3BZFA

The human non-classical major histocompatibility complex molecule hla-e
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title Subtle changes in peptide conformation profoundly affect recognition of the non-classical MHC class I molecule HLA-E by the CD94-NKG2 natural killer cell receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 276
sequence length 276
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bzfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bzfA01
2V2XA 4FP8L 3UC0L 5T3XE 3RZCC 3G5XB 4LPVA 3MRIB 1B0GA 5AZEH 4LSSL 3SJVD 5JLZB 1LP9E 2YXMA 4QOKE 3ARFD 2AV1A 4M7JH 1OAXL 3O81A 2LABA 4G8IA 1XT5A 2OJZH 4OZGA 3VRIA 5J6GA 4Y4FD 5JO5B 3ZKXC 1NANH 5GS1C 1CN4A 4WHDA 3V4UL 4AZ8A 5LAXA 1AE6H 1EGJA 2PYEB 2DJSA 2YA2A 3D3VA 4KRPD 2JIXB 5GRWA 4PRPE 5I8EA 1Q9LA 3Q3GA 4I3GA 3QQ9D 4MDIB 3O45A 4IOIB 4QRPD 2VDKH 4G6MH 3TH2T 1YDPB 3NCJH 5IHUL 2CH8A 1WK0A 4KI5E 2ZCLH 2AXJA 1S7XB 4WW2B 3TO4C 4PS4H 3BZFB 1NC2B 5GZOD 1EHNA 4I0PA 2BXZA 5I9QC 1PKOA 4UB0L 1TQCB 3MNVA 1QRNB 3KYAA 5JNYB 1YEKL 4LAJH 2C3WA 2OCFD 5DK0A 1KCRH 2ESVA 3HR5A 4X4XA 4KXZH 4NPYB 3LD8C 3VG0L 4D9LL 1MWAL 1JMZA 1KJVA 3X3GL 2V7NB 1KJ3H 1XGTB 2Y1VA 4X6CA 3FTGA 2J4WH 4GOSA 1BFOB 2ED9A 1WLHA 3OPZH 4U1IB 5CZVL 3GSWA 1CDUA 3C6LD 4IDJH 4U0QB 2DQHL 2Z31A 3BX7C 4CUCA 2IF7A 3TT1H 2WWKO 2Z8RA 3L3GB 3B9KD 5I6XB 2BXYA 1P5VA 3BKMH 5F9JA 3PWUA 3EO9H 4AEHL 1BLNA 3KPSE 1LE5A 2JTDA 3HS0B 2DQDL 1MFEH 1CZ8H 3CXHJ 1MJ7H 4LL9A 5IROA 1QYGL 3VD7A 1SJVA 5C0CB 3O8XA 3FAWA 4PRHB 2KZWA 3NIGE 5MENB 5ICZA 2N4IA 4NO2A 4KPHH 5IB5A 1C12B 1ZS8B 4AQOA 4EQ2A 1HILB 5ESQB 3UTTB 1ROWA 2Y4SA 1LP9F 3U4EB 3JWDH 3SKNB 3WUWG 4XCNA 5D70H 1UGNA 1RIUH 4Z77A 3DGGA 1HE7A 1BBJB 4GKNB 4U1NA 3RNQA 5CEZL 4Y2DD 1X7QB 3FQXB 5CJXA 1OF2B 4P59L 2F54E 5T1DH 4NM8L 5FUCC 3MLPA 4JFDB 1GZPA 1MWAA 1P6FA 2XKSA 1YN6B 4TULL 4ISVA 5IVNA 1K5NA 3MNWB 4G59A 5DMIL 2X89D 4PJGA 5C2BL 2VZUA 3N9GL 1U8LA 5I18L 2FWOB 1XAUA 4KI5F 2ITCA 1RPQA 3SKOA 4JVWA 3ROLB 5HPOA 1BD2A 4I9WE 4QT5A 3S7GA 3ZMRA 5IR1B 3PWPE 5DJDB 2XWTA 3VGAC 3OGOE 3PDOB 4KVNL 1A22B 4TVPD 1WZ1L 5HGHB 4IOSD 3DARA 1FRGL 5DGRA 2B5IC 4EI6B 1HSBB 5L2KB 4Q0XH 4OQ1A 5BV7B 3MQIA 1MFDL 5IESL 5CBAA 3KJ4B 2IPUG 3VD5A 2ZNWA 3MRNB 3BW9B 2QQKL 3IAGC 1FFPA 3LS5L 4GRLA 1GHFH 1RURL 5EU3B 1MCLA 1OSZB 3QUYA 2G9HA 1QP1A 4HS3A 1ZT1A 1TCMA 3IGAA 4PJBB 3ABZA 3H9HB 3P9LA 2BNQE 3GSNA 1PEWA 2DBJA 4KY1L 3TA3C 1R5IB 4JFZL 3QDJA 4K9EL 4OSUH 1SEBB 1XIWC 4M3JA 5IK3B 2P48B 2J1KA 3BP4B 3HZMB 4IM8A 4ZUSB 4CN4A 4MNHB 3ILPA 2BERA 2YN3A 2DDQH 3BEWA 4MS8D 4XNMB 3UYRL 4HG4J 2XZZA 4GXUM 3MRKB 1PZ5B 3BPNC 1NBVH 4XCFH 3SGKC 1I1CA 4NC0B 1U36A 1QACA 1A14L 4LCCB 2VDQH 4HXAL 5CJOL 5IMOA 4WDIB 4PRBB 3NIGF 4A6YB 4NT6A 1OQXA 5FGCE 5LXGH 4FZ8L 1LK2B 1JGVH 3MLUH 5CD3B 3QEGL 1IAMA 4NN6C 2NYYD 4FFEX 4J6RL 4IOFD 1IAKA 1CS6A 2UWEA 3OZ9L 4NC2B 4U0RB 4GFTB 3O6FD 1OAYL 4Q6IC 5IF0B 3ARDB 3JXAA 4NNXB 1WISA 1S3KH 1C5DA 5IVXA 1LO0L 3W5NA 5KJRH 2VC2L 3NOIA 1N59A 3W82A 4MGXA 4NJ9L 2EXYD 1MFAL 1FBIL 4K7PX 3D0LB 2AXFA 3C5ZB 3D0VA 1HYRC 2ICWA 5FV1L 4Y19B 4RGOL 4UV4L 3DNKA 3DXAD 2AI0H 3RVWC 4Z0BL 1UWGH 4L4VE 4CVZA 5F71A 3CFCH 3ULVD 3TFKC 4LSTL 2RGSA 2NXYC 3QNYA 3SDDB 3QEHA 3TBSB 3CDFA 3HNSL 2W0FB 3L6FB 3HMWH 2VKWA 4P5TA 2ADIB 4HXBH 1UKSA 2WBJC 5EO0B 5F70A 5GJTL 5ACLA 5C0AA 4G7YL 2GFBA 1NDGA 1BVZA 4NO3B 3WFCH 1TLKA 3VFWB 1H3WM 3T0EE 1I8LC 2A6KA 2PXYB 3NZHL 3HAEG 4JZJA 4WEMB 3X12A 1E28A 2Z4QB 1ZHNA 4CMHC 4Z78B 5D1XD 1OY3B 5D4QA 4JN2A 4TNWK 3A6CL 4AENB 3CFEA 1GYAA 2VAAB 3UDWC 5I15L 4N1CA 4M1GL 4J4PD 1W72A 4WTZA 2PCPA 3BP5A 1V7MH 4L4TA 3PJSB 2PYEE 1DSFL 2JCCA 1Z5LB 4YHOL 3GB7A 4Q9CA 5BVJB 3VXOB 1XZ0A 5LGHL 4ORGA 5JPNB 2I60H 2DN7A 3VXTB 1NCAL 1RK1B 2AJSH 4I48B 4QF1B 1QFOA 1HHIB 1LO3H 2YC1B 4M6OH 4EVNA 3IDGA 3HPJA 1EXUA 1C5CL 1B0RA 3HNVL 4YUEH 2OR7A 5IW3A 4PRIA 3SOBL 3H42L 1TXKA 1UJ3A 4OFPA 3F58H 2QR0B 2AKRA 3NFSL 2MQ3A 5E08H 4X8JA 4ETYA 4RAVA 1QRNE 1XGYH 4JY5L 3W11D 2KL6A 2AERT 2K7PA 1YY8A 1Z0NA 5D7IA 4P3WA 4X9GA 1NFIA 1S7UB 2ADGB 5ANMB 4NQDB 5ESVB 5ADPH 5F7EH 1EO8L 5TDOA 4OQTL 3LS4H 3RWDB 4NSKA 3D39D 2NY5H 5TE6L 4ZMAT 1LEKB 1WTGT 5FB8B 2GTZA 4GUPB 4RISH 1FQ9C 1QSFB 3V5DB 3WJLC 1SY6H 2AV7A 1I3UA 3PL6C 4KH2A 4F2MB 5BZDB 1S7QB 4MSWB 1JGLH 1EFXB 3L1OH 4L8DB 4JDVB 3UAJD 3HC3H 2A9NL 3GBLA 3EYUL 1F4XL 2VDPL 1D5XA 5L2JA 2F15A 5C08B 1A8JH 2A74B 4MQ7A 4PRHE 2A0LD 5MENE 1KIPB 2EYSB 3QHFH 3QO0A 1RD6A 3ARED 3Q1SL 4KU1A 3R06A 1EMTL 4WUUB 4GMSL 2FL5B 4KDVA 3LKRA 1MVUB 3WFEL 5I1HL 4E0RB 2R56L 3MUY1 1KJMA 2CKNA 4HS6B 1P7KA 4V1DE 1JRHL 1QHOA 1KGCD 1X3DA 4N0CC 1MREH 4TVPH 4Y4KB 3T2NL 4R3SB 1I1AA 5JDSA 4RFEA 3IAPA 5FYLD 1J0YA 3GBNH 1OGAB 3ZO0A 1GGUA 5I75B 5J57B 4TUKH 4MXQC 4X98B 3EO0A 2R9HD 4IMKA 4ZNEE 3O45B 4XHJC 1RIVL 5E8OA 3HUJA 1P84K 4YHML 4I4WB 5DURB 3QIUA 4NQSB 3FT3B 5EBMB 5JXEC 1NGQH 4IRSD 1F58L 2AGJL 1MI5B 4MYWB 4P2RB 3SPVB 4YBLB 1MLBA 4YZFE 3MA7B 3BP7A 4PBWD 4PJXB 1JPTH 4TVPE 4HHAA 1JTPA 5CILL 2VN4A 2BOBB 2ESVB 4JPWH 4PGZA 3MRRA 3QG6B 2V9RA 1FYTA 4Y16A 5L2KE 4U7SA 2Q7NA 3MRHB 3UYOD 3IS1X 1QLEH 5E56A 1I4FA 1CK0L 4RFNC 3A6OA 3RWCA 1A3RL 3KPLA 5IIEB 1OGTA 3GHBH 4NWUL 3DV6B 4M62L 1YUHA 2WUBL 4Y1AA 3K81A 2D7MA 2NCMA 1XH3A 2ADFL 4PJBE 5IVZA 5IBLD 2Z31D 3K8KA 4DEPB 2AK4E 4N8VA 5MP6H 4LK4A 3DHMA 3GO1H 3MLRH 4OM0H 4ZOCA 4ZTPL 2BSRA 3W2DH 5KANG 4GRWH 2VXSH 4PB0H 5TDNA 4YDKL 3O0RH 1YJDC 3NIFE 4ZOBA 5C6WH 4M6NL 3VD9A 1AY1H 2P5WB 4ODWB 4CMMA 1AXTH 3O8XD 3TV3H 1GGBL 5D1ZC 4M3KB 1TJIL 1U58B 3WFZA 4P4RA 4RIRB 1WBXA 2ICWI 2NY0C 4HV8A 3HI5L 5GGQH 5FIEA 1DQDH 4DKFL 3RTQD 4CBPA 1WFTA 1BJMA 2HT2C 3NABH 5DUMH 1GIGH 3CDYA 4MQXC 4QRUA 1EBPA 2VZ3A 3WIHH 4RGNC 4KQ3L 1ZV5A 3IJHB 3PQYE 2LU4A 1HINL 5IT2H 2CGRH 3TVMC 4FXGB 2D2OA 3RDTB 5LGJA 3RNQB 4Y5YC 5INDA 4GRWE 4EDXB 1BX2A 4JFXB 2DLEA 1KEGL 5B8CB 5DJ2A 5FK9B 3O3UN 3L7EA 4RWHA 3WL9B 3CSPA 1MIML 1GGIH 1PG7L 2IFGA 4AEIH 5IW1B 3QDMA 4ZYKA 5EU7E 4LASL 4JCLA 2VZ1A 1U91A 2ZCHH 4M00A 4HZLB 3SKOB 3ZTJH 4LCWB 2BY1A 2UZYB 4XMLL 4QRSB 7FABH 3MRCA 4BELD 5I73C 5KVGL 4OLWL 5I1CL 4YIQA 1HH9B 4YZFF 2VLME 2BRQA 2XWTB 5KSAD 2FIKA 4LHUD 1XCTA 4N8CL 5HJ3B 1BD2D 3MRLA 1DBAH 1HQ4B 1BZ7B 3KXFA 3OHXB 3RZCA 5KN5A 1A5FL 1J11A 3HG1A 4KMTH 3S88H 1FSKB 3ZKNC 2ZNXA 5TFSL 1BVLA 1ADQL 1X5JA 3VMOA 2HVJA 5C0EB 1G9NC 2VMFA 1TQBB 2PTUA 1Q9KB 3RWJA 4BZ2L 5GS1A 4MJ2A 4GRLD 2APBA 2BVEA 3QUYD 3AVEA 2IPTH 2DMKA 5ICYB 4XMPH 4GLRI 3NFNA 5HGGS 1Y6KR 3FFCB 4LSVL 3GMLB 4OCSH 3QIWC 4KK6D 2BNUB 3FFDA 3VFMA 4MD5A 1YEHL 4JY6B 3MSPA 4IIQC 1NAMH 3QPQC 1FGNH 3QDJD 2JJUA 4MWFB 3THMH 1YYMH 4KMQA 1QA9A 3RUGB 5F1IB 3TO4A 4ZS6D 1LEIB 5B39A 2DQGH 1J88A 5EZJB 5I0ZA 5IMOB 3LEVH 3X14A 5DK2B 5GPRA 5CEZD 3F7PC 1CFQA 4UAOC 2XPGA 4ZFZB 1FFNB 2FX7L 2VLRD 4NFCA 1ZEAH 3O4OC 4UIKL 3CX5J 5F89B 5DMYA 2A6IB 1YMMA 3MC0A 4OLEA 1SYSB 4KKAC 1L9MA 4UUJA 3WNPA 4H1LH 2DQTH 1N7ML 2BC4B 4MJ5B 1VEOA 4RAUA 1UJTA 4UDTA 3WFBH 1BOGB 3GMQB 3N1QC 5GSVA 1R0AH 1QLRA 1N59B 5DJYB 2EDTA 4GRWF 4XNZC 4L3CA 3BIBX 3D0VB 3D39E 1EPFA 5ANME 4AT6B 2DBLH 5C0DB 4O2CA 2MPAH 3HA0A 3CLEL 4PJIE 4XAKD 3C60D 1ADQA 4F7CA 1YNLH 3QUKA 4X7FC 2DL2A 3PDDA 1VFMA 2D3VA 4NRZA 2X6MA 3GIZL 4R7NB 3VFTB 4PUBH 1QSFE 3SDYH 3VXPA 3FB6A 1EGJH 4WU5B 2WY3A 1WIPA 2FGZA 2EDFA 5EIQA 3EGSB 3TYFB 1WFOA 4OZFA 4UIMB 1HOCA 4JFQA 1AXIB 4QHLA 2GJ6A 3QPXL 5EUKB 1BPVA 4P5KB 2GFBB 4RQQA 2XXMB 4P5TD 3H8NA 1OP9A 1CFTB 1ZMYA 5E6ID 4MAYB 5C0AD 1B4JL 1FO0L 4XP9H 5CLTA 1HI6B 2EIEA 4W81A 3RY5A 4ODBD 1EJOH 5F44A 3K46A 4Z5RA 5I8CB 43CAA 4TSCH 4OLVH 4LHJB 2ITDB 3CZFA 5TGBB 2APXA 4OZGE 5DMKB 3IDUA 5ICXB 1R5VB 3ELAT 4MD4A 2MMXA 3I50L 4X7DC 1BQHA 3BP5B 4LDLB 3SE3C 3LSOA 3D3VE 1KTDA 5C7XH 2DRUA 5DD5H 3DUSA 4JCMA 1FZMB 4KTYA 4MMXC 1AR1C 4POYA 4ORGB 5LBSL 4MA7H 3F7QA 1J5OL 4P23D 1R6VA 3HRZA 5CJQH 1CTNA 1YEJL 5HHMD 3MV7D 1OL0A 1E0OB 4FP8H 3GUTA 5BV7L 2PKDA 5ISZB 3IDGB 3HPJB 5ETUA 3AXLB 1EXUB 4XH2A 4ZO7A 1AFVH 1B0RB 2OTWA 2ZUWA 2Y9RT 4P2RE 1U93B 4JLRB 1OAXH 4O9HL 3CH8A 3IB4A 4X8JB 2H41A 1JRHI 4HWZA 2CLVB 2YPKA 2XWJA 4MD0A 2ESVE 3MA9H 1RZ8A 2CUMA 5INCA 5I76A 5F7FA 1BQUA 3WEXA 5H35A 2WUCL 4NOFA 3WMSA 4PJAA 4HWBA 3BH8A 4K71B 4K3DH 4V3EB 1T21B 2JJTC 1HXMA 4I2XA 4BSWA 4X6CE 3V6OC 3TA3A 1L4IA 1FO0A 3MXVH 4PJ5A 1XIWA 1S7VA 1TNMA 4PJIF 2FJFB 4JJ5A 1P5UA 1FNHA 2GAZA 2DQCH 3GJEA 3QCVH 3SGKA 2W9DL 1YEKH 4WHTB 1T7VA 4IRJC 1WEJL 4OB5L 3W0WA 5BCAA 4DQOL 5IQ9A 4X5XB 1KFAL 4Z7WA 2YUZA 3RWHB 1NH6A 4D9LH 1MWAH 5D9SA 3ZDYE 5F1NB 1QRKA 1GGYA 3X3GH 4NGHH 3MNZB 4ZD3H 5DD3L 3H3KA 5GGVY 1S7WA 3D85A 3W5MA 3IVKA 2VQ1A 4NQEB 2OI9B 4ESKA 1UCTA 4OFVA 1N4XH 4F7PA 3RI5F 2GSIA 4JM2C 4ZPVA 2VH5L 1KJMB 4Q6IA 1QVOA 4K7PY 4LPWA 4LLUA 2DQHH 2UY6A 3DO7A 5EIVA 3MODL 5I8KH 2Q87A 5HVHB 2NW3A 1UWEL 5D2NC 4OLUH 3P30L 4HUUB 4OZGF 1MRCL 3V6ZA 2GK0B 5F3HA 1RUKL 4PFEA 4H25A 4XNXL 3LKNA 3TJHC 4K07A 1XMWA 5IB3A 3F5WB 1QYGH 2BSSA 1MFCL 4S2SB 3P0VL 1OTUC 2DKSA 3HC0B 3UXFA 5HI3D 5J6HB 3TFKA 3RIAF 4PJGE 2GCYB 5GISL 1MRDL 2H2SD 5JQ6H 3T77A 3MLSH 3T0WA 1A9EB 3GSNH 3GGWB 1I85C 4D0CA 5DRNB 3WJJC 1BD2E 4HHAB 2WBJA 2PO6D 1ZLUH 4XCEB 2H8PA 3ARGC 2APTA 2NPLX 2HFTA 2KH2B 3MXWL 2Q8AH 5DJZA 4NNPL 5E2JA 3EJYD 5L6YH 1I8LA 3LB6D 4OLXH 5CEZH 1SYVA 1WC7A 5DEFB 4M5YL 1CG9A 4P59H 1FYTD 1H8OA 4G80A 4NM8H 4Y16D 3QDAA 3V4PH 3CDGA 4Q58C 1MHHB 1IZKA 2EDYA 4NBXB 5EOQL 5DMIH 4JQIL 3N9GH 4X4MA 4J3VA 5I18H 5F9WB 4NM4H 4X6CF 3UDWA 1YUHB 3MV11 1CQYA 4NZDA 1U8NB 1LE9A 3HMXL 1G6RA 1BM3L 3FFCE 4JVPA 1H5BC 1LDSA 4U4BA 4NQTA 5KSVA 2V5TA 5ID0A 4FRWA 1CL7L 1ND0A 1WZ1H 2VWEE 1IGML 5IHBA 3VH8A 2DYPB 1KXQE 2EIZB 2ZUUA 4WFHE 1DE4B 5DI8B 5AUMA 1DFBL 3RWEB 1EJ6A 1ZVSA 2FIRT 5IESH 5BVPH 4F58L 5EFIA 3O6LL 3ZDYF 3ZZ1A 3QI9D 5GRUL 2QQKH 3LS5H 1BWWA 3VFVB 3V8OA 5DZLA 5L8LB 2NLJA 3ZT7A 4OUOA 1KLGA 3SEPA 3MCG1 1EAJA 5E95B 1U2HA 5ITBL 1VKXB 4KY1H 2UWEE 4JFZH 4AQ1B 4NN5B 1ZWIA 5BZWB 5FDWB 3RWIB 3SQOH 4M93B 5INDB 4R97C 4LF3A 4WHYH 1T7WA 1Q9WB 4J2XA 5GRJH 5IVXE 1MJ8L 1KEMH 4JFFA 3KNBB 4UOW1 1A14H 3WJLA 3UTOA 5CJOH 3PL6A 1U91B 4FZ8H 4M9OA 4PJCA 3WIIL 3QDMD 5EBWA 4Y5XC 1AGFA 4ZDHB 4PJGF 1KT2B 2YKLL 3QEGH 1T83C 2IAMB 4FFVC 1T22B 1EHLH 4YHIA 2R0LH 5L7XH 2DL9A 1J8HA 1W72H 3OZ9H 1O7VA 3HMXA 4HUXA 3L3KA 1OAYH 2IFFL 2MFNA 2V2TA 1QQDA 2GT9A 2X4NB 3HE6D 1D5IH 3JV4B 4JHBA 1LO0H 1YQ2A 4Q7DA 3RBGA 3SE8H 5FOJA 5C0AE 3RZCD 4NJ9H 1UZ6F 5HD8D 3VWKD 3NIDE 1I7RB 1LEGB 3HG1D 4N0CA 1U42A 5EZIH 3RWJB 1SVZA 1CE1L 3B4NA 3K2UH 4RGOH 4UV4H 5J9PB 1NGZB 4QXTA 1LO4H 4GLRH 4U1LB 4R4BA 2PYFB 3KLHD 3DIFA 4Z0BH 3L3JB 5FHBH 5IKCB 1VESA 4XRCA 4MXQA 3MCKA 1W2KT 4NOBA 4ODHL 4XVSL 3DX9A 1QPXA 4MVBC 4WI3A 3SGJC 4L4TE 4OD3H 2JCCE 1QHPA 2VLJD 4ENEC 2P8LA 5GJTH 4HZAA 4OGXL 3VI4E 4ZFGH 3P4LA 4G7YH 3U7YH 4K94H 3X17A 4CAGA 3EAKA 3TO4D 3CH1B 1AD9A 5IOPA 3QUZC 2EE9A 4QTIL 5ITFA 1HH6A 2F9BT 3S37L 2YXFA 5AD0B 5E2WL 1F4WH 3FO9B 4JDZB 1R3HA 3L5XL 3LD8B 4PRIE 4BKLA 1TVHA 1FGVL 3TM6A 1JGUL 4UUJB 4NZJA 3BWUC 5I15H 4M1GH 1MHCB 2UWEF 4RAUB 1A4JB 3MUZ1 3ARZA 3L5JA 2F74A 1LO5B 1I8KA 3AU1A 3PV6A 4ZFOB 1QLRB 5D7IE 3V79C 2VDRL 3DRTA 4R96B 1H9VA 1VSCA 5EA0L 5LGHH 2YK1L 5IVXF 2YPVL 3E6FA 1ORQA 3MRJA 4XPHL 5CLWA 4LKXA 4MX7A 4X6DB 5DQ9A 2JIXD 2HJFB 1U8QA 4ODSL 3HNVH 1CXLA 3O6KH 3H42H 5JHDB 5LVEA 3SKMA 3GKWL 4DGYH 3NFSH 4MNGA 1VHPA 4KKNA 5FEBA 3VXRA 1G9NL 3MGTB 4QRQA 1I1FA 3PWJB 4NO0B 4OCRH 5D1ZA 4UZGA 1NDMA 3S36L 4MB5A 5HYFA 1NC2D 4M7LT 5DRXB 1P9MA 2KUTA 2DMCA 1CBVL 1M7DA 1Y18B 2GJ6D 4U2YA 3WS3B 4M5ZL 1EO8H 3TZVC 5GGVL 3RHWF 3HI6L 3NIDF 5L0QC 4NQEE 1KG0A 3U6RA 1R3LB 4BUHA 3CC5A 3TVMA 4PJHA 1F2QA 4OM1L 3TPUA 3MMEA 3I3DA 3BEVA 5HGDB 3TN0B 4Y5YA 3KPMB 1OB1B 4YHPB 5EULV 2BMKA 3WNNA 4PLNC 3P3YA 1FDLH 3PWVA 4B7IA 4DK3A 3I9GL 4XBPA 1S9KC 2YRPA 1D7FA 4QHKI 1II4E 3O6MH 4NUGL 2A9NH 5JW4N 3EYUH 2JCCF 4GMTL 3DURA 1KB9J 1S9XA 3MLWH 3TIEA 3HUJE 5ENWB 5E8EB 4AMKL 3GUTB 1MAJA 3WLBB 3FB7A 1EMTH 5I1JL 3VGAB 3RVUD 2R56H 3CFJA 1V3KA 2G5RA 2HT3C 2ZUQB 3KWWA 3TYGL 3ROOA 1T1WA 4ONGH 2YPLB 3K1DA 4LEOA 3T2NH 5C0CD 5HHQA 3DROA 2BK8A 3RU8L 3EYQC 4HWZB 4NJAL 2CRYA 4BH7A 5T5FL 1IGJA 3SDCC 3FQWB 1SJHA 4F80A 3DX8A 3BPOC 5HYJA 3EHBD 1FYTE 8FABB 3GIVA 4YGVA 3KPRA 1RZGA 1RIVH 3UTTD 4UU9B 5D7IF 3QDGA 5JIIA 5E2TL 4FS0A 4YHMH 1DBBL 2Y36L 3NFPA 4GXVH 1KPUA 3UMTA 2X9WA 3RIFF 3RX8A 3QIWA 4BZ1L 2L4OA 3OKLB 2AGJH 3S97C 2HRPH 2NY7H 4IIQA 3LMJL 5KSUB 4PJ5D 2F58L 4Y1AE 3KYKL 3GJEB 2J3SA 4I5BB 3FQUA 3LH2H 4PLJC 3MPCA 4FZEH 4LP5A 5EO9B 3ZKSD 4AIZA 2EKSA 2XKNB 3UO1L 3QIBB 2CPCA 1QFWM 2LQRA 4JFHE 1IILE 4LPCA 3B5GA 5TQ0L 3K80A 4BH8A 4LLWB 1T3FB 5EBLA 5EWIH 1ZANL 3W0WD 3AUVA 5ID1B 3IFNL 1N64L 2DWDA 5AAWA 1NEZB 3NGBC 2EDLA 2ARJB 1INQB 1IVLA 5J11B 3D85D 4UBDD 5B38B 3LAFA 4QO1A 4K3EL 4NWUH 4P2CG 4M62H 3MX0A 4M48L 4X6FA 5ERWB 3BIAX 5T33H 4F7TA 1IQWH 1TVBA 4XP6L 3PGCA 4M4PA 4X4YB 5HI5C 1BF2A 3FO0L 2XYCA 1X6NA 3HPLB 4ZPTB 2CIKA 1JWMA 2YSSA 3MUJA 2WWMD 2ZUTA 5DJXA 2R2HB 1CL7I 4M6NH 5BQ7B 3EDEA 1BVKB 3CJJA 2X7LB 2NX5A 2R0ZH 2QSQA 3ARYA 3O4LA 3CVHB 5M95B 4LPYA 1GSMA 3E6HB 3EYVB 4KROB 5BOZG 1GGBH 3AB0B 3HUJF 1TJIH 2A1WH 1HDMA 5JR1H 3HI5H 2MWCA 5SWSA 4DKFH 3TFKD 4XVTL 3TO2A 2NTFA 3CSGA 2JB6B 2CO7B 2UVEA 4NZTL 4WI7A 3DO3A 3IU4L 1R3KB 4IMLB 3ARRA 4LOUC 3QO1A 4DCQA 5DLML 1VGEL 3B6SA 4KQ3H 2X4TA 5CP7B 2HJLA 1OD9A 2WBJD 1GPOL 4OKVA 3CSYA 5EOCJ 2BVPA 2G75B 4PB9L 3KXFE 4D94A 4JDTL 3STLB 3S36X 3SO3B 1DLFL 1AIFB 4RBPK 2RAMA 3MV9B 1QUNA 1MIMH 4CMHB 1KV3A 2K3TA 5IVOA 4LASH 2OXGA 3QCTL 4ONFL 3SE3A 5DEGA 4HJ0D 4XMLH 4OUUA 3DSFH 1G6RB 3RJDA 4AM0A 4KDTC 2XN9A 4OLWH 3L5IA 5I1CH 3M1BA 4UILL 3UTZB 1F6FB 2MSPA 1F00I 4TOYL 1H8NA 4N8CH 1FAIL 1NSNL 1Q72L 3VH8B 4LSRH 5C07A 2R1WB 5T1KB 3M17A 4OZ4A 1ZVSB 1A5FH 3JTTA 3T4YB 1HK6A 1MY5A 1NC4B 5GHWL 3ERYA 3QHTC 2FLRT 1AKJB 2PW2A 5TFSH 1ADQH 1FVCA 5CP3A 4GS7B 1KLGB 5KAQF 5JW5A 3BQUB 4WO4C 5EBGA 1N6UA 4XC1H 1CXFA 4P48A 4E5XA 5TQ2L 3BRGC 2V2WB 2BNRA 5CINL 4YWGL 1YMME 1DQQA 3MBEC 2P42B 2Y06L 3UZQA 3VXUA 1YEHH 4OZFH 4JKMA 5KZCB 2OQJA 2JJTA 1YEDA 12E8L 4OZIB 4D9QD 2Q76A 4MAUL 1MF2L 5IBTH 3V6OA 2DLGA 4WI6A 3PG2A 3BRFA 2MJWA 4E41A 4QHNA 3BSZL 2ZWLT 4PY8J 1NFDB 4FQXC 1MCBA 1JNLL 2H32B 2Q86B 1X5KA 3EDKA 4PJCB 1OAZH 4IBLT 1AGFB 3IJYA 4XP1L 5DC0A 5D2LA 1DN0B 4MNQA 2FX7H 4FXLA 4LKCB 3LV3B 1EH9A 4D8PB 1U8MA 2B4CC 2IANA 1CICB 2X4RA 3Q5OA 2J2ZA 4G8GA 4M6MH 3ZDZF 1GCFA 4YFLI 5IGXL 3BVNA 4C59B 3I02B 1QQDB 2GT9B 4PRNB 4IHOA 1F5WA 3V52L 5GGSA 3VE0B 1K6QL 3KDMB 4JM2A 3WFDL 1JF6A 3C8KB 3JWNC 3QBTB 2BOCB 4Y8DC 3QFJB 2EC9U 1IBGH 5D2NA 1F3RB 3T8XA 4U6XB 1KOAA 2P8MB 3CLEH 4N0CD 4YE4L 4JFOB 1WITA 3STZA 3KHQA 4Z7UB 3NN8B 4XRCB 4XPGH 4L29A 1KLFA 4J3XA 3TJHA 3P4OA 5DFWH 5IV2A 4IS6A 5HDBE 1U8JA 4NQDD 3OAYK 4UV7L 1C7TA 4MXQD 4RX4A 3D2UB 1UKQA 2EC9T 3HI1A 3QZWA 4R4ND 5FUCE 3QAZB 1FNAA 4XHJD 5HHPB 3S34H 1JPFA 3QPXH 4HWBH 1S9VB 4DVBA 3QCUH 2ATKA 1MLCA 3CUPA 3L3IB 3AMKA 3H7BB 2Z35B 3H9SA 5C0RL 3T0DA 1BZ9A 2XRAH 1MJJA 1CFSB 4KWUA 4ZAKC 5DSCB 4ODXA 5JXED 1I85A 3K8LA 5MEPB 2DM3A 1B4JH 1FO0H 4NN7B 3WJJA 4KVCL 3GK8L 4LVNC 1MCQA 3RGVB 3ARGA 3SDAC 5J13C 2AQ1A 4WFFD 1OT2A 4K7FA 5FOBA 3GSRA 1I3RA 4KHTL 1FFOA 2HTKC 4Y4HB 1HSAA 4UQ3B 5MI0C 3I50H 2Y5TA 3GSXB 3HZYA 5D72L 1QFWH 1ZHKB 2FEDC 4WUUD 3DMMC 3UBXA 4LLMA 1CDCA 1J8KA 5I1EL 3O11B 3S98A 1EEZA 1Q0YH 3FQTA 1RZ7L 4BM7A 1J5OH 4Y4KD 3QA3B 5EU6A 4Z8FL 4F33A 4I2XE 4MCZA 1A6TB 1DLHB 2J6EL 4JPKL 2EDRA 2QQQA 4I18C 5GGTL 1H5BA 1U3YA 4H88L 1FG9C 4CDHA 4QRRD 1AR2A 1PKQA 1PJ9A 2CIIB 4O9HH 4OBSA 1FLRL 4MA3B 3UTSB 2NXZB 2QHLA 4BJLA 1IEAA 3G04A 5JPMB 2F5AL 3PHQA 4LHQB 2HG5B 5A2LH 4ELKA 1JFQH 1YEFL 1AQDB 1OPGL 4NBZB 5E9DB 3S5LB 3MR9A 1MCWW 5F8QC 4GAJH 4WHCA 1NDMB 2APFA 1VFBA 1MI5D 5A16A 1U9KA 3TC9A 4Z7WE 1N5AA 1WQVT 5C6TL 4PJDA 3TBYA 2HFFA 2NY0D 5C8JA 2QL1A 3ZTNL 1SBBA 2ATPB 5GQBA 2HT2D 3L3HA 1KG0B 3VGBA 1BFVL 4EUPA 3CC5B 1YNTA 3QB7C 4N68A 4RGND 5TDPB 4QEGA 4Y5YB 3PXHA 4XX1E 5H2BA 2C4FU 3TVMD 1ORSB 4EXKA 5ILTH 1RJYA 2CRIA 4JB9L 5EN2A 1E6OL 2GITA 1WEJH 3HTLX 3B83A 4OB5H 3BZEB 2QKIB 1A7PL 4GW5B 2CXKA 2V7HA 4Y5XA 2EC8A 1UG9A 2C4FT 4J1UA 5J3HD 4W6YB 5DD3H 1J05B 1EUTA 3N85L 2X70A 2J6EA 3WV0A 2VH5H 4KTEL 4RCAA 3BJ91 4W4NA 1CT8B 5D7SL 4LNRB 4EN3A 4LEOB 2IGFL 3CPLA 4HIIA 3MODH 2FCBA 1G7PA 1E27B 3P30H 1ZT4B 4MA1B 4WY7L 4BH7B 1G0DA 2I07B 1Z2KA 5FA4B 3S96B 1MRCH 4U6HA 4HKZB 1SJHB 3WHE1 5SWZA 3I75A 4GKSA 4XNXH 5DVOA 3P9MB 1IGIH 3ZKND 3VGHA 4LARL 1RU9L 1XCQB 2HN7B 5HYJD 1L7IH 2L0DA 1NCNA 3MRPB 2AEQL 3D48R 3KPRD 5DR5H 4PJAF 4QYOA 1AXSB 2R2EB 3PIQA 4RSVA 3QDGD 4CU7A 1A7NL 1JYWA 3BZ4A 3G08B 4AY0A 4PRAB 1MRDH 4X4ME 3OR7B 4YEFA 1VFAB 3RRQA 4XPTL 2R15A 4MVBA 3L95A 1JTTA 4PP8C 5IMLA 3SGJA 1Z9MA 5IQ7L 1JHLL 2HKHL 4WFEE 4O2FA 5KS9A 3O2VL 4ZUTB 1OD7A 3KLAB 2QEJA 4HS8H 2ZUVA 3ZSSA 1FN4B 1NEZG 3JUYA 3C5SA 4ETQB 3VFOB 1NPUA 5IFHL 5B38G 1B3JA 3MXWH 4U1HA 4BH8B 4RMSA 2Q8BH 5LQBL 5GXBB 4OIIL 4LCWD 4M5YH 5FA3B 3TBWB 3FB5A 2X4SB 2DWDB 4Z7WF 3IDXL 4Y5VC 4ZFOL 2VAJA 4EKXA 5EOQH 1CLOL 3TCLA 2QHRL 2DQFA 1CGTA 1T5WB 1PEZA 5F7MC 4P4KB 2C3VA 2XG5A 1PW3A 3JBG7 3TWCL 1KCGC 3LKQB 4JO3L 1C7SA 2EYTB 2HP4A 4LLYA 3HMXH 1BM3H 1RUPH 3QNXA 3L7FA 3B2UD 2W38A 4NNYA 4Y8AA 1JPSL 1CL7H 2X1OA 3DVNB 5C0IA 2E7BA 1WCBA 5DQJA 2RCSL 5EO1B 5HHXL 2J8HA 4JFFE 5JW4M 4FQ2L 5F8RC 3UPAA 4F58H 3O2DL 4ZUWB 4XNUH 1FE8L 2FR4A 3BAEH 5GRUH 4LGPB 3DBXA 2NX5D 2XZCL 4LCUA 4F9PC 5F3BB 3BFOA 5SWSB 4PJCE 4O2EA 1JUFB 4JFYB 4NKMB 5JIHA 4D0DA 1VADB 4ODTH 5C71A 2R8SH 2O5ZH 5I1KH 4FFYL 4DCQB 3N50A 3CFBA 5FYKU 2O61A 5ITBH 3MBXL 1J8HE 1V3JA 3OR6B 4PBXA 2YD1A 3A6BL 4Y4FC 1F8TH 3TZVA 5EORL 2NY6B 5SWQB 2NZ9D 4RMUA 1MJ8H 5GS3A 1NMCB 4JJHA 4L5FL 5FKAB 3IKKA 5DC4B 3V6FB 3HZVA 3RGHA 3QFJE 2NW2A 3MGOA 2JB5L 3WIIH 3PP4L 3VH8G 3OF6D 4B53A 2JJVA 4LAQL 4UT6L 2H45A 2CR6A 1X5HA 2YKLH 3MFGB 3D9AL 3RP1A 1PX4A 5J1AA 4GG8A 5DHVA 1A6ZA 1U3JA 5GZOC 4HIEA 2I9LA 1HN1A 4HH9A 3X11B 1N2RB 1S5HB 1CFNB 2IFFH 3HB3C 5D7JB 2FYYB 2F8XC 4G8FB 4UNTA 2W91A 1QSED 4DAGL 3GJFA 4NKOA 2Q6WA 5C07D 3MJ7A 1CGYA 4TNVK 4KKCC 4U1KA 1LD9A 3OXSA 5DA0B 3V0AC 2XTJB 3BRDA 2JJWA 2FHFA 3O2DA 1ULVA 5HHOB 3DOSA 2NR6C 2VTFA 1M6OB 3BP6B 1FV1A 1OOAA 3L5WB 4JAMA 2W9EL 4PJFA 4YNYB 1AGBA 1YJDH 3SDCA 3GMNA 5IB2B 4EIZC 5K9QG 5DJ0A 4OD1L 2FATL 3ZT6A 3SCMA 2BNRD 1MCWM 2Q76B 1DQLL 5FFLA 3VXUD 1MEXL 2DJ4A 1CD9B 1TMCA 4WEBH 1C1EL 2GY7B 2FHCA 5ACZB 4F15B 1G7LA 2NY1B 4E41D 2BFVL 1T0PB 3S37H 5E2WH 2CMRL 2IANB 2DLTA 3QNZA 5E4EC 3G5VB 3GI9L 4MNQD 4G8GB 1JGUH 3MV8A 4HGWB 4IRJD 2MQCA 4MNGE 4ODVL 2BSTB 4TQEH 3AY4C 3VFGH 2A73A 5I1AA 3VXRE 3R1GH 3FB8A 1NKRA 4GG6B 4PY7B 3E8UH 4JFEB 2QJDA 2LVEA 2HLAA 3IFLL 5EA0H 5FYKL 4YDJA 4LSDA 2CK2A 2YPVH 1QKZH 1U92A 3O3DB 4I3SL 4JM2D 4MJIB 2CKBL 1JYVA 5FECB 4KKLC 2ZJSH 4RGNE 5GIRA 5FUZL 4RGMC 1G7QA 4RNRA 1NAKL 1MNUL 4PJHE 3BO8B 2Z91B 4L29B 5DJAB 3VXMB 4ODSH 3TPUE 4HEME 5E4IA 2X4PA 3MYJA 3I6GA 3LDBB 3QWOA 4B7LA 3GKWH 3Q6FA 3T1FB 1AO7A 1O7SA 1CR9H 1MRFL 1G9NH 4X99B 3T3ME 2KBGA 3H0TA 4RX4D 3QQ4A 1JPFB 1YPZA 1HHHA 1FVEA 1VACB 3GRWL 3S36H 1RMFL 3U46A 1BEYL 2ZOKA 4HKXB 2DICA 3O3BB 1IL1B 4Z6AT 3SO5A 1MJJB 4PTUA 2CDGA 2DWEA 4ZG1A 5TE7L 3C2AH 4JRWA 1GZQA 1DBJL 4LVHB 4PD4J 4KUZH 2OL3A 5IW6A 2VZVA 3WNLA 5I66A 4AH2B 1RUMH 4IJ3B 2R2CA 5E8DH 3T2OA 3ARGD 1WUNT 5MEOB 2Y5TB 5ALCL 3DV4B 3KPPB 1EIBA 2EDJA 3I9GH 3P73B 3U0TA 5HYJE 1T20B 1X5XA 4HT1H 4Y89A 2D7TH 2COQA 1IM9A 3KPRE 3VWJC 4GO6B 2B4CL 1KJ2L 3BGFC 3QDGE 4GMTH 3T2PA 3QEQA 5CBEA 1DN2A 4KDTA 5TH2B 5GS0L 5EU6D 1RZFL 2CKBA 5I1JH 3S5LG 1JHTB 4HWEL 4NQXA 3LZFL 4XBEL 1BFTA 1ZGLP 1P1ZA 5E70A 5IEHA 3FL7A 2WLYA 4P57A 5HXMA 2H26B 1IEAB 4UTBL 5BS0A 2VDNH 3QRGH 4NJAH 2NYYC 1ZLWK 5JOFB 3O3AA 4IOFC 4NO5A 2CLRA 4MA8L 8CGTA 2UV3A 1AQKH 2L7UA 4QHUA 1J9CT 3NPSC 3Q2CA 3QJHA 4G7VL 3KLSA 1IGCL 4WO4A 1U3HB 3W9DA 4X5WB 4NCC2 4XPAL 3MRDA 3OKEA 1KPRA 2D0FA 4EUPB 5F6HI 2EXYC 3LQAC 3MBEA 4BZ1H 1BIIB 5JTWA 4H5SA 5F88A 2HA1A 4FQLL 4HJGB 2F58H 1JBJA 4PJHF 3KYKH 1MCDA 3ESVF 3HE7B 2AJ3A 2CJUH 3V0WH 3VFRB 4GAGH 1LWRA 5FUOL 4LSQL 3ULVC 2VLKB 3PWLA 3UO1H 2D31A 2ERJC 3U30C 4WI5A 4YFLF 4FQXA 1GVIA 3IJSA 3IYLW 1VPOL 3UJTH 3VFPB 2DAVA 3GKZA 4M8VA 5TQ0H 3T3MF 5HYSB 4AIXA 1ZANH 4U6YA 2NX5E 4LU5L 4C56B 3IXTA 3O4LE 1C8PA 3ES6A 2FGWH 4HIHB 4DZ8A 3SDXB 2XICA 5EZOL 5GGUA 1KJ2A 4HLZH 3C09C 3KG5A 5E5MA 1MHEA 4FFVD 2Y25A 5F7DB 2V6HA 5SWSE 3ARBB 3PGFL 4NRXA 4EN3B 2DYPD 4YX2H 1XGUB 3QXUA 4LLDA 1T04B 5DQDL 1A7RL 3NAAL 3FMGL 2LTQC 4G9FA 1BJ1H 4JZNA 4GBXB 4KRMB 5DYOA 1NCBL 3H9YA 1SHMA 5D1XC 3KPOB 1UZ8B 4L4JA 2IPUK 5DK3A 1NGXA 1T6VN 5I1DA 2O5YL 5SWZD 4Z7QE 4PGDB 5HDOA 4IEFB 4UDUB 1D3CA 4G9DB 5CP3H 2P24A 2AEPL 4BSVA 5HYIA 1BQLL 5GJSL 5I8OL 2R0WL 4C4KO 4F3FA 3BYYA 3L95B 3SKJL 1KPVA 4HKBB 4NZTH 2JELL 1J86A 3IU4H 4OZHB 4MVBD 2XN9E 2N7AA 4J3SA 1P7QB 4QLRA 3B9EA 3C5SB 4N0FB 4OD2A 4ZAKA 2NNAA 1A7QH 4U1HB 1GPOH 3ME0A 5C07E 4PB9H 4DUVA 2CDFA 2ADJB 3W11C 4F8TA 5HPMA 2VLLA 5F96L 1DLFH 5I0DA 3QUZD 3FT4A 3MRFA 5C0BA 3SDAA 3VXSB 5FKPB 1JF1B 3TCLB 2UUDK 2DQFB 3BWAA 2QADB 2EDEA 3BE1L 4R7DB 3KLDA 5HHOE 2BVQA 3NH7H 4PGBA 3DMMA 1OWWA 2GYSA 3MTRA 1CGWA 5L88H 3CDCA 1LQSR 2BNRE 4UILH 4KJQC 2DTML 1OWRM 2HVKB 1TZGH 5D7LA 5EIIB 1Q72H 3REWB 3W39B 3ZKMC 3DECA 4I18A 2B7DT 3HR6A 3V6OE 1M71B 5DWUL 2W07A 1YEIH 2C26A 5GHWH 4E41E 3UAJC 1HNFA 2X05A 1EEYB 5I30L 3E3QA 1WFNA 3BZDA 1A6VH 2FB4L 4H0IA 1K2DA 3U9PL 1T4KB 2BJML 5EOCH 5B22A 2P5EA 4YHKL 3N1FC 4MNQE 3AM8C 2PN5A 3AREC 5EC1B 1A9BB 4P2QB 1YECL 1QG3A 2HJKB 2IANE 5TQ2H 2AJVL 5FYJU 4R90L 1CDIA 5I17A 1TETL 4L8SC 2VB5A 4G8GE 1IM3B 5IJVA 3BH9B 5ESAA 3BPLB 5L8KB 3JWOL 4FNLH 1BQSA 2IEPA 3A0OA 1NCWL 1MF2H 4JG1L 4JFEE 1ED3A 1J1PL 3I2CL 2X1QA 5C0JA 3MFFB 4HK0B 1RSFA 3U9UA 2R9HC 1I9JL 4Z7QF 2H9GA 4YXLL 5F6IB 2NW2B 5I74B 1AGCA 1JNLH 1LDPL 5EG6C 5DMJB 4XC3L 4JGJA 5J1AB 4GG8B 4XP4L 5CJ5A 5E00A 3GSQA 4IRSC 1G7IB 1G1CA 2AJZA 3EJJX 4JZOA 4XAWL 4OV5A 4FTVA 1QPPA 1V7NL 3C9NA 1YQVL 2XQBL 1S7RA 1A1MB 2E3VA 3GJFB 4EI5C 1CDHA 5CGYC 3V52H 2HMID 1SJEB 4S1QL 1K6QH 1Y0LA 3H9SE 3MOAH 3CCHB 3OXSB 4WENB 5JHDD 3DPBA 5C09D 3SY0A 5KG9A 1FZJB 5FCUL 1PD6A 1QBBA 4FHBD 2IALA 2W65B 4XBGA 4YE4H 1FV1B 1WSST 4JAMB 3EO1B 4PJFB 5F7NC 5GSRA 3EYQD 4NO0D 4HW6A 4U1JA 2FJGB 1W0VA 1JL8A 3LRGA 5DZNA 4Q9RL 1UEMA 5DJ0B 1FNSL 3J7HA 2D03L 1HQRB 3SCMB 3SDCD 3SGEI 5DTFB 4LLQB 4PJEA 5IBLC 5B3JF 4G6AD 3OKOA 4Z76B 2EIBA 2OLDA 1FZKA 2F19H 4AJ0A 4KDWA 3ZE1E 1Q94A 4POUB 2J8UA 4APQC 1FL6A 4D0BA 5GS2D 3SBWC 1MFBH 4YC2C 2C1OB 1U8OA 2H6PA 3TN0D 5EU6E 5EU5A 1X5GA 4HIXL 1F4YH 5C92A 5GGRA 3CFKB 5DD0L 3LQZB 4KVCH 3UYPA 1JZ5A 4JRXA 2BY2A 2CLZA 1SM3L 2DQIL 3UCRA 2XNAA 4G42A 1PKQE 3QNZB 1TPXC 2CDEA 3DX6B 3U1SL 5D2LF 3MV8B 3RTQC 3MROA 2EIDA 4KK8C 1GXEA 1G7JB 5BW7C 5EDXA 3BHBB 1GOFA 1U95A 4Y5VA 2YBRA 3IFOA 5J12C 4NQCA 5LKNA 3OJDB 3VA2C 3FRUB 4PREA 5F1SA 2GTWA 4PJDE 1ETZA 43C9B 4N1EA 2BVOA 2X42A 4JM2F 4DN4H 3FOLA 1Q8MA 4PLOB 5FF6A 3MLXL 3GI8L 4KKBD 2J6EH 4JPKH 2OSLA 1F45A 4WWKC 4H88H 1B4RA 1WWCA 1B6UA 4DK6A 2ZKHL 4BQBA 1DVFB 3UROR 2FSEA 2F5AH 5HYQA 1HHHB 3M07A 4CNIB 5KSAC 4KJWC 2L7JA 4F9PA 2EH7L 3GSVA 1M7IB 3F12B 5I71C 4KHXH 4PTUB 3ZTNH 2R23B 4OFIA 3QQ3B 4MDJA 4PP2A 4ZUUA 3QEUB 3SJVA 3SDXE 1MQ8A 3EOTL 3ARFA 1BFVH 5KOVC 1U8PA 1CD1B 3CFDB 4Y4FA 2CO6B 1OVZA 3CVIL 5KVEH 2IH3A 2GSGB 3BKJL 2OJEA 4H8WC 2A6JA 3JV6A 4JB9H 4JE4B 1J0JA 1NMBL 3UTQA 3U0TB 2CD0A 1U6AL 4HBCH 4KK6C 2UYLA 4QRPA 1UXSB 4NWTL 1A7PH 4A2LA 1KB5B 2XACC 5C3LD 3FONA 5EOTB 5D1QC 2K1MA 2PW1A 5CBEB 1IM9D 1OAUL 3BJLA 5HY9B 2IBBA 4YHYC 4ZSOB 3TT3L 3N85H 2RR3A 1G7MA 2BHZA 1AJ7L 4JHAL 4XP5L 3RL2B 1Q9OA 4LSPL 5FYKD 4KTEH 1YC7A 3EOBA 3WDHA 5DVMA 1JZ8A 2IGFH 5IMKB 5KS9E 1Z3GL 4KROD 2N7BA 4GSDL 1H0DA 1I8IB 4YDIH 3C2SA 4QHUB 4EUPG 5BS0D 4XWGH 1EX0A 5SV3A 4HGKC 5E1AB 1AD0A 1B2WL 3FO2B 1HXYA 3W9DB 1RU9H 2EE2A 4G8EB 1GC1L 3KVQA 5CIPB 3OKNA 3FO1A 1ZOXA 2AEQH 3P77B 4MHHG 1T03L 3TBVB 1R24B 1KPRB 4PJDF 5CSGA 4WO4D 4GAYA 3VG9C 3ZLQC 1R5WA 4M8QB 3MBEB 5M7QA 5C86A 2JF1A 4X9FA 1ZSDA 5BXFA 4XPTH 3LIZL 5HYSG 4XZUB 2PTVA 3C60C 3VD3A 2B20A 4ELMA 4ZUVA 5K9KA 3NCYS 4KZDL 1JHLH 1I9RH 2HKHH 3O2VH 1DBKL 4G6KL 4YDVB 3NMEA 2SEBA 3GMPB 5KBNC 3D69A 1QBAA 4MJ6A 1QFUL 3HLAA 4ALAL 4L3EA 1FPTL 2VISA 1KBGL 4OIIH 3NZ8B 4YDLC 3IXTB 1QO3B 3GSUB 4DZ8B 4K9EC 3IDXH 3IFPA 4XNYH 4D9RE 1I8MA 1FG2A 2W0KA 2QHRH 1LP9B 2WMPA 5E6IC 1WBZA 4QOKB 3AY4A 4WNQA 3VCLA 1D6EA 2BRRL 5T1KD 4R0LC 5DHVH 5EC2B 4JREB 2ZUYA 5GS0D 2KQMA 3PP3K 2VIRB 5DYOB 1G9MC 4G9FD 1UQSA 4R8WL 2ICEA 1UENA 1JPSH 3VXNA 4Y2DA 4PRPB 2RCSH 3ARXA 1VFUA 3BQUD 4WV1C 4NCC1 4NKDA 3U7AA 3WHXB 1BAFL 4DN3L 4R9HA 4FQ2H 3QJFA 3T4AA 2X89A 3O2DH 3IETB 3O3EA 1ZA3B 4P23C 4F3FB 5HYEA 1D5BA 2IBGA 3G5ZB 3QHZL 4NKIL 3TPKA 5T1MA 3R8BB 2F5BL 4FFYH 3V7AG 1QLFA 3LN4B 3WFHA 2Y6SD 1XR8A 1JI2A 3GM0A 3GMRA 1UB5A 4WUKL 4X0KA 1ACZA 4NYLB 4Z0XB 4CADA 5KS9F 5IM7B 3SGDI 5GRYA 3LQAL 4L9LA 5EORH 1VB9A 4U1MB 1I7TB 4ZAKD 1S7TB 3MRFB 4XPBL 1MCCA 5D96B 1QEWA 1JYNA 3MOBL 3KS0H 4Z7VA 1CICD 3V9FA 4M7ZB 4F37K 4CKVX 5T5NF 2RFXB 3QWQB 4GKZA 4P2OC 1PLGL 1NBZA 3E2HB 3EFFB 4XCCL 1XR9B 1JGDB 2BVQB 4R4FH 4LAQH 4PJFE 2WIMA 2HTKD 4OCLC 3D9AH 4Q2ZA 1V3MA 5E24E 2FEDD 1A6AB 3LCYA 4IDLA 4YHZL 3VWJA 2PNDA 4MS8A 4K23H 1JWSA 4XB8A 4YXHL 3ESUF 3CK0H 5DJCA 2V9QA 4HJJL 1D9KB 4N0UB 4FQCL 1ES0A 5J7CC 1CLZL 1JNNL 3F7YA 1SMOA 5DD6B 2P5EB 5CHNA 4J8RB 4JR9L 3LHPL 4JQVC 2AS5M 2W9EH 2Z8SA 5FGSA 3Q5TA 3CMOL 4HUMB 3O6FA 1R3JA 4JFPA 4JGMA 3SHSA 4PGEA 3MV8E 4BFEA 4ODUB 5F21B 4OD1H 4PRDB 5I2IB 1DQTA 1GL4B 1IAOB 4P3DA 3DJ9A 2X2YA 4FQHB 2XY1A 2WAHA 4WU7B 3ECBB 1FCGA 1MEXH 3G6DL 1C08B 1OAQL 1A2YB 2F54B 1ZLSH 5K33A 3V5KB 1CGVA 2H9GB 1JIBA 2B1AL 3DXAA 4PJ9B 5C0GA 3TBTA 1BMGA 2OL3H 4Y4HD 1NCTA 3VU2A 2NY2B 5HI3C 2CMRH 5IEKA 4ZQKB 1CE6B 1E4JA 1D5MA 2IADB 3V0VB 1F6LL 3GI9H 5KSBA 3PWPB 2OP4L 1LILA 2F53D 1CXKA 1AO7E 4ODVH 4YLQT 4J12A 4ONHA 2Z8VC 1BWMA 2X4QA 4NIKB 4U1GB 1YPZE 2FX8L 2PO6C 1N8ZB 3HFMH 1W0YT 3KYOB 3IFLH 4LSUL 2D7OA 3EJYC 4HFWB 4I3SH 2NXZD 3LB6C 2ZUSA 4OF7A 1UACL 2CKBH 3RPIA 4O5LL 3OG4B 1DUZB 4E42A 3EJZD 2GJZA 2XFXA 5EU4A 1MNUH 5D1XA 3H3BC 1JGEA 1WGOA 1DL7L 2BNQB 5HDQL 3SGEH 3IDYB 5DJ6A 3UPRB 1FFQA 3ZYZA 2V5MA 3MRGA 4OAWB 4POZC 5BO1L 4YGAB 4HCRL 3ZE2E 3K1KC 3OB8A 3ULUL 2DIBA 2H1PH 2NY3C 3OGCA 3R0MA 1NMAH 3IXAA 5KVDL 1U8HB 3GRWH 3ULSA 1BEYH 4YFEA 4TTGA 4UQ2B 3BKCL 1CXHA 5JZ7C 1AHWC 3DVFA 2HTLC 3QEQE 3O41A 3GMMB 5FGCB 4QNPE 1S9YB 4NHUA 1YEEL 1DBJH 2CLZB 4F7MA 1I1YB 2LU7A 2XNAB 4YAQA 1UM5L 1FJ1B 4NUJB 1F3JA 1JNHA 5JA9A 5IFAL 1VCAA 5D93B 5DRWA 3RNKA 4GJTB 4LIQL 1P4LA 5EPMB 2WBWB 3T3PE 4N0YL 3F6LA 2XY2A 4RMTA 3IFOB 1KACB 4KC3B 5D71H 3VA6A 2X4OA 4TUJB 4DVRH 2IQAA 3O9WB 2QBWA 2B4CH 4LNVA 4NQCD 5E6ZA 1KJ2H 1KLUA 5CEYA 2P8PB 3EYFA 3CD4A 2XWBB 3OXRA 4HWEH 3LZFH 4XBEH 3INUL 2MHAA 4PYGA 1JN6A 4HK3J 1I3VA 3SE9H 2C1PB 4UOW0 4C83A 4BFIA 3AS0A 4O51B 3D18A 4HX1B 5A40E 3LY6A 2R69L 4FG6D 4UTBH 5IG7A 1SQ2N 1X4XA 4MA8H 2LAGB 3BUYB 4X7TB 1N0XL 1F13A 1H3XA 4YK4C 3RX7A 3GSVB 4G7VH 1RUQL 1ZTXH 1YPZF 2WINB 1IGCH 1U8KB 1T1XB 2VXQL 4RRPG 3AM8A 3AREA 3DVGA 4XPAH 1OQOA 3HE6C 3V7MA 4GW4A 3SJVB 2B2XL 3PHSA 3T0EB 1UEYA 3ARFB 4CRPA 1DQJB 2VL5B 1A6UL 1T0NA 1HZHL 3H2WA 4L8SA 3VWKC 5HD8C 2BP3A 2FZ3A 3EDDA 1RI8A 4QY8B 3TNMA 2OJEB 3D25B 4G9FE 2HT4D 3IDIA 4KRPB 3KLHC 5FUOH 2HWZL 3C08H 3L3DA 2VDML 4LSQH 3S4SA 4CVXB 1G7HA 3UTQB 1DJSA 5ABDE 4HGMA 3ZE2F 4LBEB 1X44A 1C5BL 4M9PA 1H3PL 2EEDA 2I24N 4LVOC 3KPQB 4PP1D 4P4KD 4WJ5A 2J88H 2B1HL 5LGKA 1OCWL 3MRMA 3QFDA 4PG2C 5EZOH 2A83A 4IRSA 5JXAL 4LEXH 4YHNA 5T3ZH 3EOBB 4QNPF 2K9UA 1TZIB 3PGFH 4N9GA 1I1RA 5DEZA 4QRTB 3FHAA 4EI5A 1CQKA 5DQDH 4TTDC 1IC5L 1ONQA 3HB3D 4QXGL 1KXTB 3OKYA 1QR1B 1DANU 1S9WA 4YO0B 1U2CA 1NEUA 3DUUB 1WBYA 4HUWA 3H3PH 4KKCD 3T3PF 1HXYB 5HI4D 3W9EA 1T2JA 2V5YA 2R2BB 5CSZA 3IDMA 3REVA 5C0BE 4RZCB 3C5JB 3JTCA 2NR6D 1KC5H 4OCMC 3C6LB 4HD9A 4P46B 2AEPH 4FFWC 5I8OH 1TIUA 1DANT 2P43B 2R0WH 4LPTA 4PJ7F 5DGQA 3OAUH 5T3ZE 1J1XL 1A6PA 3B9KB 4QCIB 5E8PA 3FOMA 4OFKA 3P0GB 4ZUVB 5K9KB 4I3RH 1K8IA 4AG4L 5I19H 2OMBA 1XF5A 1AGDB 2ZOLB 1AH1A 5MEQB 4PJ8B 1S7SA 1AI1H 5D7LE 1F3DH 1SMAA 4O4YL 2X1WL 1AGEA 1L0QA 1XF1A 4M43H 3WO4B 3MLZL 2P7TB 4G6FD 4X83A 4WW2C 2EE3A 4L3ED 4FXKB 3E3QE 3IFPB 4H8WL 4N0UE 5DRZB 1L8JA 4A2MA 3RTQA 3V5HA 3NACL 5IB1A 4XCYB 4TYUA 1RZIB 4WNQB 1F2XK 1TQCC 1VGKA 1D6EB 3BE1H 5D7JD 2P5EE 1I7UA 3VCLB 1DBMH 4V1DB 5BW7A 1UB6B 3OB0K 1HHJA 5LCVH 1MJUL 2HFEB 1XGRB 2VXTL 1OT1A 3AROA 5TF0A 3UJJL 4CN6A 4Q97A 2ICWJ 2OTUB 4KK5D 4KTDL 2AJYL 2VXUL 4WI4A 3PHOB 2DTMH 1GGCL 4Y2DB 2R39A 3U2SB 4U1SA 3JTSB 4GW1A 3ZHDA 4X6EB 2R1XB 4NKDB 4FA8A 5DDHB 4NCDA 1HHGB 5DWUH 3MRBA 4WWKA 4XPFL 1JZ2A 4KKLD 1ZLUK 4XWOC 3LRSB 4KJYB 5I30H 3TEUA 4ZTOL 1REIA 3PF2A 5FO7A 4NFDA 4FFZL 2FB4H 4LRNL 3WN5B 3GHEL 4Y7MA 2BJMH 4YHKH 1W8NA 5T1MB 5TF1H 5FO9B 3IDJA 4OLZL 3U0PA 4WFGD 1K3IA 4OI8A 4FQIH 1WWBX 4XNQB 5KSAA 4NZUH 3RVUC 3AAZB 4LHUA 4X0KB 2P47B 1PQZA 4XGZA 1IGFL 1BBDH 3OQ3B 4U33A 4QTHA 4FTVE 5I1LB 5CCKL 4UT9L 4X6BA 3CXHK 4N5UA 2NY1D 15C8H 4L9LB 3QXAB 4OIBA 4J3WA 1ZAGA 5HGAA 1NCWH 1JE6A 2IBZY 4PG9A 3WE6A 3JV5A 3UTPD 2J12B 2CUHA 3F7VB 1KN2L 3KJ6H 5DT1L 3EHBC 3OKDB 1I9JH 4GKZB 4LCYB 3QRFM 2DM7A 1NBZB 1UKTA 4KZEL 3GFUA 5HSFA 5BRZA 5CEXB 4XC3H 1M4KA 2RQ8A 1RQ5A 5CMAA 4ZXBB 1RUAL 1CVRA 3GNML 2W59A 4M02A 1Z9OA 4Q9BA 3U82B 1NLBH 4BZYA 2PUQT 2AK4B 4XAWH 3L3OA 4MJID 3VXQB 5D1QA 1MAKA 1KIRA 1V7NH 4PJEE 1YQVH 2XQBH 3VWJD 3C6SB 1NKOA 4K3JL 2J8UE 4S1QH 1KNOA 3VXMD 2E8YA 2ZSWA 2C3XA 3DYMA 4HF5H 3QUML 2IQ9L 3BPCA 4HEPG 4HFUL 1Q0XH 5IFJA 3EYSH 4OF8A 4YFDB 1T1YA 1FL3B 3TIDB 1XF3A 1G9ML 1UFUA 3RHWK 1DR9A 3ALWA 4F7EB 1FH5H 1ODAA 2VLRA 2YN5A 5CHNB 1IEBA 4PGCB 4JRXE 3HCVB 2DLFH 1TTGA 3PNWA 2IH1A 4QKXB 3O6FB 1R3JB 5ELIA 1WCQA 4HWNA 4UBDC 4PGEB 4M1DH 4RMVA 1MCOL 1S8DB 1FNSH 4GH7B 2XQYG 4OFYD 3PQYB 3JSSA 5BV7C 1EDQA 2EEBA 2MOVA 5AWNH 3KJ4C 4GRWB 3EFDL 3WIFB 1TJHL 4G5ZL 4HIJA 3OAZK 1MIEL 3MJ8B 1LNUA 5F97E 4ZNCD 1UA6H 2WWMC 4BA8A 1K4CA 3DXAB 3KYMA 1JV5A 1S5IL 1DZBA 4YXKL 3C60A 3K7UA 4HIXH 3BXNA 4QXUH 2EZ0D 5JORA 5DUBB 4TUOB 5I16B 3EYOA 2VXVL 1SM3H 2OR8A 1PVHA 4TRPL 5DA4A 5T3XL 1YN7A 1RIHH 1IC4L 3U1SH 3VFSA 5MHSE 4I0CC 4TSAL 2JK5B 1TCRB 1ZE3C 4OT1L 1JK8B 5AG9A 4OCXH 4ONHB 2X4QB 3VI3E 1UVQB 2FEEL 2MNUA 3MLVH 4HG4K 1ZK9A 2OK0H 1IGYB 4BQ6A 2X44D 1C16A 5E6IA 1MUJB 2E6JA 4HKJA 4JG0L 2XV6B 1NGYB 1CDJA 2FJHB 3MUGA 4R0LA 3RWGA 1HWHB 1T5XB 2QQNL 3QUMA 2VITA 3GI8H 4E42B 3SJVE 2M1KA 2B0SL 4LDOB 3KYNB 4YR6B 4PV8B 2XFXB 3GMOA 4L8CA 4FABL 4U0RC 3FQNB 3ARDC 2X4UA 4WV1A 3IKCA 1U3HD 4HJ0C 4JANA 1M1SA 1DUYB 2R1YB 3NA9H 3PGDA 4PTTA 5JW4Q 4YBHA 3RVXD 2Z93B 4M7JL 3HZKB 4QRPE 1ZLVH 4PJEF 2OJZL 1HEZA 3C5ZC 4P23A 3RWFA 3IAQA 5C0FA 2EH7H 1LK3L 5HHMA 1Z9LA 3MV7A 3AFLA 2J8UF 2Q7YA 5FAAA 3O41B 3HE7D 3B5TA 1X9QA 1RJLA 4OGYL 1UYWH 3LPFA 3EOTH 4OGZA 1YEGL 2GHWB 2VLKD 5DHYB 4JEGB 1NJ9B 2VDKL 3SDDC 4G6ML 1CDBA 1X5ZA 4OI9A 4AIOA 1X6LA 3BKJH 1MAMH 4BFBD 2IPKB 3W81A 3T65A 4PS4L 4DKAA 3EOYG 2AJXH 3QULB 1Z6JT 2A6DB 1NAMB 4NDMA 4NWTH 5CWSB 1UCBL 3C87A 5C9JA 3G6JA 2GJJA 1YMHA 1IGTB 1P2CB 2B8OT 5EZLB 4FQQA 3E0GA 2PXYC 3D39B 1OAUH 4F8QA 4GBXD 3VRJB 4PJIB 1F11A 1IQDA 1BZQK 2EYRB 1AJ7H 1OP5K 2Y7QA 4LSPH 1NUGA 3WKML 3QUXD 3WUWA 4H26A 4KJQD 1KJ3L 1UH3A 5JUEL 4ELME 3RL1B 5IG7B 4JRYD 3OPZL 5E8NA 3ZYIA 3ZKMD 4JY4B 4YJZL 1BGXH 1XGPA 4XXDB 5FO8B 4H1LB 3RKDD 3BGAA 4UNUA 1K8DA 3VI3F 4L3EE 1HYSD 4TSBL 3ULUD 3DVGB 3IU3B 4CW1B 4JQVA 1ZHLA 1QBMH 3EO9L 4RBPH 4GW4B 4AL8H 2YMXH 6CGTA 2V2XB 1T03H 4LGRB 3DETC 1UM4L 3DLQR 1B0GB 1PYWA 3BYTA 4JO2L 2BCKA 1M7XA 3BESR 2FBOJ 2AV1B 1D5ZA 3IF1A 3LIZH 4G8IB 4Z9KB 4JO1L 1XFPA 4OZGB 3VRIB 5J6GB 4MB3A 3CIQA 3FRPG 1DBKH 4G6KH 5LAXB 3PXJA 4MZ2A 4P99A 3D3VB 2QADD 5I8EB 5DS8A 4ALAH 1Q9LB 3Q3GB 1FPTH 4R4NC 4WJ5B 5A1AA 5L9DH 1KXVC 1RIUL 3IT8D 1JZ3A 4IRSB 2NY4B 2AQ3A 2E7LC 4YHNB 4LLVA 4OQTA 2R0KH 4BUGA 4I0PB 1GH7A 2BRRH 2PO6A 3MNVB 5HHNA 2G2RA 4GQ9H 2ZPKL 4CU6A 1CCZA 4EI5D 5TJWK 5CGYD 4R8WH 5DK0B 2VUOA 3HR5B 1RZKC 4X4XB 2HKFH 1FVDA 3PV7A 1XF4A 5J4MA 1KJVB 1J1OH 2Z0BA 5T1LA 4P2QD 4DN3H 3AGVA 1TFHA 3TGXA 1JWUA 4X6CB 3FTGB 2FBJH 4Q0XL 4D3CH 4Y4KC 4CVUA 3GSWB 2HLFD 2Z31B 3QHZH 5I75C 4XMKH 2J5LB 1GHFL 1J0KA 1ZHBA 5F9JB 3PWUB 4ELMF 3DX7A 1BLNB 2ICES 1LE5B 3LN9A 1AHWA 4APQD 1CU4H 3LQAH 2UZIL 2E8ZA 1A4KA 5D6CA 2D0GA 4DGIH 1F6AA 3O8XB 4XPBH 1N3NA 3QI9A 4OSUL 3T2QA 5ICZB 3MOBH 4NO2B 5JA8B 5IB5B 4MZ3A 4HBQA 1T0MA 3OKKA 1PLGH 4YBLC 1F97A 3ULVH 4XCCH 1VGKB 4G43A 3LN5A 5F72S 1WT5C 1NBVL 4XCFL 4KK8D 3QXDA 1KELH 4ZS7L 4W68A 5EUOF 2VDQL 4XCNB 1MH5A 2E6PA 2FH6A 5LXGL 3OAYH 2DKMA 4Z77B 4YHZH 3T08A 3DGGB 1PFCA 5F93C 3IDNA 4U1NB 4XTRD 2E9IA 4OJFL 2EDOA 1PDKA 1GZPB 1MWAB 5IHZA 4ISVB 1CLZH 1K5NB 1T6WA 2E9WA 4L9DA 4LCIH 4WWKD 1OP3H 5IMMA 3DXAE 1P7HL 4PJGB 1CGXA 1FIGL 1U8LB 3WBDA 3HAEA 2BY3A 3VJ6A 5J3HC 1TITA 1FNGA 5KJRL 2YEZA 2ITCB 4DEPC 3ULVE 3BDYH 5F7WC 5D5MA 4LQFH 1Q1JL 3CMOH 1BD2B 3BN9D 4QT5B 5KSBE 1FNEA 5J1TC 1SBSL 4KJWD 3HE6A 4UINL 5HGAB 3VFNA 3VWKA 5CBAB 4L8BA 4HUVA 4X9BA 3PWNA 3WHE0 4HUNB 1FFPB 2B1AH 3HMWL 4Z7VF 4GRLB 1BJ8A 3NVQA 3X13A 1AP2A 3QUYB 2G9HB 4HXBL 4HS3B 1A1NA 5IB4A 1ZT1B 3LPWA 3IGAB 4PGJA 3U36A 3JUZA 1PAMA 3P9LB 2VJXA 5BRZD 3GSNB 1HHKA 4NQVA 1JPGA 1U8IA 1N5YH 4DKEL 3RDTC 4HDIA 3QDJB 4WW1A 2DLIA 1NGWA 4RWYH 5CJXC 5B8CC 4W70A 3FN3A 1I7ZA 4PG2A 2VLJA 4L4VA 4UI2A 3ILPB 3BEWB 4DZBA 4QGYA 5D1QD 2FX8H 4KQ4H 1A0QH 5F7KC 3C8HA 2VR5A 5IFJB 2MCG1 4B41A 4EOWL 1UH4A 3DTXA 1DVFD 1XF3B 1V7ML 1UACH 4NT6B 5J1SC 1NUDA 2VLRB 4R2GD 4UT7L 4ERSL 4NHUE 1QTYT 2VE6A 3NA4A 1WAAA 1IAKB 5HDQH 1MFNA 1QNZL 2UWEB 2AJSL 5E5UB 3DYOA 5BO1H 5AYUH 3G5XA 2EO1A 2QSCH 9CGTA 3MRIA 3FKUS 2YZ8A 5TPWL 3P40A 3VG9B 4YUEL 3B2UC 1C5DB 5DD1L 1FSKC 5KVDH 3LEYL 5IVXB 1N26A 2EH8H 3F58L 2WM0A 1TQBC 5JO5A 5A2IH 4BQ8A 3SE4C 2AXFB 1CLCA 3S8WA 2ICWB 5FCSH 2PYEA 4QWWC 4MXWH 2RBLA 2JIXA 1J0IA 4DUXA 5FYLH 4MDIA 4IOIA 4CVZB 1YDPA 3ULVF 1N6VA 3QNYB 3QEHB 2NY5L 4WIQA 1S7XA 1EV2E 4ZOAA 4WW2A 5KSBF 1R3IL 1NC2A 4N0YH 4P5TB 4RISL 2E5EA 4KUCD 2DQUH 5J89A 5C0AB 1OW0C 3ZSTA 3ZTJG 1NDGB 3L1OL 5JNYA 2NZ9C 1A6WH 2C4XA 1UC6A 2XXCB 1D6VL 5F7UA 2A6KB 4U7MA 5F9AC 4NPYA 5FM5M 3K4ZA 4Z95L 1KGCE 3CX5K 1V05A 4JZJB 3X12B 1E28B 3INUH 1ZHNB 4QHMA 1IE5A 1WZMA 5FYLE 3MLYH 2V7NA 2YUWA 2VDLH 2IMMA 4JN2B 4JANB 2R69H 3CFEB 1BFOA 1W72B 4U1IA 2PCPB 3NPZB 4L4TB 3KR3H 1CDGA 1MREL 1N0XH 2JCCB 3RWFB 3TH4T 3GB7B 1L0YA 35C8L 4ZO6A 1XZ0B 1HIMH 3L3GA 2VXQH 3UP1A 5I1GH 1YYLL 4KK9D 2B2XH 4QHKJ 4TUKL 1PG7X 3HS0A 3UC0H 4OCWL 1CIUA 1MCNA 1DEDA 1HZHH 4LSSH 4EVNB 4CN1A 5C0CA 4PRIB 2YRZA 5HVFB 3KHOA 1CF8L 1UJ3B 2VNCA 2AKRB 2VQTA 1HKLL 4RAVB 1C12A 2UVFA 3V4UH 5T3XD 2XOTA 1YY8B 4LVEA 1HILA 5D7IB 1H3PH 5ESQA 3UTTA 3U4EA 4MAYC 1NFIB 5DC9B 4P2OD 3GZKA 1OCWH 5IHUH 5TDOB 4JPWL 4J7RA 3I3EA 4NSKB 5F1OB 1PG7W 1UWXK 4ZNEA 4H1LG 1X7QA 3FQXA 4PRPD 2GTZB 1OF2A 2FO1A 3BISA 4A6YL 4JFDA 2AV7B 5E6YA 1YN6A 4KV5E 4UB0H 3MNWA 1EO7A 3GHBL 4KGLA 3ILQC 2FWOA 4X80L 2EKJA 2G60L 3CAFA 5DMGD 1Y6NR 3ROLA 3VG0H 5MP6L 1D5XB 5L2JB 3GO1L 3MLRL 5IR1A 3AS2A 4MQ7B 5DJDA 1E6JL 1FP5A 3PDOA 3QO0B 2VXSL 4PB0L 3R06B 1MVFA 5HGHA 2AXGA 3O0RL 4EI6A 2BCKB 3LKRB 1HSBA 5DO2D 5L2KA 4OF6A 4HC1L 4MMZC 4MJ4A 5CZVH 3S3PA 5JOPD 1AY1L 1P7KB 1AXTL 1I1AB 5JDSB 5DFVC 1KN4L 3MRNA 4RFEB 3BW9A 5EU3A 1OSZA 4M61A 4AEHH 5DUML 2YA0A 1MQKL 4K71C 4O4YH 3EO0B 2DQDH 3H9HA 3WIHL 3NCMA 5E8OB 2F8OA 1R5IA 3HUJB 5C70A 5IT2L 1SEBA 2CGRL 3OJMB 4ZFFA 4H8WH 5IK3A 3QIUB 4JKWA 5H94A 3BP4A 3HZMA 4ZUSA 3KPSD 4XNMA 2CXGA 3MRKA 1PZ5A 1WZKA 1MLBB 2E9BA 4NP4L 1MJUH 4HPOL 3BP7B 2VXTH 4AEIL 4WDIA 1D9KD 2B39A 4PRBA 4A6YA 2VXUH 4TPRL 3QQNA 2RHEA 1LK2A 3MRRB 7FABL 5CD3A 1FYTB 4Y16B 4BSJA 1T2XA 2ZUXA 1UZ6E 2OI9C 1I4FB 2X41A 3RWCB 2XA3A 4ZTOH 2KPNA 5B4MC 5IF0A 3ARDA 3KPLB 4TULH 1OGTB 4NNXA 5T1LD 4FFZH 5C2BH 5HVHC 4LRNH 4DTGL 3SKUD 3GHEH 5BRZE 4P9HC 4KMTL 4Y1AB 4HC1A 4POZD 1XH3B 5IVZB 3D0LA 2F54D 2GY5A 4N8VB 3C5ZA 2NY3D 4N8PA 1G9EA 3QDJE 4Y19A 4KV5F 2BSRB 2N56A 5CCKH 1WJ3A 4PJ9D 1X4YA 2YOCA 4KVNH 4HULB 2IPTL 5TDNB 1FRGH 4XMPL 2VN7A 5JZ7D 2GK2A 3L9RA 2C3GA 3QI9B 2HTLD 1KN2H 5AZ2L 5E7BA 1MFDH 3SDDA 3TBSA 4CMMB 4DOHB 5CEZE 4XI5D 4I9WD 5DT1H 1T0MB 1FGNL 1LMKA 4P4RB 3RY6C 2W0FA 1WBXB 3THML 4HV8B 3SQBA 4KZEH 1RURH 2JE8A 2VLRE 2ADIA 2VRAA 2VOTA 2DQGL 2EDKA 5EO0A 1Z0MA 1RUAH 3LEVL 4QRUB 4NO3A 5E2UL 3FQRA 2X1XR 2WSKA 3VFWA 4K9EH 4RFOL 2PXYA 3IDNB 2GUOA 5LGJB 5SX5H 5M94B 4X7EC 2Z4QA 2AXHA 1BX2B 3UYRH 5DJ2B 4Z78A 4OIAA 1RHFA 3L7EB 1H3UA 1KYOJ 4HFUH 3QUMH 2IQ9H 4AENA 2VAAA 5F9WC 3MJGX 2OXHA 2ENYA 3CX2A 3QDMB 4ZYKB 3WS6C 4XAKE 1G9MH 4HXAH 3WFBL 1F02I 1RZKL 1Z5LA 5BVJA 2OM5A 3MRCB 1RJCA 2RIKA 3VXOA 5KVFL 5LJYH 5JPNA 2DBLL 4J6RH 4YIQB 3VXTA 1GJIA 2FIKB 1RK1A 1XCTB 4I48A 3T04D 2D7PA 4QF1A 1IEHA 2W0PA 3MRLB 2Z92A 3ETBF 1HHIA 2YC1A 3QXWA 3KXFB 3RZCB 5JW3L 5KN5B 3V2AR 4CU8A 2DS4A 3FCTA 3HG1B 1TJHH 4G5ZH 3SDYL 1MIEH 2VC2H 4L8BB 1EGJL 2QR0A 3F8UB 1WIOA 5K93A 1S78D 4KRNA 1MFAH 2AEWA 1FBIH 1CXEA 1BVLB 4YXKH 2HVJB 3X13B 2G5BA 3ZKXB 4W6XB 4YPGA 4WEUD 5GS1B 2LAAA 1WWWX 2Z8WC 1S7UA 2ADGA 4NN5C 4NQDA 5ESVA 3NFNB 5DJ8A 4HDIB 4M93C 3O9WD 4LSTH 3FFDB 3RWDA 3VFMB 4MD5B 1EJOL 5KANI 2VLJB 3HNSH 4TSCL 4OLVL 2WP3O 2E7LA 4ZO9A 5FB8A 4GUPA 4V2BA 1QA9B 3TO4B 1QSFA 3V5DA 4L4VD 5BZDA 5B39B 5JXEA 4F2MA 1S7QA 4MSWA 5HHME 3MV7E 4JG0H 2EO9A 1EFXA 2VZTA 3X14B 5I9QB 2QQNH 1CFQB 4WVRA 4L8DA 2IAMC 2XPGB 5DD5L 4GKOA 3FT2A 3V8CA 4TTDD 3NZHH 2BVUA 3S6CA 4FABH 5JIKA 5CJQL 2FO4A 4WRLA 3D1MC 5C08A 5IP4A 1YMMB 2A74A 1KIPA 2EYSA 5IHLB 4JHWL 7CGTA 4WUUA 3SN6N 4NHCL 3A6CH 3LKSA 2FL5A 1MVUA 3T0ED 1AFVL 3BMVA 4E0RA 3S9DB 4UDTB 2XZQL 1PSKL 4HS6A 5GSVB 4Y4KA 1DSFH 3ORJA 4K2UL 4R3SA 4YHOH 3G6JE 1LK3H 4OF0A 4FFWD 4L3CB 1OGAA 4O2CB 1I9EA 1NCAH 3MA9L 4OGYH 3OG6B 4QRRA 4X98A 1YEGH 4F7CB 1JYXA 3QUKB 2PYED 4NRZB 4YBQD 4K3DL 2OYPA 1C5CH 4WHYG 4I4WA 4XB7A 3SOBH 3VXPB 3FB6B 4YHLL 2VKXA 3MXVL 3FT3A 4NQSA 5EBMA 2GI7A 4V3DB 3WSQL 3KGRA 4JY5H 3WO3B 5FDYA 1MI5A 1OAKL 4OZFB 1FNLA 1HOCB 4JFQB 4P2RA 4QHLB 2VUYA 3SPVA 1UADC 2GJ6B 4MB4A 4KUCF 2DQCL 1UCBH 4JPVL 3MA7A 4RQQB 1WT5A 4PJXA 3QCVL 1XEDA 4AK1A 5DVKA 2BOBA 3B43A 4OQTH 1QRND 5JOPE 4WTZG 3G9VA 3QG6A 2A9ML 4Z5RB 2ZSVA 43CAB 5TE6H 4QHMB 3CZFB 4K7PL 3MRHA 4NGHL 4ZD3L 3WKMH 5GRZA 5JUEH 4TVSa 4MD4B 5IIEA 3M45A 1N4XL 1BQHB 4LPXA 2A2QT 4P46D 3LSOB 3M8OL 1KTDB 3DV6A 5I8KL 4XWOD 3DUSB 4OLUL 1F4AA 4TSBH 1F4XH 3HRZB 2VDPH 3G5YA 3MRQA 1WFUA 4F9LC 2HMIC 4OCYL 1UM4H 1CFVL 2WANA 2UUDH 3Q1SH 4PJ8D 4GMSH 4JO2H 1WZLA 5ETUB 4XH2B 1QSZA 3WFEH 5I1HH 2OTWB 1MPAL 3WD5L 2B5IB 2DI8A 2P5WA 1JRHH 4ODWA 4JO1H 4B0MM 3BIKA 2YPKB 1U58A 4NRYA 4PRHD 5MEND 2XWJB 4RIRA 1T89C 5JQ6L 3MLSL 4MD0B 2YD6A 3GSNL 1RZ8B 5INCB 5I76B 2BHUA 1ITBB 3WEXB 4IRZL 5H35B 1CD0A 1EBAA 4V1DD 2OR9L 2N1KA 4PJAB 4G6AC 3BH8B 3VRLE 3IJHA 1BJ1J 1HXMB 3G6JF 2QQLL 4I2XB 5HDLA 4BSWB 4FXGA 2Q8AL 3TA3B 3RDTA 2X09A 4U3HA 1FO0B 5L6YL 4PJ5B 4OLXL 3TN0C 1XIWB 1S7VB 4EDXA 1F58H 4JFXA 5B8CA 5FK9A 4JJ5B 3V4PL 3WL9A 2GAZB 3NCEB 3BPNB 5IW1A 2ZPKH 4JFDD 2QLVB 4NM4L 2DOCA 5CILH 4HZLA 3W0WB 1L6ZA 4LCWA 3S35L 2PETA 4QRSA 5IQ9B 4M7LL 4Z7WB 1KB9K 5D9SB 2WNGA 4EEEA 4P2YA 1HH9A 3F7RA 4NN6B 1S7WB 3WXWL 1NFKA 3D85B 4DOHE 1CK0H 3IVKB 5HJ3A 3HAEH 2VQ1B 2HYMA 2AXGB 1A3RH 2ZUQC 1HQ4A 1BZ7A 4F7PB 2GSIB 3OHXA 4ZPVB 1L6XA 4Q6IB 1QVOB 4LLUB 4KKBC 5BVPL 3DO7B 3S37X 2FD6L 5L2KD 2WUBH 3KPNA 1P4IL 2NW3B 2ADFH 3L5HA 5C0EA 4M61B 3V6ZB 1Q9KA 5F3HB 3SE4A 4ZTPH 4H25B 2APVA 1EZVX 3LKNB 3OJ2C 1CYGA 3AS1A 2UZIH 4CVWA 5IB3B 4LFHG 2BX5A 5ICYA 2BSSB 1E4WL 2DKUA 2GW5A 4YDKH 3FFCA 1KTKE 4ZXBD 2ZCKL 3GMLA 2BVYA 2BNUA 4ZFFB 1P4BL 2VDOL 4JHZA 5CGMA 2AK4D 4JY6A 3SQOL 5H94B 3P11L 3QDME 1EUUA 2NXYB 1NUNB 2YUVA 1GOGA 4MWFA 3T77B 5GRJL 1HNGA 1KEML 5CD5C 3RUGA 5F1IA 1LEIA 5D5ME 5EZJA 4D0CB 3QIBC 4ZS7H 5JHLL 3ZDZE 2WBJB 5DK2A 1U3ZA 1OW0A 1CFBA 4ZFZA 1HINH 2H8PB 4X9HA 3MJ9L 1FFNA 1ZXQA 4PV9A 3FZUD 5DJZB 1EHLL 4W6WB 1SYVB 2R0LL 1WC7B 5F89A 4OJFH 1QBLL 4OTXL 5L7XL 1CG9B 2A6IA 1A64A 1W72L 2XTLA 1KEGH 3HG1E 1WTLA 4G80B 5J11C 1EEQA 1SYSA 3CDGB 2OZ4L 4N8VG 3VRLF 1PG7H 3PQYD 2BC4A 3OF6A 4ZO8A 4MJ5A 1FIGH 2FH8A 1D5IL 1BOGA 3GMQA 3ARDD 1MCHA 5H37G 3SE8L 5DJYA 2O93L 1Q1JH 3RQ3A 1LE9B 5C0DA 4AT6A 5EZIL 3QWRD 5KVGH 3K2UL 5KAQG 1LO4L 5KSVB 1SBSH 5ID0B 1RVFL 3C5ZD 1QSEA 1ND0B 2M8XA 2VLJE 4UINH 4Y19D 3K2MC 5FHBL 4N1HB 4R7NA 3VFTA 1PY9A 4KROC 3L9RB 5AUMB 1T66D 1FC1A 1RFDL 3AB0C 5EFIB 3HNTL 2VLMD 4WU5A 3SDDD 3EGSA 4OD3L 3TYFA 2EEAA 3BDXA 4UIMA 4OI7A 2NLJB 4N5EC 4C58B 5MERA 4BZ2H 5EUKA 4ZFGL 3FJTA 4P5KA 3U7YL 4K94L 4O02L 1WAAE 4K8RC 3B9AA 1CFTA 3FQRB 1I9IL 4DKEH 1BOYA 2A77L 4O00A 4MAYA 3MZTA 1MCPL 2FX9L 4LSVH 1ZWIB 1HI6A 2ZP0T 3RVVC 4G3YL 2GUOB 4HAGA 3SO3C 1F4WL 5I8CA 4LF3B 2ITDA 2PXYD 3MJ9A 5TGBA 4JFFB 2BZDA 3MCLL 5DMKA 1VFOA 1INEL 5ICXA 1R5VA 4EOWH 3VMNA 2EDBA 2PR4L 1KUMA 1EFQA 1FCCA 3PL6B 2OZ4A 1IFHL 4UT7H 2Z9TA 5EBWB 4ERSH 1FFRA 1FZMA 2M26A 4UTAL 2YWYA 4KAQL 2H2PC 4IRJA 2EDHA 4UIKH 4YHIB 1QNZH 1L0XA 5D5MF 1J8HB 4HUXB 3L3KB 2Z92B 5GS0C 2V2TB 5ISZA 3CNKA 5TPWH 5KTEL 3AXLA 1N7MH 4Z18A 4HMDA 3WUZA 3O6KL 5DD1H 3FCTB 4P9HL 3LEYH 1U93A 2GJ6E 4JLRA 3S35X 5JW4R 4GT7A 2EDQA 4DGYL 1F42A 3DETD 4GS7C 1IAIL 2DQEL 2CLVA 1V3LA 1Q38A 3BQUC 2G5BB 3K3QA 2R29L 4YPGB 4OCRL 5CZKA 4QXTB