3C19A

Crystal structure of protein mk0293 from methanopyrus kandleri av19
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
b'SLGLDYEPSHLMFLVTVLDDRDGEVLGDAIQKLIEREEVLACHAVPCVTKKNRPGHVLVVLVDGGEDPDRVAEDVARDIMVLTGSTGVDRFDADGVYSVPSRFEDVRVVYGEREWRVSVKIAETEEGEVVTVKAEFDECREIGEETGIPPREVKAMVEAAARVGGWVDLKEREIKVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MK0293
publication title Crystal structure of protein MK0293 from Methanopyrus kandleri AV19.
rcsb
source organism Methanopyrus kandleri av19
molecule tags Structural genomics, unknown function
total genus 36
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01969 DUF111 Protein of unknown function DUF111
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.300 Alpha Beta Roll Ubiquitin-like (UB roll) mk0293 like domain 3c19A02
3.30.70.1380 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transcriptional regulatory protein pf0864 domain like 3c19A01
3C19A
chains in the Genus database with same CATH superfamily
1B0PA 4FXVA 2AEFA 4FZVA 3VXWA 4U7UD 5L46A 3C16B 3OVSA 1TKEA 1L3KA 1ROEA 4J9MA 1TKZB 3L10B 2ZVIA 1ZPVA 1TTHB 1XR7A 2DK2A 1HR0F 4YB5A 1MMNA 3RZAA 2OJWA 3SEBA 1IBLJ 2RH3A 2WDVB 2XM3A 1DYQA 2IYDB 1IUJA 2MZTA 3I82A 2DYAA 4FVCA 3WBZA 2VZKB 2RUSA 3ZTQA 4F67A 3X23A 2FLOA 2QLFB 3G6VA 2IRUA 2PVOD 1PIEA 3WX4A 2VICA 5BR8J 4EGLA 5I4DA 1XO3A 2WQYB 4Q8EA 4JV5F 3THVA 5F0UA 4UOCA 2DNOA 4O3QA 2C2NA 1QOAA 3M9OB 1T9TA 2M4MA 3JYTB 4IRKA 3W2VA 2FJVA 4CLPA 2CPEA 2ALZA 1C2PA 1FDDA 1YN3A 2MQMA 3NOCA 2A4ZA 3EYZA 4MSQB 4F1SA 1RSCA 1PYOB 3LTOA 2J0MA 1UVNA 1NB2A 1NK7A 4ZVHA 2HFNA 2PIIA 1IGCA 2V4QA 2K9XA 3OSPA 1NK9A 2CWXA 3DRXA 1CJUB 1LXDA 5HMZA 4C00A 1JLAB 3I63C 4Y6IA 4A6QA 1WD6A 2CFXA 2V3PA 2C2OB 4C8OA 4ZDVA 4HHUA 3R2DJ 3W5ZA 2EI5A 1O5JA 4ANWA 1LW0A 3I5JC 3DGVA 1N5WA 4LFAJ 4I68A 5KG7A 1XXGA 4F50A 2YX1A 5E3QA 2JLEA 2BPSA 1UVLA 1C0UB 3H2LA 2ZH5A 1PILA 3UIPB 4GKKF 5KTQA 2DB1A 4ARCA 1C1BA 3CJ4A 2DISA 2RT3A 3OV7A 4HDQA 4ATNA 4HROA 3EUNA 5C5JA 2OIHA 1HNZF 1ZA2B 4NZLB 1WYWB 4R3DA 3ZDTA 3R8YA 2EC0A 1C4AA 2CHZA 4CIOA 4N56A 4UUXA 2FHMA 4DXGA 1TVRB 2GMHA 5DLGA 3QAUA 4B3SF 3N32A 4ZRPA 1KVIA 1WZ3A 1P1TA 3S1TA 1SV5A 2GZOA 1GMWA 4J9NA 4C0HA 2BVCA 1FO4A 3OFEA 1J8CA 4YTPB 1YJTA 5FDLB 3DRYA 1AA1B 4K7UA 1I6JA 1RTJA 2PEHA 4IO1A 2LRWA 2LCWA 4JL9A 2UZAA 3HJFA 4B3OA 1GUAB 4LJMA 4W9LA 4UTGA 2CQCA 1R0BG 4OZAA 4BHQA 3RB6A 2GMIC 3HSZA 5C2GA 2CJNA 4PG5A 1HD1A 9RUBA 2J9DE 3ML8A 2QG9B 2VG7A 3IWNC 1VIXA 3KUHA 3OVBA 4DV2F 1NHVA 2UU9J 3CO9A 1MMLA 1LW2A 2AGOA 2Z0GA 4ZYNA 3HKZD 2KOXA 4C3MA 4PPZA 2DNYA 1K1QA 4DV6F 3QJLA 2CZ9A 3UN3A 4EE2A 2C3YA 2DZMA 1DFDA 2EK6A 2LQ5A 2HHHF 2WOMA 2PI5A 2H5JB 2E6XA 4K1RB 5DM7Q 3MPDA 3TARA 3N6MA 2RB7A 4KGKA 1Y4ZB 3I87A 1ZOTA 4I64A 1FRHA 1G7CB 2HZCA 2J5AA 4MKBA 3FFIA 4DF4A 4EUVA 2O1PA 2CA9A 2VC0A 2FJAB 4N9F4 1NZAA 1XNQF 1OO0B 2L83A 2XO6A 1N6QB 2KLGA 2BDPA 4XPCA 5I3PA 3AH7A 2KFKA 2MHJA 1FXIA 3KJQB 3LANA 4TN2A 2OJ3A 4JQWC 1V1PA 1MN9A 3PGEA 1CSJA 3L13A 2MZSA 4I6LB 2W7PA 2AQ4A 4QWDA 3I5AA 1YKWA 4HK2A 1DHMA 4A8QA 4FF1A 4HLEA 3FMWA 1SCJB 2ATCB 5C42B 2HIYA 2M56B 2IC3A 1FIQA 3DC2A 2FY1A 2AGQA 2YNFB 3PREA 3LGNA 3J7AN 3NVWA 1NSKL 1V2YA 4ICVA 4PG6A 2IY0B 1J7AA 1Q4RA 1YIJS 4DSJA 2KX0A 1NEEA 1NSPA 2AYOB 3N9YC 3HHLB 3NY5A 1S48A 3QX1A 4NNJB 2ZE2A 2AT1B 2XBBC 3M6UA 1XNRF 2XLKA 1SE9A 4J3OD 4MGKE 5B0AA 2J7QB 2JX2A 2W55A 2ZEJA 4HT5A 5A76A 2GQCA 1XT9B 4RW8A 4ARIA 3GYNA 4P7IA 3DYAA 1R8CA 1IKYB 4KGMA 1SIWB 1RYJA 1ZKHA 2H1YA 2RUGA 4U67Q 3PFOA 5CHWA 2MQLA 3N1ZC 1U2FA 5IQ6A 3VRBB 1DOXA 2BABA 2Y1IA 2GV1A 2JOQA 1C0TB 3GV7B 2GHPA 2YVSA 4HXDA 3HIZA 1FFWB 4CH7A 4I2QB 2ON8A 3BGRB 2W2OP 1WSPA 2IYIA 2V9KA 3PSEB 5LJ5Y 4NXMJ 4FNIA 1B4SA 1MU2A 2JLFA 4ZIWA 5KFCA 4ITKA 1O0PA 3IGVA 2C7HA 3P5TL 1UGJA 4PQAA 1RI7A 1ESFA 2KO3A 3NZ3A 2DR9A 3NOBA 3GJRB 2P2CB 4LFCJ 3OR2B 4LJOB 5HATA 3ETMA 1IBMJ 2FHJA 2X1GA 2BM0A 1VZ7A 3B2GA 2WDRB 2HHUA 2W4PA 1X60A 5GMVA 3KG4A 8AT1B 4RCOA 1YGYA 2MZQA 1H38A 3EJMA 5JXVA 3H7PA 3T5LA 2NSCA 4CO0A 3H4DA 1IUEA 2D3ZA 2KN4A 4MIAA 3R5BA 1CS4A 1F5AA 3BO3A 3VVWB 1YQ4B 2O67A 1IBKF 2H89B 4HLBA 2UV8G 2XS5A 4USTA 2L9NA 2Z57B 5HSPA 3MPWA 2ADCA 2KFNA 3DOKA 2KYXA 3J7Z5 2R3VA 3K89A 2GAGC 2MKHA 3V6DB 2OMLA 2WVDA 4QIFA 4KGXB 4P73A 2KFZA 1RTDA 1FD2A 3U7DA 4YDDB 2YKMB 4FNHA 4QR0A 1J0GA 4DCPB 3RBDA 3IN5A 2MLYA 5G2NA 3MMBA 2Y3AA 1MG4A 3K2YA 4QBUA 2V68A 4NCBA 4JUZA 3MZIA 2BRKA 1NYRA 3FILA 3WAOA 1WSRA 3EFCA 5G0RA 1SL2A 3POTA 4NOHA 5HVFA 4KHMA 3WIVA 2AU0A 2KM8C 2KACA 1T6BX 2CPXA 3M32A 2BQRA 5JXSA 4MGYE 4YN3B 4L2YA 3NKYA 1UETA 4LIRA 1TKDA 1GXTA 2DNQA 4HTJA 4X66F 2YH1A 3LP0A 1WORA 3HUIA 5HQLA 4M95A 3V62A 1RT4B 3H8YA 5J1PA 2WXMA 3JSVB 2VBZA 1Q0NA 2NUUG 5JVGQ 1FEEA 5AUKA 1RT2B 1H0HB 1VQOS 2WXQA 4L74A 4J9PA 5C24A 1N34J 3RRGA 2JRHA 1L5PA 2N4DA 1L6UA 1V3SA 4OYZA 4OI4A 5A2QY 3VH3B 2MBQA 3OTEA 4DPWA 3MPVA 2I2YA 2WS3B 3P49B 3K0JA 3E56A 1F5CA 1NBFC 3HVTA 4PEOA 4F3OA 4O44A 1RTHB 1R8AA 4HJKA 3MEEB 2HQCA 4O3PA 1Q5VA 1OQQA 2XK5B 4Y2MA 4LRCA 1HHQA 2KYWA 1ZDVA 3DLEB 1NK4A 5DG8A 2ACZB 2ZITA 4DSKA 2J9DA 3EX7B 4QPXA 1LGRA 3FBEA 4F8RA 1JLQB 2O2VA 4GOCA 1N33F 3ZZOA 1CLFA 1NRKA 1STEA 1S1UB 4WYWA 4MKYA 1VC0A 2KVQE 1QKZA 3PY8A 1QF6A 3AE5B 3RR8A 1KS2A 2RDDA 4W9CA 1OYDA 4Y2KA 2WXJA 4D3HA 2OO4A 4US9A 3GV5B 4QZVB 1RAJA 1RU2A 3N4WA 3G71S 4O1NA 4WH4A 2W2PP 4GN1A 2IIHA 3KG0A 1FESA 3N6NA 2VPYB 3FC4A 2XB2D 4IKGA 2MKKA 1S76D 1XMOJ 1UJ6A 5EX0A 4DR1F 4PS8A 3IVFA 2MSED 2QEJC 1VOMA 2KT7A 3R9LA 4DV3J 2IMOA 2GIFA 4QYZK 1E8XA 3FJ2A 1F9HA 4G50A 2XY7A 1QOFA 3Q2AC 3UGBB 2HG4A 4R8UA 4NCGA 2LKZA 2IM3A 2LXFA 4HKZE 3BVGA 2Y5CA 3KWMA 4NLYA 3QJPA 5D6JB 2XMMA 3SV3A 1VQ6S 3TVKA 2MP2B 4W9KA 1RAHB 5DPWA 1S72S 4QU6A 3ZZPA 4LSNB 1UF0A 2JSXA 1AW0A 1BMLC 4C11A 1SL0A 3ITHB 1ZM3A 1QSYA 2VONA 1XBWA 4P2XA 1WGRA 3Q22A 1KQSR 2O6VD 4USKA 4X4QA 1FNXH 4YOEA 1VQPS 4E8UA 3MEDB 3CF6E 3IHPC 2B7BB 2HLTA 3FCHA 2HRTA 2ILYA 3J81j 1B7FA 4P7VA 3MF5A 3V6HA 1B70B 2VF3A 5BYSA 5IXUA 2W7AA 3AA8A 2XMAA 4O0IA 3AEFB 4LUBA 3G8TA 2NYIA 3M1VB 3HXMA 1IBLF 2EMTA 4UQTA 4RZRA 1WGDA 1IBCB 4RUAA 4XTTA 1I5OB 2FCNA 1XWLA 1VQ8S 4JI8F 3KUZA 3NNCA 3G87A 3PLVA 1FTCA 3Q8BA 4HDHA 2LVQA 1IBXB 4DEZA 4MYUA 1U48A 2R4FA 5BMHA 1D09B 1FDNA 1UVMA 4TNOA 1X5PA 2MBOA 2UUBJ 1NDCA 1HBNB 4HRSA 3H5UA 4C80A 2HAFA 1B9RA 2BANA 1S1QB 1S6QB 1HTQA 2SXLA 3WIUA 3VH4B 1N5VA 3G82B 4W9JA 2HNZB 4X4SA 1QVFR 4RBTA 4LQ9A 1UELA 2QHOA 2Z0EB 2R7UA 2GIQA 1RHUB 2K8CA 1U24A 4L75A 2WWZA 1H4RA 1NH8A 5EDWA 3FRYA 2M17A 3N1YC 1TL1A 3ZJUA 3DHXA 4CLFA 4IC7B 3DLJA 2HBQB 4DPTA 4EO6A 3VTWA 3BJYA 2JHEA 1LQ9A 3B4MA 1QUVA 3MD1A 3PIPQ 1KD1T 5KFKA 3T6BA 1LOUA 2BBEA 2R7QA 3MDFA 5KFNA 2EPIA 4Z37A 4IM0A 4LFAF 2BKOA 1FKOB 4JV0A 2R2SA 3PRVA 4ANCA 4OI6A 1SIFA 2KQ4X 2VOOA 2ROEA 3P1MA 3LO3A 4EKUA 1N6QA 1QAXA 1RWPB 4QAYA 3PO5A 2ZPYA 3SCKE 4FPIA 5EX3A 2L8JA 1HD0A 5L9NA 3M2UA 3L16A 4BFRA 1HNIA 1KLMB 3BSAA 4I6WA 2Q6BA 5HG2A 1U8SA 2BVZA 3THTA 2ASJA 1WC3A 3L7OA 3OFGA 1KN6A 2XZTB 1WMHA 3AEDB 3SSSA 1UVJA 3SD5A 4P1CC 4MMOA 1K47A 1JLFB 2YNFA 2RRBA 1X4AA 1TQLA 2AJQA 4A8KA 4DG1B 2FVPA 2MLBA 2RIJA 4DR5F 1V3RA 1KDNA 3HHKA 3MM5A 3BPSP 4ICUA 3HHLA 3DM2B 1M0SA 4XDCA 2COLA 3D3CJ 3D54A 2I1RA 2Q6CA 1D9AA 2DCUB 1K1SA 1XMQF 3UF8A 3AOBA 4IYQA 4IQXA 1SE3A 1U26A 5KFEA 2M5YA 4PWDA 2JYEA 3OTCA 2MQJA 1S1TB 1IKYA 2VPXB 4S0RA 2OP5A 5HQMA 1N62A 2B3AA 1UKUA 5LLIA 2KHCA 4I4BA 3I4HX 2IHR1 4PQUA 1RYRA 1BQMA 3Q8FA 3CJ5A 1SJRA 2RRAA 2G0CA 1T0RC 1SXTA 2LP4A 1C0TA 2VBWA 2GMLA 1I4QA 2UU9F 3DRSA 5DZ7A 4IFVB 3H25A 2W2NP 2HKEA 3ZO5B 4YB7A 4F4YA 4RMAA 5CQGA 4HPMB 1NSQA 3B2FA 5HVGA 3DWMA 3V6CB 1RT1B 4B6WA 5C2CA 5HMWA 2UVVA 2C2KB 3WDOA 4PUOA 2LXCA 4NEZA 3OR2A 1DQ8A 4KFBA 1D1UA 4LF2A 3V3XA 1NDDA 3BF4A 1FE0A 1U1RA 2J0SD 3HVRA 5DZ6A 1SE2A 3TAMB 2IVFB 2NPIA 5A8KB 2WGSA 1FM0D 1M5SA 1RHRB 3V6JA 3PRBA 3A8KA 3W1YA 1I4HA 4HACB 5KOWA 2I0XA 4WJQA 3C3LA 1KFDA 3CD6S 4OYIA 4DWFA 3LYYA 2MZRA 4ZA1A 2BOPA 1IP9A 2KHWB 4H54A 2CR5A 5CYMB 4I7FB 1YRXA 2YWWA 3CCTA 4X62F 5ETVA 3VGTA 3ZNJ1 1V6EA 2K39A 3EGWB 3S01A 3AB5A 3HHNB 3DGPA 3RTVA 3Q2SC 1GOZA 2L7RA 2KVIA 2WSFC 1FRMA 3RW6A 1XEEA 2KDFB 3MCNA 2HZVA 1RISA 3TP2A 1RT7A 1WG1A 1NK8A 4EBDA 3CD0A 3JSRA 1VRUB 4TY8B 2OPQB 3QK0A 1C1YB 4GU2A 4K3BA 2HS0A 5ITHA 2PEBA 5M2UA 2SEBD 4O3NA 1BMQB 4KPCA 2N0SB 1LNQA 5EN1A 3A4SC 2XY5A 5KFHA 4A4JA 5G4DA 2ZWPA 1Q8KA 1UFLA 3GZNI 4ECYA 1BUIC 2IVMA 1EJ7L 4KKOB 2Z2YB 5C25A 1BGXT 2FLLA 3PRPB 1HI8A 1Q81T 1JCKB 3LQVA 3MR6A 4FLHA 2KTRA 1GXUA 4QQBA 4DV5F 4IDIA 1ZBTA 1WTFA 4K4XA 5KFWA 5SUHA 2W82A 2HNDB 3B1LX 2DR6A 5A0YB 1Q10A 1NKEA 1WZ0A 4RW6B 2JEIA 2QE5A 2YPZA 2JC0A 2KKCA 4XYCA 2PTLA 1H6KX 4NXMF 4GO7X 5KFOA 4DOZA 2I38A 4X64J 3JXOA 3DRRA 2NXUA 4ER8A 2QC3A 1SJHD 4M0WB 4X4UA 2M8SA 2CQHA 3ADAC 1F3VA 4LFCF 3WA0A 1UEUA 4MJSA 4YR0A 1FFGB 1IBMF 2JZZA 1N6ZA 2WXPA 3UPFA 3EUB2 4F3QA 2VIHA 3FSYA 3BH7B 4UOFA 1WIAA 3T8MA 2ACYA 5GAEU 1EARA 4LF8J 3WHIA 3JSMB 4ED3A 5CZVA 1LV5A 3CGIA 1SBRA 2REXA 2MZJA 1TL4A 2IGHA 4JYAJ 3MM8B 1T03B 2D41A 1WEYA 1TAUA 3CC2S 2CDQA 2XSJB 2LU2A 4RFBA 2ZH4A 2ZDPA 5J2PA 4MFBA 1OY9A 3TEYA 2G13A 4DN9A 3M8ZA 5GAEI 4BOZB 2M7SA 3OUYB 3T19A 2LQBA 3GFXA 2AHOB 3AEBB 4F4AA 1HQ2A 2E1AA 4OZ5A 3DDNA 4F0MA 3KFWX 3VTVA 1KEKA 2KD0A 3MUVP 4I6AA 4C4VA 1MFWA 4K4YA 5CYQB 2PMWA 2DGSA 1SC3B 4O3OA 2AZ1A 4DDID 1HNVA 1S9FA 5KT4A 3GB0A 4LNIA 4YEAA 1SPBP 1PAUB 3ENVA 3ZUNA 5AJ3J 4TU7A 4CZCA 3RYTA 1KLUD 3RB3A 2MGZA 2JVCA 2HK2A 3C6UB 1LWXA 3VGSA 4X4OA 3UNYA 3EC8A 4TUUA 2XGQA 2NQPA 4W9HA 2DNLA 1KQKA 3MAQA 4K0KJ 1C1CA 2Q66A 2VOPA 3BEGB 3QRQA 1KHWA 1CQMA 4KVGB 2IFXA 4WAFA 2MP2A 2V34A 1TZOA 1HTOA 1NDKA 1S99A 1IKWB 5T41A 4C8MA 1Y9OA 4B9KA 2FY8A 4NASA 5EUHA 2PI4A 4DUZJ 3N0VA 5D8HB 3TUZC 3PW2A 3CW2C 4DF8A 4F04B 3Q8SB 1PSDA 1U0HA 1TS4A 3Q3OC 1JW9D 3IG1A 1QE1A 2LGIA 3SDEA 3GR0A 4AT1B 4LLGM 2ZH6A 5LSRA 1WEZA 1U4BA 1N34F 1NLKL 3TZZA 4YWGG 1F52A 2B5JB 3PLUA 4HEA9 3KNGA 1NJIT 3H7SA 1N4LA 1S12A 3VVUA 4QWEA 1RLCL 3M1VA 3H5XA 4HEA1 2NCNA 3PYDA 2V2QA 2JZPA 2V9HA 1OGWA 2BS2B 4U8YA 1RM6C 4JI0J 4CI0B 5IT0A 2WXGA 1WACA 2RU3A 2KTFA 5DDPC 3NAHA 1KH0A 1K0VA 4RM9A 1IR0A 2LGYA 3IM9A 3UD3P 2YNHB 3AJDA 1E7PB 4WQMA 3R1HA 3I6PA 1OIAA 2FUHB 2D3UA 4WFBQ 4BVUC 2UUCF 5CD4H 2CZVC 2AL6A 2GO9A 1B0TA 2IO1B 1NI3A 2XC9A 4C3LA 2VFTA 5CZXA 3DFEA 1D9FA 1IYFA 1TS2A 1Y5LB 3OL9A 3G6YA 1WM2A 2V4JB 3ICLA 2CVEA 2NZ4A 2R61A 3EE3A 2J42A 2YKPA 2DRBA 1DLOA 2JYTA 1RFKA 2FC9A 4QIVA 4UZBA 1YDLA 2JFDA 3LWLA 2CRLA 5LM7E 5J2MA 4NJ7A 2G4DB 1U6ZA 5IV4A 2NVUI 3MAAB 1OMSA 4DDGD 1HHTP 2I5JA 3PJ9A 4MH0E 4ZPTR 5DPSA 2C22A 4X2BA 5THWA 2IJRA 2IA0A 4RO0A 1WXVA 3KOAA 2JQRB 1HNWJ 5AT1B 2M70A 4LNNA 4A20A 4ECSA 1SJ3P 1U45A 3IFWB 4ECZA 2MJEA 2N1VA 1WY8A 1YVFA 1NJYA 1SL1A 3QT5A 1C79A 1P0RA 4LF1A 3FEYB 3W65A 2IAJB 3AE6B 3SEOA 3NGDA 1R8HA 5IT9Y 3WQPA 2BYCA 1X31C 1WR1A 1N5SA 1Q8BA 2E44A 3SQOP 4K7QA 2FZKB 5HMXA 3KLIB 3W5XA 2E5LJ 5E3CA 2BM1A 3W60A 4B9UA 2HMIA 4B95A 5AUIA 3GS2A 1NZ8A 2W9BA 3MMCB 3BVMA 4BWMA 4PXCA 4EZ6A 5U47A 2DO0A 2JVOA 4YQWA 2YEPB 4Q2LA 1YK9A 1TMJA 3NEKA 1MJDA 2AKWB 1UFKA 1X0FA 2ZC4A 2JXXA 2GS8A 1WJ9A 2R8KA 1V81A 2DHZA 3CCVS 4US8A 2KU7A 4DSEA 3D66A 2EKYA 1HPZB 1B7YB 1FCCC 2YKOA 4IM3A 3FZ2A 3RNEC 2FGCA 2MRPA 3GG1A 3NZSA 2GJ2A 2ZBCA 4TYBA 2UUBF 1WX7A 4DR7J 4LMZA 4QWBA 3CSTA 3OQ2A 2QN6B 2QMXA 1AN8A 3QWUA 1L7YA 3HSJA 1CJKA 3W2DA 3EDRB 3ZFVA 1V5VA 2BE9B 3DBLB 2KRRA 3A13A 4BOSC 3W61A 2BYTA 1SKRA 3JTOA 5KFPA 2CPZA 1TKYA 2BJ1A 3SFEB 4P72A 4NLRA 4LF6J 2MQOA 5IWAF 1RT1A 3AD8C 3V81B 2CG4A 1JWWA 5GAGU 2HQDA 2BW2A 4USWA 1IKXA 2KLCA 5HBMB 4KTQA 2GVDB 1QLNA 2H5IB 2FJXA 2K1RB 1NUEA 3OTBA 1NO8A 2WHIA 5HFYA 3JVZX 1VQ4S 3MC0B 4DS4A 2YNIA 4EO8A 1LQBA 1HWIA 2B4VA 4IH7A 3PHTA 5GAGI 2INPE 1XERA 2PLPA 3HRDD 1VC5A 4W9DA 1GNKA 5F8MA 4M8MA 2K06A 2B6AB 3LAKA 3VUYA 3P4QB 4N5SA 3DMJB 2J52A 1VC6A 2OPSB 1ZAVA 1FX4A 1J5EF 1KOTA 1ET9A 3MCSA 5J1NA 2WVCA 3TEXA 2E1PA 4UY8T 1PQSA 1HQUA 4FS1A 1RT3A 1C4CA 1RHJB 1XEZA 3HSDA 1IN0A 3OHAA 4YSXB 3DCAA 5ETMA 3BGUA 3TAQA 3IS9A 1D4BA 3HULA 4NAWB 2WVBA 3NOGA 1IGDA 4KX6B 2G9HD 3OXGA 5GVQA 2HHQA 4B9MA 4N58A 3GYXB 1WJNA 1EF5A 4X57B 3L09A 4B02A 1RWUA 4HL9A 2XYGB 4WP9A 5DDOC 3DDCB 4F7VA 3A1QB 2QA4G 4ZJOA 1QUPA 1Y3KA 2J0KA 2LGDA 2IY5B 2LA6A 1OY6A 1VRTA 3ML9A 1RHKB 3GJTB 5H8YE 2ABYA 4BKSA 4XWWA 3APFA 4ITSA 4EBCA 5G5GA 2IO2B 1RWKB 1QILA 2PGCA 2AIRB 4N8NA 2C3PA 1KHVA 5D0HA 2VG6B 2OEKA 3WC0A 2MB0B 1T95A 5D4NA 2KDMA 2AEJA 3P6YC 1L5UA 3ZVVA 2YBVA 3TIXA 2FBWB 2O3DA 2CPFA 2CJYB 3GWCA 5AXKA 3W7BA 2MHEA 4BCAA 3BO2A 3IBWA 1TFYA 2M0GB 2BKPA 3U30A 4NQLB 2K7JA 1DAXA 3ILIA 5JUMA 3RNCC 1ZGUB 2XCPA 1MG8A 4YT0B 1V3ZA 2F8EX 1E8YA 3U7ZA 3BSOA 3MM9A 3RULA 1XJWB 3FMBA 3QAEA 4MEMA 4YP3A 4ZP6A 2JL9A 3KXDA 4MM3B 3RUIB 3M8PA 3DRPA 2R2TA 3CJKA 1L0XB 4CTAB 1H2UX 1AZSA 1TV6A 1FD6A 3Q0AA 4MK7A 3VHQA 2RDGA 2BV3A 4CQ1A 4DCJB 2DYMA 2KQ7A 2XSJA 3M9NB 2DHHA 3NGRA 2ASYA 1WXMA 3DN9A 2QA4S 3DQVA 4USMA 3QNWB 4H4OB 3CC4S 2HQIA 1OSDA 4NI2B 2IJNA 2L1AA 1EETB 3AAWB 3DI6A 2MA9B 1J5OB 1S4EA 3CJ3A 3N79A 4ED2A 5GMDA 3GZ7A 3C14A 5F9NA 4XDDA 4ZVOB 3H7HB 1CPZA 2B4UA 4FS2A 3CWIA 4X4RA 4USUA 1WXSA 2L0TA 2QLWA 1ZTTA 4DHJD 4MDKE 3DBSA 2DZJA 3TO8A 2JWZA 1NXIA 3SR6A 2WBRA 4LVNP 5I3UB 1VI7A 1C4PA 3QYYA 2LD9A 3KK3B 2VZ9A 2BYEA 2ZKTA 4B3RF 5DLFA 1GH8A 2GB1A 3CSFA 2R7SA 4F8CB 3KKFA 4FYVB 3AE1B 1Q5YA 1V6HA 5E3PA 2HGNA 2DLBA 2OOBB 2P6TA 1KTKA 2BWES 2XWYA 3QIPA 1MROA 1R8BA 1WKJA 1H72C 2DBBA 3CCES 2BR0A 3OXFA 3QLHA 1HYSB 4FYDA 3OW2R 4OHXA 3KTQA 1FTRA 2XS7A 2JWNA 2Y8YA 1GMVA 4H2AA 4X64F 2CQPA 3DLKB 2HPUA 3R3MA 2RS8A 1PCAA 2LI5A 1ZZFA 2N9KA 3P2BA 2RVJA 2C3OA 1FFSB 3PYEA 3TRGA 2UUAJ 2YY3A 3OLAA 3H4BA 4ZVSB 4OW0A 1BC6A 5L8RC 4GSWA 4HKQA 2RKIA 1HMVB 2ALYB 2BJ3A 3ZZZA 2ZC3A 5A8WB 2EMSA 2W3RA 1J2VA 3IFEA 4USJC 2B76B 2CQ3A 1NPKA 3M2VB 2XHWA 3SSRA 2QSDA 4JI1J 4UQGA 1WSVA 1U47A 4USVA 1NKBA 2J76E 4DL5A 1YX6B 2BKFA 3TVYA 1I3OB 2WXNA 2BWFA 1HBOA 4TQ1A 5TR5A 4JYAF 4KKIA 3SBMA 2B0GA 3CNQP 4GRSA 1NVID 2KMAA 3PG9A 4GGQA 2AQ1B 3NG8A 2RR9A 3UVJB 2GBNA 3QIJA 3M2RB 3H2UB 3FBFA 4N41A 2BKNA 1WGKA 2BACA 3L7UA 4CO7A 3BN7A 1KJTA 2KVRA 1CK1A 2R7RA 2CJ9A 3SHQA 3HP6A 2R42A 5E2QA 2ZJDA 3PW5A 3ZNID 3DHWC 1RAOA 2AX0A 4FHKA 4DMZA 2QJLA 5KT2A 1YJWS 5KHQA 2FJDB 2MJNA 3AB4B 1D3ZA 1ZE3D 2YNGB 4DR6J 2ONQA 5AZFA 2QRRA 3F41A 3TUIC 2E66A 1NBEB 3BV8A 3DLLQ 4Q7AA 2QLXA 1M4VA 1HQEA 3CTRA 3QIDA 3LW5C 3GIIA 3C46A 4ETXA 1T0QC 5CHCB 1HR0J 2RDJA 4ANXA 4YR3A 2AGPA 3ZXWA 5DRKA 3SQGA 2GA7A 3UCGA 2CDRB 3EFUA 1G6BA 2R8GA 5K8MA 2KMMA 2M8HA 2JC1A 1CBKA 2A3JA 3AU4A 3LP2A 5IC4B 1VQNS 2VBXA 3LPEA 3O3LA 4O0NA 1F1HA 1FKPB 4G1QA 5LT5A 3QT8A 4DUZF 4GC6A 1YMHE 1EIYB 5E0OA 3K5LA 3IM8A 4ALZA 2J0QD 4OYXA 1V1OA 5GMEA 2NCKL 4PXEA 5CYJA 3NXZA 1P98A 2VG5A 1HBMB 1L6VA 4S17A 3S7RA 3RGIA 5KG0A 1Q78A 1TKTB 3NCPA 2FJEB 3UNGC 2YTCA 1NI2A 2JRSA 1KM7A 3R5GA 2LGSA 2FHJD 4QYRA 1X9WA 2BJEA 1KWMA 3EHVA 4MAKA 4W98A 1D0EA 2E1RA 2GHWA 4M5JA 4JI0F 4GDLB 3W9IA 5LMNJ 1F0XA 2BYFA 1FO1A 2HGLA 3MEGB 3CCJS 3UQSA 2HW3A 5LXIB 2BKRB 4RL1A 1GC7A 5HROB 1WTBA 1GFWB 3N3KB 5F8HA 2FVSA 4ZITA 1SJQA 4ZPBA 4A8MP 3OR1A 3LPYA 1XC9A 1VBYA 1TKXB 2JU6X 1N36F 1KFSA 1U09A 3Q23A 3GSDA 3PRMB 2H3EB 2BGFA 4IG0B 2ZHAA 1YITS 1LFWA 1RWVB 2ZW0A 4CO4A 4W92B 3V6EB 3B82A 3MGJA 4NLPA 5ETNA 5RUBA 1HNZJ 4PK1A 2ASQA 2MZ1A 3OT9A 3J7YU 4BC7A 3KLHB 3UI3A 4IR9A 2HYIB 5IAAC 4ED6A 1R89A 4OMFG 3V81A 5IT9U 2J0WA 4NA2A 3OSNA 3JQKA 2HWIA 1TL7A 2QGFB 4KV8B 4ZPVR 4KDLB 1Q86T 3EMTA 2FGOA 3J7YI 3D6TB 4ZPDA 3ZLZA 3TZYA 4JP8A 5K8NA 4D2KA 3BH6B 4P6QA 2Z0DB 1FWLA 2RF2A 1S79A 1HNWF 4PYUA 3OD2A 1PJ7A 1VQMS 2XG8A 3I57A 1YJRA 1W26A 4J9UE 2NMQA 3KYCD 3CD5A 4JIOU 2W4DA 5HP1A 3RW7A 3LB8C 3DMJA 2OPSA 5KFAA 2EW9A 4OV6A 4HHHA 3JB9k 4HCPB 3V61A 4BAXA 5F3ZA 1LWCB 5E6PA 3I9V9 2HNYB 3PPAA 2HEKA 2UXCF 3QO9A 5IS2A 3KQ4A 2HLUA 3IT4B 3OJUA 3EPIA 3L4BC 1FNWA 1SVDA 2X3GA 2ILZA 2AJ2A 3KK2A 1VK3A 1LWFB 1NPPA 1WF9A 4DV6J 4X4NA 2DYOA 2KANA 3PX4A 2MLZA 4ECXA 1DRZA 4IFYB 4LVOP 2HHHJ 2KJVA 3DBRB 3I5CA 3X0WA 5A8RB 4H4KC 3N28A 2AEMA 4ANEA 1T11A 3NHEB 1YJIA 4K4TA 4DL2A 2LJIA 4YL8A 2PW9A 1LFDA 1A5RA 4TLQA 3F0NA 1UWBB 1DGJA 3C19A 3NG0A 2N7CA 2IM2A 4LREA 2EWHA 2APOA 2FLPA 1QSSA 1WOOA 3A9KB 1CG2A 5IOLA 4RR5A 4JGHB 4NA3A 4F0HA 2JVRA 2UUTA 1IQZA 1YHQS 4GO5X 2ZVNA 5DQHA 3PZDA 1JLGB 2V8PA 2B9WA 1JALA 4KGTA 1UZXB 1ET6A 2A6MA 1T9UA 1CJTA 1TS3A 3A4TA 1HZ6A 1T9XA 4PG4A 1FNVA 4NYPA 4KO0A 4R5PB 3A8JA 3W62A 2LVWA 1RP5A 5IM0B 1TL3B 4IDKA 3BINA 2O6VB 3AE2B 4ZVTB 3UR0A 4LF6F 3FGVA 5KG6A 1JLCA 4QIWD 3NBPB 3GV8B 5KFQA 2A5UA 2V2VA 5J1EB 3MP9A 2ASLA 3ZXVA 2NXNA 2ZBPA 5JMNA 1FNMA 3SYZA 5D3GA 3HF5A 1HI0P 1BWVA 1RZMA 2VH1A 2Z56B 2DHAA 3NS8A 4AJYB 4QIEA 1TUVA 1FCLA 1FMAD 3M8QB 1E6EB 1FK9A 3W8PA 4MM3A 1WHYA 2G9OA 4KDIC 2EFPA 5DO2A 1DTQA 3AULA 1RT6B 3KHHA 2KWUB 1BHNA 3D68A 1FRXA 4HDOA 3LA0A 2RQCA 3NS6A 3VDZA 4WU2A 4WFZA 2HVDA 5MAOA 1CQNA 3MMAA 3MCOA 4ES3A 5HQ8A 4NA1A 2E1CA 2LXAA 4C2MA 1YJVA 1S1VB 5F8LA 2G0IA 4ZVUB 3PS6A 5KT5A 4MH8A 4TMAB 4LIWA 2GCFA 3TA0A 4KPYA 2VU5A 2RNEA 2P9EA 1YLXA 1U1NA 1U1LA 4A8YA 4ECQA 1IVZA 3GONA 4TKNA 1E0ZA 4WFYA 1SBBB 1SJFA 3W3SA 2MDAA 3ZIMA 5DG7A 2CU3A 1WRDB 2FPHX 3MJWA 3PFEA 4KGSA 1SKWA 4AUKA 4OX8A 2C60A 3FBBA 3H98A 5AE1A 3GCXP 2FTRA 1IKVA 1OQRA 4JOUA 3KLEB 4PT5A 2YX7A 3T3FA 3UCUP 2G1HA 4FF2A 1V5TA 4YSZB 5I42B 3KYLA 3FQLA 1EP4A 3MM7A 4MK8A 1U6FA 2H65B 4ZPCA 1PDXA 5HANA 5AXMA 2NLWA 3ZZYA 4YTMB 3P4PB 3E01A 1UMJA 1EKSA 2ZZMA 3A4RA 4RW9A 2Q1LA 2VD3A 1SEBD 4URSA 1SQGA 2QSFA 4FJYA 2LEKA 3QSIA 4KKJA 1I4XA 4HYKA 4M5IA 2KHDA 5FLXY 1HMVA 1HIYA 2DITA 1XD3B 3ZKJC 2J8AA 1REVB 3Q8RB 3W2WB 4ZS6A 3M2VA 2XS2A 3TUJC 3PZPA 1WRIA 4BS2A 4I69A 3JS9A 1RGVA 2LHDA 3VAGA 3RUBL 3FK4A 1ZPSA 4OI1A 1N56A 3IBFB 3T9ZA 2XO7A 3D1QA 3ELHA 1WR6E 3FUYA 4W4MA 2OH2A 1BQNB 4Q2MA 4M5DA 3W63A 4NAMA 3EZOA 5LXYA 4NX9A 4DU8A 1EO6A 2CU1A 4Q45A 4X4TA 5KHOA 4OV1A 1Q1KA 4PG7A 4YY3J 5KFMA 4WWPA 3G96A 1DQ9A 3L54A 2KJRA 2P9CA 2V69A 4IG3A 2B7CB 4X66J 1R6YA 3PIOQ 1F60B 3QSYB 1SUQB 2UXDJ 4KZCA 1L3VA 1OFFA 1RBLA 2W2QP 4M94A 1CULA 3DLGA 2FIUA 2ZVOA 4RBVA 2A2DA 2N7YA 3AE3B 1S3SG 4KRWA 3RAQA 2X1BA 1TY0A 3TX8A 5BMGA 2E5GA 4B17A 2EG1A 1E6VB 2K2PA 4KGVB 2V3SA 4OZ3A 2G45B 2ZD1B 1PFDA 1QLBB 3UIOB 2PT0A 5J2NA 2OAUA 3M30A 3HVWA 3K59A 2BQ3A 2UXBF 1XLNA 4FXCA 1S1XB 2Y9HA 5KG3A 1SC4B 4C7QA 3TUPA 2GGPB 1VIOA 5C7PA 1PAEX 2Z2MA 4W90B 1OSCA 1WHXA 4GB9A 2L76A 3VRAB 3SIPB 2FCSA 3AXMA 1VLOA 4HI2A 4N76A 2H88B 3IXQA 2RD5C 4ED1A 1KP6A 1N33J 3IR7B 2N3OA 6FD1A 3MC8A 2D74B 4OI2A 4PS3A 2IBIB 2LMIA 2QL7B 2KKHA 2UUAF 2HHSA 3BVZA 1RADB 8ATCB 4JX1C 5TSSA 1YSJA 4YB1P 1Q8IA 2V4RA 5CH7B 2OEMA 1FDBA 3OFFA 2AD9A 4JI1F 1X4EA 2AW0A 2WU5B 1JLBB 4WE1B 1XQIA 2ZUGA 3MM6B 1WF2A 2IRYA 1I35A 1ZDXA 1MSWD 2BE2B 3QARA 2ZW1A 1SF0A 5GMKa 1T94A 1WELA 5D78A 1CC8A 2DHXA 4WXOA 2N7DA 2XWXA 3C6TA 2RPVA 1JLEB 4CM0A 1VQ9S 3MUMP 5IT4A 1YQHA 1KQGB 2J53A 4Y65A 1C76A 1YBTA 2SAKA 1V9JA 1A7GE 1VYAA 2WDQB 4C7ZA 4ZOSA 4JB8B 4WWSA 3K9OB 1X9MA 3O1LA 4P1BC 1QAIA 2RILA 3QQCD 1WWTA 2F65A 2XULA 5BXIA 4ICLB 2B8QA 2DHGA 2C3MA 3MD3A 4OQJA 4DQIA 3VUXA 4DL6A 5HLFB 4IH6A 2DXDA 3ULHA 3KLHA 2OPRA 2RU9A 4G3XB 2K22A 3RNGC 3EZUA 4J9RA 4GVLA 1OTRB 1S4FA 1UW4A 3KW5B 3O8WA 4LCDE 6FDRA 1VBXA 5D15A 2GMJA 2G4BA 1QAJA 4J7CA 2QYGA 1VQ7S 3OJ4B 3AD9C 4D3GA 4DXLA 3GQCA 3DOMA 2AYEA 2MYFA 4F02A 4JI8J 5HL7Q 2W9CB 1BD6A 1BXNA 1TK5A 1XLQA 3SZ2A 3B78A 2Q3PA 4OYMA 3W66A 3I96A 4RGMA 4G3IA 3U52E 3AQPA 2GO8A 3C15B 3BIID 5HJYA 2HIQA 3AA9A 4Q5VA 3HD1A 3K8WA 3HX9A 4KIKB 2MCNB 4K4UA 3H90A 1N48A 1GAOA 4OHZA 3DHHC 2XEWA 2YVCA 2YKNA 4OZNA 4OHYA 3KDNA 4OX7A 4ZK7M 1TELA 2E3TA 4DPUA 3QJJA 1WXQA 3CPWR 4GDKB 5LMNF 1RKJA 2BEFA 3N01A 1UVKA 2IBKA 3I56S 3HM9A 1WC1A 1BLUA 4YHHF 1FNUA 1B99A 2OGUA 2IPKD 4KIAA 3T9LA 3LGHA 3I0RB 3CDWA 3FCWA 1QD1A 2BJ7A 5JJBA 5D2MB 1AARA 1K50A 5JVHQ 1UBIA 1RUSA 3UQAA 2DGXA 1RE1B 2CQIA 2BQQA 1WUUA 3FC9A 3NVVA 3U27A 4HCNB 1JLGA 1W2BR 1FE4A 3LJ3A 5IP4D 2DGWA 1EQ0A 3UDVA 4FA6A 3RFZB 2E5JA 4R5PA 2FLNA 2FIFA 4J9QA 4ECRA 2R7TA 1EX8A 3C66A 2JH3A 3MTNB 1C78A 1T0TV 3AH6A 4HDGA 1OQYA 2EELA 3LP1B 4OZLA 1LWEA 5KFVA 4DR5J 1FWKA 3TQ1A 3ZZUA 1AROP 4MJKA 3BBBA 3NLCA 4LBHA 1JROA 3MOZA 4KSKC 2KX3A 3B08A 1NCLA 3KJVA 1G3OA 3I55S 2IJ0A 3UN5A 2WXKA 1S1WA 3R5CA 1TMMA 4PPDA 3M8QA 3BQ1A 2LHEA 4LNKA 1O51A 4WBFA 3VWSA 2LFIA 5KFXA 2KG1A 4LBIA 4A8WA 3T1YF 1XMQJ 1B64A 1MMDA 3MJ5A 5EE1A 1L3UA 2UU7A 4LR8A 2ZZPB 3X3UA 3JSYA 4DI6A 4DPXA 2XNQA 5L83A 2J0XA 4G1PA 2DEIA 3BYTB 4O23A 3PRDA 3PR5B 2GVZB 3GG0A 4CLWA 2KZMA 4CLLA 2HJ8A 4NRTA 1S1VA 3TX0A 4IUFA 1D5ZC 2AYMA 2CQ0A 3KK1B 5L38A 4FXWA 2ZVSA 2PDAA 2IY1B 2PE9A 3VHTC 3BM7A 1QTMA 3UE2A 4UT4A 3NWRA 4LSLB 1JMTA 3I0SA 2R9LA 4DL4A 4C9DA 1TY2A 1VR9A 4CYUA 3PR4A 4RLEA 4ZHRB 3MOJB 1XIQA 2W9AA 2XCAA 1F9JA 3T1HF 3OG5A 2YKAA 2V1YA 2OUGA 4RWWA 1L0VB 1RA6A 4N59A 3A9JB 1JKHB 4M5MA 2HFVA 2KT2A 2L08A 4B3TF 2DKOB 3MTKA 2HVHA 1JJHA 1Q1OA 2GBJA 2CPIA 5T7LB 3N5FA 4ZLJA 1KQFB 5B0DA 3QGHA 2ZH3A 1DURA 1DQAA 2UP1A 4DBGA 1Q16B 3PRZA 2HHXA 2OI2A 4Q0BB 4F4ZA 1X7VA 5DDRC 1LKZA 2BXJA 3PDNA 4F2SA 1T7PA 2DY9A 4X62J 3IA0A 2NTSA 3W5YA 1WGGA 2A2CA 4YUDA 3UN2A 2GX8A 1HWKA 1AT1B 1RBAA 2KZZA 2CNNB 1E6YB 4PXDA 2EFGA 2CQ2A 4DL3A 1HBUA 1UTAA 3PTWA 2OTLS 3KYDD 4UZCA 4ZOHC 2W25A 3V4IA 1UCNA 2CYYA 3Q8VA 3A1YG 2YWFA 3KJNB 2NPTA 3EGRA 3DOLA 1G1XA 4QWAA 3R5AA 1Y8RC 3EA6A 2E9TA 3Q86A 3SMZA 1U2RA 3PHEA 3BS9A 2R8JA 1SQFA 5MPOA 3UD5A 4M8NA 4CLYA 3PJXA 4OYOA 2MKYA 1UWXA 1WG4A 3D9BA 5L1IA 4XPEA 5CCLA 3CEDA 3OHBA 1NDLA 3ZTDA 1F3FA 2FHOB 3E51A 4NJ6A 5LXRA 4DV5J 2DPIA 3D2WA 3GR1A 4GVBB 3M8RA 2CPHA 4ELUA 4O3SA 1Z2MA 4RW7A 2CJXB 2M1MA 2N82B 1RU1A 2VKRA 1RTIB 3WIMA 3EICA 3P4SB 2ZBIA 2WX0A 1DTTB 2VB6A 1TKGA 5C1ZA 2QL9B 1ULRA 4QR1A 3W64A 3I32A 2Y1RI 1RAIB 2DH7A 3U4EG 4KC5A 4DQPA 5KG5A 1BY9A 4WK3A 2ZBQA 2ZH1A 2EKNA 3CT9A 4P16A 2MPUA 1NK6A 1HE8A 4GMVA 5IZHA 4HTIA 4WYLA 4IOBA 4IOAQ 5CABA 1S1XA 2IDEA 5M2RA 1UGMA 2J6TA 1N5YA 3CIMA 3HVZA 4ZLPA 1NPRA 4EZKA 1SKUB 4RH6A 3VAMA 3CCZA 3RT3B 1DARA 3PVXA 1WJUA 4CT8A 3D6HB 5HMYA 1WDTA 2EFQA 2AMCB 3GMGA 2K3KA 4ZVQB 4RW4B 1YQ3B 2GI9A 3TVZA 1H8CA 1VJQA 4FVMA 1SE4A 1FVSA 1S57A 3M62B 2EK1A 1JMLA 3R2IA 2JRIB 3TCAA 4OX6A 4TQ0A 1XCQL 2WYQA 3NCQA 2KZRA 3ZTPA 3ZNZB 1YN5A 4FXDA 3IAM9 4EEWA 1JRUA 1UEKA 3Q8EA 1M90T 4CO1A 4HI1A 3M63B 1SIJA 1YX5B 5KFDA 5LSLA 3VUWA 3VFKA 3G9CA 2GBMA 3OJSA 1GAQB 2CQGA 1CMXB 1QDUB 2KXNB 3DVGY 5LMUJ 1PGXA 2WSEC 5BYRA 3R5DA 1SGHA 3FKYA 4DU7A 1R4MB 3W1SA 2DR8A 2KTQA 3LXFA 4M01A 5CXTA 3HDSA 4YY3F 3TEGA 1VK8A 2IZVB 1F2HA 1U7LA 2XZWA 3Q2TC 3VTUA 3HJVA 2EKEC 1HA5A 5D0EA 2HHTA 2UXDF 4CP5A 4ZRKA 2ZZNA 2RQ4A 1IJEB 2ZFHA 4ICLA 1D6EC 2XBPA 1HLWA 3W1YC 2DVIA 2XYHB 5H9EJ 3D0HE 4ZVPB 1P8GA 1OEYA 3J9CA 4ZVEA 2OTJS 5IN7A 4NEYA 1N60A 1TUWA 2DAJA 1HFEL 2DT9A 3C16A 1KF6B 5CHFA 2J8SA 3PO0A 1TKZA 2K0PA 3IT6B 4NLDA 1NEKB 4N8OA 4C98A 2O66A 5KFTA 3PYFA 1R6VA 2V6AA 3I9ZA 1P7FA 1PO6A 3CXCR 1WH3A 4WQOB 1K0TA 4IW0A 4WKYA 4OYWA 1N61A 1LW0B 2IRXA 5KFZA 1ICEB 3RBEA 1HXYD 2LZ6A 3L95X 1N5TA 2KXHA 3Q8YA 3OJ3A 4B0MA 3MHZA 1C1BB 3H20A 3T1AA 2N7EA 3CIZA 4OYPA 2WK4A 3KWVA 4BLGA 3R7BB 4FKYA 4KHPJ 2MY8A 4PS7A 4X4PA 2VFUA 3AM9A 3JYTA 2RPQA 4WCEQ 1SI9A 1WOPA 4MTPA 2UUCJ 2RD0A 2MTLA 4I56A 5GADU 5ETQA 1D8ZA 2DGUA 2E9RX 4Y28C 3W9HA 4BBNF 2HS4A 3HFVA 4Q44A 4URQU 1SV5B 2I1JA 3NMRA 3VAHA 4RNMA 2QILA 4DFJA 3EXYA 1CJUA 1GX6A 3KLFB 1JLAA 5GADI 4TVAB 1UL3A 4DHJB 4M1KA 3J7A1 1NENB 3TSSA 3DVNV 3NL0A 2QJ3A 4B3OB 4DL0C 3O44A 1FRIA 4PXBA 3ZC4A 2DR5A 2UV8A 2XMKA 4ES2A 1C0UA 4EZ9A 4NYOA 2HVIA 5D0GA 2V5HG 2VG7B 2MH7A 2GNKA 1C77A 1VBZA 3PV8A 1J27A 2GFFA 3GYGA 2CWKA 2J6SA 2DRAA 1UA0A 1M1HA 2VL1A 1LW2B 1JQGA 2P6SA 2PA3A 1RAGB 1B1ZA 2N3LA 1A70A 4KZ0A 4IRCA 1FI4A 1S10A 2XLJA 1TVRA 4A8OA 1FXLA 2DNGA 2WOMB 3CD7A 4NZ0A 2XMJA 2QT7A 2AJ0A 3AFGA 1RYSA 2QMUB 2R7XA 2G2OA 3E2EA 1MLAA 4HPLB 1R31A 4C8ZA 3FFIB 5FDLA 1N0VC 2BA9A 3GE3C 1VLBA 3FCVA 3RBXA 4JV2A 3PW4A 5F0WA 2MQ8A 5ETRA 2EFVA 2UWQA 1GMUA 2FZGB 4E98A 3LGMA 3HT3A 4NLSA 1RHQB 2BB6A 2OPPB 2KFKB 2N9EB 4J90A 3BYYB 3ET6B 3ZRCA 2QFJA 1YJNS 2DHSA 1I1GA 1V1PB 4Q43A 4ASWC 4ETZA 1X4CA 2HHPA 3VAWA 4K4ZA 2IC3B 4TV3A 3Q3FA 4B0EA 2H5EA 5EWGA 1D9DA 3BSNA 2KAJA 2B9EA 5GXGB 3UR3C 4NPOA 1V97A 1FDAA 3V5RA 5IWAJ 2RDHA 3US5A 1WGHA 4J9KA 4FP9A 2JWUA 3RRHA 1OPZA 4LR9A 2ZE2B 3ZZTA 3ZGZA 4N6EB 3A33B 1T02A 2DR7A 3AXKA 4ID8A 2K8HA 1JQ4A 4KH1B 2LFVA 4RW8B 1X4FA 1AUSL 2GQQA 4F2RA 2HTME 1PGAA 2ZOMA 2LUEA 3GIRA 3QZ7A 3AECB 2CXEA 2YLMA 1GQEA 3EVWA 1TR0A 5EWFA 3AT1B 3QA8A 2V0NA 1MN7A 5HI7A 4MELA 2HDEA 1FPYA 3BZQA 3TA1A 1FFUA 1VRQC 3D1OA 3MPUB 4I0WA 2UVRA 4QOTA 1X0PA 4RUBA 2GC8A 5C42A 1J5EJ 4RGNA 3KMSA 1E6YA 2HFUA 1DZ5A 3OVAA 4WK1A 4WFNQ 2CJAA 4B9SA 1AUDA 3PEJA 4BBYA 2NBWB 4LNFA 2EG2A 3VALA 5C23A 1SXLA 2JLGA 3WAPA 3WC2A 2AJ1A 1W2IA 3BN4A 1AXQA 2GLSA 3LF0A 1N52B 4I6NB 2VFVA 2MY7A 2BE7D 2WONB 2M2BA 2N4FA 3PHXB 4FF4A 3IR5B 1TUGB 3UWTA 4DX8H 3HO1A 3BKTA 4EZJA 3T5HA 3EGZA 3VR8B 3MC9A 2XI3A 1E5WA 1PJ5A 2LQJA 1GC6A 3H2VE 2NXEA 3QGIA 3TQEA 1DY3A 3H7PB 3NVYA 2HRYA 4X4VA 1F5BA 1IPGA 1RJJA 2Z8LA 4IG7B 3QHTA 1NH7A 1AFJA 1V49A 1CS4B 4F4WA 5F9LA 4BWJA 2I1KA 1Z2LA 2OSQA 4I2QA 3BGRA 1FT8A 4X65F 3DOKB 4WJPA 4DS5A 3K17A 3FDSA 5FJ4A 1QSLA 3BSCA 4ZHPA 4PYDA 1U8WA 4WIPA 2BF8B 3GJSB 2JZ5A 1RTDB 4WWOA 1X4BA 2LVOA 2CNKB 2W24A 4K2XA 2PPHA 1EF1A 3BGOP 2WXHA 2H51B 4ED0A 2OD4A 1WFYA 3MMBB 3QZ8A 1GB1A 3IWXA 1AW7A 1T3NA 2KN5A 2WTFA 4EFOA 1IM6A 4Q2JA 3A3OB 2G0JA 1WI0A 3U02A 3P45B 4A55A 3NWGA 3A3PB 2BMBA 3FILB 2E7VA 4F3MA 1TK0A 3POTB 3AMZA 4RUHA 3CCUS 1AWDA 4KH0B 2CHXA 4XZ4A 2KI2A 2HQ3A 2MQPA 1OJ4A 1D5XC 3T5JA 2RRNA 4ZJQA 3R7SB 2C2EA 3TEWA 4ZIVA 3P63A 3CUNA 5D4PA 1Q53A 3HHDA 3LP0B 1PGBA 3HFZB 5B7WA 3DHGC 1HWJA 2HAIA 2W8LA 1SQEA 4PWUA 3TUOA 2O01C 3ZTOA 3G2XA 4DHZE 1NU4A 3V6DA 3K9PB 2A0FB 3DBHI 2K25A 3TJAA 4Y2AA 5KT7A 3DU6A 3U1LA 3ZJVA 2CJQA 4AXJA 1Z2ZA 3E8OA 5C24B 2YKMA 2M19A 2MKCA 3CCRS 3GIMA 4TU9A 1MHXA 4XAKA 2DXEA 3ZJTA 1H2TZ 1Y56A 4AOFA 2MJ3A 2KC1A 1JB0C 1C9FA 2PE8A 2DYBA 2HD5B 2WB1D 2OMOA 3AOCA 3HVTB 5IO9A 3FRZA 3N5BA 3H0PA 8RUCA 4O44B 2IO0B 1SKSA 3I4PA 1QZEA 4B3RJ 3TAPA 2DNZA 3BGFA 1A9NB 3PHWB 1PBUA 1RXOB 2IGDA 2AJ4A 3GSIA 5KFSA 1Y3JA 2VRRB 2O2VB 5AXLA 4DV0F 4CT9A 1UNSA 4DZ6A 3APCA 1ZETA 2BW7A 4RJVA 1HHSA 3DU5A 3FEZA 1RT4A 3QT6A 4TXSA 2ZNZA 3JSVA 3CSKA 1B3TA 3MR3A 1RHMB 5FKAC 4C0BA 1WM3A 4XIUA 3RCZA 2M4NA 2Y5BB 1S0MA 1RT2A 3VF0B 3HK2A 4MGZE 3VR1A 2BUNA 3P5BP 1URNA 1S7IA 3SI8A 1VQKS 3BO4A 4FBJB 3GFYA 1BQXA 3SXLA 1LM8B 2WVFA 2VJUA 2KT3A 3M95A 3OL8A 4II3B 4FF3A 3D7SB 3UFCX 4R8UB 4LF5J 4NCGB 1S59A 3T6JA 3JW0X 1RTHA 1VD2A 5IFMA 5DETA 3NNHA 4LF7J 1BXTA 3MEEA 1UJ4A 4MYTA 2XK5A 2AEHA 2FE8A 3F73A 3DLEA 2HGMA 2WXRA 4ZHOA 2C9WB 4C11B 2HE7A 5H1SV 1OWXA 1JLQA 3O65B 1CVJA 1KLGD 3SSQA 1S1UA 4BDPA 2IO3B 3Q69A 1SH0A 2GW8A 3DBLI 2LWPA 1FRRA 4I1TA 3DWGC 1I4RA 2YQ3A 3WCQA 1ENFA 2I9SA 3SV4A 4C48A 4MK9A 3AHPA 3ZNUA 2GJFA 2M3DA 1JXEA 4I2PB 2ZH8A 2BB5A 3EXCX 4F26A 2JEFA 1V5OA 1UEVA 4U6PA 5L1KA 5CTRC 4ES1A 1E10A 4Y34A 3KLFA 2FUG9 4HJGE 2KJ6A 3PZ7A 1X8DA 3ZO7A 4ZPWR 1MVKA 5FK9C 5LMUF 2HURA 3IRWP 2WXOA 1L0YB 2FUG1 3QAQA 3VQIA 4ZVFA 3WALA 3ISZA 2EFOA 2HQFA 1WI8A 4AQYJ 2INNE 1JJ2R 5A2QU 1HNXF 4LFBJ 2LVPA 1R0AB 1FEHA 2N9PC 4LSNA 4C3KA 3L7PA 2PN6A 4U95A 2BANB 1KSPA 3Q8AA 3ITHA 1ZXIA 1BUXA 2ZKUA 2MWSB 2K6DB 4I67A 2KG0A 4CLZA 3GB1A 5E41A 2POKA 2FC8A 2YQ1A 3UINB 2DNFA 2IA6A 3MEDA 2OHDA 4DCOB 2RDIA 3H59A 1S5ZA 2Z58B 4QW8A 1EU4A 2L05A 1FVQA 3T9NA 4CHKA 1TL1B 1TL5A 2KYZA 4RGTA 2RQKA 1R4NI 4AYBD 4XK8C 2ZZTA 4JBCA 4ILMA 1M5HA 1RWMB 4PG8A 1Y0HA 2V8GA 2DZIA 3MCMA 5F8IA 3ETRA 4OX9J 3N6LA 3ZYYX 2KWCA 3GP7A 2YWGA 4NPNA 1NJXA 1GB4A 1IBXA 3ZDMC 2CIMA 1VJWA 4KAIA 3D32A 3DNCA 5KG4A 1K8RB 3L17A 3NRZA 1RWXB 5LJ3Y 4RF0A 2OPPA 2D3CA 5H9EK 4P7TA 2CPYA 3AJ1A 3ET6A 4LJPB 2ZNVB 1YNTE 1HBNA 3M2UB 3G86A 1BT0A 3MFGA 2DIUA 4KHPF 1HNIB 4MACA 4DR3F 3W5VB 1S6QA 3JAMY 1N36J 1YJJA 2ZHBA 1S6UA 3G82A 2V2KA 1WMHB 4AJWA 1QOBA 2HNZA 3T41A 3EPGA 4Y3CA 5E7OB 1PC5A 3HCXA 1KKHA 3BYRA 5L39A 3O5TB 3J80Y 3DBHB 1U25A 2LLZA 3PM9A 4FPRA 4UF4A 4C97A 3R3TA 5DQGA 1NHKL 3MM5B 2DH9A 2E5IA 1T3OA 4OLPA 4HT7A 2D10A 3HHEA 2Y3YA 1KOHA 3AOAA 1SSNA 4DV1F 1EWYC 4P74A 2C2DA 2VQEF 1NDPA 2XZDB 1NHUA 2B4OA 1FKOA 1S6OA 1VQSA 4DHVA 4PWDB 1YZ6A 1IWGA 4DV7J 2DD8S 1VRAB 2YKQA 2QFIA 3OXLA 1UVIA 5KT3A 3BPDA 4S0MA 3O2IA 4PQUB 1BQMB 5E6OA 2M88A 3IG3A 2W8KA 3PO4A 1KLMA 3UO0A 3DRSB 4I6YA 4UY85 2FQQB 7FD1A 1S0VA 1YN4A 3JYUA 1H74A 4EEYA 1VCBA 5B0BA 2YWHA 2DNNA 5C2TB 2IVYA 2AWZA 2ZOGA 1JLFA 1RAFB 2XN9C 2UXCJ 1ZW7A 4CO2A 4DG1A 4PUOB 3AEGB 2PJHA 2NSBA 5J2RA 2QLJB 4KFBB 2EBGA 3TJ9A 4P10A 3DM2A 3ZTSA 5L1LA 2LQ8A 4ZDNA 2WONA 4MKVA 3M3JA 2DEJA 2HTHA 1S9EB 1GPXA 3KJFB 1K44A 4NRUA 4ELVA 3X1LB 2V63A 1ZPWX 1JXLA 2V2ZA 3Q3JA 4DV4J 4IM2A 1UUPA 4PCQA 2U1AA 1S1TA 2MHNA 1FJEB 2JJ4D 4DBQA 1FJ7A 4DSLA 1GX5A 2VA3A 1NYQA 2QA1A 1URRA 2INDC 5F3TA 3IRXB 4M63A 2CNOB 4Z7YA 4XWTA 3DGPB 3M4XA 2A6OA 4DFMA 4ANDA 1UD7A 1VMBA 1VQYA 4IFVA 5H9FJ 3NRBA 1RT7B 2LECA 2ZCBA 2W54A 3CULA 2ZHOA 3LH2S 2HRUA 3N20C 3Q24A 4WAAA 4B08A 1N8RT 2RGFA 5HHDG 2HWTA 2WZ1A 4NZ6A 4YSYB 1H2VZ 1RABB 2YWKA 2D7SA 3GE8C 5KOXA 1N5QA 1VZ8A 2Z30B 5KT6A 2ZH9A 3VAFA 2W7OA 1VJKA 2JXTA 5C25B 3VCDA 4KJIA 4A9AA 2FVCA 4DPOA 3TAMA 3AN1A 4HVZA 5A8KA 2MXYA 4E71A 2KTRB 1FJCA 4F7ZA 4HACA 3N9UC 3BKFA 5HN0A 2CJBA 2HVEA 4TKTA 4EYIB 1KC8T 1UFWA 5CYMA 1T5XD 4IOIE 3PYGA 4I7FA 2WW4A 3KUDB 3QC8B 4NXNJ 3MHSD 1IR1A 1EM7A 3VQSA 3OAWA 4OIXA 4KBIA 4ED4A 4AS1A 3DRRB 5AZGA 1V9OA 3QQ8B 2W9NA 2HSEB 4WIIA 2OD6A 1RWSA 3PCOB 2VHGA 1VRUA 4TY8A 2OPQA 2P9GA 4B9LA 4NLOA 4E3CA 3CJ8A 2HFOA 1HL6A 2DCLA 2KC2A 1R4NB 4MJSB 1PYWD 1FXRA 1L2NA 4GMKA 3RB0A 1RAXA 4LT6A 4K5SA 3DVNU 4WZMA 3A8EA 1ZM2A 4KKOA 4LQ3A 4OZBA 1S7HA 3RZFA 2W1BA 2DWQA 2CZ4A 2HBRB 2K8GA 3S6EA 3QRRA 5T8IA 2DXFA 1HWUA 4O3RA 3VGUA 2LXUA 4MKAA 4K4SA 2PA8D 3IAS9 4URGA 4IR1A 3DDIA 1WYGA 1ITPA 4KT0C 5J2PB 4MFBB 2HNDA 3LDZE 3IAS1 1N32F 5A0YA 4Y2IA 4RW6A 4JI7F 1WF1A 5A6PA 1UWAA 1F9EB 3BQ0A 1QVGR 3CO0P 3MR5A 4J9SA 3MTJA 3PEHA 4C4VB 2R2RA 2WNMA 4M0WA 2PC6A 3JTPA 3J7ZT 1J7BA 4JI3J 3FKBA 4K50A 4JI2J 1HNVB 3THPA 4ED7A 4ACFA 1MWZA 2INCC 2L0FA 3R7NB 1Y5IB 3D28A 5ETTA 4KSEB 2QMTA 2KJWA 3U8ZA 2RDBC 1P1LA 3BGLA 2MGZB 1ZAWA 1S0NA 2HVZA 4ZCLA 4U8VA 2QLBB 4A8FA 3ETOA 1ZAXA 1C1CB 7AT1B 4RNHA 3QRPA 2ZH7A 3SDLC 2AJFE 2VBYA 3JSMA 4N7TA 2XMVA 4DXAB 2IM1A 2V8VA 4G1IA 3LAMA 4QCLA 4GXBA 2OEDA 2F3JA 4PAAA 3MM8A 1T03A 2WHOA 4J6IA 5BJRA 5K5MA 4F25A 3TMPB 3ZW3A 3TI0A 5E5NA 2MQQA 3OUYA 3ONSA 4LDTD 2MW5A 2MBEA 5JHAA 1AYFA 1WJ6A 1MPEA 4AQ7A 1U0HB 4QWCA 5FD1A 3TZWA 3IG1B 1QE1B 2LJ5A 4K7WA 3CMES 2XGPA 1XF5L 1X5SA 2BS3B 3SDEB 1FRLA 5KAKA 1GMWD 3R2CJ 3Q3MC 2DH8A 5CYQA 1WHVA 2MJDA 4I2PA 1YRUA 1P9DU 1SH3A 2H9ZA 2QX0A 3VV2B 2LXIA 2DPJA 2AF6A 4EI2A 2NUHA 2ZUAA 3V6KA 4LK0M 5AE2A 3HD2A 3VZIA 3C6UA 4UW2A 5HJXA 1YX2A 1W7WA 5IOIA 3RMKC 5D4OA 2CQ1A 4FYXB 2Y8WA 1S9GB 2UXBJ 1OQ3A 3H5SA 4Y2CA 5BR8F 4B3MJ 3TA2A 3MR2A 1E8ZA 4MT1A 2XTJP 2PO4A 1R0AA 2E9ZA 5D77A 3K57A 2EKIA 3BDPA 2OKQA 3HZGA 1IKWA 1P9QC 3UDLA 2LGXA 2DGTA 3G4SS 3ENWA 1E8WA 4USHA 1R7IA 1KNZA 4DQOC 4L3NA 1P6TA 3CJQA 4YS2A 4GC7A 2D3OR 3L9ZA 1Q5WB 3R7QA 4OFZA 4JWSC 2XYPB 1I51B 4UDUC 4K5RA 3TBLD 3D5MA 4PKDB 2MSSA 4DWIA 5CCMA 5KFRA 3N1XC 4DR4J 4DFPA 1DLOB 2B5JA 2AX5A 3VAJA 4BC9A 2F4VJ 1XLPA 2PSZA 5J2MB 2OFHX 1LK5A 3FZBA 3DBRI 4LF5F 4WTOB 2KNBA 1D3WA 2WBMA 2I5JB 4PR6A 1RTZA 3K58A 5KG1A 1U1PA 2LYVA 3KHLA 2C7NB 3HZEA 4LF7F 2G3QB 4ZRJA 3QPIA 9ATCB 2LDYA 4DSFA 4W9GA 3WAMA 1PG5B 2KVZA 1VZ6A 2LUMA 4HVBA 4HH0A 2CNLB 3F56A 3DCGA 1S77D 1RWWB 3AE4B 2Z4PA 2YNHA 4RF1A 1WC5A 4DX6A 1HI1A 3EVOA 3RR7A 4R0JA 2GAHC 4WJOA 5EE0A 1YG0A 3NGKA 3PX6A 4RPFA 2FCQA 2CG8A 3AQOA 3M9MB 1WC6A 2XLIA 1LXJA 3HSGA 1QM9A 4DHZB 2VA2A 2CHWA 2X1AA 1HEZE 2JDJA 1DOYA 4OJ3A 1FKAF 2CVIA 2UUWA 3OL7A 5L1JA 2PMVA 2HMIB 1TK8A 3HKWA 3CDBA 4IWPA 2V4JA 3G8QA 4QW9A 1RWOB 2W9BB 2J9EA 2KMCA 3RG6A 1VR6A 3ILJA 4CLTA 2LDIA 3CCMS 2R7WA 4MGIE 1K8AT 5AZHA 4ERDA 4DN0A 2MEKA 1NK0A 5AE3A 4E0DA 3MAAA 2N9LA 3AD7C 3D4JA 3UW1A 3D67A 4AQYF 4A8XC 4LRBA 2R7VA 4TY9A 3CCSS 3V2UC 4LFBF 3ENAA 4RKUC 4L1BA 1TJEA 1N63A 2OELA 3NJTA 4FHJA 4LBPA 1FXAA 2E7WA 2BT6A 4G11A 1CJKB 2QYCA 2KDBA 1NK5A 3MFIA 4TQRA 4WURA 2AX1A 2VFRA 1U1MA 3HM3A 2D3GA 3DLHA 2IAJA 2ADBA 3KG1A 2K3UA 3OWEB 3GTYX 4OI0A 2L48A 3KLIA 1KVJA 3PACA 3OTOJ 5K9FA 2R8HA 1VDHA 2XSFA 3JAMU 1X4HA 4M5LA 4F4XA 2KFJA 2IYGA 3HK0A 2RHQB 3KUEA 3MMCA 1IKXB 3VQTA 1WEXA 1SJED 4GKJJ 1HW9A 1HZ5A 1SIZA 5KFFA 2EBEA 2NREA 4B9VA 4NLTA 1WKKA 3J80U 1X9SA 4WTYA 4OX9F 1XCTL 2ATLA 3RNFC 4P75A 1N0UA 3PNIA 5SZTA 1A0OB 3BWUD 1S9EA 2YNIB 4M5HA 3ZNGC 4YHHJ 5G5HA 5E3RA 1HPZA 1HWLA 1VHIA 2JNJA 2OLWA 3HM6X 4RNNA 1ROFA 4NLQA 5D7GA 1Q8LA 3RD2A 3R66C 1L4ZB 4OVUA 2HQGA 4UOHA 3TEZA 1MWYA 3L4PA 5DM6Q 3IRXA 1WC0A 2L9DA 4DQRA 1FXTB 2K5PA 2FDNA 1DJ0A 1WNEA 3KHRA 3UCZP 3KLGB 4AL5A 1HQUB 4BKTA 1XTZA 2JZ3B 4M00A 1RT3B 1X5TA 4W9EA 4ANUA 2UVUA 2GHVC 1ISNA 4WPAA 4FN2A 2DENB 3TWZA 3VTIA 5HKHA 4WU3A 1NMEB 3IS9B 1JIHA 5KFGA 1TZ1A 2W4CA 3H5YA 4A90A 3H8HA 1B0VA 3PW7A 2U2FA 5HBMA 1RT5B 2GVDA 2H54B 5JZEB 2K1RA 5ETOA 5ETSA 1WDDA 3EM1A 2IBOA 4DV7F 2WU2B 2VDIA 4OLOA 4ZCMA 3TJPA 2DGOA 2HFSA 2XNAC 1VRTB 4B9NA 1CZPA 3DKDA 3NCRA 3T1YJ 3Q6BA 4X84A 3BB5A 4P2SA 3EECA 4ZVRB 2B6AA 5KG2A 3H1UA 2DIVA 1OPIA 3ZTCA 2HHVA 5H92C 1KRHA 2F8MA 1PUTA 2WXFA 3GFHA 3BK2A 2NXCA 2V9WA 4DFKA 2ZPNA 4M5GA 4J9VA 4A3PA 3RBZA 3ABVB 2RJZA 1V5IB 4IUMB 3Q8PB 4W9IA 3I9V1 1RACB 3NUHB 5ADZA 1WX8A 1JX4A 3AV8A 1H7WA 1IQTA 4EU0A 2NZCA 3FEXB 1XR6A 4AE5A 2B3TB 3MR7A 4NAWA 2CS4A 4AXIA 2ROPA 3I5BA 3SCLE 1TGZB 3MM9B 4CDIA 2VZKD 2YXLA 3URYA 4LSZB 1XQQA 1ZH5A 1WWHA 1EHWA 3T1HJ 2X38A 3M8PB 3DRPB 3P4UB 4DV4F 3CJKB 4NWBA 5AEKB 3GE9A 3K5PA 3A1QA 3PJWA 2PD1A 5IKCM 1AZSB 2I8EA 1FRJA 2X51A 1TV6B 1WHWA 4B3TJ 2E5HA 1Q7YT 4ZN1A 3SCIE 3GCWP 4DQQA 4IKAA 2VPZB 2PVGC 1XN9A 3O6QA 2XMUA 2KT5A 4NMLA 2MJUA 4ZLLA 3B9JA 4C8NA 4N47A 1H98A 2Z2LA 2BZ2A 2VG6A 2R2OA 2L32A 3ONQA 1ZS6A 4JI4J 4GIVA 2MKSA 2CKHB 3M05A 3CDAA 3DI6B 4BBNC 4K8RA 4K4WA 4RU2A 1P3QU 1CC7A 2M9KA 5IV3A 4FBUA 1K9MT 5EE3A 1JK9B 3C14B 1H73A 5B0GA 4JLCA 1RLFA 1OYEA 2VDHA 5K14B 2NR0A 1AB8A 3UQBA 3CE8A 1K73T 2G1EA 1PGZA 5F8JA 5CD4A 3NAIA 4ZMMA 2VH2A 2M8DB 5CX3A 3L0WB 2MLXA 3Q14C 4FJVB 1RWNB 1FHTA 4LF4J 3BR9A 3MFHA 2YX4A 1UZDA 4KY3A 3CCWA 1WC4A 1YBAA 1P1AA 4MIBA 4CCHA 1OS5A 2ZOFA 4NLWA 4CTAA 5H9FK 3MUTP 3OTDA 3OL6A 4LRDA 2LEBA 3QIPB 5B0CA 4TSSA 1MROB 3AI5A 4RWXA 1U4AA 1U2CA 3BDEA 3R1LA 4AL7A 4WFXA 2Z2ZA 2M0AA 1Y7PA 3M7VA 4NXNF 3QLHB 3OLBA 3HLUA 4C56C 3MHYA 4H4OA 3CF5Q 4ID5B 4NI2A 1EETA 1ZA1B 2G1DA 1SJ4P 1J5OA 2BTEA 3R2TA 3GFZA 5KFYA 1UBQA 2FIDA 4FYWB 2VV5A 5KFJA 3PW0A 4LNOA 2RKIB 3ISND 4RX6A 3NS5A 1I42A 1YI2S 3L08A 4FKXA 1SB3C 3A12A 1SB6A 1V80A 5I3UA 3KK3A 3DPDA 2RS2A 1HBOB 2IDLA 4CLKA 3NGSA 2Z59B 1S9GA 3CCLS 3DXBA 1EWCA 2KQSA 4XGAB 1E7UA 1JWBD 1VQLS 2FYXA 5F8NA 4NCAA 2C1EB 2QL5B 4N77A 4DXFA 1R3NA 2QA2A 1PYSB 4YTNB 1GTHA 1T3QA 5HVHA 1HYSA 4DJBA 3UDEA 2BOAA 2ZCCA 1T9WA 2J7KA 1S6PB 3DLKA 5LL6d 2L9WA 1HA1A 3G6XA 3AU5A 4JI3F 2OEJA 3JTNA 4JI2F 5C3JB 2Q5WD 3CJTA 4CO3A 1S97A 1QOGA 1RDRA 2P5VA 3P96A 1XMOF 4Y00A 2OSRA 1WI6A 1Q95G 4HH1A 3CMAS 2J7WA 5EHHA 1BE4A 3HI9A 3M6VA 4UUWA 5A8WA 2VASA 1HQEB 4DV3F 1P27B 4EWTA 4V19J 3FNNA 3GZNB 2MMYA 4WWNA 4L6V3 3BR8A 2IGGA 3SQGB 1Q79A 3T3NA 2AQ3B 4KGZB 2K6QA 3QATA 4EOYA 2VJVA 2AWTA 2KXJA 4J91A 4NLUA 3IBCB 2ASDA 4RNOA 2WX1A 4ZCIA 5E33A 2DGQA 4KGRA 3LP2B 2XMWA 3UVJA 4ELTA 1GEHA 4H4MB 3M2RA 3KUGA 3QMQA 2LEAA 2DGVA 2ZM6J 2JEGA 3TEHB 4G1QB 1G4CA 2D07B 1TAQA 1T8EA 3AE9B 2PFDA 4W9FA 1XLOA 3ZTRA 4P6VF 4EUTA 3H42A 1KLNA 1H7XA 2E1MC 2VG5B 2XI2A 2BJDA 4Z7CA 4ENOA 2M52A 4KR0B 4UOGA 3RI7C 1XK8A 1IR2A 3HHLD 4DX5A 2CQ4A 2YNGA 4L72B 2KM8B 3JQJA 5EGYA 2V94A 5B09A 4RNAA 2EVZA 4FJZA 2UYZB 1TP7A 2NXJA 1FRKA 4P71A 2KWVB 1WKLA 3QBCA 1LXNA 2LQ9A 4NJCA 4M8LA 2C2ZB 3U2SC 3GU0A 1NNDA 1UJ5A 2X3DA 3AEAB 1YIWA 3LALA 4OHVA 4B3MF 3CWJA 1LFPA 2MBBB 1U0SA 2C2RA 2RAQA 5B0EA 2KDIA 3VZHA 4TQSA 2J9CA 4GLSC 4R25A 4J37A 4CLUA 4O4GB 3OR1B 2CQBA 2ZDOA 1WX9A 2WXIA 1KR4A 5E6JA 1ACCA 5B0FA 1FKPA 4ANVA 5D3DA 2LMCA 5HI1A 3TYTA 4NLGA 1A6LA 4DQSA 3V60A 1OY8A 4ZRQA 2DNPA 2KO1A 3W9JA 4JPSA 3GLJA 1M94A 3CJRA 2IMWP 1DOIA 1RAEB 1RRBA 3RB4A 4OZ2A 4DR2J 1HBMA 4DR4F 1F6TA 5HO4A 1TKTA 2BYVE 1JWAD 2V3NA 3QWZB 4IWQA 1V86A 1FA0A 4PABA 2N9XA 2F4VF 2G4SA 4PRFA 4HWIB 4EMDA 5KFIA 3U7JA 4F4KA 1TL7B 2G2YA 4RGOS 1GTEA 2FHKA 3GJQB 1PKUA 2BRLA 4GDLA 2KFYA 1JWUD 4YFUA 3MMJA 3MEGA 3SFGA 2CADA 2RF2B 3UD4P 2L00B 1U1KA 3MWBA 3B8HA 5HROA 1DBDA 5E3AA 3VVTA 1FF2A 1WOSA 2GBRA 2WB4A 4DUYJ 3KWLA 3QCAA 4TU8A 5HP1B 1L3TA 2Y1LB 1TKXA 4ZCKA 4NY0A 3W5UB 2F9JA 1F1BB 3CMMB 5HK4A 1TS5A 1IWAA 2NR2A 5EWEA 3OFHA 2HFZA 1UWMA 3CIRB 1YD8U 1XMBA 1V8CA 3KLGA 2FB0A 2JUOA 4IG0A 4OI3A 1VFJA 2D3O1 1GK8A 2YEPF 3HFKA 3QO9B 2L3MA 3DOWA 1I94J 1FJGJ 2K8BA 3B0AA 3N30A 2C2MB 4RBUA 4KQZA 2X1FA 1HKAA 2C3UA 3KK2B 4L3KA 1GG3A 1RAAB 2DBYA 1FD8A 4CNZA 2OJRA 2F63A 1ZTWA 4KV8A 1RT5A 4K59A 5J2QB 1TIFA 3B54A 2OFGX 2YQ0A 1J19A 2DNKA 1EAYC 1NB7A 4FULA 1YOVB 1GT8A 4IH5A 4KHRA 4JI5J 4JI6J 4KB7A 1KLVA 4USIA 2DX5B 3D6FB 4XE0A 1EUVB 1QT9A 1VLYA 3QWPA 4WP8A 4LF9J 1Z1ZA 1VBKA 5K20B 4EBEA 2M0XA 1TU0B 5L9XA 1XR5A 3IP0A 3RYLA 1WE7A 3D6MB 3Q89A 3HPOA 4C6AA 3K5OA 2KRBA 2WCXA 2CJOA 1GJZA 1P7EA 1CJTB 3A8IA 2IM0A 3MECB 5E6NA 4WKRA 2YPYA 5LOQA 2DNMA 2AQ2B 1K51A 4KO0B 4Q8FA 1LWCA 5DQIA 4C8YA 3SU8X 2GIRA 2L52A 2HNYA 3VAKA 3OTOF 4AFFA 3RJMB 1SH2A 4IDKB 2B43A 3KUCB 2VODA 1JWMD 4EZLA 3W1SC 1M1GA 4K3CA 1JLCB 1OQ6A 4FBTA 2L41A 4GKJF 2JFKA 4F36A 1LWFA 2LASA 2V8DA 3GILA 2V67A 3D0IE 4J9LA 5D3GB 2AYGA 4AP4C 2YH0A 4IFYA 4PZVA 1NM2A 2BX6A 2Y0SD 4LRAA 5A8RA 1JJCB 3HHMA 1RCXB 1FK9B 4LTUA 3R6GB 2JSVX 1UWBA 2QO3A 1R43A 1HQRD 1DTQB 1Q0WB 2CKWA 2D2QA 1F2RC 4IRDA 2PE6B 2NBUA 3A9KA 4U7UK 1WE6A 3QJZA 4MIWA 2XEXA 3PKYA 4YR2A 4CQNA 3MMAB 2QC8A 1R8PA 4E2FB 2QSWA 4AL6A 2ZJQQ 3D3BJ 3RNBC 1N5XA 3IGNA 4WIQA 4WZQA 1E90A 2VC1A 3NS1A 2TSSA 3B4DA 4FYYB 1U02A 3QFHA 5IM0A 1TL3A 1WXAA 2O6VA 3TANA 2PFFB 2ACMA 1X5OA 5DG9A 1LK7A 5D0RA 3NBPA 5K14A 2MQNA 1PBAA 4A48A 3BK1A 2RQMA 4WJNA 4A3OA 2KB2A 5J1EA 3V05A 4WFAQ 4XO0A 4HR2A 5MLCV 5EDSA 3TW0A 3C0RB 2FD2A 3AE8B 2DNRA 4EK2A 1Q7LB 3T3OA 2KDEB 2QEXS 2WRMA 1ZP0B 3BZDB 1MW7A 2IDYA 1IKVB 3IR6B 1G2EA 2XMTA 3LOUA 5KFLA 1VDVA 2ROGA 3ILOA 2XY6A 1RT6A 1R4MI 1TTNA 5K8OA 2DY1A 4CO5A 2F8HA 1ZOYB 4M5NA 1EP4B 3R8BA 2A10A 3IC1A 1CJEA 2N1WA 3MM7B 2VQFJ 5DPRA 2NBVB 1UW9A 1F9FA 2FNJB 3PX0A 4XX5A 4NLVA 3KHGA 3OLMD 3NGTA 4KV2A 4U9RA 2QIFA 3K5MA 1RQ0A 4ID5A 3P4RB 1YZ7A 3F44A 3E01B 1YJUA 4CM2A 3GPAA 2V8HA 2JEJA 5D6GA 4X65J 4ECWA 4RW9B 2R8IA 2WDTB 1YJ7A 3FQKA 2FCMA 3E9SA 4AUQC 3ILLA 1KTQA 4ILRA 2V4IB 5D94A 1X4GA 3CDUA 3VR9B 4DSIA 3K8VA 3J81Y 3DVGX 3NMAA 1D5MC 5IA7A 4OYAA 2CPDA 2J7UA 4YMEA 2F4FA 3D0GE 1EU3A 2Q43A 3B6BA 1YWXA 4LF8F 1MWQA 3P3DA 3KMQA 2RSQA 3CJ2A 2CQDA 1VS3A 2L3ZA 1G6JA 5KFUA 1QQRA 3V4MA 3HVDA 5LXHA 3KLEA 3CDEA 1F2GA 2VFSA 4M5DB 2MKIA 3W9CB 4P2FA 3NP5A 3FAHA 2GQ2A 1T05B 1NKCA 4P9SA 5I42A 2E29A 5ETKA 1S0OA 2KH9A 4JI4F 3ISNC 2HK3A 2D5GA 2HWHA 3UDCA 3MI7X 2GOWA 2QZ8A 3AXCA 2KK8A 1RBOB 4PWWA 4IG3B 1S6PA 4HPPA 4CYEA 4G0NB 2BJ8A 5I3QA 3LWMA 3WX8A 4DX7A 1CJVB 7FDRA 1JXVA 1CULB 3DLGB 3R7RA 5AJ3F 2DZKA 3RAMA 3ZRFA 4KE5A 5JH5C 4NQKE 3HVAA 3T5KA 1P9YA 4ZJLA 1REVA 5F8GA 4TLRA 4K0KF 1KFYB 3W2WA 1FXDA 3R6LB 4LF4F 4HHJA 5J2NB 3M30B 2RMMA 2FVRA 2FJBB 2K7KA 4Z2XA 2MX2A 4K81A 4RNFA 1Y11A 4OJ1A 2CPJA 4WF9Q 2DAFA 5G55A 4QR2A 5CAAA 1NSAA 1S49A 2I6WA 3KLSX 2KL8A 1BQNA 3K7RA 5ETPA 2JT4B 4H4MA 2OHFA 1TZ0A 2B56A 4EFAC 4OZ1A 2XNRA 5M2PA 4JV5J 4OZCA 4DV0J 2CUYA 1UPPA 1YJ1A 2H4WB 5FR6A 2ZWOA 3BREA 2PEAA 2H4YB 4ZPAA 5CHVC 3DXSX 2QCZA 1SUQA 5DCNA 1E9MA 4AWJA 5EE9A 4IO9Q 3Q3NC 4KYZA 4A8SA 5FIIA 3G6ES 2D3BA 2MBHA 3QGGA 2VKZG 2ZNVC 3FBCA 2F40A 1CQVA 2A18A 1E6VA 4CNYA 5B08A 2P8IA 5DGBA 4OVVA 2ZD1A 4ECVA 4REZA 4C4WA 3P42A 5DS7A 3TZXA 2JPHA 4BZAA 1L4DB 5A6WA 4ZP9A 1K53A 3H40A 3C6TB 4PYZA 1RLDA 5FLXU 3G8SA 3QT7A 1KVKA 1HW8A 2GGPA 1UPMB 5BMIA 3KLVA 4O4GA 2B9YA 4U96A 2F9DA 3HHLC 4GKKJ 1OEYJ 1NAQA 2WAQD 2Q79A 2B51A 3BYPA 4CRJA 4II2B 3LUYA 1TT5B 4CWBA 3I3TB 1HARA 2MSTA 2AP6A 2WVEA 3NNAA 1CEZA 3IBEA 4OL8A 3IWLA 2OPRB 4USAA 1YRTA 3C2PA 4NLXA 1J7CA 3EVMA 5CA5A 4B3SJ 1N88A 3BY4B 4I6PA 3IAM1 3H6NA 4URKA 1JLBA 4WE1A 3MM6A 2LEPA 2VH7A 1QY7A 2BE2A 2Z8QA 1Y10A 2W01A 1RKIA 1UAWA 3CJSA 1MI0A 2CAJA 4Y0FA 3R97A 3DOMB 4WXWA 2MEWA 1ZXHA 2X8XX 1JLEA 3SCJE 2KJHB 1EZZB 3QFWA 3DHIC 2KWDA 3TNVA 2VPWB 3CCQS 4K7SA 1I7HA 2F1FA 2QMWA 2NTTA 2ZM6F 3PZ8A 1Z4UA 4IOCQ 4ED5A 1HNXJ 1VISA 3M8SA 4ZLNA 3IMQJ 3TJ8A 2ZJRQ 2AL3A 3FSXA 3W2VB 1TBEA 1RA7A 2VUGA 5JHBA 3ZZ0A 1T0SC 2E5LF 4OYBA 4DV2J 1F0ZA 4DDFA 2ZBRA 2C28A 4L23A 2YKNB 5HLFA 3CB4A 3U1NA 3MPYA 4QPTA 4L76A 3MAHA 1W25A 3EGVA 3OBIA 4U7CA 2D3AA 4MSMB 4DLGA 4IQMA 3EZ5A 2DNHA 3ALBA 1T9VA 5J2QA 1NJWA 1U49A 4XC2A 3PVLA 4C0OC 1MNEA 4K2JA 4BKSD 4NE9C 4ZYSA 2FAZA 2V0GA 4ZP7A 4DR7F 1M5PC 1GNUA 2ZH2A 2W9CA 2DJWA 2V50A 3EWGA 4DPYA 1RB0A 1XNQJ 2FVQA 4CH1A 4RM8A 3U1MA 2R2UA 2C7MB 2H48B 2AV5A 1VCTA 2NYHA 3C15A 4OJGA 1E7VA 2KDOA 5HAOA 2EC2A 1ELOA 5LSOA 2D9OA 2XHCA 1EQMA 5GAHU 3MECA 4KSLC 4ECTA 4KIKA 4DR2F 4DR3J 3APDA 4TYAA 3DLBA 2JY6A 4LDTB 4NMXA 3BKUA 3MEKA 2B4PA 1WF0A 3PT2B 1REGX 3KH0A 3NY0A 1N54B 3RRKA 1H3DA 1IXKA 1KONA 2ZJPQ 4YB6A 3RU0A 4WJBA 3SFDB 1TFWA 2XQCA 5GAHI 2BS4B 3BBFA 1JRPA 1LWEB 3RPFC 2RHSB 2C42A 3TL5A 4GDKA 3NGUA 3KJVB 2X7IA 3AJ2A 4LRFA 3S8SA 2CJKA 4EYHB 1S1WB 1RTJB 2PMHA 2HBYB 3H9DA 4DV1J 2VQEJ 1I4GA 1XNRJ 2KXFA 2QV6A 3I0RA 3WANA 3AB2B 2DRDA 4DUYF 3VGVA 1KTVA 5D4LA 2GJIA 3ZQ4A 3E3XA 4V19X 3WZ0A 1JNZB 4L73A 1O8BA 3Q8CA 1PJ6A 3HMJG 4NL5A