3BZ5A

Functional domain of inlj from listeria monocytogenes includes a cysteine ladder
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
450
structure length
450
Chain Sequence
TLKAGQTQSFNDWFPDDNFASEVAAAFEMQATDTISEEQLATLTSLDCHNSSITDMTGIEKLTGLTKLICTSNNITTLDLSQNTNLTYLACDSNKLTNLDVTPLTKLTYLNCDTNKLTKLDVSQNPLLTYLNCARNTLTEIDVSHNTQLTELDCHLNKKITKLDVTPQTQLTTLDCSFNKITELDVSQNKLLNRLNCDTNNITKLDLNQNIQLTFLDCSSNKLTEIDVTPLTQLTYFDCSVNPLTELDVSTLSKLTTLHCIQTDLLEIDLTHNTQLIYFQAEGCRKIKELDVTHNTQLYLLDCQAAGITELDLSQNPKLVYLYLNNTELTELDVSHNTKLKSLSCVNAHIQDFSSVGKIPALNNNFEAEGQTITMPKETLTNNSLTIAVSPDLLDQFGNPMNIEPGDGGVYDQATNTITWENLSTDNPAVTYTFTSENGAIVGTVTTPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Internalin-J
publication title Crystal structure and standardized geometric analysis of InlJ, a listerial virulence factor and leucine-rich repeat protein with a novel cysteine ladder.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell adhesion
total genus 147
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bz5A02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3bz5A01
2Z63A 3E2JA 4MN8B 3O6NA 2RR6A 4Z61C 1XWDC 2C9QA 3BCDA 5B0NA 4BSSA 4CP6A 3WPGA 3C6OB 4ARNA 1O6VA 4U7LA 4B8CD 4Z8GA 2WQXA 2FT3A 2ELLA 3ULUA 4XSQA 4HQ1A 3BZ5A 3RW7A 4ARRA 1G9UA 5GS2B 2Z82A 3FAWA 4Z64C 3C6NB 3PMHG 2XWTC 3KJ4A 2Z64A 4LSCA 4LSXA 4GT6A 3TSRE 3UL7A 1U0ND 5B4PA 2Q4GW 4C2BB 2IFGA 4NKGA 3OJAB 1P8TA 4KXFB 5FTTB 5AWCA 4WP6A 5IJCA 5IJDA 3G39A 4QBZA 1FS2A 5GMHA 4U06A 1W8AA 4L3AA 4Q3GA 1O6SA 3OGMB 3WN4A 1D0BA 2OMXA 1DCEA 3JB9j 3ULAA 3E6JA 2UZXA 3RIZA 2P1OB 3W3KA 2BEXA 3BCFA 3DZEA 4PEQB 2Z7XA 4RWTC 1OOKG 3G06A 3RJ0A 2V9TB 5AWBA 3W3GA 3ZYJA 3OGLB 4PQ8A 3WPHA 4FS7A 3UN9A 4WYKA 2OMWA 4FMZA 2Z65A 2ASTB 4TZHA 4LSXC 1IO0A 2YA1A 4RCWA 3RFSA 4Q62A 4QXEA 3RGXA 3CVRA 4K17A 3OGKB 4XOSA 4CNMA 3G3BA 3WPIA 4R0AA 1K5DC 2V9SA 4M7EA 4V2DA 4CNCA 2ASSB 1YRGA 4BV4R 5HDHA 2WQVA 4Z94G 4LSAA 4I6JB 1OTNA 1WWLA 4R6AA 4P91A 4YEBB 1FQVA 1KOHA 3WPFA 4LXSA 1O6TA 2BNHA 4KT1A 4P8SA 3G3AA 1A4YA 4Z79A 4R08A 4LXRA 4C2AB 3WPBA 2UZYA 1P9AG 2OMYA 2ID5A 4LI2A 3WPDA 2WFHA 3C6PB 4PKIG 2XOTA 3G04C 1XCDA 4BSRA 4UFRA 2OMZA 1LYQA 3BC9A 5AZ5A 1XEUA 4R6JA 3CIGA 4NKHA 2P1PB 2RA8A 4H09A 4MQWX 4U09A 2Z81A 2RA1A 5HZLB 4PSJA 4R6FA 4R6GA 4J4LA 5CMPA 2Z66A 4AY9X 3E3ZA 1H6TA 3UL9A 3M18A 4CILA 1FT8A 1XKUA 1XECA 4FDWA 1QYYA 3REZA 4RCAB 3ZYIA 4M7EC 2OMVA 2C9PA 1K5GC 4R5DA 2O6SA 5GQRK 2Z7XB 2WQUA 1A9NA 2O6RA 1NM4A 3GOZA 3W3NA 3RFJA 4GLPA 4AQ1A 5CMNA 5GMFA 4IM6A 2OMTA 4R5CA 1FO1A 3W3LA 4Y61B 3CIYA 2P1NB 3RGZA 2V70A 4CC4A 4U08A 2Y5QA 3W3MA 3A79B 1IX2A 1M9SA 3E4GA 3W3JA 5B0TA 4OQTA 2Z62A 4V2EA 4FD0A 3OJAA 4V2CA 1P8VA 1M10B 4KNGA 5GMGA 3WPCA 4R58A 3UL8A 5AWDA 1DFJI 2OMUA 1PGVA 5IYXC 1OGQA 1OTOA 4J0MA 4ECOA 5IJBA 1LTXA 2P1QB 5GS0A 1GWBA 1M9LA 2O6QA 1M0ZA 5D3IA 3O53A 4L3FA 2JQDA 5A5CA 4XGOA 2R9UA 4BSUA 1SQ0B 4PERA 1DS9A 1ZIWA 4ECNA 2CA6A 3SB4A 4QC0A 1JL5A 3P72A 5LFNA 2JE1A 1M42A 1H6UA 4R07A 1Z7XW 1OT4A 1OTMA 4AW4A 3VQ1A 3RW6A 5ICUA 2WQWA 3FAXA 4R09A 1KOOA 4CC4C 4EZGA 3VQ2A 3ZYOA 4Q3IA 3WPEA 4FHOA 3ZYNA 3M19A 2C9RA 4LI1A 1OZNA 3ULVA 4FCGA 5AWAA 2A0ZA 2JE0A 2P1MB 3RFEA 4G8AA 3FXIA
chains in the Genus database with same CATH superfamily
3O11B 4P2RD 3AABA 3E2JA 4R4NC 3UZQB 1YZZA 2WBXA 2HT3C 2V7HB 4TVPH 1XH2A 3BCDA 4HJJL 1D5BA 1O7DC 1FN4B 2FT6A 2WXKA 5FHAL 3IF1B 4UQ3B 3FRPG 3GZOA 1OGTB 4PJ5B 1E4HA 1T6VN 2CM5A 4HD5A 4OH2A 1TVHB 4YDZA 3ARXA 3ZE0F 4EZLA 5JIHA 1U42A 3RFZC 5I1LA 4WAFA 1H3VA 4H0LC 1E8XA 4GAGL 4LCCA 4PR5A 4S1DD 3T0AA 4HK3J 3MV9A 3KLHC 3PWLB 1RQ5A 3V0AC 5AVRB 3UOAB 3RWCA 2XU9A 3ZU8A 1G9UA 1UQSA 2E27L 1ACYH 4A7VA 3C6NB 1HXKA 3AAZB 4J1UB 1AI1L 4LP8A 4LVNC 5GJTH 2VM4A 3FCTB 1QFOA 3EJQA 1MHCA 5EU6B 4BDVA 3UJJH 4M7LH 5K9JH 4MXQD 3T77B 4HK0A 1GGBH 4YSRA 3RWIB 1G84A 2J20A 2Q7AA 3U9UA 4N9GA 4JMXA 2ISDA 1RUKH 4R2GB 1RHFA 5FTTB 1KBGH 5FCUH 4NQQA 4BQ9A 4NZTL 2EZ0C 2VDNB 4FCAA 2QVKA 5IW6B 4FQHA 3DYPA 3H42L 1K5NB 5IVXE 4C4KO 1OAXL 1Q9KB 1LO5A 4DCQB 4X5LA 5CD3B 4H8PA 4KRLB 4E41A 4M1GH 5HI5C 3I85A 2H6PB 5E5RB 3TXAA 3S7GA 1XR8B 5CJBA 3L3HB 3MYJB 1X9QA 1ZSDB 3HG2A 3Q8BA 2CKBA 3R1GH 3BLKA 3UZVB 4ABUA 2BM3A 4X8GA 4BQCA 3RRQA 5ES4B 3JQOB 1PLBA 3GMRA 5D5ME 3WJJC 4Z7OF 3VXSD 4AOFA 4QDGA 2Q76A 4CDGC 3L95B 2VW6A 3GJFB 4Q9BA 2FB4L 2E6QA 2NUPA 5DQ9A 4AI7A 1IEAB 4QTFA 4BZ1L 4BFKA 5EZJB 1F3JA 2ITFA 2GAZA 4UUJB 4OQ1A 5E1AA 1MREL 3ARUA 3C60C 3CZEA 4HKXA 4H26A 5H2BA 3TVMB 5DEGA 3BPCA 2EXYD 2HJKA 1AQKL 2Y7MA 1ULVA 2JKIS 4H8WL 4H2AA 4J2QA 3RDJA 4AQAA 1PJWA 2GBAA 5HGGS 1NFDF 1TUPA 3HAEB 4Y4HB 2AXGB 4LHUG 2YPKB 3ELQA 4ZX5A 5JHDA 1CU4H 3PDOB 5BPPA 2WINB 4Y4KD 5JNYB 1PMYA 3T8MA 3H7BB 4RFNC 3S96B 2HT2C 3LNEA 2ADJA 2WCGA 5DR5H 4GRLA 4MQXC 1S7RA 3SCMA 4LSPL 5KYYA 2EDLA 5IEKA 2V9TB 1ZTXH 2G4EA 1EDYA 2PR4L 1MG3C 4X7SH 2BXZA 2HMIC 4LZKA 4JDZA 4KKRA 4R7NA 2Z8SA 4IS6B 2R2EB 1FI8C 2UWEF 2BWQA 1OSPH 2SODB 3HS0A 1KCLA 4GW1B 4U6HA 2BX5A 3JV5A 3A6BL 2Z64C 3PG2A 4XPBL 3MCKB 4X9YA 4U1MA 4J4PA 5B3JE 3QDGD 3CWGA 1GS8A 3Q8AA 4B9PA 3N43F 1A7RH 1IAIL 1TZGL 3BSZH 1MPAH 3KPPA 1CLYL 1S7SB 2DIBA 4MA3B 2GFBB 5T1KB 1Y7VA 4X99A 3CTTA 4FFYL 1B90A 2Z4QA 3KEHA 4OF6A 3WIFA 3QNXA 5KSBA 4MMXB 2A74A 4FXTA 3VFUA 5IIEA 3QWOA 1IBYA 3JVGC 1AD9B 1FNHA 4ESKA 2K3TA 5FK9B 4D0CA 2L8AA 3HKFA 4UTAL 4KFZC 5EN2B 4U6VH 1A4CA 1MVUB 2XBTA 2ZXDA 4XVJL 3QDJB 3SGKC 3ZL4L 1HKFA 4DKEH 4BUQA 3NZHL 4L1LA 4AUJA 1KB9J 5E8OA 2OL3L 2JCCE 1QFUH 3DUUA 4Z3FA 2VLJB 4JVUA 1RZ7L 3U1SH 4MAYB 5FO8A 1WFUA 2WQVA 5FV1L 5KVGL 3M46A 4JHWH 3SOBL 3RURA 3R7QA 1BQHB 3K72B 3ALPA 2BLFA 1XWVA 2UZIL 4AT6A 1NC4A 4HUVA 3SZ6A 4L1HA 1E90A 5FYJU 2E56A 2IJ0C 3DXAD 1GH7A 1QO3A 5C0EB 1JUFA 4PY7A 4UB0H 4QHUA 3GSNA 3ILPB 1XCTB 2HKAA 4Y1TA 2ICEB 2J44A 2GSIA 3QORB 4Z0BH 4GG6E 4O51B 3TT3L 2Y36H 3BRFA 3HS9A 3UAJD 3ZUCA 2B20A 4JW3A 4LSQL 4EUPG 3O3EB 5T3ZD 5T5NG 1HL4A 3KLAB 3HNVL 4XNZB 1AY1H 4M62H 4R08A 1MCDA 4P5TD 5AVXB 4N1HB 2H0EA 1F4AA 4L8CA 5I19H 3AJ7A 2Q3ZA 4HIHB 5FLUA 3PWVA 3SGEI 2NY5L 3SO3C 3ECVA 3H9HA 3VUAA 3HUJA 3NFSL 1A0QL 4HSQA 3GLEA 1CI5A 2DIEA 2X2YA 4AGLA 2PXYC 1OW0C 3A22A 4KDTC 4UFRA 5TDPA 3CLFH 1XEUA 2B59B 2YKKA 4YN3A 3SDDC 1GOHA 4IHOA 1KJ2L 4LCIH 4BZ2H 2CBMA 3B3IA 1AS7A 1AXSB 4N90E 2H5UA 3D08A 3DSNB 5CILL 3O0RH 3MRFB 3QAQA 5F7NC 4DKTA 3SGJC 3N42F 5DO2C 5FPIA 1BW8A 5SWSB 1WH0A 1Z1WA 2QLVB 2C5DC 3ROOB 3ZKXC 1TVBB 1G4RA 3VSQA 3D05A 3ZHKA 2PYEA 3CHOA 3GRWH 3ZRSA 2ESVD 4Z9KB 2WBKA 4DQAA 2WTOA 5T5FA 4WI2A 3G6JA 1JHKL 4HH9B 3HOGA 4R8WL 4J4LA 2IQAA 2K8QA 3DTXB 3FUDA 4FG0A 4UZSA 3E3ZA 4KBPA 1P6AB 4K5PA 5ERWB 5HYSA 1X5JA 4N2BA 5E4AA 2QR0A 4OBRA 3V4PH 1XKUA 4LU5L 4MJHA 3SY0B 2JNZA 3TFBA 4KVCL 3AU1B 2G2RB 3X12B 4A39A 3REZA 3QHZL 3FRPB 3VYOA 1K5GC 4PJFF 3I6LE 4NPYB 4IMLA 1O0VA 5LHDA 5CP7A 3VSTA 3HG0A 2G3MA 5GQRK 4YAQB 2H32A 5ADOL 2XV6B 3V0VA 2V9RA 1RU9H 4MKMA 3S48A 4A2LA 4ANWA 1YY9D 2WUCL 1EFXD 1DBKH 4XB7A 1SOQA 4MRBA 4YWGH 4F1SA 2KERA 2HSIA 5F7YC 4DN4H 1S7WB 5LDUA 3CMOL 5DUJA 5IT2L 3MRGA 3BZEB 2DQGH 1DJSA 3C9NB 3MRRB 1NGQH 1KOAA 3FU0A 1KWKA 2VLLB 1PDKB 5CAYB 1IGJA 2JJTC 2XTJB 1MXGA 3IDJA 4KTDL 1FE8L 3TOPA 5BZDA 2XXMB 3SQBA 5C08A 4K9EH 2A9ML 1U8IB 2KDYA 2OMWB 4G5ZL 3TEYA 2YPLE 4ZAKD 3RDTC 5C9JA 3OR7B 1EX0A 5CJOH 1NCOA 1KCRL 4H8WC 5KVGE 2R56H 3GO1H 3MBEB 3Q3GB 5BZZA 2WYZA 1FCGA 3FTGA 2I07A 1NDMB 5JR1L 5CWSB 4HCRH 5HVHC 3D6GA 2BNQB 4C8XA 2IBZX 3BAYA 4JCLA 5EO0B 5D2NA 1OAUL 3H3KA 4AMKH 4RBPK 1NMAH 2NMSA 5F6IC 3HB3B 5B39A 4RIRA 3F6LA 4Z7UF 4EBQH 1I82A 1KY7A 2YARA 4QY8A 2B3IA 3WPCA 4ABQA 1AZBA 4PVBA 3E1ZA 4NKOB 4Y19B 2X42A 3RKPA 3QJXA 1E9QA 4GB9A 4KKNA 5KVDL 3S5YA 1MI5E 5F7WC 2MCMA 2BOLA 4OFYA 4LCWA 3UTQB 2OMNA 5IOKA 1JWSB 2GI0A 1QTPA 2GK2A 4LDLB 1X6LA 4U3XA 1QSFE 3QEQE 1DVTA 5C0CA 2AJZA 3MZGB 3ESMA 5HHOA 3S3BB 5AW4B 4P8QA 1BFSA 1LJMA 1CVSC 1F3DH 1Z5HA 5C0BB 1KGCD 1M6OB 1RZ8A 3C6LD 5TDNA 2WZAA 1KTRL 2MJWA 4KDVA 3EXJA 1X9LA 3CXDL 4LHUB 4CVWA 4F2ME 5D72H 4X6BA 1D7BA 3MXWH 3VD5A 2ERJC 1BX2B 2ZXBA 2OZ4L 3D0LB 4IIQA 3AXLB 3MMEA 1C8PA 1GMIA 3BT2H 2EVIA 1ZT7B 3KXFA 4B53A 5F9OL 5F7AA 4X6DF 1IAOA 3VI3E 5IHZA 3QJHB 3UZEA 5JPNA 4XZUB 4JREB 1Q9WB 1NCTA 3CFCL 5HPOA 3WS3B 3MRIB 3NSDA 1G9NL 1MCJA 5FKPB 1Z6JT 4PLJD 5ETUA 1RZGB 4Y1AB 3VXRE 2AKRA 4P2QD 4IOSD 2Y1ZA 1EK3A 2FX8H 4FCHA 4K3JL 1HIMH 5IQLA 4OZFH 1SJHA 1HQRB 2OXGB 3IEAA 3NQIA 3R18A 5SX5K 2JFCA 4LDOB 3QQ3B 3EO1A 3EO0A 2O5NA 2BH0A 3GNMH 3O45A 2XNAA 2W88A 4KJYB 4PUBL 4R4FH 3R8QA 2X9YA 3RVXD 3FBKA 2QPSA 4JZJA 2EDJA 5GGVY 3B7RL 4HAKA 2YSSA 3WXWL 2R39A 5AVSB 1ORQA 5I75B 4LOFA 1OHQA 2GG1A 3H7LA 4R09A 3VI4A 3B2UC 3VD3A 1UWGL 2NR6A 3WFZA 4F33A 4RMSA 1H3XA 1MWAB 4HIJB 1KPRB 2N0KA 3P0VL 1R5VB 2YGNA 1JDCA 4N2LA 3VQ2A 3MLPA 2E59A 1NEZG 3WTYA 4U33A 1J8RA 1DQIA 4GRMA 1RH8A 5JA9A 3WJLC 3WAKA 4UNUA 2C9VA 5I26A 2V5TA 5J7CC 3ZDXB 2NY5C 4XXDB 4MD4A 3PJNA 3VX1A 3LNHA 2DEXX 2FEDD 1C5BL 4DEWA 2AJVH 1IGYA 1TQUA 1BM3L 3KLDA 5CFHA 4PRID 1FO0L 3BVWA 4Y7MA 3RFEA 2P80A 1BXXA 3NJVA 3FXIA 4WK4B 4Y16B 4KOCA 1A02N 5FO7B 2UXVA 4MN8B 4MDRA 3O6NA 2FGWH 4L4VD 1MW1A 1M7UA 1CIDA 2IWEA 4OKVA 1LE9A 1KJMA 5I17A 5DMYA 2OTPA 1S7QB 1BEYL 1A14L 3GMQA 4RQQA 5CBEB 3QEHB 3DSFH 1PZ5B 1TOXA 3DURA 4PGEA 1Q0XL 3CFMA 5B3SB 4FLQA 1HHKA 1IMHC 3QJQB 1CF8L 2NTSP 4POZD 2XJLA 5C0AB 3O6FB 2AK4A 4KH2A 4B8CD 2WQXA 4I2XB 3LYRA 4NYLA 5I0VA 4PJBF 4JFDA 5INDA 3T65B 4ERSL 3EFFB 2ELLA 5KVDE 1JE6A 3WENA 1YYMH 3BZ5A 2WUBH 1N9PA 1JXKA 4IJ3C 2AAVA 4M6OH 4WWKC 5IJKC 1KLGA 2EACA 4JBSA 4P23D 5D1QB 2I9LB 3EIFA 4Q2ZB 3QPQC 5EIIA 4W6XB 5TGBB 4FQCH 4KK5C 2KPWA 1HZHH 2ZF9A 4LSXA 1U21A 3DHMA 4GRWH 4HUXA 4CVUA 1U0ND 1VZHA 2CLRB 3ECWA 1QFWM 3NVQA 1AO7D 4WI5A 4YDIL 1QRNA 4M3HA 2RFXA 3O3DA 3SKUD 3FTZA 7PAZA 1ZT4B 3ZN6A 2QL1A 1SHMA 2JQZA 4HJGB 4PGBA 4V2CB 1ZA3A 2GSMB 2V37A 4KQ4L 3KWUA 5IMKB 5IJCA 5CJQH 3LRMA 1FP5A 4QRBA 2Y72A 4LKXA 4RSVA 3WUZA 3UERA 4JDEA 3CC1A 3TT1H 2X9ZA 1J0KA 5GRJL 5D2LF 4YHPA 5D7IE 1CGXA 3KYOB 2PP7A 4UILH 4WW1A 1G94A 4R26L 4HIXL 1OTSC 1BAGA 1GCYA 4YFLF 4S0HA 2C7UB 4K5OA 3BH8A 4IRSA 2ATKA 1ACZA 4YLCA 2W65B 1BZDA 4M4RA 2GIMA 1AGFB 4PJGF 4QRUA 3VDCA 4MNGE 4LDCA 3WO3B 2D7TL 1U8LA 5DYFA 4WTQA 3GMMB 3LQMA 2EDKA 3EH2A 2VZTA 2F8IA 2M26A 5E0FA 5T1JA 3RFZB 4J3TA 3NEEA 5H94A 1LP9B 4GXUN 3Q1EA 4LRIA 4RDQG 4N2AA 1F11B 1HOCA 2EYRB 3JV6B 1G7LA 4DGYL 4NQCE 4UTCA 4PJDB 5I1KH 1GPOL 3MKGA 4EI5C 1OAQH 2OTUB 2M83A 2IAND 1E5YA 2UZXA 4Y5YC 3ATDA 1KFGA 2R69A 2ZCHL 2F8XC 5E7BA 5AW8B 4UOW1 3RIAK 5CJ8A 3C6EA 4PLNC 3KYKL 5DVPA 5CCKL 3EO9H 1KEMH 3QIWA 3BRDA 2WP3T 3T1FA 1T1YB 2X4NB 3IJHA 5BZXA 4R0LA 1BZ8A 2YD5A 1NGXA 3PWJA 1I85A 4OLZH 1NIBA 5CIPA 1IGIH 2APBA 4JM2C 3FQUA 5LWYL 4KQ0A 2B4CC 1Z5LA 2GBTA 3VU1A 1EERB 1D5IL 4L4JA 5G5DB 2LU5A 3LTVA 1F2XK 5FB8A 4CN6A 2X4TA 2VE6B 3ZYJA 1DQLH 2VDPL 2BOCB 3WN5C 4PJFE 1RJYA 1T4KB 2GEEA 1L9NA 3ARVA 5IUSA 4G1EB 1FSKC 1UJ3A 2V3FA 3BE1H 3MCG1 4E9XA 2BP8B 1LK2A 2VDRH 4ODUB 1RJLB 1GGIL 1MZZA 2FD6L 3THML 3RX9A 1USQA 3OLEA 4U1SA 3ZE1E 3F58H 4FYRA 1CDBA 4QWWC 3EJSA 3W38A 2SEBA 5C9KA 1A7OH 1MFCL 3BUQA 3JXAA 4RCWA 4S2SB 3GBLA 4YXLH 4R7DA 1ETJA 1G9NC 4U4IA 3MV7A 3LPWA 4XCYB 1JDAA 2Z8WC 1BVKB 3T09A 1BJ1J 4GG8B 5E8NA 3UGEA 4K17A 1BREA 1AGEB 2WSDA 3Q8EA 4FYSA 5HDLA 3C60B 4D0BA 4G7VL 4PCSA 1CGUA 1D2PA 1U8NB 3PHAA 4KGLA 3V6ZB 3MROA 1BGXL 4Q6IC 5CLZA 1JGEB 4N28A 1NAMB 2E7DA 5T1LA 3MOAL 4WSGA 3RILA 3I9GL 3MRKB 4J3BA 3ZTDC 2FIRT 2WC7A 4V2DA 1I9EA 2ZPKL 1J8HA 1E6OH 4X6CF 1CF1A 1W72A 3MNVA 2WXLA 7FABL 4OD2A 1T21B 5AB9A 4L9LA 4RFNB 4MLSA 3TPUA 5GGSB 3OQRA 2C8NA 3BVVA 5C07A 4I6JB 4C83B 1F41A 1WT5C 2YLKA 3HNSH 2FLRT 3VWKC 5K69A 2WXIA 2WNWA 3CJJA 1AD0A 3QCVL 3VCLA 4I1NB 4LXSA 1YC8A 2WO3B 4OLWH 1IAMA 4XVTL 5B1AB 3BVDB 1KDJA 4GKZA 3N1FC 5GS2H 1NH6A 3EH3B 3LOWA 3QCUH 4G9DA 1UM5L 4ZYKB 1U4EA 5KAQG 3FFCA 5BVJA 3FUEA 2LW3A 5L2KE 4Z79A 2NNAB 1HSBB 1NCWH 4UU9B 1XV8A 3L3OA 4XC3H 5IVXB 1HKLL 1JNHB 4FQXA 1U33A 3FU7B 3BP7A 4IU3B 4PB9L 2OMYA 3L9YA 4JKKA 3BWAB 3CVHB 5B38A 3MNDA 4PKIG 2E9JA 2G60H 4LRNH 4NP9A 3BRGC 1VZGA 3WIAA 1LNUB 1KTBA 2XY2A 3BC9A 3C2AL 5D5MB 5JOEA 2W8CA 4IEFB 3EOAB 4OM0H 2XA3A 5BUAA 4ZUWB 4ZSOA 2WLKA 4O02B 2PMZA 5FUCE 2FWOB 4OCWL 3CFEA 2EIBA 4KNSA 1J12A 3HMXH 4BFJA 1TTBA 2CBPA 4H09A 4B7IA 1D5XB 2WLJA 3FONB 3UBXG 4PREB 4ZTPH 1NSNH 1BXVA 5DVKA 4BK8A 3S34L 2L3BA 4CUCA 4X83A 4Z78B 3OR6A 1QBBA 3UPAA 3LNFA 1OK8A 3N0PB 3N85H 5DJZA 5FA4B 4R6FA 4JFZL 2NY1C 4IBYA 4TF4A 4UIMB 5INCB 3SBRA 3I02A 3MUZ1 3D09A 3MOBL 4LEXH 1S6NA 3OKNA 1XECA 4K7PY 4WFED 1EZVY 1DJIA 2IWKA 1USZA 3Q5YA 2V7NB 1F4WL 3OF6D 2O6PA 3SKOB 2YD4A 3DROB 2OMVA 4BWWA 1BVLA 5IGXL 1EXUA 3HJ0A 3L1FA 4JK0D 4E0RB 3V5KB 1UACL 4KMTH 3UZQA 5DVOA 2XIBA 4WI7A 3QQNA 1CDUA 1HWGB 1NEPA 3DYOA 5TE7L 4LL4A 3VXNA 3SO3B 1JN6B 2N4IA 1FN4A 3QG6B 1PLGL 5IV2B 3CN2A 2PXYB 1YEWA 3IF1A 3QJZA 4UQ3A 5BQDA 1PL3A 3LZOA 1OGTA 4V33A 4PJ5A 3F5WB 3HG1E 1KV7A 4N24A 1TVHA 4MB5A 4PEEA 3HZKB 2LLGA 5E1QA 4W70A 1WBZB 4IM6A 1JNLH 3RYMA 3KEDA 2Y5TB 4RAVB 4DZBB 3PWLA 4ZD3L 3MA7B 1YA5A 1P7QD 4XPGL 2P1NB 1OLZA 1QBML 3KR3L 4G43B 1AMYA 5ECJE 3RVUC 1HJBC 1DBMH 2BC4A 4QPEA 1VF5C 4PRHE 2BRRH 4OD3H 3AAZA 3ZKXB 5I6MA 4A2DA 3W3MA 3MLUL 3FCTA 4NRZB 2YZ1A 5J11C 2X10A 1XL4A 5EU6A 4AZ8B 1WCBB 1CQKA 2FHFA 5FUCC 1VFOA 5EU4B 4LSSH 3T77A 2WWOA 3KE0A 3V52H 1NAKL 3RWIA 4P46C 4AQ8C 2CPCA 2PO6D 2JCCB 4PJBE 4FD0A 3DXAE 3JZ7A 4M6MH 1Q0YH 4G6FB 4PV9B 2ZYRA 4XR8C 1QLEL 2H0JA 4XNYH 1AG0A 2G75B 5IW6A 1K5NA 3ARDD 1JV2B 1Q9KA 2FUQA 3UTTD 4DCQA 2WCSA 2W60B 5CD3A 4N2CA 5GRVK 3HC3L 2H6PA 5FW6A 4WUUD 1XR8A 3OMZA 3L3HA 3MYJA 1ZSDA 4DP2X 4GG6B 5GJSH 3UZVA 3S36L 5DT1L 3OAUL 3S5ZA 3IVKB 3A4FA 1JPST 4CADB 4KDWA 1HHHB 2NQDA 1DDHB 3DX2A 3O41A 3PXJA 4YFEA 4Z76A 1OTOA 4X80H 1QASA 1V3JA 3DJ9A 2VLKD 4H13C 3VDBA 1ZGLB 4ZOCA 4BJLA 2YEZB 3E3QC 3L95A 3L13A 3FUKA 3ZKSD 3ZUNC 1XH1A 3GJFA 4KGJA 4OW6A 3D2TA 3U4AA 4MZ2A 1IEAA 5GS0A 3O9WD 2DWEB 5EZJA 3NJGA 2P49B 4HKBB 3MKKA 4PJCF 4RWHA 4XAWL 1RIHL 4UUJA 2ZUXA 2VKXA 4OZHF 3V0IA 2MNWA 5GISH 3D2UB 4NKDB 3TVMA 2TRHA 1EZLA 1M0ZA 3RDTB 3QUYB 1L7IL 4FKKA 1DZBA 5EIQA 2AXHA 2CDGA 3HAEA 5HVHB 2AXGA 1SXSA 4N0UB 5C0FB 4M02A 2YPKA 4FMVA 1M9WA 3S4SB 3PDOA 3FYIB 1NCGA 2WINA 5JNYA 1XZWA 5F6IB 3B83A 4NO0B 3H7BA 4ETQB 3S96A 3VFPB 3TWCL 5ACMA 1DQVA 3VTMA 4I3GA 1ND0B 1RZFH 5ICXA 4B9ZA 3QJRB 1Z9LA 3ZTJG 3WTSA 5J12C 4P2OD 4ODVH 2C7FA 2RALA 3GSVB 2V9TA 2Y6SD 3FHQA 3IN0A 1S3RA 5DCCA 5DJCB 2P43B 4PRDB 2WQWA 4WY7L 5JQ6L 3NCJH 4CC4C 5C92A 3PQYD 3T71A 4IS6A 2R2EA 4EKJA 4NAJA 3T08A 3P77B 2R0ZL 2YQBA 1VJSA 1YEGH 4GW1A 1CCZA 3SE4A 1J1PL 2XIIA 3MCKA 3MUUA 3UAJC 2DLHA 2QVIA 1WK0A 2O30A 4EN3D 5EOCJ 3KMDA 5EWIL 3NABH 3IM1A 5C0ND 4MA3A 5TK4A 1S7SA 2GFBA 2ERJB 4OZ4A 4P5TC 1S9WB 5T1KA 3VRIB 1AR2A 3RHWF 2NZIA 4N2OA 4CAGA 3EBIA 5DK3A 2YAQA 2ZF8A 4KI5E 4MMXA 3UBHA 2VERN 3KWXA 5EN3A 1AD9A 3MOQA 3BLBA 4ELME 25C8H 1JG9A 3DMMA 2PCPB 1UGKA 1MVUA 3MA9L 4X8CA 4G82A 1YMME 3EYOB 2YPVH 3QDJA 2EVGA 2KI6A 3Q2NA 4AMXA 1WWCA 4Z61C 3EF7A 1UGNA 3AG2B 4LPCA 1MFBH 2L7EA 2OL3B 2VLJA 1TDQA 4MAYA 2GSGA 3K2UL 2YPLB 3RZWA 4AM0B 1J9SA 2WZ0A 2ADFH 1LVEA 3POCA 3C6OB 1BQHA 3K72A 4NGHH 3NACH 5C0EA 4RFEB 1J05B 3X2QB 1SN5A 2XT1B 3ILPA 3FOLB 4OSUL 1XCTA 1YEHH 1YEJH 2ICEA 4ZI8A 3QORA 2CLVB 4FHKA 4O51A 1QBLL 2AGJH 1U3ZA 2F19L 4HV8B 2J1ZA 1V5JA 1SJXA 4NEHB 4CMMB 5EPMB 3O3EA 1HINL 3ARBD 3MXVL 5B21A 3KLAA 2GIYA 4WI0B 4IRZL 1LWRA 2VDLH 2ENQA 4K8RD 4LSDA 2VDQB 3II3A 4UQCA 1I7TB 3AITA 3IU3B 2IEPA 1MI5B 4HIHA 5I8KH 2GEQA 1U92A 1HSAB 1UADC 5E95B 3N40F 3TCLB 4PI2A 3VD2A 3QNYB 1O5DT 3UBXB 5EUOE 1QSFB 3QEQB 3L45A 3WCYA 2VUYA 1WDAA 3ML8A 1YYLH 3F7KA 4KJWC 2B59A 3S88L 1MJ8L 3IMVA 1KJ2B 2WOBA 3Q6GL 4HW6A 3PNRB 2DIJA 3LV3B 4KZDH 2OMUB 4F2MB 2BVOB 4YDKL 3OGCA 3DSNA 4IBLT 3ZK0A 5AWNL 2HT4D 3MRFA 2ICES 4QHKJ 2OSXA 5EORH 1FHGA 3JWOL 5SWSA 3UG5A 3WD5H 1R0AH 2BVTA 4KI5C 3UTSD 3C5XA 3ROOA 2YRPA 3VI3B 1TVBA 3U1QA 1P4IH 1XB8A 3MLWH 1NUNB 3KL0A 3L4CA 4JO3L 1CL7L 4R7VA 4ZAKC 4QIRA 4HH9A 2B1OA 3BPOC 5JHLH 2D0GA 3DTXA 4KKAD 4C4KT 2AQNA 1ZVHA 3VXRB 1JS4A 5D8JH 5ERWA 1L6PA 2A6JB 4IJ3B 2OTWB 3E6FB 4WWKB 4Z0XB 3E6JA 4FJYA 3SY0A 2QSCL 2CKBH 3AU1A 2G2RA 3QC6X 4XCCL 3X12A 3FRPA 2J88H 1SVBA 2NZ1A 3TV3L 1I9IH 2IFFH 3HRPA 1OAYL 2R4SL 4NPYA 1L5GB 2CG9X 3WFBH 1MLBB 3UACA 2Y7QB 4YAQA 4LOEA 3RG1C 3EYUH 4HPYH 5EA0H 1BQLH 2P47B 2VMCA 3DHPA 5JZ7D 4FULA 4HQQL 4P9HL 1W8NA 1XTMA 1ADQH 4JM4H 1S7WA 3INUL 2N7BA 4RMVA 1MRDH 3BZEA 2NYYC 3NZ8B 2I69A 3MRRA 3M8OH 3ZDYF 3P3UA 2WXQA 2VLLA 1PDKA 3NAAH 4RMQA 1M7IB 1B9ZA 2DKUA 4NOFA 4I0PB 2WIIB 3C6LC 2P5EA 1INDH 2OMWA 1U8IA 4HJUA 4JL2A 1TEGA 5E2VL 1GOGA 1U8OB 4MD5B 3OR7A 2OR7A 3MBEA 1OEZW 1TZHB 3Q3GA 1NDMA 4F8TA 2DD8L 4Q62A 3N50A 4TSCL 5K9KB 4PV8B 5CWSA 5F6HJ 4V1DE 2CK0L 3VWJD 2XRAL 4LMQE 3K2KA 5F93C 5GGVH 3BN9C 2FEEL 2NUTB 3QUKB 5TD4A 3U1PA 3LXUX 3NGBC 4PLJC 4EI5B 5IJDC 3OGKB 2QFRA 4FP8L 3U2JA 1FHNA 2HVJB 4OUUA 4Y5YB 3WL9B 2XYBA 1KIUB 3OBAA 3G3BA 4KX9A 1TQVA 3IPBA 1T5XB 4NKOA 4Y19A 3T3PE 3DKHA 1WS8A 5F0JB 4DAGL 1T89C 5ADPH 1FJ1B 2CXGA 3H85A 3NT0A 4MAUL 4PGJA 4M43H 3CU1A 3A0OA 3UTQA 3BO8B 1JWSA 5FFOA 2H45A 4FX5A 2IG2L 3Q7JA 4JM2B 4YL9A 3T0BA 3VYPA 1CMOA 1H3UA 1AO7E 4YS4A 2ED9A 1NUGA 2YQ3A 4EO5A 3EGDA 3FF8A 4NP4H 5C0BA 1I3RB 4YSDA 4JJHA 3ZZ1A 1CR9L 2FATH 2LVEA 5JW4R 1SEQL 3WN5B 2KKQA 2KZBA 4K7PX 1LL1A 1EZVX 3P2BA 5CZVH 2MHAB 1BX2A 1FSKB 3D0LA 3AXLA 1Z0NA 4KT1A 1SQMA 5HD8C 1YSOA 1ZT7A 1JD9A 3OB0H 1ZLSH 1R46A 3HLAB 5DZ9A 4Y2DC 3VXPB 3KLKA 4XZUA 1Q9WA 5EU7C 1JK9B 4R5TA 1L7TH 1ACCA 3MV9D 3WS3A 1ZOXA 2PPFA 3MRIA 4OQTL 3QUML 5FKPA 5D7IB 3ISYA 1RZGA 4XXCA 4TLUA 4Y1AA 3M88A 5I0DA 1QI3A 2O72A 1J0IA 2A1WH 3GSNH 4KKZA 4GH7B 4MNGB 2ZUQC 4XCFL 4B96A 1XCDA 4JR9H 1HQRA 2OXGA 5GZNA 1A8ZA 3QQ3A 4Q6IB 3A3YB 5F0PB 3A4AA 4EOWH 3DGCR 4KJYA 4XP6H 2XZCH 4Z7NE 3QI9D 1MNUL 3FT3B 2ZE0A 3V0FA 2H6OA 3L3IB 4WUKL 1A7QL 3NJKA 5C97A 4AXWB 3ME0B 2YUVA 4NQCB 1KENL 3TX4A 5CGTA 15C8H 2PWHA 1N26A 4JPWL 1INEH 1H3GA 3K0WA 1MWAA 2F5BL 4HIJA 1MCOH 4YHNB 2YMXH 4J23A 1KPRA 3IDUA 1R5VA 3T2NH 4OI8A 4E41D 1HEHC 3VWKB 5DD3L 5DF0A 4P23C 1HL8A 3PXLA 5F96L 4ZFZB 5G4OA 4B9CA 1NDGB 2FJUB 3Q9QA 4BZYA 3TBYB 5TQ0H 5CGBA 3ZKQD 2DQCL 3RE0A 2V17L 4XXDA 1E65A 2NX5E 1IFHH 5AALA 3ZTCC 1ZRUA 2JJWA 4X6FB 2A6KB 2ZXCA 3B8SA 4AGQA 2QFPA 1QLRB 4CRPA 2P5PA 4M7EC 4XMKH 1EGJL 1W91A 1FO0B 5ISZB 4E68A 1BAFH 1XB6A 5EO1B 5G55A 1KJ3L 4Y16A 2WJ7A 5FO7A 3GZQA 3N1MC 5E9DD 4DFHA 3BAJA 3VFWB 2YGPA 3GXFA 4Y8DC 3DX8A 4JPSA 5CBEA 5EULV 3ULVF 3JWOC 3QEHA 1PZ5A 2JI3A 3M86A 3ZE1B 2CCWA 4PJAE 5CMAB 3ETSA 5LBSA 3SD5A 3WUWG 1JFHA 5KWYC 5C0AA 1OM3L 4KXDA 5JHDD 4XZ4A 2VWEE 3RGVD 5IESL 4KNUA 1AHMA 1QRKA 5ILTL 5ANME 2P1YA 2YUZA 1E3XA 3QISA 3U2SB 3T65A 5E8DL 3EFFA 3P30L 3H3PH 5KBMA 1U91B 3QRGH 3N06B 5TQ2L 1ZLWH 2FJFB 1FNSL 2GVYA 5AEAA 3SCMD 5ICZB 2CHNA 1EV2E 2ZKHL 3RGZA 1E4JA 2H32H 5D1QA 3GHBH 2I9LA 1LK3H 4Q2ZA 1BV8A 5TGBA 2IVFC 4JHAL 2NY1B 4ODTH 2J25A 2AJ3B 5HVFB 4FL4C 1P7BA 2CLRA 2NPLX 3I6SA 4IDJL 2ZCLH 3GSOB 4TSAH 1N6UA 2A5UA 4TLKA 3GHEH 4FG2A 4LSRL 3PLYA 4U1KB 1ET7A 4M03A 2YK1L 4P9HC 1ZT4A 5DJYB 4Z7QE 4V2CA 1JGUH 4HJGA 4N0YH 5IMKA 4J4PD 5J1SC 2AJSL 4RVBA 4BA0A 4F92B 5GMGA 2IADB 4LPYA 4DK3A 4FQPA 3SDAD 5FEBA 3Q2CA 3B7TA 4YNYB 5FCSH 1HS6A 1UZGA 2FX9L 1RMFH 1URZA 2C7UA 1A6UL 4W1TA 4E9RA 2W65A 2XKNB 1AGFA 2YRZA 1RUPL 3X3GL 1A1MA 5L2KB 3QXDB 1DN0B 2LOEA 3GMMA 4U1JA 4WGWB 1FL5B 4GSRA 2ZP8A 4N9OB 4W9EC 4YHML 5L0QC 3AS2A 4PCTA 1WZ1H 5CEYA 2BIHA 1JXFA 3RFZA 4AUUA 1LP9A 2QQLL 5F7KC 4TQHA 1F11A 2EYRA 2GCYB 3JV6A 2HRHA 4ABWA 3OXRB 4NFDA 4QHPA 1NBVL 2IPKA 3JT2A 4PJDA 3WGVB 1EVUA 5JPMC 2GC7C 2OTUA 1NC4D 4KNQA 1I9RH 5M7QA 3K8MA 4KO9A 2YR3A 1MF2L 2K78A 1OGAE 3IE9A 2JQDA 2VN3A 2DEYX 3RNKB 4AJWA 1N4XL 4GQ9H 4F9PC 5A2KH 2XIDA 2VWEC 2EAEA 4C59B 4MCNA 3BAXA 2Y2YA 5J11B 1PZDA 5DZNA 5TF1L 1DSYA 3FZUC 2ZOWA 2L7UA 1K72A 5T33H 1T1YA 2X4NA 2XPGB 1NGYB 3BPNC 2CA3A 4P46B 4OZIF 4ZTEA 2GJ6E 3QZNA 4PI0A 1B0GA 4ZOBA 1JL5A 1ILUA 1NMCC 5L6YH 2XA8H 4MZIA 1U30A 1Z3GL 4WK2B 5G5DA 3BHBB 4LARH 3Q5TA 4MS8D 5J6SA 5T1DL 1VAHA 3IN2A 4MZ3A 4WFEE 4CVXB 3KZ8A 3BUIA 2VE6A 1CVRA 1PZCA 4K94H 1MFAH 2VDPB 2BOCA 3EJUA 4E5XG 1T4KA 1VRSA 4G1EA 3VMPA 2BP8A 1E9PB 4ODUA 1RJLA 4KRPD 1CC3A 3KS0H 5ABZA 2K8MA 3HI5H 1UFUA 1G7PB 5EB9A 1F1GA 1RUQL 4OUOA 4NBXB 3WJJA 3ZYOA 1WHPA 4S2SA 3T1WA 4OT1H 4ALAL 4AG4L 5TK2A 4FQ2H 1F6LL 2BY3A 4XCYA 5EEXA 4ZFQA 1BVKA 1IBBA 4N1EA 3BAIA 4LDEB 1AGEA 5AFAA 3E7JA 3C60A 5TE6L 2PYED 2X6UA 4JO2L 5E70A 4AJVA 1U8NA 3WAJA 3V6ZA 2A9CA 4AGNA 3L3KB 1DANU 1MRCH 3QRLA 4FG4A 5F3HB 2DQDH 3ARQA 3HG1B 3TIDB 3CMGA 2OR8A 5DZAA 1NAMA 5EF0A 4P0DA 3MRKA 5IFHL 3WFDH 5B7MA 5EZIL 4W4NA 1YJDL 3RTQC 4IM8A 3W9DB 2RR6A 4OLYH 3GF8A 1ZK5A 5I1AB 4ZMAT 2GY7B 2O26U 2X4PB 4P5RA 3I75B 5IVNA 1T21A 3V0HA 2J4WL 3O8XA 2IAMC 1V3KA 4FERA 3WIHL 5GGSA 5I0XA 4PRHB 2EH8H 5GGQH 5HJ3B 4F1ZA 4F7EB 4C83A 4ARNA 2COQA 4V11A 5J12B 3QDME 4TUKL 3O81A 3DECA 2IXQB 4XHJD 5EUKB 2EDOA 1I3GL 1ZK9A 3UPRB 3HZYA 3L1OH 3VO0A 4HQ1A 2OP4H 4OFIA 4ARRA 4ONFH 5KSVB 4H25B 2WW8A 3DXAB 3EJZD 4O4YH 4ZYKA 1D6VH 5IQOA 2VDOL 3V8OA 3W0WE 3WKML 2E5EA 1T1XB 2E9GA 1T03H 3PMHG 2NNAA 1HSBA 3WLBB 4UU9A 4K3EL 2Z64A 1JNHA 3FU7A 3T8VA 4IU3A 4ODHH 2X3AA 2Y7NA 2A3TA 4X5RA 5C08D 3O6KH 4XMLH 3GBNL 3MFFB 1QOKA 4UQIM 4OI7A 4P5TB 1LWHA 1OCZB 4X9IA 1QHOA 1WC7B 3VFVB 3FUJA 2V8LA 1FH2A 2YD6A 1LNUA 2R8SH 2FQDA 2R2BB 3JVGA 5D5MA 2Q6WB 3WS6C 3DVGB 4IEFA 1PW3A 3CXHJ 4BQ6A 5GS1A 4ZUWA 3BWUC 4CN4A 5ESQB 4D3CL 4P4KD 4O02A 4ZZKA 5CUSL 2FWOA 5BZWB 4HUMB 5MENE 2DI8A 3LZRA 2B1AL 4I88A 1QD0A 3T6XA 1N7ML 1QI4A 1N10A 1ETZB 1D5XA 1N5AA 1IGCH 1PQZA 3FONA 3Q6FB 4PREA 5DJ2B 4F8OA 4U06A 1KBVA 1DVZA 3P40A 2ZOLB 3QIBC 4MD0B 2CHWA 3GSXB 4RGOH 4Z78A 5J56B 3TFKD 2CH8A 4RMUA 4U0RB 1DYZA 4A6YL 5FA4A 2XWCA 4YHZH 2ZYHA 3BUBA 2EDTA 2E7BA 4UIMA 4OFYD 5DJAB 4FEIA 2AS5M 4LCWD 4TNWF 2UX7A 2XFGB 4RGND 1R5IA 4XPFH 2IDFA 5CD5C 3KDPB 4BWTA 5HHOD 4LLUA 3IT8D 3QDAA 4E42B 1DJWA 4OJYA 1YQVH 2OMBA 1EHKB 5IEHB 2JTYA 2V7NA 2PO6C 1L9QA 4XNXH 3WUWB 2BP5M 3SKOA 1YHPA 4DT2A 2NY7L 3DROA 3UIZA 3W3KA 1KC5H 3F65A 4G70B 5AKSA 4E0RA 3V5KA 3KYNB 3ZT7A 2UYLB 4BGDA 3GXIA 1J9CT 4X9HA 2XKSA 3ARDC 5BJTB 1DO5A 3IFPB 1JN6A 3QG6A 4K5NA 5IV2A 2PXYA 1P6WA 1OW0A 2VW7A 4KDTA 2DB8A 1CJYA 3F5WA 3QZPA 2R69H 3HZKA 1TMQA 3PABB 3HNTL 4OGZA 3UN9A 1IAII 3HBQA 2Y5TA 4RAVA 4DZBA 1IBDA 3SKJH 4GP5B 4YPGB 4BK5C 2V2XA 3EZJB 2EDYA 3MA7A 1A4AA 3MX0B 2XZAL 5H8DA 3TV8A 3CPUA 1T7YA 4G43A 1NBQA 5BO0D 3O9WC 5IY5B 1DVUA 4ELMB 4ODSL 3U36B 4NRZA 5DUPL 3O3BB 3PGFH 5DLMH 4AZ8A 2ICWB 5JQIB 4ZAKB 1WCBA 1YMMB 4KXZI 5H4YA 4YHLH 5EU4A 4NQSB 2XQBH 2NR6D 3BPOB 5D9SB 3IWUA 1IFGA 1PY9A 1Q1JL 2JCCA 1E5BA 3ERXA 2APXA 4N6RA 2F1BA 4C4UA 4PV9A 1V3LA 3RIFF 4N5UA 2EYSB 2VZ3A 1H15B 4MXWL 1JVOA 1QLEB 5JA8B 2G75A 1UH4A 3STLB 4MBRA 1JV2A 4H8VA 4G8EB 5JUEH 4J3OD 2YO3A 1YEDB 3PGCB 2W60A 1LE5B 1V3MA 4P2OC 1LO4H 3FO1B 4D0DB 4HS3A 2V2WB 4GG6A 2X6CA 1JZEA 5A2IH 2HWZL 5J57B 1IL1B 2P80D 3IVKA 2FWSA 4CADA 4UV7H 1HHHA 1DDHA 5LN8A 2EVHA 1TTCA 1EBPA 1W9XA 3IGAB 2WZ6A 1OOAA 3L48A 2YEZA 3LKSB 5E99H 4HKZB 2JJTA 3MTXA 2MSPA 5CU5A 3S8FB 2DWEA 4BZ1A 4HKBA 1UH3A 5HGBB 4DPCX 4EN3C 2GYSA 3C6LB 5EUOB 5CSBA 3D2UA 4NKDA 2P8PB 1W72H 5C0NC 4R4BB 4DKAA 3RDTA 3QUYA 2X7LB 1DR9A 2WAHA 4XHQA 5HDQL 3RLSA 3AROA 4HX1B 3H0TB 3EOYG 5IFJB 3UTSE 4WNQB 5F7DA 5C0FA 4AEHH 3F3HA 1YJDC 35C8H 2F7IA 3ZO9A 4H1LB 3UJIL 3S4SA 3X1NA 4E5XB 2HFFB 4NO0A 3NGBB 4ETQA 3A5VA 4KO5A 3VFPA 5DMGD 3U4BL 4CDHA 4JFUA 4KTGA 4PMFA 1ZT1B 1I53A 3AS1A 1RZKC 1U3YA 3GSVA 4KITB 1I9JL 1TJIH 4BWUA 1QRND 4LHJB 1E2VA 3NRQA 1EO7A 1MCPL 1PNCA 3H9SE 5DJCA 1CGYA 5KVEH 4PJHF 5DD0L 5J9PB 2PP9A 1QWHA 5DU7A 4BXVA 3GI8L 2ZT9C 3L4TA 3P77A 4U09A 3L5WA 3L2LA 5FYJD 4KPHL 1G1OA 4PSJA 2J71A 2CM6A 2EJ1A 5FF6B 2AQ3A 4XCNB 4AGOA 5FM8A 4WI8A 3DARA 2ALAA 3VXTB 3TO4C 3ARBC 2J6EH 1P4BL 4IRSD 2ED8A 3UL9A 2NY0D 3FDWA 1RIUL 3LVTA 4YQXL 1S9WA 3VRIA 1HL5A 1K85A 1J9RA 3GMOB 2V5RA 3IFOB 3PHQB 4FFYA 4ZBJA 3G5WA 2FJHB 3ZYIA 2YAOA 4WIQA 4Y2DB 3KL5A 5TH2B 1YCSA 5DMIL 5F2FA 4F8NA 1XF3B 3P3TA 4UTAA 2F8VA 2NYZA 2IGFL 2PCPA 1UXSB 3GSUB 4YXKL 3EYOA 4XBGB 3WNLA 4OCYH 5E5UB 2K7PA 5AYTA 2O6RA 4TQPA 2JELH 2OL3A 1A6VL 4TRPL 5ABAA 2Z35B 4NOBA 1DBAL 1O7VA 2I27N 2YPLA 3CZNA 2ZUQB 4AM0A 5KVFH 2VRKA 4EF3A 3FQXB 3QIWD 5GGSY 2LAAA 4JM0A 2XWDA 2AXFA 3I50L 5GMFA 1P4LB 4RFEA 1IC1A 1D9KC 1XGYL 5LXGH 1EUTA 3FOLA 3KHOA 1QKZH 3CIYA 1JPTH 2WHVA 1ET8A 4KQ3H 2CLVA 3W2DL 3ZR5A 2HX9A 4JN1L 2X2HA 4WCYL 3RWHB 2WJ5A 4HV8A 2Y5QA 3N04A 5EIVA 4KKAC 4CMMA 5EPMA 2OV0A 3FO9B 4GJTB 2R29H 4X8JB 5LCVL 4WI0A 3A79B 2ZIDA 1NFIB 3T3PB 4X9FA 4P23B 2ZJSH 2CHDA 3C5JB 4LQ1A 3QJVB 3WJLA 4HVBA 4UAOC 1X5GA 1I7TA 3IU3A 1AH1A 1MI5A 4UANA 1DLHB 3S2AA 3MLTB 1HSAA 4A67A 4MQTB 3TCLA 1NUFA 1TQBC 3W5NA 2Q8BH 3UBXA 1Y1DA 1QSFA 3QEQA 1SJEB 1AO7B 2ZAIA 2XFXB 1UURA 5FO2A 4JEGB 1J1OL 3QVAA 1E27A 5FA3B 5GRWA 3T3ME 2XACC 4XC1L 1A66A 1MCBA 3HC4H 4JFYB 1QNZH 2Q3AA 4LIQH 3KLQA 1KJ2A 5AWDA 3LV3A 4GIOA 1FBIL 2OMUA 3RB7A 3ZDZF 2MQGA 4F2MA 2AABH 2BVOA 4X7DC 2NY2D 1ZLVK 5I6PA 3MDJA 1Q94B 2Q9OA 3FO0H 3TA4D 4IKIA 4CKVX 2AQTA 3FH8A 5GZOD 3QW9A 2JJSC 2MEJB 1TJXA 4HT1H 1CQYA 1EEQA 5T1LD 3VI3A 5E94A 3QUXC 3PY9A 4AEIH 4GQQA 1J8HD 3K6SB 4FI8A 2I60H 4ZW3A 1JPGB 1GW6A 1SY6L 4NHCH 2WBJC 4DTGH 2WNKA 2Y4SA 1BG1A 1OD7A 1PY0A 3VXRA 5C07D 2BNRE 3V0WL 1KXQE 2A6JA 1QYGL 5I18H 2OTWA 3E6FA 1KCSL 4HF5L 4WWKA 4Z0XA 5IJKA 1P1ZB 1OZTG 4LLYA 3EJTA 3ATAA 4ZUUA 4JPVL 3KW7A 2YD3A 2O5XL 4AEFA 4Z7NB 1WFOA 1L5GA 2WANA 1AIFB 1BZEA 4S0SD 5HHPB 4FL4B 4XX5A 1CFQB 3JZYA 1SQ0B 3W39A 3NA4A 4PERA 1MLBA 1FZKB 3VD1A 2Y7QA 3FFCD 2P52A 1H3PH 2WCPA 2BOBB 4LLWB 4PBXA 3MBXH 1MAKA 3QG7L 3MCLL 4H8UA 1NCHA 4HMCA 4DUWA 5EO9B 3VFSA 2DF3A 1T6BX 2B08A 4MAZA 1JYNA 3NZ8A 1ZV2A 4KOBA 3T9WA 3F84A 1DLFH 1IKOP 3C09C 3C08H 4WI3A 3S35X 4IKKA 3WDIA 4RLDA 1SMAA 2K9FB 2Y2TA 4I0PA 1QFPA 4YXHL 3PPEA 2A7BA 3C8HA 2D03H 3HAEH 5JO5B 2J21A 1KBBA 1QFWL 2ZCKH 2NX5B 2O5ZH 3BQVA 5KOVC 2PWGA 4TVSa 1ZE3C 2R9HD 5E9DE 4FQQB 1AHKA 1WWWX 1IKNC 2PWDA 5AW9B 4HJIA 4ANUA 2YAPA 2F7PA 4MDIB 5IB2B 4LPTA 1TZHA 3ZO0A 5I1HL 3DLQR 2WXJA 4W9GC 4XMUA 5L0QB 1BJMA 5K9KA 4PV8A 2DJMA 4K2UH 2B14A 1RVFL 2Y23A 2VLRD 3IDIB 3BW9B 2NUTA 1MW2A 1Y1UA 2DS4A 3QUKA 3T0WA 5I76B 4EI5A 5JPMB 4PJAB 2WQAA 1SUHA 2HVJA 3HIZA 4QXUH 1F2QA 4Y5YA 4N87A 3WL9A 1KIUA 3AACA 1T5XA 3HMWH 1XSIA 4LCYB 1Q72H 1F13A 1T5WB 2CR0A 2JB6B 2NCMA 2NT1A 1MJUL 5ANMB 1FJ1A 3MN8A 3I9AA 3BPNB 4UT6L 2EUVA 3KLSA 3QFDB 5B0NA 3OLGA 1PY4A 2ATPB 3QI9C 2HB0A 4N2NA 3WPGA 1KGXA 2C9XA 5AQ0A 4JM2A 5TFSH 1G87A 2F7QA 3SPCA 1NMCB 1CFVH 2QDVA 1U8MB 2GW5A 4U7LA 1VB9A 5IHLB 1JL8A 5CHNB 5D1ZC 5CEZH 1I3RA 3NIGE 3PREA 2QQNH 3W9EB 3WN5A 1KT2B 4NC1E 1XF2B 3RW7A 1AZUA 2MHAA 5HJBA 3LXBA 3WEBA 4KROC 4G1MB 5IBTH 2OZ4A 4Z64C 4Z7QB 3JWNE 4PJ5D 3UFIA 2QQQA 1YN6B 4NPJA 2CJUH 3HLAA 3CVBA 3VXPA 4OU3A 4AQEB 3CU7A 4GIAA 1JK9A 1NZRA 1BXUA 3UJJL 3V4VL 2R2HB 4M7LL 4CW1A 4JE0A 3QWNA 5K9JL 1ESOA 5D7IA 3QUMB 3OSKA 2C9AA 1UM4H 4HHAB 3UG3A 3OKOB 3BZDA 2W9EH 3BZ4A 3IAGC 1IM9B 1RUKL 1HXYB 3MACL 1KBGL 1LMIA 4MNGA 2FECL 5FCUL 5BO1H 4IBUA 1TYEB 3QSKB 3RA7H 4LNVA 1E2ZA 2DDQH 3CK0H 1VENA 4FYQA 5B4MD 4B3VA 3B9AA 2AC0A 5KANG 3NFPB 3FT3A 4QMEA 4TOYH 1NCAH 1UZ6F 2VW4A 5CZXD 6TAAA 2VZUA 3L3IA 2J5WA 3RTQB 5DJ8B 3CFIC 4LSTH 2WXPA 4R2GD 1T3FB 3R1GL 1JZHA 1WFMA 3ME0A 4NQCA 5AVTB 3RGVC 4AXWA 3MNMA 1ET5A 4PJ6A 4F15C 3EDFA 4LSVH 2Y7OA 3O6LH 4N2KA 4OIBA 4XP4H 2IAMB 4YHNA 1OGAB 2TSAA 3T0XA 4P2YA 3VAEA 4LLQA 4UINH 1RIVL 4MYPA 3SCMC 1WT5A 3VWKA 4I3SH 4ZFZA 1FORL 1NDGA 1MFEH 3AU0A 1KCUH 5CINH 4XVUD 2QKIC 3IS0X 2RTTA 1OQXA 1PEZA 4WDIB 3TBYA 2VXSH 5ID0B 1ZJBA 2COVD 4IOFD 2GJ6B 5AW5B 3ABGA 3RIZA 4JFPB 1ACXA 4MA8H 5SV4A 4X6FA 5F21B 5KYXB 1R75A 3HZMA 2MPAH 4TUJB 5A7BA 1K8DB 1QLRA 4PW9A 3T6QC 5HSFA 2P45B 4D9QD 1FO0A 3AADB 4I3RH 5GS0D 3EJYD 5I5IA 1H8SA 1HCYA 4K23H 1BYPA 5L8KB 4BRVA 3CFJB 3VG9C 4CKQA 3QRFM 1WGOA 4PJFA 2OSLB 3VFWA 3GSRB 1CU4L 3TVMD 3MJ7B 5EEVA 4G6MH 4UNIA 3L7EB 3QXAB 2MKLC 5DZPA 1D6EB 3JWNC 3SDAC 2F15A 4JO4H 2A9NH 2Y0SA 3MLXH 1CWVA 2YN3A 1ZTXL 1MIMH 3OGLB 3N41B 1RPQA 4X7SL 4Y9GA 3U2SA 1U91A 2Q86A 4DKFH 1C12B 2HVBA 2FJFA 3OXSB 4XXWC 5ICZA 1MCRA 3GZKA 3RPIB 1T20B 1AS8A 3KJ4C 3QIBB 3FQWB 1YYCA 5GQBA 4JG1H 1ILSA 1P7QB 3MQIA 3VH8B 2E8ZA 3Q1SH 3MJ9L 3NCWA 4QF1B 1GVIA 3R4DA 2AJ3A 4J12A 5A16B 1NOLA 3GSOA 3BSZL 5JTWA 1MPAL 3EHBC 5KYUB 4Q6YA 5IKCB 1O75A 1I7ZB 2WGXA 1HWWA 5CLWA 2QVFB 4Q9RL 4PJIF 4U1KA 4I77H 3RJQB 1SXBA 4QRRE 3UYOD 4GPVA 2IADA 2PO6B 4Z7UA 3X1GA 4AK1A 3QDMB 4CU6A 6FABH 3CHSA 1JGLH 4TTDC 4UQEA 4P07A 1PG7L 5T1KD 4Z7WE 4CNCA 2IBGA 1WIPA 4DKEL 5I0ZA 1OAKH 2LFEA 4YNYA 5AZ2H 4XE5B 1KPUB 4KUZH 5FW7A 3UTTB 4HWEH 4PWHA 2XKNA 3B8YA 3EDKA 1FVDB 3CHQA 3HLKA 3DMMD 4FC3E 4PWGA 3W0WB 5CF3A 2RD0A 4JHWL 3A6CH 3QXDA 5EFIB 4BFGA 5L2KA 1T0PB 1Q8MA 3QXVA 4P05A 1FL5A 4BD4A 2BW5A 3QDJD 1DJXA 1KOHA 4Q4EA 4NBYB 3WPFA 4XP1H 2VLJD 1WF5A 3P11H 3U48A 1L3WA 1XBRA 1IB5A 4WHYH 2GCYA 4Z0BL 3OXRA 1PKOA 4UBDC 3SIKA 1PVHA 2Y36L 5LG1A 4JFSA 1I8KB 3O9WB 4P06A 1RULH 5GRVL 4KZEH 4XI5D 3RNKA 1AY1L 5E2WL 1B2YA 4S11A 1QA9B 2EADA 2MMXA 43C9B 1CGSL 2IBBA 3QORD 2W5PA 4JDTH 5I19L 3P4MB 2XXFA 5MENB 4OZGE 2XPGA 2HYMA 4JFOB 5DD6B 2VXUH 2X0WA 4P46A 1JZ3A 5K59E 4ZX4A 3ZBMA 1G7IB 2WM0A 4M8VA 4UIKL 3S35H 4G6AD 2OCJA 2PP8A 1CE6B 1AOZA 1XR9B 5A6IA 1IVTA 2RIKA 3ABKB 1UKQA 3KWTA 1TTRA 3BHBA 1HAUA 4LCIL 4CVXA 2LR4A 1MHEB 4MJ6B 3LB6D 3BYTA 4XP5H 5IW1B 1V7NH 2C26A 5I1DB 2RA8A 2GJZB 4OJAA 4P2OB 3V95A 5E0QA 1E9PA 4J3SA 4LP5A 3FB7B 3ARRA 2RA1A 2AJXH 3QZBA 5LGKA 2WNGA 5HZLB 4HFWB 1UWEH 1NQBA 2P7TB 1B2WL 2AMUA 3GRWL 1J8KA 4ZNEE 4J27A 4XTRD 3W37A 1ZTXE 4NWUL 2Q0ZX 4R84A 1C1EH 5SWSD 2ZXWB 3GQFA 1BSIA 1H8NA 2XQYK 3D69B 3E8VA 4AW7A 2IIJA 4GO6B 4EN3B 1QYYA 1RPKA 3WDJA 4RCAB 1PSKL 2Y06L 2WLLB 3L3KA 4X2UA 4UOJA 1JV5B 5F3HA 3LH2H 1YC7A 5ITBL 4TSBH 1YPZE 3HG1A 3TIDA 2N7AA 1MWAH 4FTDA 2XUWA 5E5MB 1N68A 4KJQC 2EDXA 4BYHA 1MCWM 1MCQA 1EA9C 2VO5A 4GKOA 4UI2A 1AKJB 3W9DA 1NM4A 4NHUB 5I1AA 2X4PA 3I75A 4P4KC 1DBKL 4XO3A 3FSOA 4U31A 4YWGL 4DN4L 2VMFA 4KRNA 1SGKA 4PRHA 5HJ3A 4F7EA 4D9LH 2DQGL 1D7DA 3MV11 3TASA 5CMNA 4G6JH 1F6FB 1ZHKB 2IXQA 3UTOA 2G2PA 2XSKA 5EUKA 3UPRA 3TFKC 1JZ6A 4PJBA 2CGRH 3VGBA 3CHXA 4H25A 3N55A 3DXAA 2B1HL 2D4DA 4M48H 5DD5H 4AKPA 4CC4A 3BKYH 4U08A 1ANUA 1N5YH 4MYWB 3OAYK 4ZZFA 3PUCA 2VDOB 1CE1L 3CSGA 2KH2B 4FS0A 1T1XA 4JZOB 5CJOL 2R56L 3GO1L 5SWQA 2EIJB 1KN2L 3WLBA 3DUSB 2XTJD 1G7HB 5LBSH 1E4WH 4EUPH 3DVFA 5GXBB 2JMRA 1LM8V 3LEYH 5B0TA 2IDUA 2P5ED 3ARBB 3NSXA 2NRDA 5CR8A 3TO4B 4BSJA 2VL5A 3MFFA 4JUTA 5CJXC 4AMKL 2EUWA 1NMAL 2XN9E 4P5TA 2FH8A 2ZZUT 3MBED 1WC7A 1M10B 1S7UB 3VFVA 5D7EA 4EBQL 1HTYA 4OTXL 3UYRH 1X3DA 4YZWA 4GMTH 2XWBB 1TFPA 3OZ9L 2R2BA 2Q6WA 3DVGA 4UAHA 3UZEC 3O3AB 4YZFE 4HHWA 1EXGA 1DFJI 3ULSB 3BWZA 4P9MH 3X3FL 2BXYA 1UT9A 4HU2A 2HN7B 5BZWA 1EUUA 2ITEA 1XD0A 4FLSA 1ETZA 3Q6FA 2CRZA 4Y19D 2ZOLA 3BD3A 3CVIH 1JWMB 3GSXA 3TBVB 4AX3A 3TYFB 3REWB 2AI0H 4A6YB 3BKCL 5TPWL 4X6EB 3NTCH 2BS9A 1EJOL 2XICA 3QJUB 3UTSB 5EEYA 3IETB 3AVEA 5DJAA 4HULB 1D9KB 2XWZA 5IM7B 5D72L 1FLTX 4A7TA 1KXHA 2WN2A 5IW3A 5BV7H 3JWNG 3G5VB 4FG6D 4NQEE 1UFGA 2D3VA 4TMPA 4L3FA 3FCUB 3NSJA 4G8GE 5IEHA 1XH0A 4YSTA 3WUWA 4H7VA 4PJ7F 1S5HB 2WSPA 1B4RA 1N0XL 3VQ2C 1JPFB 1MJ7L 5DDHA 2GHZA 3KYNA 2R2CA 2UYLA 3H9SB 5GRZA 3VNYA 5JOPD 4UAOB 3L08A 1RJCA 5E00B 5BJTA 4Y5VC 5DHDA 3NIFF 2EIMB 3IFPA 1TQBB 1E42A 1A7BA 2XN1A 3P2DA 3WEAA 5IQ9B 3IXAB 3VW3L 3UO1H 4FFVD 1NGZB 4W9ZA 3TCXA 2Z31A 4R07A 2GHWB 2ZOTA 1JRHH 4KKQA 4LCUB 3GNML 3FMGH 4BCXA 2UV3A 2OA9A 4Y1AD 1ORSB 1BVNT 1WITA 3PABA 5SX4I 1PNDA 3VQLA 1KOOA 1DEEB 3DGGB 4YPGA 4OFPA 5GZND 1G9HA 1BBJB 3MX0A 4GO9A 3ZE2F 4GXVL 2YD1A 1HCFX 2X53A 4NO3B 3OZLA 2XWJB 3QUXB 3ZXAC 5KYWB 4ELMA 3U36A 4DZ8B 3LMJL 4NNXB 3O3BA 4PG2A 2ICWA 4ZAKA 3EOBB 4L8SC 1YMMA 3BOVA 3H9ZA 1HEJC 4XE0A 3P3RA 1OV8A 2WBJB 4NQSA 5D9SA 3RY4A 3M7FB 4AYDC 2J1XA 2D2OA 4GEIA 1QUPA 3GEWB 1CD9B 1Y0LB 4ZMOA 5DJ6B 4R96B 4RFOH 1AE6L 1DBJH 4NS0A 3OB8A 4IKJA 2AJVL 2IQ9H 2EYSA 2P1MB 2F9BT 4GBXC 4F93B 2NCEA 3FUNA 3STLA 2KQMA 4PP1C 4PGZA 1SN2A 5JORB 1BIHA 5B1KA 4G8EA 2YJQA 1VZIA 2P8LB 4LMQI 2FGWL 1YEDA 3PGCA 1LE5A 4M29A 4AH2B 4X0KB 3FO1A 3CZUB 4TPRH 4D0DA 3C75A 1M57B 2E47A 4JY5H 2BSRB 4NM8H 1QQDB 1TO5A 1IL1A 4ZMXA 3KYMB 4Y16D 2MCG1 3IGAA 4DERA 4XB3A 4Z1PA 3LKSA 3C09B 4HKZA 1E8WA 4CU8A 2AF2A 1NAMH 1YYML 2FE0A 4F8LA 5HGBA 2WUBL 1N6QH 3AB0C 2WLYA 4M6OL 4U49A 3SGDH 3C6LA 5EUOA 3AFLA 3T6WA 1NIFA 4R4BA 2NY0C 5B22A 2X7LA 2EC8A 2UXFA 3T3MB 4FQCL 5IROC 2H2PD 5EC1B 1M71B 4HX1A 3H0TA 5IFJA 1WE5A 1ZHBA 4WNQA 4PY8I 3TEWA 5I1LB 3OQ3B 3GTTA 2DLEA 1PFOA 4E5XA 4H1LA 5D1QD 4PR5B 2HFFA 4JDVB 2WWKT 4MSWB 4N0CC 4JFEE 3HS8A 5IJDA 2RR3A 2RAMA 3TYGL 2FHCA 4I8DA 4MKTA 2Y5EA 1X5LA 1ZT1A 3D07A 5BS0E 1XTLA 4ONGH 4QBZA 1C08A 1SFDA 1L9RA 2FJSA 5AB2A 5JIKA 4WJ5A 4UILL 1V55B 1T89A 4S1RH 3RKDC 2BNRB 1ZHLA 3QZWG 4MCYB 5J9PA 5E2TH 3BP6B 3QI9B 1J18A 2Z92B 3CVHH 1SVCP 5FYLD 5E51A 1UC6A 5FF6A 3FU9A 4R4ND 4XCNA 3WFHA 4F7CB 1K6QL 5D1ZB 3S2CA 4BHUI 2Y2WA 5IHUH 1RZPA 4ATWA 3GXTA 3WN4A 3VXTA 3M07A 3FU6A 4MLIA 4N2DA 4WW2C 3WV0A 1NWPA 3ARGC 4FXLA 5DWPA 2E4FA 4H2CA 1M7XA 4IRJC 4KROB 1OAQL 2A77H 3GMOA 5E4EC 3PHQA 1S5IH 2FJHA 5BMFH 1F4YH 4ZMYA 4Y2DA 4HS6B 2VR9A 4WO4C 1XF3A 2WVTA 2Q7NA 1OARH 6PAZA 3BT0A 2Y07H 3EO9L 1KEML 1UXSA 2VJ0A 3GSUA 3PU7A 1WZMA 3UYPA 4XBGA 4ILDA 4PD4K 4EZKA 3IDGB 1BLIA 1IGMH 4JHZA 4OLZL 1A3LH 3S8WA 2Z35A 3R8BB 2JKLA 3F2LA 1CLZL 2X4UB 5E9DB 2CDFB 4HKXB 4S1SH 4ZMQA 3BPCB 3QEGH 2VLRE 3FQXA 4OJFH 1KPVB 3HVNA 5I16B 2R0WL 1MCEA 1FRGL 1EO8L 1UD8A 5GZOC 1P4LA 4V1DA 4H0HB 4PJEE 3P3SA 2WXHA 2NSXA 2I5YH 2J12B 3BVNA 2VKWA 2DLIA 2FEEI 2WXOA 3BE1L 3ET9F 2X4QB 4DPRA 4F15B 2C4FU 3RGVB 2G4GA 4GAAA 4GMSH 4MJJA 5F1NB 3RWHA 4ZTOL 2ASTB 4NDMB 2JIXB 2NNRA 4XPAH 3RFSA 4X8JA 2YAHA 4JGMA 2BY2A 1NFIA 4IRZA 5HI5D 2BVUA 4YXLL 4P23A 4G8FB 3TIEB 4MMYA 2G3XA 4TULH 2X0VA 2QKIB 1BP3B 3D18B 4PJXF 1DLHA 3MLTA 1KGUA 4FN0A 2VOTA 4JDZB 3GD1C 4RDBA 5F9WC 2ZD0A 2ZWZA 4OLVL 4JCMA 1X7SA 1OLLA 1SBSL 1SJEA 1AO7A 2Y1VA 2XFXA 3IMSA 3GK8H 4KY1H 4W81A 5FA3A 3RU8L 1XF5B 3HC0B 4M7EA 4JFYA 1U93B 3LRSB 3WEMA 1DL7H 4GKNB 3NIGB 1DP0A 4O2EB 4GRWE 3OG4B 4HC1H 3LD8C 3VG9B 3V0DA 1AAJA 1SPDA 1E6OL 1CBJA 2X1QA 5EF3A 1Q94A 3D33A 1R9FA 2J57A 2BNUB 4X8XA 3TJEL 3SDAB 4X99B 2HTLD 4FKHA 4EI6B 4ISVB 5IIEB 3K6SA 4FI6A 3SQRA 2YN5A 5IFAL 4NZTH 4QRFA 5CCGE 3FFOA 1JPGA 4X50A 1A47A 4RETB 3KVDD 3K8KA 2WQRA 3O8XD 2FJGB 2K70A 2APWA 4N85A 4MQXD 4R90L 1ZDSA 2EC9U 2FVNA 4OD1H 5FO8B 1JZIA 1P1ZA 2YD0A 4OZHA 4EEEA 5EDSA 3KJ4B 3L6FB 1GIGL 1NCWL 4PAZA 2BSTB 4XC3L 2WYIA 4IBSA 2YUXA 2YA0A 4HLZG 4AT6B 1GKOA 4HUVB 1EEUA 1AIFA 5HHPA 5G2NA 1CFQA 4WWID 5F7LB 1FZKA 3EHBB 3MFGB 1WZKA 2BOBA 2F08A 5EH1A 3G04C 1BZ7B 1WAAE 4LRNL 3VM7A 2J2ZB 2CJ3A 3JYBA 4O9HH 1ZLUK 5EO9A 1AOHA 2J8UF 4KZ0A 4OM0L 4DP8X 4YSCA 3JV0A 2IPUK 1AQKH 4H8WH 1HFUA 3ALXA 2ENPA 1HH9A 3R0MA 3ZQ9A 5DHMC 1XCWA 2VQTA 4OGYL 4TUOB 2ZUWA 4QD2E 2W80C 3BPLC 5JO5A 4RA0C 5M95B 4MQWX 3QO1A 4QXTB 2NX5A 1NSNL 4ZTPL 1U3JA 3H9HB 5AKTA 4FQQA 2EDDA 4JG0H 2JI2A 4PGDB 4MDIA 4L05A 1SDAB 3JWDL 3SOTA 2A9BA 1D7FA 3LS4L 1BFTA 1U8PB 1LO2H 3KPSE 4TM9A 4FKEA 4A7UA 3B3IB 1FNLA 4Z77B 1GXEA 1A2YB 1ZVSB 3ULAB 4IBVA 3IDIA 4LEXL 3BW9A 5I76A 1M7DB 4KK6C 3D51A 2PR4H 2PTUA 1A3RH 5FKAB 2VN7A 3P0YL 5JPMA 4PJAA 1BZQK 4YBQC 3RPKA 4N4YB 2CBQA 1MG2C 2IPTL 2GJPA 4OVUA 3MRLB 1MWOA 3L1GA 1EIBA 4F9PA 1YEEL 1E5CA 2WB1A 3QR0A 4LCYA 2JB6A 1T5WA 4LESA 2AJUH 4KMTL 3GYRA 3NK3A 4QTIL 2IMMA 5ANMA 3VD9A 4QI3A 2YRLA 3QFDA 4MA7L 4YH6A 4ZO9A 2ATPA 3FQNB 5GSRB 1CXIA 1TZGH 4QRPD 1GTFA 1CLYH 2QR0B 2K0RA 1C7SA 5I1GL 3QA3B 2VXVL 3TU6A 5HHXH 1U8MA 2H3NB 1FG9C 4ZMLA 3CFQA 5CHNA 3VGGA 3A23A 1KGJA 1FFTB 1ZKAA 5D1XD 1JNLL 3W9EA 3QJSB 1KT2A 2WV3A 1XF2A 3FQTB 3Q13A 2PXYD 4JNXA 3EJPA 5A2FA 4BFIB 1DBML 4YX2L 1YN6A 1JJUA 4QRRB 2MQ3A 4IOFC 1UCTA 2Z7UA 2CUMA 1E7UA 2R2HA 3V4VB 5KVGH 1RFDL 1HDMB 4L29B 3SOBH 4Z7WB 3VDAA 4OQTA 3QUMA 2Z62A 4LSSL 4V2EA 4IKLA 1JPSH 3MJ8B 3HE6D 4HHAA 3ISRA 2CO6B 3DDGA 3V4LA 2YD2A 5BZDB 2C34A 3QZWB 3FN0H 4IGBC 4R5XA 1IM9A 1Q0YL 3NIDF 1P8VA 1HXYA 2BW4A 4J7RA 2Q7YB 5E9AA 5KW9L 4R6UA 5ENWB 1FIEA 1P84K 2VDKH 4XNYL 5E6ZA 4U6XB 4NJ9L 3DV6B 3IFNL 3FCGA 5EZLB 4Z3TA 5KVMC 3FTGB 2Z8RA 3RWDB 4LSQH 1PGVA 3NFPA 3F7YB 4WWPA 5DQDL 1RSYA 3NJLA 1F18A 2DZEA 3F7RA 3RTQA 5G4NA 1T3FA 1KYOK 5GJSL 3OMAB 3DA0A 4CJ1A 5K39B 2VDQH 4OCMC 2PN5A 4P4KB 2WBWB 3ULUD 4WQOA 1PLAA 2IAMA 5K33A 1F4XH 1I1FB 1U9KA 1OGAA 3GBDA 4X80L 3NFSH 1OIOA 1C5CH 1I1YB 2X2UA 5DHVH 4RESB 1VFBA 2H3XC 4OZGB 2LHAA 4WDIA 5ID0A 1E9QB 2BO0A 1OE2A 1RZJH 3AXHA 2GJ6A 1A25A 1F58H 3IYLW 3LSOB 5CS7A 5GISL 2G3ZA 3ECQA 2NY3D 4JFPA 1X5IA 5KYXA 3EOTH 4TUJA 4Y9BA 1K8DA 2WNXA 1JZ7A 4XN8A 3SE4C 1EGJA 3OG6B 1DQML 4YJZL 1J0YA 3B34A 1I3VA 3CFJA 5C0JB 4GP4B 2OSLA 2HTKC 5F7EL 3GSRA 3D2UD 4N5EC 4XOCA 1SXNA 3DX3A 3MJ7A 1IE5A 1ZIWA 3L7EA 3RDTD 3QUYD 3QXAA 3SB4A 1QMUA 1JHKH 1D6EA 4GI9A 4R8WH 3MLSH 1H6UA 3HKZA 1OT4A 4N90D 3WS6A 4ODVL 5IHZB 1U36A 2KQNA 1CD1A 2L0DA 2EVFA 5I15L 3DMMC 4KVCH 1NCDH 4NO0D 4HOZA 4M5YL 3OXSA 3NCJL 3VXUD 3FCBA 2HX8A 3MLRL 3G9VA 4OZFG 4EZGA 3CHRA 3RPIA 5BRPA 3QIBA 3E9UA 3FQWA 4M7JL 4IIZA 2JKNA 1YPZB 3EYSL 2Y22A 2DWYA 3VH8A 3OWEA 1KIPB 2C9RA 4QF1A 3SD2A 1OT2A 3CMOH 3O45B 2PCXA 1V7MH 3NABL 2A9AA 3SPVA 4XI5C 7TAAA 5KYUA 5IKCA 1KXVA 1I7ZA 1UH2A 4GUOA 5HHNB 3WDHA 1ORQB 1OP5K 3HBZA 5B38G 2HG0A 1H3WM 4AYSA 4KTDH 5IREA 4JFVA 5H35B 3IK2A 2PO6A 4L3EE 1FFQA 3QDMA 1IC5H 1IBZA 4G5ZH 1OAJA 3E38A 3D0VB 2BSBA 1QTSA 1X9RA 1KCRH 1RAMA 2YPVL 4NM4L 5JR1H 1FLRL 5IB5B 5I6OA 4Y5VB 1KPUA 3LB6C 4CP6A 3BUTA 4YEEA 1IC0A 1FVDA 4GUPB 3W0WA 2ADFL 1OAUH 1TZIB 5EFIA 1KYDA 1IGYB 5KSBF 4Z8GA 2F74B 2HCZX 2P46B 4NGHL 3JWDC 4IBZA 5J3HD 4LGSB 2AQ2A 4GSDH 3EH5B 5KANI 3WBDA 3MRQB 4FQIL 5EC2B 3LKQB 3CVCA 1OXYA 4BK5A 2XN9B 3W1ZA 3TCTA 2AGJL 3CLWA 4PCYA 1OCWH 1WD9A 1I8KA 4KJPC 3EYVB 3O9WA 4ZFGH 1CURA 3FTXA 4F20A 3UL7A 1NCJA 1J5CA 3REVB 2B4CH 5FDWB 1QA9A 43C9A 1KJVB 4L8SB 3P4MA 4XOEA 4URKA 5MENA 3B2UD 4JFOA 4NYLB 5DD6A 4OV6F 3GB7B 1AMXA 1AQDB 1G7IA 1BJ1H 3IMTA 2Z7WA 1CE6A 3EFOA 3RL2B 2BP0B 1XR9A 2FIKB 3BD5A 2R7EB 4PIBA 1YYLL 3Q48A 4GBXB 1AZVA 5L7XL 1LEGB 3HHSB 3TH4T 3V2AR 5CFAA 3VQ1C 4MJ6A 5I1JH 2I24N 3PXHA 5TDOB 1QATA 5IW1A 3ZTJH 1MH5B 1EDHA 1NPUA 5I1DA 4U1LA 3QEQD 2GJZA 4XWOD 2QHRH 1HE7A 1G9NH 5BUPA 1RERA 4NQEB 3WMQA 4DGVH 1R0AL 4JE4B 3SBPA 4NIKB 3FB7A 2XG5B 3HUJF 5EOTB 4G8GB 3GBEA 4HFWA 3LZQA 1P4IL 3U4KA 2P7TA 3MLWL 4LL1A 2R59A 3Q0HA 4L3AA 3APFA 4HAFA 2PW2B 3KGUA 4KXBA 5FYLL 1AHWC 2DWSA 1FUNA 2J8UE 2MPVA 3KBEA 2Z93B 4YUEH 5DQJB 3CDCA 4FAAB 5D8JL 4NQDE 5IQMA 3D69A 4EN3A 4M5ZL 4LLAA 2EYTB 2X2IA 4AZUA 1TF4A 3WXWH 1J0ZA 4RCAA 3IBOA 4RAUB 4DK6A 4X4YB 2VERA 3TBTB 2WLLA 4Q14A 4M8UA 2EIKB 1JV5A 4QNPF 2FK9A 5DJXB 1UWGH 2J88L 3WGUB 5E5MA 2R27A 3P0VH 2MTPA 2XV2A 2CUAA 3G6JF 1AKJA 1H6EA 4RWTC 3EYUL 4XMXA 4DGWC 1AJ7H 4NHUA 3QPQD 4UM9B 1WJ3A 4Q6KA 3WG7B 1ADQL 2O5YH 1HN1A 4YE0A 2D7PA 3LH8A 3T6VA 3KHQA 3WIHA 1MRDL 4GAYB 3BVUA 2F7RA 1UWYA 4OCRL 3UTPE 1ZHKA 2DM2A 2YMOA 3M8OL 2BHZA 3SPIA 3IMRA 1MCHA 4NC2B 1BM3H 1HYRC 1IQWH 3A24A 4W93A 4N3UA 4TKWA 4W4OC 3RVTD 2HZHA 1EMTH 4KK8C 1ITBB 2WLNA 4FI7A 2X3CA 3KH3A 4M56A 4JZOA 2LLLA 1BEYH 2BVQB 5ALBH 2JKRM 3FT4B 2LAGB 3DUSA 1CXKA 3V5DA 1G7HA 1ZAGA 4LL9A 5D7LE 4I0PD 1Q0XH 4J28A 5HHQB 3X1EA 5AZUA 3I3EA 1CF8H 3TO4A 3CVRA 4XX1E 4BIKA 4WW2B 3RHWK 3ARGB 4KV5F 3WFCL 3X1FA 4IRJB 4A63A 3PV6B 4ERSH 1S7UA 4MJIE 3MO1B 2JI1A 2XPZA 4ACTA 1BMGA 2O1AA 5DJ0B 3WPIA 5AB1A 4L1BA 2XWBA 1RUMH 3QHTC 4WO4B 4CMHC 2RACA 3O3AA 4FFVC 3SN6N 2DM7A 1BEXA 2HPTA 3ULSA 3RTLA 2HN7A 4UOW0 4EI5D 1Z9PA 3H55A 3MODH 1EAOA 3A6OA 1UYWH 4M43L 2XCMC 3E2HC 1VHPA 4F2FA 4Y0GA 1LXMA 3N1GC 3TN0B 3M7OA 4WWNA 4D7PA 1JWMA 3TBVA 3BIAX 3UBGA 3TYFA 3REWA 4A6YA 4NP4L 4X6EA 2ALWA 4HUKB 2PNDA 5D70H 3SO5A 3UTSA 3IETA 5DWUH 1D9KA 5IM7A 1GYAA 3A67L 3LRGA 5CZVL 4Z3JA 1TYJA 4JM2D 4GKLA 1KXTB 3MNVB 4UZGA 3G3AA 4X5XB 4JFEB 3AQYA 4R26H 4HIXH 2DQFB 1ODAA 4XPTL 3FN3A 5BS0B 3NA9H 3BJ91 4HZLB 1L7TL 1S5HA 3ZTNH 3OKEB 1YNTB 4MXVF 3X14A 1U6AH 1JPFA 2ID5A 5FYLE 3H9SA 2K6ZA 5E8EB 2PR9A 4XNMB 2BPBA 2HRLA 1CXFA 5E00A 4S0TD 2XOTA 4B60A 4U3CA 3MRPB 5IQ9A 4JY6B 4N8UA 3S36X 1H8OA 5F9WB 4LE8A 3IXAA 2CCLA 3SYAA 2X12A 5DRNB 1NGZA 4JR9L 4OZFB 1BDYA 4NFCA 3RAJH 3KVQA 1TQWA 4LCUA 1GPOH 5D1ZI 1BQHG 4EOWL 4XP6L 1ORSA 3AY2A 1OP3H 2P1PB 3LD8B 4QHMB 3T8XB 1DEEA 3DGGA 3KYKH 4OF5A 1BBJA 2MNUA 3ZLQC 3MI6A 1INEL 2JJSA 2KL6A 1MCOL 2AHIA 5HYQB 4O2FB 4NO3A 4HIQA 3T2NL 2XWJA 3QUXA 5KYWA 1F1AA 4MJ2A 2LGNA 4DZ8A 4C47A 4NNXA 5LWYH 1IC4L 3QIUC 4NQCD 3ZZSA 3EOBA 1A5FL 1D5IH 4HWBH 2WBJA 4MCZB 4M1DL 5TQ0L 5DHXB 1AACA 1Y0LA 4DNLA 4R96A 4X42A 4LFHD 1IFHL 3P1VA 2KDGA 1KSRA 3VI4F 2ZUVA 1DQTA 1E6JH 1THCA 3CSBA 4NZTM 2C9PA 2VLRB 2OPCA 1JFQL 2JK5A 2EEBA 3C8KB 2FD6H 3THMH 4HUCA 3SJVE 3VGAC 1WCQA 5JORA 1BAFL 1G43A 4PJEB 3K6IA 2P8LA 3H8NA 1PAMA 2B7DT 3F83A 4TYUA 1YEFL 4AH2A 4X0KA 3RUGE 3I02B 1OPOA 4UT9H 3FBQA 3LPPA 2AEPL 3G04B 5I1CH 4J3OF 2BSRA 1QQDA 4PTUB 1NANI 3KYMA 1ICTA 4ZFFB 2E75C 3K6DA 3LXAA 1UOKA 4G7VH 4FMFA 4A2GA 1ZGLM 4W9IC 4Z18A 2DTML 2GKIA 2OMVB 5JHMA 3FULA 3HA0A 4R5CA 2D9CA 3H3PL 3II2A 3NPZB 3QQDB 1KDIA 2R1XB 3MOAH 3BPLB 4WTWA 4OB5H 1OB1B 4BE5A 1UD4A 2BVEA 3TL5A 3VXNB 1W80A 1FCCA 1L4IA 4OY9A 1R3IL 3GHBL 4GLRI 1LK3L 1IC7H 3ETBF 1IKNA 4Q56A 3K6NA 7FABH 5EC1A 3SE9L 4ODTL 5C7ZA 5JMRA 1M71A 1AANA 3ARTA 1TLKA 3GEFA 3DDFA 2CBOA 4GRWB 4AYID 2V5SA 5EOCH 1ODUA 2XBDA 4JDVA 2BIPA 3QCVH 4MSWA 4NUGL 5ID1B 2D31B 1PU0A 1OE1A 3N91A 4L2YA 2NY1D 3N40P 1J0JA 5C0IB 3WU1A 2Y3NA 2VAAB 2A73B 2BC4B 1UM5H 4JPIB 3IJ7A 3B2VL 4E9LA 4KY2A 1QX1A 3CSPA 4FZEH 1KYAA 2H3KA 3IJEB 3F64A 2CUHA 1MVFA 3K5SA 3KBFA 2BNRA 1KXQA 4PB9H 1RMFL 1EZSA 4MCYA 5T3ZH 3BP6A 3QI9A 4E9QA 2Z92A 3F6JA 4CC0A 3HR6A 4OGQC 2J56A 3SKMB 2ZOKB 3B9KC 4UYPA 1DVXA 5EBWB 1ZS2A 2VC2H