3BZFA

The human non-classical major histocompatibility complex molecule hla-e
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title Subtle changes in peptide conformation profoundly affect recognition of the non-classical MHC class I molecule HLA-E by the CD94-NKG2 natural killer cell receptors
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 276
sequence length 276
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bzfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bzfA01
3CH1B 4DTGH 2KQNA 1ED3A 1DR9A 3QFJD 5E6IC 4I4WB 3KPSE 3QIBB 4NO0B 2H6PA 3DV4A 4KTEH 4FQJH 1D7FA 3PGDB 1X44A 4LDEB 5LAXA 4WHYH 5C0FA 4PRDA 1J0IA 5EULV 1BD2B 3ARTA 3RPKA 4P2RA 1ZANH 2MHAA 35C8L 3T77A 3U7YH 1RUQL 4Z7VB 4IRSA 4WHTB 3RIAK 4EQ3A 2QR0B 1WEJH 1MRCH 1UM4L 1KCUH 5D7KE 1CXFA 2ED8A 1T4KB 1DBKH 4L3EA 1DL7L 1IC4L 1V7NH 2IGFH 3I50L 3E6HB 2ZUYA 4OCWH 4PYHA 4JDVB 4GW1A 2ZJSH 4BKLA 2P5EB 5SWZD 2VL4A 3BKCH 1C5CL 4UIKH 3O8XC 2V7NA 1LK3L 2XI9A 3CGTA 4XZUA 1WCBB 5HGHB 4BH7B 2NX5D 4IRZL 4LVOB 3FONB 3IGAA 2VE6A 4K3HA 4KDTA 1U8NB 2ZUUA 2DWDA 2OK0L 3SY0A 4WI2A 2V9QA 4Y19A 5IMLB 1OHQA 5CZVL 5ADOL 3CCHA 3FZUD 3IFNL 5F3HB 1UCBL 1JK8A 4QXGH 1BLNB 4ZUSB 1T2JA 1HQRB 1CGWA 3BZDA 2XWTA 1YDPB 2E9BA 2HT2D 1KIQB 3KPLA 2VDLH 5K9OB 4TUJA 1JV5A 5DMKA 4CN4A 5EB9A 5HY9B 1ZT4B 3DRQB 3SE8L 2XTJB 2B2XH 1MAMH 4K7PH 5DJXB 2R2BA 1HZHL 4AQ1B 1OP5K 3RTQC 2QHLA 2VDOH 4LCCB 1RZGA 3DX6A 5BV7B 4HF5L 1QQDB 4NRXA 5GGUA 4QRQB 1IZKA 3BZFB 3UTTA 3WN5A 2HLFC 3VFVB 2LU7A 3I85A 4NHUE 3GSNA 2GTZB 4JREC 4KROB 4ZFOA 2YUVA 3M8OH 4NKDB 5EG6C 3TJHA 1LO3L 2DQEL 3PNWB 4I3SL 4PJ8C 4ZTOL 5EU7C 3MRJB 3AREA 2QADB 4J8RB 1JYWA 4FTVE 2C4FU 3DV6B 3NIFE 4QKXB 1JGLH 3GSWA 1IGCL 4MJ5B 1I8KB 25C8H 1FG2A 2ZCHL 4HXAH 3GKZA 1SJEA 4H26A 1QNZH 1D5MB 3QIWB 1HK6A 3MOBL 5E2WH 2NY0D 3U1SH 1F4XH 1XF5A 3MUJA 4KVCH 5LG1A 4DUVA 3MLXH 1F4HA 3DBXB 4LCYB 1EZVX 4WTXA 5E6IB 3OSKA 1WITA 1IGTA 1MCHA 4PBWD 1N3NA 4I9WD 4LEXH 1J86A 3H9SD 3MXVL 5KZCB 2VLJD 3GMLA 3F5WB 3ULVD 5MEQA 5D8JL 3HNSL 3LVEA 1NFIB 4LLVA 1K3IA 2H8PA 4WY7H 4HDIB 3X17A 4KK6C 5T1MA 5IQ7H 3L3IA 2BY3A 2ZKHH 3GZKA 3RFZC 4I5BB 1CR9H 2X4SA 2K1MA 1UXWA 3EO0B 4YHOL 4U1MB 1LNUB 4JPIA 3CSBA 1LDPH 3MZGB 1XGRB 2IFFL 3N50A 3S35H 3MXWL 2CK2A 1NAML 3MACH 3E3QA 1UZ8B 3RNQB 4N90D 1W0WB 2BNRB 2NPLX 3OZ9L 1A6WH 4CL7A 4NUGL 2EDEA 1MCSA 4OF3A 1YEHH 3O8XB 2VLKE 4PJFB 4ODHL 3ARBD 5T3ZE 4JFEB 3FO1A 4MCYB 1T04A 1AIFA 4NNPH 2ICEB 5H35A 5A2IH 4TUOB 5E70A 1ZHLA 3MV11 3IDMA 3AAZB 3EYFA 3B9VA 2GUOB 3BPOB 3WXWL 5TFSH 1KENH 4RGOH 3U7AA 4Y7MA 2WLZA 4ZFZA 3SQBA 1RJYB 3QEUB 5DJ6A 5E6ZA 4NWTL 3CJJA 4ZUTA 2O61A 4LLQA 2DYPB 3EOAB 4M1DL 3MUGA 2MFNA 2NY2C 4D9LL 4Z5RB 1UEYA 3SKOB 5CMAA 3NPSB 4TSCL 2Q76A 5IMOA 3WDIA 1S7RA 1HXMB 1FP5A 4ZO8A 1GOFA 3QEHB 4CBPA 5I15L 1BAFL 4XP9L 1LEKA 3RTQB 4WI3A 4G6FD 4X83A 4O4YH 3IDIA 4JRXA 4PJ8A 4NZUH 3HUJB 4XXDA 1MHEB 2ADJA 1TTGA 3EDFA 1FAIH 5F70A 5LCVH 4OCXL 2E3VA 2BXYA 1YY8B 1N0XH 2D31B 4H25B 4JREB 3U30C 2FATL 2VTFA 2IH3B 3AY4A 3OJ2C 4NT6B 5T1KD 2VITB 2YSSA 3R8BB 5IW6B 3IDGB 2IANA 2MJWA 1X5YA 5DJ8B 3KPOA 4P0DA 3QRGL 4PRPA 4M7ZC 1PAMA 3H3BC 4Q9RL 1AP2A 1JHKL 5F97E 2X41A 5D71L 4WFEE 1CDUA 4LSQL 3H3KA 4JKPH 1KIRA 1AGFB 2ZNWA 2YUXA 3LPWA 4BZ1L 3MRKB 3T0DA 2FX7H 2VXSL 3HRZA 4K71C 1LO5A 4TSBL 3RIFK 3GJFA 4HX1B 2CDEB 1DQJA 4KI1A 4IHOA 3NGBC 4NSKA 4GAYB 4WW2A 3H7BA 3P4OA 3CAFA 1ITBB 4PJHA 3I02B 1MJ7H 1SJHA 2Z31C 2P8PA 3PUCA 4IRJD 2YK1L 4WW2F 1QRNE 1U8OB 2VXTH 2IAMD 3BSZH 3BX7C 4XBGB 3E1F1 4PJHF 4N9GB 1R5VB 2YXMA 5C2BH 2FH6A 2VXUH 4DAGL 5GS3A 5JDSB 3NFPA 4HULB 2YD9A 3BE1H 4RRPA 3T0WA 3IFPA 4OGYL 3VFMA 4PG9B 2VXVH 4MD5B 4JPVL 4S10A 1AKJB 2YWYA 2F54E 3ESUF 4M5YL 1KTKE 4WFFD 1CFQA 3BN9D 3CMGA 5EBLB 4GBXD 4KI5C 1I3UA 4NQVA 4G9DA 2F8OA 3SBWC 4ZS7H 2V7HA 4A6YA 1HSBB 1PJ9A 5BS0D 1BFTA 2ARJQ 3K80A 3GMRB 3QUKA 1BREA 1MF2H 3Q6GH 5C0RL 3LIZL 4Z8FL 3KS0H 1VKXB 1G7PA 4TNVK 3WSQL 5C0EB 1HKLL 2CSPA 4XNXL 1QHOA 4OSUL 3FN3A 3O3BB 1IGJA 1A7RL 5CP7A 1J0JA 1EXUA 3JWOH 4WWKA 4P59H 3SKNA 2ZUQC 1DCLA 2V9TA 5I1CL 1N8ZB 3B9AA 1Q0XH 4HWUA 4OZIB 4NZTL 4YHML 2AABH 2NY2B 3PQYD 1L8JA 4QHLB 5LBSL 2I24N 4NQEE 4N5UA 4W70A 3RVXC 3MGTA 3CIQA 1FNGB 3L7EA 2ESVE 4H20H 1XMWA 4X6DB 2BMKA 5GRJH 3BQUC 3TPUA 3O4LA 2PYED 5FOBA 3GSOA 3PWNB 1A14H 4NP4L 1DUYA 3QUYD 4FXGA 3V4VH 1L4IA 2GCYB 3OAZH 3FRPA 1R3HB 3VRJB 1U2HA 1ZEAL 2GTWA 4KPHH 4MA7H 4PJ5D 3WEXB 5SX4I 3QQ3A 5ID0B 5GZOC 2A77H 1FVCB 4KRNA 1U8MB 3EFFB 5C71A 5GGSB 2HVKA 4JO1H 5C0BE 4NQSB 4F7MB 1FZJA 3S8WA 4ERSL 4OJFH 4RRPG 4G5ZH 3U30B 2GEEA 4Y2DC 2VXQH 2LFGA 3QUML 4EI6A 2OTUB 1S7WA 3EJYC 3OGCB 2JB6B 4K3DL 4IOIA 4F57H 1NCNA 1F8TL 1MCPL 1J1OH 4LPXA 1TCRB 1ZHKA 4RMVA 4CJ1A 4U4BA 3MLTA 3STLB 3WMSA 3I6KB 4XNMB 1N59A 4JAMA 4M7ZB 1JL8A 2X2YA 4KTDL 2UZIL 5D2LE 4YXLH 2C3HA 4HV8B 2NY1D 4HJJL 1YEGL 2HVKB 4FZEL 1RU9L 1WT5A 4OUUB 3GHBH 5E94B 3PWPB 4CW1A 4D0CA 1QEWB 3GDBA 2V9RA 1JZ6A 4XXCA 5JW4Q 3QCTH 4M6AA 4K71B 3RNKB 4S1DD 1FPTL 4KZDH 1YEJH 1F4YL 1HCVA 2VDRH 4I48B 1M7DA 1UYWH 5FDWA 5L7XL 3FFDA 4WDIB 5F88B 2JK5B 1VFOA 5KVGH 1BPVA 1NGXB 1JHTB 1KF9B 4U05A 5C0JA 3QT2A 1A4JB 1BFVH 2Z31B 2GFBA 1P7QA 5HI4D 3FJTA 3V6FB 2ZOKB 4LEOA 3TYFA 5J12B 3ISWA 3TIEA 4QY8A 4XP6L 1A7PL 4JFFD 1NCWL 3VXRD 2KDGA 1EH9A 4BQCA 4JG1L 2ENYA 1G6RL 5D93C 2QSVA 5L88L 3O6FD 4L8BB 4MSWB 3L95A 2BSTB 4BK4A 3FRPG 1KEMH 2M2DA 2FEDC 1AC6A 1UJ3A 1X5LA 4F15C 3H0TB 4W6WB 2YA0A 3GSVB 5AYQA 4ESKA 3QDJA 4C58B 3SGEI 3P0VL 2XXCB 5IHZB 4P2QD 4GRLA 5KS9F 1J0HA 1JN6A 3AU1A 2H1PL 2HWZL 4LCUA 5I8OL 4CMMB 5AG8A 4DVBA 3TBWA 5DMGC 2HFTA 4IDJH 1CDIA 2WP3O 1CZ8H 1I1RA 1RZKH 2AXJA 1G9ML 2HFFB 5SX5K 5C0AB 4JDTL 3VU2A 1ZVSA 2AEQL 1WBZB 2FSEA 5DEFA 4DOHB 2FWOB 3GO1H 1MREH 1A3RL 1CGYA 2MWCA 5SV3A 5I30L 2YPLD 4ZMAT 1JJUA 2F53A 2ATKA 1CFVL 4G6MH 3BQUB 5K9KB 4Y2DA 4AIXA 2A9ML 2OCFD 4J4PA 5KOVC 5B22A 2LQRA 1YEIH 5B39A 4L1HA 4NO3B 5FGRA 2EE2A 4FQ1H 1C7TA 4I8DA 1YZZA 3CMOL 4RMTA 4JB9H 4DFHA 1I3GH 3OX8A 1NDGB 1AXIB 1GZQB 1A7OL 4HT1H 2X4PB 4OLXH 4QHUA 3FTGB 5E4EC 2ATKB 3P73B 3WIFA 3BUTA 3T1FA 5CBEB 1OAUH 2HT4D 4Z95L 1BQLL 3DRTA 1JGUL 1C5DA 5MENE 2IQ9L 3TVMA 1Q9KA 1U95B 1YMHB 1ZA3B 3EOTH 1ZVYA 4PGEA 2Y6SD 4TRPH 4PB0L 1I8IA 4F3FB 2OXGA 3L3GA 3BDBA 1IAII 4ZNEE 5F1OB 2DQTH 2Z92A 4R7DB 4OLZL 3X14A 3OHXA 4HIIB 4PJXE 1NGPL 2D2OA 4RX4D 3ZT6A 2P8MA 1I7TA 1U92A 2QV2A 4LPVA 4U7MA 4Y1AE 4OZFH 3TEUA 2VRAA 3C6LC 3CFBA 4HIEA 4FFZL 3TCXA 1MELA 2CD0A 2X89D 5K33A 3PDDA 4OTXL 4K94L 4L8DA 3G5VA 5HYJB 3RAJL 1A6PA 1UWXH 3O41B 4YDIL 3TBVB 3GI9L 1GJIA 5I1JH 3P9LA 1UXSB 5IG7A 5CFHA 4PB9L 1NUFA 3INUL 1IKNA 2NQCA 4LLAA 3KR3H 5INCB 1GIGH 1FCGA 1FN4A 3CU1A 4G9FE 4MB5A 4YPGB 3ZE1E 2P1YA 35C8H 1YQVH 5BO1H 3RUGB 4ZAKD 3MRIB 4NHCH 3FQUA 1BD2E 1B6DA 4KJQC 1OAYL 5KSVA 1UM4H 1KOAA 5T3ZL 3DNKA 4HEME 3MV8B 2WWKO 4V2BA 3CVHH 5DYOB 4J3XA 1EFXA 2WWMD 1NCAL 3C5SA 2Z4QA 1IC4H 4L8SA 2F58L 3EOBA 3WKML 3MRQA 5HHMD 2HTKD 2G9HA 1IQDA 3L9RB 3WNLA 5IW1A 1A1NA 3QXVA 2VMFA 4MXVE 4AEHH 1FNFA 3HE6C 5J1TC 4S1QL 1CICD 1SJXA 5EU3B 1C5CH 1T0PB 3RX7A 5F7UA 5BVJA 5EZIH 1LK3H 2CKNA 1AR1C 3IXAA 1AD0A 3QZWB 4MA8H 1D5ZA 1WZMA 4DKAA 5ICYB 4WWID 3T4YB 4MLSA 5T5FL 4ZODA 2NY4C 4P9HH 1JFQL 1T7XA 3UBXA 2GJ6D 5I1EH 1JPSL 3ARRA 5C0IA 4TPRL 2EKSA 3IFNH 3V5HA 2EYRB 3QUZD 4OLUL 5IBLD 3MRGB 4ZDHB 2R2HA 5HDQL 3N9GH 4EJ1C 4CVZA 1X5IA 1CXLA 1X7QA 4KZEL 5EU4A 3O11A 4TTDD 4WFHD 5ACZB 3MJ8B 5F21B 1F3JB 3ZHLA 4N0CA 4LIQH 4C56B 3OJMB 3JWDL 4H0IA 5I1DB 5E8PA 2WUBL 4WO4D 1SHMA 5DQJB 5E4EB 1HZHH 3PWVA 4PGCB 2NXYC 4LK4A 5E1AA 1YNLL 4HF5H 2XT1B 3A67L 3L3OB 4Y19E 3MLSH 4YGVA 2Z93A 5I1LB 4FZ8L 4B50A 3GI8L 3MUY1 3C6LA 5GRZA 5FUCC 4E0RA 1J8HA 4GW4A 1XFPA 3RBSA 2Y1VA 3LSOB 1EBPA 1I9EA 5EOTB 2X70A 3EO1A 3CPLB 1QFWL 3C60C 1KIUA 1WFOA 1WIOA 1H15A 4N8PA 3I6GA 4ELKB 4ZFGL 2V2TA 2VZUA 3V0VA 1GPOL 2P4AB 2AXFA 4I3SH 2XA8L 2K7PA 3RWDB 2XN9D 3L3JB 1W8NA 2APVA 1IGCH 1OLLA 5HTSA 1JUFA 1UJTA 2ZCHH 1JZ8A 2N56A 4QF1B 4LNVA 3MOBH 3ZZ1A 3UTTE 5INDB 4JRYA 1HN1A 5HHOA 1M1SA 3IRPX 5JPNB 1UACL 3IDYC 2JELL 4PJDA 3UBXG 4X4YA 5CP3A 5F96L 5HYSG 1RK1B 1QKZH 1LO2L 5CJXC 1DQTA 3RZWA 4QO1A 3HNSH 5EU6D 3L3KA 5ISZB 4MCZB 2BVQB 2B8OT 4PJDF 2VKXA 1TZGL 1I8LC 4BUGA 2PXYC 3RVVC 4PRAB 1AXSA 1IZJA 4X6EB 3JXAA 1FIEA 1P53A 1HHIA 3L5XH 1EO5A 2FJHB 1LEGB 2VJXA 4YHOH 5E2VL 1CTOA 3K8KA 3SJVD 3B9KD 1VFUA 3LMJL 2BERA 4Q9QH 4IS6A 1KJ3H 3MXWH 1LWRA 2W65B 1NAMH 3NCBB 4QHKI 5HHVL 4LAJH 2VO5A 5ETUA 5I0ZA 1RZFH 1EFQA 2AQ3A 2KBGA 3HE6B 4UU9B 1U0QA 1NBYB 1P6AB 1I1AD 5DXWA 4MWFB 3UBXI 4XTRD 3QHZL 4ODHH 1I1FB 3O2VL 1XF4A 5FKAB 1KB5A 4NDMA 3UEZA 1OT1A 3MV7B 1S7TA 5DHVB 5DT1H 3HZKA 5J8OA 1N5AB 4PJFE 5CIPA 4HUMB 3GSRA 2PTUA 3EYOB 1KG0B 4FFYH 1VADB 2J1KA 2CQVA 2NY4B 4FQCL 4BELD 3HG1B 4KK5D 5GRYA 3NVQA 1NFDA 5MEND 4K3EL 4GG6A 1K4DB 5FXCH 3E3QE 3CDGB 4NWTH 3KPSD 4D3CL 1U8KB 4Y4HB 1UCTA 4M1DH 3MJ9L 1FH5L 1E6JL 3E6FB 5F7HA 3WIIL 1NFDF 1S7TB 1UM5L 2AV1B 3QUXC 4HGMA 4TSCH 1TVHA 4ZSOA 2R4SL 2YPVL 1IQWH 4XP1H 2VDPH 4U7KA 1UQSB 1IEHA 3DTXB 5I15H 5DRNA 1BAFH 5ADPL 4LVHC 1MHPL 5I1KL 4DQOL 1DQDL 1GC1L 3NAAL 5D7KD 5JMRA 2Y5EA 1G7IB 4YHIB 3SDDC 2J5LC 3VCLB 5E5RB 3VD3A 4MQTB 4ZTPH 2YD6A 2YN5A 1XCTA 3HUJE 3KLAA 3NCEB 4M4PA 5JUEH 2IPTL 2FATH 3WYRA 5J6HA 3C60B 1GGBL 4LPUA 3QH3B 5FYKE 4V3EB 4UZGA 1WWAX 4PG2C 3O6MH 4KTYA 4E41A 2JCCB 5CJXA 4C83B 3QRGH 2WBWB 1IGMH 2YR3A 1D6VH 4EDXA 2DIBA 5I1HL 3VFTB 4TQEL 1JHKH 1NGYA 1JRHL 1BQHB 3VFGL 4JRXE 5I18H 5EU7E 5JO5A 4TNWF 4GKNB 4BZ1H 1DQQB 3ZT5A 5H37G 2VXSH 3LRGA 5HD8C 4TSBH 3L5WA 1B0RA 4DN3L 4NWUL 5CHNB 2K9UA 3C9NB 3MV9A 4HCRA 2IPUK 1I7RA 2IWGA 2V2WA 4M8QA 4QHMB 3TN0C 1IAKB 3RJQB 5HI5D 1FL3A 5TF1L 2NLJB 3TNNA 4FXLA 5E99L 2IANE 2FECL 3RRQA 2YK1H 4KKCC 4BH8A 2ZOLB 2HJKB 3KPNB 4PRPE 3GMNB 2PXYB 3BUYA 3RDTA 4M61A 2Q3AA 5EZLA 4JY6B 3D6GA 4PIRF 1GH7A 2AEWA 3HR6A 1FJ1B 3WXVL 4HS6A 2KZ1B 2ADIA 3KNBA 4HWBA 3TH4T 3SGJA 5IQ9B 1YA5A 3ROOB 4AIZA 3ARVA 2F9BT 1G7MA 1AO7B 1NH6A 4JPVH 3G5XB 1Z9SA 4JKKA 2GSIA 3W11C 12E8L 5K59F 4WTZA 4M6NL 3VG0H 2B39A 4UQ3A 2B1AH 1U8PA 2XIDA 4BH8B 4Z78A 4HGWB 4F7EA 1ORSB 1ZKAA 2NW2B 1U3HB 5TQ0H 3QI9C 2Z8RA 2H26A 4WJ5A 3WUZA 4MNQB 2Y4SA 4HMCA 3QWQB 3TO4B 4KAQL 2DM2A 4EXPX 4FTVD 2VL5A 5D1ZC 3LIZH 3UTSB 3V8CA 4X4ZA 1KULA 3H42H 3O9WA 1A9BA 1HKLH 5SX4H 1TVBA 3VFPA 1TETL 4NCDA 4CU7A 3RPIB 3G5YA 3LQAL 3HI1A 1QFUL 5C0CA 5C86A 2IQAA 5DFTA 1P4BL 1T22B 4NQUA 4AMKH 2DI9A 3RX8A 5I1CH 5F71A 3MJ7B 3C5ZD 1HIML 3NCYP 5BMFH 1BFSA 1L0QA 3QUXB 1DEEB 3QIUD 4GH7B 3WCYA 4OZIE 4JPKH 1UB5B 4R4BA 5JIHA 4HC1H 4UBDD 1TQCB 1YJDC 2O5YH 4KJWD 1UWEH 2F5BH 1NSNL 3IU3A 4LVHB 1BVKB 4NP4H 5D7IA 3WD5L 1T1ZA 4QCIA 4HH9A 3AXLB 3O3EA 2NY5L 4GKOA 5IIEB 3HAEB 4HK3N 5EC2A 3CLFL 3SDDB 4ZPTB 3FT4B 5HGBB 3VXSA 2HKHL 4RA0C 3EJZD 3BGMA 3EO9L 3FZUC 3MA7B 4DCQB 3IJSB 3TYGL 4UT9H 4ERSH 4X6FB 5GSRB 1KACB 4OIAA 5IR1B 4OGAD 2VLKD 1ZVHA 1S7QA 4YNYA 2ZSWA 3ZO0A 1NMAL 5T3ZD 4K3DH 2W91A 1F8TH 3TN0A 1V7ML 1DUZA 5I9QC 3O4LE 3OKMA 43CAB 3QPQD 1HNFA 5L2KB 4RBPH 4GUPB 3D3VB 4KTDH 2UZIH 2DWEA 4LSDA 5DVOA 2AV7B 4PY8I 2WK2A 2VWEC 3SE4C 2V6HA 1U93B 5JLZA 1FPTH 1XGYL 2W0FA 3PWPE 2AKRA 4P48A 1JNNH 1NGWA 1Z0NA 5EUOB 1ZXQA 3QCVL 1U91B 3O2DA 4GQ9L 5AYUL 4Y0GA 5T1DH 4XI5C 3GJEB 4NQCB 2V2XB 3EHBD 4TYUA 4WI5A 2AGJL 4DFIA 2DBLL 3C6SB 1ZSDB 5HHPA 3D0LA 1HHJB 3VXOA 3U0WL 2DTML 3KXFA 3UYOD 5J56B 1N5YH 1H8OA 3V5KA 1NCWH 1JTOA 3FB8B 3KG5A 5AUMB 5D1ZA 4JG1H 4DN4H 5E8EB 1FLRL 2M1KA 1G6RH 3RGHA 5DD5L 3GHEL 4ONHA 1KJ2B 3JTTA 5ANMB 2A6IA 5GGTL 2NXZD 4PREB 1N7ML 3DX8A 2OP4L 3TF7C 2BOBB 3QDMA 2Y36L 4HBQA 1IM9D 1B88A 4JGMA 1MCWW 1IAIM 3ULVC 3QI9B 1WZLA 3RGVD 3SDCC 4WI4A 4KVNL 3O3DB 5IOPA 4KI5E 4OM1L 5ECJE 1IC5L 3KLDA 4OZGA 3R1GH 4L29A 4EDWL 2E7HA 3UYRL 1EPFA 1WISA 2F5AL 4NBXB 4P5TD 4WFED 4AH2A 3ARUA 2DQCL 5I8OH 1MFDL 1RK0A 3SDYL 3T8XA 3W82A 1EMTH 3QP3A 1ZLUH 1U2CA 4MAYD 4OZGF 1KELL 1D5XA 4M43L 2D0FA 3KHOA 4X99B 1TPXC 4U1LB 4OBSA 1X6NA 4JDTH 2AEQH 3WFHA 4ZUUB 5DTFB 2FJGA 1U8LA 1KEGL 3CSYA 4UB0L 5CD5C 1V3LA 4L29B 3OL2A 5FF6B 5SWZB 5I30H 5MEOA 1CWVA 1T0NA 1QRND 3N06B 5ITBL 3ARQA 4P2OD 1CFVH 5EBWB 1OSZB 4MNGB 4F9PA 3TT1L 3T65B 5GIRA 1IEBA 4ODTL 4ZUVB 3OXSB 4I0KA 3FO2A 3W0WA 2RHEA 1UKSA 1PKQA 3ZE0E 5F7FA 2BRRL 4KQ3H 3NOIA 4X5XB 3UPAA 5BV7L 2HJFB 1ITCA 4XP5L 1C12A 2F54D 4L3CB 5C9KA 5IB3A 5DEZA 1TTFA 3VFSA 3DOSA 2AXHA 4YXHL 4Z95H 1FIGL 1BQLH 4UT7H 2FD6L 1MFAL 4KHXL 5I1AB 5JPMA 3AFLA 2F53E 1N2RA 2MQCA 4PJ9C 4YBLC 5FGSA 2OQJA 1CDJA 2IQ9H 5HPMB 3NIDE 4Y5VC 2DBJA 1P4LA 5TJWK 4OT1L 2W0LA 4ZYKB 4YHLL 1IVLA 4PB0H 2V17L 1A6VL 1JPST 1WF5A 2CDFB 2R2EA 5FFLA 2HAZA 2ADGA 4JFPA 4OLZH 1VCAA 1ZS8B 1NGPH 3L3HB 3QO1A 2DI8A 3QXAA 1AGBB 1KCRH 1P5VA 5KSAD 3TBTA 5ALBL 4ODWA 1N2RB 3VD7A 2BJMH 2RB8A 5I0DA 4NQED 5DK0A 4YHPB 3LKRB 4TULL 5C09A 1Y6MR 2QEJA 2ESVD 2D7MA 3N1QC 4KKBD 5EC1A 2MPAL 4XNYL 4QRPB 5HDLA 4OTXH 5DSCA 5SWSA 1RZJH 5TDPB 2X6MA 3HRPA 3VFNB 1OAKL 4N8CL 2VABB 4NJ9L 3RAJH 2A6KB 4V1DA 4YDIH 3ULSA 4N0FA 1J5OL 3B8YA 2APXA 4NRYA 5FV1L 5HYJE 3SDCA 1G0YR 2VLLA 5CLWA 1L0XA 3W5MA 2B5IC 1DLHA 3I3BA 3GKWL 1WC7B 1XR9B 2AXGA 2PO6D 4AG4L 4OLWL 5TE7H 3W2DH 5C0BD 2BSRA 4NFDA 5IFJB 2HYMA 2FYYA 5ICZB 5TGBB 1OP3H 1OGTA 1WAAA 3WHXB 3C5JA 5D2NC 4JCLA 4MD4B 4YHZH 1OAYH 4IJ3B 5K9JH 3H9SB 2VLRA 1A1MB 2VLJB 5T3ZH 4X9BA 1ES0B 2X4OA 3RUGE 1WAAF 1NCAH 5DO2C 3VFRA 4Z0BH 5D5MB 2F58H 4P49A 3WKMH 2IAMC 3X12B 4GLRI 3T2PA 2D0GA 4EN3A 1XIWD 1T1XB 2XY1A 3CK0H 5KSUA 4XMLH 5SV4A 4OF5A 1TPXB 1V3KA 4DKDC 3BZEB 3FQNB 5FHAH 1MJ8L 4Z7WA 3TFKA 5HDBF 4HMDA 4Y4FD 1IJ9A 2YRZA 4YFDB 4OV5B 3BN9C 1IM3B 1JFQH 3HR5B 5ITFA 4PJEA 4Z7WF 2OZ4H 3FB7A 3MBXL 4U6VH 5I6XC 2X9XA 5HYEA 3QG7L 3EW3B 3QFDA 1E4KA 4EKXA 3D9AL 1SBBA 3BD3A 4GRWF 4TPRH 3FCTB 3BJLA 1TZIA 4OLUH 2AI0H 1OTUD 3LRSB 3PHOA 4XCYB 4PJEF 5HDQH 1G9NC 5TDOA 1VGKB 1PDKA 4FQXC 4DGVL 2WUBH 1CLOH 4F58L 1I1YB 1VGEL 5EPMA 1I3RB 2XACC 2ZCLH 3OB0H 4J3TA 5FYKL 3TWCL 4C56E 1CD9B 4X6BA 3ARFD 4YDVA 1TNMA 3A67H 1OAXH 1J87A 1XZ0A 5DEGB 4PJ9B 3GI8H 5H2BB 3ILPB 1G0XA 4Y5VB 3CFJA 3DVFA 2CR6A 3MNWB 1NC2A 4AT6B 1BFOB 4HLZG 3LEXA 3U6RB 3QUYC 1QFWH 2MQ0A 4G6FB 3I9GL 3GMQA 1S9KC 1GPOH 4P46A 1NCDL 2UV3A 4LRIC 4WI7A 4LRNL 2H3NA 2SEBB 3BRFA 1MCNA 5FK9B 2DQHL 2YPKB 4MX7B 1MI5B 3BDYL 1LE9B 4LNRB 5A3IC 4N1EA 4UDUB 5D9SA 1ADQA 2R1WA 3GMOB 5LQBL 1YQ2A 3X13B 1HYSD 4HK0B 2X7LA 5T1KB 2C4XA 4OF0A 1CE6B 2NY6D 4XAWH 5D2NA 4D8PB 1ODAA 2CIIB 2X4QB 3MLPA 3DLQR 3S36X 4LVEA 5GGQL 4LF3B 1UACH 5D1XC 2R1YB 4GMTL 4YZFE 5BZDA 3W9EA 5F96H 1LO2H 1MLCB 1QO3A 4XCFL 2B5IB 3RWEA 4P23A 5EOQL 3PP3H 4LP5A 2Q86B 3RWGB 5ENWA 1HWHB 1PY9A 1X4YA 4E42B 1TZGH 4APQD 4S1DC 5ISZE 1X9QA 5F3BB 1T80A 2E9WA 3CC5B 3UZVB 1PSKL 4U1GC 3I2CL 4JPWL 3NACL 1R3KA 3VXNB 3LMJH 1T7YA 3NABL 2ICWB 3MBEA 4JRYE 2EDTA 3O3UN 4LKCA 5HHOE 4IRJB 2P42B 5HHVH 2IAMB 2J3SA 4U1NB 4C4KT 4FXKB 3MFFB 3IS0X 4R26L 3MTRA 4H1LH 1YN6A 4FFWD 1G7QB 1JWSA 1CFTA 2I27N 1BIIA 3BRDA 1OQXA 2NZIA 3BKML 3D85D 1D3CA 3O6FC 4LBEB 3KYNA 1INDH 1G84A 4Y1AD 3VFWB 1I9RL 1PBYA 3UPCA 4MQXD 2YBRA 3STBA 3E2HC 1F6AB 4FQCH 4GBXB 4X4XA 4HFWB 4NO5A 2CDGB 5I6XB 4QHNB 4PP1D 7FABH 4K3EH 1A2YA 4NRZA 4D3CH 3MRRB 3MJ9H 1FH5H 4P5KB 1E6JH 3SN6N 1EIBA 2I9LB 3WIIH 2CLVA 4G9FD 4N5EC 4I3RL 4JLRA 1OW0C 5EZJB 1A5FL 2R4SH 2UY7A 2YPVH 4FQXB 2RCSH 2OJZL 4CVXB 2Q20A 1KN2L 3HI6H 5ADPH 1BD2D 3IAGC 1EJOH 3VGAC 1HSAB 1ACYH 3WO4C 4AK1A 5I1KH 1DQDH 3NAAH 3OKNA 4KK8D 4QHKJ 4Y16D 4ZS6D 3LN4B 4LRIA 5E24E 3ILQC 3OKEA 1ZK9A 2H2SC 1MCDA 2XA3A 1JWMB 4KRPC 1TJHL 4K23L 3K74B 4GG6E 3L5HA 5FGBA 2X1XR 1MHCB 2BX5A 1MFBL 4UV4L 1AGCA 2MQ3A 1MCBA 5I75B 1H5BC 2PYEB 4JJ5A 2JTDA 3OR6A 4XPTH 4P3DB 1MCIA 4JGJA 1WBYA 2ZZUT 3MX0A 3CFCL 3QUYB 4CVUA 2R0WL 5FUCE 3BGFC 2PCPA 2VR5A 4YHNB 2P46B 2O5XH 4ZG1A 4JANB 3E8UL 4Y88A 4IDLA 4M7LL 3KYOA 5GJTL 5EO9A 2DRUA 5A43C 4Z6AT 4TQEH 1VENA 4NGHL 1JRHH 3VFGH 3K2UH 1JNHA 3R06A 1FO0B 4L9LA 1PKOA 4Z77A 5AWNL 3V0AC 4PP2A 1S9WA 4ORGA 4AQOA 5DJDA 5H37H 3TZVC 3M1BB 2IPKA 2DMCA 1BBJB 2GJZB 4JG0H 4NC1C 1I9JL 2OMNA 4P5MB 4NM4L 4NYLB 3MROB 8CGTA 5D1XB 1ZHBA 1GYAA 3FQRB 3DX7A 3ZYOA 4UTAL 1I4FB 3SDAC 2Y6SC 2NY1B 4U6XA 4R8WL 2AEPH 1FL6B 4QYOB 1IRAY 3L7FB 4PBVC 1HXYB 4MDJA 3ARWA 5E99H 5JIPA 1MH5A 2AAVA 2E9IA 1J10A 3EYQC 3MNZA 3S5LA 1JTPA 15C8L 1PG7X 2YHGA 2C7UA 3FQWA 3HMWL 4Y4KA 4U1GB 4M9PA 3TIDA 2OJEA 3HCVA 4UV7L 2R23A 4Y19D 3SDXB 1WBXA 1NBQA 1EUTA 1CBVH 5IMKB 4XNQA 1K8DA 5C9JA 1RY7B 2G60H 2WINB 1RUML 12E8H 3MV9E 4M6NH 5I8KL 3ECBB 2I07A 3TT3L 2CXKA 3P0GB 1U9KA 2FX9H 2Z35B 4BQ8A 4JFFB 5J6GB 3VXRB 1XGUB 2P7TA 1H3UA 4JQVC 4X98B 1FVEB 4KAQH 3O6FB 4N5EA 3BPCB 4N0UB 5FA4B 3VG9C 3RWHB 2WIIB 3BIAX 5KTEL 3EGSB 4R7NA 4O00A 4PRHA 3DVNA 4O2CA 4HFUH 5DJZA 3E2HB 5K59E 1K6QH 3IDJB 5C6PB 1TETH 3UTTD 1IC1A 2HTLD 3LQAH 4LLDA 3LKSB 2J6EL 3D2UA 1CLCA 4DKFL 4MJ4A 3QIWD 1P4BH 4JM2A 1CT8A 1NEZA 3CX5J 2EYTB 4P2QB 1INEH 2CO7B 1GSMA 2HTKC 5KVMC 3W39A 1HIMH 1RJCA 1CG9B 2VN4A 2X4TB 3S98A 3P77A 3ZKND 3H7LA 2DS4A 2DQDL 3LB6C 4KUZL 5BW7C 5F9JA 5DD6A 2V5TA 5E6ID 3ALWA 3AMKA 4JM2F 1SEBB 4KKNA 4J3VA 3BESR 4XX1E 1H5BA 2OL3A 1QSFA 3ARED 2G75B 3RL1A 2PETA 3ZMRA 3FT2A 3VGAB 1M05B 2BZDA 1RHHA 3WD5H 1QSVA 2AJXH 3SKJH 1XCQA 3IAQA 3S5LG 1S7VA 4KRPB 1FDLL 5DA0B 4XVSH 5C0CE 3O6LH 4G42B 2EIZB 2HKHH 2W60A 1CLYH 1J12A 2YPLB 1KTLB 1A6ZA 2OTWB 3TYGH 5FB8A 2C3VA 5T3XL 4BSWB 5DRXB 2DLTA 2FLBT 5JW4M 2H32B 3BGFB 1NMAH 3L6FA 4R90L 1L9NA 2R9HC 4X8JB 1Q9WA 1V7MH 4OKDA 1B90A 3O8XD 5DVLA 2VNCA 3SDAA 1KJMB 3BP6B 2JE8A 4S2SA 5CINH 5D7IE 1SBSH 2IMMA 3WFEL 1T1WA 1OGAA 4OIBA 1BM3H 4F33B 4P9ML 2COQA 5FB8B 1M71B 2W0PA 4YDKH 5L2KE 4GSDL 3D69B 3BXNB 1D5IL 2YKLL 3TZVB 3BEWA 5GSVB 1KLGB 3TA3A 1XGYH 1JZ7A 3DIFB 5DZNA 3P3YA 3O45A 3QCVH 3WL9B 2I9TB 1K5NA 3S3JA 3PWJA 1I7UB 5KSBA 3V0WL 1PW3A 2AGJH 3D39A 3PGCB 2E27L 1W0VA 1D9KC 1XGTA 3U0WH 2DTMH 3S34L 3CFKB 4N1CA 1HH9B 5KSBF 2RJMA 4LGPB 4CU8A 1FNAA 5K93A 4EI5A 1UH2A 4ZXBA 4OZHB 5DD5H 2R0KL 3DO7A 5IJKC 3PWLB 3MRBB 5GGTH 1K5NB 2BC4B 1E28B 2DDQH 4FQIH 2JJSC 4TUKL 5I76A 2LABA 5ESQB 4WHDA 2Q7YB 3V79C 5FYKD 3ZKSD 2UWEA 5DD0L 2Y36H 3D39B 1I8MA 3OKKB 1W0VB 5CEYB 2VDKL 3B9DA 3F58L 1ZWIA 1YNKL 2WMPA 2O93L 2QL1A 2UWEF 4OM1H 2XWJB 5EO1B 3NN8B 1U3JA 4QRTB 3B2UD 5J1AB 3OAYK 2F5AH 4EZMA 1GL4B 4PJGB 3KXFE 4JRXD 4PJ8D 1W72A 3S4SB 3AB0C 3SDYH 1F58L 1KELH 1OPGL 4RGMC 3B9KC 5KVFL 2V5YA 3MOAL 3HE7A 1MIEH 2ID5A 1YYLH 4OFYA 4OM0L 5MEPA 5BXFB 2R69H 1NBVL 4LQFH 3HZVB 1X5AA 2EYSB 3QDME 4UB0H 1OB1B 2F15A 4O58L 5I16A 2Q6WB 4M7KL 1BVLA 2IAND 1FNEA 3GSUA 4XTRC 3ZLQC 5ITBH 1EEYA 2Y07L 3GSXB 4PRPD 1W2KT 2BHZA 5CILL 4WEBL 1HILB 5IVOA 4MDIA 3MR9B 4RIRA 4ODTH 3UPRB 1U41A 4KK6D 2VB5A 1A6TA 3IVKA 3PP4L 3EUUA 2X05A 1T89C 1FBIL 4X7TB 3TCLB 4RSVA 3VXTB 3QNYB 1DN0A 5BV7H 4JN2B 2GJ6B 2FL5B 4M02A 3K46A 4FNLL 3M17A 4MYWB 5IB5B 2ADFL 2PTVA 3WE6A 2IALA 2GT9A 3QUZB 3TBYA 1DLFL 1G1CA 5ESAA 4GO6B 2A38A 5M95B 1AKJD 4QTIH 4NCC2 1FIGH 2FD6H 4G8FB 3BIBX 1MFAH 4C57C 4KK9D 1KXTB 3OV6A 2ZG1A 1EDQA 2XZAL 2MSPA 5IB1A 4LMQI 4IMKA 3T0EA 4FOMA 5HGAA 4YAQB 5GS1C 3ULUH 2AJZB 2UVEA 1MWAB 4WO4B 3OG6B 3F7YB 4M5ZL 3LEYH 1YNTB 4YHLH 3DI3B 1PKQE 2V17H 1U6AH 1DBBH 3GJFK 5F1KC 2ZG2A 5DK3A 4UDTB 4HPOL 5FO7A 4HZLB 1D9KA 2H41A 3EZJB 2ERJC 3VH8A 1F11B 1FFNA 1ZLWH 1YEKH 5EU5B 3VXMA 3V52L 3DYOA 3KYMB 5ALBH 1KCSH 1NAKL 3STZB 2VSCA 1FZOA 3ABZA 2HLAB 4ZOAA 2VWEE 4HEPG 5IJKA 4N8VA 1AGEB 2PNDA 4K3JL 3VGGA 3O3AB 5EOCJ 3QEQA 4Y8AA 4U1SB 2A74B 4YBHA 5DUBB 5GRWA 1KN4H 2HFEA 1FFPA 1HHKA 1J5OH 3NZHL 3EDDA 4QRPE 1CL7I 2XN9B 1FG9C 1KGCE 4L8CA 3WFCH 1E6OL 3DUSB 5FYJH 3MLWL 1Y6KR 2L7UA 3P4MA 4R4FL 3MMEA 4D9QE 1XH3A 2IFGA 2VUYA 4WWKD 2EO1A 4PTTB 1JF1A 4AG4H 4OLWH 4G7YL 4HJGB 1G9MC 3VGHA 4U1JB 2LVCA 4LSTL 1MAJA 5DJAB 5C09E 5E5MB 4U1IB 5EFIA 2XQYG 2W9DL 1C16A 1NC4A 4P57A 5SWSE 4XPGL 5EU6B 1GHFL 3O4LD 1FL5A 2EH7L 3GM8A 1A6UH 4V1DE 4QT5A 1Y6NR 1LHZA 2E8YA 5H94A 1H0DA 5D5ME 3REWA 3AB0B 3QQ4A 1NDMB 4IBLT 4WEUD 1Q0YL 4Y5XC 4RGMB 1R24A 3B9KB 4ZD3L 3G6DL 1BF8A 1MCOH 2GK0B 3K0WA 2CRZA 1YUHB 3PWPD 2VDNL 5DVMA 1T89A 1FV1B 4QXTA 3CSPA 4JHAH 4O2FA 1VERA 3H3PH 4GW5B 5HPOA 1WIPA 1S7UB 5FYLL 3VH8G 1VFAB 4K55A 2NY7L 3H9HA 2VLRE 3JVGC 3QUMB 4FP8L 3MBXH 3QG7H 2PW2B 2RR3A 1T83A 4OAWB 1CD1A 4D94A 3OAUL 4N8VG 1R3IL 3VXPA 4K3GA 3QO0B 3C2AL 4DW2L 3GUTB 3KDMB 3DXAA 5HYQA 4ZFFA 3S96A 4Q97A 1NGZA 5HDBE 3QDGA 5TQ2L 4QXTB 1F4WL 3L1OH 4WW1A 2HRPH 1BJ1H 3U9PL 5MENB 1C08A 4NJAL 4Z7WE 1YPZA 3HLAB 5C6TL 1Y18A 3KPSB 1FYTA 4FQLL 4GRWE 3EZ8A 3IFOA 1EO7A 4YH6A 5E95B 1RVFH 2JB5H 1YPZF 4LPCA 1P7QD 3U4EB 3QIUC 4KI5D 4P2CG 4LSSL 4MVBC 4N0YL 2PTTA 3FRUA 4K94C 4PYGA 4JY4B 4UBDC 3ARGA 5JOFB 4E5XA 5GS1B 4WHYG 3QHFL 5I2IB 5C70A 1ZLVH 1EVUA 3KPPB 3FQXB 1RZIB 3QEGL 4M1GH 4GG8A 3JZ7A 3ZSTA 1M6OA 4LDOB 1DE4B 3I9GH 3WHE0 1A02N 3MQIA 4GKSB 1DZBA 1OM3H 1XGQA 5D7JC 1NCDH 2BSSA 5FIEA 4X4ME 5KVEL 3H9YA 3NTCH 4F7PB 2DQHH 3EJZC 2BHUA 3B43A 3BDYH 4HKBA 4LHUA 4U33A 1IGIL 5SWQA 3QDJD 4DVRL 1MI5E 5ERWA 5C07A 1R5WB 3BD4A 4GRLD 3MGOA 3D0VB 3QNZB 1NLDL 1KTDB 4O51A 4PR5A 4PV8A 5GGQH 4PRNB 4J1UB 4GMTH 1YMMA 3KJ6L 4GXUN 1JWUB 5DVNA 3AM8A 4XCFH 5EOQH 4HKBB 3C8KB 1KXQE 5KG9B 3CFDA 3LEVH 4Z9KB 4HCRL 3G04B 3VRIB 2X1WL 3UTZB 5GZOD 2YZ8A 3VA6A 3RX5A 4FQ2H 1S5IL 1G7HA 1PSKH 2DKUA 1HEZA 3ORJA 1CU4L 3I2CH 4MA3A 2F53D 2X4NA 3WS3A 4LLYB 4HQQL 3CFEA 4M7LT 1ORQA 4Y2DD 1B4JL 5D2NE 3FFCB 4J4PD 2FJFB 3UC0H 4HUUA 3EHBC 3EJYD 5JNYB 4PJ7A 4GAFB 4HWBL 4R26H 1JGEA 1Z9MA 3PWUB 2XPGB 3HC0B 4Z7NE 1HHHB 1ZMYA 1X5FA 3FB5A 5D7LA 2HVJA 1GZPB 4RWHA 5GGVH 3WJJA 4Y5XB 4PJ7F 5J11C 1OCWL 2E5EA 3BKMH 5IB4B 2HKFL 5AZEH 2NXZC 2F74A 3JWDC 4NHUB 1I9RH 3R4DA 4JQXA 3SKUD 2W0KA 2WZPD 1JYNA 1LP9B 5T1LB 1WTGT 5IROA 3MCLL 3TO2B 3HFML 1T21B 2C26A 4G6JH 3V6ZA 5D70L 3RGVC 3VWJC 4NQXA 2C4FT 4LHUG 2RAMA 1PGRB 3QQNA 4FTVB 2ICES 4FFVC 5HYJD 2QTEA 1AQDB 2HFGL 2QJDA 2QQLL 1DQML 1AI1L 1CIDA 3U0PB 1A5FH 2VAAA 4MAYC 1KPRA 5JA9A 3HAEG 3F7VA 5I73C 3QFJA 3HI5L 1DBAL 1KN2H 4EIGB 5L8KB 1Z9LA 4GOSA 4LKXA 5IEHA 2XNAB 5D7JA 4UUJB 4LHJB 4NO2B 2FEDD 4HIHA 2A6JA 7CGTA 4Z7QE 1ZOXA 4K23H 3QIUB 4KJYA 4PJBB 5CBAB 4P2OC 1KIPA 2DQGH 5D7SL 1WSST 5DRZA 3M45A 3NMEA 3S36L 3EYVB 3IXTB 1TTUA 3MYZA 3CFCH 1AD9B 4F80A 5FGCE 43C9B 2HJLB 4LKXB 1AHWC 4TN9A 1J1PL 4OZ4B 5D7JB 3DGGA 1R3LB 3MNVB 3MO1B 5BVPL 1CXHA 5DMGD 1GGCL 4WI8A 5GJTH 3VE0B 1EV2E 4XC1L 1UB6B 4MNHA 4QRRA 3GGWA 4L4TA 2VLKB 2M8XA 1MHHA 4AJ0A 2D7OA 4JCMA 2NX5A 5I8EB 3MRHB 1JZ3A 3F8UB 3RL2A 3SE3A 2FZ3A 4NM4H 4CNIB 3M07A 5DJ0A 5GISH 4LSUL 1EEZB 4UTAH 1S9YB 2V5MA 1JHLL 3DWTA 3PL6C 4MQ7A 4QRSB 1SEQL 5IMMA 4Z7UB 1SYSB 3TBSA 5EZOL 4MNHB 4QTHB 3MREA 4HG4K 3O2DL 4MHHG 4C56D 4CMHC 3RU8L 4JFOA 3WIHL 5E00B 1WWBX 5HVWA 1NFKA 4GMSL 5F93C 2ATPB 1N6QL 4RFOL 1IAOA 3WLBA 1T7WA 3MRMB 1DQLL 1MVUA 3T4AA 5IMMB 2FO4A 4PRIB 2E6JA 5I8KH 2A0LC 1OAQL 3ZT7A 4CAGA 3TT3H 1P7HL 5TE4H 1Q9OB 2C1PA 3QG6A 4Q58C 5DHXB 2PW1B 1S7SA 4N0CD 1HDMA 1T1YA 2CMRH 4UIMB 5FM4A 5DHYA 2YRPA 3Q5TA 1R3JB 2PO6C 2LTQC 2NTFA 3EIFA 2NXZB 3UTPE 1EHLH 3S6CA 1F3DH 3TNMB 2EH8L 3BP7B 5EO0B 1GC1C 3I6LE 4MHHI 5F1NB 3QJFB 5DMIL 4N0UE 4HKJA 4BFIA 4OD3L 3C6LD 1QLFA 2VR9A 4NOFA 3RGVB 2J6EH 3VWJB 2O5ZL 2XKUA 3HZYB 3BP5B 2A73A 1VACA 3O81A 4GT7A 5BJTB 1YJDL 4JFXA 4P5TB 2DQDH 2P24B 2B0SL 2YZ1A 4B7IA 2A9NL 1SMOA 3JV4B 3JTSB 3CUPB 3OXRB 5HHNA 1ND0A 4MAYB 4YEFA 3DUUB 3IKKA 2C9AA 4YUEH 3BRGC 1P4IH 5IESH 4YE4L 3KJ4C 3FT3B 2IADA 5CS7A 2AJ3A 4QRUA 3MCKA 2BVOB 5MP6L 4PRHE 5E8NA 3AUVA 4JO4H 2ZUWA 4QEGA 1EX0A 3WNNA 1BZ7A 3NFNB 1KCVL 4JRYD 4X7SH 4JVPA 4WNQA 5HHOD 3LPGA 1MUJB 5EBMB 4P2OB 3EKCA 4G59A 4K7PY 1OTUC 5T3XH 1LK2A 1RD6A 4BFBD 5ACMA 2G5BA 2VN7A 3W9DA 3BW9A 4NNXB 4XPAL 2B20A 4XCEB 2XRAL 2UYLA 5D6CA 1AHWB 1S9VB 4R90H 1QSFE 5ICXA 3HS0A 2QQNL 4J6RH 3JV5A 1AQKL 4JR9L 2VQ1B 2DM7A 3WFEH 4HK3J 1PG7L 2C1OA 2I26N 2LAGB 4I13B 1U58B 5B38A 2FEEI 3SPVB 2X4UA 3GB7A 3ARBA 4P9MH 3ARDC 3ARFC 1FZKB 1LK2B 5DC4B 1D5IH 3IFLL 5IM7B 3CDCA 3OMZA 4LFHD 4ZQKA 4XPFH 5MERB 3D5OF 3F65A 3QNXA 3Q6FA 5L0QC 3PL6B 4NC1E 4TOYH 1WIUA 3MLYL 1EA9C 3B83A 2E27H 1XGPB 1YN7B 5ESVB 1BWWA 5T5NF 1OGAE 3OR7A 1HHGB 2CIKB 2VZTA 2Z91B 4CMHB 3S34H 5J0BA 3VGFA 1CDYA 5DDHB 3P9WB 4RA3A 1A8JH 4NQEB 2ITDB 5F1IA 4MGXA 5I66A 4X0KB 5J4MA 2NXYD 1U8JB 2R0KH 4S0UC 2C3WA 3ULVL 1CDHA 1IT9L 1FQ9C 5FCSH 4XBEL 1BEYL 4DUWA 4TUKH 2BOCB 3LZFH 2H2PC 4Q6IC 5DD0H 4JHWL 5E8DL 5IHBA 3KWWB 4UINL 1GOHA 3C60D 1YNKH 4MXQC 2PO6B 1P7KB 4NFCA 1HNGA 3D39E 4R6UA 5C0BB 1MFCL 5JXEA 1S5HA 4DK6A 1PEZA 4PGZA 4JN1H 4KFZC 4I18A 3HPLB 5C0NC 1EEQA 4HKZA 1HI6A 1IL1B 1HE7A 3VJ6A 5B38G 1XR8A 2YEZB 5GRVK 4NPYB 4GKZB 3DETD 1NBVH 3JV6B 5D2LB 1NCCH 5AD0A 4RFEB 5JXAH 2UWEE 4YIQB 2UZXB 2EECA 5EN2B 4M7KH 1K9TA 3SKMA 3MRDA 1MIMH 1P84J 3IF1B 1QVOB 4WV1C 5CILH 5DVKA 3P9MA 4WEBH 3QCUH 3PF2A 4WU5A 2YC1A 3KJ4B 4XVJL 4JEGB 2NR6C 3QWOB 1A3LL 4H5SA 1O7SA 3B3IB 2PXYD 3RVVD 4YXKL 3PP4H 5IKCA 1C5BL 4ALAH 4RAVA 1IAMA 4S1SL 1RZ7L 3MRLB 4XGZB 4NN6B 3CDFA 1O5DT 5FCUL 5D1QA 3FQTB 3MV9D 4J3UA 4FNLH 4OF8A 2CPCA 2QKIB 1DLFH 3KGRA 4IMLA 2WSKA 3P0YL 5ELIA 1HQ4A 4PRBA 1NJ9B 4UOW1 4GAJH 3G6JA 2XZZA 3KPMA 4P9HC 2XZAH 5F7DA 2DLFL 1S3KL 4UNVA 3NCFB 1K3ZA 2AS5M 5ACLA 5FAAA 2R56L 4JDZA 4M5ZH 3G6JF 4RMUA 2DQFB 3O2WL 5BS0A 4X80L 4G8GA 1BQUA 3ARDB 3ARFB 4GRMA 2X1OA 5CJOH 1OY3B 4JQIL 1HOCB 3V52H 3KYAA 1KLUB 3UO1L 3U2SA 2A83B 2RFXB 1EGJL 2HN7B 1T0MB 5L0QB 1ZT7B 2E7LA 4PJCA 3QXDB 3MA9L 3SE9L 2XKNA 3T0EE 1OAZH 3QUXD 5DS8B 3RZCA 4Q6IA 3NZHH 4WUUA 3PQYA 1KJVB 4IRSC 1I7ZA 4OZFA 4U2ZA 4PJCF 4BZ2H 2IBGA 2VISA 1E6OH 5DQ9A 2J8UA 4U49A 4R4FH 5C0CD 5CEZD 4LAQL 2YRLA 2IBBA 1WLHA 4XVUC 4PTUB 4MJ6B 3RWFB 1BX2A 1QFHA 4RMWA 5JORB 1WQVT 1RUKL 4G7YH 3VXME 2NY6B 3S7GA 1TDQA 4C54A 4EUPB 1ZHNA 5JZ7C 4HBCL 4LSRL 1TENA 4YO0B 5DJ2A 4KWUA 1QBML 3T0XA 1LE5A 4Q6IB 1UVQA 4PJ5A 2BDNL 1CQYA 3QJHA 3LQZA 4HXBL 1JMXA 4RNRB 4JFYB 3QEQE 4XPGH 4K7FA 5CJBA 3ZHKA 4KMTL 5LVEA 1VHPA 2DKSA 4APQB 1ZA6B 5DHVH 5C3TA 4JZNA 5L2KD 3N1GC 1R0AL 5HGDA 1PQZA 3CVHA 2G5RA 5F1SA 1JNLH 2DB8A 1Q0YH 4ZD3H 3FB6B 1YEDB 1HH6A 4G6AD 1T20B 2VDNH 2NMSA 1JNJA 2DF3A 3HB3D 5HD8D 4P3CH 1MJJB 2CLRA 5FYLH 2NY7H 4Q6YA 1G9NL 4FP8H 2EDQA 3TN0D 4WTWA 1QBLL 4G80B 2BVTA 5IVZA 4PJXB 1AY1L 4WV1B 1SMAA 3BVNB 3QDHA 4XP4L 3D85B 1B6UA 3CVHB 4MJ2A 2I5YH 2PYFB 1JPGB 2XZCL 4XVTH 4DW2H 1INQA 2CR3A 3PHQB 4Y1AB 4KKCD 5HJ3B 1JGVL 4HUWB 3LKPB 1N64H 3GMMB 4XWOC 3OKDB 3LKOB 2D7QA 1F4WH 3WN5C 4Z76A 3BIKA 1LD9B 3LDBC 5DGRA 4OZFG 4LU5H 4NIKB 3SDXF 3U9PH 5DI8A 3QAZC 4KKLC 1IFHL 2A2QT 2CUHA 1REIA 1B0GB 1OWRM 4G8IB 5CJ8A 1M7XA 3IDNB 4G9FB 4OCYH 3TJHC 3G08B 4NKMB 1CDGA 3B9EA 4DKEL 2FHFA 5EIQA 1UADC 2AQ1A 4RAUA 5F8RC 4LLMA 2R0LH 5DURD 8FABB 3AREC 3QI9D 1E27B 1RZ8B 4XRCA 3QHFH 3KXFD 1QLEH 5FEBA 2N7BA 4LSPL 4PV9A 1RURL 3DXAE 3QEGH 5D1ZD 4Y16B 5BOPA 1BWMA 3RVUC 1BZQK 4PJAA 2BRQA 5I17B 5GS2D 1EAPB 5IT2L 4P4RA 3PV6B 2DMBA 2AJYH 4XCNB 2IH1B 1FO0L 4XH2B 4J3OC 5KVEH 1YPZE 1ED3B 5DF0A 1UWGL 2VR4A 2DD8H 4JO2L 1FYTE 5FO9A 4PJAF 2H6PB 3QDMD 3DV4B 2EE6A 4JZJA 1XF2A 5GGRA 2UUDH 1IGIH 2I60L 4N1HB 5LAXB 5C0FB 4PRDB 4POZD 4NNYA 4P2RB 2GHWB 1NLDH 4YK4C 2G2RA 2MHAB 3T77B 4IRSB 4HS3A 3KJ6H 1EEUA 2VLME 1FZMA 5HHXL 3U4AA 3D25A 1UEMA 2Q8AH 4L3EB 3E3QC 4HHAA 1HINL 4Y8DC 3BH9A 4GW1B 3KLHC 3K1DA 4BKLB 1S5IH 4QNPF 5F7LB 2V7NB 1NL0L 4LL9A 5KVDL 4HQQH 4ZUWA 4UQ2A 5IP4A 2BP3A 3BPNC 1B4JH 4XZUB 4B41A 3BMWA 5FUZL 1GGUA 4AM0A 4M62L 4LSVH 3IGAB 1CLZH 2VE6B 2CGRL 3P40A 3LQMA 2K3TA 5IV2A 1YMME 1FGVH 4KMQA 3FFCE 1DTUA 4OCSL 2DWDB 3SY0B 5IWLC 3BT2L 4Y19B 5CUSL 1JMZA 3CCHB 1NAMA 3ZE2F 1JK8B 2HKFH 2ZP0T 3QA3A 2XWTB 3KPLB 3V4PH 1IILE 3UJIL 4DUXA 3OJDA 5HHQA 2Y7QA 1PG7W 3G5ZA 4TUJB 1JV5B 5DMKB 5DD1L 5D70H 2D0HA 4NC0B 4ONOA 1LP9E 4BK5A 4QRPD 4XI5D 1KGCD 3DHMA 2R2BB 5IB2A 1ZLSH 5DJYA 2EZ0C 3B2UC 2QQLH 2P8LA 1AH1A 4D9QD 1G7LA 4X7EC 1RZGB 1JPFA 3DX6B 5D7LE 1AI1H 4NRXB 5GGUB 3U0TA 3CZJA 4LASL 3UTTB 3WN5B 3DHJA 4DK3A 3WNMA 4LARL 3HAEH 5L9DL 3RVWC 3QAZB 1NBZA 1DBAH 4OZHF 3GSNB 5CSGA 1JF5A 2AJSL 5C09D 3Q0HA 1NLBL 4ZFOB 3AY4C 1NEUA 3SGKA 1PFCA 5SWSD 4YWGH 3AS0A 3IT8D 4V1DD 3LRHA 1RUPL 4Q0XL 3Q3GA 1UGNA 3MLZL 1NANH 2XG5A 2R29L 3AREB 3K3QA 4ZAKA 4NKOA 3SDCD 4OQTL 3GSWB 4YFLF 3PJSA 3S36H 1FG2B 1RI8A 3Q48A 4PJBE 1SJEB 4H26B 1XF3A 1RJLA 4PJGF 3O0RH 3P30H 1NMCC 1XF5B 4NN7C 5HHMA 5DJCA 3D48R 3QYCA 5BVPH 1CGVA 3HMXL 4U6YA 1GGCH 1L7TH 4WW2C 1IGTB 5BRZA 4XC1H 1N3NB 1R5IA 2VLRD 1CICA 5E8OA 5L6YL 3GMLB 5MEQB 1IKFL 1B4RA 4LLVB 3LS4L 4KK9C 2H8PB 5CD5D 4JKWA 1P5UA 2DKMA 4EN3D 5T1MB 3L3IB 3B2VL 1T7VA 4CDGC 2X4SB 2RQ8A 4LSUH 1UXWB 1LEIA 1JHLH 4JPIB 1Z6JT 3DARA 3U48A 2CKBH 1MEXL 5EZOH 3TFKD 1B9ZA 2XQBL 3DSFH 5JHDA 1E0OB 4DGYL 1PD6A 4MD0A 5IWLA 1KJ2H 4Z7UE 1H3PH 2PR4L 2FR4A 1UM6L 5KBNC 4QRRE 3WIHH 4L4TE 4M4RA 5DLML 2IG2L 1AXTL 3CNKA 1J05A 3VGDA 3CZFA 3BPNB 2WANA 3FO1B 1WVZA 1N6QH 2J4WL 1T04B 2FHCA 1AIFB 1IBGH 1DQLH 5H35B 3ZKQD 4MAUL 1ZHLB 4NKIL 1OAQH 4PJ9D 2ED7A 3IJYA 3IDMB 5IF0A 1VFBA 2J2ZA 1F5WA 3GBNL 3EYFB 4ISVA 4PRIE 4NUJA 4WWKC 4ZFZB 5DJ6B 3RWCA 3X3FH 3BO8A 4ZUTB 2R4RL 1S7XA 2O61B 4LLQB 3EYUL 5A1AA 2GAZA 3MUGB 5I1GH 2EH8H 3RHWF 3BZ4A 5CMAB 1MI5D 4AL8L 1CE1H 3MODL 2EDRA 5DMIH 3DX9A 5E7BA 2Q76B 5IMOB 1CXEA 1S7RB 1Q94A 1PLGL 5C0DA 5B4MC 3WUWA 2A6DA 1NC2D 1CFNA 2DLHA 5CCKL 1LEKB 2VC2H 1W72L 2BNUA 1S9XA 1YJDH 3QR2A 5CJQL 5IEKA 1Y0LA 2X09A 3IDIB 4JRXB 4PJ8B 5TF0A 2A9NH 4YFLI 4X9HA 4XXDB 2ADJB 5FECA 5AZ2L 5A16A 1FVDA 2O26U 3PDOA 4D0DA 1OP5H 4YHKH 1FFRA 2JJUA 5E9DA 1KXVC 1SY6H 4YE4H 2D03H 5MP6H 4N0RA 4YHYC 5E08H 2HP4A 2XWBA 3VD9A 4KGLA 3NCJH 1KCVH 2YSSB 1TJIH 4HC1A 2IANB 5JA8B 3WJLA 3KPOB 1T3FA 5ID1A 4PRPB 4PGDA 4PLKC 1DBMH 4YR6A 3FN0L 3QQ9D 1IC7L 5DO2D 3CLEL 4I2XA 1AP2B 1FVDB 3CXDL 4P23D 1MWAL 3SJVA 3OG4B 1WT5C 3GBMH 1KIRB 5CEXA 4XXCC 2XRAH 1NMCB 2RBLA 3HRZB 3DMMA 1LO5B 4NN7B 3GJFB 1DQJB 1I1CA 1RUAH 5IHUH 2QQNH 4ELMA 4R0LA 5B21A 4JR9H 4IHOB 3ZDZF 3QB7C 4NSKB 4XBPA 5I1IH 5LGJA 4WW2B 2HMIC 3H7BB 1JPTH 3EOYG 1I1AA 3P4OB 5GGRY 4F7TA 4PJHB 3CH8A 1ACZA 1G9EA 4AENA 4ELMF 1SJHB 1C1EL 3K4DA 2P8PB 1EHAA 3G6AA 5EBGA 5B8CC 2BVEA 3VXUA 2LAAA 4S1RL 1EK3A 3S88L 4QOKA 1KLFA 3NFPB 3WUWG 4L4VA 5EUKA 4HUVA 2GY5A 3VFMB 3IFPB 5F89A 2Y5TA 3MRNA 3GEWB 2WBJC 1KCKA 1BGXL 1G0DA 5GHWH 3MLYH 4F7TB 4FN0A 4RWYL 4FQXD 1UJ3C 4M3KB 1CFQB 2XZQH 4JFDA 5BQ7A 1C8PA 4NQVB 4G9DB 2V7HB 2ZSVA 4A6YB 3PIQA 2GKIA 1LO4H 2EDHA 2JJVA 4DZBA 4XC3L 3QUKB 4GRLC 3ULVH 3DSNA 1LO0L 3T0AA 4ETQA 4XBEH 1QYGH 3FO9A 1G7PB 3KPRA 4W4OA 4ONFH 4JHWH 5E8DH 4HGKC 1CGXA 1IGJB 1G6RA 1LDSA 4DTGL 5CP7B 4YDJA 1EXUB 4UINH 4OKVA 4WWKB 3LKQA 3SKNB 1TMCA 1MLBA 4UI2A 1RZJC 2VIRA 1TXKA 3LY6A 3ROLA 4KRMB 3B6SA 1OD7A 3UTQA 3MGTB 5GRUL 5A3ID 2M26A 3L7EB 1ZANL 3KYKH 3U7YL 2BMKB 5E2TL 2X4RA 3TPUB 3O4LB 2W59A 5FOBB 3GSOB 4J4PC 1WUNT 1DUYB 4FXGB 3RWJA 1A6AA 3CXHJ 5B3JE 2GTWB 5D1XD 2X9WA 3F62A 1F00I 3QQ3B 2H45A 1A4KA 1D6EA 4N9OB 2ZJSL 4CN1A 2DIJA 2JIXA 1FZJB 4JFZH 3UZEA 4UIKL 4R96A 1L0YA 1A3LH 3RY6A 4EI6B 4YHYB 1S7WB 4WU7A 4IOIB 3AC0A 1RZ7H 4S1SH 5CWSA 3NGBB 1H3XA 2P5WA 1ZHKB 3MJGX 4O2EA 5FCUH 5BZWA 3TVMC 1GOGA 3MLTB 2OX5A 5JW5A 1N59B 4JAMB 3ES6A 4NM8L 5E5UB 1FFOA 3ZYJA 3KS0J 3P0YH 4Q2ZA 4CW1B 5B8CA 4D0CB 1AJ7L 2NZ9C 4QXGL 5IVXA 5J9PA 1CDBA 3RY5A 4BQBA 1S3KH 3UTPD 2UY6A 2VDLL 4X7FC 4YEEA 1M7DB 4Y4KD 1JGDA 2P5WB 5FDWB 3BN3B 3FFDB 3I6LD 1BZ9A 2WBJA 5IVXF 3O2WH 1ZGLP 4NQTA 4O5LH 5C0JB 2GFBB 1P7QB 3VI3F 5KS9A 4H8WC 1CGSL 4JQIH 4IIQC 4HKXA 2VDOL 3BMVA 4LEOB 3TYFB 3TIEB 1RFDL 1IKNC 4QY8B 3D18A 4XCCL 5KN5A 3NIFF 1EGJH 2YA2A 1CVSC 4L9DA 3U9UA 2NYYC 1U8QA 3LN9A 1CXIA 4N5ED 3L95B 4PLJD 1MJUH 5CD3A 1J88A 1UJ3B 4PRHD 3WS6A 3M8OL 4AZ8A 2BFVL 1AGDA 2ZUQB 1E4XH 4QLRA 4LAQH 4G8GE 3QDJB 5GS0C 5C7XL 3ZKMC 2EC9T 4BYHA 1JGLL 1IEAA 2OR8A 4L8SC 4GRLB 3ILQD 2H2SD 4KRPD 3KAAA 25C8L 2YMXL 4FRWA 4X5WA 1NCBH 1JN6B 4HD9A 3QBTB 1K2DA 1QNZL 4HBCH 4LSRH 3AU1B 4EVNA 1P84K 5E2WL 1NUDA 1QBMH 4YQXL 5CGMA 3PABA 4LCUB 1F4XL 4KVCL 4OD2A 4DVBB 3TBWB 5CD3B 4GXUM 1QSFD 4HXBH 5JW4N 1MCFA 2VH5H 2LU4A 3C08L 1AGDB 2DL9A 2XV6B 1ZVSB 4LEXL 4M93C 4WUUE 3JUZA 2FSEB 2NW3A 3MRCA 5DEFB 2NY3C 2J8UE 4QXUL 5F9DC 3ZSSA 1J0ZA 1R0AH 2CH8A 2F53B 2ZKHL 4Y2DB 2YWZA 1T5XA 5CZKA 4WRLA 4S0SD 5B39B 3TZVD 1EAJA 5C1MB 1CS6A 1ERNA 3MACL 1G9NH 4QWWC 3RWIA 5ILTL 1QBLH 4R4ND 3QULA 4N0CC 2EIDA 2BCKA 3SDAD 1FLTX 3A6BH 3OX8B 4Z7OE 1A6WL 4XP4H 4U6HA 4QHUB 1OGAD 1G7JA 3GRWL 4ODUA 2PKDA 2IBZY 5JTWA 2XZCH 2NNAA 1HYRC 2APTA 3WIFB 3T1FB 1YEFH 3EYQD 2FB4L 4G43A 4P4KA 5J7CC 2DL2A 3IETA 2OZ4A 3U7WH 3DRTB 4CADA 3F12A 1F90H 4NNPL 1C5DB 4MJIA 3TA3D 2XFXA 3TVMB 1Q9KB 2B4CC 1IFHH 4OCLC 1ETZA 4XMPH 5DQDL 1YECH 4PGEB 5TFSL 1I8IB 3BHBA 3FO0L 2FBJL 3L3GB 2DJSA 4U3XA 4JFQA 4PY7A 4IIQA 1BOGA 2Z92B 4AYFA 3X14B 4DKEH 3OHXB 3V5DA 3D39D 2ICCA 1O0VA 2P8MB 3DYPA 3OTTA 1SYVA 4OLVL 1I7TB 1U92B 5D93B 1IM9A 4LSPH 3GMPA 3OKOA 3CFBB 4KDWA 1RURH 4HIEB 4HIJA 4MS8A 4L8DB 3G5VB 1RUQH 1CXKA 4F15B 3VFUA 1S8DA 2D7TL 5DK2A 1FO0H 4XPHL 5IK3A 5I71C 1A1OA 3K4AA 1OF2A 3P9LB 4YPJA 5IG7B 4PPTA 1UWGH 4O4YL 3MSPA 3S3PA 1DL7H 3K4ZA 1FAIL 1FN4B 1H3WM 2I60H 5LCVL 3I50H 4ZO6A 4WHCA 4MZ3A 1ONQA 4LIQE 1UH3A 3LB6D 4JRWA 4RMQA 5EWIL 2WUCL 3KHQA 1YC8A 5CSZA 1NCUA 2AK4A 1J1XL 2YN3A 3FQUB 4LPWA 4IOFC 4W6YB 5KSVB 4P2RE 4R2GD 5I8CA 5BCAA 1QRNA 3BEVA 4IRZH 3VWKC 1EFXB 3C5SB 2VSDA 4GQPH 2Z4QB 3MYJA 3EOBB 4L8SB 3MRQB 4G8EA 2G9HB 3SCMA 1IQDB 4MLIA 1HINH 4BM7A 5KJRL 4HJ0D 5IW1B 2OK0H 1A1NB 4PDCE 1ZGLA 4OFPA 4L3EE 5CZVH 5ADOH 5HYSA 1UCBH 2OI9C 5BVJB 1NL0H 5KVDH 1T5WA 5HI3C 2F54A 3IXAB 1AD0B 4YFEA 1P9MA 4P99A 5FUZH 2BNQA 1D5ZB 5I74C 5C0GA 2R9HD 2CGRH 5E56A 5CAYB 3HPJA 1MJ7L 3MRPA 2CRMA 5TH2A 3IDXL 3SE8H 3GSQA 4X9GA 4X6CA 3BSZL 4OCSH 5SX5H 3N1MC 3U36A 3UBXB 5CUSH 4F2MA 2DJ4A 4QNPE 4OLYL 4Y5YA 5C0IB 2EKSB 3FN9A 3V5HB 5C2BL 3BH8A 4X6CF 1A9EA 3QWRA 2R2HB 3EJJX 5FA3A 4CVZB 4H1LA 5F7KC 1X7QB 2VUOA 3UJIH 1KPVA 5EU4B 3O11B 3RJDA 3T0ED 2VZSA 4UNUA 5E8PB 3T04D 5KSAA 3BWAA 4ZS7L 1JCKA 1LO3H 1TVDA 2DQEH 3PWVB 3ZE2E 3OKLA 5E1AB 2ESVA 2X40A 4ZTOH 4IOSD 2HG5A 1A9EB 1D9KD 3Q6GL 4LASH 4G7VL 4YGVB 2Z93B 3VXMD 4TSAL 3C6LB 4E0RB 1DDHA 3C8HA 1J8HB 3L3DA 3ZDXF 4KV5F 4GW4B 5L9DH 4F7CA 4AY0A 3MJ9A 2X70B 3EO1B 2AJSH 3DETC 1H15B 3I6GB 5ABDE 2V2TB 4I0CC 1D5BA 3REVA 3QEQD 5A2FA 3V0VB 3VXQA 1Q0XL 1K4CA 2H32H 1DVFA 1RUPH 2AXFB 4OIIL 4Q0XH 5L2JA 3MXVH 1PX4A 2R29H 3PHSA 5D8JH 3FOLA 4OQTH 1QFWI 2EC8A 1JUFB 1CFSA 2B1HL 4ODXA 2DQIL 4HUXA 4NQDA 2CLZA 4JRYB 3UMTA 2R1XA 5I71B 5HHOB 3HMXH 4UILL 4X7CC 1XIWA 3CSGA 4X4YB 4PJDB 4MA7L 3VWKA 2IFFH 3V7MA 5L6YH 2A77L 2ITCA 1NC4D 3L3KB 1IKFH 3TGXA 5J89A 3BAEL 1JE6A 4JO1L 2X1QA 1TLKA 3OZ9H 4H1LG 2YD8A 1GGYA 4OJFL 4G5ZL 4NUGH 3RDTC 1AXSB 3P4LA 4Y4FA 3B2VH 4BUHA 2OI9A 1HHIB 1NPUA 3FOMA 1L6XA 3SGJC 1J1OL 4OI9A 1KPUA 4O02L 4XAKE 4BQ9A 4BSJA 4IS6B 1EHXA 5IJVA 2GSGA 4HSQA 5ETUB 1QA9A 2YUZA 3WXWH 1JZ5A 2PR4H 4JKLA 4KKAD 3A0OA 4PJIA 1UM6H 1OWWA 3DVGA 3QCTL 5DLMH 1BOYA 1AXTH 4KZDL 2Y72A 1XF4B 1KB5B 4D9LH 4NDMB 4PJIF 2CRYA 3HZKB 3KPQA 5CIPB 5TDNA 1F45A 3DXAD 3GSRB 4I0PC 4NKIH 4U0RC 5I74B 1F6LL 1QLRA 5TE6L 3O9WC 1BFVL 1MNUL 3HZMA 4LLWA 4XP9H 1CCZA 1NFDB 2Q8BL 2Z8WC 4GG6B 2NXYB 4RQQA 1B3JA 5FO8A 1FYTD 5JHDE 1RSFA 1UT9A 2GITA 1Z2KA 4OCXH 3IKCA 3MODH 1TVHB 4LCIL 4ZSOB 1Q9LA 3EFDL 1PLGH 4DZ8A 4LLUA 4U1KA 2JKXA 3BGAA 1B2WL 1RJZA 4FQQA 5DRNB 1Z9OA 5CCKH 1Z5LA 3TV3L 2VLMD 1KT2A 4BSVA 2EXYD 1KUMA 1KB9J 4OUOA 1JYVA 1M7IA 5AZ2H 4Q9RH 4NCC1 2KUTA 3OB8A 3T2NL 5D71H 4LSQH 2J12B 1PZ5A 3DURA 4G6AC 1XCTB 3KLAB 4LHUD 2ARJA 1U8IA 2E6QA 3HB3C 1RJZB 5J6HB 2R39A 2EE9A 1CZ8L 1BBDL 4ZNCD 1RZKL 1WCQA 2BVPA 2F8VA 5DD3L 4FQHA 4U6TA 5HXMA 3GIVA 3IDYB 2EDLA 32C2A 1KNOA 4E41B 1QSEA 3ARZA 3UDWA 4LCWA 1K8IA 1MREL 5EIIA 1YMMD 4EDXB 3IYLW 3X11A 3IJHA 3FFCD 3SGDH 3CXDH 1LVEA 1NGYB 2H9GA 1MWAH 3ERYA 4G6ML 5JO5B 4M6OL 5HVFB 3MRFA 4N68A 2ARJB 3THML 4Z0XA 3L5WB 1B0RB 4DAGH 3P4NA 3LKNA 4FQ1L 3MV9B 3BP4A 1I7RB 2V2WB 4M8QB 3RVTC 1QPPA 1JRHI 4OGYH 5C08A 2OSLA 4ZNEA 1TZHA 1FL3B 4JB9L 1I3GL 2DM4A 3TNNB 1WZKA 1C1EH 4M5YH 3TPKA 2KZWA 4HT1L 4GFTB 5T1LD 5E2UL 4PJHE 3BUYB 3RDTB 4M61B 5FV2A 5EZLB 3Q5OA 4HAFA 4XNUL 4PJXF 4S1RH 5FKPA 4I2XE 4HS6B 1P2CA 5D7LD 2ADIB 3KNBB 2FIKA 3ZDZE 5C0RH 4AIZB 3F7QA 2FECI 4RZCA 4Z8FH 4I0PA 4RDQF 3VFOA 1G7MB 4HIXL 1BGXH 4KROC 3WSQH 2GSIB 2WNGA 4XNXH 4OSUH 4RWYH 4ELME 4NZRL 2JJWA 1QR1A 3CH1A 1A7RH 4UQ3B 1A7QL 2VDQL 1U8PB 1EUUA 4Z78B 4F7EB 4I4WA 3QIBA 3ULUC 4NO0A 4EUPG 4S11A 1VB9A 2H26B 4WJ5B 3PGDA 1GGIL 2QADC 4NZTH 4POZC 4YHMH 2MMXA 2FIKB 3E0GA 5LBSH 1BD2A 2VL5B 3VXUE 4U0RB 2JLLA 4I0PB 4MVBD 5DFVD 4QOKE 3G9VA 5FM5M 3O9WB 1A9BB 3BKYL 1TVBB 3VFPB 4Z7VA 4WHTA 4LOUC 4L4VE 2QR0A 3G5YB 3HI1B 4NZDA 5C0CB 5I1JL 1W8OA 2IQAB 5GGTA 1T4KA 3KR3L 4Z7VF 4YGAB 1ZEAH 4CUCA 1N6UA 1GIGL 5CLTA 5D7JD 4JFDE 2E6PA 2J5LB 3E6HA 4JDVA 3DROA 3ZDYF 4MXVF 2XOTA 5GRUH 2P5EA 1YQVL 4R4BB 5BO1L 5E2TH 4NHCL 3QUMH 1H3GA 4F9PC 3B5GA 3PGFL 3AGVA 3IU3B 1WCBA 5D7IB 1T1ZB 4QCIB 1MCPH 1T2QL 5HGHA 4BH7A 3CVHL 3KPRE 4HH9B 3TPUE 3FONA 3O3EB 2YS4A 1U8NA 5EC2B 4RDQG 3VXSB 3DROB 4HJJH 4AEHL 5IMLA 1YEGH 3BGMB 4FZEH 1RU9H 4TTGA 4HWNA 1VPOL 5F3HA 1BLNA 3JWNC 4QRRD 4ZUSA 5EZIL 1HQRA 4L4TD 2Q3ZA 4JM4L 2VAJA 1YDPA 5IBUB 4L5FL 1KIQA 1S7QB 4YNYB 2ZSWB 4I77L 1F4YH 5K9OA 4MA8L 4U7SA 5J3HC 3TN0B 1DUZB 2W9EL 5L7XH 3OKMB 5DC0A 5HY9A 1ZT4A 2DI7A 3DRQA 4P9HL 4NM8H 2DWEB 3BPOC 5E7FA 4X5LA 5I1EL 5DJXA 3JUYA 4PRID 1AJ7H 4ZOBA 4LCCA 4K2UL 5EA0L 1QQDA 4XP6H 3G9AB 3N9GL 4QRQA 5JLZB 3BZFA 1N0LA 5C6WH 1A7PH 4KUCD 2W0FB 4KMLB 3VFVA 3NPSC 2AKRB 3R8QA 3AMLA 1NGWB 1EZVY 5L88H 2GTZA 4LIQL 1RMFL 4F9LA 2P5WE 1S78D 4OI7A 2JJTC 4NKDA 1CGSH 4RMRA 3PNWA 5DURB 1FYHB 5HHPB 1RFDH 3D0LB 3MRJA 3VXOB 4WCYL 3VWJD 2GI7A 3KXFB 4J8RA 4XCCH 3W81A 3DV6A 3MLSL 3P0VH 4J3WA 3V5KB 1QBBA 4FFVD 1KCLA 4MJ5A 1I8KA 5D1ZB 3ULUF 4G3YL 1D5MA 3QIWA 5IVXE 3QXTA 4ONHB 2H1PH 1AR2A 2HWZH 1BJ8A 2A6IB 3JTTB 3TJEL 4UT6L 3PXJA 3DBXA 4LCYA 3DX8B 3VI3E 3QDMB 5E6IA 1G9MH 2BFVH 3IRZA 5C7XH 3F5WA 3CXHK 4NZJA 1RAMA 5IOPB 5KS9E 1NFIA 1A3RH 4OZGB 2YMXH 4HDIA 2AJVL 2DQUL 3SEPA 4EN3C 3QDJE 1I75A 1MCJA 5T33L 4LP4A 4AH2B 4YQXH 5FM8A 4I5BA 2EC9U 1RK0B 4HUKB 2A9MH 3T8XB 5KAQF 1FSKC 4ZOEA 4W6XB 3EO0A 1D5XB 4U1MA 1LNUA 3C08H 3TFKC 1XGRA 2PF6A 1QKZL 3WFHB 3NZ8A 5CSBA 2FJGB 1V3JA 5EIVA 1U8LB 2V5RA 3NFSL 1UZ8A 3CMOH 4WEMB 3RNQA 3SOBL 3CSYB 1W0WA 4QXUH 2BNRA 5H8DA 6CGTA 3T0BA 5MEOB 1CQKA 1A7OH 1T0NB 4CN6A 1X5JA 1E4KC 3O8XA 4PJFA 3L5XL 4XT1C 1WICA 5FM5O 5GIRB 4JFEA 1VA9A 1IEBB 3P2TA 4MCYA 1FORL 3FO2B 1JGUH 3W0WB 2ICEA 4TUOA 5DA4A 4PJFF 1PKQB 4Q9QL 5I9QB 1KJ3L 4FABL 3AAZA 3NZ8B 1JTTA 5ILTH 2X9YA 1F4AA 2GUOA 1RZFL 4F8QA 1C12B 3PL6D 5IB3B 3WBDA 5F7NC 5L8LB 1RJYA 3GRWH 3QEUA 4V2CB 3VFSB 1IGFL 2FB4H 2DYPA 3EOAA 3GSNL 3QRFM 4Z5RA 4ZFOL 3SKOA 5JPMB 1WWWX 5DT1L 3V2AR 2FBOJ 2OQJB 4OB5L 3ALPA 3OAZK 4FFYL 4OFVA 1HXMA 4FFZH 2APBA 3QEHA 2ZUXA 4K94H 5DQDH 1P4LB 3FO0H 2FBJH 2JJTA 4E9LA 5KAQG 3IAPA 2R2EB 3RTQA 3GI9H 2A0LD 1V05A 2ADGB 4JY5L 4JFPB 4P46C 4PB9H 3INUH 3HUJA 1MHEA 1KSRA 3QO1B 1HCFX 3QXAB 4OLVH 3TBTB 4ODWB 5DK0B 1CTNA 4XP1L 1IQWL 1YY8A 5C09B 4H25A 2D31A 3HUJF 2VDPL 1UH4A 5EC1B 4P3WA 2IH3A 5DSCB 3V6BR 5SWSB 2ZNXA 4NT6A 4MJIE 2D7TH 2VITA 4V1DB 4XPHH 5IW6A 3ULSB 3IDGA 4HPYL 4N0FB 4NRYB 5DJ8A 2W38A 3SDCB 1NKRA 3QQ9C 1F97A 2EIBA 2FH8A 2VLLB 2BXZA 3MJ6A 1DLHB 4P23C 4ZTPL 2AXGB 5EWIH 1Q8MA 5JUEL 1AGFA 2BSRB 5JXED 3MRKA 2WUCH 3KLSA 4S1QH 2FYYB 2Y06L 4HX1A 1MCWM 1OGTB 2CDEA 1J1XH 3C5JB 5IGXL 3O6ML 4GAYA 2VLRB 4OBRA 2ZCKL 2X4OB 3MBEC 1IGML 1QOKA 3VFRB 1D6VL 3F6LA 3I02A 5T5FH 2CUIA 3WFDL 2WP3T 1U8OA 5KJRH 4XBGA 1QFWM 4EN3B 5I18L 4N9GA 4U3HA 1JPSH 1NKOA 1R5VA 1FSKB 1OL0A 5KSUB 2ZPKL 4XHJD 5JDSA 4JZOA 3DYMA 3DGCR 3T0VA 4PG9A 4Z7WB 4KZEH 4MD5A 2AK4E 3C8DA 4AEEA 1AKJA 1MFEL 4GRWB 1TJGL 3IDXH 3JWDH 5ITFB 5JW4R 1FC2D 4PJEB 5EBLA 3FB7B 3V7AG 2BY2A 5D1QD 4NOBA 3QFDB 1Q72L 5J12C 1CYGA 4OLYH 5J1SC 1HSBA 3ETBF 5F7WC 1TZIB 3ARDD 1I85C 1YNLH 1ZGLM 3GMRA 3PHOB 4L4JA 2X10A 3UTOA 2DIAA 4JZOB 1U3ZA 5TDOB 4YBLB 4FZ8H 5JOPE 3VRLF 1VKXA 5C0EA 3V9FA 4OFIA 3O3BA 3VG0L 1GRWA 2B1AL 2BNQE 4ZFGH 5EPMB 1QZ1A 2YD1A 2FO1A 5TQ0L 1N8ZA 2EICA 4OZIA 4G8GD 4X6BB 4X6CE 4YDVB 2XA8H 1ZAGA 5C3LD 4QHLA 2HH0L 1XZ0B 4G7VH 1FNGA 4TSAH 5FGBC 4OZIF 4X6DA 3H42L 1MY5A 3CFJB 1NC2B 4KC3B 3LEXB 2WIMA 2EDBA 3PWNA 1J8HE 3U79A 3U83A 3WO3B 3GMQB 2GCYA 4X6DF 4AMKL 1R3HA 3VRJA 2N7AA 4POUB 2H2PD 4P46B 3RZCD 2JELH 2C5DC 4OIIH 3WEXA 2H3NB 4WUUD 5ID0A 3MFGB 5BMFL 1FVCA 1U8MA 3EFFA 1F6FB 2ILLA 5GGSA 5D9SB 4MXQD 2R1WB 4NQSA 3MLRL 3ZDXE 4KV5E 4F7MA 4JPKL 2B1HH 4HC1L 4L9LC 1V8HA 2DQIH 2O5YL 3V6OC 2X7LB 1UWEL 2OTUA 2F5BL 3OGCA 5D2NB 2JB6A 4HS8L 5E2VH 5C0ND 1TCRA 4UILH 3STLA 3I6KA 4XNMA 2GJJA 5BZDB 3W9EB 4Z18A 1QO3B 3RWEB 4P23B 4HV8A 2AP2A 3BAEH 5ENWB 4OUUA 4PJDE 4UT9L 4FMFA 3PWPA 5E94A 4LVNC 1QEWA 1XT5A 2WWKT 3VMOA 2N4IA 3RNKA 3QHZH 3O2VH 4Y4KC 1FNHA 1M4KA 4I48A 4NN5C 1A7BA 3ZTNL 2WQRA 1UWXK 1R3KB 2IF7A 4WDIA 4L1DA 2JK5A 4NQDE 4O02H 5F88A 3LHPL 2NR6D 3MBEB 4M9OA 1NGXA 1JHTA 4L3AA 1EBAA 4A6YL 4LKCB 1MPAL 1A4JA 3I84A 4BFGA 2OR9L 2YD5A 2Z31A 2E7CA 4EEEA 3V6FA 2EE3A 1YN6B 2ZOKA 3AS1A 1JWSB 5IHLB 1CFTB 1V3MA 5F7MC 3UROR 1BIIB 1I85A 4PD4J 3VGEA 2HRLA 3KYNB 1JNNL 1UM5H 4PLJC 4L8BA 4MSWA 4FG6C