3BZUA

Crystal structure of human 11-beta-hydroxysteroid dehydrogenase(hsd1) in complex with nadp and thiazolone inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYNMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization and pharmacodynamic effects of an orally active 11beta-hydroxysteroid dehydrogenase type 1 inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 99
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bzuA00
4U6QA 4DGSA 4TQGA 3SLGA 4YJGB 1HE5A 1U5CA 1TB4A 4IDDA 3FRJA 2O3RA 2Y1GA 1ML3A 1HDXA 2PV7A 3WGZA 2ZYDA 1PU2A 1YB5A 4WASA 5JCJA 2PY6A 3H4VA 2C2XA 3W4JA 4R68A 1E3SA 4N54A 1ISFA 1QYWA 3IP3A 1WP4A 2AG8A 2EP5A 3KRTA 3MZ0A 3O03A 1N9GB 4L76A 1PGJA 4OL9A 3DOOA 4RVDA 1ZMTA 3FWZA 4FD3A 4BUCA 3CE6A 2AW5A 1BDMA 3TQHA 4UVHA 2FHSA 5ICMA 1EDZA 1EMDA 2V7PA 3RAJA 2PZJA 2SCUA 3I83A 3ZHZA 4BO3A 5B4TA 2HK9A 2POQX 2ZJ1A 1FMCA 2DUWA 3B20A 2X6TA 3GFGA 2ZYGA 4ZA2A 5L45A 3RROA 3PPIA 3GNTA 4BKQA 4ZN6A 1YL5A 3W6ZA 2D2IA 3CZMA 3DMTA 5L4NA 4W82A 3SC6A 1WDMA 4J16A 1PWXA 5THQA 4RPHA 2PGLA 5KJCA 3I3OA 3OICA 5BNIA 5TT0A 1QRRA 2B4QA 4AJNA 2VNSA 3QA9A 4YT2A 3E9QA 2G76A 4YB8A 3WR5A 1NQAO 3Q11A 4JCOA 4XGKA 3TDKA 2PH3A 3ANMA 3JQAA 4CMAA 3U4HA 3SLKA 1Q7BA 2FR1A 4LRSB 3H8VA 1EUDA 3Q3CA 4BKPA 1NWHA 5IXYA 1PR3A 1N5DA 2IDZA 1EUCA 4P4NA 4BO4A 3HE3A 2A4KA 1W0CA 3GGGA 4BO7A 4D45A 1HWYA 1XQ1A 1Y8RB 4MJLA 3WFJA 2RHCA 3OQ6A 2JHGA 4EUHA 4E21A 3IOYA 4RF5A 1YDEA 4TRNA 4AVYA 1WPQA 1E7MA 2QYSA 3VTFA 3WX0A 1IZ0A 1PIWA 3RC2A 3CMMA 2GNAA 1YBVA 1Z75A 4N5MA 5IDYA 4BNVA 3H3FA 4BVAA 2JAHA 3KLMX 3FCOA 5IDXA 3WBFA 4B7UA 2ZYAA 2Y0DA 4M49A 3OEYA 3DZKA 5AOVA 3ETDA 5DBIA 4CLEA 1N9GA 2OOSA 1BGVA 3ZW8A 1FDVA 2BRUA 1C1DA 5GMOA 3BHIA 3GVXA 4RVGA 2FN7A 5U9CA 3WQQA 3NT4A 2A35A 3U0BA 1LRKA 4BNWA 2GZ2A 4K6CA 4ESOA 3X2EA 1BSVA 5L4LA 2FZWA 3VPGA 5A3JA 3MTJA 1JLLA 1E7QA 1TT7A 5JC8A 3PYXA 1NVTA 5EQFA 5C7OO 4PLPA 4CMIB 4EJMA 1ADGA 1XGKA 1UZMA 1EFLA 5I9NA 4W7HA 1FJHA 2FWMX 2EV9A 2DU8A 4IDBA 4RPGA 7MDHA 4H16A 2NUAA 4C7JA 1IUKA 5F3RA 4D79A 3GQVA 5FYDA 4D3SA 4H15A 1DC3A 1GZ3A 3ITDA 1DFHA 1PTJA 1ZK0A 2X22A 1D3AA 4F6LA 3RUIA 2AQHA 3AM3A 3HWRA 4LCJA 2FR0A 1WDLA 1EVYA 5G0UA 2HRBA 5B12A 2W2KA 5HBRA 1LC0A 3Q9UA 4TVBA 4XQEA 2JAPA 3C7DB 1H0KA 1M6WA 1OBFO 4RF2A 2NACA 5IDQA 3JCZA 1C1XB 4PG6A 1M76A 1ZXBA 4CM4A 3UCXA 4DXHA 1P31A 1SEPA 4XA8A 1QP8A 2O3UA 1J6UA 3PQFA 5H82A 4DYVA 1GV1A 3R1IA 1PZHA 1GUFA 1Y8RA 4WNCA 2DFDA 3DL2A 4FW8A 2P5UA 1E6WA 7ADHA 4AJPA 1B26A 3NJ8A 5TGDA 3WTBA 8ADHA 4FFNA 3RC9A 1YOVB 4DWVA 4E2ZA 5JPIA 2Y1DA 1DFIA 3NAQA 4PG7A 4MKXA 2FRDA 1CETA 1QMGA 4CQMD 4CUKA 1GTMA 2EKPA 2BI8A 1U7TA 1KS9A 2AXQA 4O6VA 4FJ0A 3HDJA 3GGOA 3OFSA 5CEFA 1T2DA 4UUOA 4CLRB 4CMEA 1ONOA 1I10A 1YGYA 2OP0A 2YFHA 1VL8A 1O0SA 3U4DA 1Q7CA 3EZLA 4TKMA 5A5EA 4LISA 3DZFA 1UP6A 4S3MA 4A26A 4DBZA 2C7GA 4YAKA 3ZWCA 1A27A 4E31A 4JBGA 4AJLA 2D59A 1Y7TA 4MIOA 3AOEA 3ZWWA 4R3NA 4K1LA 4QECA 4I5EA 1FXSA 5KVVA 4U5QA 2ZCUA 4QQRA 1YBMA 4YAEA 2YDXA 3K8ZA 4BMNA 3L6OO 1AHIA 4R69A 2E6UX 1D1SA 5ER6A 3G17A 4YR9A 2X5JO 1W4ZA 4R3WA 4A27A 3FTPA 3PWZA 2JCXA 3K2EA 2CDCA 2WEKA 2X58A 2C2YA 1U28A 3LC2O 3OBBA 5F1PA 4L9RA 3I23A 3PLNA 3S2FA 2VRCA 3PYMA 1E1KA 3VH1A 1I0ZA 2ZKLA 4QUKA 4Y98A 5DCUA 1JKIA 4F46A 1WNTA 4GX5A 1T2EA 4PLCA 3OA0A 3WBBA 1K2WA 2X1HA 1NHWA 5T67A 1A7AA 4Y6PA 3DOCA 4RJTA 1JTVA 4GPD1 4CLDA 3FI9A 4J3FA 5J23A 5TIIA 4D0SA 4J0FA 5CPBA 3RUCA 4FPXA 4RL6A 1PZFA 1G1AA 4PRKA 4KUGA 3CUKA 2NLOA 1PZGA 5L95A 2GGSA 1KVRA 1ISMA 4WLNA 1B15A 4CUJA 3UICA 2AQIA 2Q2WA 3GG9A 5F1OA 2PFGA 2AMFA 1HLDA 4RDIA 3ETGA 3BMOA 3KBOA 1DB3A 1BDBA 3PIDA 4N5NA 1QYDA 2ZTLA 4NU5A 1LDGA 4A10A 1EVZA 4RF4A 4GSLA 5TJHA 4W4TA 5HS6A 4FOSA 1ZUD1 1N7GA 4YRBA 3F47A 4B4VA 2P4QA 2XXBA 4D3DA 4HWKA 3BMQB 3BXXA 1QYXA 2Q46A 5KKCA 3ON5A 4D43A 2Q1SA 3H9UA 4GKVA 1PSDA 1V6AA 4LVCA 2QW8A 3EZYA 3DBLB 3ZV6A 4Y6RA 3QRWA 1YB1A 1P3DA 3KV3O 3LLVA 5CDYA 1A7KA 3JQ9C 1C14A 2F1KA 2RH8A 4FFLA 3PXXA 1AUPA 5T8KA 1DHTA 3K92A 1HZZA 4ZQGA 3GUCA 1LDEA 3WYCA 1LDBA 3JQ9A 4XQ9A 5JY1A 4II3A 1QSGA 2P9GA 4Q3CA 3GR6A 3SXPA 2X8LA 2E82A 3INGA 4RPLA 4ZHSA 2JCVA 4J2OA 5EMHA 4YEDA 2YV3A 4OAQA 1E3WA 5DP1A 1Y6JA 2JFHA 2BELA 3JD0A 1C0IA 4AJEA 4IPTA 3IDSA 3TOZA 3FWNA 4R1SA 4CMGA 3K6JA 3T4EA 1O89A 4CM3A 4CM5A 1JA9A 5B4VA 3D4OA 1C3VA 1KVQA 3R3JA 5JDCC 3S1LA 4DMMA 1H2HA 4E3ZA 1XCBA 4AJHA 3HQ4O 3WGYA 4BB5A 3QVOA 1BXZA 3TOXA 5HWSA 3C1TA 4I9UA 3GEDA 2AEMA 2JFGA 1JVBA 4IMPA 1D7OA 1CWUA 1MG0A 1Z7BA 5G0WA 4DQVA 1ZBQA 2Y99A 2CVZA 2X86A 4F6CA 2RAFA 4DRYA 1K6JA 3F1LA 3L4SO 1JKJA 4GMFA 1DRWA 1YQGA 2QZ9A 4TZKA 2BFAA 4ZRMA 2OBYA 4IZIA 4CV1A 2NVUA 1I30A 1WZEA 3UFXA 2Q4BA 4WUVA 2ZB3A 5FEUA 4CL3A 1BW9B 1V3VA 3ZWNA 4BL5A 5JLAA 3WJ7A 2DTDA 2G82A 1HF3A 5IN5A 1U3WA 3RUEA 3PIIA 1I3KA 5JW6A 4EEXA 4IJUA 1WMAA 2VNAA 3RUAA 3ANNA 5B37A 5ILOA 5TF4A 1OMOA 1H9BA 1PJTA 3QW2A 2Y66A 3F4BA 1KC3A 1X0VA 3H5NA 4I1IA 4FSHA 3E6AA 4RVSA 4XJSA 1J5PA 2IXAA 3PVZA 1PJQA 2BHLA 4FDAA 4R41A 1SNYA 5L40A 3KM0A 5THKA 1O95A 4GKBA 4XIYA 4B79A 3BTOA 3QV1A 3C8MA 5TRTA 1MLDA 4RVUA 1W6UA 5G4LA 3TL2A 1SZJG 4FB5A 4XYBA 1NAIA 4XWYA 1A9YA 3RSHA 4N5LA 1ZEMA 4OKNA 1EK6A 4HFNA 5IN4A 1NR7A 3TZKA 4CM7A 5CDGA 3BZUA 1UAGA 1Y8QA 2C0CA 1V0JA 2R2GA 4DTIA 3GZNB 1DIGA 5CDTA 2ZTUA 3WGTA 4U0KA 2GSDA 2VYVD 1P9LA 1GPJA 3ONFA 1DIBA 3VZQA 2DUUA 3PDUA 4JK3A 4M8SA 3I9JA 4KZPA 2W8ZA 1HDYA 4PLFA 2WD8A 1YVEI 2GD1O 1HKUA 2HLPA 3OIDA 5KOIA 3ZNPA 4HNGA 5EJ2A 2WYVA 1H6BA 2HKIA 3GLQA 3LK7A 4D42A 1C0PA 1NVGA 2GN6A 1L7DA 1T2CA 4PLVA 1G0OA 4D46A 3ZW9A 1BVRA 2IZZA 5TJ9A 4B3IA 4HFJA 3H7AA 4LRTB 4K26A 1WDKA 3PI7A 4QT0A 2Y1CA 4A73A 1BW9A 4BNJA 5JAMA 2EP7A 4YPOA 1NFFA 4CV0A 2P68A 4HADA 3WWYA 4FS3A 2JKVA 4NHEA 5G2OA 1ZSNA 1CQIA 3W1VA 4G65A 4NFSA 1TT5B 2RHRA 3TRIA 2CD9A 3CEAA 3WDSA 3QLJA 2X9VA 3EVTA 1CDOA 3EGOA 2VT2A 5H83A 3ZU2A 1IZ9A 4OYRA 1BG6A 3OJ0A 3TSCA 1DIAA 4R1UA 4B4OA 4IQGA 2PA3A 3ZU5A 3ZWVA 1CQJA 4W9NC 1AGNA 3D4PA 1GCOA 4UEKA 4ND5A 5ES3A 4IJKA 5JO0A 1PQUA 1VSVA 1M6HA 4DVJA 1DIRA 2EJWA 3WXBA 2EEZA 1MP0A 1ZO8A 3H9JA 2B0JA 1EEHA 1VRWA 2UUPA 2GO1A 1V3TA 1DLJA 2B35A 2Q2VA 3TN7A 5K9ZA 2FMUA 1JAYA 2PR2A 4DREA 4XQCA 5KTKA 2RBEA 1SEVA 2R00A 1DPGA 2VHZA 3KZVA 4XYLA 5JDIA 1SMKA 2Q2QA 3H9EO 4OQZA 4ND3A 2C5AA 3BYZA 3PJGA 3PWSA 3JQ8A 1QYVA 3NYWA 3DXFA 1HYHA 3E8XA 5C3MA 3KVOA 3CTMA 1KOLA 5GY7A 4IS3A 3F4LA 1QR6A 3GUYA 2UYYA 3RQSA 3WB9A 4ZU3A 1HT0A 2OHXA 4CM1A 4JGBA 1EFKA 1EQ2A 3G3EA 4BNMA 4OSPA 3GPDG 3DZIA 3VVCA 3AI1A 1QV7A 2BMAA 3PQEA 3BMQA 5LCXA 1G0NA 4URFA 3DQPA 1IY8A 4S1VA 4J1NA 3OM9A 4FFOA 4ND1A 2OL4A 1Q2XA 1HLPA 2OORA 1ZSYA 3L07A 3NV9A 1N7HA 4XD2A 4CM4B 3PGJA 3DONA 4PVCA 4L4RA 3ST7A 1JN0A 2ZTMA 1MG5A 1N1EA 4MVJP 3HHPA 3FN4A 6ADHA 4YYZA 1LXCA 3V5NA 2EXXA 2B4RO 3W8FA 2PGJA 4B4UA 3CSDA 4MP3A 3IQDB 3LLSA 1Q0LA 1HYEA 4CM9A 1OI7A 4LVUA 3FR7A 3NT2A 4NI5A 3JYLA 3WLEA 1RPNA 4AL4A 3DFZA 3UH1A 1I3NA 3CZRA 3AW9A 4NBUA 1ONPA 3E82A 3BMNA 4FC7A 1HL3A 3ENKA 4BV8A 3NJ4A 2Q1UA 3TZCA 1R16A 1PJBA 1U8XX 3X2FA 3RBZA 3BHMA 3H2ZA 2JCYA 3KYDB 3QWFA 1XA0A 1K5HA 3GMDA 2GRAA 3G49A 3JQFA 5JDIC 1E3IA 4JIGA 4FFPA 2VHXA 1E0DA 2O3TA 3DBRB 3GVIA 3FNFA 5EERA 2PD6A 3H2SA 3I6IA 1UXGA 1EBFA 3HB5X 4EYEA 3COSA 1Z45A 2ZCVA 4LMRA 5COQA 1V8BA 3ZHXA 1LDNA 4BGEA 4KQXA 4KTVE 2Z5LA 2C59A 4TRMA 2I66A 4XQGA 1IHYA 1UP4A 4JLWA 1TI7A 4WLOA 2W4QA 3SC4A 3LQFA 4DUPA 5IZCC 3NDRA 3I1JA 1U3UA 1S6YA 4Y8VA 3PHLA 2I65A 3MJVA 2GERA 3VPHA 1PJLA 4BGUA 2PZMA 1LDYA 1FDUA 1HDZA 1M66A 2AQKA 4X54A 1E3JA 4PRLA 4Z9XA 4BNKA 3GHHA 1VSUA 2QG4A 3GN2A 4B8ZA 4WPGA 3KHUA 3V8BA 4OXKA 2DLDA 1E1MA 2WMDA 2CVOA 2NQTA 3ITKA 3E5RA 3OSUA 4JBHA 2BFOA 4XRGA 1GUZA 3ABIA 3IJRA 4B8WA 4P8RA 5KWEA 3UOGA 3IUPA 1QYCA 1ENZA 3FF4A 3IP1A 4ZJUA 4NZ9A 1R4MA 4DLAA 1O94A 5A03A 5BNTA 1NQ5A 1O5IA 4LW8A 3ZN2A 5KJFA 1LDMA 4MP6A 1T1SA 4DC1A 1T2FA 3PDJA 3TFQA 5L7TA 5CG1A 5KCZA 4HP8A 4WNIA 3DWFA 2ZK7A 1KY4A 5B4UA 3K9QO 1EVIA 2YHIA 3C3XA 4ND4A 4MVJG 5JAQA 4EJ6A 1HXHA 2D4AA 4NR0A 4E2XA 2P9CA 2CDBA 4AJ4A 2PH5A 4D3FA 2FOIA 2P4HX 3QVWA 1H6AA 1PGOA 4RCVA 1PX0A 5BNFA 1A72A 1BHSA 4YJHB 4NDNE 4WE3A 3M1LA 4UULA 1U1IA 3E1KA 4DIBA 3EDMA 1YL6A 2EW2A 4WLUA 2HMUA 2F00A 1QV6A 3DOJA 4W7IA 4BKRA 3WGIA 4GVLA 1E77A 1UXJA 4KOAA 3B6ZA 4IM7A 1GZ4A 3GVHA 3D64A 5F1KA 4J49A 1N92A 4ALLA 2HSDA 2IEBA 1PZEA 1XEAA 1DSSG 3QE3A 4QTZA 4AG3A 1X1TA 1C1DB 5CG2A 5KJ1A 4WLVA 3S2GA 3U9LA 1TXGA 4WCFC 3IUSA 4Z0PA 1ISIA 4AJ2A 2O7QA 4RGBA 1O6ZA 5DZSA 2B4TO 1MB4A 1PGNA 3EHEA 4PLYA 2FZEA 3ZDFA 4PG8A 3JV7A 2ZB8A 1NQTA 4E4YA 4TSKA 1IULA 3E9NA 2VHYA 3EC7A 4P4LA 4I5DA 4OQYA 5JMPA 5H81A 2VZ8A 5JAZA 2E37A 1WVGA 3JQ7A 4NBRA 4ZVVA 3M1AA 3HSKA 4EUEA 5L4SA 4NIMA 3UHAA 4ZQEA 4YBZA 3JQ7B 5COAA 1ISJA 4RDHA 1OAAA 3QWIA 3HNPA 1X15A 2I99A 4YT5A 5A9RA 1XQ6A 3NEPX 3NDJA 5JXWA 1I33A 5JDCA 4OM8A 4CMKA 2RCYA 4L4XA 4IINA 5IXSA 2G1UA 3DBHB 4GGPA 3Q2KA 4HUJA 1Y5MA 2NTJA 4BB6A 5IZ4A 1Z7EA 4P4GA 3KLPX 5EPOA 2XXJA 2YHIB 3GDFA 4IDFA 4M55A 5TLSA 3BTUA 3WIEA 1R6DA 2Y0EA 2EF1A 2FPGA 1UXKA 4CQLB 4E0BA 5MGBA 3IAHA 2GUGA 1YE3A 2AE2A 3WGOA 5LC1A 1C0LA 3OIGA 1Y9AA 4I8XA 2BGKA 2D3TA 3OECA 4I9NA 1ZJYA 1I01A 3PHHA 4GX0A 2OO5A 4E5YA 2J8ZA 3CIFA 1LNQA 1ZH8A 3VPFA 4BNYA 4OXYA 4IJWA 1NM5A 1VE9A 1UP7A 4FJ2A 4CLOA 2VCYA 4PVDA 3GOHA 4BO8A 1ZJZA 1UAYA 4TZTA 3AM5A 1N8KA 4AFNA 5K0ZA 3V2UA 1GCUA 1T4DA 5I7FA 5IFLA 1P77A 2O50A 3FBTA 3NTQA 3LT1A 1DFGA 3MWEB 2W2KB 1AE1A 1LBEA 4MKRA 3DBLA 1H93A 3CXRA 4YJFB 4GSKA 4J90A 4LCEA 1O9BA 3QVTA 4M54A 4YJGA 1K0UA 2WE8A 3O9ZA 2E48A 1DRVA 2Y68A 2Z95A 3FNHA 4PLZA 5B1YA 4O5OA 5BT9A 3ZU4A 3DR3A 1IPEA 2HJSA 4E32A 2I76A 5JBIA 3MOGA 4J9UE 1DHRA 4WJZA 3RD5A 3KYCB 4E6PA 4A5OA 3GFBA 1N2SA 4MIEA 5AXCA 4Q3BA 3MCVA 1I2ZA 4BQPA 5C5IA 2Q49A 1EUZA 2PKQO 5G4KB 2B83A 1XDWA 3QVXA 4W9NA 4NBWA 2CMDA 2VYVA 5TX7A 1ZSVA 3PHIA 3DMTC 4WOJA 2YUTA 2PK3A 2PTGA 2NQ8A 1NFQA 1XIVA 4J1TA 5TSDA 3LZ6A 1X7HA 4BNLA 4BO6A 4II2A 2D1YA 3L4BC 2X4GA 4M1QA 3JYQA 4YAGA 5DCYA 1ID1A 4WLEA 3HDHA 1PS9A 3MEQA 2DPHA 5EESA 1YJQA 4Y6SA 5K6AC 4PCVA 1ULSA 1LSSA 4E5PA 4N18A 2Y1OA 3UGKA 4FFMA 3FHLA 4XJTA 4B3JA 1D4FA 2NU9A 4WCDA 4A03A 4ROSA 4DLLA 4OOFA 9LDTA 3GZ4A 2NTNA 4DQUA 4DPKA 3RKRA 1LTHR 3LC7O 1I8TA 1YL7A 4FBGA 2H6EA 2FPPA 3NTRA 4J6FA 4BNIA 2AA3A 2D5AA 1NNUA 1KVUA 1NQOA 2BKAA 1EQUA 1GUYA 1Z82A 4BKOA 4CM9D 1PS8A 3DTYA 1PEDA 4J1SA 1WLYA 2UAGA 3HADA 3OP4A 4CR6A 5DULA 1VL0A 1F06A 4J43A 4Z3KA 3AU8A 4JP3A 4HX5A 1DO8A 3R6DA 2C54A 3MJTA 3U3XA 5AVOA 2X9GA 1P1HA 2OP1A 1NPYA 2YY7A 3D1LA 3IJPA 1R12A 4RZHA 2WE7A 5CEJA 5JYEA 1DAOA 3ZNQA 3GMSA 4QXMA 1I2CA 4CM8A 2DPGA 4CMIA 4KTTE 4CR8A 1LQUA 2AE1A 2ZB4A 5KVQA 3BIOA 1LX6A 2Q45A 2AEFA 3ZV3A 3KSDO 2QIOA 2IODA 4FOOA 1NAHA 3OETA 3OQBA 4U6SA 2HMTA 3JQAD 1ZK4A 3DBVO 3M2TA 1NX6A 2IZ0A 4GWGA 2BGMA 3AUSA 3C85A 3N74A 1I3LA 4RZIA 3A06A 3DB2A 3LT2A 4TRRA 4XR9A 4J7XA 3Q2IA 3ONDA 5AYVA 3H3JA 4IGEA 2DBZA 4YCAA 3AUUA 3RFVA 2HMWA 1ZFNA 4R54A 1YB4A 1KIFA 3Q1LA 4BKUA 1RM5A 1GQQA 2BFMA 3HUDA 1T1RA 3GY0A 4WGGA 1P33A 2DKNA 2B5VA 4C4OA 3KOUA 4Q3DA 1H6DA 4BO5A 1PQPA 4G2NA 4N7RA 3K5PA 1KY5A 4JX8A 3QWHA 2YW9A 2LDBA 3AI3A 2C20A 2O7SA 1AXGA 1NR1A 4AJJA 1KEVA 3F1KA 1U4SA 4NG5A 5BSFA 1LSJA 3JQGA 1TLTA 4UEOA 3H5RA 1DXYA 1VLLA 8LDHA 2AHRA 4RF3A 1ENOA 1HSZA 1LJ8A 3U62A 4NQZA 3JD4A 4INAA 4YJHA 5I9MA 5COBA 5I8ZA 1F14A 3OH8A 2VWPA 3TJRA 5L3ZA 1XR3A 3AJRA 1ULUA 4EJ0A 2EKQA 2H9IA 4PLHA 2GYYA 4EUFA 3NRCA 2O23A 4PZCA 3JQEA 1YDWA 2P2SA 4O63O 3ZWXA 5LDHA 1GADO 2YZ7A 4GLLA 4AJ1A 3A9WA 5T64A 2ZTVA 3GNQA 1E3WB 2CVQA 5A9TA 3WSVA 1PJ4A 2CUKA 5JO9A 2IYOA 3IL2A 4K9DA 3NT5A 3VH4A 2VRBA 1ZW1A 1SC6A 4OH1A 3BHJA 4MIYA 2V6GA 1LSOA 4RQTA 3RC7A 3RWBA 4IDGA 1HDGO 2HUNA 1EE2A 4XEHA 1E7SA 4XZ3A 1XLTA 1IB6A 1OZAA 4UUNA 3BMNB 1LU9A 3D0OA 1A4UA 1E3LA 3ZU3A 5IAAA 5JCXA 3O8QB 2HDHA 4YACA 4XRRA 1D1TA 4MOWA 2XF8A 1CIVA 1L1FA 3GRPA 4BNZA 2DBVO 1YQXA 3UKOA 5G4KA 1O8CA 1SOWA 1H2BA 4RV9A 2GZ1A 3DAPA 3JYPA 1Y5RA 2BH9A 3R3SA 4TWRA 2VOEA 3GNSA 1RYDA 4MVJH 1XHLA 1GQYA 4PZDA 1ZK3A 4FR5A 2Q4EA 3OJEA 1P1KA 2CZCA 4BS9A 1B2LA 1HSOA 5DF1A 3ROQA 4YWJA 1U2GA 1BXGB 3QSGA 3JQCA 5T57A 2FY8A 5I7SA 4JP2A 3U09A 3K96A 1R15A 4KWHA 2HK8A 1T26A 5DCWA 2Y0CA 3KSZO 3ADPA 3T7CA 2VTDA 4BMSA 4E13A 3V1TC 4AJIA 1PQWA 2Q3EA 4C7KA 3RCBA 3ROKA 1GZ6A 5AXBA 3VKUA 4O1MA 5I9LA 3WGQA 4NJMB 3TNLA 3MJSA 2WD7A 1KETA 1CEQA 1P45A 5F5LA 1NPDA 5DT9A 1E6UA 5IG2A 4BO2A 1KEPA 3I4CA 3AY3A 3JYNA 5DOZA 3VPXA 3JQAB 3W4KA 4LK3A 5CDSA 3NUGA 2YYYA 1W73A 2DBRA 3ASVA 4CMCA 3PJEA 3MOIA 2UVDA 4K28A 1RM3A 3WQRA 1Z73A 2I9PA 3GAFA 4IUYA 3PGXA 1NXQA 4ZICA 2QRKA 2E4AA 3QY9A 3RUFA 1AN9A 2J6IA 4FCCA 3RBVA 1OFGA 3VHRA 2QQ5A 1G6KA 1Z74A 5CHEA 3N58A 1R4NB 1YWGO 2VOJA 4R5HA 5BSHA 2V6FA 4UUPA 3WNQA 5A4DA 1LLCA 4FFRA 3VH2A 3GC6A 4CODB 5HM8A 1I24A 1CYDA 3ZWOA 2EGGA 5JFOA 1BTOA 2Q50A 2J3IA 5C37A 3WOHA 3FNEA 3DEYX 3KYBA 2X7HA 3ZWAA 5L9AA 5IJZA 2PZKA 4E2WA 1JAXA 2ZB7A 4DYDA 3GDGA 1DAPA 4CL8A 2TMDA 3A14A 4IIUA 2NU8A 4R5MA 1P1IA 1ENYA 1TT5A 3L9XA 3CH6A 4NK5A 1T2AA 3D3WA 2AG5A 4MVJI 5A02A 4JNKA 1NFRA 3RVDA 4H3VA 3DHYA 5A9SA 1IOLA 1QXSA 4HY3A 4XR4A 1ISGA 1P74A 3ZCXA 3ZNNA 1B8PA 4GX1A 4XIJA 5JC1A 1K6IA 1CF2O 1HE4A 5GZ6A 1J4AA 3TZQA 2HQ1A 1R37A 3S55A 4DC0A 2B36A 4NU6A 3D4NA 4E5MA 2DAPA 1Y9EA 4Q9NA 5EL0A 4ITUA 5EQDA 1UDAA 4PZEA 3TFOA 4IY1A 1EBUA 5G0SA 3W8DA 3D3WB 4ALIA 1YOVA 2NVUB 4E5KA 3KB6A 1JU9A 4R16A 2DBQA 4GLOA 3VAZA 1B14A 3G1UA 4KP7A 3D3EA 4MKZA 3GH3A 5BSEA 4J9VA 2ZQZA 5FI5A 4D7AA 2OGUA 3LT4A 3K2BA 1ZKMA 2Y1EA 3O26A 3RJ9A 2P5YA 4ZD6A 4BNNA 3JD2A 4DIOA 1RM0A 3WQSB 3AUTA 1SOVA 4TVOA 1U3TA 1PJ2A 4NNJA 1T4BA 5CP8A 2DFVA 2O4CA 5L53A 4FIZA 4XYMA 2CF6A 2Q1TA 3AUAA 5FFFA 2D5CA 4BNFA 1PL8A 1P1JA 3KYCA 3C24A 5AQ1A 4CLRA 1MFZA 1KBZA 2Y1FA 4FJ1A 4JN6B 4Z9FA 3WTCA 1NASA 4BNUA 3PYLA 5C7LO 1R4NA 3KSUA 1ADFA 4BNGA 4XKJA 1R0LA 4DA9A 5MDHA 1N1GA 2H63A 1ISHA 2GPTA 3JQ8B 3P7MA 2VRCD 3OHSX 1ZMOA 3ZWBA 3HG7A 1ZZEA 3PWKA 2AEJA 3F46A 1WZIA 5TT1A 3ZWYA 2I3GA 2CSUA 1KC1A 1LEHA 1NP3A 2ET6A 2IZ1A 4KMSA 3HB4X 4MVJM 4E30A 2V6MA 4DPMA 5JYDA 1GAEO 3VZSA 5AXDA 3AK4A 4CQLA 4BNTA 1KEWA 2D8AA 4M86A 4OHUA 3BTVA 3ROMA 4OMUA 1E7RA 1EDOA 1V9LA 1A4IA 3I9MA 3NTOA 2WJPA 4DPLA 2Y67A 3ICCA 4CQMB 3T7EA 4CMHA 1NWCA 2GZ3A 1ZK2A 2IE0A 3BMOB 4XYGA 5ITVA 5JNLA 1ORRA 5FF9A 1GEGA 1DOHA 1P1RA 3OIFA 4EI2A 2NWQA 3G1TA 3WMXA 1X7DA 2XPCA 2EKLA 4IXTA 1SO8A 3NX4A 3K30A 1HDRA 1VKNA 4JQCA 1C1XA 3VPSA 4DIFA 4PN3A 3PHJA 1SAYA 3HFSA 1UDBA 1KVSA 2H1SA 1ZNQO 1GY8A 3VOSA 3I9OA 2J5RA 4UVIA 5ILGA 2FPIA 1H94A 2GLXA 4OIMA 1W8DA 2VUTA 1B3RA 1UZLA 2NADA 4IDAA 1T25A 3WYBA 1PR9A 3PZRA 1FDSA 3VZPA 4D41A 4MO2A 3AFMA 2EJVA 3GF4A 3IIEA 4XB1A 2H5LA 3ROPA 4A0SA 2EIHA 4WEQA 3LF2A 4B7CA 3UCFA 3GG2A 1GQ2A 4R1TA 2GR9A 2I3AA 2NTVA 1MUUA 1SB8A 2JD2A 2RIRA 4BGIA 5HS4A 4PIVA 1QKIA 5I8WA 2JD0A 5T5QA 4RVFA 5CEEA 1A5ZA 1F0YA 2HMVA 4Y67A 2A94A 2YV1A 4OSOA 4KUHA 4LSWA 2Y93A 1RKXA 3IKVA 3JQBA 1ENPA 4UREA 3R0IA 3ZNOA 5F21A 2HJRA 2X0NA 3UXYA 3ZWPA 4BHTA 2BLLA 1VJ0A 1Z6ZA 1YKFA 5GZ1A 4CMBA 4E2YA 4A7PA 5A3VA 3VTZA 2PKRA 2X5KO 4D44A 3ZZNA 3F9IA 4QEDA 4YT4A 2QX7A 4NFYA 4ZQFA 1JKFA 4KDFA 4DBVO 1U5AA 2NVWA 3L9WA 4QSMA 3U49A 2RH4A 3RBXA 4L73A 4YJDA 1JVSA 3BAZA 1GR0A 2CFCA 3FR8A 4ONEA 3SJ7A 1XELA 3H9GA 5KKAA 1M75A 3OJLA 3PK0A 1YONA 1E5LA 3DZJA 4MINA 3OA2A 4BO9A 3H9QA 4HXYA 5TNXA 1MFPA 3V1YA 4F45A 3PQDA 1Q1NA 5ENVA 4MVJE 2PD4A 1M67A 4CLHA 3STHA 3VVBA 1MC4A 1MC5A 2I6TA 1K6XA 3SBOA 2QRJA 4E5NA 2EERA 2FSVA 3ZH2A 3ZHBA 1XG5A 4MVJA 5JY6A 5C7IO 2X23A 3ONEA 1TEHA 1EE9A 3QVSA 4YQZA 5HA5A 2I5PO 2ZATA 4CMEC 3WGHA 3P2YA 1PL7A 3PZBA 2X5OA 3DHNA 2BF7A 1X0XA 3AOEC 2DQ4A 1WW8A 2DTXA 2O3QA 5L7WA 4BO0A 3BA1A 2G0TA 3OJOA 4Q39A 3DBRA 4J7UA 2DTEA 1NHGA 2ZQYA 2JJYA 3VDRA 2O2SA 4RLSA 4CQMA 5L7YA 3A1NA 4L8VA 3QWAA 1DIHA 2X0IA 2DT5A 3E18A 1C0KA 4Z0HO 5JS6A 4YXFA 1X1EA 4JROA 3WG9A 4IXWA 4Q3AA 2CY0A 4MDHA 4Z9YA 3I9NA 2DC1A 1GPDG 3HN7A 4FQ8A 1U4OA 4EGFA 5DDIP 4RORA 3L6EA 4RPJA 3JQ6A 4ALMA 1FK8A 1X13A 3Q0EA 4WECA 2UUOA 1PWZA 1YH3A 2JL1A 5G0VA 1WXDA 2XOXA 4ND2A 3MJ4A 5I7VA 4NH4A 4PG4A 3FTNA 3KEQA 4RVHA 3DC2A 3WLFA 3L6DA 3HZZA 1XU7A 3AY7A 4I5GA 5ENDA 3CPSA 3B1FA 1HYGA 1GYPA 2BGLA 1OC4A 4HV4A 1E7WA 3JTMA 3ORFA 4UUMA 3UCEA 1R0SA 4CM6A 2GCGA 4TMFA 4GL4A 1I3MA 1YS4A 3LU1A 3DBHA 3CMCO 4J0EA 4CMJA 4NBTA 3LDHA 1M2WA 1E6EA 3GGPA 4WKGA 2C7VA 1DJNA 1JW9B 2AQ8A 4CUZA 3LSYA 5LDGA 1I32A 1QLJA 3SEFA 2YV2A 1K89A 1KERA 1E1LA 5TQVA 5CFZA 2GDZA 4R01A 4MPDA 1SBYA 4CLXA 3IMFA 3UUWA 3FNGA 3INRA 3AM4A 3OF2A 5KJ6A 2NU6A 2VWHA 4CV3A 4E33A 1UR5A 2D0IA 5ADHA 4MVJF 4UVEA 5A1TA 3H6KA 1R66A 4CLOB 1P1FA 3VDQA 2XAAA 3GZNA 4J91A 1B8UA 4F3YA 4BNXA 1VJ1A 3ICPA 5EN4A 3EMKA 5TS3A 1DBVO 3I6QA 4OKIA 2NNLD 1ZVMA 4YAJA 2P91A 4OOEA 1DJQA 1UUFA 3WFIA 3M2PA 5U4QA 2OMEA 4TROA 1YRLA 3H5AA 4UVDA 1XU9A 4WEOA 2O4UX 2VZ0A 4HNHA 1H9AA 3F5QA 3LVFO 3VH3A 1E92A 1JQBA 2UV8A 5DP2A 5I7EA 2J3KA 3PJFA 1LRLA 1XYGA 4XB2A 3WIDA 2HAEA 5ICSA 1CJCA 4GMGA 3K73O 5JE8A 3SJUA 3MTGA 4EEZA 1SCUA 5T8KC 3ZWMA 1MXFA 1HRDA 5JAIA 4WK6A 3DAGA 4JJIA 2YQ4A 3DAFA 3GVPA 4MP8A 4LSMA 4AICA 1CERA 3CINA 3TWOA 3I9LA 1PL6A 2YHUA 3UF0A 1XSEA 1YQDA 3TF5A 4GBJA 4U8GA 2NSDA 3QP9A 2OFPA 2C5EA 1DEHA 4YJFA 4YAIA 2IYPA 1E1NA 3JQDA 4HFRA 2UDPA 5AXAA 4NFHA 3I9KA 2GN4A 3RU7A 1WAMA 3IS3A 1XWFA 4OGWA 3ADOA 2VZ9A 3WWZA 4EBFA 5EINA 2NV6A 4XDZA 2R00C 2FSSA 3PTZA 4BOYA 1GEEA 3E5MA 4DL9A 1PJSA 2BFPA 3UN1A 1ZCJA 1PGPA 1UZNA 4B3HA 3M6IA 1IL0A 1R4MB 3T4XA 2OXIA 3EAGA 5KVSA 4R51A 4IGFA 2WSBA 1B8VA 3AY6A 3SX2A 2VYND 3FPLA 4BO1A 4PFJA 5JCJD 5IDWA 2GN9A 4P38A 2GF2A 3TZHA 1PJCA 2OBNA 1YO6A 3RC1A 1LUAA 1BWSA 2IXBA 2NVBA 4GAEA 4DQXA 3GPIA 4QFCA 3A4VA 4XGIA 3GT0A 2P9EA 3A28A 4LN1A 5TC4A 4Y9DA 2WM3A 2WDZA 3HDQA 5CDUA 3F5SA 3MWDB 4OO3A 4WCFB 3RFXA 2NM0A 3D5QA 3ULKA 3E48A 4GH5A 1UDCA 3LC1O 3PRJA 1QORA 3WICA 3LT0A 4JJGA 4G81A 4XCVA 3UAGA 3AOGA 3FPCA 3I4FA 4J1QA 4L75A 4PGFA 1LI4A 1AHHA 4DMLA 1D8AA 3KTDA 4AJOA 3FSRA 5ITWA 2GASA 5DBFA 4PG5A 3TPCA 2YDYA 3IKTA 4ID9A 4ZGWA 4WOKA 1LSUA 1J49A 2JD1A 4IQ0A 4R9SA 5HRUA 2O3JA 1TVEA 1GYQA 1HTBA 1HDCA 1E7YA 4J7CA 5DBGA 5IF3A 1A9ZA 1HE3A 4IQ8A 5DNAA 3U5TA 3C1OA 3GK3A 1U8FO 1VKOA 4QX6A 4IZHA 1IE3A 3HDYA 3GAZA 1B0AA 3KYDA 3D7LA 4L4SA 5K6AA 4I5FA 1RM4A 3JQBC 4XX0A 3INTA 1DRUA 3I52A 3GRKA 4RQUA 2G5CA 3OQ1A 1P0FA 2VN8A 5CPFA 4YTEA 1YXMA 2CNBA 2O3SA 3ZI0A 1U7HA 2Q1WA 4JBIA 1WMBA 3FBGA 1E3EA 4J4BA 1KYQA 4YRDA 1U3VA 3E03A 2HK7A 1ZK1A 4EZBA 2V6BA 3DTTA 4A2CA 3RIHA 2VUUA 1HEUA 3JSAA 3O4RA 1HE2A 2EG9A 3RJ5A 4FGSA 5A9SB 3WMWA 1B7GO 2PLAA 4B4WA 3VKVA 5F5NA 3B70A 2C82A 2VYNA 5ER9A 1TA4A 1HETA 1H5QA 3EVNA 5G0TA 3L77A 2YQ5A 2VTEA 4L74A 3P2OA 3GEMA 4AJKA 1IPFA 3HJAA 1H6CA 4H7PA 4BGVA 2Y05A 1VL6A 2EGHA 1KEUA 4IDCA 5A06A 3IC5A 5A5FA 1L7EA 2X0JA 1VC2A 2W90A 2QHXA 2R6JA 4NJMA 3JD1A 3V1UA 1PJ3A 3DDNA 1VJTA 2G17A 2HRZA 1VPDA 4HKTA 2PKQP 1DC4A 2CF5A 4L0QA 4QFDA 3W8EA 1T24A 2PD3A 2WYUA 1HZJA 2W2LD 3BTSA 4EITA 2HMSA 5KIAA 3E9MA 3PJDA 4LGVA 4BMVA 1RYEA 4UEJA 3PHGA 3ZV4A 3NGLA 4PLTA 2DM6A 4J4TA 3S2EA 5HTOA 1VI2A 1EZ4A 3RFTA 3RKUA 1Y8QB 5JSFA 2ZJ0A 1ZIDA 2FP4A 2JHFA 4M87A 4EW6A 2PNFA 4GGOA 1GU7A 3DFUA 4UVGA 1A71A 4OJNA 3W6UA 2WTBA 1OOEA 2BI7A 4IDEA 4DLBA 3PFFA 4Z6KA 4CR7A 1ONNA 3LF1A 1MGOA 1NYTA 4R9RA 4U7WA 3O8QA 4NPCA 1LA2A 2Z1NA 3V2HA 4O0LA 4KDEA 3RUDA 4FC6A 2PGDA 5JMWA 3DZBA 2VQ3A 4XDYA 3L4BA 1NTOA 2VHWA 1JDJA 5KVCA 4GQAA 3KUXA 1P44A 2IRWA 3PEFA 4YVFA 2GN8A 1YBAA 2WWRA 3L0DA 3RUHA 4BIIA 3ZHYA 4RPKA 3WGGA 3LYLA 2Q99A 1BXGA 4QO8A 2A92A 3NGXA 3F3SA 2PZLA 4U0JA 4ALKA 1X14A 1DC6A 4UAGA 2W98A 5U1PA 3Q9NA 3FD8A 3QJ5A 4W99A 2X0RA 2BD0A 1ADCA 2VHVA 1BXKA 2J5QA 4OXNA 4Z0TA 3KETA 5FI3A 1GD1O 1F8GA 4Z3DA 2WYWA 4PLWA 4YDRA 3P5SA 4J4HA 4Q3EA 1Q7GA 1F12A 2WD7B 4ZQBA 2QZZA 3JYOA 3W4IA 1UXIA 1LLDA 4P22A 3ZV5A 4D0RA 3V2GA 4IBOA 3C7CB 3BMCA 1DC5A 4KQWA 1FDTA 3EYWA 4KWIA 3GEGA 4PLGA 2E49A 4WCFA 4NBVA 1SB9A 1GL3A 3WS7A 1BVUA 2VWGA 3QWBA 3GVCA 4CJXA 1ZXLA 1OC2A 1ZEJA 5A05A 3G0OA 3GHYA 5DN9A 3OJFA 4BV9A 1LC3A 2B37A 3KO8A 2C29D 3KXDA 1LQTA 1ADBA 1I5RA 1XKQA 1I36A 2EW8A 3B1KA 3GN1A 4EDFA 1J0XO 3F6YA 1WWKA 4M89A 3RASA 3S2IA 9LDBA 3VC7A 2A9FA 4IS2A 3U4CA 4CV2A 2OZPA 1S7CA 1HDOA 2HCTA 3ENNA 4GI2A 3N7UA 1F8FA 3TZ6A 2I67A 4ALJA 5DOVA 3K31A 2J3HA 1AXEA 1JWAB 1FF9A 2LDXA 1GFSA 2C07A 3SVTA 4FN4A 2HU2A 2V65A 1NBOA 3DO5A 2FR8A 1V35A 1B3BA 2W2LA 4YA6A 5T6BA 3I5MA 1ARZA 3JQFC 1BRMA 1CRWG 4BNHA 1NVMB 4IMRA 5CAEA 2HO5A 4GVXA 3MJEA 2O2YA 4ILKA 1UJMA 3DZHA 4JJFA 4WLFA 3GA0A 3ZGYA 5BR7A 3D5TA 1IHXA 3AFNA 2YJZA 4NK4A 3UW3A 1MA0A 2ZIZA 4B7XA 1QLHA 3KEOA 1BMDA 3QIVA 4MVJD 5EIOA 3TL3A 3QHAA 2O48X 4J2HA 3HFGA 3O38A 2EWMA 3EY4A 1U9JA 3CKYA 3ANLA 4BQRA 4FGWA 4RO0A 5A04A 3RU9A 2VT3A 4JXKA 1F17A 4HBGA 4CPDA 5KNLA 5L51A 2YFQA 2IEDA 1SPXA 5IZCA 3VZRA 1MV8A 3UVEA 1Q0HA 1PGQA 3EUWA 4NJOA 2JFFA 3WYEA 1U2DA 4I08A 4GX2A 5KJEA 5BQFA 1VM6A 1GYRA 4R1NA 3GDOA 3BMCB 4QO7A 3PFWO 1P0CA 4LMPA 4ZQHA 4GWKA 4IJVA 1RJWA 3WJAA 3B1JA 3H65A 4I9HA 3S8MA 3OEWA 3DHEA 1R0KA 1V3UA 3NKLA 4O59O 3NDIA 3P19A 4W6ZA 3ETEA 5FWNA 1K3TA 3EK2A 1LLUA 3QQPA 5BSGA 3AWDA 1PS0A 3DMYA 4HFMA 4XGNA 4XYEA 1QG6A 1MX3A 4YRAA 1Y81A 3ASUA 4ZRNA 1JWBB 1X7GA 1LLQA 1UXHA 1UH5A 4ALNA 3OMLA 1I2BA 3DZGA 2X9NA 1DDOA 2NU7A 3JD3A 3AI2A 3U4IA 4G5HA 1Q0QA 1DLIA 4YQYA 3PLRA 4KUEA 1Y1PA 1KVTA 1LRJA 3G79A 2ILTA 4IIVA 3C1AA 4K6FA 2VWQA 2QRLA 1YJ8A 1MXHA 3AU9A 4CM8B 2J3JA 1E5QA 3RI3A 1NPTO 2J5KA 1EK5A 1GDHA 2EHDA 1IYZA 1RWBA 4R4JA 3Q6IA 5GZ3A 3EW7A 3HN2A 4TRJA 2VUSA 2PWZA 2CDAA 3MJCA 4NMHA 1GV0A 3C7AA 3PP8A 2B69A 3WNVA 1FDWA 2QYTA 4Q3NA 4RLHA 2OUIA 2Z1MA 3JQGB 4TKLA 4E12A 1EVJA 4YT8A 6LDHA 3WSWA 2B5WA 2TMGA 1B16A 2DVMA
chains in the Genus database with same CATH superfamily
4U6QA 1AKNA 5A3QA 4ZU6X 2PQ6A 4FWIB 3TQRA 1QAQA 1L7XA 4C1BA 4YJGB 5FUMA 1GNSA 5CXQA 4QHSA 3QW4B 4PQYA 3RYHA 1AG9A 1CNEA 2O8EB 1RKQA 3UB4A 3R9XA 3FNQA 1PU2A 2NX2A 2J0EA 2OCAA 3PC2A 3L05A 4H08A 1KKUA 1NKVA 3LGSA 4RK0A 2I4TA 5LA6F 4R0VA 1P2UA 1FQKA 1S2NA 1KZ6A 4GR5A 4HXEB 4L8WB 1ZNXA 3DDCA 1FFDA 3IDFA 2QORA 1I6LA 2AN5A 3AF3A 4BLUA 4ZCMA 3Q9LA 1E60A 1BYIA 1L8OA 2NW6A 3IB6A 2C2ZA 3LBFA 3MZ0A 3ZEIA 1N2BA 3CUSA 2X1MA 3MG9A 3BBPA 2M9MA 3VJRA 1PGJA 2G4VA 3CZAA 2NZJA 3N8GA 5KNDH 4NYJQ 2BHSA 4INZA 4NYMR 3WMRA 2AW5A 4TT8A 2BIFA 4UVHA 5HILA 3KR2A 1NDQA 1NLYA 1PT6A 3LXXA 1HFEL 2MDTA 2JGLA 4JITA 4YT2A 1FMCA 4RGYA 3RSQA 3ETHA 4HNRA 5LQRA 5CJ2A 4ASUA 3W34A 5IVPA 1NNEA 2B78A 5DI3A 1RSZA 4KPEC 2FQYA 4O0MA 4NABA 4BN5A 2A5GA 4XOUA 3MINB 2HSWA 3NM6B 4OQMA 3W6ZA 2D2IA 4M37A 4F3KA 5GINE 4MHTA 1XZNA 3I09A 2X1LA 1IY9A 3I0MA 2ENUA 3OUTA 1IM2A 1YA8A 4TV8A 3RVJA 1EGVB 4Q48A 2FFAA 4RPHA 3NANA 5CA0B 4A6PA 4YHBA 3C8UA 3PGA1 5AVKA 2IBMA 2YNMC 4AJNA 3P9NA 2VNSA 2W2TA 1UBCA 4F2PA 3S28A 1ZLYA 1XTZA 3E9QA 3L1KA 1KO8A 4YB8A 2ZBFA 1QONA 4JCOA 3TDKA 4EP1A 3LY9A 4OI2A 5CBPA 4TZ6A 1TJ5A 3EB9A 1A50B 2QQ0A 3SLKA 2OD9A 2ABWA 4LRSB 3GB9A 1UWKA 1G7CA 5EJ8A 1KZ7B 1PKEA 1X7XA 1XROA 2VP0A 5FBWB 2IDZA 5J2UF 1AD2A 4YLGA 4P4NA 3P5BA 4A2PA 3LC0A 1T9BA 1RJ9A 5K8UA 4WD3A 2EARA 1ECGA 3PTLA 4JJ6A 4BO4A 3WB2A 4MUAA 1XDGA 3VV2A 3WK7A 1RRMA 4JA0A 1XQ1A 2PAFA 3LUBA 4NVRA 1E0AA 2RHCA 3FZQA 3OQ6A 3UAZA 2IS6A 1GILA 3AR2A 1G21E 3IOYA 1CR2A 4TRNA 1TJ4A 4YXWA 3OT4A 1ZQ9A 3QF4A 4HC4A 1PIWA 4M3NA 3UMFA 3CMMA 2QUAA 1YBVA 1XZCA 4BNVA 5JZMA 1JG7A 1X1DA 2JAHA 3KPJA 1UBUS 5ALEA 1EE1A 4A6EA 2G36A 4ERNA 3L02A 5BWOA 2H2IA 4HRAA 2UVPA 4Y30A 3SYLA 2HR1A 4M49A 1FU7A 2W6ID 1U90A 1A82A 2MT9A 2Y8EA 2XYQA 3I4LA 1HE8B 1N9GA 2VQDA 1BGVA 5E6RA 5AOVA 3RIGA 3PUXA 1P5RA 1VYHA 4TT3A 5CVUA 5D3MB 1J25A 5EEHA 4GKJB 4H7DA 3V4FA 4WQMA 3PFKA 4DB2A 1E64A 5SY9A 2I2DA 1KI7A 1MAVA 3EGCA 4JFRA 3UMJA 5BR8B 1QGDA 4G8JA 3U0BA 1NYLA 1LRKA 4ON9A 1Q19A 3PQ3A 3SQMA 3X2EA 4KQJA 5L4LA 1Q3KA 4F9FA 5A3JA 1PNOA 4ZTZB 1E7QA 3HZHA 4EI9A 5JC8A 4Z4FA 2O07A 5C7OO 1AKWA 3GGJA 4PLPA 5EZSA 4CMIB 4D98A 1ADGA 2UYHA 1EFLA 1PTJC 3OZTA 3R3VA 4NATA 3G2NA 5I9NA 1REQB 1Z0SA 4H16A 5AJVB 2NUAA 5JAUA 1IUKA 3JZDA 5FR1A 5ALXA 1Q22A 4H15A 1YQQA 1S2LA 4HWPA 1AS0A 4ZOEA 1O6FA 1PTJA 2X22A 1IHPA 2OGWA 4F6LA 4WN9B 2F3RA 5IYZA 1UC8A 3FDZB 5C35A 3LM8A 5EMNA 3FJYA 4FUTA 3M6LA 5HBRA 3PWTA 5HOEA 1H5UA 3Q9UA 4TVBA 4XQEA 2CB9A 1PDVA 2IVFA 3T7KA 4IIHA 4QUIA 2B9VA 4RF2A 1NN5A 4JUIA 5IDQA 3ZDDA 2OCYC 5IVHA 3PGMA 3D6FA 3UCXA 2J59A 2ZWIA 3U40A 1SCJA 2HDNB 4DXHA 3MSXA 2Y1KA 4Q5IA 2F6RA 5EWJA 3WLTA 1UINA 2O3UA 2VDQB 1J9ZA 4QDJA 1A1VA 2WFMA 3RSFA 4WNAA 4DYVA 4W5NA 5LZ8A 1Y8RA 2F1JA 3FVQA 4FW8A 3DL2A 1JX6A 4CDRA 3IKJA 1KO4A 1UQUA 4K8RB 4OP3A 3Q3EA 5BW6B 3J7TA 2IHJA 5TGDA 8ADHA 5FBHA 5T6MA 4E2ZA 4IHKA 1Z0DA 2DKFA 3QZUA 2F3UA 3AVPA 3OPXA 2CXRA 3HYSA 2PX2A 4GOJA 2EZ9A 2V9PA 4PG7A 2ZQ5A 2FRDA 4C4YA 1CETA 5JWRA 3CJTA 4YMLA 3QUQA 3A1UA 4KITB 4X3CA 5J5VA 1V39A 1U9ZA 2EKPA 4FW9A 1B93A 4BVJA 4O6VA 2I6UA 4POAA 5CEFA 3OFSA 3KTFA 4DCTA 1T2DA 4BX9A 5WRFA 3MQ4A 4CLRB 4CMEA 4F72A 2B4KA 1OYOA 3IVMA 1B8OA 1YHNA 3VNRA 1KO5A 3V1LA 2TMYA 4O4LA 5BXYA 1OH8A 2D2FA 1RZRA 1T4GA 4DDMA 3L1JA 1XALA 1UPTA 4U2KA 1XMIA 2B4YA 3KJFA 4DBZA 2O8DA 3ICVA 4BQNA 2QZJA 3HVJA 4EHLA 1TQ8A 2XADA 2D59A 1Y7TA 4P3YA 3AOEA 3X0DA 2QV0A 3AV3A 4GBED 3ZWWA 4REOA 4K1LA 1EUYA 4I5EA 1D0IA 4WXMA 4CKEA 1U0SY 1YBMA 2JDID 1QK4A 4BZXA 2AIRA 2J6CA 2C4KA 2HF8A 2Q27A 4IXDA 4BMNA 2JF0A 2AS0A 3LQQA 2NYRA 4QARA 3W5UA 1WV0A 3KZKA 5L3SB 1NOJA 1OHHA 2ZWAA 1SKYE 3FTPA 3R8XA 1EUQA 1EPUA 2GK6A 2JCXA 2R8XA 2CDCA 2WEKA 4MV5A 4M0MA 5ESWA 2JGIA 3I2HA 3KETA 3PLNA 1SH7A 3PYMA 2FX5A 1W36B 1WD5A 2XUPA 3NS7A 2R751 4G89A 1YAHA 4Y98A 5DCUA 3L0CA 1JKIA 2HDOA 2IUSA 3PD7A 2CNOA 4F46A 1CY6A 3VR6H 3CM0A 2JEYA 4LTMA 3M34A 2C9BA 5ALHA 1QRAA 2K7ZA 3F3KA 1C2TA 3RIEA 2Z6UA 2Q4OA 4WNYA 3AT1A 5LFAA 3H75A 3LCVB 3UY4A 4QQFA 3TIVA 4FT2A 1J07A 4MR8A 1DP4A 2YVLA 4DARA 3GLGE 5LMCA 2JAWA 1K9SA 1R88A 2V1XA 3DLTA 4TPKA 5M5BA 4X62B 2XNHA 3H6HA 4Z8YA 5FWYB 3GEIA 1VSTA 3I2IA 2IHZA 2WHEA 1G1AA 4M1EA 4U7HA 1SOMA 1QBGA 4KUGA 1Q57A 4TQUS 5ENZA 3CUKA 1KYZA 3ZCVA 5CLHA 4GM1A 1PZGA 4Y2PA 4B3XA 1RYNA 1Y89A 2CN1A 1B15A 1H3FA 2GCPA 3NHBA 3MUEA 3OLCX 4FZ5A 3UICA 1XZMA 5ADWA 4FKBA 3GG9A 5DMHA 1HLDA 4IH4A 3PNLA 4RDIA 4FHEA 2P67A 3BMOA 5DASA 2QD3A 3N05A 3CJRA 4N5NA 3X1ZA 4NU5A 2WJHA 5KU1A 1EVZA 3EIHA 2QUJA 3TRFA 1BJKA 4BBJA 2MYUA 2BE9A 3NHZA 4YI5A 4JEIA 1ZUWA 4RMHA 1P7CA 2WSLA 1C7QA 1QTNA 1R5JA 5HF8A 4YRBA 1CJKC 2Q9BA 3F47A 3TIFA 4BWYA 5B7PA 2QMQA 4D3DA 1T2VA 4HWKA 5BR4A 4FGZA 2GUWA 2PQ2A 3Q9SA 4MVYA 3TINA 4D43A 4LVCA 3H9UA 4FDMA 3HLKA 5AVRA 1N3YA 5EUQB 5BRJA 1JDZA 3BEOA 3EZYA 3N86A 3EDQA 3LV8A 4NARA 1FRQA 1NXPA 4WESB 3O91A 1XF9A 1W96A 4OGFA 1Q84A 2WWYA 4QE3A 2P9QA 3OTWA 5CDYA 1A7KA 2QNRA 1XQXA 2RH8A 3DR5A 1R8JA 1AUPA 5T8KA 1DHTA 4U8HA 5KSYA 3WYNA 4WZBB 1HZZA 3SQLA 3GUCA 1JR4A 1JIIA 2WKPA 2B61A 5JY1A 4II3A 4WY2A 1NLMA 1RLUA 1QSGA 3BH6A 1TZMA 2X2FA 1RQGA 2H1RA 2P9GA 3A0UA 2VC2B 3FGZA 3HA2A 3QU7A 5GM1A 1WM1A 3KJEA 1XJCA 1G5IA 2C3PA 2PKEA 2E82A 3X1XA 4AM8A 2Z6AA 1U8AA 1XFAA 2QENA 3IIMA 3MK31 4AQ7A 4GE0A 4P58A 1P60A 4OAQA 1O54A 3VJKA 3EAQA 3AIIA 2I4NA 2CFOA 4UU8A 2H1HA 4PQFA 4RHFA 4J16C 5BNWA 2BEKA 3SICE 3W3ZB 2Y6VA 4CMGA 4TOIA 2E55A 5KYXA 3T4EA 1CCWA 1O89A 1OWMA 3VZCA 5B4VA 4HLCA 3D4OA 2R6AA 3L0OA 1P61B 3FUCA 4UTZA 3K4QA 3RK1A 2GFQA 3U17A 1E9EA 3JPYA 4AJHA 3SKYA 5LPNA 3QVOA 3AEKA 2MSKA 4EYKA 3C1TA 1YZ3A 1JSLA 2M1ZA 3HEMA 1RRPA 3M81A 3AQIA 4D8WA 4D96A 5AIAA 2YZNA 5KTTA 1Z7BA 5CB6A 3K0HA 1G60A 4KR9A 3W7AA 4CTNA 4RK5A 2Y99A 2X86A 4H1WA 3DMRA 1JH9A 1K6JA 3PRHA 1ISPA 5DLYA 1DRWA 2C96A 4TZKA 3S44A 5EMMA 2ISCA 2XQJA 3H42B 4IZIA 4ZC8A 3OLVA 4G4IA 4V03A 3ZCQA 4CI9A 5BT8A 1OZGA 1GL6A 1M1UA 1UMCA 2BKVA 2Y77A 1KIAA 3A9TA 4WUVA 3RRZA 3RS4A 1GP2A 1BW9B 1RWQA 5EVCA 4BFUA 2FW1A 1JDBC 2P90A 3OVMA 1VJCA 2JGAA 1XP8A 1WO8A 3VU8A 3AG6A 3NTUA 5LQUA 1L5FA 2G82A 1HF3A 4PNZA 1GNLA 3WKEA 4MYSA 4EPVA 2BY4A 2XH8A 4RABA 3RVKA 1N78A 1RTTA 5IAOA 2XA1A 2AVDA 3MTDA 3QF7A 4HDAA 3ZK9A 3ANNA 2O1WA 2VBGA 4ZJPA 5BUQA 3CWQA 1DCKA 1M1NA 5CBPB 1F5NA 1UWCA 2H11A 3R5FA 5ILOA 3DUFA 1PJTA 4CGYA 4W5RA 1X0VA 1LWOA 4FSHA 4M8LA 4RVSA 2X4IA 5K8LA 3H9BA 4EA8A 1JTEA 1ZA1A 1VE3A 5IMBA 4MDEA 5L40A 4NY1A 5CW1A 2YIMA 4GKBA 4B79A 5AVWA 5HR5A 3C8MA 5K0CA 3ZU6A 4RVUA 1P9OA 1RDFA 4FB5A 4XYBA 1NAIA 2QU7A 5DNWA 1EWQA 3VVLA 2OD7A 3DF9A 4KE6A 1ZEMA 5FAXA 3LQKA 1EK6A 3VYVA 1AK1A 1BGXT 5IN4A 1NR7A 1NUAA 3ICEA 3C8HA 5JPIA 1FVHA 5THXA 5EC8A 1JHYA 2R2GA 3CH7A 4DTIA 5HJ5A 1DIGA 4O2BB 4LRWA 3HY3A 2RKBA 3QKWA 5C31A 4DLRA 4BFZA 1P9LA 3VC1A 3USES 5FOTA 1QFSA 5JG7A 1B6TA 2C5FA 4UM7A 5FKJA 2GWHA 2XD4A 4PNHA 1XPRA 1ZDMA 1A9SA 1BOOA 2EQ5A 2X3YA 2Z2XA 2YJ5A 3AKEA 5TARA 3VV3A 3ZNPA 1IZ7A 2I8CA 3HMKA 4MQMA 2G9RA 2PBFA 4QVGA 1P91A 1NVGA 1R6UA 2GN6A 3RTGA 4B46A 3U7HB 5HF9A 3AVUA 1T2CA 2P4EA 4HEA1 1KJNA 3AHDA 3BM5A 3PA8A 4HYTA 3ZW9A 3DAOA 4D46A 3KWJA 4Q66C 1BVRA 4BFWA 2NMVA 3RQIA 2IU0A 3H7AA 5IEJA 2EKDA 3CLUD 1WDKA 3PI7A 1QIGA 1A8PA 1A8QA 1W4RA 4L15A 1LF0A 3ABQB 3EBLA 3S2ZA 3IMKA 4HSEA 1N2XA 1DJLA 1NFFA 1PD1A 4KBGA 2GA9A 3URMA 1JR2A 1S2OA 4LBZA 1EP9A 4WMLA 1FSZA 2RJNA 3HUTA 3A4MA 4OX9B 3TW8B 3W1VA 1VMAA 4NFSA 1QNLA 5BQOA 4DM3A 3TRIA 3CEAA 2WNIA 2H1IA 3QLJA 4HWRA 4BBAA 1UMKA 3EVTA 3IR5A 4WOKA 5K4AA 4UOEA 1CDOA 1XMQB 2VT2A 1VPWA 4IUDS 1T1EA 3CRRA 1IZ9A 3TSCA 1BG6A 1DADA 3KK0A 3OJ0A 1XDBA 4M98A 4YPFA 1AH2A 1OUMA 3AUFA 4IQGA 1O97C 1EIWA 1RWVA 2CFSA 4F4CA 1MQSA 4LZJA 4YRGA 3FTEA 4UEKA 721PA 4ND5A 2J3LA 1KK0A 3BDAA 1PQUA 2YV4A 4IJKA 4K86A 3WXBA 5BN3B 5JO0A 5C51B 3H9JA 1MP0A 2IPLA 3T4UA 2C1ZA 3JARA 4OQFA 7YASA 2FW0A 1VRWA 3S7TA 2UUPA 3WMFA 2A9JA 1R3UA 4KMMA 2Q2VA 4P1ZA 4JWTA 3TN7A 4FYPA 6Q21A 2RHBA 1O58A 1JAYA 2XUZA 4OP2A 3BXEA 4XQCA 4DREA 5KTKA 5LQJA 1SEVA 2ANCA 1DXQA 2R00A 1E2NA 1LW6E 1EAYA 3KR9A 4JGGA 4N76A 3KZVA 4XYLA 3EZ9A 1SMKA 1TD9A 5TF0A 4FOTA 4ND3A 1FX0B 3RS3A 1JF8A 3ZIUA 3D6MA 3PWSA 1KARA 1QYVA 3NYWA 3CSUA 4C4RA 2DY0A 4TTSA 2HB6A 4TS1A 4JBYA 4KX3A 3CTMA 5EAIA 3LDFA 1KOLA 1RRCA 3F4LA 1QR6A 3GUYA 3AGPA 2IJGX 4HQRA 5EHZA 5C32A 3FCYA 1EWRA 1YGPA 5BUSA 1M2KA 5DMXA 3BWEA 3Q0TA 2OYRA 4Z4CA 2A5JA 1PNQA 2OC4A 1EQ2A 3IGFA 4PFQA 2VS1A 1SKMA 2RGGA 3O21A 3DLIA 4GP7A 3GPDG 2HI0A 2YHBA 3FE2A 4KQHA 2HSJA 3VVCA 1QV7A 5LCXA 1P6QA 3MT9A 2W6ZA 1G0NA 1FFAA 1TO1E 3I92A 1Z8DA 4RS3A 1Z26A 1IY8A 2J07A 4S1VA 3NIDB 4D9BA 1XI2A 1CJUC 3BB4A 3MTIA 3QUTA 2OL4A 2XNCA 4IFIA 1AKRA 1ZSYA 3VPAA 1EVKA 1NW3A 4XUEA 2IIVA 5J59A 2XY4A 4GC9A 3H1BA 1BU5A 4QBHA 4QA9A 4H6PA 1E4YA 2JEZA 3DONA 3PKIA 4C03A 2CXHA 3NKVA 3AESA 3F6EX 4RVOA 2WPDA 4MVJP 4PNPA 6ADHA 4DXAA 4I55F 1B43A 1LXCA 3NFYA 1R10A 2EXXA 1V7QA 3MWEA 3W8FA 4B4UA 3CZ5A 1IXZA 4N48A 1HYEA 3GJ5A 3DUFB 1GSOA 3V8RA 4LVUA 2F90A 1KWKA 1EHCA 4AKTA 4JJ7A 1U98A 3JYLA 3LPMA 1XQWA 2IUEA 2IW3A 1SU6A 3M1IA 4GXRA 4J0KA 1FXWA 5FTMA 4UTVA 5AW4A 3U4QA 2FPRA 1CY1A 1JLRA 3E82A 3K05A 4IDOA 1RPJA 4FC7A 4QYXA 2A1TR 4EVSA 4RGQA 5KOJA 2Q1UA 3CWCA 4PSAA 3EXAA 3BHMA 5DN6D 2ZULA 4JT4A 2IYXA 4PTLA 2JCYA 3MQ2A 3KYDB 4CKCA 4FMDF 2GEVA 1XA0A 4RJIA 1JBQA 1K5HA 2Q0HA 5DBEX 4MJ3A 5M3BA 1AKMA 5CA1B 1E3IA 3F6RA 3F7OA 3VKFA 2JFWA 4FFPA 4ZHQB 5BMOA 3MJFA 1MU0A 1CE8B 1GO2A 1EJ6A 2B98A 2B1QA 3KTAB 4LBWA 1E0DA 2O3TA 3DBRB 1CUHA 3GVIA 3L5OA 3U7EB 3B53X 4UARA 3FNFA 5EERA 1XWWA 1BQ3A 3I6IA 5B3AA 1EBFA 4NCKA 1OXMA 4Z7QB 4LF5B 3KJQA 1H2WA 4QGGA 3DKIA 4MRMB 1OH5A 3PT5A 5EKUA 3LA8A 3UT6A 3WADA 4HVTA 2IIBA 4C9BA 1LDNA 2BPOA 3NMUF 4CU2A 2JIQA 2C59A 2IXDA 3WLNA 4XQGA 2OHVA 1IHYA 4GVPA 2J6BA 3DKPA 3SI7A 1SG9A 1T3ZA 2H4WA 1FSGA 5IS2A 4KLRA 3CUTA 2A0KA 4ZOLF 3LX4A 5K01A 3NTVA 4U3JB 4IDQA 3EWIA 3IP9A 4UM8B 3TMKA 3VOAA 1U3UA 4YRZA 2XVAA 4Y8VA 3EZ7A 3PHLA 2I65A 1AQYA 4FZVA 1OWPA 1FDUA 2EC5A 2WTEA 4CHGA 2JI4A 1AK2A 3P4YA 3D8TA 4UPEA 3FF1A 3KEGA 3UWDA 4Z9XA 1X1BA 1Y80A 1JLHA 4DNOA 1CRPA 4HB4A 4JWKA 5BO5A 3KHUA 3ZHUA 4Q3LA 1QWSA 4EFDA 1H22A 2GI4A 4BX3A 1E1MA 2AJTA 3TB6A 3WLEA 2CVOA 2JLCA 3ITKA 1KZGB 4C29A 1SBNE 3IAM6 1QHYA 1XO1A 3OE7A 3ABIA 2O2EA 4OU4A 3QMMA 4FMCB 4YS6A 2P78A 5C46F 4P8RA 2GZRA 4LWZA 3H11A 4LFBB 1QYCA 2VT7A 1QHXA 1FEZA 2A5DA 4G0MA 3VKWA 3FF4A 4DJTA 4RXUA 2R6DA 1R4MA 4DR4B 1CZHA 1XLTC 3KDSE 1AMNA 1IDN1 5ALSA 4R2MA 1O94A 3EQ8A 3KJGA 3L1UA 5A03A 5BNTA 3ZN2A 5KSOA 2PUFA 3NONA 5BQXA 1Y4SA 5F7XA 4DC1A 4ZEMA 4ZVTA 1ODIA 1XT6A 3ED5A 1WSBA 4WNIA 5KC9A 4M1ZA 4EF4A 3R7WA 3K9QO 1EVIA 3K9NA 4MVJG 4D5EA 5BN4B 4EJ6A 5A2GA 5REQB 2D4AA 1H65A 3LQ4A 1F60A 4NR0A 4Y2GA 3U3RA 4BNDB 1CS0A 4P93A 4TS3A 1ST3A 5JQGF 2XB2A 5EGNA 4KDRA 4GDMA 4DCVA 2PH5A 1IQ0A 2A0FA 5DTJA 2FOIA 4N41A 4DZTA 5CVCA 3WHKA 3BMXA 5CB4B 3B60A 4CIAA 3DEZA 4FGJA 1KAHA 1SCBA 1ZMBA 4NDNE 1GKYA 5J47A 1U1IA 4DIBA 2WWXA 1ADJA 3U4GA 2H48A 1XDSA 4MLCA 1UOQA 3WDLA 1QH1B 1IY1A 3O82A 3IBCA 1CF9A 1RRVA 2QTCA 4MEAA 4WLUA 3AKZA 1QV6A 4TKZA 4BKRA 2ZM6B 2ZANA 4ZPXA 1VG9B 3FRIA 1FZQA 2HYDA 2GCOA 5LA6B 1UXJA 4PBRA 2PGXA 4R31A 1YZFA 1JQEA 1MOSA 3KQPA 5AKXA 5CFQA 3GVHA 2OV3A 1GHTA 4YLYA 1T15A 2HIAA 1XZKA 4DIMA 2RGCA 3CVJA 3L6CA 4ZGBA 1TGYA 4QUAA 1GIAA 1C1DB 5CG2A 3FVWA 4OLHA 3ZY3A 2GPNA 4B0PA 1M5UA 2GKSA 2ZYIA 5BW5A 5KKNB 1TMOA 3S2GA 1V11B 1XYVA 1TXGA 2XE4A 3E5HA 3I76A 2OHIA 3IUSA 4HLUC 3ZXIA 1ISIA 4B6PA 2O7QA 2FEOA 1CJSA 2AYXA 2ZJ5A 3PXCX 4WL0A 1LTKA 3RGGA 2PZEA 2B4TO 1AV7A 2HA6A 1UEXC 2WHQA 2Z8ZA 2HM7A 4QXOA 3MVEA 4RANA 5MGNA 2RC6A 4CZ2A 3FJ1A 5LD2B 4P3KA 1M6YA 2VHYA 2B8TA 3DWGA 4JBLA 4MUIA 3OQIB 4MS4A 3EXIB 2VZ8A 5TY0A 2V7QD 1T4CA 5ICGA 3RVPA 1O95D 4X3OA 5FUYA 3JQ7A 4ZZIA 4NBRA 2L19A 4OUKX 3RARA 1QKKA 2B2NA 3CS3A 4CNQA 3UJ3X 4AUMA 3V8NA 1WXFA 1E3TA 3D3KA 1X2EA 3FFAA 3OMXA 4HQFA 4ZQEA 4YBZA 1OFHA 1YR2A 3UT5A 5DGDA 3GT4A 3L06A 1G2PA 1OAAA 2HLDD 5F1PA 4NU8X 4N3GA 2MINB 4NCHA 5CYPA 4PSKA 4Y3UA 4Q1VA 3OJWA 3QBEA 1XQ6A 2YIDA 2NUBA 3LK6A 2OXCA 5JRZA 3R74A 1VHJA 4OM8A 4PYRA 4LXIA 3M4YA 5JDCA 2JGEA 3EW9A 3M5DA 3A58B 4IINA 2G1UA 1FLNA 3UJ9A 2BAGA 2XB6A 1ZHHA 3GFQA 3UJ6A 3Q2KA 4P3PA 1E2FA 1QQBA 1Z7EA 1QG0A 2IYRA 3A3PA 4DNQA 1KKMA 1JPUA 1R6DA 2H1LA 5MGBA 1TEXA 2FPGA 3NU1A 1EFCA 2O14A 3W90A 2WWFA 2GUGA 2ONJA 4IDPA 3C4QA 5DU2A 1E58A 1Z8HA 5LC1A 4I9NA 2AD1A 3OECA 1I01A 4X8MA 4E5YA 4EB8A 3W2IA 4ZDKA 3AHEA 4DNFA 1YE8A 3T9BA 1JIXA 1DXHA 3V4RA 1VE9A 3QM1A 3KAJA 4AZ0B 4LRYA 4FJ2A 4LYEA 3ZWKA 4WFIA 1ZJZA 1KEEB 5LZ9A 1P9NA 5TB5A 4AFNA 2P4SA 3ASYA 3V2UA 1W88B 4D02A 1T4DA 4I50B 5BUZA 4Q0MA 3FBTA 1YCHA 1RC8A 1QYIA 1JVNA 2X4LA 1TNDA 3BXGA 4YMWA 5AM1A 3MWEB 1YBHA 3WAGA 4KO8A 5LB2A 1PLJA 4XE5A 2VT6A 5FNVF 4YUAA 3AVOA 1E2BA 3KHKA 3EG9A 1H93A 1LBQA 1PHPA 2YC4C 1W76A 3CXRA 5KNCA 4ZYYA 3FYUC 1EWKA 3QVUA 4OD0A 2Z2KA 4KVFA 2VZLA 1V5EA 3TJMA 4EBBA 1HRKA 2FDCA 4M54A 1JR3A 1GGJA 3H8JA 1BHJA 3RAEC 4EHIA 2OUKA 2Y68A 5DHUA 3PD0A 5E3JA 5F33A 2BSXA 2QNBA 4ZT6A 2WA1A 2ZPTX 3DR3A 5ESRA 5CK5A 3MOGA 2JLXA 1L5QA 4I2NA 3P97A 2R1VB 5EJ4A 4J9UE 4OHFA 4G1CA 2IHBA 4ZAZA 1JJVA 4FFBB 4JHXA 1ZD9A 3RSOA 4E6PA 3GFBA 4M0KA 4Q7MB 4K9OA 4KGZA 3EXHA 1FBNA 3B1VA 3UAOA 1GA1A 4MIEA 1G7SA 2PUGA 4ZTUB 1NP7A 3FAZA 1I2ZA 3EA4A 4KJXA 4BQQA 4YRSA 5C5IA 4Z3OA 5KNBA 1A5BB 2J5BA 1D4AA 3RM3A 3FIJA 3MWJA 1EUZA 2A14A 5IXJA 2ZUCA 5G4KB 2B83A 1ESDA 1XDWA 1XRNA 3QVXA 4NBWA 4V2UA 4W9NA 1EJ2A 1N2CB 5EFZA 1V8OA 4M1WA 1QRUA 3PHIA 3DMTC 5CJPA 1UOOA 1V71A 3VQTA 4K2HA 2OV6A 3WGJA 5IHPA 5E95A 4C0XA 2B21A 4GEGA 4YR7A 2GF0A 4KB5A 3FOBA 1SCUB 2FEMA 2VK1A 2I34A 3ADCA 4LYHA 5AI5A 5BVHA 2BMJA 1C7RA 1OVMA 2NQ8A 2PTGA 4C6RA 3ZD7A 1SUCA 1XIVA 4J1TA 5L6MB 1DCMA 1YI0A 4GI1A 1U2EA 1X7HA 4BNLA 1GVHA 5DCYA 5CB4A 2WYHA 2P65A 4MJXA 3HDHA 4RFVA 5HVNA 1SN7A 1ZJ5A 2Y2UA 1RXIA 1OAKA 2R4TA 3BORA 4Q4CA 3HCCA 3LUDA 4X6UA 3VJLA 4XCXA 4ZEWA 2QK4A 4E5PA 4IHQA 2Y1OA 3IELA 4JU9A 4FFMA 4B3JA 1YRWA 2NU9A 4URWR 3I37X 3VHLB 2W2MA 4A03A 3VVMA 4E5VA 3RLFA 5UKDA 4CT0A 2O0KA 2C0QA 2D2VA 1LTHR 3IP8A 4IIDA 3RKRA 3T7DA 1U04A 1ZAKA 2XUJA 1FYWA 5HZGA 2H6EA 4HGOA 1HV8A 3LIIA 4J6FA 5ALOA 2AHOA 1M0WA 1Z0AA 2V0GA 4MUHA 1NNUA 1NQOA 2JH3A 2CJXA 1C7EA 3NCHA 1KYYA 2W2VA 3SMVA 5CFOA 2QKYA 1Z82A 1A5AB 3PHBE 4YI3A 4CM9D 1PS8A 3DVAA 2A6PA 5D2CA 5ERXA 1L8XA 1WLYA 3OP4A 2AK3A 5DULA 1VL0A 4IIYA 1KZ1A 3ZXSA 2W71A 3BL6A 3MQFA 2FUKA 3HDVA 3N3AC 4I66A 3R6DA 3FTQA 4LTNA 4UBOA 4WKBA 5JR3A 1NPYA 2QTFA 2ZSEA 3D1LA 3K7EA 3RNOA 2WZBA 3T3MB 3VNAA 1AGXA 1TM7E 3BCHA 5CEJA 3EVEA 4R2XA 4D74A 1I6WA 2OVBA 2M2IA 3ROZA 3ND9A 4QXMA 3WYFA 3QNMA 1SUBA 2AF4C 4CM8A 4E94A 3IPXA 2DPGA 1M7BA 3DNMA 1NJFA 4CMIA 1LQUA 1T9AA 2ZB4A 4CWAA 4PYNA 2IITA 3T7SA 4E11A 3D02A 4B74A 4PGAA 1RWMA 3I8OA 4KLNA 4BDSA 3ADKA 5DNUA 3OETA 1UBSB 1GAJA 1NSFA 1BD3A 1V5FA 2JIPA 3D8RA 3NQ41 1M7HA 3IPRA 3WL4A 5BXQC 1D9XA 1TC2A 3J81A 2R7MA 1YNOA 1C81A 4FB4A 4MI1A 2Q5EA 1NX6A 3KQVA 4HB2A 4I4LA 1F20A 2IZ0A 1T6ZA 1KZ9A 1MQAA 3N74A 4HDRB 3IPYA 2A1IA 3MWLA 4UHBA 4L5BA 3LT2A 4TRRA 2WHYA 3L0ZA 5AYVA 4JENA 2AXPA 2HRCA 2ZUDA 3OCVA 5FNZA 4HUTA 3AQ4A 3H1AA 2Y4NA 1V43A 3CGGA 3KTOA 4N0PA 4FNOA 2HMWA 4FS8A 4Q4JB 3CN9A 4R54A 2FN3A 3LYAA 2IHYA 5K3EA 1GQQA 1BX0A 1EFTA 2BFMA 3HUDA 3FA2A 1EX1A 1NF8A 2Q7OE 4PQEA 3LHSA 2B5VA 1U9IA 3JZMA 4CF5A 1G20B 1E2DA 3AUJB 3EASA 1PFUA 1NMEA 1H6DA 3MHPA 2XZTA 1PQPA 1CUSA 3RO7A 3JY6A 3O95A 5AFSA 3KIPA 3IV7A 5K0SA 1VBMA 1XTRA 2FEPA 5JJCA 4EJSA 7MDHA 2R6ZA 1D0SA 2YW9A 3D7SA 1K63A 4RD0A 4ZAWA 4O25A 1N57A 3N8HA 4H6VA 3DZDA 3PC3A 1WUJS 2F4NA 2J0QA 1KHHA 3F1KA 2XT0A 5IU6A 5BSFA 1LSJA 3COJA 3KQSA 1TLTA 3ZIDA 3H5RA 5J9FA 3CEMA 4A2WA 5IAJA 4LMAA 4RF3A 3GRFA 5JZBA 1ENOA 1XTKA 3BK7A 1LJ8A 1AY0A 3EHDA 2PKYX 1G9SA 3R3YA 4IJ6A 4NQZA 3TZLA 3JD4A 3VR5H 4DY4A 3A4IA 5I9MA 3I45A 5I8ZA 3QENA 3D31A 3TJRA 1L5LA 3RAGA 4JODA 1ZN9A 3D6VA 4WKCA 4EJ0A 1V8ZA 2GYYA 4Q15A 3D6NB 3GLFB 1NVVQ 4PZCA 2JCBA 2HLDA 1KDRA 1YDWA 3MAAC 4O63O 4YQFA 3RVBA 3ZBTA 4GLLA 1PK9A 4KE8A 4MKFA 3A9WA 3B9RA 3Q3HA 4X20B 3ZV7A 2CVQA 1E3WB 1DVRA 1XHFA 1Z22A 3PKJA 4LJ8A 2WAXA 3WJ1A 5BN1A 2DOKA 2X3FA 3FCCA 4K9DA 3IL2A 1O87A 1YQTA 2IEGA 2ECOA 2BCJQ 1KMIY 1SC6A 1WZNA 4OH1A 1HLFA 1KJZA 3HB1A 1LSOA 4MDYA 4RQTA 4TKUA 3RC7A 3ZX4A 4CM9A 3D0KA 1DNPA 1JHPA 4XDGA 1QGAA 4EW3A 2OHJA 3JVDA 4MWCA 2J0UA 1KYWA 3RRFA 2PM8A 2QE6A 2AXNA 4MWGA 5IAAA 4MI3A 2XMQA 3BE4A 3M3HA 4R2HA 3P2JA 1R6XA 2EJUA 1JIKA 1JUDA 1YQXA 3OCJA 5G4KA 3UKOA 1O8CA 3ZLTA 2VZEA 1ZJJA 4KQ6A 3JYPA 2VOEA 5DI9A 3DMHA 3WAKA 2FWIA 1WMFA 2RHGB 3IX7A 4DT1A 1GQYA 1KSFX 4KPUA 2BL4A 4P53A 1NUHA 4BS9A 1QIKA 1K92A 2QD2A 2RH9B 2ZDGA 4YWJA 2XCUA 3R7LA 5IABA 4DE5A 4MQ5A 3DVAB 3A1CA 3JQCA 4IV0A 1NRIA 2YC2C 2Z4RA 3KKQA 5C9ZA 5I7SA 3ZS9A 1B00A 4CT5A 3R7FA 2B3TA 3DKRA 3FNBA 3HA7A 4EQZA 1W36D 5TMEA 2HK8A 2RB5A 4TYQA 5TXGA 2ZPUA 3BWBA 3WWPA 1ZH2A 1XCGB 3RV4A 3LWZA 5ALVA 4AJIA 4AROA 4D6YA 2B8WA 5AM0A 1U1CA 3N8IA 3NM4A 1DBRA 1PT9A 3PXBA 4O1MA 3GRCA 4O4HB 2HU5A 2WIFA 4QHTA 5TE9A 2WD7A 1I4OA 3MS4A 4A4DA 1P45A 2IY7A 2TMKA 1E6UA 5DBOA 3ZQJA 1F9AA 5IG2A 3WP0A 1BS9A 2BTEA 5DHAA 4YASA 2JLRA 5DOZA 1C7JA 3JQAB 3W4KA 4LK3A 3NUGA 2C1XA 2YYYA 4LYJA 2NXJA 4U5XA 3SBEA 3SC2A 4AZ3A 4K28A 3CISA 1AUQA 1L4HA 2BF4A 3KHTA 5HGXA 1Z73A 1XZGA 2I9PA 3ZH9B 1J33A 1ACLA 4RKFA 2O2HA 3DE5X 1H05A 4MA4A 4HQNA 4LJSA 1UFVA 1WR8A 5ALYA 4WERA 5GONA 3F2IA 4PAWA 1P0MA 2J6IA 5EEGA 3RBVA 1OFGA 1DKUA 1R50A 1Z74A 4MW4A 4MYCA 5H3HA 2C2HA 1MR3F 3LNTA 3CW8X 3N0RA 1YWGO 4R5HA 5C34B 3MD9A 5TQ0A 5C8XA 2QRVB 4OBBA 5LIRA 1MVNA 3V3TA 3OC6A 2M98A 3GC6A 3N76A 4BMDA 1K4MA 2WTUA 1Y1RA 1G8AA 3BQMB 4MUFA 4TVKA 1SOAA 4E46A 1XVTA 2XUQA 2PUEA 1BQ4A 3PR1A 2X8BA 4NC9A 4R1LA 4B3RB 1IEVA 1Z3CA 2ODTX 2R6CA 3DPUA 4CIVA 2GARA 1KI9A 2VPZA 4HDMA 2Z5GA 4YRPA 1RD4A 4LDJA 3SVLA 4H17A 1UPCA 4NV3A 4FI3C 2MR6A 4M4SA 4Y9UA 1Z0IA 1NRWA 1JAXA 3IQWA 4DYDA 4MRNA 2YN0A 3QX8A 4Y1RB 3V7YA 1P4HA 2L2QA 3GZTB 1QG2A 1MKYA 2XECA 4Q19A 4KNWA 3UV7A 4L6IA 2LVBA 1WX1A 2GSWA 2LUOA 1T2AA 1RAFA 2FK8A 1TZKA 1XZDA 4LPSA 4WDQA 5B1DA 5FDFA 3HVRA 2V5AA 1UKEA 2GAAA 2XGOA 4H7KA 4EKNB 1ZMRA 3GT3A 2QSJA 4HY3A 4XR4A 4AMGA 4RXTA 2IHNA 3ZE0B 1K5GA 3F98A 3ID6C 1B8PA 4GX1A 4RMGA 1HE4A 5BOSA 5C8VA 4EY7A 3FWKA 5DKFA 1WQ1R 2HQ1A 1FMTA 1R6BX 3H5WA 4YUZA 2JH8A 1T1GA 2WU0A 3WLRA 4P4SA 4UW9A 2PWPA 3MM4A 3PSHA 4R9UC 2L17A 3BDVA 3SZ3A 1Y9EA 3IQEA 4Q9NA 1HDIA 5IKMA 1I80A 1KJYA 3UO8B 4IY1A 5H70A 1CHNA 2UYOA 4A8JC 4JLOA 2H4FA 3LBIA 1IMJA 1SUWA 3FDFA 4ALIA 4IKEA 4E5KA 4BUJA 4LHYA 1JU9A 4FXPA 5ESDA 1EU1A 4P32A 4LHZA 1QR2A 3D3EA 3O2JA 2E7ZA 3GH3A 5CGQB 2VKQA 5ECWA 4C3ZA 4L2IA 5B53A 2CLEB 4QU0A 1OU4A 2GS9A 2OGUA 3KVVA 4NBKA 3LT4A 1KR2A 4WW0A 3S4YA 1RFGE 2C1EA 3V97A 1DKOA 4K6MA 3QEAZ 2YMQA 1R8YA 4ZD6A 3JD2A 3AG5A 4X1KA 3THXB 1VIDA 2OFXA 4LAFA 4ACBA 4AF7A 2P2ZA 3AVWA 3NHKA 1E2JA 1S5PA 1SUPA 3UMVA 4N6NA 1T4BA 4Q34A 1YFLA 5ALQA 4JI8B 1XTUA 3TOSA 5L53A 3IO5A 3IMEA 1RZVA 3JQRA 2CMHA 3OF3A 3WL8A 8OHMA 5FWXB 1KMNA 5B7GA 1NVXQ 3VYRB 4BN4A 2D5CA 3PDWA 2VUHB 4N8SA 1PL8A 3CLRC 1P1JA 2NV2B 3KYCA 3TKYA 2NTEA 5CFLA 2N0SA 3L7JA 1ESNA 5EIEA 4OX9Y 4FJ1A 1NXTA 4BNUA 3QVMA 1B0UA 2QBYB 1NASA 3KD2A 3PYLA 1G2IA 4MGYR 4XD7D 4QQNA 3RREA 3QI2A 4MITA 4EVQA 1CZRA 4Q4LA 3UJCA 3KLBA 2FWJA 1ISHA 2VDKB 3HV2A 4IXNA 3PD1A 3T1VA 1CY0A 2ATCA 2VRCD 3JQ8B 1F4PA 3HRHA 3S29A 4JB0A 5FLEX 4JYMA 2WSSD 1ZZEA 1H1DA 4BECA 4HG2A 2CSUA 3DFKA 4L78A 3OZAA 5K3FB 4EHHA 3HB4X 4EHFA 5IUJC 2UXBB 2V6MA 4RTKA 4G5SA 2R2AA 2NU6B 3ZTTA 3WIVA 5CYGA 1CZOA 1DKLA 1Z6QA 3HH8A 3U7FB 1O9GA 1OA0A 3I28A 4CQLA 4C5AA 1DQSA 1NBMA