3C19A

Crystal structure of protein mk0293 from methanopyrus kandleri av19
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
SLGLDYEPSHLMFLVTVLDDRDGEVLGDAIQKLIEREEVLACHAVPCVTKKNRPGHVLVVLVDGGEDPDRVAEDVARDIMVLTGSTGVDRFDADGVYSVPSRFEDVRVVYGEREWRVSVKIAETEEGEVVTVKAEFDECREIGEETGIPPREVKAMVEAAARVGGWVDLKEREIKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MK0293
publication title Crystal structure of protein MK0293 from Methanopyrus kandleri AV19.
rcsb
source organism Methanopyrus kandleri av19
molecule tags Structural genomics, unknown function
total genus 36
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01969 DUF111 Protein of unknown function DUF111
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.300 Alpha Beta Roll Ubiquitin-like (UB roll) mk0293 like domain 3c19A02
3.30.70.1380 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transcriptional regulatory protein pf0864 domain like 3c19A01
3C19A
chains in the Genus database with same CATH superfamily
1RI7A 4PS3A 2HVDA 3DGPA 1S99A 1WF2A 1N60A 3RBXA 1I4GA 2KVIA 4ANEA 2HMIA 2D9OA 1X7VA 3AM9A 1OY9A 5CA5A 1KM7A 5KOWA 1K53A 2HHXA 4C7ZA 2XHCA 2WZ1A 1HWUA 2HNZA 3IBEA 1OSDA 1FXDA 2J0QD 4CLZA 3BYRA 4HYKA 1UW4A 3UDEA 2QTWA 3RN9C 2E7XA 2HTHA 3BGRB 3BKFA 1FNOA 4UY8T 5EE9A 3PXGa 3KLEA 2M56B 4W9CA 5DJBA 2V3NA 3AB2B 1KOTA 3AY0A 1GT8A 3ZDMC 4ZPAA 1UBQA 1F52A 4A3PA 3PVXA 4HTIA 2KC1A 1IGDA 1WHYA 1EETA 4LF7J 2WVEA 2IJFA 1D9DA 2JUOA 4U6PA 3OFFA 2LXUA 4CNYA 5FD1A 1IUJA 3PO4A 3NVWA 3J81Y 5IQ6A 4C7YA 2R2RA 1JKHA 2YX4A 3AI5A 2FHJA 4W9FA 5J2QA 1HQEA 4RBUA 2DH9A 4F2RA 3NCRA 5KFBA 1S1TA 3HVTA 2YPYA 3KJFB 4EFAC 2DXDA 2DITA 3CO0P 4N5SA 1HQ2A 4IG7B 1A5RA 2XULA 4OZBA 4WAAA 3OT9A 3KJNB 2C3YA 3R3MA 2AJFE 2PIIA 2XK5A 1T9TA 1C0TB 3SCJE 3HXMA 4HEA9 2DYAA 1I94F 2KRBA 3M32B 4OHZA 4DV4J 3GIMA 3QIPA 2YQ0A 4IG0B 1U1RA 1XMQJ 1JMLA 4AJWA 5ETNA 2J4XA 2HK2A 3ZNID 3FBFA 6FDRA 1EUVB 3BH6B 1YJVA 1XERA 3A4TA 2LHEA 2E7WA 5CAAA 1M5PC 2FGOA 2GIRA 4AXJA 1RHMB 4ZN1A 2XS5A 2V5HG 2KFKA 3PACA 2V4IB 3PR4A 2W9BB 5EGYA 2M4MA 5FK9C 3AXKA 2N9XA 3U8ZA 1W2IA 1E6EB 2K1RB 2Y1JA 1HA1A 4LF2A 1LV5A 1YDLA 4OI1A 2ZD1B 4AL6A 1IBMF 2CQHA 4TY9A 4C8OA 2QMXA 3Q8YA 2OPQB 2AV5A 3EICA 1H38A 4I4BA 4J3OD 2MJDA 2CUYA 3CDBA 1SVDA 4NLUA 1UVMA 3AE3B 3FCVA 3MAAB 5A0YA 2RQCA 3V6CB 1WOOA 3VAHA 2VD3A 1N5SA 3OR2B 5B0AA 1ZUD2 1IBKF 3PIPQ 1MROA 4EBCA 4X4SA 4CO0A 2XZDB 1D8ZA 3AJDA 2MEKA 1RAIB 2C22A 2ROGA 3H6NA 1S72S 4TY8B 1HNWJ 2EFGA 2WXJA 3KWVA 2VDHA 1OEYA 4P7VA 1VRTA 5IOLA 1YNTE 1SE3A 1B99A 4DSFA 2DNFA 2YVSA 2ZEJA 5DDRC 1CC7A 2XI2A 1DY3A 4JI0J 4LMZA 1VBYA 3DM2B 3ETMA 3CE8A 4DV5F 2UU7A 2IC3A 1IR0A 3BGFA 1LO5D 1VQLS 4TYAA 1QOFA 1QTNB 1LK5A 1FWLA 2Q43A 5KT7A 5C24A 2BXJA 1J7CA 1NSQA 1SH0A 3KNAA 1DGJA 4ZCLA 4QIEA 3K5OA 5KT2A 1L3TA 1G4CA 4RGMA 4USMA 2HDEA 4WFBQ 2GB1A 5AXNA 4B9KA 2MZ1A 1JJHA 1GJZA 3NG8A 5LXIB 5L9XA 4ACFA 1D4BA 3RPFC 2C9WB 1FEHA 4WTYA 3KDNA 2QL7B 1R4MB 4USHA 1RT7A 1Y56A 1ROEA 1HWIA 2BQ3A 2MQJA 1KWMA 3MM7A 2MY7A 4ZP6A 4URGA 5LXRA 2ZDOA 4H54A 1D5XC 5LMUF 1ZETA 2W2QP 3MEEA 1PFDA 2ZZPB 3FZBA 3UDVA 1SIWB 1R4NI 2PMWA 4PEOA 4Z37A 1KKHA 5CYJA 4DQOC 1FJGF 1RWOB 3DCGA 1T3NA 2W24A 3GP7A 4B9UA 2LXFA 2O66A 1HMVA 3OWEB 1HHQA 3J80U 4USIA 3A3PB 2J52A 4X4PA 2V63A 1ENFA 3MOZA 3G82A 1YK9A 2PEAA 1VQ7S 4B3TF 2CQIA 2HVZA 4DSEA 1EJ7L 2V4JA 2U1AA 4PQUA 4A8XA 2DZMA 4W9DA 2Y0BB 3AE7B 3DBLI 1NHUA 2O67A 3DKDA 1S1QB 3MEDB 3RNGC 1RXOB 1HR0F 5EX3A 3P4RB 1RT4A 3ITHB 5E2QA 2M8SA 2QMUB 3D6MB 1WR1A 4P6VF 3CDUA 4JI2F 1IKXA 3CGIA 2ADBA 2KHWB 2MQQA 2GVZB 5LJ3Y 3PX6A 4ANXA 3LTOA 1LWFB 2W9CB 1MN9A 4JPSA 2OI2A 1Q10A 2QGFB 3RB4A 4CRJA 2XBPA 5CD4H 4J91A 1S0VA 1TVRA 2PPHA 3JSMB 4GMKA 4Y34A 1C4AA 3FK4A 1A6LA 2JXXA 4XK8C 2WAQD 2XMKA 4ZVGA 4ZRPA 4LVOP 1YI2S 2VA3A 2ZBIA 1GMVA 3H7PB 2H4WB 3LO3A 5CXTA 1Q5YA 1VZ8A 4YY3J 3X1LB 3R1LA 4AOFA 4TKNA 2AP6A 4NLOA 1N5XA 3CEDA 5A6WA 4JP8A 3HHLB 4NNJB 1TFWA 3BS9A 4I6YA 2ZVNA 4KKOA 3RNEC 2RH3A 3N79A 4R5PA 2W1BA 1R8BA 1SL2A 1IPGA 3NS7B 4QWEA 4Z7YA 4XWWA 3IN5A 3LWLA 4E98A 2XM3A 1Q16B 4HJGE 3PCOB 1MWZA 2K8GA 1K1QA 4H4OA 3MAQA 1HD1A 3QX1A 3KUGA 2N4FA 3VF0B 2XSJA 4MACA 2EFQA 3DRYA 3GWCA 3H20A 2G0IA 1DYQA 4DHJB 5CCMA 3NS6A 2RRBA 4HR2A 3N28A 3DU5A 3OSPA 1S7HA 3MPVA 2D3OR 3HJFA 1UMJA 3SMZA 4CI0B 3IWLA 5MLCV 1RWXB 2HFVA 3DLLQ 2HWTA 3Q0AA 3W2WB 1IGCA 3MDFA 1RTZA 1NYRA 2E9TA 5F41A 3OL6A 1EU3A 1GX6A 4U7CA 2HFUA 1Q78A 3A8KA 2VOPA 2HQCA 1UZDA 1PBAA 3RR8A 2KX0A 4X66F 4USAA 3DLJA 2XNQA 3NVVA 2YY3A 2RUSA 1YZ6A 4JB8B 1HBUB 1ZPSA 1UL3A 4J9RA 3DWMA 3BIID 2FC8A 4TXSA 2CXEA 1LFDA 4C7QA 4M0WB 4JI1F 4JI5F 4UQGA 3RB0A 2CJOA 1CULB 4RNFA 3LW5C 3U7DA 5DLFA 3Q3FA 3HJVA 4BZAA 4B9LA 3WAOA 2G1EA 3OTDA 3C15B 2WVFA 1VRQC 4FXVA 2DVIA 2CG8A 3OXGA 1GQEA 2QLXA 4USJC 4J5OA 1WIAA 4KHPJ 4DL6A 4O4GA 2KM8C 4IOIE 3N4WA 4LTUA 3HUIA 3FFIB 1CJUB 2X1AA 4KGVB 3QLHB 2G4SA 2L9DA 5HO4A 5DQIA 2XYGB 2IVFB 2GJIA 1RM6C 4CT9A 1TKEA 4ZITA 4NPOA 4A6QA 2KVZA 1X9SA 1WJ4A 2IIHA 4HPPA 2IBKA 4LNIA 4O0NA 3MFGA 4K2XA 4DUZF 1M0SA 1NJIT 3N20C 4S0MA 3ML9A 4O23A 1M5OC 2XSFA 3AB5A 1IBXA 1RWMB 4DZ6A 4ECXA 1XO3A 4OJ1A 2VQEF 4KT0C 1KONA 1HA5A 1CJKB 3L17A 5IT9Y 2H9ZA 3DI6B 4WURA 1YJ9S 5E5NA 4M5JA 4DS5A 2UXBJ 1P98A 1UVKA 2YKAA 2ZPNA 2VA2A 1D1UA 3MC0B 4F3OA 1IKYA 1TP7A 1S9EB 4DHJD 5KFQA 2KZZA 3DHXA 3MM6B 4PG4A 2LMCA 1FERA 1RWNB 4MJSB 2IYIA 4LRFA 1RT3A 1DTQA 2IO3B 1AUDA 4KZ0A 2O5DA 4BLGA 2F4FA 2CQ0A 1I6JA 4C2MA 2M19A 4WP9A 5J2MA 2JF5A 2ZPYA 4PXEA 3KOAA 2L48A 3VTIA 1RBOB 4WH4A 4ECTA 5E3AA 2WS3B 4HCNB 4Q8FA 1JNZB 2HLUA 3DLKA 1F5CA 4RX6A 3W65A 4B9SA 1B9RA 3V2UC 1BGXT 3CDWA 1MW7A 1WRDB 1AZSA 4F4YA 4PPDA 4BDPA 2K7KA 2CNKB 4ZVTB 1HQUB 1VGYA 1TR0A 2CQBA 4GDLA 3MCNA 4LSNB 2HVIA 4JWSC 5LSRA 4P2FA 2UV8A 2LVPA 3QGGA 2FJAB 3CCRS 4QWAA 3RYLA 5B0FA 4LJMA 2EKIA 2J0KA 3P96A 4K81A 2LVQA 4ZLJA 4CLLA 2HRYA 3R5BA 4I0WA 3A3OB 3DLHA 2RF2B 4OX9F 3GMGA 2BUNA 4K4ZA 3IWXA 3EGZA 2CPIA 5KFDA 2EFPA 4K50A 2KJRA 2RDDA 2WONA 2SAKA 2X8XX 2BRLA 3CCSS 1MFWA 2LGIA 2WOMB 1JXVA 2IGHA 1IN0A 1KHVA 4LRDA 2X3DA 3FILA 4UOGA 4WJOA 2UXCJ 4JI4J 2KLGA 2AQ1B 1N88A 1L2NA 4BS2A 5KG4A 1LKZA 1PIEA 5I3UB 4WCEQ 4RR5A 2YVCA 1RB0A 2XTJP 4EU0A 3W1YC 2KZMA 1C0UA 7FDRA 1KLMB 3QATA 2MA9B 4Y6IA 4ZIVA 3QJJA 3WA0A 2BDPA 4HPMB 1GXLA 3ZJVA 1T11A 1TV6B 1RHJB 3P4UB 2CNNB 1IKWA 5BYSA 2GBMA 2ON8A 3MM5A 2WDRB 5ADZA 4PWDB 2PI5A 3EGRA 4LFBF 1LM8B 2KXNB 3K5NA 3HFVA 4G11A 1N6QB 1M5VC 3LF0A 3TZXA 2YKPA 2R7SA 1JRUA 4UUXA 2QIFA 3IR7B 2E5LF 2RDGA 4PKDB 1J2VA 2GAGC 7FD1A 1IQZA 1JLQB 3GV7B 2HJ8A 1J5OB 3Q2AC 2OD6A 5L83A 1WDDA 1U1PA 3M9MB 3M2RB 4G1QB 2K3UA 1RISA 5A8WA 2WXOA 2E9ZA 1O6XA 1TZ1A 4KIKA 2KWUB 4ECZA 2ASQA 2BT6A 4ANVA 3K5LA 2JLEA 1RABB 1GXUA 1FFGB 1RA6A 2RRNA 4KB7A 4OX8A 2ZM6F 1YBUA 2MXYA 5B0EA 4UOCA 3CSTA 3M6VA 1YG0A 2IAJA 5J2NB 1PO6A 2YX7A 1QY7A 1N5YA 5A8KA 3I9ZA 2OH2A 2DGOA 3IHPC 3NGRA 5IZHA 4NWBA 1FKPA 3AHPA 5THWA 1HZ6A 2AJ1A 1H2TZ 2R8HA 2VG7B 4KH1B 4P74A 1YJTA 2DRBA 1CJTB 5EE0A 1GB1A 4E2FB 3TEWA 2DK2A 3RCZA 2GQQA 4P71A 2HIQA 2V34A 3SR6A 2KI2A 4CYUA 2BV3A 3H40A 1LXJA 1PBUA 2ZUGA 2RILA 4I67A 3ZQ4A 2VFUA 1CJVB 2NPFA 5H92C 3J7A1 3HVRA 1KF6B 1FNVA 2HFSA 3VR9B 2JSXA 3UD4P 4B6WA 3AA9A 1AN8A 3CJ4A 2G13A 1P0RA 1XEEA 3R6GB 4LF8F 3THTA 2ZUAA 1K51A 3IR6B 1I94J 5BO4B 2M52A 2CQ1A 2KXHA 3NWGA 4DQRA 3CCLS 3IXQA 4PUOB 4FF2A 1X31C 2CS4A 5DZ6A 5ETTA 2QMTA 2ZOGA 3K2YA 4RF0A 3A9KA 2YQ3A 2MZRA 1VOMA 2BZ2A 2HW3A 3PJXA 1TL1B 4DV7F 4K3BA 1WHVA 4F67A 1V3SA 5HP1B 1IP9A 1AT1B 2D41A 2FLPA 2L0FA 4JI7F 2C42A 4W9IA 2DZIA 1QDUB 1AROP 3QGIA 2WW4A 2BJ3A 4ENOA 5KFFA 3SQOP 5HMYA 2DAJA 4P73A 2H5EA 4LJPB 2KWVB 1IBMJ 3W8GA 4HL9A 2JT4B 1ZA2B 1HNIA 1N62A 4URSA 1RAAB 2FC9A 5EWEA 5KFVA 4TU8A 4FYXB 3M8ZA 4ZKAA 4K7QA 3KJVA 3AT1B 3EUNA 3AEFB 2GS8A 3HD1A 4TKTA 1FJEB 4I56A 5G0RA 2XMMA 1IBKJ 1TL5A 2AEJA 2LP4A 2KG1A 2LECA 1T02A 1JLAA 2VHGA 3M62B 1DURA 4WFNQ 2FUG9 4LLGM 5DLGA 3QPIA 2YNIA 2RUGA 2XY7A 1YWXA 1FTCA 4MMOA 2WB1D 1AFIA 3LQVA 3VUXA 3KK2A 1U1QA 2OEKA 3CXCR 2MTLA 2D3O1 1MMNA 2HNDA 2K3IA 3T6JA 4USTA 5IO9A 2JC1A 4DV5J 2YWHA 3L7OA 2MBBB 5D78A 1JWBD 3KFWX 3Q2SC 2GW8A 1E8XA 4WZMA 1F9EB 4HXDA 3AE8B 3I0RB 1S57A 1HNVA 2PTLA 2HQFA 2JFDA 3TUJC 3ZZOA 3ZVVA 2FCNA 1V1PB 3GV5B 4MKAA 3E01A 4RO0A 5CTRC 2ZVIA 1MMDA 3TAMB 1TU0B 1SIFA 2QA4S 1UELA 4GKJF 2DNQA 3DOKB 3V6EB 3PRDA 3GB1A 2IDEA 2HJ1A 5D3IB 2C3PA 2DHSA 3OTOF 2VJVA 5L1JA 3HP6A 2CVIA 4LSZB 3CIMA 1LK7A 4XTTA 2ZH6A 3N6MA 4M5LA 1FJGJ 4ZCMA 2MX2A 2YNGB 1TY2A 2ROPA 3L0WB 2IJNA 4RNOA 2YBVA 2UVVA 3CSFA 1Q0NA 1HHTP 1Q8KA 1LXNA 3NOBA 1WMHB 4YOEA 1IXKA 4FVCA 4B9TA 1AARA 3UD3P 2J8AA 4CH0S 3R7QA 1RT6B 4M8MA 4B3TJ 2AKWB 4HROA 2GMJA 5AE3A 2NXCA 2AX5A 4HH1A 3NBPB 4BOZB 4ANCA 5C42B 4WKRA 3LGMA 2N7JA 3OW2R 4LIRA 4HDOA 4PG8A 3EWGA 4LT6A 1MJDA 5DGBA 2HIYA 1KDNA 3D0HE 3PHEA 3UGBB 2WXNA 3RMKC 4MKBA 5BXIA 2M1MA 3KG1A 2LEPA 4JI2J 1D9AA 1OQYA 3PO0A 3HULA 2Y1LB 3H8HA 4DJBA 1KTKA 2K8BA 1IBCB 2OTLS 2DISA 3EVOA 2DCUB 1QF6A 3BGRA 3SEOA 4BWJA 1H3DA 3C14B 4K7UA 3HSGA 3O5TB 3BBFA 3O1LA 1HQRD 3T3FA 1O5JA 1YN5A 2AX0A 4L3KA 1K8AT 4ECYA 1MG4A 2WVBA 3OXLA 1B70B 2HZCA 4NLXA 3W9HA 3OFHA 3SI8A 4L23A 2VG6B 2W54A 1JJ4A 2XY6A 4FN2A 2G0CA 2ZW1A 3VH4B 1R0AB 2VPXB 3ZO7A 4A8MP 1XR6A 2QSDA 1N0VC 3ZXVA 5C2CA 3D28A 1C1YB 4ECVA 3S1TA 3VVTA 3AEBB 4G3XB 3IAS1 3H90A 4P6QA 4XDDA 3MCOA 4DXAB 2BOAA 3DBLB 5IXUA 2B6AB 4J9VA 1SC1B 4BKGA 2GVDB 4UF4A 5FIIA 1L3UA 4OZ0A 1FD2A 2BVZA 1TL3B 4PS7A 2LVWA 2ICIA 5DDPC 4WXWA 5CABA 1HWLA 3TRGA 3VAGA 2DXFA 2QL9B 3APCA 4WKYA 1C0TA 2AWZA 2MLBA 1AUSL 2H1YA 4NMXA 4C00A 4DN9A 4X84A 3ULHA 4LCDE 1ZAVA 3TZWA 4KKJA 4IG0A 3K57A 1RK8A 5DG7A 2AL3A 2WLBA 5G5HA 4WBFA 4FBTA 3R7SB 3ZRFA 2BS3B 3PYGA 3AQOA 2DHXA 2CPXA 1HBOB 2LYVA 4N7TA 3P2BA 4OI2A 4KSLC 3L7UA 3DOLB 5KG0A 2PFDA 3NGDA 1J5EF 2IMOA 1UVNA 2EPIA 3D6TB 3IO1A 3CWIA 4ZVOB 3PFOA 4X4OA 2N4CA 4WE1B 2CQGA 4RNAA 1JNRB 2GIFA 3FSYA 3K9PB 1X8DA 2IM1A 2K1RA 3E56A 3HVDA 5MAOA 2FVPA 3VDZA 5M2UA 4E3CA 1NDKA 2ZD1A 4J9NA 4JI1J 1U24A 2HNYB 4JI5J 4BWMA 2QL5B 1NJYA 4A48A 2KYZA 1R43A 3TEYA 4ZDNA 3W5UB 3BO2A 2A1BA 2I1JA 2HAIA 4KHRA 3ISND 3JTNA 3MAAA 2KTRA 2J9DA 1WZ0A 1RTIB 4NLYA 4P2MA 3OR2A 1MG7A 3UN2A 2YKMA 1UWMA 5D94A 5IS2A 3HKZD 3KYLA 4DX8H 4B17A 2WSCC 3MPDA 2Y1IA 4YL8A 4RGNA 4TY8A 4W9HA 3W5XA 3VGUA 2CQ4A 2O01C 2GMLA 1PGBA 1JK9B 1U4BA 4DX6A 4IH5A 2NXNA 2A2CA 1NSPA 2IY0B 1AA1B 2FYXA 1V6HA 4W4MA 3DM2A 3B4DA 2J5AA 1GXTA 1UTAA 4CCHA 1SCJB 4RF1A 1D6EC 3WQPA 4C0HA 3GQCA 4F4KA 1TMMA 4DUZJ 4GN1A 3UWTA 4ID5A 3A3NB 1NKEA 2QIEB 2VDIA 3ZNUA 1E5WA 1U1NA 1KQFB 1PG5B 1RTJA 3DC2A 3BKUA 1JWSD 1WACA 3URYA 1EKSA 1Y10A 2ZH9A 4LJOB 1FFUA 2CZ4A 4DUTA 2W2NP 3Q8RB 2M9KA 2VPYB 3B9JA 3AJ2A 3JYUA 3KLGB 3NY5A 4EO6A 3D1QA 4HLEA 1F9FA 4AWJA 1U1MA 3L4PA 3A1QB 3QAUA 4EEWA 1YQHA 3M8PB 5KFHA 1NNDA 2J6UA 1S6PB 4LNFA 2JZZA 1FRMA 2HSEB 2AYEA 3ONSA 3VAJA 2C3OA 1B3TA 4DQQA 2X1GA 1T0RC 4ZJQA 1E9MA 3L4BC 3R27A 2FD2A 2OMOA 3IBCB 2POKA 2IGGA 3VZIA 3I63C 1NVID 1T3QA 1K0TA 1CS4B 4I1TA 3RRKA 4DL5A 2HHTA 2IZVB 1N5WA 4X4RA 2BW7A 1LXDA 1EP4B 4WQMA 3PRBA 2DNKA 1JJCB 3WIVA 2MKHA 3MEDA 1X5OA 2DNMA 3ITHA 4A47A 3SHQA 4FNIA 2PSZA 3P4PB 1W25A 1FE0A 4EEYA 3MCSA 1BC6A 2PVOD 1I4QA 3U1LA 1UFLA 4YEAA 5KFXA 2GAHC 1H2VZ 2GVZA 2D07B 3DLGB 2HLTA 4B9VA 1NU4A 3ILJA 4OX9J 2INNE 1LWFA 4X62F 2W9CA 4LRCA 2B76B 2WX1A 1KTQA 5HVGA 5RUBA 4V1Ak 4PYUA 4DV0F 4DR2F 2NR0A 1CZPA 3JSMA 1QT9A 1VLBA 3MR6A 1QUPA 5D0HA 2I8EA 1RWKB 2DBYA 1FIQA 3OVAA 5EHHA 3L10B 3H7PA 4FYDA 2BQUA 3IFEA 3R6LB 1WXMA 3BBBA 3ZTQA 1YJ1A 1RCOB 2CQ2A 2ZNZA 3HHLA 2W2MP 1KVKA 3ABVB 5C23A 1U7LA 1M1KT 1N36F 4GSWA 1Y3JA 2N9LA 4QR1A 1FTRA 2LASA 3BYYB 2HNZB 3A8EA 2EXUA 3W9CB 2MKCA 2CZ9A 4C6AA 2WHOA 5JZEB 2R7QA 3U30A 2G4BA 1YHQS 2FGCA 3Q8VA 4ECWA 3DLBA 5J2PB 5DO2A 1YRUA 4Y0FA 5CZVA 2F8MA 2LU1A 1S6QB 1IR2A 2VONA 3PKYA 4LFBJ 4LFCJ 3AFGA 1GX5A 4W9EA 2BE2B 3TA1A 3NZUA 2ZNVB 4B3SF 4KTQA 1D09B 1SB3C 3UCGA 4DV2F 2E5LJ 3NMRA 2DENB 4ZLNA 1P3QU 3OBIA 4F7ZA 1VK8A 2RD0A 3DFEA 2MMYA 1SBRA 1RHKB 4D3GA 4QU7A 2LQ5A 1R0BG 1HYSB 1NK5A 4MYTA 1QTMA 3M05A 4ZJOA 4DPUA 3CIZA 3W2WA 2KT7A 1X4DA 2HURA 2C2DA 4FYVB 3DHGC 4K5RA 4EE2A 2AZ1A 3KUZA 1O8BA 2RU3A 1L7YA 1K44A 5KTQA 1FRDA 2ZM6J 2BMBA 4B9NA 2DYOA 2D2QA 1FVQA 3N32A 5D0RA 3QGHA 2OHFA 4ITSA 4DF4A 1HBUA 3PRZA 3AXCA 2X1BA 2LI5A 3OFEA 2DYBA 3W2VB 4M0WA 3ET6B 3R97A 2NVUI 2RSUA 1CULA 2YH0A 4DEZA 1XLPA 1T9UA 2JVOA 4LNNA 5J1PA 3P5TL 3P4QB 4KGXB 1V97A 2LA6A 5AT1B 2Q5WD 1FFVA 3VAIA 1WG5A 2EELA 3Q2TC 1NEEA 2HS4A 1LWCB 3C15A 2I6WA 4V19X 3GFYA 3ENQA 4M95A 1LFPA 3TEGA 2MKYA 4ZRJA 4J9PA 2MLZA 2PI4A 4USUA 1ZM4A 2V2ZA 2O6VD 4LF8J 2KQ7A 1FVSA 4A46A 4YS2A 2XB2D 2WP9B 3FFIA 1CJUA 2GO8A 2NTTA 3QLHA 4FKYA 2HGMA 3TSSA 4PT5A 2BPSA 4F50A 2A6OA 4WU3A 2BX6A 3M8SA 1QLNA 4E71A 1UEVA 5GMVA 5ETVA 3KK3B 2MJEA 4DV7J 3TUIC 2V8DA 4X2BA 3N3KB 4DWIA 4JGHB 2X7IA 2OSQA 5C7PA 2E3TA 4JI7J 1X0PA 3OL7A 4NZLB 5A0YB 1TK8A 4DV6F 2NBWB 1P8GA 4KSKC 1WX9A 5HLFA 1C4PA 3I56S 4LREA 3UQAA 4NEZA 1UA1A 4NJCA 3TEHB 2C3UA 2RMLA 3PW4A 2HHWA 5KG6A 2HFOA 3DI6A 3FQKA 1E7UA 1LQ9A 4ECQA 3S6EA 2R42A 5L1KA 1S9EA 3H7SA 2CPFA 2C7NB 3J81U 5A2QY 2KQ4X 5IQQA 3MM6A 3QGPA 1FO4A 3EVWA 3U1MA 2CG4A 2MWSB 2QG9B 5DRKA 4CLYA 2ZNYA 3KLVA 4IRKA 3ZXRA 4GC6A 2G9OA 5T7LB 2KFYA 1YQBA 2K0PA 5HFYA 2DNLA 2P9CA 4EWTA 1YJWS 5CHVC 2ILZA 1VCBA 3TVYA 3W9JA 3I5JC 1RU1A 1VMBA 3D7SB 1GAOA 1WYGA 3ZTCA 4YUDA 1BD6A 5LLIA 5ETOA 3HHMA 1LWEB 3CMMB 4I6PA 2PO4A 1HQUA 1VFJA 4QIVA 1NSKL 1P9QC 2BABA 4LSNA 3SSSA 3MM7B 1FRRA 1L6VA 4KPCA 1ZXHA 4GIVA 1NDDA 3DRRB 3MEEB 2XG8A 3RU0A 4YQWA 1N8RT 5D6GA 3GIJA 3ILIA 5E6JA 1OY8A 5D4OA 2W4CA 3AE2B 2K06A 5KT5A 3PHTA 4TLQA 1XC9A 1S59A 3AJ1A 1VQKS 3Q8FA 2RF2A 3BV8A 3NAHA 4GKJJ 2M0AA 2MBOA 2YNHB 3PX4A 2BYCA 2DO4A 5AZHA 3KWMA 1Y7PA 2UV8G 1NXIA 3JXOA 1QAJA 1F0ZA 2WOMA 3T9ZA 4M94A 4W9LA 3OTOJ 1FXTB 1Q0WB 3RULA 4ZPDA 1SJ4P 4OW0A 2LLZA 4P75A 1NPPA 1YN4A 4IRCA 4YR3A 4MGIE 2VZKB 5I3UA 4II3B 2SEBD 1CG2A 2JVCA 2BWFA 3AE4B 2ZH2A 1WRIA 5IT0A 4AL7A 1FDBA 3SFGA 2LQ9A 2F1FA 1J8CA 2HFNA 2W8LA 2B3AA 5C2GA 2LQJA 3ZTRA 1N6ZA 1YQ4B 4F25A 2HHHF 3TJPA 2CPEA 4XGAB 4I6WA 2EI5A 2OUGA 3CJKB 2B51A 3D3CJ 3ZZYA 3AE5B 1N5TA 1TKTA 3MUTP 1RLDA 4DN0A 1CEZA 3I5AA 1N6QA 5L9NA 2Q6BA 3R5JB 1C9FA 4ID8A 4M5HA 4WWNA 5TSSA 1JLQA 1IJEB 2EVZA 1J5OA 1S0MA 3CF6E 4P2SA 2FDNA 2Z0GA 3IC1A 3DDNA 4WFAQ 2EC0A 3M2RA 4G1QA 2B9WA 2OLWA 2L00B 1IWGA 2L7RA 2Y5PA 2ZBCA 3CJ3A 3B4MA 4NLSA 2Z58B 4XAKA 3BR9A 2E66A 3DBRI 2APOA 2AJQA 2HBZB 5J2NA 1N0UA 3E9SA 1TTHB 5HBMB 1HW9A 2BVCA 4ED4A 2G2YA 3G6ES 2NPTB 1XLNA 1J7BA 2VG7A 1WXSA 1CJTA 2NREA 5B0GA 2C7MB 2H88B 4PR6A 3RNBC 1D0EA 4AS1A 3SFDB 3GE3C 4P72A 5HK4A 3KKFA 1YJUA 1CJVA 4LBPA 1NPRA 1UW9A 5B0BA 4TU9A 3DOWA 4TQ0A 4CQ1A 2LRWA 3CMES 4I2QB 1Z2LA 2V8PA 3KHGA 2UXDF 2CIMA 1JLEB 5DG9A 1F2RI 3LH2S 2PFFB 2VZKD 1ZE3D 3U2SC 4HPLB 4DQIA 1VQ9S 4P1BC 4RH6A 3L09A 4KV8B 1WOSA 2V69A 5M2RA 4XIUA 1WWHA 2XWYA 4NLGA 3BKTA 3TX0A 3N01A 3SQGB 1TL1A 1RFAA 1VQPS 4URQU 1RAGB 3KUHA 2KOXA 2CNOB 2H5IB 5E3QA 5HP1A 4BAXA 3EE3A 3IWNC 2A10A 3EJMA 1R4MI 3BQ2A 1EF5A 4K4VA 4RW9B 1ZZFA 1L0VB 3ILOA 2QSFA 2LQBA 3A13A 2TSSA 2JWZA 4O3SA 2NCKL 2DGUA 4OL8A 3B82A 1U8WA 1V86A 4OYOA 5EWFA 4CTAA 3TUOA 2KANA 4NLWA 4XWTA 4UQTA 2CWKA 2WCXA 3PVLA 2GI9A 1EF1A 1IVZA 1UAWA 4JIOU 3TWZA 1KOHA 4O3RA 3DDIA 3TO8A 4IM3A 2O3DA 3TI0A 5F8LA 1U4AA 4KC5A 4ANWA 1V5TA 3AU5A 2RD5C 1I51B 2V8GA 2NXJA 1FRJA 2PJHA 1XEZA 3GZNI 2FUHB 2J42A 4YB6A 3GV8B 4URKA 3N1YC 1SE9A 4FNHA 4UW2A 4FLHA 3CCUS 2HKEA 3Q86A 4GXBA 4FBJB 1Q8LA 4KGMA 2RS2A 2R8IA 1SQFA 4W9KA 1UVIA 1ULRA 1Z5SB 2IM3A 1QVGR 1TS4A 3T5LA 4OZAA 2V9HA 3U02A 4CLTA 2VH7A 6FD1A 2H65B 5K14A 3QSIA 2PEBA 3W5ZA 1E8YA 1B0PA 2A18A 5IP4D 1UUPA 2ZHAA 2DY9A 3I0RA 2R8JA 4ELTA 4CO2A 1APSA 1G2EA 1REVB 1EZZB 3QYYA 4C98A 4LNOA 1ZTWA 1YQ3B 5BMGA 3CIRB 5C5JA 4KRWA 4NI2B 1E90A 2MSSA 1XMBA 1RT3B 3IR5B 1WC6A 4RFBA 2Z2LA 2ZH4A 3DOKA 4I69A 4YN3B 1N61A 2R8KA 3MMCB 3V60A 5J2MB 4FHKA 3JQJA 5BYQA 2F9DA 3IGNA 1ZM9A 1FMAD 3TIXA 2OJ3A 1IBLJ 2HS3A 1NRKA 4N58A 1KVIA 2KB2A 4FPRA 3SXLA 3Q14C 1EWYC 2YNGA 3J7ZT 2GC8A 5AXLA 3PY8A 1VBKA 4TNOA 3PW0A 1AZSB 1WMHA 4HI1A 2PMHA 3T1HF 1S9GB 5T14A 4AQ7A 3DN9A 2L3MA 5I4MA 3HM9A 1ZM3A 1H0HB 2Y3YA 3TMPB 1Z1ZA 3NBPA 4GC7A 5C42A 2XS2A 2HBYB 3KLHB 3UCUP 2LD9A 2J9EA 2I0XA 2HWIA 4MAKA 2E44A 2HQ3A 1X4FA 3WX4A 3WC0A 2K8HA 2IO2B 1VC5A 1LEOA 3MPWA 1RTDB 2FCQA 3R1HA 3C2PA 1YBTA 4HEA1 2BM1A 2CKHB 5FJ4A 1OYDA 1RE1B 1VDVA 2WW8A 4FF3A 1SJED 5CX3A 5BYRA 1H72C 3Q22A 5IC4B 4DR6F 3X0WA 2WVCA 4X62J 2HHPA 3TAQA 1RBAA 4A8OA 3KTQA 3C14A 1KLVA 4DV0J 4DR2J 3RZWC 2W7OA 3GJTB 1UPPA 2XMAA 5HROB 3FMWA 2JXTA 3UPFA 3IAM9 1EM7A 4R0EA 5IT9U 2AQ3B 2J7WA 2CHXA 2VG6A 3E3XA 1NB2A 1AYFA 3J9CA 2JNJA 1R0AA 2Y8WA 3PTFC 5L1LA 2D1CA 2LEBA 3EGNA 2D3BA 1UJ6A 1V5IB 4LIWA 3ENAA 3ZXWA 1N36J 1VCTA 2FE8A 3LGNA 2MYFA 4DR7F 1Y8RC 4Y2AA 2BF8B 3UN5A 2IRXA 2B6AA 4DR1F 4OJ3A 4B0EA 1WSVA 2GVDA 5KFAA 2KDEB 1PAUB 3GFHA 3QT6A 2DR5A 1TL3A 4KIKB 2OGUA 2G1HA 1CMXB 3OL9A 2L9WA 1L0YB 1XD3B 3TL5A 4B3SJ 1PGAA 4J9SA 3X23A 4DV2J 1EX8A 3TJ8A 4USVA 4A55A 5F9LA 1QVFR 2CJ9A 4K3CA 4NCBA 2OMLA 2ZH7A 1FXLA 3AEDB 2F8EX 1YTYA 2WDTB 3SD5A 3VGTA 2WSEC 4ELUA 3KG0A 1EARA 2DGSA 2VC1A 5HL7Q 2PMVA 4ZPBA 1HBOA 2Z2ZA 3ZNJ1 4RBTA 4KGTA 2QLWA 3ENVA 2ZCBA 2FNJB 4XZ4A 2B5JA 3DOLA 3CJRA 1NAQA 4W98A 2K6DB 3CJ5A 3CC4S 4CYUB 2BQQA 5HJYA 3PEHA 1WH3A 4WE1A 3H4DA 2FZGB 1WGDA 2DNZA 2LGSA 4OYXA 4RCOA 2CQ3A 5HVHA 1C1CA 2ZZTA 4WF9Q 2HNYA 2B43A 1DFDA 4K0KF 2HEKA 3V05A 4WU2A 5GMKa 2IA6A 4ED2A 2B7BB 2PE6B 3VALA 1NH7A 4K4XA 4WYWA 4LF1A 1Q4RA 3PTWA 2I1RA 2RVJA 4QR2A 4UT4A 1GUAB 3GR0A 4ED6A 2XI3A 4Y2CA 4IR9A 3IBWA 4BFRA 2AGQA 3CDEA 2H5JB 2JY6A 3DOMA 1TZOA 1FESA 4AFFA 3NG0A 5KT3A 4EOYA 3MFHA 1MI0A 5LOQA 4IUMB 3OTCA 1D3ZA 2NCNA 4NAWB 4Q5VA 2CJXB 4C0OC 3EZ5A 1WC4A 2LFVA 1FRIA 1UGMA 2GCFA 1IR1A 2Z59B 5LXHA 3ZNGC 4RPFA 1UZHA 4DV6J 2GGPB 3RTVA 4OZ1A 3PZPA 5HI7A 2D3CA 3NS5A 3T1YF 4ICLB 4D3HA 1UBIA 2MQLA 4PRFA 3ZUNA 1PQSA 5G55A 4ZK7M 1YKWA 3R5GA 4HJKA 3QO9B 4OJGA 2OPSB 3KLGA 4K4UA 4PYAA 3CCTA 2XC9A 4C8LA 2FZCB 3A1QA 4WIIA 3E2EA 3R8BA 3MPUB 2IMWP 3T19A 3M8PA 4RUBA 3Q8AA 2HNDB 1S6PA 2M4NA 2FJBB 1Q8BA 2FJVA 4HACB 1B0TA 4K5SA 1J19A 3ZTSA 4NEYA 1P27B 4ZVFA 3LANA 2FJXA 1K47A 3ZYYX 2QX0A 1LWXA 1CS4A 3OUYA 2KX3A 2YWWA 3H9DA 5LMNF 1JX4A 2XYHB 3IFWB 3M2VB 1EP4A 2AWTA 1VQ8S 3P45B 3JW0X 1RZMA 4OLOA 1U26A 1I4HA 5HATA 2OSRA 1AYEA 2E6XA 3Q8BA 3ONQA 2KJHB 1ACCA 3BSOA 3P6YC 1L5PA 4F4ZA 1XN9A 1KSPA 4HHJA 3NS8A 4C4VB 2DCLA 2BM0A 3GCXP 3DLGA 2UUAF 2BB5A 3ZZRA 1N34F 4IWQA 2E1CA 4FF4A 4OHJA 4P1CC 3VVWB 2BYFA 3NGTA 3L9ZA 5ITHA 2D11A 3VHQA 4ECSA 1F1BB 5JHAA 4CZCA 3LAMA 1EAYC 1RACB 3AAWB 1PJ5A 3FGVA 2ROEA 4KO0B 1NK7A 4RW8B 2O6VA 1DRZA 4N8NA 1KEKA 2MPUA 5D4NA 4DBGA 4JX1C 1X60A 1WEZA 4WP8A 4YTMB 2XLKA 4WJNA 2UUTA 3TAPA 2BJ8A 3ZW3A 3H5YA 5LSLA 3P49B 1V9OA 5HG2A 1SJFA 1NDLA 4NLTA 2W9NA 3WBZA 2QO3A 4KPYA 1S10A 2ALZA 1FNWA 2WRMA 4II2B 1WGGA 2A4ZA 4KH0B 1VQSA 5KFWA 3GILA 3T9NA 5J2PA 3JSRA 3TYTA 3PRPB 2HHHJ 2JYTA 1S6QA 2RPVA 2JWUA 1NDCA 3PJWA 8AT1B 4ERDA 1V5VA 1C79A 4MELA 3MM8B 1MNEA 2BE2A 4W90B 4IDKA 1PILA 2PVGC 1VISA 3O44A 3FBEA 2KWCA 3FEZA 1KRHA 1NYQA 1NK9A 4QPTA 2W3RA 1GB4A 3LUYA 3TA2A 2V94A 1HYSA 2CJNA 2KT5A 3CSKA 1G3OA 2IFXA 5F8JA 3M1VB 1RRBA 2GZOA 1OMSA 3O3LA 2MJNA 3AXMA 2L32A 1R3NA 4ZVQB 2OEMA 4ED5A 1UZXB 3V81B 2CDQA 2P2CB 3MC8A 3D68A 4PQAA 3PR5B 3QK0A 4MFBB 5ETSA 4JI8F 2MZJA 1EKRA 1S48A 4TSSA 4BOSC 2XMWA 3RD2A 2F40A 1IKVB 2WXGA 1UFKA 3LWMA 4J9MA 3FEXB 3W2VA 2XO7A 2REXA 3ET6A 4OZNA 1YRTA 1SIJA 3W9IA 5IKCM 1FCLA 3MMBA 1PAEX 2CPYA 2FQQB 1PYTA 5DS7A 4MIAA 2QDFA 1LWCA 2HRUA 1HI1A 4CYEA 1TL7B 1E8ZA 4NYZA 4NRTA 3NY0A 2OEJA 3SFEB 4A8WA 5J17A 3ZZUA 1VDHA 1JB0C 2UXDJ 3GG0A 1GOZA 2NBVB 1BHNA 4Q2LA 5JXSA 1KD1T 2DXEA 2V2VA 2KYXA 2IDYA 1CC8A 5JVHQ 3TCAA 3QT8A 2JLGA 1S1VA 3DHHC 1WJ6A 1AB8A 2BS4B 3T5HA 1ZDVA 5ETLA 1FWPA 4J9QA 2KFNA 1T0SC 2HHUA 2B9EA 3IT6B 4DSKA 3HSDA 2LJIA 1WNEA 4M63A 3D0IE 4NLPA 3KK3A 3NZ3A 2V4QA 1REGX 3DBRB 2CQPA 2AJ4A 2M0XA 3GB0A 1V2YA 5ETKA 3MTKA 1P9DU 4DSLA 1SPBP 2KTRB 4Q45A 5D0EA 3GJQB 2Y1RI 1P1AA 2YKMB 5J18A 4OI3A 2VC0A 3IRWP 3MJ5A 2WXLA 4N47A 4CNZA 2GIQA 2HG4A 4WP3A 2GFFA 4DL2A 4BKSD 5BR8F 1Q8IA 4F0HA 1HKAA 3H1UA 1S97A 2YH1A 1EIYB 4NXNF 1D9FA 1YOVB 4GRSA 1LW0B 4TU7A 3FSIA 3PGEA 4ED8A 4LDTB 4PXBA 3IG3A 1L3KA 2GMHA 4DL3A 4CHKA 3VGVA 5T7LA 1R31A 2NYHA 4NOHA 2H89B 1WI6A 1AW0A 2ERRA 4K1RB 4ID5B 4PG5A 3PLVA 4D2KA 1U2FA 3BO3A 5FDLB 1RTJB 2MHNA 3EXYA 4UOFA 4A8XC 3ETRA 2N9EB 1U0HA 3ML8A 1X1MA 1LWEA 2BGFA 4P7IA 2OO4A 4LRBA 4DSJA 4JOUA 3ELHA 1TK0A 3BINA 4OHVA 4USWA 2RS8A 3DRRA 4DS4A 3GIRA 1UWAA 3VQTA 3FVYA 4X4NA 3I31A 2NUHA 3QIJA 2C7HA 4DDID 1FFWB 3W5VB 3CD7A 4F4AA 2XZTB 2M70A 4X65F 4Q2JA 3CNQP 2DLBA 4ILRA 2KLCA 1RAOA 2YNHA 2GA7A 5KFZA 4K7SA 2CAJA 2C60A 1NM2A 2AEMA 2HTME 3NGKA 3H8YA 4K4YA 2BJDA 2VBZA 2QT7A 3HHEA 1ZOTA 4YSZB 3PDNA 2CNLB 2QFJA 3QJLA 7AT1B 3GZNB 3ZRCA 1S1WB 1VJKA 3D6FB 4WJPA 3KW5B 2QLFB 2ZE2B 4RW7B 1FA0A 1SJ3P 2QN6B 3B78A 2RAQA 4CO1A 4TLRA 1VZ7A 2HGLA 3T1HJ 2IM2A 2DKOB 2O1PA 2BA9A 2DHZA 1TIFA 1E8WA 4XDCA 1WTBA 1LGRA 4MSMB 4OHXA 3BSNA 2B4PA 2DPIA 1X4BA 1FCAA 2E9RX 3RFZB 2B4UA 4EBEA 3C46A 2HVHA 1XQQA 5IOIA 4C3MA 2L83A 2OELA 3CJKA 4MGKE 4WJQA 1VZ6A 3R66C 1MHXA 3NJTA 1T9WA 1RA7A 2FPHX 5F3ZA 4DG1B 3RNAC 3AODA 2ZH3A 3H5UA 4LBIA 4ZCKA 3BWUD 1I5OB 4F02A 1TFYA 1L4ZB 2N7YA 3OHBA 4LDTD 1G1XA 1GNKA 4DR6J 3T8MA 3DVNU 2PE9A 5L1IA 2B0GA 3L3CA 1SGHA 2V3SA 1FDAA 3K17A 1WJNA 1G7CB 2ZOFA 3CD5A 3KLIB 2L52A 3OQ2A 1PYWD 2BTEA 4YDDB 1YX2A 3R2CJ 2BKFA 1HBMB 2NPIA 4GU2A 2XS7A 1RWPB 2EKNA 1S7IA 1MSWD 5HBMA 1WUUA 2G9HD 4IYQA 4UUWA 2ZOMA 3TANA 5H9FJ 1MPEA 2NPTA 1S0NA 4E8UA 3UIPB 2DNPA 3MD1A 2V68A 1T6BX 4DR7J 2K6QA 1I42A 1V3RA 1ESFA 3D54A 3TUZC 4KX6B 3OAWA 1FCCC 4L3NA 4DR1J 2FIUA 3F41A 1T95A 2HQDA 5CQGA 1B1ZA 1PC5A 3GTYX 3Q24A 2QSWA 2KHDA 2EMSA 5KOXA 4Y3CA 4I2QA 4I6AA 1S77D 1FF2A 1PCAA 2OJWA 1JLEA 2W01A 3BBCA 1SL0A 2FUG1 1FXRA 4LF9F 3PV8A 2I9SA 4QWDA 4OMFG 4OZJA 2KWDA 1UD7A 4KV8A 4EZ9A 2WNMA 4ZPTR 4F4XA 3W1SA 3R3TA 3SQGA 1T9YA 4YDXA 1SKSA 5B08A 1NK8A 1VR6A 1SC3B 4E0DA 4N77A 2ZJPQ 5FR6A 1RAEB 4I7FB 1JQ4A 3M2UB 3BY4B 5KFSA 1ZP0B 4Y2KA 2OJRA 1KR4A 4RW9A 1JALA 3RB3A 1SE2A 3VXWA 1TJEA 1H6KX 4RGOS 4PABA 5J1NA 4C0BA 2KM8B 3VGSA 3Q89A 4RJVA 4Y2MA 1JXLA 4A90A 2D3AA 1N33F 4FS2A 2E1AA 3MAHA 2XZWA 2FVQA 4K0KJ 4GDKB 1R8HA 3UN3A 4N56A 4KAIA 3A1YG 3N0VA 4DHZE 1IWAA 4U8VA 4WFYA 1FRLA 2JWNA 2Z2MA 1U8SA 2QFIA 1E6YB 5HQ8A 1U48A 3ECIA 4ZS6A 1OGWA 2ZKUA 4KSEB 3T9LA 4A8YA 2WU5B 5DQHA 1VIXA 4J9OA 4QWBA 3RBZA 3IM9A 4JQWC 2VG5B 4DK5A 3W66A 5E3RA 5AJ3J 2F9JA 5KFNA 5LNK1 2HZAA 5KFUA 3NEKA 1FT8A 4A4JA 1CQVA 4FZVA 1NSAA 5AXKA 4CM2A 4ZYNA 1B7FA 2KVRA 3UR3C 5JVGQ 4A9AA 1U02A 3SDLC 5HLFB 4MM3A 2MJUA 4I6NB 1JLGB 3CCJS 3OR1B 3HVZA 1NEKB 1NKCA 4M02A 2WDVB 5EWGA 1WGRA 4FF1A 3V6DB 3CW2C 1ZAWA 2QEXS 3GFZA 4G65A 1V5OA 2XBBC 2EBGA 3BYTB 1REVA 3JQMA 4A3OA 3GIIA 3NMAA 4ER8A 4AT1B 3CCWA 4DPOA 1DOXA 4NI2A 3CF5Q 3K5PA 3T1YJ 1U6ZA 3Q8SB 2PT0A 3UW1A 3MMCA 2ZITA 3A9JB 1X4GA 5CD4A 2HHQA 2JYEA 1Q1KA 2R7WA 2ZZNA 4ZLLA 3BPSP 5HQMA 2CHZA 1G6BA 2Y8YA 3WCQA 3LDZE 4CP5A 1SV5B 3R5CA 4L6V3 3RBEA 1L4DB 2WVDA 2BB6A 3BGOP 3KHLA 1U0SA 3V6HA 3OHAA 2WDQB 4KYZA 3X3UA 1S9GA 2P8IA 4W9GA 4OV1A 3AN1A 4A8FA 3F56A 2DY1A 3Q3OC 2V9KA 2KU7A 4NAMA 2NS5A 5IN7A 2RIJA 5K8NA 5LMNJ 2VH2A 3KLHA 3CUNA 4K8RA 3NL0A 1WY8A 3NRBA 4QAYA 1IM4A 2LGXA 1SH3A 3AA8A 2CZVC 4TYBA 4AUKA 1WE6A 3IBFB 3HZEA 1H98A 2DO0A 4KGZB 1K73T 5LXYA 1KH0A 1NKBA 3ZC4A 1RTDA 1L0XB 5GVQA 2D3UA 3RJMB 2B8QA 4HH0A 2UUAJ 4BCAA 1VRAB 4F8CB 1N34J 3OJSA 2R4FA 1OQQA 2D69A 2F7VA 3PFEA 3EX7B 2KXFA 2BQRA 1M90T 1HD0A 4YTNB 1VQ6S 2FIFA 5HROA 3BK2A 2W82A 4L72B 4KVGB 3EC8A 2ATLA 3QWZB 2YKOA 3MM9B 2ZJRQ 3AOCA 3A4RA 1HI0P 2RQ4A 4DU8A 2WYQA 3WAPA 2WBRA 2VRRB 3KYCD 3QIDA 4WTOB 2JX5A 4LR8A 3EM1A 4HCPB 2FHKA 5A2QU 1X0FA 2YEPB 2OP5A 3M6UA 1UGJA 4GB9A 2V6AA 1FRKA 4LFCF 1TKTB 4USKA 4R3DA 1X5SA 2KDMA 3TEXA 2DNNA 5BMIA 1JWUD 3DHWC 4G3IA 5F9NA 4LVNP 5E0OA 5CHCB 4JE3B 5K5MA 3LXFA 1Q5VA 1RT1B 4NXMF 4NJ6A 3ETOA 3FSXA 4GO7X 4P10A 2W2PP 2QA2A 3W62A 2WWZA 4REZA 6AT1B 2DR7A 4AP4C 3UFCX 4OVVA 4NYPA 3SFUA 4P52A 2UU9F 1R8PA 3FC4A 2DNYA 2JEIA 2G3QB 3T1AA 1N63A 2V1YA 1KC8T 3VQIA 1WC3A 2B7CB 2XEWA 3AH7A 3LGHA 3AULA 5AXMA 2KMMA 1CQNA 1T05B 3L13A 1E7PB 4IDIA 3O65B 2V8VA 4A20A 3UF8A 3IS9B 3TVZA 3IXSA 4ZVUB 1RSCA 4FKXA 3G87A 4KGRA 5AZFA 4F04B 3TA0A 4DLEA 3AMZA 1OPZA 3RG6A 3P1MA 4O4RA 5B09A 5U47A 1FKOB 1MN7A 3HKWA 2NYIA 4DUYF 1MVKA 1GPXA 1XNRF 3B0AA 4M8LA 4EO8A 2D3GA 2GO9A 1HXYD 5HVFA 3CVKA 2FCSA 4KKIA 1STEA 4DCJB 1MHHE 4QBUA 1KP6A 3EZUA 4JI8J 3BGLA 3DVGY 3IG1A 1Z2ZA 3VR1A 3HFZB 2RDHA 3D9BA 1T3OA 3T3OA 4HVBA 3HT3A 3IA0A 4CIOA 1WXQA 4DFMA 4RGTA 3PYDA 1EB0A 5KT4A 2LKZA 4F7VA 2XGPA 1D8YA 2KZRA 2HFZA 3QJPA 1GNUA 2PKOA 4CLPA 3B08A 2IRUA 1UEKA 2KT3A 2JZPA 1DQ8A 3CO9A 3I5CA 1XQIA 2VFTA 1Y5NB 2GMIC 4LF6F 2NUUG 2JEFA 2AQ2B 4IM2A 4HKZE 4OV6A 1UNSA 1Y0HA 1TS2A 2WXIA 4QJVA 1YIJS 1T94A 2P6SA 2VFRA 4DL7A 3NUHB 4U8YA 3MR5A 3KWLA 3OLMD 1FRXA 2UYZB 2LGYA 1QAIA 1FNUA 3TZYA 5E3PA 4LFAF 4ETZA 1VC0A 4NX9A 2IRYA 1EQ0A 2GNKA 1OSCA 3LPEA 5KG2A 4NAWA 3SV4A 2QLBB 1RGVA 1TYGB 2AHOB 4CTAB 5C25B 5H1SV 5LSOA 2HD5B 2CYYA 4N59A 1CJEA 1WJ9A 3MJWA 3LP2B 4B9MA 5KFJA 1E6VB 3DXSX 2LEKA 2RMMA 3B54A 2GGPA 3BVMA 5C2TB 3VUWA 4LR7A 3QA8A 1U45A 2WX0A 4ICLA 5KT6A 1T03A 1VLYA 3V62A 2CU1A 2C2EA 1TTNA 5DQGA 1KLUD 2F65A 2LXIA 4WFXA 2QA4G 3HRDD 3QZ7A 1SB6A 2GQCA 3MURP 2BBCA 2EMTA 5BR8J 3QO9A 1MWYA 2ACYA 2OPSA 4RBVA 3NVYA 1RYJA 5HJXA 2R2QA 4KZCA 1Y4ZB 3LAKA 4NXNJ 4RNHA 3VRAB 4FA6A 2OKQA 3O13A 2ZH8A 1ZBTA 3DVNV 1HW8A 2UUBJ 2B56A 4MK9A 2IJRA 3BJYA 4HACA 5K14B 1RWVB 1FJ7A 2BW2A 3U1NA 4A8KA 1URNA 4RM9A 2CR5A 1YSJA 2JRIB 2Z0EB 1BE4A 4C56C 3P5BP 1H8CA 1N48A 2W7PA 2R8GA 3UD5A 1OO0B 4QIGA 5KFCA 1GMUA 3D32A 4NQLB 3M2VA 4FJZA 3KHHA 3QBCA 2A5UA 4OIXA 4ZVPB 4ZHPA 3ENEA 5KG7A 1Q7YT 3FEYB 1K9MT 2GX8A 5DM6Q 3FC9A 4N8OA 2AZ3A 1BQNB 5I3PA 5AUIA 3RAQA 4YTPB 3A8IA 1OYEA 4CQNA 2FJWA 2IJ0A 3PREA 4QIWD 2GQ2A 5MPOA 4C4VA 4HHUA 1ET6A 2F8HA 2MLXA 1N32F 5G2NA 4X65J 4MSQB 5L95C 2KDOA 1WORA 2CJBA 5KFPA 3UNYA 4O0IA 1M1GA 4O44B 1NK4A 4JV2A 4F4WA 4ZHRB 3RGIA 4KO0A 4RW8A 4AE5A 2K5PA 4MTPA 1YJNS 1RT5B 1L3SA 5J2RA 3GZ7A 4H4KC 1GMWD 2C2OB 2DRAA 2ZWPA 2B3TB 2XEXA 2CPDA 5DPWA 4JYAF 1DQ9A 4UTGA 5SUHA 2YPZA 5E6OA 1KVJA 3RZAA 5ETRA 2FJDB 3JS9A 1YJJA 4ANDA 3PT2B 1SC6A 2ASJA 3W64A 5JH5C 1MU2B 4J9UE 2H48B 3OFGA 1V81A 3TX8A 2ZHOA 3THVA 3UI3A 1DLOB 1X4AA 5L46A 4DHZB 1XR7A 5G5GA 3AD9C 5BMHA 1N52B 4KQZA 3A4SC 1ZOYB 5KG5A 3GONA 2R2TA 1VQNS 2V2KA 3MM8A 4ZDVA 1UWBB 2NR2A 1BLUA 1HNZF 1NUEA 3P4SB 3LPYA 3IRXA 4DV3F 2AD9A 2J53A 5A6PA 3CJ8A 4BKSA 1RUSA 4ANUA 3VCDA 5D0GA 2QMWA 4EZ6A 2D5GA 1WELA 3ZTDA 3QHTA 1QLBB 2RKIB 2N1WA 3I96A 5CHFA 2EKEC 2ZC4A 1GEHA 4PZVA 4LQ9A 3I4HX 2K22A 1F9HA 3R5AA 2VOOA 3M1VA 1NZ8A 1QSYA 4L2YA 2FTRA 1TAQA 3OJ3A 2CQCA 3QWPA 4M5IA 2R2OA 1BMQB 3NLCA 3V81A 2XNRA 4DLGA 2DGXA 3TVKA 2LA4A 4ED1A 2Y9HA 1JWWA 3W60A 2KRRA 3I0SB 2DGQA 4MFBA 2DRDA 4MK7A 1Y5IB 2RJZA 1AXQA 1Q5WB 3CPWR 3TQEA 2XCPA 4ILLA 2DB1A 1IKVA 5KHQA 2KKHA 3NVZA 3SSQA 1P6TA 1XT9B 2VU5A 2KQSA 4QIFA 4AL5A 1WDTA 2IBIB 3ADAC 1UKUA 5FR3A 2IO1B 1KQGB 3VV2B 3EDQB 4LK0M 2E1MC 3G4SS 3I55S 2BANB 2D9PA 4RW6B 4C48A 2R7XA 4YP3A 4OZLA 1TL7A 2GOWA 3DLEB 1RAFB 2W3SA 4R0JA 2VIHA 3B6BA 4H2AA 1GFWB 1P7FA 2B5JB 4OYBA 3RNCC 1L5UA 1B0VA 2KDIA 4LF9J 3A8JA 2H54B 4DQSA 4EZLA 3OJ4B 1UP1A 2Z8QA 2MLYA 4DR3F 1NJWA 3DRSB 3RB6A 5EE1A 1F3FA 4ZVHA 1NBEB 2OPPB 1S79A 1FO1A 4TQSA 4OZ2A 1UJ5A 1CSJA 3C6UB 2VASA 1WHWA 1YD8U 2MBHA 4X4QA 2HBQB 1C1CB 2I1KA 4ETXA 3W61A 1F2RC 3O8WA 3I4PA 1PJ7A 4QYRA 1X5TA 3PX0A 2MY8A 3S01A 4MGYE 2DTJA 4FDFA 2MZTA 2YLMA 2EC2A 1WXVA 3QFHA 2FLLA 5DG8A 4KE5A 2YWFA 1N33J 4IM0A 5B0DA 4DPXA 4QYZK 1TS5A 5KFRA 2A0FB 3K89A 3KK1B 3HO1A 2P6TA 2QHOA 3ZIMA 3DOMB 5C3JB 4ES3A 2ASYA 2NS1B 2EK1A 3KG4A 3D3BJ 2X3GA 1JW9D 1LW0A 4DV1F 3H4BA 4GOCA 3KMSA 3H59A 1XNQF 5D6JB 2CPHA 4YHHF 3IVFA 1S49A 4LSLB 3DYAA 3I82A 4F8RA 3W5YA 2Z2YB 4IQMA 5CH7B 2VF3A 2YWEA 3HIZA 3TR5A 2MW5A 1TKDA 2IY1B 4KFBB 2V3PA 5FDLA 1QOAA 2GBKA 2XMUA 4OZCA 1FM0D 1WE7A 4B3MF 4U9RA 2N7DA 4RW4B 2XNAC 2L41A 2HE7A 4L73A 2IVMA 3JSVB 1WWTA 2LCWA 4CO5A 4QCLA 1IBLF 4YFUA 1FPYA 1C1BB 3V4IB 1N4LA 1FKAF 1X4CA 3BSCA 4IO9Q 2AL6A 3QAEA 2I38A 2HWHA 4KGKA 3PLUA 4RUAA 3RR7A 3QRQA 1PUTA 2D74B 5L8RC 2EW9A 4FXCA 2JFKA 1TUWA 2I5JB 2BYEA 2KK8A 2XLIA 1ZPWX 2W4DA 2Q3PA 4XPCA 1VC6A 1TK5A 3G8SA 1VQMS 4MK8A 2CFXA 5D3DA 1OIAA 5DZ7A 2G2OA 5KFMA 2QA1A 3PS6A 3OUYB 3ZZPA 4KIAA 1NJZA 1S1WA 2ZE2A 4RW7A 4FYWB 5KFLA 3I9V9 3EPGA 1M5KC 4UY85 3M8WA 3N30A 3AE1B 3MR7A 3R5DA 4OYZA 4CLFA 2BWES 4FJYA 3DVGX 3N1XC 2DEJA 1TKZB 3HHLC 3MECB 4OYAA 2PA8D 1XCQL 4UOHA 1WM3A 4U7UD 5CZXA 2ZDPA 4C11A 2GBNA 2IO0B 3H2VE 4ES1A 1BQMB 3GYXB 3GU0A 1RLFA 4N6EB 5D77A 1VBXA 2YKQA 5CYMB 4B08A 2UWQA 1SXTA 1YX5B 2FBWB 2DWQA 1KNZA 3QT5A 2M17A 2NXEA 2CJKA 1DTTB 1LNQA 1ZA1B 2ZVOA 4DG1A 4ICUA 2O6VB 3EPIA 2HK3A 3JAMY 4O1NA 1R7SA 2R61A 3F44A 4B3RF 4K4WA 3HFKA 1HEZE 1N5VA 3C66A 3APFA 1VD2A 1QAYA 2FCMA 3VAKA 2AYOB 4NCGB 3SIPB 5HMXA 3BZDB 2BJ7A 3SU8X 4WXOA 5D4PA 2HYIB 4US8A 2EFNA 4HK2A 1FEEA 3KLIA 2B9YA 2M5YA 1V6EA 4PYZA 1FD8A 2J76E 3FDSA 4OI4A 3FMBA 2MHJA 4IR1A 2LJ5A 1VRUB 1RYRA 2E7VA 4DZDA 1HBMA 5EDSA 1WC0A 3LP0B 1BT0A 3AE6B 1BUXA 1HWKA 1UFWA 2P5VA 2KJ6A 1VHFA 2QV6A 2HZVA 1HZ5A 1H7WA 5GXGB 4IH7A 3QMQA 2D7SA 4DL4A 3HHDA 4IDKB 1J27A 3HM6X 4YT0B 1VJQA 2AJ2A 2M2BA 2YKNA 2AMCB 4RM8A 1ZAXA 4NLVA 4IFYB 4NXMJ 1UVLA 3FRZA 1I1GA 3HCXA 2G45B 3RNFC 4X4UA 2DAFA 2H51B 2VKRA 4DPWA 4F26A 2UU9J 2KFJA 3IT4B 4HHHA 2K1FA 1RHRB 4WK3A 4IKAA 2W8KA 5GADU 5ETMA 3M8RA 5KFTA 3POTB 4OZ5A 4KDIC 3U7JA 3HHLD 4YMEA 4NA2A 1EO6A 3UO0A 4S17A 2J0MA 2NMQA 5KFIA 4IH6A 4AQYF 2RDBC 4M5GA 3FAHA 1DOYA 3M63B 4DXLA 5E7OB 3SV3A 2K3KA 2MDAA 3MOJB 4DUYJ 3CCQS 1XNRJ 1Q81T 5KFYA 4RWXA 3K8VA 1XMOF 3OG5A 2LUEA 3CMQA 3ZZTA 1YZ7A 5GAGU 2H3EB 2ACMA 4I7FA 3OTEA 4G50A 5D4LA 3M2UA 3FKYA 2MZQA 2KG0A 5K8PA 3MMBB 4J6IA 4IC7B 2FLNA 1T0YA 1FK9B 2KD0A 3NNAA 2GHVC 1JLBB 3AOBA 4OYMA 1Y3KA 4TVAB 1TELA 4WZQA 2E5GA 2JVRA 4CWBA 4GDKA 2GHWA 4IFVB 4WFZA 1TAUA 1S1VB 2DH8A 3DDKA 2XCAA 4KY3A 1M5SA 1AWDA 2MQPA 1ROFA 3MMAB 1E6YA 3AEGB 5CHWA 3N5FA 4LF6J 1ITPA 4B02A 2Z57B 3BQ1A 2CPJA 2ZBPA 5L39A 5LT5A 4J7CA 4CH1A 2NTSA 5M2PA 3IP0A 4ZRIA 2VG5A 3JVZX 3MPYA 3NS1A 4MKYA 1RKIA 2KVQE 2VPWB 1V80A 2ZC3A 1WZ3A 2CHWA 2CQDA 4OX6A 1HBNB 4LR9A 3OLBA 4ARCA 4LFAJ 3LP1B 3QSYB 1S1UB 5HSPA 4CLKA 1H4RA 1KFDA 3DBHI 2PN6A 1JLGA 3OR1A 3SSRA 4R8UB 3KUCB 4Y28C 2WXKA 2VPZB 5CYQA 2MQNA 2WHIA 5KFKA 3V6DA 1NHVA 1NB7A 2MEWA 2RHSB 1NDPA 2N0SB 4GVBB 3IMQJ 3ILLA 2E29A 1OS5A 2OFGX 4YB5A 3VRBB 1F0XA 4DSIA 4CLWA 4K4TA 1YBAA 4H4MB 4LQ3A 3WALA 3DRPA 2ZJQQ 1FXIA 2E5IA 3ZO5B 2KFZA 5HN0A 3B1LX 1ZW7A 2QILA 2VZ9A 2WBMA 3A9JA 1U6FA 4J9LA 3BN4A 3CJ2A 3FBBA 2DNOA 3MXHP 4KDLB 2P9EA 3IAM1 1T9XA 1NHKL 2KTFA 3APDA 1SV5A 2WXRA 2VQFF 4PG6A 3Q8PB 2VBWA 3MTJA 4M5DB 2X38A 2C2MB 3CTRA 2DR6A 1U0HB 4LRAA 4DCPB 1EU4A 4HDGA 1F77A 4FS1A 4IQXA 1T7PA 3K0JA 4LF5F 1HNXF 2YNFA 2KYWA 1BQXA 1VLOA 1QJHA 4HVZA 3TUPA 5IV4A 2LZ6A 2KDFB 1Y9OA 2PDAA 5IWAF 1PYSB 3VH3B 3ZGZA 3THPA 4HT7A 2ZZMA 5I42B 2G1DA 3L95X 4G1IA 4I2PA 4M5NA 3DMJA 2ZKTA 3HT0A 2NZ4A 3ZTOA 2ZEQA 1U09A 4CLSA 4C3LA 4ARIA 2BJEA 2PE8A 5FLXY 2GV1A 1E7VA 1WX7A 3PHWB 2C2KB 3W1YA 3GJSB 3SDEA 1N32J 3MUMP 3HX9A 1LW2B 3IM8A 1WX8A 5ETQA 1RAHB 2JDJA 4EYHB 5GADI 1FDNA 5AEKB 2EG1A 2FHOB 3UINB 2V67A 2HBRB 3Q3NC 1URRA 4P2XA 3MM9A 1S12A 4NL5A 2J9CA 4PYDA 1QD1A 3TEZA 1R89A 2IPKD 3I6PA 1VYAA 1K50A 2MH7A 1YN3A 2RU9A 1JIHA 2JZ5A 4Q2MA 3LALA 4JYAJ 1TKXB 4B3OB 1GC6A 4RU9A 3ZZZA 1Q82T 3C19A 5GAGI 4KJIA 4NE9C 1OQ3A 4UZBA 2JEJA 3CDAA 5IV3A 4TN2A 2C2RA 3QJZA 2ADCA 1NK0A 4HTJA 1RT1A 1TUGB 1QE1B 1TBEA 1U49A 3C16B 1OQ6A 2MJ3A 1XTZA 1S1XB 3OV7A 1JLFB 3K59A 1PDXA 2V2QA 1JROA 4NY0A 3Q8QB 3L7PA 5EUHA 1UETA 3AOAA 2Y5CA 2N3LA 1WEYA 4C8YA 1XK8A 1HNZJ 4WK1A 3M95A 1FRHA 3PZ7A 8RUCA 4DV3J 3R8YA 1XR5A 5A76A 1KLGD 2RDJA 4PG7A 3B2GA 1T05A 4DL0C 3HK0A 3IS9A 4NRUA 5D3GA 1WG4A 4Q0BB 3KUEA 3G86A 2L05A 3AE9B 3CB4A 2HGNA 1O0PA 1FKOA 2FVSA 1WXAA 1Z2MA 3MF5A 3H98A 3FUYA 4ASWC 4RKUC 1I4RA 3BPDA 2OPRB 4NLQA 3BDEA 1PC4A 1VQ5S 2L0TA 2WXMA 2PLPA 2VH1A 4CO3A 4DOZA 1F5BA 4V19J 3R7RA 4BC7A 3JSBA 4CDIA 2M7SA 3G6XA 2F4VF 5IFMA 2G2ZA 2L08A 3Q6BA 2ZH5A 1V49A 4OI6A 2MHEA 2N1VA 9RUBA 4ZPVR 3HHNB 2JC0A 1R6VA 3EGVA 1QOBA 2JL9A 4EZJA 3KUDB 3FRYA 5IAAC 3KNGA 2XHWA 1D3WA 3Q8EA 3SCLE 4DCOB 1VK3A 4JBCA 2KO3A 2PC6A 2RSQA 1I4XA 1HPZB 3NNCA 5KFEA 2J7QB 2LHDA 4IKGA 4YR2A 3MUVP 3GFXA 1SQEA 2HAFA 4LBHA 2FZKB 5E3CA 1VJWA 3EYZA 1NJXA 2CA9A 3CULA 3CCZA 4IO1A 2ATCB 2BRKA 5IM0B 2XGQA 1WF9A 3OTBA 1UJ4A 4DR3J 4ZOHC 2V0NA 3DU6A 1HL6A 3Q8CA 1GMWA 3FQLA 4BC9A 3GLJA 4ZOSA 4ED7A 2VBXA 3HF5A 2B4VA 3AV8A 2QC3A 4FVMA 1HFEL 5C25A 3UVJB 2PW9A 2YWKA 2DGWA 1KFYB 2W7AA 2FVCA 1PGZA 2QCZA 3LP2A 4LF4F 2ZCCA 1BUIC 4Q8EA 1E6VA 2V4LA 3TJAA 2JH3A 4NYOA 3V4MA 3OSNA 1S4EA 1OPIA 3T41A 2N4DA 2Q6CA 3NGSA 5LMUJ 1C3TA 2AF6A 3L16A 4EI2A 1ZGUB 4MGZE 2IYDB 2XY5A 2A3JA 1F60B 2AYMA 1AW7A 1WD6A 1C2PA 3GG1A 4ZCIA 2RHQB 3JQKA 2C3MA 1F5AA 4AD6A 4BHQA 4OFZA 4A8SA 4ZYSA 4DV1J 2OTJS 3KVFB 4MM3B 3PHXB 4TUUA 2O2VB 4RMAA 1XNQJ 4JWUC 4YHHJ 3V5RA 2UVRA 4JI6F 2BYTA 4DBQA 1X4EA 1TGZB 2BKPA 3EHVA 4GMVA 3QWUA 4MH0E 1S76D 1LOUA 1S6UA 4WIQA 3FKBA 2KJWA 1YX6B 3NGUA 1HR0J 3TP2A 2WB4A 2MGZB 3WANA 1PYOB 2HHVA 1KBRA 1WG1A 2VBYA 4B3MJ 3J81j 2PIAA 1JLCB 2RPQA 3FCWA 3KDOA 4TV3A 2DZKA 3P63A 2KL8A 3CWJA 3G6VA 4QR0A 2ZBRA 1BQNA 1ZKHA 1RFKA 3WZ0A 4WAFA 1H7XA 4PWWA 2W9AA 2EEYA 4ZMMA 1VIOA 3K7RA 4MT5A 4JUZA 3VAMA 1EQMA 2PGCA 2LXCA 4GKKF 3DRXA 3VWSA 2XO6A 1JMTA 1RWSA 1TL4A 3U4EG 3ISNC 2LFIA 1M1HA 1RHQB 5F8HA 1CPZA 3QC8B 2MP2B 1R4NB 2OHDA 3FCHA 4WIPA 2ZVSA 4DWFA 1V1OA 3OPKA 4H4KA 4OI0A 1CK1A 2WU2B 4O44A 3LYYA 3I87A 4IRDA 1PJ6A 2OFHX 4ZHRA 2JX2A 3C0RB 3PJ9A 2BKOA 1RT5A 4Q44A 3D5MA 2R2UA 4RUCA 3Q23A 1OTRB 5FKAC 3Q83A 1IYFA 1A7GE 4DDFA 3GSIA 4OVUA 4L75A 5DPTA 3KLFB 3C6TB 3W2DA 2CWXA 3CD0A 4PPZA 2EKYA 4OQJA 5I3QA 3OLAA 1RAJA 4RU2A 3RRGA 2DGVA 4NCAA 2ACZB 4MKVA 5JMNA 2UP1A 1MU2A 1Y11A 1HI8A 4M8NA 5KG1A 1IJFB 3BZQA 5GMDA 1SUQB 1SE4A 4M00A 1DLOA 2GBJA 3HPOA 4FXDA 2ZHBA 3M6XA 2MCNB 2ZW0A 2VICA 1V8CA 4IUFA 4DR4F 4I68A 1RQ0A 1UWBA 3M32A 1YITS 1U1LA 1GK8A 2D10A 3PRMB 2KN5A 2LQ8A 3BB5A 3BYPA 1WGYA 3QZ8A 4HLBA 3F0NA 4Y2IA 4B3RJ 1FNMA 1Y00A 1VQOS 1WC5A 5D15A 4CO4A 2RKIA 5EE3A 2E5JA 3SCIE 2EBEA 4QZVB 3LA0A 3MEGB 1FJCA 3JYTB 2KNBA 4J90A 2K9XA 4EGLA 2DYMA 4IG3B 5E41A 4X66J 2JLFA 3J80Y 3KLSX 2W9BA 2E5HA 2RR9A 3DBSA 3RUBL 4XPEA 4KHMA 3PV1A 1UEUA 2NBUA 3KHRA 1SSNA 2JRHA 3I0SA 2W4PA 3V61A 5SZTA 4XO0A 4O3NA 1VBZA 2OPQA 3QT7A 1SKWA 5J1EB 3QNWB 2W25A 2FY1A 3HD2A 1QKZA 1RDRA 4Z7CA 2CU3A 3MFIA 1OY6A 1NO8A 2BANA 4RW6A 4UDUC 3BVZA 1QM9A 2EG2A 2INDC 3I32A 2AX1A 2WXPA 4LNKA 4DX5A 1KHWA 3DLEA 4J9KA 3EFUA 3GIKA 4CH7A 1R8AA 3GR1A 3PM9A 4GO5X 5LL6d 1FE4A 4MIBA 2PD1A 3HHKA 4GVLA 4ZRKA 3RYTA 4DMZA 1RT2B 3PNIA 1T0QC 2Y3AA 5JXVA 3DRSA 4BKTA 2J8SA 3IG1B 2BE9B 4AQYJ 2OPPA 3WIMA 3C6UA 4BBYA 1WM2A 4JL9A 4QYZJ 1ELOA 3C3LA 2KHCA 1XMOJ 1SJ1A 4FPIA 2C2NA 5D7GA 2MZSA 1PGXA 4OYIA 4UZCA 4WWMA 1RTHB 1JJ2R 4ILMA 3BO4A 3MI7X 4QPXA 3R2IA 1TT5B 2IY5B 4NASA 1I4PA 2VQEJ 1T0TV 4Q7AA 3HVWA 3TOQA 1XIQA 2A6MA 1L6UA 5HAOA 2KKCA 4G0NB 3T6BA 3BR8A 3GE8C 4FADA 4F0MA 2DX5B 2H4YB 1B64A 2MKIA 3FNNA 1MG8A 3PEJA 5AJ3F 4DR5F 1RLCL 1S3SG 3BH7B 2CPZA 3M8QB 3KK1A 4DPYA 3MGJA 1ZZNA 3D1HA 3N1ZC 2KC2A 3HDSA 3T3NA 1M5HA 5TR5A 5F3TA 3BEGB 1PKUA 2KJVA 2NSCA 3TBLD 4B95A 1SL1A 2DJWA 3JTOA 1BMLC 2MQMA 3N6LA 4RLEA 3M30B 4LSLA 2RRAA 4M5MA 2AIRB 3G8TA 3MTNB 2F63A 4NQKE 3CJTA 2AW0A 4CO7A 2ASDA 1K52A 3GE9A 1KLNA 4WWOA 5L38A 3DNCA 3DWGC 4G6VB 4XYCA 1WSPA 4KFBA 4EMDA 1KFSA 1G6JA 4F3QA 3EXCX 3ZJTA 2Q79A 5DETA 2N82B 3KJQB 1T03B 1K0VA 2DZJA 1HTQA 3NP5A 1YGYA 3NXZA 5HQLA 1FHTA 2BR0A 4PK1A 5F8GA 4ELVA 4RW4A 2N3OA 2ILYA 1M94A 1F3VA 1F2GA 3AB4B 3QQ8B 2M3DA 3SCKE 4W9JA 2MSTA 3JSVA 3KYDD 3WHIA 4KV2A 3R2TA 1T5XD 1UCNA 4WPAA 1NCLA 1C1BA 2X1FA 3LJ3A 1FFSB 2BJ1A 3V4IA 3PG9A 4RUHA 5A8RB 1M4VA 2JJ4D 1FD6A 3VAFA 3NOCA 2KO1A 1EWCA 2IYGA 2UUCF 2YXLA 5AUKA 2I5JA 2L1AA 2L76A 4DDGD 4DX7A 3UR0A 4HI2A 1SJQA 2HRTA 4C8ZA 3DGPB 2DHAA 4YSYB 1V3ZA 3KH0A 1YMHE 3ZNZB 2K25A 4ES2A 2HMIB 2CRLA 2VQFJ 3QRRA 4DXGA 4BBNF 3GYNA 1XLQA 2EFOA 3M3JA 3UQSA 5H9EK 2YX1A 2LUMA 3RBDA 1FNXH 1U2CA 2E1RA 4DXFA 3V6KA 4EK2A 3VFKA 2IGDA 4HWIB 4LF5J 1TKZA 1HNXJ 3MECA 1Q95G 1P1LA 2KTQA 2D3ZA 1ACMB 4L74A 3DBHB 4ZN3A 1RBLA 3VVUA 3HVAA 4C80A 3O6QA 3HSZA 5IWAJ 3BF4A 4MEMA 5HI1A 3PSEB 1BQMA 4ICVA 5D8HB 2J7KA 3KLEB 1W2BR 2WXHA 5CYMA 4US9A 2CJAA 3NOGA 2BKRB 1R8CA 4NJ7A 1DHMA 3CJSA 1DTTA 1YIWA 3FBCA 3VZHA 2J0JA 4DFJA 1X9WA 2R7OA 1VHIA 2ZNVC 1EETB 2DNRA 1F9JA 3MWBA 4YWGG 1UWXA 3CJ0A 1TZ0A 1LQBA 4EKUA 1U1KA 4NCGA 3TNVA 1A9NB 2AU0A 2RB7A 3R9LA 1JKHB 4CT8A 4ZVEA 1TS3A 5I4DA 5CCLA 5J2QB 3B8HA 1HQEB 4YB7A 1S1TB 3HVTB 2SXLA 3OVSA 1JWMD 2LWPA 3HMJG 2QJLA 4XE0A 5GAEU 1DAXA 4C8MA 2I2YA 2M0GB 4ZJLA 1VRUA 3D1OA 1F6TA 2Z30B 2B4OA 1YJIA 2CJYB 3MR3A 3LP0A 1RADB 3V3XA 5DDOC 1Q79A 4P16A 4NLRA 1H2UX 2WTFA 3DHIC 2XK5B 1TUVA 2WXFA 1HWJA 4JI3F 2LVOA 2M8HA 1BXTA 1FX2A 1ZDXA 2GHPA 3IRXB 1NMEB 3QIPB 4WJBA 2C2ZB 4IFYA 2A2DA 1ZPVA 3L54A 4HRSA 4DQPA 1U25A 1C4CA 1DOIA 2YQ1A 1DBDA 2LU2A 4KGSA 3H2UB 2J0SD 3IGVA 3RAMA 2HQIA 1IM6A 3G9CA 2UVUA 5T41A 3UNGC 3NZSA 3MHYA 3POTA 3DXBA 2KFKB 3JB9k 1KRPA 3AD8C 1SQGA 3SZ2A 2AJ0A 4ZVSB 5DPSA 2KT2A 2UVWA 5AZGA 2KXJA 2FAZA 4TQRA 4FN5A 3V6JA 2NXUA 3IAS9 3JTPA 3F73A 1OFFA 3H7HB 3QRPA 3UIOB 1HARA 3D2WA 3AQPA 3AECB 2L8JA 2W2OP 1R7IA 5KAKA 2RGFA 4F36A 2MQ8A 4OYPA 1N56A 2K2PA 1RYSA 1MROB 2B9XA 4OLPA 1FK9A 4U67Q 4PAAA 1CJKA 2QC8A 4MH8A 3SYZA 3KQ4A 2F4VJ 3VTVA 2R2SA 9ATCB 1JLBA 1HE8A 3EUB2 3A33B 3M9OB 1NBFC 1NPKA 2MQOA 2GJFA 4MYUA 4WQOB 2WK4A 3MD3A 1VRTB 5KFOA 3BSAA 2WSFC 4TQ1A 4ED3A 3NAIA 3DPDA 4IFVA 1WC1A 5C1ZA 1A70A 4MJSA 4AJYB 3DDCB 2EK6A 4OJHA 3ZLZA 4N41A 1SIZA 3MMAA 4MJKA 1WSRA 2IC3B 3DQVA 2FHJD 3N6NA 1HHSA 1GTEA 2V4RA 2YWGA 5EX0A 3TJ9A 2AGPA 1NK6A 5C24B 4HDHA 2N9KA 2QZ8A 2U2FA 3D0GE 4M1KA 3ZNHB 3TZZA 2WXQA 4HT5A 2IA0A 3N9UC 3CCES 2MSED 1HBNA 1K8RB 4X64F 2DNGA 4AUQC 2JOQA 5D2MB 1KN6A 3GJRB 3LP1A 2JRSA 1S1UA 5HHDG 2MKSA 3AU4A 2ZWOA 2WGSA 2DD8S 3AH6A 1RT7B 3RUIB 3EVMA 4OHYA 2LXAA 1T9VA 4R8UA 1OJ4A 2VB6A 2K7JA 4P7TA 2FJEB 4JV5F 3OD2A 3W7BA 3BDPA 4FJVB 2BYVE 4LF4J 4M5KA 1ICEB 1YJ7A 2BACA 4GVBA 1FI4A 2XWXA 3C8YA 3K5MA 1HMVB 1XWLA 4H4MA 1ZYQA 4TMAB 2UUBF 3VR8B 1X4HA 3G82B 5EDWA 1O51A 2QLJB 4L1BA 3PZ8A 3BQ0A 1J7AA 1SXLA 2Z56B 5IA7A 4ECRA 3DYAB 2KMCA 2Q1LA 4IWPA 1QZEA 2V4JB 4PQUB 1S5ZA 2BKNA 2XLJA 2UZAA 5JJBA 1KJTA 4YR0A 5JHBA 3W3SA 1V9JA 3ZKJC 4WWPA 2AQ4A 3AEEB 5LM7E 1S9FA 3PIOQ 3HK2A 1IQTA 2DR9A 4X57B 1RT4B 4M5DA 5B7WA 2Y5BB 5DM7Q 1FDDA 4JI6J 1UVJA 1KLMA 4JV0A 4EZKA 3PPAA 5GAEI 5HKHA 1IKXB 2DEIA 2R7UA 1TV6A 4YB1P 3Q69A 2EWHA 1H74A 4DFKA 3ZZ0A 4PWDA 4ZPCA 3W8PA 1Z4UA 3H25A 3B2FA 4F1SA 3SBMA 3H0PA 4WYLA 4Z2XA 1TVRB 5I42A 3EECA 3GP9A 3MEKA 3G6YA 4KR0B 4C97A 2BE7D 3UCZP 1QSSA 1WKJA 2MBQA 4ZRQA 4O3QA 1XCTL 4ED0A 1VI7A 2ASLA 4LF7F 1SBBB 4L76A 2NSBA 3BVGA 4GKKJ 1H73A 1HLWA 2DPJA 2ALYB 1FWKA 4E74A 1JWAD 2OD4A 1LW2A 4LUBA 1YRXA 2CVEA 2VFSA 3PRVA 3S8SA 4X4VA 4IOCQ 1XLOA 4KBIA 4KKOB 1K1SA 4R5PB 2RNEA 4FP9A 2GRIA 1OWXA 4PXDA 5IT4A 2R9LA 1RAXA 3Q3MC 3QQCD 1WR6E 4C11B 2DH7A 1Y5LB 3NRZA 4CLUA 4H4OB 1TY0A 1TKXA 4B3OA 2ZBQA 1KOOA 2OEDA 4N9F4 1RWWB 3HLUA 3J7AN 2XSJB 1SKUB 2VV5A 4ALZA 4FXWA 5HANA 4DV4F 2PEHA 2FB0A 4IW0A 1XMQF 2CJQA 3KMQA 1QE1A 1MWQA 1GAQB 3C16A 1S1XA 5GAHU 2RQMA 2M88A 3PO5A 5H9FK 3VTWA 1JLFA 4BVUC 4MT1A 1DQAA 4IWOA 3AD7C 2JPHA 4DR4J 3N5BA 1DARA 2NLWA 5DDQC 2Z8LA 1E10A 2ZFHA 2DIUA 3GCWP 4PUOA 1UH6A 4U96A 2IDLA 1C77A 1NI2A 2IBOA 2Y0SD 3R7BB 4P9SA 4ZHOA 4Q0BA 2AEFA 3M4XA 3G96A 2QRRA 3U52E 1HIYA 4DHVA 2DNHA 1J5EJ 2RDIA 5F0WA 3W63A 5KFGA 5G4DA 3W1SC 3WAMA 2HHSA 2VUGA 4JLCA 2NQPA 2OPRA 2YKNB 3FZ2A 2CDRB 3EFCA 3N9YC 3E8OA 2FLOA 3JSYA 3U27A 3Q8UA 2MKKA 1C78A 4ZP8A 4F0KA 4DFPA 4C3KA 1IUEA 3LB8C 3R2DJ 3S2AA 2ZH1A 2IPOB 3GS2A 3U7ZA 1F2HA 1HNWF 3H5SA 1SKRA 2INPE 1I7HA 1P1TA 1SI9A 4O4GB 2JQRB 2V0GA 3H2LA 1NENB 2PA3A 3NWRA 1WF1A 3RAXA 1P9YA 1XJWB 4OX7A 2KN4A 3P3DA 1WFYA 3UDLA 4JI0F 2ZJDA 3HI9A 2L3ZA 2N7CA 2FVRA 2KDBA 1WYWB 4QU6A 4R25A 2AYBA 4RZRA 1ZXIA 1B4SA 1HPZA 1X5PA 3MR2A 2BBEA 4NZ0A 1R27B 4FULA 5ETPA 4DI6A 1RJJA 3OVBA 3WDOA 4CM0A 2LGDA 1Q7LB 4PCQA 3M9NB 2VJUA 3ZTPA 5KG3A 2HVEA 3VQSA 8ATCB 5EN1A 3CCVS 3T5KA 2XN9C 1IBXB 1KS2A 2R3VA 5IM0A 4FBUA 1CLFA 2GJ2A 4I64A 3ALBA 2B8PA 1PSDA 3NKYA 3LOUA 3WIUA 1KQKA 3VTUA 2KH9A 2MBEA 1WHXA 3JAMU 3EGWB 2G0JA 4ZIWA 2E1PA 2K39A 2Q66A 3A12A 3UVJA 1IKYB 1JRPA 1V1PA 4NA3A 3EDRB 4ZP7A 3DCAA 2DT9A 4MIWA 3TAMA 2MB0B 3OL8A 1DTQB 1WKKA 4FHJA 1R6YA 2VODA 3US5A 2K8CA 2V8HA 1SJHD 2CKWA 4HKQA 1BY9A 4N76A 2MKJA 4DR5J 1UA0A 1GG3A 1MLAA 1FXAA 4G1PA 3DLKB 3NCPA 2COLA 3VAWA 2DHHA 2J7UA 4ZA1A 3CCMS 1SF0A 4ECUA 1ISNA 4DF8A 4YXDB 3QCAA 1U1OA 2QEJC 3OJUA 2O2VA 3ZDTA 1RT6A 1WI8A 4GDLB 3GSDA 4AYBD 3PW7A 3PKMA 5F0UA 1CQMA 5CYQB 3K58A 1L3VA 5HMWA 4OHWA 4F2SA 5B0CA 4Y65A 1ZM2A 3UE2A 1NI3A 4ATNA 1F1HA 2FY8A 1JCKB 3M6WA 2WONB 2MGZA 1DJ0A 3MP9A 3DRPB 4J37A 1JLCA 3ICLA 4PS8A 4RWWA 1DZ5A 2J9DE 1WGHA 3EZOA 3FILB 3E51A 4XC2A 3D66A 1YLXA 5GAHI 3MHZA 3O2IA 1AFJA 4ZPWR 4YY3F 2BOPA 2V9WA 2VL1A 2QE5A 1BWVA 3MHSD 4K4SA 1D5ZC 2XYPB 3ZFVA 2UUCJ 1C0UB 1MMLA 2N7EA 2MP2A 3ENWA 3D4JA 4IOAQ 2BJ9A 2QYGA 4ZP9A 1Q1OA 2XMJA 5E6NA 2J0WA 1U47A 2LDIA 2YNFB 1S4FA 1IKWB 2RQKA 2KAJA 3MM5B 2JEGA 2INCC 2JHEA 5AE1A 3I57A 1U6BA 3RT3B