3C0OA

Crystal structure of the proaerolysin mutant y221g complexed with mannose-6-phosphate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
467
structure length
450
Chain Sequence
b'EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRGDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLGLRLEIPLDAQELSGLGFNNVSLSVTPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerolysin
publication title Molecular assembly of the aerolysin pore reveals a swirling membrane-insertion mechanism.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Toxin
total genus 102
structure length 450
sequence length 467
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01117 Aerolysin Aerolysin toxin
A PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 3c0oA03
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 3c0oA01
3.30.412.10 Alpha Beta 2-Layer Sandwich Proaerolysin; Chain A, domain 2 Proaerolysin, chain A, domain 2 3c0oA02
1W3GA 2D42A 3C0OA 1BCPB 1PRTC 3G4OA 3G4NA 1UYJA 1W3FA 3C0NA 1BCPC 3ZJXA 1PTOB 1Z52A 3C0MA 1PRTB 1W3AA 1PREA 1PTOH 1PTOC
chains in the Genus database with same CATH superfamily
1W3GA 2D42A 3C0OA 1BCPB 1PRTC 3G4OA 3G4NA 1UYJA 1W3FA 3C0NA 1BCPC 3ZJXA 1PTOB 1Z52A 3C0MA 1PRTB 1W3AA 1PREA 1PTOH 1PTOC
chains in the Genus database with same CATH topology
1W3GA 2D42A 3C0OA 1BCPB 1PRTC 3G4OA 3G4NA 1UYJA 1W3FA 3C0NA 1BCPC 3ZJXA 1PTOB 1Z52A 3C0MA 1PRTB 1W3AA 1PREA 1PTOH 1PTOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3G A;  2D42 A;  3C0O A;  1BCP B;  1PRT C;  3G4O A;  3G4N A;  1UYJ A;  1W3F A;  3C0N A;  1BCP C;  3ZJX A;  1PTO B;  1Z52 A;  3C0M A;  1PRT B;  1W3A A;  1PRE A;  1PTO H;  1PTO C; 
#chains in the Genus database with same CATH topology
 1W3G A;  2D42 A;  3C0O A;  1BCP B;  1PRT C;  3G4O A;  3G4N A;  1UYJ A;  1W3F A;  3C0N A;  1BCP C;  3ZJX A;  1PTO B;  1Z52 A;  3C0M A;  1PRT B;  1W3A A;  1PRE A;  1PTO H;  1PTO C; 
#chains in the Genus database with same CATH homology
 1W3G A;  2D42 A;  3C0O A;  1BCP B;  1PRT C;  3G4O A;  3G4N A;  1UYJ A;  1W3F A;  3C0N A;  1BCP C;  3ZJX A;  1PTO B;  1Z52 A;  3C0M A;  1PRT B;  1W3A A;  1PRE A;  1PTO H;  1PTO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...