV8B 3WBDA 4MASA 1OANA 1EZVX 4ZPTA 3B2XA 3PS6A 4XB7A 1DVFA 1BQLL 3U4EA 2KS0A 3DSNB 3G9VA 4XNUH 2HX7A 2ADIA 1T7XA 1KCUL 4A38A 4C83B 4YH6A 3CFBB 3UL8A 5DRXB 3ETSA 3X2QB 3RGVB 4CW1B 2VYRE 1BM7A 2XG5A 4MJIB 1E2ZA 4Y4FC 2WNGA 3GLDA 5AW7B 2G0LA 3H9HB 4P23C 4ZK8A 5E4AA 2HMID 3Q44A 3BIKB 1HH9B 1MLCA 4P5SA 5CP3A 2GSMB 3ZYZA 3QUZD 3WCYA 1RK1A 4XRCB 5ALBH 5E2UL 5ID1B 3MNVB 2EKSA 4K15A 1QFWL 1ZE3C 3L4TA 4K3GA 3SY0B 1X5KA 4KZDL 5KSBE 2YRZA 1EK3A 4I6JB 1IKNA 2Y3NA 3EHBD 1U8QB 4NQUA 2AC0A 4WEBH 4GG8A 3RGHA 4BE5A 4Y1AB 4ONGH 1JDAA 3HNVL 1DUZA 3KGRA 1LO5A 4X0KB 3B5GA 2F9BT 4FF9A 3W9EA 4FZEL 2VR8A 3HG2A 3VXRD 2CNYA 3B1TA 3TPKA 4NFBA 3V0GA 2UX6A 5DQDL 3H2QA 1GKEA 4M62H 1I8MA 5C3LD 1K8DB 3RVTD 1I8KA 5FYJD 1XCDA 1Q9WB 1D6VL 1MWAH 1SQ2N 1UT9A 2OW7A 1RUAH 2SEBB 3OR6B 3Q5TA 3QEGL 4ODBD 4PP1D 4BFEA 1U8IB 4TQPA 3H1ZA 3MFFB 4MD4B 4R8WL 5EIIA 5JQHC 5HY9B 4NO0B 3QIBD 5AVTB 3RIAK 1PG7L 3Q8CA 2DWDA 5LXGH 1IAIH 1SJHA 3MNWB 5B0NA 2G60H 4HWZA 4X80H 1ZD6A 4EUPH 3TC9A 1XD0A 1QBBA 1PMYA 2DV6A 4JVWA 2KH2B 4ZUWA 3PDOB 1ZGLP 1Q94B 1LD9B 4L4TE 2HFFA 2JI1A 1ZY9A 1EGJL 2WQAA 3KWUA 4BKLA 1FP5A 3DURB 2OAAA 4XMKH 2AEPL 2HAZA 1M2OA 2BOLA 5DFVC 3K8MA 4ELME 1D5ZA 3N9GH 3I50L 3MXWH 4R4NC 2AJZA 5AKTA 3TXAA 4GP5B 3IRPX 5F7WC 3TTYA 3EUDA 1J8HE 1P4UA 3LSOB 4Y5YA 4CNMA 3UDWC 4LLYB 2M1KA 3RX8A 3PWPD 3X1EA 3DSFH 1DQLL 4B9KC 2E86A 2OK0L 3BT0A 3B43A 5C0GB 2GJ6E 4U6YA 1HHKA 1NDMA 2WZ6A 2OTWA 2JI2A 1PSKH 5DZPA 1PKQB 1MCRA 2X1OA 5L2KD 1AGCB 3FHAA 1CGYA 2ZUYA 3LMJL 5AVYB 12E8H 2QVKA 4MDJB 4LSXA 3VI4F 1EAJA 4A7VA 1XWDC 2CA3A 4C57C 4GB9A 4TQEH 3UAFA 2ESVA 1JWMA 2CDEB 4NZFA 4S1RH 4B9JA 2GUOA 1Z0MA 2ZKHL 1HIML 1F4XH 2BVUA 5KZCD 2GK2A 4KMTH 4Y7OC 1E42A 1E6OL 2Z91A 3N44B 2AQQA 4JG1L 5K9JH 5BS0D 3W3GA 1IM3A 3B3IA 4MA3B 1KB5A 1NBYA 2LHAA 4OB5L 3GKWL 2DWXA 3C6SB 4YUEH 2OMWA 4GI9A 4ARRA 1ZK9A 4NKMB 3F64A 3F58L 4UT6H 4PRDA 1T2JA 1T5KA 4OD2B 4JEGB 5FXCH 1KTRL 3BKJL 1PYWA 1THAA 2F5BH 2I5YL 4KTYA 5FUZH 3Q6GL 4R5CA 1PX8A 2A6DB 3GKZA 5IY5B 4L18A 2GHZA 3H9YA 3OBAA 2X6VA 1EXHA 1ZPUA 3HRZC 3B2DC 5KSAD 3QPXH 2X5PA 1WLHA 4W1TA 4P2QB 2NRDA 4Y19A 1PNCA 3MOAH 2PWFA 4TYUA 1Z66A 2R2CA 4E41E 1ZRUA 3HTLX 4LCWE 1A6AA 4YR6B 1DN0A 4YQXL 1G9NL 5TD4A 5DVLA 2FGZA 2IMMA 3NT0A 1MOEA 4MCZB 3MV7D 3VXPA 2TSBA 4G6FB 4H8QA 4POZC 5T33H 4JQIA 5KVDL 4HWBH 4P9HH 5EWIH 2DOCA 4OGAD 5IYXC 5IQNA 5JO5A 3JYCA 3SPIA 1O6SB 2PP9A 3CMOH 3LS5L 4WKXA 3K72A 3QNZA 3HG5A 4M43L 4FKKA 4Z7QB 4PUBL 4XGZA 3VJ6A 2GUYA 3WKNA 3CVDA 4ZXBA 2E9WA 2ZXQA 2X87A 1IFGA 1LEGA 2R0KH 3A4FA 4PB9L 3PIQB 1BVLA 3BGMB 5J11C 2VSCA 2VXVL 1NUDA 3MBEA 1S7VB 3KW7A 1A6VL 1S7XB 3L4CA 1Z3GH 2I25N 2OMXA 4FFVD 4NQEA 4DK3A 4Q97A 1I3VA 1VDGA 3QRLA 1JXFA 5IVXE 3ZO9A 3RVVC 4AL8C 2K6WA 4ZUTB 4OGZA 4L1BA 5JQ6L 3MOBL 4FCAA 3CFCH 4LCYB 4XXWC 5I76B 2VDRL 4G42B 3NCMA 4U09A 4HAGA 3UTSA 2M83A 4PM1A 4PJFA 1Y0LB 3IDGB 4ODHH 5F2FA 1U8HB 3ZL1A 1NAKH 1TZAA 5MEPA 2J3SA 5A7BA 3VI3B 1MG2C 1UUSA 1F4WH 2XV3A 3EKCA 4NNYA 3CBKB 3D06A 4TVPL 4Y5XB 1NEUA 1RZPA 2CXKA 2UWEF 4YZFE 1EXGA 5T5FL 5L88L 3DROB 4X99B 3STLA 4JDEA 4GMSL 3AU1B 3FAXA 1CFSA 4OCRH 4X7TB 3Q2VA 2AZUA 4H8VA 3BAIA 1YEGH 4UTBH 2OL3A 1ZKAA 4LOVA 4JPKL 2DL2A 3UTTB 4MYWB 4MJ2A 4PLKC 3QORA 2FDBP 3MO1B 3FN3A 5DEGA 4HX1A 4TVSa 4U1NB 5EPMA 5KSUB 1N0XL 1A4JA 1F4YH 3D12B 2WXPA 3SBPA 3V6BR 4HCRH 4Z3FA 5IBUG 2ZWNA 1GGCH 5HHMB 1EEQA 1G6RA 4MXVE 2B5IC 1DANU 4DTGH 3T77B 1ZT7B 4DKEL 1XCWA 2V2TB 4P46D 5LCVL 3DUUB 1OSZB 2WJ7A 3FUIA 4HIXH 3L3DA 5IMLB 3SDDC 5EG6C 4DKFH 2L8AA 3KPRE 3G6JF 1VSCA 3QDMB 4LFHD 4BYHA 3C87A 4H8WL 2YC1A 4MQXC 5C0AE 1QLRA 2JKRM 2I27N 5ELIA 4M00A 3CSBA 3AG1B 3IB4A 4LF3A 3ZZQA 1FO1A 4Z61C 1HOCB 4TF4A 3BWAA 3EGDA 1MF2H 1LMIA 3L13A 2MTPA 2BNRB 2VLJE 2WHVA 1FGNL 2DQEL 3C9NB 4P59H 5FV1L 3ECVA 2UY7B 4GKNB 5IMKA 4G80A 2AK4D 4L48A 1NGXA 3ULUE 1AI1L 1BMGA 1TZOA 1RFDH 2FB4H 3H55A 3ZZLA 2ENSA 1DLHA 2H9GA 3WGUB 3GQFA 1A9EB 3PWVB 1SQ0B 3GDBA 5C0FA 3DX8A 4DP6X 4N0YL 1W8OA 2PXYC 4GG6B 2R2EB 3IU4H 1CE6A 1FZKB 4DVBA 4G6KH 2KPWA 1KJMA 2Z31C 3MV8D 2DBJA 4RIRA 3SB3A 3BKMH 4E2OA 3M19A 3MROA 3FUEA 1HK6A 2XQBH 1HL8A 4HT1L 4ZG1A 2A83A 1NBZA 3C6PB 2J1WA 3TASA 5KYUB 2ERJB 3H7BB 2XG4A 2QGBA 4QXEA 1FGVL 1KV3A 2LVEA 5E0FA 3KPTA 4IRZL 1YYLL 4N1HB 3VWKC 4D9LH 3HNTH 2O6PA 1GMEA 3W9DA 1FHGA 1MZYA 4B9CA 3FO1A 2WGXA 3CZKA 4G9DA 4PN6A 4POYA 4RCAA 4XP1H 1YEHH 4CA4A 3KZ8A 4QBZA 2E8ZA 2EXYC 2ICWJ 3QYMA 2HG5B 4OGYL 4H40A 4LLVA 4PW4A 1TZGH 1CFNB 5GRZA 3WO4C 3FQRA 1RUPH 4X6EA 4ACTA 1AP2B 1YJDL 4S2SA 4YVNA 2B59B 1ETZB 1F11A 4PHXA 1VACB 3QG7H 5D4HA 1OGSA 2A9DA 3O6LL 1BM3H 4JVUA 2X0WA 3RY5A 5D6DC 2CUIA 1F3DJ 1WZLA 2XZCH 3HC4H 2DMBA 2OMUA 3VXSD 3WSQL 2JJSC 2AJYL 3C5SB 2XU9A 4IIZA 2VDOB 1XF2A 1IGTB 2OCJA 4MAUH 1Q0YH 3O45A 5J1AB 2A77L 4OVUA 3C8KB 1OTTD 3CFKA 3W0WA 2ZYRA 4X6FA 5K93A 3QP3A 4YLCA 1TG8A 3O6FC 5IWLC 2UZYA 1BGXL 5D1XB 4ZFGH 2QMJA 3KWXA 1W6LA 2H5UA 3OG6B 2QPDB 2WWOA 3D5OF 5KVGL 1K5WA 3CX5J 3H4HA 2BINA 4M93B 2VJ8A 2FBJH 5FO8A 4PJCA 2H26B 3EF4A 3RYMA 3WEXB 2H47C 4LSRL 2FLMA 1C16A 3INOA 1KYDA 3LRSB 1NEZB 2BOCA 3TPUB 1CT8A 2DLTA 3HN5A 4R4FH 3FCBA 5CD5C 1P9AG 4JM2D 3V6OC 3WU1A 1A21A 2YAQA 2IWFA 1UOVA 4K55A 1D0BA 4BJLA 2QHRH 5C07A 3VA2C 3ENEA 4YXLH 1UKTA 4HUKB 4BE6A 3QQ9C 3HE7A 4O5LL 5SWSE 2E7HA 3B8SA 3DRQB 3EYFB 2VRQA 3KPMB 2NUPB 1A3LH 1BVZA 2AJUH 3T3PB 1LE9A 5HHOE 4KC3B 5AB1A 3MYJB 3MRRB 1HKLH 2FWLB 1QSFA 3NCBB 4XPGL 4Z7IA 3ALXA 2VABA 4TUOB 2WBWB 3ULVE 4A04A 1DANT 2WSPA 3CV5A 3PQYB 3BP7B 4M8RA 1A6PA 3CLEH 2XOTA 3EO9L 2L0DA 1MHHA 2X09A 3HG3A 4DK5A 3D69B 2P5WE 1ADQA 5HHQB 3CXDL 1WZ1H 2VR6A 4I0PC 3CN2A 3UP6A 3FOLA 3X1FA 3UBXA 2B1AL 2FEEI 4FQ1L 3HI5H 4OZ4B 1DUYA 2NW3B 2CJUL 4HJJL 4Z64C 4R3SB 2JKWA 1RAMA 4OFQA 3ISYA 5KBLA 3BE1L 4I13B 2ZCHH 3N1GC 1L0XA 1F41A 4JRLA 4PRID 2Q86B 4IBTA 5DWUL 1G7IB 2NY6D 5D2NE 4K4KA 3O81A 4WY7H 4U6TA 5GRJL 4ODWB 1QNZH 5EOTB 3L3JA 1OTSD 4I1NB 2WV3A 4CMMA 1KEMH 4J39A 4HW6A 4KZEL 2R1WB 3TIEA 2OV0A 4KK9D 5TDOB 1RXLA 3S9DB 2QTVA 5FK9A 1UJ3B 1AOZA 3WN6A 1X9LA 5E5UB 3OSVA 4KO9A 1Q4NX 1GZPB 2E0PA 2N4IA 3VRIA 3L2LA 3VD2A 1AHWA 4IGBD 3O4LB 3P54A 3NIGB 5BRZB 4FFYL 5G4NA 2H1LM 1N19A 4FN0A 2E76C 3M86A 3BVWA 2IBZY 2ZQKA 2FO1A 4G1EA 4O9HH 1MFVA 1OOWA 3NP3A 3EBHA 3D0LA 4QRQA 3ESVF 1EHXA 3QNYB 1MDAA 3T0EB 2NY2B 3P77A 4WWKB 1XXDC 4Y4HD 4AM0Q 1G87A 1TQWA 3SD5A 1TQBC 5LUMA 4D3CH 5HYJE 1YY8A 3MRGA 2NR6A 4RAUA 2QFPA 4Y4FA 2EICA 4P23A 3THMH 3W5NA 4P5MB 4JFHE 2AV1B 4KO5A 5BZZA 4J4PC 4HUVA 4ZTOH 3QI9C 5B3NA 2IFGA 2X2JA 3LV3B 2XTJC 2ZWSA 3UZQA 4AUYA 4DPBX 1T04A 4JBSA 4U1HA 4N0CD 4YHMH 3DGGB 1PKOA 3HZMB 5H37H 5HDHA 4E0RB 2FGWH 2MRYA 1BYOA 2EUVA 2HJLB 2N7AA 4Z7VE 2WXMA 1HSBA 1IAMA 3L1OL 1RZFL 5TH2B 2D31B 3FFOA 3R06B 2N0KA 3IMRA 2P1PB 2FH6A 2XWXA 4YHZH 4KHTH 2MCPH 3ETBF 1PZ5A 3H9SA 2EEXA 2JTDA 2PUQT 4K7PY 4BQ9A 5LVEA 3C6LD 3WFZA 1SDAB 1KGJA 4UQ2A 3GM0A 3WXVH 1MCJA 1S7WB 2X10A 4LB8A 1ZIBA 2YK1L 4HGWB 5F1SA 3EO0B 1QSEA 4FTVD 1CD1B 1QVOB 3KLAA 1L5GA 4QRTA 1INQA 2VZUA 5D7KD 5JW5B 3TBCA 3A67L 4YHOH 3D4CA 3WKQA 1OD7A 1KMGA 4R5DA 3FO2A 3TT1H 2GJRA 4PJ7E 4UQDA 1L0PA 1BZ9B 3OHXC 4FNPA 4JDVB 4N5ED 3VFMA 6CGTA 4FLQA 3D3VB 1MRDL 5INDB 5C08E 1BJ8A 3CFTA 2X3AA 4GQQA 4F1ZA 3UOAB 3MRHB 4NN7B 3ZT7A 3W11C 5IGXH 4AQAB 1J5CA 3V8OA 1HL9A 3OJDB 4HIHB 3CDGB 5CUSH 3QUKA 1KIRB 2BW4A 3EJZC 4NQVA 4HK3J 2G9HA 4UOZA 1KJVB 3JV0A 3S3CB 2VM4A 3UDWA 3CN4A 5KJ4A 5ITBL 3P4MA 3GUFA 1WWAX 5EFIB 4AZ8A 1RV6X 5EIVA 4IJ3C 1D7FA 5CMAB 5T1LB 3UO1L 3TF7C 1XSKA 4XPBL 3N44F 3BP5B 4AKOA 1MWOA 2OCFD 5ILTL 5I19H 4WDIA 3FDWA 2BFGA 3QVAA 2E6PA 5HDBE 2A5UA 2FECL 1KJ2H 1Y1DA 3HI6H 4N8CL 3PGCB 5TDPA 4UQBA 2IAMC 6TAAA 2BSBA 5J5EA 1RZKH 3WIHA 2QQNL 3UJTL 2EE3A 4N2FA 2WYHA 1OP3K 5JPMC 3D6GA 4K9JA 2QV2A 4WV1B 3EADA 3PWJB 1BFSA 4NT6A 4N85A 5AVWB 2VR9A 4GIAA 2OMVA 5D2LE 3OR7A 4A7TA 2P24B 5H94B 1MCFA 3FFDB 3BRDA 1IT9L 5DK0A 1KNOA 4KOCA 3FFCB 4LOFA 3VGHA 1ESOA 4AQEB 1HVXA 1A8ZA 1NICA 4UQAA 3OG4B 5BVPH 4H88L 2XWTC 4UB0H 5DMJB 1QP1A 1UATA 2DQHH 3HRZA 2IDFA 3E4GA 3V6FB 2J44A 4EBQH 2HT2C 1B0RB 2XY1A 3RNQB 3NIFE 4Z7WE 4X4KA 1PY9A 4XCEB 4TLUA 2VZ1A 4ZX3A 4Z7QF 5HDLA 1QWNA 1JPTL 3K46A 5KSVA 3TA3B 3U25A 4PG9B 1OARH 2X9YA 2Q7NA 3H56A 2CJ3A 1M05A 4XVJH 2HTKC 2W94A 5E8EB 3NSDA 5AW1B 1YUHB 5JIKA 4AGMA 4BZ2A 3DX7B 4WFGE 1OY3B 2WWNA 4I87A 4UUJB 5IBLC 4JCMA 4JRXE 1IGIL 3FU5A 4J28A 4BWUA 4R6AA 1FO0A 3QUMA 3LQZB 2M2DA 3HPJA 3B34A 1MIEL 1W72L 2DJMA 2JB5H 4IRSD 3QXWA 2LE9A 3HLAA 1F18A 4HJ0C 5E00A 4IBYA 2N01B 1IC7H 4AYFB 3OKNA 1VGKB 3QORD 1AZCA 2VLKA 3LQAL 4M6AA 1JGEA 3SHSA 3UAAA 1VKXB 4AGLA 2HZHA 3ZMNA 1EZSA 1KOAA 1NOFA 4JGUA 1JZHA 2FYYB 5EC2A 3LHPL 4R09A 1MNUL 5IT2H 2NTFA 3GPSA 5J3HD 5EZOL 3KBPA 4LHUG 2VZSA 1AGEA 2C1OB 2BVEA 4GKOA 3EH4B 3FYIB 3NCCB 3OXSA 1F4AA 5FWQA 4KVNH 1JHTB 2PW1A 4FYSA 1T1XB 3P73A 4YMPA 4G1MB 5I1GH 3A24A 2DQTL 3EJYD 1KEGL 1IKFH 2YUZA 1R5VB 4JO2L 4QTHA 5J1SC 1DDHA 1FIGL 4NRYB 4Z0BH 5AG9A 4L8SC 3VSUA 4WHDA 2D03H 2F54E 4NO2B 4JFVA 5LN4A 4JDZB 5BMFL 4W9IC 5FKAA 3MRFA 2O5XL 2GJZB 3L5WB 2IANE 3TVMA 1ZHKB 3ARGB 2LU7A 4FLRA 1XH0A 2EE2A 4WNJA 2WYTA 4CVZA 5AL0A 1T7WA 4XNYL 1E50A 2GSGA 3FTYA 3UZVB 5FDWA 1S9KC 5E9DA 4LKXA 2C7UA 3ZKNC 3WGVB 2RA8A 1HHIB 4GLRI 4FQHA 1QHOA 5BV7L 5I1LB 1R46A 4ZBJA 1T7VA 3RI5F 1J5OH 4NPJA 4Y4KC 5CIPA 3AU0A 4XNUL 2DTSA 2EYSB 4G8FB 5GGTA 4ACPA 3GSWB 43CAB 2B1OA 4GKZA 4QHNB 1HH6B 4JFEB 1BZ7A 3D39D 4KJQC 3U2IA 1T6VN 3SDDA 2W9LA 4IU2B 1XGRB 1NCBH 3REVB 5AKSA 3ES6A 4KMQA 3VFGH 3W3LA 5ALBL 1SYVB 3LNIA 1CL7H 2HJFB 3BN9D 4G8EB 4GXUM 5CSZB 4OUUA 4PJ5B 5HI5D 1ID5I 3MGAA 5F89B 4OGQC 4WEBL 2PCPB 4UBDD 5D93C 1WHOA 1DEEA 1LDPH 3ARBB 1RJCA 4K2UH 4ONGL 4OLWH 3MODH 3D18B 4EZKA 1C8QA 4GG6F 2EILB 4DP9X 4HOXA 4MAZA 4XH2B 8FABB 5KBDA 1YEIH 1CGSH 2W0FB 3D4GA 4KRPD 4RVBA 1XGPA 4HKZA 4M62L 4BZYA 5T3ZD 2KLTA 2XWRA 3RRQA 2VLRD 4QRPA 2V8LA 3LKPB 2YXVA 3QEUB 1MWAL 4OJCA 1RUAL 3BI9X 2YN3A 1UKSA 4JKMA 2KL6A 3DO7B 1EV2E 5GRUH 1FCGA 3L3IB 2BK8A 2JKTM 4XVSH 2DYPB 2Z31A 2C3VA 4ZUUB 3LXBA 4ZMZA 3WTSA 4HIEB 1IAIL 5LXGL 4ZJ9A 4V2DA 2G60L 4X80L 4UV4H 5CBAB 2WTRA 1A4KB 1YNKH 1CICD 4P8SA 4YDJB 3VFSB 4J2QA 1RZJC 2I9TA 1AIZA 4XNBA 3VXOB 1DFJI 5C0DB 5LNGA 3VWKA 2E9IA 2OMYB 5J7CC 1SNRA 4URTB 5AVVB 3OPZH 3B6SA 4KWUA 1C7TA 3ZBMA 3HZKA 5ADOH 1TIUA 3QULA 2VR3A 4XMKL 1Q9KA 3IAPA 2QKIB 4G70B 5DD1H 3HUJA 5I73B 2XWCA 3VVVA 4LQFL 5GGRA 1P7QD 1G7JA 3N9GL 4IKIA 3MXWL 4PJGB 1AO7D 3QR2A 4YBLB 4YNYA 3FMGH 2FUTA 2ZJSL 4O2CB 5DVPA 4F33A 5EUKB 3JV4B 4HEMA 5GS1C 5C07D 2CKNA 3ARFD 3RILA 4JM4H 3QDJE 2NXZC 4PAZA 5FYJU 5A2IH 2LVCA 3DSFL 3E6HB 3CQPA 3LKRA 3BD5A 4KROC 2EIZB 4Z5RA 1SFDA 4GW5B 5ISZB 1PSKL 1A7NH 3OC8A 4KK5C 5IHZB 3ARTA 4ZO9A 12E8L 4PCTA 5DC4B 2OW6A 2X7LB 1E27A 5FHBH 1KG0B 4TQEL 3O6FA 2PW2A 5L0QB 4JREB 5IWLA 4S1RL 1QSFD 3H3BC 2YKLH 1F4XL 4HISA 4KMTL 1IGYB 3AM8C 1QR4A 1EHNA 1WFTA 2IADB 4G3YH 3JV5A 4PERA 5K9JL 2WZPD 3EFFA 1LK2A 1I1RA 1U8MA 1V3MA 2Y7QB 3QWQB 1XF3A 5EBMA 1FG2B 5INCA 3T6XA 4F7PA 1F1DA 3BMWA 3DC0A 1T80A 4YUEL 2RD0A 1P6WA 2RCSH 3DOSB 2ZOLB 4G59C 1WBYA 4UT6L 1MCEA 1QWHA 3V6OA 1SN2A 4YJZL 1CU4H 1PFCA 2W1NA 2H32B 4N2IA 5SWZD 4AYDC 2CR3A 4JFFA 2WLYA 2GAZB 4YSAA 2C9XA 2F5BL 5FUZL 4NQDD 5F0PB 3T3PF 3ZDXF 4CDHA 4GINA 5TGBA 3TO4C 1QPXA 4JG5A 5AOIA 5F0LB 2AW2A 3WE6B 4C4BA 3QUYB 3QPXL 4O2FB 3MOAL 1JERA 4MKMA 1JZ5A 2RQEA 2YEZA 3HG4A 5F0MB 3U9WA 2P1NB 3MNDA 1EEZB 3LZQA 3BP6A 3B3BA 5JIQA 1KLGB 1M9WA 4WUUE 3HZVB 4UAHA 3V5HA 1ULVA 3P2TA 1AG6A 5TTRA 4RNRB 1MFDH 2HYMA 2YXFA 5T33L 2CM5A 5HBBA 2XV0A 4HWBL 4P9HL 5EWIL 5A6MA 4HKBB 3CDZA 3V4UH 4M7ZC 4GNKB 2AAAA 2UWEE 4LXSA 3CMOL 2O4EA 2FWUA 3L9YA 3WL9B 1FFQA 3II3A 3ZZ1A 3GUTA 3WHXA 3SJVE 3RTQC 1S9XB 4MNHB 3OKEB 1AGBA 1I82A 2R0KL 5C7XH 5GS0C 5LNEA 1BBJA 1CGTA 1G7MB 5IEKA 1T20B 4I0PA 4MMXB 4RWHA 3SGDI 3VFUB 4PWIA 4GUOA 1MFAH 3P40A 1T22A 2DLFH 2AJVH 1JPGB 3CIQA 5HYSG 1QEWA 1RY7B 1Z3GL 4PIRF 2K4AA 3GD1C 4PTUA 2JVUA 4QHMB 5CEZD 3BZ4B 3ZSSA 4JFOB 3K71B 2NR6D 1LM8V 1GR7A 1WRFA 5FA3A 4N2CA 2YPLB 4YE4H 2CBPA 1H19A 3FN9A 5I1JH 1ASPA 4W81A 3FQTB 3WTUA 3CFCL 4ZO6A 1LE5A 1X5IA 4ENEC 1PZ3A 2DH2A 4WNQB 1CC3A 1Z9PA 3NIGF 2QBWA 4N9GA 3BPCB 4ODHL 5T8IA 1NAKL 3PFUA 3IDYB 1G9UA 1NTDA 5G55A 3SB4A 2XUWA 1I75A 1HWWA 1R5WB 1SXZA 2XFXB 3MREB 4WGWB 1F4WL 2E7BA 4H0LC 4Y16C 4NDMB 4BA8A 2ZIDA 5AW2B 2V5RA 4P3DA 4PGDA 1BYPA 5AVQB 4OCRL 5DU7A 1I3UA 1NCIA 1X5YA 3H9SD 4GT7A 3RKDC 5KYYA 3FB7A 1YEGL 4GRLB 4UTBL 3PL6A 3TZVB 2GTWA 1PEWA 5AD0A 4HVBA 1SFHA 1ZV9A 1PW3A 3MACH 3T0VA 4KQ0A 4HPYH 2YN5A 4XHJD 4Q6IB 1FYTA 5DCCA 5MENB 4OU3A 1F4YL 2LQRA 1GY1A 2Z93B 3OWRA 1A1MA 4MCYB 3GMRB 3ESNA 5C1MB 3MR9A 4AKQA 1JZDC 3OV6A 1GGCL 3LEXB 2JI3A 1F90H 2JJUA 2XN9E 2NNXA 4DTGL 1DVQA 4PJBB 1MI5A 5D5MA 4AEIH 4J4PA