3C19A

Crystal structure of protein mk0293 from methanopyrus kandleri av19
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
SLGLDYEPSHLMFLVTVLDDRDGEVLGDAIQKLIEREEVLACHAVPCVTKKNRPGHVLVVLVDGGEDPDRVAEDVARDIMVLTGSTGVDRFDADGVYSVPSRFEDVRVVYGEREWRVSVKIAETEEGEVVTVKAEFDECREIGEETGIPPREVKAMVEAAARVGGWVDLKEREIKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein MK0293 from Methanopyrus kandleri AV19.
rcsb
source organism Methanopyrus kandleri av19
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MK0293
total genus 36
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01969 DUF111 Protein of unknown function DUF111
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.300 Alpha Beta Roll Ubiquitin-like (UB roll) mk0293 like domain 3c19A02
3.30.70.1380 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transcriptional regulatory protein pf0864 domain like 3c19A01
3C19A
chains in the Genus database with same CATH superfamily
3Q8QB 2ILZA 2H4YB 1P9QC 2LP4A 5BR8J 1MWZA 1Q1OA 4FBJB 4QWBA 1FHTA 3PM9A 1G7CB 5KFXA 4G11A 2CJBA 3A4SC 1SV5A 2G4SA 5DPSA 4QBUA 4MIWA 2HFSA 4LRDA 3IWNC 4OYBA 1P1LA 4DV7F 2ZDPA 4HVZA 4GOCA 5K14A 2YNFA 1IWGA 1IYFA 1H72C 3UQSA 2ZH2A 3EM1A 2HVHA 4JYAJ 3IHPC 3I87A 2IY0B 4CM0A 1SUQB 3SV4A 3R8YA 3W62A 3V2UC 3CDBA 1R4NB 4DS4A 3ZTOA 4YSYB 2Q5WD 4U9RA 3SEBA 1MHHE 2WOMB 3HFVA 2B5JA 5E3RA 3ZLZA 2VUGA 1M90T 5B0AA 1T9TA 1W2IA 2Q3PA 3URYA 4MFBB 2YNGB 3TEWA 2L9WA 2YKNB 4Y0FA 4IH5A 2N82B 3ZNZB 2KYXA 2R8HA 1FRHA 2IYGA 1HQUA 4IDKB 2XY6A 4KKJA 2JRHA 2M52A 3C8YA 1TK0A 2DO4A 1QAIA 4JV5F 4DL2A 4MDKE 3ZZRA 3KFWX 4Y6IA 3W9IA 3UCGA 1XR6A 3A3PB 1IKXA 4I1TA 2WW4A 2P2CB 2XLIA 4X65J 1JLAB 4RNOA 2N9LA 1TS3A 1TBEA 2GQQA 4E0DA 4LFBF 3MR5A 3IG3A 3RNCC 2HW3A 1B9RA 2EFGA 1IWAA 5C24B 1NK8A 1K51A 3Q89A 1RBLA 3R2DJ 4OYWA 3MCOA 4ED4A 2G1EA 3CJ4A 2W7AA 4TQSA 1NJZA 2YQ3A 2ZCCA 3J7AN 4Y2IA 4PG5A 2X8XX 4RCOA 5GMVA 2JXTA 1MFWA 4DV7J 1F9FA 5CAAA 1P7FA 1NK6A 3HHKA 4K5SA 4KYZA 1RT7A 1RWUA 4NXNJ 4JLCA 1CULB 3NJTA 2LQ8A 1FFUA 2W9AA 3OL7A 5IT9Y 4JI8J 1V80A 1I42A 4Y28C 5H9EK 4WWOA 1VCTA 2Z2YB 2VBWA 1MVKA 3M2UA 4B3OA 4OZBA 3V6KA 3R1LA 1MMNA 3GCWP 3Q8UA 1I1GA 4HCNB 2B0GA 4FJZA 3RRHA 4NWBA 3IP0A 5G55A 1NEKB 4X4QA 3BQ0A 4P6VF 3V6HA 5BYQA 2X1FA 2BOAA 4ELVA 1HNWJ 3E01B 3VTUA 3ZTPA 4DQPA 1RAJA 2FUHB 1NDDA 3KUEA 5DM7Q 1DFDA 3GJSB 3I0RB 2QC8A 3CF5Q 4DL5A 2J76E 1R8HA 2HHXA 3WANA 4Y2AA 3RZWC 3Q24A 2MQ8A 3MWBA 2QIEB 2EWHA 2K3UA 4ZP6A 2DRBA 1GOZA 2OSRA 4ZP9A 3L10B 4CT8A 4IWPA 3VHTC 1IGCA 1APSA 1MI0A 5K20B 4LF6J 4TY9A 4X4TA 1NPRA 3E56A 5A8WA 3LTOA 1T9WA 1H98A 1BQNA 4FZVA 2LXIA 4WKYA 3Q3FA 3FRZA 4LF9F 3JYUA 3R5DA 4EOYA 4HH1A 1EM7A 4B02A 4PUOA 2INNE 2DKOB 2K25A 2FIDA 3EFCA 2V9WA 2Q66A 2DZJA 4FF2A 2CPJA 1S6PA 1UWXA 4B0EA 5CYMB 1TIFA 1HBNB 4DXFA 3OV7A 1JKHA 2BJ8A 2EMTA 4EWTA 1QUPA 4R8UB 3AFGA 3EVWA 4JWUC 5D7GA 2D74B 4WU3A 1UUPA 1OEYJ 1LQ9A 1ZTWA 2KTRA 3DVNU 4LF7F 1TKDA 1Q81T 4KPYA 1AWDA 1T7PA 3HHLA 2J0KA 1FX4A 2CRLA 1UZHA 4ZN3A 2BEFA 2EKYA 3J7A1 2NXEA 3CTRA 2AX1A 5G0RB 3QNWB 2ZPNA 3QBCA 3D5MA 1SC1B 1GX6A 4TQRA 2MW5A 2DGXA 2RMLA 2HNYA 3ZXVA 2WX1A 4K0KJ 3FDSA 1PGBA 2ZH8A 5L95C 1M5VC 5K8OA 2GVZB 4K4WA 1F9JA 4KB7A 1JX4A 1R4MB 3N5FA 3ZZ0A 2IGHA 2D10A 4HKQA 1CQNA 5DGBA 1LXNA 2XS2A 4BKTA 1YNTE 3QAQA 3GB1A 2HBZB 1S1UA 1N52B 4RW4B 1JWWA 1TL7A 4OI2A 4KKOB 4JGHB 3G8SA 4DUZJ 4ZVTB 1ZW7A 2BVCA 1ZS6A 3RULA 3DHXA 1V97A 2A10A 1L0YB 2H65B 1X9WA 1HARA 2W9NA 1R8CA 1M4VA 4ECTA 2RRBA 2JZZA 4ZVGA 1WGDA 3IR6B 2LVWA 1T8EA 4LRAA 2EK1A 5BMIA 2I5JA 2HRUA 1JWMD 3GP7A 2IO3B 3D6HB 2KO3A 3DRRA 1PBUA 3H4BA 3X0WA 1XLOA 2IBIB 4PEOA 2ASYA 1UA0A 1C1YB 4EKUA 1MPEA 2AX5A 4P2FA 2HK3A 3R66C 2K1FA 2Z2ZA 3CCVS 2MY8A 3AJDA 1HHQA 1RI7A 2BF8B 3T5JA 1IKYA 3H5UA 2HMIB 1DRZA 2IPOB 4ZCKA 3T6JA 3N5BA 2V94A 3MEGA 1KJTA 5IC4B 2MZRA 3AODA 2LQJA 3NHEB 2KJRA 1ACMB 4E74A 5AT1B 3VTIA 2ZKUA 1MN9A 4Q8FA 3K9PB 2IMOA 1QVFR 1S48A 1WOSA 3FEXB 1UGMA 2QJLA 3VQSA 3RNBC 3M62B 5CYMA 4OHZA 2AZ1A 2HAIA 2KOXA 5DETA 3UR0A 2LECA 5FK9C 1K8RB 1I51B 5DDQC 3T1HJ 3ISND 2F3JA 2XMTA 4B3SJ 1CEZA 3TVYA 4HTJA 4DUTA 2PE8A 4E8UA 3QGIA 4P9SA 1WGHA 2CR5A 1CBKA 3HVWA 3VGSA 2GMJA 3E2EA 4A8XA 4HJGE 2BBEA 1ICEB 4HACB 1I7HA 2ATLA 3EUNA 2R2UA 4I64A 2QCZA 2RQMA 2R4FA 1RCXB 3P4PB 1NJIT 4MKAA 1KFSA 3PRVA 3BO3A 3LAKA 1KDNA 5DDPC 4NEZA 4KIKB 5TSSA 3GE9A 5L1KA 4NMXA 4IWQA 4FN5A 3AE5B 2YWHA 4ZVQB 3IN5A 2LEKA 1TFWA 4DHJD 3CCWA 5J18A 2R2SA 4QWAA 4QZVB 3CD5A 2OIHA 3QLHB 5L38A 5F8HA 2CQBA 1SC3B 1TL7B 1V49A 2FZCB 4R5PA 2N4FA 3LW5C 2DY9A 1DQAA 1YN4A 1RTZA 2LHDA 3Q3OC 1FRJA 1HWLA 1NPPA 3TX8A 4C6AA 3MEDA 4W92B 2NUHA 2D3AA 3NS1A 2XWYA 2UUAF 1HBMB 4Z2XA 1NZ8A 3L0WB 4CM2A 4MIAA 1IR0A 2N9EB 2NXNA 2VG5A 1XNRF 4J3OD 2MQOA 3TX0A 2EKNA 2UV8A 2XEXA 3V62A 3W5UB 4A8FA 1B64A 2VJUA 3M4XA 3PW0A 3U27A 1RCOB 2M1MA 2VC1A 1FD6A 1FXDA 2C60A 3MECA 1E8WA 1OSCA 1ESFA 2LVPA 1WEYA 4DSJA 4LT6A 2GLSA 1HBOA 3X3UA 1FRRA 2W4CA 4HCPB 2W3SA 3AE2B 2HRYA 2EG2A 2JEIA 3MPUB 2XZWA 2OLWA 5IO9A 5A8RA 2PVOD 5KFPA 3QSIA 4LF5F 3ICLA 1FTCA 1K1SA 3HHNB 5KT6A 3ML8A 1N5VA 4LNNA 2VICA 2YNHB 6FDRA 3APCA 4P6QA 2AMCB 2ZHAA 1RWOB 4OVUA 1TYGB 4HPLB 3MJ5A 1FXRA 3H5XA 4QCLA 3FSYA 4N47A 4XPCA 2M9KA 4EBDA 2JNJA 5A8KB 1OQQA 1FNOA 2BQ3A 4ED3A 1WTFA 2QHOA 1NLKL 5I3UA 4DBGA 3MP9A 1JJHA 4DHVA 1XR5A 3AA9A 3A9KA 3NL0A 2ON8A 2M0AA 3DLGA 5DG8A 3RUBL 2MBQA 4IFVA 3RB4A 2IM2A 2KWUB 4AXIA 4RKUC 2IO1B 2C7HA 3R7NB 1BD6A 1Y5NB 1BQNB 2PGCA 3NNCA 2NXUA 2AYBA 4NLSA 8ATCB 5GMKa 4OJHA 3B8HA 3ZDTA 3AULA 2NVUI 4QIEA 1WWTA 1YQBA 1HPZA 3S8SA 4JX1C 2DHAA 3P96A 2EFNA 2UVWA 1FKAF 2U2FA 3WC2A 1U0HA 3VR9B 4CYEA 3KOAA 3IS9A 4OYPA 3H6NA 2QMUB 2PTLA 4O4GB 4W9JA 5JXVA 3DVNV 3IBFB 1C4PA 1ZOTA 1HTOA 5HKHA 2KJVA 2BJ9A 4A20A 2XULA 2QA1A 1WRDB 1YRTA 1ZA2B 5I4MA 3PHWB 2BGFA 3FCWA 1I35A 2DT9A 4JI4F 2BYCA 2CJKA 3NS5A 3CEDA 1RTHB 4USUA 2JYEA 3BBBA 4DDID 2WCXA 4ANVA 3KHLA 4DQOC 1T02A 2B43A 3C6UB 2FGOA 3KMQA 1SH3A 1Z2LA 3H20A 1AXQA 3CXCR 2KMCA 3JAMU 1IJFB 2H51B 1XERA 1Y5LB 2OPPA 3S1TA 2Y3AA 2XBBC 4F4AA 2C2NA 2K6DB 2DNYA 5DDOC 2A4ZA 1E8ZA 4YDXA 4X4SA 5KFDA 4DFKA 1VIXA 3DBHB 3H8HA 1TKTA 2MKHA 2PFFB 3AH7A 3Q8BA 1X7VA 4MSQB 2ZM6J 2E1PA 5FLXY 1IM6A 4EZ9A 3M3JA 2XI3A 2ASQA 2D3ZA 2AQ1B 2OHDA 1T0RC 2MGZA 4ZRKA 2CZ4A 1DLOB 3JQKA 1X4HA 5DQGA 4UT4A 1MG8A 2R8JA 4WTYA 5DGAA 2V67A 3ZTSA 3LPEA 3OVAA 4L76A 3RJMB 2N3OA 4OFZA 4XO0A 2DB1A 3MCMA 4UTGA 3CIZA 2WXGA 3DBHI 3RI7C 1OQ3A 1C1BB 5A8KA 1N62A 2LFVA 2NLWA 2Q79A 4X2BA 3Q14C 4K3CA 2PT0A 1XMOF 1XNQJ 5HMXA 2DGOA 1KHWA 3T9LA 1YBAA 4DV3F 3V6EB 1T3QA 3LP1A 3VGUA 3OR1A 1RBOB 3LXFA 4W98A 3IAM1 1RTIA 2LUMA 5ETLA 4BZAA 2D2QA 1YZ6A 3V81B 5CYQA 1I3OB 5KFTA 3ZXWA 1VJQA 1RT4B 2YEPF 1HPZB 1UTAA 2VFVA 3IBEA 4A8YA 1URRA 3ZZZA 1L6VA 5L1LA 2CDRB 3J7YU 4A55A 3ZFVA 2BQUA 5HI1A 1U24A 3KUHA 2G0CA 1R0BG 3NOGA 1P98A 3UN3A 3AB5A 3KG4A 3AE9B 2HQIA 3VHQA 4MGKE 4R25A 3HRDD 3R2TA 1C0TA 4ZPAA 2LI5A 1RP5A 1DTQA 1N6ZA 3JYTB 2IZVB 1X9SA 3BINA 1R7SA 1RTHA 1N63A 3NZSA 3OJ3A 3QAUA 2IRYA 3FFIB 3MMJA 3C6UA 4HDOA 2KFZA 2ZUAA 1VQYA 4RNFA 2BDPA 3PV1A 1XN9A 2MJUA 4W9CA 1NJYA 4JYAF 4O44A 2LGDA 3PIPQ 3RZFA 3LA0A 4X4NA 4TU8A 2KQ4X 1S6QB 4MGZE 4J90A 3T5KA 3PO0A 4I2QA 4KO0B 2QG9B 1RA7A 3VTVA 1IBXA 4YB7A 4ZITA 2AQ4A 4K0KF 1LOUA 1J2VA 4WXWA 1REGX 4U6PA 4M02A 4USJC 4ZOHC 4GU2A 2B9XA 2W7PA 1TS4A 3P63A 4AYBD 3AQOA 4UOGA 1C79A 4LJMA 4LF8J 3BKTA 4HXDA 4RBUA 1FJEB 1Q8LA 2B4VA 3I5JC 3AY0A 1IBLJ 1GEHA 1S0VA 2JC1A 4LSNB 2DAJA 4F8RA 1LQBA 2RPQA 4DQSA 5G2NA 2WXRA 1SIFA 4HRSA 2IHR1 3SFGA 2V4IB 1Y0HA 1P0RA 1TUGB 1BWVA 2MPUA 3MUTP 2HHSA 1ZM2A 2CFXA 2WXHA 3ENQA 4P7TA 3TNVA 5B7WA 2Y5BB 3WX8A 2HGLA 4JV2A 2FE8A 3R6LB 4IM2A 1EJ7L 1RSCA 2VZKD 2WU5B 3Q23A 3TJAA 2P8IA 3DYAB 4C48A 2AHOB 4OV1A 3M8RA 4NRTA 4DHZE 3EFUA 1X1MA 1BGXT 1VC5A 1WX9A 1S1WA 2OPQA 2KT2A 3LPYA 4KGKA 4LTUA 4IUFA 1CJEA 4B9NA 2IM3A 3I32A 4JI6J 1E7VA 4P72A 2PI5A 3AE4B 3VUYA 3DRXA 1N8RT 1PILA 3EICA 4USKA 4W4MA 5ETOA 2QO3A 5D4PA 4HDQA 5D3GA 1FVQA 2HLUA 3N3KB 4DR3J 4ENOA 3D9BA 3C14B 2MP2A 1UFWA 5K8NA 1E6YB 2M4NA 1JQ4A 3KUGA 2IA6A 4IOBA 4DUZF 3KLGB 3M9OB 2JZ3B 4LQ3A 1AN8A 4LIWA 1ZYQA 1TL1A 1NDPA 3DU6A 1YJNS 2NPTB 2WVEA 2CAJA 4HWIB 4OIXA 1EARA 2H3EB 4X66J 2YWWA 2M4MA 2ZDOA 4WFBQ 1SBRA 3W1YC 2CPEA 2NSBA 3T1YJ 4PXCA 4A4JA 3CC2S 2KTQA 1B99A 4RW8B 1YGYA 2IC3B 3TMPB 4P16A 1N36F 4B6WA 5IQQA 5F9LA 2K39A 1TVRB 4OVVA 2WP9B 4LR9A 4MYTA 2HRTA 3OUYA 4NQLB 4RGTA 1Q5YA 4EE2A 5LXIB 3FVYA 3ZZPA 3UCZP 3A4TA 3G8QA 1U7LA 3MC9A 1LFPA 1C76A 4HT7A 4DX6A 1S12A 3QARA 3M8PA 5KFRA 3Q2TC 4LNIA 5EE1A 3RYTA 3EZOA 1KEKA 5EE9A 4AQ7A 4OI1A 1O6XA 3GPAA 2PE6B 3ELHA 4BKSA 1DQ8A 2CG4A 5LM7E 2W8KA 3EXCX 2V0NA 3Q0AA 3RAXA 2MLZA 3G6VA 3RR8A 1S9GB 5KHOA 1GFWB 2DIVA 4JI3F 3GZ7A 5C42B 2OPPB 2K0PA 1H7WA 3D67A 3IFWB 3KLHA 2EBGA 2WSFC 1VQ9S 3DKDA 1YG0A 3C6TA 2K22A 4PS3A 4IG7B 3IBWA 4YP3A 5EWFA 3A8EA 3N1ZC 3AEDB 1K0TA 1TT5B 3IG1A 4KPCA 2AYOB 3VR8B 4J9KA 1ZAVA 2LCWA 2RDBC 3Q8YA 4DCJB 2XGPA 2HBQB 4DQQA 2IY5B 2LVQA 2YWFA 1W7WA 3PKMA 1RWXB 3TAPA 4FVCA 1AYFA 2XSJB 3WQPA 4LF6F 2HFVA 3D0HE 3NCPA 5HK4A 1UEKA 4LF5J 3PTFC 2PLPA 3GZNI 3H2LA 4NLWA 1TZ0A 1D5ZC 2P6SA 2VONA 4M00A 1R7IA 3DM2B 3RN9C 1XCTL 1D8ZA 5BYRA 4NZ7A 1SJRA 2BPSA 1T6BX 1ACCA 2AV5A 4G3XB 4BKGA 2JT4B 3R97A 2C42A 2B4OA 2RDIA 3PX0A 4USMA 3EGVA 2FLOA 2ROPA 1HMVA 1GUAB 5E0OA 5L39A 1D9DA 3OR1B 2KFKB 1KLMB 3R8BA 2DHHA 2L0FA 2DYAA 1KOTA 4IDKA 1OYDA 4F0KA 4M8NA 2W54A 3HHEA 5CYQB 3PVLA 5L9NA 3OL8A 3PEHA 4DR5F 2WONB 4EZ6A 3ZNID 4M0WB 2KZRA 1VMBA 3AJ2A 4ZLJA 2I8EA 3NOCA 3TWZA 2DNMA 2W2MP 2RVJA 5BJRA 1JROA 1LW0A 3P45B 3W2WA 3KHGA 3PDNA 4DWFA 5KT4A 4OHYA 3GP9A 3BYYB 1ROEA 3ZO5B 3TUIC 3PO5A 2JEFA 1RTDA 4ZJLA 1BT0A 3KUZA 1S7HA 1T05B 3FSXA 2C9WB 4YY3J 1QQRA 4YR0A 1IKVA 5F41A 2KXNB 4TMAB 3H2VE 1TP7A 4TLRA 3QFWA 1V2YA 2IYIA 1FCAA 4KSEB 1WG1A 5C42A 4GDKA 1DTTA 4QR2A 1JB0C 1I6JA 5F8JA 5D4OA 2EG1A 5KFIA 3BKUA 1I4XA 3ZRFA 1FXTB 1ZXHA 1D4BA 5KG5A 3L4BC 4DR7F 3OAWA 2OPSB 5KFNA 4DMZA 3CJQA 2ZM6F 1ZZFA 1NKCA 3H40A 2M88A 2RHSB 2E5HA 4K4VA 3SQOP 1FNMA 2HTHA 2CUYA 2K8GA 4TQ0A 2RD5C 2RE1A 3NAHA 2QMTA 5JVGQ 2PEAA 2GO8A 3RTVA 4B9VA 3L4PA 1V5TA 1E8YA 1WYGA 2FHOB 3VCDA 1V1OA 4U7UK 2P6TA 4LJPB 3RUIB 1LWFB 4PPDA 4HPPA 4GVBB 1MHXA 2D9PA 3QAEA 2LRWA 1HKAA 4LSLB 2YNIA 5KFYA 4ZDVA 1LWCB 4TYBA 2KANA 2Z4PA 4RWXA 3AE8B 5C2CA 2KVZA 3DM2A 4F4ZA 1M1KT 1KLUD 5A8WB 3Q22A 3PZPA 2KVRA 4E98A 4CIOA 2XNQA 3L09A 3D0GE 1ZGUB 4FBUA 1F3VA 4YN3B 3FJ2A 1Y7PA 4NLDA 2ZJRQ 3ETMA 3GTYX 2W24A 2QL7B 3K5PA 4ZHPA 4TXSA 4I6NB 1CS4B 1ZAXA 2FGCA 4LBIA 1AFIA 1D8YA 2YX1A 4PR6A 1S1WB 2OPQB 4NA3A 2YH1A 2P9GA 2GBNA 2RDGA 2VG7A 3IT4B 2B4PA 4ECXA 4CDIA 4ID8A 2EPIA 3NVYA 5CCLA 5EHHA 2DNLA 4PWWA 4YSZB 2B7CB 4IRKA 4DV0F 4AL6A 1UJ5A 3EC8A 4IG3A 3BBFA 3SU8X 4ES2A 4MT5A 2NPFA 3TAQA 1Q0NA 4J9QA 1EWCA 3MAQA 4P1CC 4WJOA 3KLEA 4DFPA 3AD8C 3T5HA 2LGYA 1XQIA 1C4AA 3JSBA 5C25B 2GBMA 2KQSA 3SV3A 4H4MA 2KQ7A 3KLGA 3OTBA 2GV1A 1IKVB 5T14A 1UPMB 4ZJQA 5GXGB 2W2OP 4NLGA 1ZTTA 1WZ0A 5LNK1 2BKFA 1MN7A 3S2AA 2HK2A 4WQMA 3W65A 3DOLB 2KJHB 2AYMA 2CQ0A 2VPWB 2V4QA 1HNZJ 1CG2A 4CH0S 4OHVA 1S1UB 4F2SA 1W25A 4CO3A 3UD3P 3I0SA 3H8YA 4CNZA 3TZXA 4E3CA 1XMQJ 4IW0A 3DLLQ 2J6TA 3VF0B 5LXHA 2BWES 1FWKA 1HNXJ 3BGOP 1YJRA 4PXEA 1UAWA 2J7WA 2IIHA 1JNRB 3OUYB 4M5MA 2UUTA 3G6XA 4NJ6A 1UNSA 5GAHU 2H5EA 2RS8A 3GB0A 2DCUB 4OZLA 1VBKA 2FPHX 5J2NA 1ZP0B 3I3TB 1T0QC 3NMRA 4A8WA 2PSZA 1VRAB 5JXSA 4ECZA 1FRKA 4OVZA 1S1XA 1TK5A 1WMHB 4NNJB 1JLCB 3WIUA 1RE1B 1HNIB 2ZJQQ 3A1QA 1I4QA 1BUIC 3HO1A 3R2IA 4MM3B 4C8LA 3MMCB 2QA2A 4KKIA 4C7QA 1FD2A 4J5OA 5K8PA 3TP2A 4P2XA 5CYJA 4M5LA 2ZBCA 4KE5A 2KFNA 3P5BP 4PWDB 1YQ3B 2VPZB 2MQJA 1RABB 2E7XA 1XK8A 3KK2B 2KG1A 2OI2A 1N6QB 3H98A 4ICLA 2HIQA 2ONQA 2PEBA 2ILYA 3H9DA 3MM9A 3C16A 2JSXA 2HQ3A 2V3SA 3SQGA 4JV5J 4RFBA 1NHKL 1S0OA 4CLZA 3OVSA 3RNAC 1UMJA 4B08A 1RT3B 2GBRA 5AE1A 4J6IA 4DV3J 2XCPA 1PJ5A 3SXLA 1XXGA 2IO0B 1ZXIA 3B9JA 5U47A 4P2MA 1HD0A 4OQJA 4UZCA 4B9UA 4CLWA 1UBIA 1UFKA 2BMBA 1SJFA 4K8RA 2QC3A 4YR2A 3MR3A 1F52A 3LB8C 4C7YA 1FKPB 2HDEA 2LGXA 4C0OC 2JEGA 3ABVB 2VD3A 2ZOFA 2IJRA 1TY0A 2H9ZA 2NPIA 2NS1B 1MNEA 1FK9A 2QLFB 2BS4B 4IKGA 2WDQB 2ACZB 3PW7A 1KQSR 1STEA 2XNRA 1TAUA 2FUG1 3JVZX 1GC6A 2JVRA 2VQFF 1FWLA 3NGKA 2GBKA 1SE3A 5AZFA 3BPDA 1QSLA 3AEBB 4OX7A 1XT9B 1T9XA 3W9JA 3QMQA 2JZPA 2LGIA 1R8BA 4PCQA 1L3KA 1P6TA 4DWIA 1TKEA 1FERA 2UVVA 2LEBA 3GFYA 2MJDA 3AU5A 3DLEA 5IP4D 1JJ2R 2JL9A 3IM8A 3FCHA 1WF0A 2WB1D 2AJ0A 2VQFJ 1SE4A 3ILLA 4KDLB 3FBFA 3I56S 1QVGR 3ULHA 2SXLA 1M5SA 2XG8A 2IRXA 4OHWA 2HSEB 4BWJA 3NGTA 2ROGA 3LF0A 1KVIA 2CJYB 5I4DA 1FTRA 4BAXA 1EKSA 1NSKL 2J9DA 4BHQA 3PT2B 3ILOA 2O6VD 3ZNGC 2C2DA 1NRKA 3DLKA 1TU0B 3I6PA 5LOQA 5D2MB 4XGAB 1IP9A 1J7AA 1DY3A 2WU2B 4LR7A 4LVNP 2CQHA 3NVVA 1FX2A 2MHEA 2CHZA 1FDAA 2BKRB 4OYZA 3QRPA 2ZE2B 1R3NA 3TUPA 1ET6A 2L3ZA 3ZZTA 2KRRA 2M0GB 2YWEA 3R9LA 3I4HX 1U6ZA 2HE7A 2QL9B 1WG5A 4BVUC 2CU1A 4W90B 3TEZA 2A6MA 4O3QA 3H4DA 4KY3A 4NLRA 3SSQA 3V61A 3BDPA 1HD1A 4PQUB 4Y2CA 2BJ1A 5E6PA 2N9KA 3FC4A 3THPA 4HR2A 4P7VA 1HFEL 4KGVB 3CVKA 3MM9B 2ZHBA 4DF4A 2D7SA 2G9HD 2W1BA 2GO9A 1PQSA 4DV6F 2P9EA 4C3LA 2ZVSA 3VALA 4OL8A 3T9NA 3MTJA 1RT3A 1TUWA 4G65A 3GS2A 1XF5L 2HHHJ 1KRHA 2XK5B 5I3UB 1PFDA 2PFDA 3DCAA 3QT7A 2W2PP 4GVBA 2YNIB 4WJQA 3PR5B 4AT1B 3U52E 1QAXA 2AQ2B 2HFZA 2COLA 2NTSA 2WSEC 4DR1J 1WKKA 4LRBA 4X65F 3BJYA 1DOIA 4CO0A 1TK8A 5H9FJ 1EKRA 4NCGA 2IDYA 4ZLLA 5ETQA 4X64F 2J4XA 2XMVA 3LH2S 2EVZA 7FDRA 4QWCA 1VQSA 4GIVA 4RH6A 4US8A 2OD4A 1HNXF 3DBRI 3U30A 1KONA 3JSMA 2POKA 4DDGD 3NVWA 3PIOQ 2QZ8A 2RSUA 5F8GA 1SGHA 1U1MA 1RRBA 1T95A 2K1RA 1NEEA 4JV1A 4RLEA 1S0MA 1NHVA 2BKNA 5AXNA 1IKXB 5GAGI 4JPSA 1JLAA 4A8OA 3US5A 3GYNA 4FA6A 2O1PA 1F1HA 5LJ3Y 2VASA 5DG9A 4GMKA 4C9DA 1KLVA 4KFBB 2MEWA 3I5CA 3WAOA 4ZVUB 5BR8F 4LRFA 1MWQA 4OZ1A 3DDIA 3A1YG 5D3DA 1ZAWA 4C2MA 3Q2AC 1GMWD 2NBWB 2VFTA 4DXAB 3S6EA 4PG7A 4DV4J 4O3OA 1N61A 1KNZA 1UGJA 4NPNA 3GV5B 3VFKA 1NI3A 1YQ4B 3DOLA 5AXMA 2FHJD 3VV2B 4ZRJA 3KG1A 2YEPB 2GC8A 2H88B 3U4EG 4DL0C 3RBDA 3GJQB 4ANCA 1AT1B 3FEYB 4WU2A 3KWLA 2ASJA 2JVCA 5E2QA 3M2VB 1J8CA 4X4OA 3UDVA 3FILA 1WC0A 2GB1A 2GGPA 1YJIA 1HZ6A 1F0ZA 2KVQE 2VQEF 4DXGA 2RH3A 5IOIA 1YD8U 2IJNA 2BABA 2I1RA 3W5VB 1PCAA 3TJPA 3GFXA 2RJZA 2LXFA 1C0UB 3EDQB 2DENB 5ETPA 3BR8A 2EELA 2V5HG 3PW5A 4PG8A 4C8NA 4IR1A 2NZ4A 1F60B 1HNIA 1OWXA 1RWNB 4W9IA 4A3PA 3P4UB 2N9XA 1UVJA 2Z8QA 3R7RA 1VHFA 2MKSA 4NCGB 2UXBF 2V8PA 1Y00A 3TCAA 3VGTA 3DQVA 4FYXB 3KHRA 1VFJA 3IFEA 1WSPA 1QAJA 3E51A 4CLTA 1QT9A 2J0JA 5JZEB 3UN2A 3SQGB 1RQ0A 1YJJA 1IXKA 3OLBA 3K57A 5CHCB 1E6VA 3KDNA 2K1RB 2N7CA 2ABYA 4HHJA 1MU2A 4MMOA 2GMLA 1S99A 1VR9A 1L2NA 2HWHA 1DZ5A 5KT7A 2J7UA 3MMBA 4IFVB 1SUQA 2F65A 1PIEA 3UCUP 3LYYA 1F1BB 3E9SA 5C23A 2G13A 5F8MA 2R42A 9RUBA 4OYMA 1H7XA 3SFEB 1HBUB 3KW5B 3PRBA 3IGNA 1HQ2A 2W8LA 3W64A 1SL2A 4IRCA 2XMJA 2VH2A 1E8XA 3FKBA 3IWLA 3V6CB 4DS5A 2FCMA 4XDDA 1KBRA 4KH1B 1H2VZ 1VDHA 3LUYA 4CI0B 2UU9F 4Q5VA 4ER8A 1YBUA 2OO4A 1SJ3P 3PREA 1SVDA 5C3JB 1GB4A 3BK2A 4X57B 4XWWA 2HBYB 3ISNC 2HNZB 2KO1A 1VGYA 3A8IA 3N6LA 3BH6B 4IRDA 1S3SG 4RM8A 1S59A 2J6SA 5KFUA 1U8WA 3S01A 3NBPB 1ZM9A 5T41A 1WGGA 1Q53A 1E9MA 2VB6A 2A0FB 2JX5A 2CG8A 4DSKA 5E3QA 1Q82T 2BKPA 3CJ5A 4Q2JA 1N32F 2K9XA 4BKSD 2NUUG 4N77A 5BYSA 2KL8A 4US9A 1A6LA 3UE2A 1U2RA 3KMSA 4AS1A 2L05A 3I9ZA 4YMEA 4JI5J 1NB7A 2R7OA 2RSQA 4ANXA 1QSSA 4UY85 4WZMA 1SE2A 1RHRB 1NBEB 1FRXA 3JQJA 1UPPA 3HCXA 1FO1A 2PMVA 1HA1A 1YITS 3NCRA 2WK4A 3WA0A 2KDEB 2JZ5A 1GQEA 2MBHA 4TU9A 3G9CA 2LYVA 2NREA 2VF3A 2ZE2A 3RAMA 2HMIA 3ZVVA 3T41A 1VIOA 3GYXB 3OTOJ 2GVDA 2HQFA 1X5OA 1S1VB 3G86A 2VIHA 3AT1B 3QJPA 3AM9A 3T5LA 4DN0A 3CD0A 1WX8A 2ZUGA 2XO7A 2CYYA 4PQUA 1UZXB 4HROA 4UOHA 5CA5A 1M5HA 3AHPA 2ZVOA 2F8EX 4TNOA 2EW9A 1GAQB 1ZA1B 3PZ7A 4PKDB 2O5DA 1IBKF 5HROA 2ZZPB 4WK1A 2D3CA 1MU2B 1XEEA 1OSDA 2V8GA 1LM8B 1SXTA 2HZVA 1B0PA 1FXIA 4O3NA 2MB0B 2VFRA 2HVZA 3W2VB 4Q7AA 3TZZA 3ETOA 1RYSA 3DWGC 2KDMA 4IOAQ 3VAKA 4QYRA 4YB5A 1KH0A 3LP1B 4QWEA 4DUYJ 1MROB 4WWMA 4ZDNA 2RT3A 2LASA 2RU9A 2J0SD 1ELOA 2OFHX 2AGQA 2WDTB 2KHDA 3HIZA 3IAS9 4M1KA 2DJWA 4PXBA 5LLIA 1B70B 3U7JA 1ZE3D 3R5BA 3UFCX 3C15A 3HVRA 2DYOA 4F7VA 2AJ1A 2APOA 1URNA 2V34A 2IC3A 3FMWA 3UVJA 4NPOA 1PBAA 1YTYA 4PYAA 3OTDA 6AT1B 2W9CA 3PX6A 1UWAA 4X62J 2WVFA 2D3UA 1M1HA 1GC7A 1WI6A 4YS2A 3PG9A 1T94A 3Q8PB 1RXOB 2E5LF 2FLNA 2BANA 2E29A 2D5GA 1TKZA 1C0TB 1WSRA 4O4RA 4J9VA 1S1QB 1P9DU 3JYTA 1NSQA 2G9OA 2JUOA 1RT2A 2UXBJ 3QWUA 4QIWD 5ETMA 1N5WA 3BN4A 5SZTA 3M9NB 3TYTA 4C97A 2K06A 1M5OC 3DWMA 1SJHD 3H7PA 3JSVA 5KFVA 2D3BA 4JOUA 4YSXB 1EETB 1W26A 1HQEB 4MGIE 2LWPA 4RNMA 3VAIA 1SH0A 3BSAA 4ZVFA 2KHCA 1F5AA 2M2BA 4ZPWR 3H7HB 1YX6B 1AZSA 1HBOB 3M7VA 5IV3A 2KKHA 2W2QP 3B82A 2MH7A 3HHLC 3MAAB 4NMLA 2PMWA 4GVLA 2DGUA 2LDIA 2OELA 1N5SA 1N5XA 4PABA 3W7BA 4DXLA 3OLMD 2XO6A 4IUMB 3CCJS 2XSJA 3MM8B 2CNNB 2GAHC 2V3PA 1QOGA 1VQ8S 4NXMJ 3CWJA 2G0IA 2L0TA 1LXDA 2DH9A 1UELA 4H2AA 4DCOB 2N4CA 1F2RI 4F1SA 2M5YA 2WHOA 2UUCF 3MHYA 3UW1A 1E5WA 1Q5VA 1C0UA 2AU0A 1R4MI 4LF9J 1EAYC 4EZKA 4DR2F 3IVFA 4PPZA 1CQMA 4KHMA 4IKAA 4M5DA 1HMVB 4AJYB 3GFHA 3C46A 4ECUA 4UQGA 4ZVPB 3DYAA 4CLSA 3BSCA 4WF9Q 2QFIA 3WAPA 4BCAA 2EC2A 1S9FA 1WXMA 5A6PA 1N4LA 3Q2SC 3PRDA 2PIIA 4M8LA 3ILIA 1SKUB 2V1YA 3WAMA 2GAGC 4DZ6A 4QIFA 3S7RA 5G4DA 1JLGB 1ULRA 1NDCA 2IJ0A 4BFRA 4J91A 4M0WA 4TLQA 3C2PA 3TR5A 1LFWA 2ADCA 4KT0C 3J81U 3EUB2 4BOZB 1T3NA 4C8OA 1EO6A 4CHKA 4JI4J 4O4GA 1XBWA 4DSIA 2DHGA 4OZNA 2OEDA 4LBHA 1L6UA 4CO7A 4C4VA 3LP0B 4ED5A 1F6TA 1UBQA 3R5GA 1CJVA 3JTPA 4Q2LA 5DG7A 2JY6A 2QMXA 1OQRA 2GJ2A 3RW6A 2RGFA 5C1ZA 2K7KA 4QR0A 2VBYA 3TBLD 2DH8A 3NZUA 3NLCA 3ZJTA 5AJ3F 4KJIA 2FD2A 1XMQF 1ZOYB 3JSVB 3H42A 1TJEA 1WHYA 3NWGA 4KBIA 4PQAA 3M6UA 1FA0A 3HVTB 4J9OA 1Q95G 4F3MA 1PGZA 2DR8A 3TARA 2H89B 2LU1A 4ED2A 4ZKAA 3UD5A 1TL3B 8AT1B 2WXFA 1PO6A 3P42A 3G6YA 4HI1A 3SCLE 5G5GA 2DR9A 5J1EA 4HHHA 4CYUB 4RUCA 2HNZA 2DHZA 4IOCQ 3QJZA 4DFMA 4DG1A 4W9GA 1FXAA 1X0PA 2E66A 1WC4A 3QQ8B 4CO1A 3W2DA 1U1NA 3QIDA 2ZJPQ 1X31C 2CPHA 1KN6A 3NP5A 2XY5A 1V86A 4FJYA 2UXDF 4FVMA 1OQYA 1HBMA 4ED7A 3CJTA 2VODA 1UCNA 2FUG9 2VOPA 4OZCA 1N48A 4RGMA 3J7YI 3MR6A 4DQIA 4JQWC 4OYXA 5JJBA 4ETZA 3CCES 4B17A 1MMDA 3C0RB 2UUAJ 2MTLA 1I94J 3VUWA 4JBCA 2J8SA 3Q86A 4ZCLA 5J2MA 4MK8A 1T9UA 1YJWS 4CP5A 1TQLA 1J19A 2Y5PA 5D6GA 3PNIA 3RB0A 1UJ6A 2B6AB 1VHIA 1N5YB 2XS7A 1WHVA 1N0UA 4L2YA 3L9ZA 3RYLA 4OZ0A 4Y00A 3I9V1 3SFDB 2MBBB 4ACFA 4DR1F 1PYTA 3UNYA 1CLFA 3BDEA 3WZ0A 4CO5A 1O5JA 3M30A 2MZSA 4JI2J 2P9CA 3LALA 2MZTA 2RILA 2DIUA 2O66A 4GSWA 4QIVA 3GJRB 3TQEA 1WJNA 4NAWB 3J81Y 2KN4A 2ERRA 4ILLA 5FD1A 1CJVB 1NK4A 1NDLA 2MY7A 5GMEA 3IR7B 3NCQA 3GYGA 2C3MA 2EC0A 2DK2A 1Q78A 2KDOA 4RPFA 3CDWA 3DOMB 1TUVA 4ZVRB 1MROA 1L3VA 1IQZA 4F02A 3EDRB 4IG0B 1U8SA 2K6QA 2J7QB 1SJED 3QPIA 2EBEA 2N1VA 1RISA 3KUDB 1JLFB 3ZTQA 4ECVA 3MM5A 2FJWA 3IR5B 1PC5A 3R7BB 3V6JA 2K3IA 1QD1A 2IPKD 3NAIA 4WFYA 2M8DB 2MX2A 1OPIA 1JMLA 2XMWA 3UIPB 3FZBA 3TA2A 2RF2B 1UJ4A 1WUUA 1H6KX 4IYQA 2V8VA 4ANEA 4MH8A 2R2RA 2V63A 3VWSA 4UQTA 2XYHB 1X4BA 3VAJA 4DV5F 4X4UA 5E6OA 3ZZUA 5J2QB 1EQMA 2MKJA 5KHQA 4ZYSA 5D0RA 2Y0BB 1RT2B 2VFSA 4NE9C 2L1AA 1G4CA 2ZVNA 4NL5A 4OI0A 3DHGC 4WJBA 4J9UE 1N32J 3K89A 4DL7A 2DGTA 1SQEA 4D3GA 4J9SA 4OX9F 4F4WA 2LEAA 2QIFA 4DR5J 5LXYA 3PS6A 3A13A 5HMZA 1U09A 5J17A 2HVIA 2CQIA 3EA6A 2VDIA 1Q7LB 4L73A 3CJSA 2OKQA 4CQNA 5BXIA 3KK2A 4DBQA 2BE2B 3K59A 3QGPA 3PYDA 4QYZK 3QT8A 3RT3B 1WKLA 5EN1A 3PLVA 1UVKA 4WKRA 2QFJA 2KFJA 4ZPVR 4QAYA 2DEIA 4IQXA 4LNKA 1KS2A 2OPRA 5KFLA 5ETVA 4B9LA 4Q2MA 4AWJA 2PW9A 1FE0A 3MDFA 3M30B 1U6BA 2MXYA 4BWMA 1NSPA 4RW6A 4K2XA 2EEYA 3TVZA 1WJUA 3BSOA 5K8MA 2G45B 1IN0A 1X0FA 1RLCL 2BYTA 5LMUF 4DX8H 2CWKA 5AEKB 2EFQA 4X64J 5F8LA 3W9CB 4ECYA 5ETSA 4FXWA 1C3TA 2CQPA 3RGIA 2KDFB 2VRRB 2MP2B 3VRAB 3H25A 1ZDXA 4HK2A 1T9VA 1HYSA 5D4LA 4W9LA 3UI3A 2HLTA 3UPFA 4ECQA 3K0JA 1ZPWX 2XB2D 3QWPA 1TL4A 3K8VA 3ZXRA 4FBTA 3AA8A 2DGVA 1QDUB 3MEKA 3B0AA 1OY9A 2RUSA 1SC6A 1V9JA 4M5GA 1FFSB 4A47A 1RT1A 1KHVA 4A46A 3A9JB 3FBBA 1RU1A 3PPAA 3SCKE 4OLPA 3DI6A 2H1YA 2X7IA 3B08A 5IWAJ 3M2RA 3I82A 4F25A 3QZ8A 1A9NB 1YJ9S 5L8RC 3SDLC 1SEBD 4FF1A 4IG3B 4FYVB 1ZDVA 5EE0A 3CB4A 3OJ4B 1Q1KA 4A3OA 3TZYA 1RLDA 3UDCA 1QY7A 3V4IB 1NHUA 1PC4A 3CMQA 5KOXA 2HEKA 4DR6F 3ZKJC 3HM9A 4MJSB 1CSJA 5CZVA 1H38A 1OIAA 5C25A 1E6EB 1LWEA 4GRSA 3SCIE 3EWGA 1SSNA 2C3PA 3ZTDA 5E3AA 3PYGA 4P74A 2F9DA 1FD8A 2CPIA 3FEZA 3FQKA 3W60A 2OAUA 4CWBA 3H59A 2E5GA 3BVZA 5IV4A 2GX8A 4USVA 3IC1A 1YJ7A 4YHHF 2ZBQA 4C8ZA 5DO2A 3KLHB 4DI6A 3U2SC 3M2UB 4B3OB 2R3VA 3PVXA 2CQCA 2HPUA 1WYWB 3OD2A 1S6QA 2JDJA 4DHZB 1VLYA 4A8KA 3HT3A 4I2QB 3SFUA 5IM0B 4O3PA 1SXLA 1RHKB 1PAEX 2IFXA 1FM0D 2WTFA 2M56B 2WVDA 1YRXA 4LLGM 2J0WA 4OZAA 2WQYB 3JTNA 2R7QA 2YX7A 4IH7A 1ZPSA 1WH3A 4X4VA 1K47A 2G2YA 4RL1A 3Q8CA 5IKCM 4ARCA 2VH1A 1N88A 5D0GA 1Q5WB 4EYHB 1BHNA 3R5JB 3P8BB 4C3KA 2UU9J 3HFKA 4IWOA 2RDDA 3R5CA 1H2TZ 4ZPCA 4H4OA 4XDCA 1SJ1A 4MM3A 3WCQA 3MMCA 4JB8B 3Q8VA 5HBMB 1FMAD 1CVJA 3G87A 1B7FA 3FZ2A 3GILA 1HYSB 5BMGA 4DPUA 3GLJA 4DSFA 2W9BA 3NS7B 1RAGB 2VG6B 2Y1JA 1R89A 1L0VB 4Q0BB 4LRCA 2QLWA 3PO4A 3R6GB 4CLKA 1KLMA 1FFWB 2YKQA 4CTAB 2Z30B 1QOAA 3Q83A 4WZQA 4NX9A 4DL4A 3DFEA 2MZQA 5BO4B 1JKHB 1R8AA 2MLYA 1X4FA 1P8GA 2YNFB 4MAKA 2WONA 1WG4A 4YXDB 1S79A 4H4KC 3M6VA 2XSFA 1GG3A 4I56A 2KM8B 4QPXA 2RKIA 1JJ4A 4ZIVA 1RM6C 2DD8S 5D3GB 1FVSA 4AUKA 1LW0B 3W2WB 3HZGA 5CHFA 3GIKA 1F2RC 2A6OA 1FDDA 2DX5B 1KOOA 2BR0A 1IBLF 1RWWB 3C14A 4ZPBA 1YRUA 4MEMA 2FIUA 1E6YA 2HHUA 1Q0WB 1CC7A 3UDEA 3CDUA 3NGRA 2F40A 4USIA 3I31A 1D3WA 4K4XA 3B1LX 2ACMA 4K2JA 1RLFA 4C80A 4URSA 3RAQA 2IDEA 1YOVB 2IM1A 3ZYYX 5EX3A 3MM5B 1PGAA 4LR8A 4HL9A 2CVEA 2C2EA 3KG0A 1HW9A 1CJKA 5IXUA 2A18A 4AP4C 2IBOA 3TEYA 2KXJA 4I6PA 3H5YA 1V5IB 1PDXA 2V69A 1HR0J 4DV2J 3IXQA 1UKUA 3MD1A 1RKIA 2HFUA 1U02A 2YQ1A 2JF5A 4F8CB 2QLBB 3PHXB 5IT9U 1NK5A 1U1RA 5J2PB 2UZAA 5IM0A 4F26A 2XLKA 2OH2A 3MEEB 3QZ7A 4CO4A 3F41A 1XWLA 2DZIA 1C1CA 5DZ7A 4B95A 3HHDA 3A33B 4C7ZA 1NK0A 1VQ5S 1A0OB 1VZ7A 1Y9OA 3N01A 2CQ1A 2HNDB 4Z7CA 3HJVA 3PW4A 1HNWF 4HHUA 4L6V3 1UF0A 3CJRA 1SE9A 2Z59B 4DV2F 5FJ4A 1MMLA 3ETRA 3SBMA 5CCMA 4AQYJ 1NKEA 2LQBA 1BLUA 1TS2A 2H4WB 2NCNA 4H4OB 4ICVA 2HZAA 1K53A 3LP2A 1SJQA 3QRRA 4NZ6A 3WX4A 3LJ3A 1ZETA 3C6TB 2QYGA 3PX4A 2OEMA 5E6NA 2OTLS 1WSVA 3BZQA 2FTRA 2Q1LA 5H8YE 1M1GA 4N8OA 2FB0A 3KJNB 1GXUA 1JWSD 3MMAB 5KFEA 3F73A 2KAJA 3D32A 2FCQA 5HO4A 1TY2A 1MWYA 1KWMA 1RTJB 1VQ7S 3RNGC 3Q3NC 2DCLA 4ILMA 1AROP 2JFKA 2V68A 2E1MC 2IO2B 3Q8EA 2XK5A 5ETKA 3OHAA 4RW6B 2EI5A 3MFHA 3W8PA 3CSKA 1DOXA 1HWIA 1V1PB 1QILA 1WZ3A 2KHWB 3T1HF 5KG7A 4PK1A 1WORA 3I4PA 2YWKA 2CJAA 1FT8A 3MI7X 3DMJA 3H2UB 2DH7A 1GT8A 1R0AB 3EYZA 2HJ8A 3CIRB 3KYLA 2VFUA 2OGUA 5H9FK 1D6EC 1QTMA 5F0UA 3OR2B 3NGSA 4YUDA 4ZIWA 2ZBRA 1S6PB 2AT1B 3JSMB 5GADI 4X66F 3VRBB 1QTNB 5JHAA 2MQMA 3GWCA 2D1CA 2V2ZA 4M5JA 5L1IA 2AWZA 1I4PA 1PG5B 4F04B 5JUMA 5DLFA 2XCAA 2KTRB 3W1SA 1B3TA 1BXTA 1WM2A 3ET6A 1QM9A 4W9FA 2GZOA 2CWXA 3HHLB 2P5VA 3KTQA 5KFMA 2IMWP 3U7ZA 4NLQA 1G2EA 2XBPA 5D15A 3VUXA 1XMBA 1V8CA 2MQNA 4CH1A 2YKOA 3SZ2A 2DO0A 2MZ1A 2HYIB 2C3UA 1S49A 2EK6A 4DL6A 2WS3B 4F0HA 4IO9Q 1SC4B 3PZDA 3HVDA 4XAKA 5E3CA 5H9EJ 1N60A 4JV0A 1RDRA 2Y1LB 1E10A 1B0VA 3DBRB 1WMHA 2KWVB 4NCAA 4LK0M 1YJTA 3MM6A 2HD5B 2XYPB 2JC0A 3SSRA 1YZ7A 2HWIA 3LOUA 2GJIA 1S6UA 2UUBJ 4ZK7M 4RW4A 1VZ8A 2ZNVB 2WGSA 2E44A 3LGMA 1S1VA 2HHTA 1EF1A 1QSYA 1Q8KA 1GX5A 4ELTA 4GKKJ 4PWDA 3D1HA 3AE7B 5MPOA 1FNVA 2KT3A 3FC9A 4WFZA 1X5PA 2HBRB 3M2VA 5IA7A 3AOCA 4LF2A 5ITHA 4ED0A 4LDTD 2ZH6A 5A6WA 4OYAA 5I3PA 3HVZA 4U67Q 3H7SA 3NMAA 1NDKA 2BWFA 3BB5A 2DNFA 3H5SA 4WE1B 2F7VA 1JJCB 4FKYA 1UZDA 2V9HA 1KF6B 1KQKA 3SYZA 2MCNB 1HI8A 1FF2A 4USTA 2Z2LA 2GHVC 2WVBA 4KV8B 2XTJP 3OTEA 1JCKB 4I7FB 5KAKA 3NG8A 2WXNA 1RT5A 3HVAA 1IKYB 1I4HA 2XMMA 3KK1A 3HHMA 4MACA 3SIPB 5EGYA 5MLCV 4ZVEA 5HJYA 3D3CJ 4JI1J 4NA2A 2CZ9A 1NB2A 2FZKB 1DQ9A 1WC6A 4KSKC 3NS6A 4ANWA 2W4DA 3AD7C 3ENEA 2ZD1A 5F3TA 2FIFA 3GQCA 1FDNA 3VAMA 1HNVB 1PYWD 3HD2A 4LQ9A 3TA1A 1UD7A 2E9RX 3D1OA 2BACA 3PYFA 1WF9A 5D4NA 4RUBA 1Y3JA 2VG7B 1E6VB 3N4WA 2XZDB 3A3NB 4F4KA 2GIFA 3DC2A 2PN6A 5FR3A 1L3UA 4U7CA 5HLFA 4WIIA 2RKIB 2M3DA 4HVBA 3NWRA 1WOPA 3NGUA 1FNWA 2DY1A 3T3OA 2ZW0A 3ZNJ1 2Y8WA 1NM2A 3ADAC 3IXSA 3AEEB 5KFHA 1N5TA 4RUHA 3H1UA 3QWZB 3GSIA 5IC6B 2E9TA 1EX8A 3TL5A 3B4DA 1EETA 3PR4A 1CJTA 3JW0X 4QU7A 5CD4A 2FQQB 2V3NA 4NI2B 4C4WA 2FVCA 4K5RA 4DLGA 3LANA 4II2B 4ZMMA 3PFEA 2NXJA 3T1YF 4KR0B 3Q69A 1A7GE 3RBZA 1VZ6A 3GR0A 2CPZA 2VHGA 3BYTB 4J7CA 2J53A 3HZEA 3BVGA 2F5GA 4LUBA 5FIIA 1FPYA 4EFOA 1KLNA 3QT6A 1JIHA 2E1RA 3VH4B 2YKPA 5KG4A 4I0WA 1NMEB 2MMYA 2WBMA 1KTVA 1XO3A 2QL5B 1TR0A 1T0SC 1KFYB 2KACA 2AZ3A 2KB2A 2AEHA 4ARIA 2D9OA 2Q6CA 3QIJA 3ZGZA 4DSLA 3VR1A 3DCGA 2HS3A 4BBNC 5FLXU 1LKZA 3OJUA 2PA8D 4B3RF 4XX5A 4Q43A 1VS3A 5DDRC 3DLHA 3M8ZA 1Y11A 1S1XB 3LGHA 3PW2A 3OL6A 4J9LA 1WI0A 3TEGA 2LXCA 2ZITA 8RUCA 4DV5J 1N54B 7AT1B 4DHJB 2LA6A 1R6YA 3R7SB 4WWPA 4E71A 1XQQA 2K3KA 2IAJA 5J2RA 1CC8A 3BGUA 3ZC4A 7FD1A 1V5OA 4FNHA 4CO2A 2HS0A 4LFCJ 1YBTA 3MMAA 3QA8A 2KX3A 2QRRA 2JSVX 2DHSA 3CD7A 3KUCB 2G2ZA 2G2OA 1AFJA 1REVA 3DOKA 3NGDA 3LGNA 2NXCA 3GG1A 2CNOB 4EGLA 3FUYA 3LP0A 3ZJUA 2CPFA 1WHWA 4TVAB 5HANA 1AW0A 4WIQA 3PY8A 3APDA 2JJ4D 4DZDA 2PIAA 2J9EA 3CCSS 3E8OA 3OHBA 4PAAA 4M94A 5FR6A 2QJ3A 1SL0A 3DDCB 1RBAA 2O2VB 2XMUA 3DMJB 3VAFA 3AEAB 4ZLPA 1PGXA 1R0AA 1VRTB 1HZ5A 4ZS6A 1JWBD 1JW9D 2ZOGA 4PZVA 2H5IB 4YFUA 4HPMB 1RHUB 3AE6B 2YNGA 4F7ZA 3U8ZA 3Q8SB 2EFOA 3ZRCA 1L5UA 1K9MT 2FJBB 3AEGB 5EUHA 1U2FA 1RK8A 1FEHA 2ZZNA 2W25A 2N9PC 2FBWB 1V3SA 2RQ4A 2R7WA 4KO0A 2R8IA 3AB2B 3M05A 3MCNA 2LLZA 2GNKA 2FY8A 5HAOA 1RACB 4JIOU 1VLBA 3WHIA 3ECIA 5EDSA 4JI5F 3OBIA 4DG1B 2Z57B 4JI8F 2WXLA 3DLEB 4MKBA 3ZTCA 4D2KA 1D5XC 1X4EA 2YVCA 2M17A 3VVTA 2CJNA 3RNFC 3O5TB 4RU9A 4M5HA 2BS3B 2DHXA 2W2NP 4MH0E 3D6MB 5C24A 2HHPA 3UO0A 4A8XC 3CCQS 2F9JA 1Y4ZB 5KFGA 2CKWA 1IPGA 3L3CA 4EEYA 1LFDA 4JP8A 3JTOA 4WBFA 2L52A 3PHEA 1JLEB 3DRRB 2QEJC 3CMES 2JVOA 3MHSD 1WJ6A 3ZJVA 3UR3C 3MJWA 3HLUA 1RT7B 4FS2A 2RRNA 2CQDA 5F3ZA 1RJJA 4BLGA 3T1AA 2XQCA 3O65B 4GKJJ 1VQNS 4A48A 4YB6A 2HHWA 5KFJA 2DLBA 2IJFA 3QGHA 5KOWA 2DTJA 2YQ0A 2RPVA 4A90A 4XK8C 1KM7A 2KX0A 2B6AA 2G1DA 3N9UC 1DLOA 5A76A 4RMAA 4DV1J 1KQGB 2R9LA 2CPYA 2AF6A 2ZZMA 2ZCBA 1UW4A 1UA1A 4P10A 4TY8A 1H0HB 2QN6B 4YQWA 1AB8A 1V6HA 4F67A 1F9HA 1VBYA 1JWUD 1VD2A 4L23A 4IC7B 1WD6A 3HT0A 3ONSA 1HWKA 1P27B 4WXOA 5F8NA 2DYMA 4Y2KA 3C66A 2LXUA 5AXLA 2LXAA 1A70A 2RIJA 3MMBB 3PYEA 2PMHA 4G6VB 4CZCA 5KFQA 3FCVA 4YR3A 2MQQA 2AIRB 2F4VJ 1WJ4A 1TL1B 2R7UA 3HDSA 2FDNA 4ZN1A 1A5RA 1WR1A 4N5SA 1R8PA 5AE3A 1FI4A 4FLHA 4OJ1A 2N7JA 1KC8T 1V6EA 4K4YA 4K4UA 2GIRA 1ZM4A 4MJKA 1IJEB 3PEJA 3EHVA 4GLSC 3IMQJ 1L3SA 4JUZA 2XZTB 1T03B 1HBNA 2RF2A 3OT9A 3MCSA 2FLPA 3GIMA 4DR6J 4HJKA 4NLVA 1TELA 2W55A 3IWXA 4AQYF 4C98A 4FULA 1E7UA 1ENFA 2LMCA 2C3OA 3BM7A 2GIQA 3M95A 3QJJA 3AV8A 3G6ES 3VQIA 3MURP 1DTQB 2WXJA 3CCMS 4KVGB 3ENAA 4L1BA 1WNEA 3AQPA 3I5AA 4WP3A 3M8QB 3M32A 1OGWA 5CQGA 4FYYB 4AE5A 2RB7A 4NYOA 3JS9A 1S97A 4RNNA 1X4AA 3UQBA 3ZIMA 3T3FA 3PJWA 1MW7A 4H54A 4MYUA 1NBFC 2KYWA 5D77A 1VYAA 4Y65A 4O44B 3BH7B 1N5QA 1GAOA 3K8WA 2VBXA 3G4SS 2BW2A 5EX0A 4MT1A 4B3MF 4CNYA 2CQ2A 2KJWA 5HI7A 1ROFA 3LAMA 1J27A 3DBLI 2RHQB 3IAS1 2G4DB 3R2CJ 1IVZA 4OW0A 2X38A 1NO8A 4EZLA 5CHVC 3W3SA 3HSDA 4XTTA 4DV4F 5D0HA 4QIGA 4ECRA 4GXBA 4LSNA 4FKXA 5IOLA 4N7TA 5D94A 4C11A 4KSLC 2MKCA 4TY8B 3RZAA 1UVLA 2MSTA 2AJFE 5THWA 3BWUD 4WK3A 3GSDA 1TMJA 1F9EB 3J7ZT 4DX7A 3HSGA 3I5BA 2JH3A 1HR0F 4FPIA 2AGOA 2OMOA 2MBEA 3KDOA 1C9FA 4OI4A 2KM8C 2R7RA 2NTTA 2J9DE 3A9KB 4Q8EA 3LWMA 2R61A 4NOHA 3DLGB 1WC3A 2A2DA 1HNZF 3BIID 3BBCA 3KVFB 1LEOA 2RD0A 2E5LJ 2KFKA 3G82B 2INPE 3BKFA 1DAXA 4PRFA 2FAZA 3NOBA 3IGVA 2OJWA 3LQVA 3NNHA 3CJ0A 5L1JA 4YY3F 5D6JB 4GGQA 4F4XA 3JXOA 4RBVA 2G3QB 3GE3C 2EMSA 2NSCA 1PYOB 2BYFA 5TR5A 4RWWA 4G50A 4WFXA 1FKOA 3MC8A 1U0HB 1U4AA 1REVB 3DOKB 4O3RA 4N56A 2VPXB 4N8NA 3CCTA 4MKVA 5AUKA 1NZAA 5B0CA 3AEFB 1UWBB 2CDQA 4EFAC 4NLXA 1TKXA 1JK9B 2YKMA 3NZ3A 4QWDA 4ALZA 1HE8A 1RHJB 2HURA 5KFFA 2MJEA 1VRUA 1UVNA 3TJ8A 3GU0A 4DR3F 3EE3A 2VKZG 2ZBIA 1QLNA 1T05A 1DHMA 4KGRA 1HW8A 2BJ3A 2F8MA 4PG6A 2J6UA 3QRQA 2KKCA 4P75A 4GB9A 1KLGD 4NYPA 1HWUA 2N7DA 2O2VA 4B9SA 2R8KA 3LDZE 3WBZA 3BS9A 3B4MA 1FJCA 4FNIA 4YL8A 2WNMA 4GDKB 1DTTB 3LWLA 1HLWA 2NBUA 1QUVA 1JNZB 3KLFA 5KFAA 4RBTA 2PJHA 2DZKA 3LO3A 1NJXA 4K4ZA 2GBJA 4RNHA 3CDAA 4P52A 1XEZA 2MKKA 5M2RA 4DSEA 2ZOMA 4YHHJ 3POTA 1UP1A 2HVEA 2CQ4A 4DR2J 1VJWA 2UP1A 2X3GA 4L74A 1NVID 1RYRA 4IOIE 2HGMA 2G0JA 5LSLA 4KHPF 2ZC4A 4R5PB 3EECA 4N58A 1VC0A 4JI0J 2BUNA 5E5NA 2UXCF 5J2QA 3NY5A 4L72B 4KQZA 1J0GA 4NAMA 1LWFA 2ASLA 2F1FA 4I6AA 4ES3A 3KQ4A 3HFZB 1SJ4P 2ZWPA 1RAHB 1FJGF 1X5SA 3K58A 3W5YA 2FJVA 3WALA 1YHQS 1RAEB 5HL7Q 1VQOS 1FRIA 1S9GA 1JLEA 1SL1A 4KRWA 4J9RA 3NKYA 3I55S 2BRLA 4S0MA 4DR7J 1LK7A 2AJQA 5H1SV 4HT5A 3UINB 2AD9A 4RF0A 3N28A 3EMTA 5GAHI 4QW9A 1PJ7A 2JU6X 3BK1A 2XLJA 4KDIC 4NXMF 3RRKA 1DBDA 2VG6A 2GJFA 5A2QY 2DRAA 4B3RJ 3KH0A 3IG1B 2UXDJ 3GMGA 1LXJA 4G1PA 2WLBA 1QOBA 2GVDB 3K5OA 1X4GA 5KFKA 3K17A 1R0CB 2B56A 2IY1B 2QSDA 5A8RB 3QJLA 4DPWA 2KI2A 3D2WA 3OTCA 2YNHA 4I6YA 4DPTA 1IBMF 4W9HA 5FKAC 4C56C 4DV6J 4IFYB 2W7OA 5ETTA 2YX4A 1RA6A 3HKZD 4XYCA 3NRZA 3J7Z5 4KGSA 1GMVA 2MSED 4U8VA 2LJIA 2OOBB 3QIPB 4ED6A 3CO9A 3KHHA 3L7PA 2YKMB 4NEYA 1S5ZA 5C5JA 4F3QA 1QOFA 4TKNA 3AXKA 3DRSA 1QF6A 2ZC3A 4PT5A 5HJXA 1U1QA 2QX0A 1RHQB 5C2GA 4R0JA 3OJSA 3QT5A 1P3QU 3DHIC 5CHWA 2XHCA 2ZZTA 3TUJC 2X1GA 1XJWB 1FO4A 1F2GA 4R0EA 1GPXA 2DNHA 3X23A 1F0XA 5DQIA 2GHWA 1GXLA 2KWDA 2I0XA 3I0SB 2HHQA 2PVGC 1N34F 2KZZA 1VC6A 2DAFA 2G4BA 2JX2A 1IGDA 3AAWB 3O13A 4QW8A 2CVIA 4OV6A 3U1MA 2FC8A 1HI0P 4KH0B 2Z0DB 4IR9A 4EBEA 2KJ6A 5HATA 1TZOA 2GOWA 4MK7A 1RTDB 2BM0A 2GW8A 2B8PA 1Z5SB 2O6VB 2ZPYA 3IA0A 3BQ2A 2WAQD 4AXJA 1EU3A 5J2NB 2KDIA 2WYQA 3A3OB 2ATCB 1B4SA 2WWZA 4OJGA 5J1PA 4B3SF 3FMBA 1ZPVA 4XPEA 5A0YB 3JSRA 2YPZA 5HFYA 2HG4A 1WIAA 3LP2B 5HVGA 1U45A 4B9MA 1RFKA 1OYEA 4MTPA 3ZNUA 2PKOA 2R7VA 2DYBA 3N6MA 3FBCA 2CXEA 1PKUA 4K7WA 1TKTB 2EFVA 1W2BR 4KIAA 1Q8IA 4YOEA 2M0XA 4LNOA 4UZBA 4EK2A 3Q8RB 2K8CA 4EBCA 5L83A 4ID5B 1FE4A 5I42A 3L08A 4LIRA 5K14B 5HQLA 2C22A 5LXRA 4LFAF 2MLBA 5D0EA 2HFOA 2XNAC 1O0PA 4FADA 5DCNA 2RMMA 3O1LA 2ZH1A 3EZUA 2K5PA 3BGRA 2QV6A 3EJMA 2L76A 3TOQA 2NR0A 2HGNA 5KFBA 2IGDA 3PACA 3EVMA 1GTHA 2Y9HA 3O44A 1YQHA 4YT0B 1K1QA 4NAWA 2WB4A 1XLNA 3ENWA 4O3SA 4NLUA 1CPZA 3OXFA 5CTRC 2L9DA 4S0RA 4M5DB 1YI2S 2W9BB 3DHHC 1M5PC 2WXKA 2B76B 3TSSA 4D3HA 1NNDA 3DOMA 3MPYA 1JRUA 4GDLB 4YTPB 3ZQ4A 1U4BA 5DRKA 1T0YA 3D6TB 4ZVOB 1VISA 2KXFA 1KQFB 1UL3A 2M8SA 1CS4A 2QSWA 2FJAB 3CC7S 3MD3A 3W61A 2ACYA 1VLOA 4HLEA 1CJUB 1RWVB 2C3YA 2J42A 1RU2A 2OEJA 4U8YA 2L8JA 2LDYA 3BZDB 5HMYA 3MUVP 3BREA 4R3DA 2IYDB 3RW7A 1EQ0A 1Y5IB 2HHHF 3K9OB 2AWTA 4LJOB 4NA1A 1YKWA 3M8SA 4JI7J 4WWNA 5HVFA 1WKJA 2Z56B 1Z4UA 4NZ0A 1HWJA 2RQCA 1G6BA 2I2YA 2PI4A 2DXDA 3MPWA 1VRUB 3RBEA 2MEKA 5ETRA 2D3OR 1TAQA 2VU5A 1EP4A 2HHVA 1J7CA 2RDHA 1UW9A 2W3RA 4KZCA 3O6QA 4RJVA 4USHA 4K3BA 3M9MB 4ZP7A 4DF8A 2WHIA 4DPYA 1JLQB 5IAAC 1WGRA 3V5RA 3EGZA 4FXDA 1U47A 1S6OA 1KVKA 2PDAA 1NAQA 3FSIA 4EMDA 2BZ2A 3QFHA 2IBKA 4MKYA 4TKTA 3CE8A 3R5AA 1Z2ZA 1RT6A 4DR4F 3PCOB 1UFLA 4WCEQ 3FKYA 1V81A 2BJEA 4K59A 4OJ3A 1U25A 4W9EA 1SIJA 3B2FA 1TTHB 2DNQA 3KNGA 2BM1A 2VDHA 4QJVA 4LNFA 4CYUA 2E1CA 2DBYA 3N0VA 3RCZA 1TV6A 3ALBA 5LMNJ 1ZH5A 2MHJA 2I9SA 3CD6S 3SHQA 2Z58B 4JWSC 3CCLS 1H8CA 3QQCD 2C2ZB 1GMWA 2CJOA 4U7UD 2HNDA 3OSNA 3PRMB 1YJVA 2FYXA 3D0IE 3IRWP 5MAOA 1FWPA 3GR1A 3AN1A 2HQDA 4J9MA 3CIMA 1VQ6S 1WELA 3G8TA 1ISNA 2EFPA 2NMQA 2CIMA 2KLGA 2E1AA 2GQ2A 4I7FA 1SCJB 4IM3A 4RX6A 1P1TA 4ZJOA 2MWSB 3KK1B 2UUCJ 2BQQA 4USAA 1RB0A 2V4RA 3B2GA 1Y3KA 4ZPDA 4WAFA 4JL9A 1M5KC 1KTKA 3PZ8A 3CWIA 1F2HA 3K5NA 2ZFHA 3RPFC 4O23A 1SKRA 5J2MB 3MHZA 1SV5B 4UW2A 4RZRA 2ZD1B 2WXOA 3AE3B 4WTOB 9ATCB 4LF7J 3AE1B 2V2VA 1ZBTA 4LF4F 1F3FA 2BT6A 4R8UA 1RTJA 2HTME 1WACA 3NVZA 3CO0P 1WXVA 2BW7A 1VCBA 2D3GA 4DX5A 3A9JA 5AE2A 1I4GA 4LVOP 5T8IA 2O01C 1OY6A 3EPGA 1VDVA 1TMMA 2NBVB 4AJWA 3RB6A 3GIJA 4ZPTR 2MQLA 1UETA 2XEWA 5ADZA 2HWTA 3EGNA 4KFBA 1YLXA 4A8SA 2QT7A 1FKPA 1UEVA 4IQMA 5G0RA 3CF6E 2LHEA 5KG0A 1Q79A 4P73A 3BSNA 3BGLA 2CA9A 1OTRB 1FIQA 3PGEA 2JYTA 1NH8A 2YVSA 3L54A 5FDLB 1FK9B 1S4EA 1FESA 5IZHA 2DGWA 2DVIA 1YK9A 3OR2A 2JRSA 2WXQA 3IO1A 4Q45A 3N32A 1QE1A 4KHPJ 4MSMB 1S4FA 1JLFA 4IDIA 2V8DA 2NYIA 3HM3A 2JPHA 2EKIA 4O0IA 2B9EA 5KT2A 5G5HA 2HS4A 3MPVA 4QYZJ 2LD9A 3SDEA 4ITSA 4RW8A 3L16A 4PG4A 4OI3A 3OSPA 2PC6A 3DRPA 3HSJA 3MFGA 2RDJA 2HQGA 2BXJA 3KKFA 2ZW1A 3K5LA 2E7WA 1T11A 3KWMA 3UNGC 1YX2A 2HKEA 1VJKA 3C19A 4EUTA 3QHTA 2DZMA 4OYIA 2O6VA 5HSPA 3M8PB 4LBPA 2OTJS 2Y8YA 1WFYA 2EXUA 2O3DA 2HQCA 3FQLA 2LUEA 4CLYA 2W01A 1NI2A 1V3ZA 3G2XA 1JXVA 4RW7A 3BEGB 3D3BJ 1IKWB 2WW8A 4XE0A 2PA3A 3VVWB 2AW0A 3VZIA 1Q10A 3DBSA 2JOQA 2J0QD 4HDGA 2E7VA 1NPKA 2BA9A 1XNRJ 3A8KA 4RW9A 4Q0BA 3QYYA 2DNGA 5GAEI 4WPAA 5HVHA 5I42B 2B9YA 2QILA 4WP8A 4YEAA 4OX9J 2N0SB 4EEWA 4UY8T 2KD0A 5DJBA 4RF1A 4QU6A 1OFFA 1LNQA 2I1JA 2OPRB 5L46A 2GMHA 2ZH7A 2ALZA 1HHTP 2BB5A 4REZA 3U02A 2B3AA 4TUUA 3AXMA 1G6JA 1NCLA 2C5LC 3UGBB 2CJQA 4WYWA 2ROEA 4KV8A 5LL6d 4XC2A 3DGVA 3BGRB 2JEJA 1WR6E 3ZTRA 3CCUS 4BC7A 2N1WA 1FCCC 2CU3A 1TKGA 4Y2MA 4A8MP 1YVFA 2VZKB 2DR6A 2VL1A 2X51A 1O51A 5DZ6A 2C2RA 4KIKA 1D9AA 3HMJG 4GDLA 3Q8AA 3TEHB 3CJ2A 3KYCD 4B9TA 1RAXA 5EWEA 3P2BA 3SR6A 5DS7A 1VQPS 4OX6A 1AW7A 4DU8A 1XLPA 4YB1P 1FJ7A 2INDC 1CJUA 2INCC 2BJDA 1K8AT 3OG5A 2GA7A 4L3NA 3R1HA 2A1BA 2MYFA 4FXVA 1H3DA 3NBPA 1TGZB 3M2RB 1D3ZA 1Z2MA 1S1TB 2WXIA 1YIJS 4FYDA 2NQPA 3PSEB 1RYJA 5CXTA 4USWA 3FAHA 5KG1A 4KHRA 3V4IA 2R7SA 4DOZA 2DNNA 1D09B 5L9XA 1LW2A 3UQAA 2NCKL 1E0ZA 1H4RA 1KP6A 2WRMA 1WC5A 1HA5A 2VH7A 3V05A 1JLQA 2DBBA 1D0EA 2L41A 1S9EA 2NYHA 3EZ5A 4K81A 3KXDA 3DGPA 4RW7B 1WX7A 1IKWA 4GC6A 3W1YA 4WFNQ 3GIIA 4ICUA 5JH5C 4V1Ak 3AOBA 4YTNB 3EGWB 2ZNZA 2KZMA 3M63B 2C2OB 2LMIA 3CJ3A 4HH0A 5LSRA 1C77A 4TSSA 1CK1A 1VQMS 4I67A 1C4CA 3ONQA 4ILRA 4EO6A 3B54A 4DN9A 4HEA1 4UOFA 3DBLB 4ZRQA 2RNEA 2PE9A 1TV6B 2H5JB 4II3B 3C16B 3VAHA 2MHNA 2JXXA 4FYWB 3BYPA 3MOJB 1C2PA 3RR7A 4KGXB 4K4TA 4FS1A 1R43A 4HTIA 3CMAS 1XMOJ 2ZH9A 1PJ6A 4QOTA 3T9ZA 1HI1A 3RFZB 4ZOSA 4NJ7A 2JHEA 1FRDA 1IQTA 3V6DA 2V0GA 2LKZA 1YN3A 3JSYA 1XR7A 5I3QA 1V1PA 1LWCA 4G0NB 1YWXA 3W2VA 2DXFA 2U1AA 1JQGA 4ITKA 3TAMB 3P1MA 3DDKA 4I4BA 1X60A 2KWCA 1KRPA 4URQU 5GMDA 2KTFA 4DJBA 1U1OA 2WOMA 4DPOA 3PRZA 3MEGB 5B0FA 2L00B 3GONA 2AX0A 3OLAA 5HQMA 1UVMA 3CMMB 1LWXA 1VK3A 3IAM9 3D66A 4MFBA 3APFA 2K7JA 1RHMB 1U1PA 2YKNA 1L4ZB 1AUDA 1JMTA 2GQCA 4K7QA 4FP9A 3TA0A 4WIPA 5DPWA 2KT7A 1JLBB 5GADU 2QYCA 5KFZA 2VJVA 3HK2A 2D07B 2MJ3A 2W9CB 1TKYA 1LV5A 5IS2A 3P6YC 1BY9A 1VK8A 3OFEA 1Y10A 2SAKA 4EZJA 3VVUA 3NUHB 2QDFA 1NYRA 4MELA 2C28A 5DQHA 1TKZB 3DPDA 4GMVA 2WX0A 4PS8A 1EHWA 2BE7D 3M8QA 1SH2A 3IBCB 2RAQA 2A3JA 1ITPA 1VRTA 5KG3A 1O8BA 2VZ9A 3R3MA 2DNPA 2NZCA 4WJNA 5FDLA 4G3IA 4C00A 4PWUA 2OP5A 4CLUA 2MA9B 3O3LA 1RZMA 2Z0GA 3BQ1A 2XMAA 1HQEA 1WY8A 3KWVA 3N30A 3Q3JA 1S9EB 1CULA 1IBMJ 3M6WA 2DGQA 3THTA 4GN1A 1QE1B 5GVQA 2FC9A 2DRDA 5EE3A 3OVBA 4DK5A 3T8MA 3IM9A 2DXEA 1KTQA 5HP1B 1CJKB 4A9AA 1RAIB 3MZIA 5DPRA 5AZGA 4WAAA 4L3KA 3RMKC 3EVOA 3O8WA 2BS2B 1NUEA 2MJNA 1V3RA 2JFDA 3T6BA 3ITHA 2VV5A 1KOHA 2CZVC 2MDAA 4G1IA 2LA4A 4JE3B 2GI9A 2RRAA 1BMLC 4ZVSB 2YKAA 3ZNHB 4J37A 1PUTA 3MR7A 2FVPA 1XD3B 3K2YA 4GKKF 2DGSA 1FDBA 5B0BA 3EX7B 5LT5A 2MBOA 4AFFA 2J8AA 4WE1A 5LMNF 2B8QA 2B7BB 3G71S 1VRQC 2LFIA 4NASA 4WQOB 2UUBF 3MECB 2WVCA 5KFOA 3AECB 2UXCJ 4HDHA 3GOEA 3TO8A 2VBZA 1JLCA 1RT5B 2AYEA 3TAMA 4FF3A 2KT5A 1IUJA 2KDBA 3HD1A 4K7UA 3W8GA 1Q7YT 1GNUA 3HHLD 1WGYA 4BDPA 1E90A 1YMHE 1NENB 4ZRPA 3V81A 2V50A 2DISA 3KK3B 1OEYA 1RT4A 5E7OB 1N6QA 4IH6A 5LMUJ 3PV8A 4ICLB 5T7LB 2R2OA 4DV1F 1WHXA 2Z2MA 1JLBA 5B08A 2D11A 3EPIA 4B9KA 2WBRA 2KRBA 3C3LA 4UDUC 5HROB 1I5OB 2MSSA 3PHTA 3NEKA 4GO5X 1XTZA 3HJFA 2ZNYA 2V4JB 2KG0A 3HULA 1U49A 3CJKB 2CQGA 4M01A 3ILJA 3SSSA 1ZZNA 4UUWA 4LFCF 1JALA 4NLPA 3CSFA 2CKHB 2IM0A 1NH7A 1YIWA 3J81j 2ICIA 2ASDA 2FCSA 1WF1A 3TUOA 4LCDE 3SD5A 4PYUA 2B5JB 2QE5A 2UUWA 4DUYF 2ZEQA 3EXYA 2DPIA 2CQ3A 5J1NA 3OXGA 4E2FB 3PRPB 2BE9B 2Z8LA 2E9ZA 3HVTA 4FXCA 1CJTB 2FY1A 3C15B 3KLIA 2RR9A 3L13A 3I63C 2FVRA 2OHFA 3UVJB 2M7SA 1TL3A 1YDLA 2BKOA 3A12A 1HQUB 4CT9A 3AD9C 4LMZA 2A5UA 4OLOA 1WDDA 4RUAA 2HZCA 2LRUA 2J52A 4ETXA 3TVKA 5HP1A 2HIYA 2AL6A 1WI8A 1GNKA 4MK9A 3IRXA 2OUGA 2AEFA 2LQ9A 1UVIA 1FXLA 3D7SB 1BC6A 2C7NB 2BYVE 4ZYNA 2BANB 3HKWA 1PAUB 3ITHB 3N6NA 4N59A 2C2MB 2GRIA 1HXYD 3MM7B 4KGZB 1U0SA 4OZ3A 2KVIA 1D5MC 1EUVB 5F9NA 2YWGA 4ECSA 3WIMA 2X3DA 4TU7A 3K7RA 3M32B 4XZ4A 3T3NA 2ZEJA 3DDNA 2I5JB 2PO4A 1QAYA 3RU0A 1WEZA 2ZVIA 1QJHA 3KLVA 2LJ5A 3MR2A 5C2TB 2XI2A 4Z37A 5B09A 3KJVA 1LK5A 3J9CA 4A6QA 1KKHA 3J80U 1BE4A 4N9F4 2UU7A 4ASWC 5B0GA 3L95X 2YH0A 3OWEB 4KGMA 4I68A 2Y5CA 4F2RA 3R7QA 4O1NA 2K8BA 1HTQA 1AA1B 4LFAJ 2ZWOA 4OMFG 1MG7A 2AEMA 2A2CA 3ZW3A 1S57A 2DWQA 2KFYA 3T19A 2IAJB 4M8MA 4C8MA 4BC9A 2R2QA 1GMUA 4C8KA 2YXLA 3BYRA 1TL5A 3KNAA 3BY4B 4J9NA 1JXLA 3KK3A 4MIBA 3ML9A 2PEHA 1HL6A 1U1LA 5T7LA 1U26A 4CH7A 4YDDB 1G3OA 4IFYA 5M2PA 4ZRIA 3JB9k 4KAIA 4ERDA 2B4UA 4I69A 3X1LB 1NU4A 3RB3A 1B1ZA 1K52A 3I0RA 2GFFA 2W4PA 2LVOA 2V4JA 4DV0J 4ES1A 3ISZA 3CJKA 2FCNA 1Z1ZA 3UF8A 5IQ6A 2ALYB 2C2KB 1T9YA 4QR1A 2XY7A 3DRSB 3DLBA 5AXKA 3V3XA 1OS5A 3M8YA 1UWMA 3OQ2A 1CMXB 4P2SA 4HACA 4I2PB 3HUIA 1HBUA 2NR2A 4CLLA 4EUVA 2VOOA 1PYSB 1RTIB 3Q8FA 4CLFA 2BQRA 4K7SA 2YLMA 4Y34A 1T0TV 2F8HA 4EO8A 3CUNA 3P4RB 2NS5A 1G1XA 2REXA 3HM6X 4J9PA 2B9WA 1JXEA 2VC0A 4LREA 4UF4A 3KLIB 4CCHA 2KH9A 5JVHQ 4X84A 2M8HA 4ATNA 3TUZC 2RS2A 1FKOB 2UYZB 2R8GA 1HNVA 4UUXA 1D9FA 3DLJA 2R7XA 1FCLA 2ZH4A 3GCXP 5KFWA 1UWBA 3UIOB 3UWTA 2QSFA 3QLHA 4N76A 1WE6A 4G1QA 3D28A 1L0XB 5B0DA 3IRXB 3Q6BA 2KMAA 4YWGG 4ZLNA 4PS7A 2FHJA 4ECWA 2XS5A 2L7RA 1U48A 3N20C 3MEDB 1K0VA 1ZKHA 4C0BA 1K44A 1VI7A 1SPBP 1KD1T 3E3XA 4URKA 1WEXA 1UEUA 1BXNA 4JI6F 3CNQP 3HSZA 3HX9A 1L7YA 2N3LA 2VG5B 2L83A 3WDOA 1EWYC 4XWTA 5ETNA 4B3MJ 1OPZA 2WXPA 3J80Y 1JWAD 4NI2A 4P71A 2TSSA 1KSPA 5AJ3J 1F77A 4P1BC 2KNBA 2CS4A 2CJXB 1JRPA 3D6FB 3GIRA 2IVYA 5E3PA 4Z7YA 2AQ3B 5IT4A 3L7UA 5J1EB 1U6FA 4F36A 2BE2A 4ID5A 2CHXA 1YJUA 1K50A 3HK0A 4BBNF 4LF1A 4HKZE 1XCQL 2OMLA 3F56A 4M5IA 1GH8A 1WXQA 4TYAA 2OJRA 4CQ1A 2KLCA 1KFDA 2UVRA 2KXHA 4WYLA 4FDFA 1VBZA 2VA2A 1N33F 3ZZYA 1Q86T 1M94A 4DEZA 4V19X 2C7MB 4U96A 4ED8A 1R6VA 2Y1RI 2J9CA 1S72S 1HEZE 2Z0EB 3OPKA 1F5CA 1SB3C 3MOZA 1X8DA 1LGRA 1EF5A 3VGVA 1VBXA 2E3TA 2FVSA 4RM9A 2I1KA 3R27A 1SKSA 4W9KA 2KC1A 3SEOA 3CW2C 5E41A 1J5OA 3P3DA 4CLPA 3D1QA 2I38A 3GV8B 3PLUA 3OXLA 4WP9A 4ANUA 3FNNA 1DARA 3M1VB 4HYKA 5KG2A 2M19A 1IR1A 3VQTA 1XLQA 4NLTA 5AZHA 2FNJB 1RAFB 4DLEA 3RG6A 2GS8A 2RUGA 1DURA 2CNKB 4FHKA 1EZZB 3P4QB 2O67A 3IS9B 1T03A 1F5BA 2XGQA 2GCFA 1NK9A 5JHBA 1BQMA 1FNXH 3QO9B 2UWQA 1CQVA 4RU2A 2V6AA 3V4MA 4NY0A 4AL5A 3BV8A 2MZJA 1EIYB 1S76D 4DL3A 1IUEA 3ZZOA 1I4RA 1WTBA 3THVA 2LU2A 4WURA 1NSAA 2I6WA 1MJDA 1HIYA 3N79A 1WE7A 3AH6A 2QLJB 4DPXA 4B3TJ 5A2QU 2WSCC 4LFBJ 2XN9C 3VZHA 2UVUA 3TANA 1UH6A 5KFCA 1WM3A 1RKJA 4K4SA 5F0WA 1NXIA 1LO5D 3MPDA 3KJQB 2XC9A 5DLGA 2QA4G 1RT6B 3TQ1A 3MGJA 2BOPA 2YPYA 3BR9A 3MXHP 4GO7X 2OPSA 1FEEA 2JRIB 1TVRA 1BWEA 2MLXA 4WWSA 4BBYA 3NNAA 4IO1A 1GK8A 1Y56A 2JWUA 3HPOA 2Q43A 3NXZA 2C1EB 1RWSA 3K5MA 3TEXA 2FJEB 2FJXA 3JQMA 4CRJA 4OZ5A 3CJ8A 3MM7A 5HG2A 1XIQA 1IR2A 4RGOS 1RWPB 3MM8A 4C11B 2QMWA 3B6BA 3W66A 2D41A 2DNRA 2AP6A 4LSLA 2VKRA 1SB6A 1EB0A 3PFOA 2JLGA 1C1BA 4WH4A 3R3TA 4ANDA 2FZGB 1N36J 2J5AA 2WZ1A 4O0NA 4WFAQ 4EU0A 1WOOA 4F4YA 5HBMA 3KJVB 4ZHOA 2CNLB 1N34J 2DPJA 2F4FA 3QATA 4A8QA 2B3TB 1SQFA 3DOWA 1J5OB 1YSJA 3PXGa 4ZP8A 1C78A 3G82A 2QLXA 3PJXA 4L75A 4CTAA 4TQ1A 2H54B 5KT3A 4V19J 1P7EA 4RGNA 3SCJE 2LZ6A 3U1NA 1TFYA 1JLGA 1RAAB 3UDLA 2MKIA 3NY0A 4BOSC 1NKBA 1TZ1A 2JLFA 4GC7A 3W1SC 3F44A 1XC9A 1WXSA 5D78A 3D68A 5DM6Q 1QLBB 2QEXS 4RO0A 2J0MA 3AI5A 1BQMB 1HHSA 2WDRB 3QX1A 4C4VB 3BO4A 5IWAF 2CHWA 3DXBA 3KLEB 4FHJA 4I6WA 4W9DA 1NJWA 3AJ1A 3MUMP 4NCBA 2ZNVC 5GAEU 5IT0A 3DRYA 4H4MB 3AXCA 1BMQB 2VA3A 2HFNA 3RRGA 2AJ2A 2AJ4A 3A8JA 5C7PA 5M2UA 5BMHA 4JI1F 4I2PA 3DVGY 2ZH3A 4RR5A 3O2IA 2L48A 4JI0F 4DCPB 2CPXA 2CPDA 1M0SA 1RWKB 3DVGX 5LSOA 1NYQA 5AUIA 1RWMB 3VAWA 1B7YB 3OFFA 2DITA 2K2PA 1DOYA 3QGGA 5E6JA 3P4SB 2OD6A 1SQGA 1IBKJ 1RT1B 3BO2A 2JWZA 1OQ6A 1SF0A 1SBBB 4AD6A 2DNOA 3SDEB 3W63A 3CULA 1AARA 1FFGB 3TRGA 1RADB 3PJ9A 4QQBA 2BX6A 3VH3B 2OSQA 3BGFA 3DRPB 1WXAA 2KMMA 1IBXB 1SI9A 3POTB 4LF4J 4JI3J 2KK8A 3MEEA 4YTMB 4G1QB 1FJGJ 2IA0A 2M70A 3W9HA 4URGA 2SEBD 4NLOA 1WJ9A 1LWEB 5H92C 3MTNB 3VXWA 2V2KA 3TJ9A 2BRKA 1TTNA 4KV2A 2IDLA 5HHDG 2F63A 3FK4A 3I96A 2EKEC 4K1RB 4M63A 3WIVA 3MFIA 3FRYA 5KFSA 3H7PB 1H74A 3GG0A 1DGJA 1I94F 3A4RA 4MGYE 5JMNA 3D4JA 1P1AA 3VTWA 4F50A 1CZPA 2D69A 1Q8BA 1WRIA 1WDTA 2PMZD 1OMSA 4GKJF 1AZSB 2JLEA 2VPYB 4RW9B 1GJZA 3MAAA 5RUBA 4M5NA 2BB6A 1OO0B 3QC8B 1IM4A 4NZLB 1OJ4A 3TW0A 3DN9A 3H0PA 2DR7A 3KJFB 3AU4A 3DXSX 2GHPA 2JQRB 2MGZB 1FRLA 4JI2F 2KC2A 4FJVB 4X4PA 4TV3A 4HEA9 2HAFA 4AUQC 3IT6B 1IBCB 1S10A 2IVMA 2BBCA 2OJ3A 1KVJA 3DHWC 4QPTA 3D54A 4TN2A 4ED1A 1E7PB 2XM3A 4U95A 2L9NA 2E5JA 4ZHRB 4F0MA 2LQ5A 1KR4A 4PXDA 3CC4S 3GJTB 3CSTA 4PYDA 3AOAA 2F4VF 3AB4B 4OZ2A 1K73T 5CD4H 2MKYA 2E5IA 3DU5A 3ZDMC 4IM0A 3OFGA 1N56A 2J7KA 2E6XA 1S7IA 3MTKA 3NS8A 3ZUNA