3C19A

Crystal structure of protein mk0293 from methanopyrus kandleri av19
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
SLGLDYEPSHLMFLVTVLDDRDGEVLGDAIQKLIEREEVLACHAVPCVTKKNRPGHVLVVLVDGGEDPDRVAEDVARDIMVLTGSTGVDRFDADGVYSVPSRFEDVRVVYGEREWRVSVKIAETEEGEVVTVKAEFDECREIGEETGIPPREVKAMVEAAARVGGWVDLKEREIKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein MK0293 from Methanopyrus kandleri AV19.
rcsb
source organism Methanopyrus kandleri av19
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MK0293
total genus 36
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01969 DUF111 Protein of unknown function DUF111
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.300 Alpha Beta Roll Ubiquitin-like (UB roll) mk0293 like domain 3c19A02
3.30.70.1380 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transcriptional regulatory protein pf0864 domain like 3c19A01
3C19A
chains in the Genus database with same CATH superfamily
4US9A 1ZDXA 4K4UA 2QIEB 4USVA 3VZHA 3CWIA 2BBEA 1Q7YT 3T6BA 2LDIA 2UVUA 4ES1A 3AXMA 1IKWB 1R8PA 5D8HB 1L7YA 1L6UA 2YH0A 2XS7A 4Q43A 2OOBB 1FTRA 1FRJA 4ZVHA 1J0GA 5ETTA 5AXNA 4UOGA 5C25B 3CMAS 1H4RA 2GZOA 2JC1A 2UUBF 2NUHA 2YNGA 1NHKL 3RR7A 4JPSA 3MECA 3DVGX 3G9CA 1JALA 5D4OA 3JSBA 1QF6A 4CM2A 1P0RA 3B08A 1SC4B 5H1SV 2XZTB 5LOQA 2F63A 1B7FA 2R2RA 2FHMA 4C97A 3MM9A 4ZN1A 3ZJUA 2D3UA 3TANA 5GAEU 2QMUB 4ATNA 4C3LA 1AA1B 2BX6A 1QOAA 2F8MA 2HVZA 1SJ1A 3GONA 1Y3JA 4C48A 5HP1B 2IZVB 2QLFB 2HHHJ 2JXTA 1D6EC 1RWWB 5CTRC 1MVKA 1TKZB 5EDWA 2RRNA 2MJUA 2DEJA 3MUVP 2OJRA 3DLHA 2OH2A 2FHKA 2VQEJ 4FJYA 3VUXA 3CDUA 4LF4F 4HRSA 4U8VA 4KFBA 2MZQA 1IBKF 3KK2B 4FYYB 1YJWS 1ZZNA 1GTHA 4XIUA 1H3DA 2K8BA 1CQVA 4WIIA 2I0XA 3E9SA 5SZTA 2ZFHA 1WGGA 2MBEA 2A5UA 2CRLA 4DSJA 2RH3A 1WI6A 4U9RA 2KFNA 3J7YI 2CVEA 3W1YA 1C1BA 3MD1A 3HVAA 4GDKA 1QZEA 3QGHA 4LT6A 3IFEA 3ISND 1TVRB 2HJ1A 1O51A 1IWGA 3DRYA 2NPIA 4ZDVA 1WG1A 2GHPA 4ZRJA 2LASA 3Q14C 1IKYB 2OLWA 3CCSS 4FDFA 2HTHA 4HEA1 1UZHA 3ZNUA 4GN1A 4LNFA 2WP9B 2E44A 3K5OA 4CLUA 2C9WB 2AGOA 2DK2A 3I57A 1DQ9A 4MJKA 1WG5A 2Y9HA 5MAOA 4OHYA 1PUTA 2D07B 4AD6A 4DEZA 1T3OA 1TVRA 4B02A 3IGNA 2WDVB 1JQGA 4CO5A 3W5UB 2XN9C 3BDEA 3CCQS 2J6SA 4X84A 4J7CA 1P1TA 3PR4A 3KUCB 2W2QP 4PRFA 1B4SA 2LVPA 2GBRA 1D8YA 1HBNA 4HPMB 2YLMA 1C0TA 4ECZA 2W4DA 2C2ZB 3G71S 4ZHOA 4RBVA 1KH0A 3KUEA 4EFOA 4ZCMA 1HA5A 4URGA 1KLVA 3BZQA 1Q16B 4W92B 3H5SA 5EX3A 3TAPA 3KK3A 5E33A 2XCAA 1UWBB 1K73T 2BKRB 1S1TA 3ZZZA 1RHJB 4B9VA 1JNZB 4IFVA 4NMLA 3KQ4A 1IBXA 1KLUD 4IC7B 2YY3A 2RPQA 3VF0B 3VUWA 3T3NA 4C6AA 3UFCX 4AL7A 3MM6B 4RW9B 1QD1A 3OR1B 2OTJS 1Q10A 2PA8D 3TWZA 2C2EA 3IM9A 1EP4A 3FMBA 3WIVA 3DDKA 3GZ7A 2O2VB 1E8ZA 3SQOP 3NVVA 4UUXA 1VLYA 3BS9A 1L0VB 3G4SS 1EKRA 4LF6J 4K4SA 3HHLB 2ZVSA 4LF2A 2BMBA 1WWTA 4OZ3A 4X64J 4B9MA 2ATCB 1OY9A 3Q22A 4EGLA 4UUWA 5JMNA 1MROB 2NR0A 3MM6A 3PNIA 3ZKJC 3GYXB 2RRAA 1MWZA 3TUOA 2D10A 3DLEB 2K3IA 4PEOA 4ECUA 1NDKA 1QOFA 3BGRA 2AIRB 4JYAJ 2VD3A 4BBYA 2HRYA 3QIPB 1Q1OA 4WE1B 2J7UA 2GHVC 4ZIVA 1VHFA 1BT0A 3ZTCA 2DYAA 2O6VD 2MH7A 5F8GA 1UA1A 5H8YE 2RDBC 5E2QA 3VRAB 1J19A 3M8ZA 2HGNA 1KFYB 3OVBA 2WSEC 4LF7J 1JLEA 2G2ZA 3H2LA 3PLUA 4PWUA 3P63A 4C8LA 2LVOA 4C80A 4JI2F 1RUSA 3BGRB 2W82A 2BE7D 2YNHA 4I2PA 1RFAA 3QIPA 3U7ZA 2DNGA 2MPUA 3OLBA 3BBCA 3PY8A 3NNCA 1F9FA 3T41A 3UCZP 2HE7A 1HNIB 2XLKA 3C14B 1TK0A 1RFKA 1NK0A 1RT1A 3CC7S 4RX6A 3PJ9A 2YX7A 2GQ2A 2DGTA 3CJ8A 2RF2A 1DFDA 3I0SA 1SIJA 2OAUA 3P4UB 1KP6A 4CO7A 5BYRA 2L32A 5CAAA 4AUQC 1EHWA 2QDFA 5CYMB 8ATCB 4F4AA 1E6VA 3TX0A 1KVKA 4B9TA 5CXTA 3NUHB 2HFZA 3GE3C 4F0HA 3B82A 1C77A 1QILA 4MGZE 2C3MA 2CQ1A 2V4QA 5KFBA 4DQSA 4TN2A 2FZGB 2KOXA 5KFAA 3K2YA 2WXQA 5AEKB 5KFXA 4G3XB 1S72S 3G6VA 4DL3A 3UR3C 4E0DA 3OFFA 1IBCB 1TL1B 3CSFA 1MU2B 1SBRA 3KVFB 3KNGA 1XEZA 4YUDA 1YQ4B 3V60A 1VHIA 2D3OR 1FNVA 1RDRA 3L7PA 4DXFA 1GMUA 1LFDA 4A8SA 1S9GA 4USKA 3KJVA 5KT2A 2LGYA 4A9AA 1ZM3A 2FE8A 3PYDA 2CDRB 2I8EA 4Y2IA 2HHHF 4QWBA 1FF2A 4DF4A 2LQ9A 3NWRA 2ROEA 1UL3A 5L9NA 1FMAD 5JXSA 5D4LA 1Y8RC 1LM8B 4A8XC 4K2XA 1FRMA 3J7Z5 1X1MA 4G11A 5KFCA 2MBQA 2KVQE 4A3OA 4I6AA 3A3PB 2Z0EB 3GG1A 2YXLA 1WD6A 3Q23A 3MEEA 1J5EJ 2ASQA 3DBLB 2IDYA 3TEXA 2AP6A 3I0RA 3U7JA 3LP1B 1O5JA 3R5GA 5KG6A 1JLAA 4B0EA 4MTPA 4OMFG 4B3MF 3EGZA 1JLBA 3S7RA 2EMSA 2AX5A 4OV6A 2NS5A 1VQNS 2PC6A 4W9KA 4HJGE 2W54A 2WVDA 1RJJA 3ILIA 2APOA 1RYRA 3SSSA 4WIPA 1R0BG 4KIKB 3FCHA 2HZAA 2BA9A 1WOOA 1RT7A 2R8IA 1JLQB 3VUYA 3MM5A 3NCQA 1UNSA 5HQLA 4Q2JA 4IUMB 3PJWA 2HHSA 2C7HA 5IT9U 3PYEA 4JV2A 1RT5A 2M4MA 5GAHU 1SE9A 3G82A 1MMNA 2M5YA 4OX7A 2PEHA 3GJRB 2VL1A 2FHOB 1P98A 1WIAA 3MMCA 2AGPA 3H4BA 4DSLA 1IN0A 3UI3A 1WDTA 2HVIA 2LRUA 3N1ZC 4P2FA 3VVTA 4II2B 1TKXA 3MCMA 2EKNA 4HKQA 1R8CA 2R7SA 4IFYB 1P9QC 2DO0A 4KZCA 3HVWA 1SGHA 3IRXB 2VZ9A 2BVZA 5IZHA 2HNZB 2ZNVC 5LM7E 4YHHJ 2OHFA 1VR6A 4AWJA 2LKZA 3DOMB 2KT7A 3HLUA 1QJHA 1OEYA 4KGXB 5IT0A 2K06A 3L16A 4WPAA 4ZJQA 5CCLA 3NY0A 1V3SA 3VR8B 3KXDA 2CZVC 5ETPA 2DGVA 1FNOA 1YZ6A 4URKA 1PYTA 2YTCA 4ZLJA 1T94A 1N5XA 1CULB 2CAJA 3CPWR 3DYAA 1Y7PA 2CQ2A 5CYJA 4KHPF 2M8SA 2MBBB 4K4ZA 3QBCA 3W2WB 4ITSA 4M95A 2HNZA 5CYQB 1YGYA 3EVWA 2FUHB 2R61A 5DETA 3BWUD 2XCPA 5KFZA 4P1BC 2BYFA 2WW8A 4MK7A 1XCTL 4A8YA 3JSRA 3DBSA 3D5MA 3MOZA 4OVUA 1HBUA 2W7PA 3MUTP 2W9CA 4DHZB 1K1SA 2KNBA 2LD9A 2RSQA 2OI2A 4RNMA 2LJ5A 3IG1A 3V2UC 4DL2A 2HVDA 4DR3J 2Y0BB 4X65F 1H7WA 3QFHA 2BJ7A 3W2WA 3F73A 5DPTA 1PAEX 4CLPA 3QLHA 3FUYA 1RTDA 4HPPA 1HWIA 2ATLA 1YQ3B 4IR1A 3PZ8A 2DX5B 3RU0A 4WQOB 3BINA 3K5MA 4NA1A 2I6WA 3EUNA 2EFPA 2FHJA 4P52A 3AE4B 2W9CB 2BJ3A 4YOEA 3FCVA 4CYUA 4B3RJ 1RLDA 2PE8A 5KG1A 2G4BA 2K6DB 1HWJA 5KFEA 3RBXA 1Z2LA 2BACA 2QJLA 4GKKJ 2DEIA 3BZDB 2H54B 2X3GA 2L83A 3E51A 4WJBA 4EOYA 3M8WA 3W1YC 2F8EX 1BHNA 1P1AA 2HAIA 3P3DA 2R3VA 4DX6A 2XMWA 4IKAA 3EVMA 4PK1A 1TY2A 1SPBP 1UWBA 1U2RA 5L8RC 4IFVB 3DQVA 4EWTA 3LUYA 1UEVA 2FCNA 3R8YA 5BJRA 4I1TA 4B9UA 2DYOA 1T0RC 3VR1A 4BFRA 2K0PA 4Y65A 3CMMB 2OSRA 4I2QA 2KVZA 3GILA 3TW0A 2FLPA 1ZPSA 1U0HA 1CK1A 3H7PB 1AUSL 1RHMB 3H5YA 1XNQF 2EMTA 1S10A 1U1MA 2O67A 2J0WA 5G2NA 1L5PA 3R3MA 3R7QA 2G1EA 1UW4A 4NXNJ 3EWGA 1GXUA 2CS4A 3SBMA 2AL3A 4C0BA 1NYRA 2VG7B 1IBLJ 1SE2A 3D54A 4X4QA 2A4ZA 3PDNA 2FIUA 1XR6A 3BH6B 1UZXB 5DDOC 2J0JA 3R7RA 1FJGF 3K9PB 4LQ9A 3VGVA 3LO3A 1V5OA 4NLRA 4E2FB 2V8HA 2ZBIA 3Q8VA 1NEEA 4JWSC 2G1DA 4A6QA 2RRBA 5J2PB 3PV8A 3A4TA 4OIXA 3P49B 1WMHA 2D3AA 4WJOA 3ZZRA 3KHLA 1FM0D 3CSKA 2KX3A 3CCES 2BOPA 2D9PA 2QLBB 1U1RA 1QKZA 2X1FA 1M5OC 1LK7A 4NXNF 5K9FA 3G6ES 1NK9A 2AQ2B 3KLIB 5LJ5Y 3G8TA 2HWIA 1S99A 2ROPA 3MP9A 4KSLC 3H2VE 3TP2A 2K8GA 4MIAA 4YDDB 4DPYA 1Y0HA 4D3HA 2BE9B 4NLUA 5HROB 1VIXA 3IS9A 2KN5A 2WB1D 2DTJA 1STEA 3VWSA 4RUAA 1J5OB 5AJ3J 1F9JA 1NBEB 1B99A 2NXUA 2NPFA 3N1YC 4WH4A 1ULRA 3T1HJ 5GVQA 2QA4G 4CDIA 4ED5A 2IY0B 3VGUA 4ECSA 4F2SA 2CPEA 4WP3A 4WK3A 2H48B 3OWEB 2LVWA 2GLSA 4ZRPA 1UP1A 4A90A 3H9DA 3PT2B 2ZH3A 2FJDB 1BE4A 3LALA 1KS2A 3DCAA 5KFRA 4LFCF 4QWAA 1BMQB 3VALA 3OTBA 2PSZA 2CQ3A 1TL1A 4QWEA 4RWXA 1F5AA 2F1FA 3KLHA 5KFQA 1XCQL 4F0KA 5L83A 3UQBA 3IR5B 2UVWA 5IC6B 1BGXT 4R0JA 3AXKA 1U4AA 4K1RB 2K1RA 2P5VA 3OLMD 4KBIA 1RISA 4OLOA 4L73A 2ZPYA 3W64A 2B6AB 3SSQA 3AE5B 1HTOA 3LP0B 5AJ3F 3HM6X 4W98A 3JSMB 3ML8A 1VFJA 3ETRA 4A48A 4L1BA 2B5JA 4OHVA 4YB7A 1C1CA 1VQ9S 4W9GA 4JL9A 1HLWA 1D8ZA 1RADB 1YJ1A 1X7VA 2ZWOA 1K47A 4JI7J 3HZGA 4Q45A 1LWCA 3DBRI 2E9RX 3LWMA 4A8FA 3CDEA 2GVZA 3CCLS 4C8KA 2DHXA 1GUAB 1HR0J 2C28A 1S6UA 2IGGA 2IYGA 1B7YB 3QJJA 1FD2A 3A9JA 3TZYA 4TY8A 5HQMA 4C7YA 1J5EF 1X0PA 3UD5A 1HQUB 4LF5J 3NOGA 3E01A 2JPHA 5M2UA 3US5A 1OQ6A 4PG6A 2DR9A 3PPAA 3AOCA 4JV5J 4JI8F 2FDNA 4BOSC 1TL5A 4PAAA 1FNUA 2V8DA 3ZZUA 2HGMA 3FKYA 2FIDA 3I63C 3CE8A 4G3IA 4WK1A 1C76A 2NXJA 1VQ4S 2MJNA 1N34F 2QIFA 1VLOA 3SFUA 1KFDA 1RTIA 1F9EB 2WOMB 3ILLA 2MQLA 2AJ4A 3J81j 1D3WA 1L0YB 2HWHA 3KG1A 4QWCA 2VC1A 2M7SA 2QSWA 5DJBA 3B4DA 1R7IA 3DXSX 1HNXJ 3D6TB 2GMLA 1FO4A 3THVA 2MKKA 1QSSA 4C3MA 3CW2C 1SQGA 2GB1A 3OTCA 3M2RB 3DI6A 3B54A 1EX8A 4IDKA 2KFKB 5E3CA 1MFWA 1TJEA 1UEKA 3GSIA 3AOBA 1CG2A 2D3ZA 1RA6A 4KQZA 1B70B 3HSJA 7FDRA 1KQSR 2AJFE 2M0XA 3N1XC 3AA9A 4QYZJ 4C8NA 3OL8A 1V81A 2PN6A 2CNLB 2ZE2B 1NK6A 2O1PA 1I94F 3U8ZA 3M1VB 3CDAA 3VQIA 2DPIA 2V34A 2BM0A 2E5LF 4M5NA 4DZDA 4JI4F 4RW6B 2IVFB 1HPZA 5BMGA 5F0WA 1S6OA 4O44B 1WC6A 2G45B 2ZNVB 4ELTA 3M2RA 4QIFA 4NJ6A 3NNAA 5E6OA 1C4CA 3PXGa 4O1NA 1VQLS 3MTKA 2WXJA 3PKMA 1SCJB 3T9LA 2B9YA 2NCKL 2PI4A 1DY3A 1NH7A 1Q79A 2HQ3A 3S01A 1VQSA 3PRZA 1KLNA 4G6VB 3NZUA 2FJAB 1U7LA 3GFHA 4X4UA 1VQMS 1PYWD 1KM7A 2EBGA 2YWEA 4RW4A 3RULA 3HDSA 2BR0A 2AEHA 1S1WA 1XBWA 3WHIA 1JKHB 1U1LA 4QU6A 2XS5A 4LRDA 1G1XA 1CC8A 4I6WA 3HHEA 2OPRB 2XSFA 5KFLA 4ZVEA 4LIWA 2MKIA 4ICLA 2RS8A 4Y28C 3OXGA 4F4XA 1VI7A 4DHJB 1FO1A 3ENQA 4Q2LA 3FAHA 3LDZE 3NOBA 1AN8A 4DK5A 2BANA 3MEDA 3VCDA 2BF8B 4ECWA 1WM2A 3CCWA 5K5MA 3FC9A 5KFKA 1U02A 3THPA 3L10B 1CSJA 4QOTA 5U47A 3J81U 1WC0A 1TMJA 1WHYA 2RQKA 1WF0A 3VAHA 4HT7A 1Q81T 1N63A 3MPVA 2N9XA 4KV2A 3LF0A 5KFNA 2RU3A 3JYTA 1VBYA 2MKSA 3ICLA 2QEXS 3JSVB 3M8RA 4ZPDA 1M0SA 1YK9A 4A8MP 1QLNA 2VPXB 1UH6A 3BO3A 3QHTA 2KZZA 1Q5WB 2JJ4D 4FYDA 3CGIA 1JQ4A 2GVDB 1PGXA 3DU6A 4NEYA 3I5JC 4YP3A 4QPXA 2WX1A 2OKQA 2RU9A 4ANEA 3M7VA 2A18A 4DUYJ 4I2QB 2W9NA 2Z2MA 2IJRA 5C25A 3N9UC 4FA6A 2Z8QA 5JVHQ 2NUUG 2AZ3A 1S1UA 2K39A 3LPYA 4P6QA 2P2CB 3MGJA 2KTQA 2GV1A 2MQJA 1HWKA 4LJMA 3GR0A 1VRAB 2XSJA 2WBRA 5C3JB 2EFQA 3NWGA 1PYOB 4RGMA 5AXLA 4PPZA 3B9JA 2YKMA 4U7CA 1HW8A 2ZH1A 2YNFA 1CLFA 2LQBA 2M4NA 3Q8RB 4TKTA 1JJHA 2INPE 3TMPB 2D7SA 3CSTA 3PYGA 2J53A 4ID5A 2SAKA 1R0AA 2OD4A 1EAYC 4HVBA 5G0RA 2YNIB 1TKZA 2ZJQQ 4GO7X 5B0BA 2PFDA 3OJ3A 5F8LA 2BRLA 2M8HA 4FXWA 4DDID 4ZKAA 3GIJA 3FNNA 1JJ4A 4GKJJ 2QLJB 1A7GE 3NGKA 5G4DA 5HSPA 2DNKA 3ABVB 4C11A 2XHWA 4K4VA 2LWPA 1Q8LA 3PVLA 3DLBA 1JW9D 4ZYSA 5J2QB 2G4SA 1IVZA 2U1AA 4ZVFA 5FDLB 2JY6A 3W9CB 2QC3A 1WWHA 3GJQB 3TYTA 1KHWA 1GNKA 1TUWA 4ZOSA 1BQNB 1MWQA 1C1BB 3SDEB 4FXCA 3DPDA 2R8HA 3BGOP 2BQRA 4ZVPB 3H20A 3NVWA 2KDEB 1VC5A 4JYAF 5MPOA 4RNNA 1O0PA 2R4FA 4AP4C 5KOXA 4PWDA 3RJMB 3JAMY 1SKRA 3MC9A 1M4VA 3JAMU 2WXOA 2D2QA 4JI6F 1XWLA 4LSNB 2EVZA 2R7XA 2MZSA 5A0YB 1OGWA 5IP4D 4FNIA 4S0MA 1E8XA 1UCNA 2ZH2A 3PO4A 2AYMA 5GADI 4N47A 2GGPB 1AW7A 2BPSA 1AB8A 2DPJA 4HLEA 1FX2A 3DRPA 1VK3A 1OPIA 2UZAA 4R8UA 4DR2J 1HBMA 4IM3A 4ARCA 2JYEA 5T41A 2B43A 3MI7X 3OVAA 2VIHA 1AARA 5J2RA 2DHGA 2WQYB 4RUHA 1MNEA 4AXIA 2UWQA 2HHPA 1QTNB 1V97A 4U96A 3TQEA 3SMZA 2MWSB 5A8WA 1HZ5A 1HBNB 5CHFA 1FHTA 2WXIA 2CJAA 3Q8AA 3I56S 5D3DA 4PXEA 3IT6B 1M5HA 3KDNA 5D78A 3T3FA 2CJKA 1R4NI 5EWEA 2LEPA 4KGSA 4O3RA 3LP2A 4RNAA 4ZPCA 4BDPA 2DNPA 4FPRA 2E3TA 3TJAA 4KV8B 4PS3A 1FEEA 3Q3JA 3VGSA 3P42A 1DTQA 2BW7A 2WU2B 4XWTA 3SZ2A 1FCAA 3ZNZB 3NCPA 3OSNA 2FJWA 4AL6A 2UVRA 3X1LB 4USUA 2O2VA 2GHWA 2AMCB 4QR0A 1X60A 2DRBA 1T3NA 2XO6A 2W4PA 4A46A 1GMWD 3UIOB 3PS6A 2V3PA 5K8MA 1U6BA 2VOOA 3BV8A 2AQ3B 1IUEA 4LF5F 3IFWB 4L2YA 2BGFA 4KAIA 3B1LX 3NHEB 5DGAA 3GB1A 4GVBA 1B3TA 3CJSA 4ZVUB 2DNYA 3HM9A 4DL6A 1N34J 4NLVA 3Q3MC 1HBOA 2YH1A 2KJWA 1XIQA 3SD5A 2XWXA 2ZZPB 3W2VB 2CPHA 3MPWA 3WA0A 3GIRA 4HLBA 5EWFA 1WI0A 2N7YA 3OTOJ 1WF1A 1QOGA 2M1MA 1LXJA 4WWMA 5HP1A 2HZCA 1KKHA 4UOHA 1IGDA 5C2CA 5L39A 1C79A 3F0NA 1FERA 3EGNA 2QL7B 2H9ZA 3SIPB 2PO4A 2XLIA 2Y0SD 1U6ZA 1UWMA 1YBAA 2FYXA 5A8KA 2X1AA 3UDEA 3AAWB 4M5DA 3PLVA 2BS2B 4NE9C 2M0AA 2QLWA 4FHJA 2GJIA 5GAEI 2B3TB 2ZW1A 1OJ4A 4DV6F 1YDLA 4X4VA 3CCRS 2XO7A 1H6KX 2UU9J 2G0JA 3IBFB 5A76A 2D11A 3N0VA 2PE6B 4IUFA 3CJKB 2HMIA 5B0EA 3W3SA 2UU9F 1JMLA 3KFWX 2Q1LA 1E6VB 4Y0FA 3C0RB 3K7RA 3RNGC 1L3SA 3P5TL 1UFKA 4M5DB 1RBAA 3VDZA 2RD0A 1Q1KA 2NXCA 4ZA1A 4IM0A 3PFOA 1OQQA 3VAFA 1XXGA 3LAMA 3EMTA 5H9FJ 4YTPB 2BYVE 3D3BJ 1FWPA 4V1Ak 3RB6A 4RW4B 2HHXA 1D5ZC 3QJLA 4N76A 4OYXA 1QAXA 2IJFA 2DH7A 4EUTA 1UZDA 3NMAA 4MFBB 2E5JA 2PVGC 5BMHA 4W9CA 2NR2A 3MJWA 4C0HA 5FLXY 1O6XA 5JH5C 4NOHA 2JLEA 3NCRA 2JC0A 4GIVA 2RILA 4WZQA 2IY5B 1VBKA 1LGRA 1NENB 5E3PA 2NSBA 3BREA 2PTLA 1I35A 2KFZA 1KLMA 3HF5A 4AQYJ 2XQCA 2LCWA 1PKUA 2E9TA 5IOLA 2ZD1A 3HHMA 2Z2YB 2V9HA 1B9RA 3MC8A 3CMQA 3CD0A 2CU3A 1Z5SB 2XMVA 1VQPS 2OFHX 1JX4A 5E5NA 2B4OA 4I6YA 3C66A 4IG0A 1KFSA 2YNGB 2IJ0A 1Z2ZA 1FJCA 2PMVA 2WB4A 3IWLA 2ZUAA 4LF9J 2G0CA 1ZGUB 3MWBA 4DFMA 3PW0A 7FD1A 4WIQA 2GVDA 1GB1A 3KW5B 2O3DA 1S9EB 2D1CA 3KK1B 3UCUP 2NTTA 3CIMA 2MY7A 5DGBA 1FRLA 4PKDB 2ABYA 4RGNA 2HK3A 4B3RF 1UAWA 3Q2AC 3CJ3A 4AYBD 4EYIB 1FDBA 5B0DA 4WFYA 2UUCF 4IG0B 2GO8A 3ETOA 4WTYA 4K4WA 1RLFA 4OYZA 2JT4B 4FF3A 1NVID 5KT4A 1VQYA 2I5JA 4MIWA 1SQFA 1Q95G 5CH7B 1YQHA 3UQAA 2CPXA 1T03A 1R8HA 1N62A 4J9MA 3QSIA 2XC9A 4K4XA 2DNFA 4I6LB 2BKPA 2RE1A 3W65A 4BCAA 1S9EA 3I9ZA 3ITHA 4UW2A 2AU0A 2BV3A 3TJ8A 1LW0A 3GWCA 1TKXB 4WE1A 1J7CA 4DXLA 4OQJA 2V9WA 4OYBA 2NS1B 2ZBPA 3AE2B 3Q2SC 2KVIA 2HKEA 1W2BR 5DLFA 4ID5B 4OX9F 3T19A 1N0VC 1NSPA 4WWOA 1LXNA 5KTQA 4DR6J 4Q7AA 3NL0A 2L0TA 2I5JB 1JLGB 2W2OP 4LF9F 1Q0WB 1WKLA 1Q82T 2LP4A 2O6VA 3GB0A 4K0KJ 5T7LB 1W2IA 2KXHA 4OZ0A 8RUCA 2VF3A 5H9EJ 1WYGA 3BPSP 2JWZA 1MPEA 3ISNC 3K17A 1IKYA 5DO2A 2KXJA 2CQCA 3CT9A 1E10A 2EFOA 1S59A 1XMOJ 3HSZA 3IO1A 4F36A 4J9PA 2HSEB 4ZCKA 2I1KA 1P7FA 4ED3A 2E66A 2IC3A 2Q43A 5A6PA 3AD9C 2OEKA 2CQ4A 4E98A 4J3OD 1DLOB 3CCTA 1H2UX 4LVNP 1NKEA 2N7JA 1ROFA 1U6FA 4P7TA 3MZIA 3BK1A 5KG2A 1NJWA 4NEZA 2IM2A 1VR9A 9RUBA 4J5OA 1FPYA 1R7SA 4DV7J 2EKYA 2JF5A 4CTAB 1LFPA 4PR6A 3VQSA 2FY8A 2MZTA 3HI9A 1MW7A 1TTNA 2INCC 3PX6A 5D4PA 2CKWA 5KFMA 4N58A 3NJTA 4O0NA 3ILOA 5D3GB 1SE4A 2RT3A 1FXDA 1ZOTA 3MD3A 3LGMA 2V8PA 2LXCA 5DLGA 2L52A 1VZ6A 1GTEA 1ET6A 3KK3B 3Q8PB 4EBDA 1T3QA 1IJEB 2B51A 2PDAA 1N5WA 2JEJA 4XO0A 1YTYA 4K3CA 1HD0A 3TAMB 2R2UA 1KNZA 5IT4A 2DNMA 1WZ3A 2DZJA 4IH6A 1TL7A 1FKOB 4I7FA 4YXDB 3NMRA 3VTVA 1HR0F 1UF0A 3OR1A 1QLBB 4CLTA 2DYMA 1D0EA 1CS4B 1UJ4A 3KG4A 1CJTB 1NM2A 2DR5A 3SEBA 1SJFA 2JH3A 3QRQA 5LMUF 1YD8U 4J9SA 4TU7A 4ZHPA 5ADZA 1ZYQA 1T0QC 2IRUA 4AQ7A 2JFKA 3HHLA 2QL5B 4GDLB 3HFZB 4X2BA 3AFGA 4NXMJ 3M9OB 1R27B 2BQQA 4GLSC 3TAMA 4BLGA 5ITHA 3U02A 5DDPC 2WCXA 3PO0A 3FSYA 1FKOA 2MY8A 4I7FB 5AE2A 2KMMA 1TU0B 1R31A 1DTQB 3DVNU 2CJXB 2UV8G 2HHTA 4KH1B 1C0UB 3R2CJ 1NDCA 3V5RA 1S1VA 4GGQA 2AYGA 2OJ3A 3KUHA 1RYSA 2POKA 1JWMD 1N5YB 4LRAA 1V6HA 3FEYB 4MAKA 4L3KA 3AJ1A 3J9CA 2FY1A 2V0GA 4ETZA 1YIWA 9ATCB 4W9LA 3IXQA 2VDIA 1XC9A 2IO2B 2QSFA 5D77A 2ZITA 4YEAA 1TFWA 3M6VA 3LTOA 5D15A 4M5IA 4HH0A 3POTB 2L3MA 1OIAA 2BW2A 2W1BA 4ENOA 4DUZJ 4K7QA 5ETOA 5HLFA 4OI4A 1X9WA 2C7NB 2FJBB 3HXMA 2PVOD 5DG9A 4M94A 4YFUA 3PHXB 2VQFJ 4WXOA 3LOUA 1YN3A 4N8OA 2OEMA 3BH7B 3C14A 4GRSA 2BVCA 3T5KA 3R5CA 1WH3A 1YHQS 3WCQA 4EZKA 4XTTA 1XK8A 3WDOA 3PZDA 1S1XB 1WOSA 3PKYA 5ETLA 3P6YC 1I51B 2JNJA 3PHWB 1CEZA 4URSA 2CQ0A 4LRBA 4XGAB 3LW5C 3OG5A 3AE9B 3IN5A 2LU2A 2V4JB 4RW7B 1OQRA 4DX5A 3KMSA 1FFGB 1TS3A 2KKHA 5HROA 1QTMA 3IS9B 5E6JA 3ECIA 3EXCX 1IWAA 4NA2A 1YITS 2YPZA 4WJPA 1U0SA 2RHSB 1H8CA 2AQ4A 1XQQA 3ADAC 4KR0B 1F1HA 2ICIA 4NLQA 4F25A 1RWPB 3MM7A 2CADA 2C60A 3T8MA 4A8KA 2DCUB 5H9EK 4O23A 2XK5A 1FRXA 4DX7A 4Q44A 2ZPNA 4LMZA 5BR8F 3PVXA 2VB6A 3I55S 3TCAA 1MHHE 1RT3B 3QAUA 2KAJA 4GB9A 5ETSA 2YEPF 1S1QB 2K22A 4EE2A 2RHQB 4OLPA 4ED0A 3TVKA 3GV5B 4C8MA 4KDLB 2C3OA 1I7HA 4MGIE 5ETRA 3J81Y 1F3VA 3D0IE 4O4RA 4MFBA 1RAIB 3OJUA 3U2SC 2ZWPA 2OPSA 2FIFA 4RM9A 2ZZTA 4ZLLA 2QL9B 3MAAB 4OI6A 5HI1A 3BKFA 4NLYA 4DV3J 3NAHA 1PC4A 4PCQA 4TSSA 3C6UB 3GIMA 2OSQA 4ZVOB 4IKGA 3G87A 4CYEA 4E71A 3GFYA 4H4KC 2WW4A 4RW9A 3ZVVA 2CQBA 5IV4A 1G6BA 4ED7A 3A1QB 1MI0A 3APCA 2FLLA 1KLMB 2GMHA 2H5EA 3BYPA 3H98A 4RPFA 1LEOA 1S79A 1L4ZB 4YSYB 4FADA 1FVSA 1NKBA 2B9WA 4IG7B 3IAM1 2J7KA 4P2XA 1SKUB 1HNZF 4L3NA 2L7RA 1HI8A 4NCAA 1NSAA 2IPKD 4CWBA 3V6HA 5J1EB 3OFEA 4TY8B 2RUGA 1FE4A 4FNHA 1GJZA 4LSLA 2MQQA 3GOEA 3DDCB 3LWLA 2BJ1A 5EX0A 4CLWA 3ONSA 2N1WA 2B3AA 1JRUA 2DNOA 3Q8FA 2DZKA 2MTLA 1XLNA 1C1YB 3PTFC 1T9VA 2MQPA 1GK8A 2HURA 4KRWA 4TU8A 4OI2A 2M52A 1QDUB 2QRRA 3AEDB 2WHOA 2FZKB 2BDPA 4YR3A 2F4VJ 4ANCA 5J1EA 1YRXA 1HNZJ 3A4SC 3A12A 2BE2B 2HW3A 1SL1A 3DOMA 4N41A 4LSLB 3QWZB 1F0XA 4NZ0A 2DZMA 4PZVA 2NYHA 2A0FB 1L2NA 5HK4A 3IVFA 5JHBA 2HD5B 3A33B 3CCJS 3HULA 1PSDA 4D3GA 1I4XA 2CQDA 2DHSA 2IGHA 3A9KB 2C2KB 3G8SA 1HNIA 1KN6A 5GAHI 1KQGB 4JV0A 2GIRA 3OV7A 4RGTA 3M6WA 3VHQA 1NPRA 4XE0A 2ZC3A 1NHUA 3U1MA 1SI9A 1LQBA 1RT2B 5KT3A 2XI2A 3QO9B 2HNDB 4K7WA 2ZEQA 2N3OA 1WZ0A 1NB2A 5T7LA 4O3QA 2R7RA 3CJ0A 2I38A 2HNYA 2YWFA 2XMTA 4IG3B 2HS3A 3PW4A 1KRPA 4G1IA 3UCGA 3HVTA 5CD4H 3GIIA 4Z7YA 2KANA 3WIMA 5AUKA 2YKQA 2XM3A 2XHCA 2ZDPA 3AODA 1XT9B 1HKAA 3CWJA 1TV6A 4WP8A 5J18A 2F9JA 2GW8A 2WXMA 4NLXA 4OHWA 3EZ5A 1F6TA 2KWCA 2AZ1A 2HNDA 2CKHB 2IMWP 5FKAC 3PRBA 3ZUNA 3PACA 4NJCA 4A3PA 5KFWA 3ZO5B 4X4NA 3FRZA 4E74A 3GYNA 1CVJA 3RMKC 5M2PA 2XLJA 4NLTA 2AEFA 2J9DA 2ZH8A 2YPYA 1N36F 3AH6A 1YJUA 5IXUA 4DXGA 3WX4A 2ZM6J 4YS2A 1TV6B 1SVDA 2CPIA 4YB1P 4MIBA 3M2VA 3DLLQ 2Q5WD 3BYRA 4V19X 1RTZA 4J9VA 2VV5A 4LDTB 4K4TA 3ENEA 3KUZA 2PFFB 3QWUA 2MP2A 5GADU 3RYLA 4I69A 4OZLA 4QYZK 4DWIA 4OX6A 4F1SA 3RI7C 2QV6A 1H0HB 2R7UA 3LP1A 3ZW3A 4CCHA 4J9LA 2JEIA 1SC3B 1HNWF 2ZOFA 3IAM9 4S0RA 4B08A 3ET6A 4P2SA 4M5LA 4EYHB 1VZ7A 2B7BB 3JSMA 1I3OB 1IBMF 3VZIA 3JYTB 3ZC4A 2R7QA 5IQQA 4M5KA 3GFZA 4IO1A 2R2TA 4KIKA 1VZ8A 4UY85 4DV1F 2FHJD 5LL6d 1SJQA 2IGDA 1SB3C 2CFXA 4NYPA 1JLQA 1IGCA 2CIMA 4O4GA 2MP2B 5EGYA 4CLFA 1TKEA 4BZAA 2XBBC 2RQCA 4TLQA 2L05A 3PX0A 4CP5A 4DR5J 1RWOB 3A9JB 4FHKA 3GU0A 1V8CA 1ZPVA 3TUZC 3MMAA 3J80Y 4DQIA 1CJUB 4Z2XA 3HHLD 2YWWA 3FZ2A 3ZTQA 1RHQB 3O13A 2HGLA 4OHJA 3LH2S 3W1SA 4H4MA 3TVZA 1BXNA 1F2RI 3PRPB 2VFUA 3HVDA 2OHDA 4OVZA 2VPYB 1UD7A 2I1JA 1RAOA 3RT3B 2CQGA 1IKVB 2BYTA 4C56C 3ENAA 4FXVA 3R7BB 1AW0A 2IAJB 2ON8A 3W62A 3PW5A 4ZMMA 1X0FA 4PXBA 1NNDA 4BKSA 4ZRIA 3RRKA 4OJGA 1KDNA 1VQ8S 3NLCA 3O44A 1HTQA 2R2QA 3KLIA 1N33F 4XDDA 1U25A 4PPDA 1HIYA 1R0AB 4R5PB 1RU2A 1H73A 2N4FA 2Z8LA 2DNRA 5C42B 4OYOA 4DV3F 1CULA 4NJ7A 4DCOB 1LKZA 1QOBA 1IKVA 3M4XA 1KD1T 4WYLA 3NBPB 4Q2MA 1LV5A 3I5BA 2BUNA 1B1ZA 2AYBA 1SXTA 4GKKF 2G2YA 3DLJA 2NVUI 4K81A 2YKNA 1VC0A 5KFPA 2NZCA 3MCSA 3RAMA 1SIFA 1NJXA 3RNCC 3GJTB 5J2QA 1UFWA 2MHNA 2CHXA 4KO0B 4K2JA 3CCUS 4NRTA 2WDRB 2PI5A 3N32A 4DZ6A 4BAXA 1BQNA 3UDVA 1DTTA 2FB0A 4YN3B 2RIJA 1FRRA 1F5CA 5B0FA 5HN0A 2ILYA 4EMDA 3QK0A 3BN7A 5HMZA 2VBZA 3NGDA 1JK9B 1WSRA 3BVGA 3KHRA 5GXGB 2RQ4A 1DHMA 5ETQA 2LQJA 3K8VA 3ZTSA 1NH8A 3OL7A 4NLPA 3A8KA 3LGNA 3SSRA 1B64A 4ELUA 1LWXA 3SCIE 2XK5B 2QX0A 5KFSA 4USMA 2DRDA 1T9XA 1X5TA 2UUCJ 1ELOA 1XJWB 2KHWB 2JEGA 2JZZA 4YY3F 4Q0BB 4JI3J 4N56A 2KFYA 4EK2A 4RNHA 1CJEA 2W9AA 5AXKA 4KC5A 2YWGA 1EM7A 1URRA 4JI2J 3M30B 2Q79A 2BB5A 3DM2B 1RZMA 1ESFA 2HHVA 1FA0A 2M3DA 1RP5A 3ZJVA 1K0TA 4DWFA 3V6JA 4PYZA 2EFNA 2LLZA 3VVWB 4EBEA 2J52A 1UPPA 4JE3B 3J7A1 4LVOP 3OUYA 4RF1A 2W9BA 1FJ7A 1AT1B 5IAAC 3M8QA 2CR5A 2IM0A 1W7WA 5C5JA 3R5BA 5E3RA 3WZ0A 3Q3OC 1GMVA 1NDDA 3Q83A 1K9MT 3JXOA 2E1RA 1Y5NB 2RVJA 4I0WA 4MKBA 5I3UA 2J7WA 2GX8A 1M5VC 3NS6A 3GP7A 4CT9A 1T11A 3CULA 5A2QY 1UVMA 8AT1B 1MG8A 2R2OA 2IVYA 4NLOA 3BKTA 4OX8A 1FXLA 1E6YA 1YMHE 3BIID 3M32B 1S97A 5JJBA 1BD6A 3LXFA 1WOPA 5EE3A 3HSGA 1R6VA 1CZPA 1WGYA 5B0CA 4IOCQ 1X4FA 4AJYB 4DHZE 4XPCA 2DR8A 1VQ6S 2MHEA 2HFVA 3B4MA 1JROA 4WFNQ 4IRKA 4TKNA 3HHNB 2BYEA 2KFKA 1NK7A 4ZLNA 3CXCR 1S7HA 2G9HD 3Q2TC 2XSJB 3NXZA 4J9QA 3N30A 4W9DA 2L9WA 1WC3A 1F77A 5L38A 2BE2A 4IDIA 2B9EA 1TK8A 2HHQA 4URQU 4ZS6A 4M8LA 3DU5A 3K58A 4BS2A 4CH7A 2RS2A 4RF0A 1FE0A 4DS5A 1HPZB 3S8SA 2KZMA 2HVHA 2JUOA 1H98A 4WFAQ 3UN2A 3DHHC 1APSA 1D5XC 5KHOA 4B3MJ 3KYDD 3UINB 4USWA 2OP5A 4TY9A 2D5GA 1NU4A 2Y3AA 1VDVA 1IR1A 2I1RA 4ITKA 4OFZA 1SH2A 2HLUA 1SIZA 5FDLA 3ZZPA 4WKRA 4EUVA 2HNYB 3QSYB 2HS4A 5F9NA 3RAQA 4IG3A 1UVLA 4ZHRA 4Y00A 3RW6A 3B0AA 3DC2A 3SDEA 4LFCJ 3V6DB 5MLCV 3M2UB 2RNEA 5CQGA 3EVOA 2E9ZA 3T5LA 4HHUA 2MQ8A 1KJTA 2RJZA 3M8YA 4MM3B 1UETA 4HDOA 2PJHA 5CA5A 2K6QA 1ZDVA 1EF1A 4ANWA 2KMAA 1ZAXA 5L1KA 4G1PA 2H65B 2UXCF 1OYEA 1QSLA 1FJGJ 3DLKB 3GR1A 4ZHRB 2KN4A 1UUPA 2ASYA 1NK4A 4WBFA 3M6UA 3DRPB 3V6DA 3AEFB 4QIVA 2GQQA 4YQWA 2KB2A 2W2NP 2AGQA 2VDHA 1H2VZ 1XLOA 5BMIA 4LJOB 4KKOB 3P96A 5KFFA 2B9XA 1C1CB 4DDGD 1YQBA 3RYTA 3HFKA 3I31A 2LXIA 3S6EA 2XULA 4C98A 1KQFB 1OYDA 1C3TA 4B9KA 4NXMF 3RZWC 2M9KA 4DHJD 2NBVB 2CQPA 2Y5PA 1RTJA 1EETB 1ZM2A 3AU5A 1M5PC 1WTFA 2CUYA 5CHWA 5FIIA 2IMOA 4X4OA 3MURP 4IW0A 2XS2A 2Z57B 4XC2A 4TNOA 2WXGA 2BJ8A 2GO9A 2RDDA 3R7SB 1KONA 3MEGA 1J27A 3B2FA 1TS2A 3D1HA 2V1YA 4DR4F 2DD8S 1PGAA 3DHGC 1S1UB 2KD0A 5JHAA 2DIVA 1YOVB 1X9SA 2E1CA 1JLFA 1HD1A 1NEKB 4FKYA 1HNVA 2KTRB 2XWYA 1WF9A 4G1QA 5KFUA 1T02A 3JQKA 1RGVA 4PG4A 3RPFC 1RHRB 1S48A 3KHGA 2FCMA 3SFDB 1DBDA 1EETA 4X62F 4ZK7M 5DM6Q 3IHPC 4M5HA 5CZXA 4OJHA 3HPOA 4P1CC 3KHHA 2VBYA 2VONA 4BOZB 2DNZA 4LF4J 4CO2A 3EICA 1NJZA 2NXEA 4K5SA 4H4MB 4NWBA 4DR5F 4M0WB 3LA0A 2QZ8A 3O65B 5DQGA 3E3XA 3G6YA 2WZ1A 4F4ZA 5G0RB 4ZCLA 4ZVSB 4LLGM 1YN5A 4FS1A 2QA2A 4QYRA 2KTRA 1WKJA 2MJ3A 4DR4J 2HHUA 2RKIA 2VUGA 3O3LA 1NUEA 1ZXHA 4F4YA 2DAFA 4FZVA 4Q5VA 2QTWA 4KB7A 1I94J 3P4QB 5K20B 3R6GB 2PIAA 4KIAA 2Y1RI 4NI2B 4PG5A 1V5VA 2YWHA 4C4WA 4HT5A 1S57A 2HQFA 1KVJA 3PIPQ 1LWEB 2WX0A 1F5BA 2DXFA 2G1HA 2KH9A 4XX5A 3B8HA 2KDIA 2PMHA 1T9TA 1VGYA 3QZ7A 3U1NA 5JXVA 1X4HA 2V50A 3L3CA 3K5LA 2H89B 4NAMA 5GAGU 4B9NA 4ANXA 2MJDA 4NASA 4O44A 2FGCA 1GX6A 4K50A 1TQLA 5G55A 2HQCA 1SV5A 1HE8A 2VKZG 1T9WA 2NPTA 1CBKA 1ZH5A 4WZMA 2SXLA 1I6JA 3O2IA 3D6MB 1YSJA 2F4FA 5DG7A 1N4LA 3I4HX 1Y5LB 2VH2A 2MJEA 2KT5A 3M63B 1F60B 3CDBA 4USHA 4O3PA 3NS5A 3AJDA 4C00A 3VVUA 3DOLA 2KC2A 2HQGA 2D3O1 1WXAA 5C24A 1JKHA 1J7BA 2IRXA 2OPRA 1V9JA 1D9AA 3O8WA 4LNOA 2OIHA 2NPTB 1U48A 1RCXB 1HBMB 1N6QA 4DSKA 2LRWA 1RT6A 2V2ZA 2WXFA 2VASA 4NRUA 3Q3NC 3HT0A 1WM3A 2CHZA 3T5HA 3PR5B 1VBZA 4PXCA 5ETVA 2D3CA 4B0MA 1EO6A 1FCCC 2KZRA 1Z1ZA 1NAQA 4DFKA 1S7IA 2XB2D 3PFEA 4CQ1A 5LT5A 1XERA 4FKXA 3Q24A 2G13A 5KFHA 2EWHA 5EHHA 4V19J 2Z4PA 5A2QU 4Q8EA 3OJSA 5A8RB 1T05B 2MBHA 5I42B 3CMES 2OEJA 4ED6A 4MYTA 3QC8B 2DR6A 3P4PB 1XMBA 3WC2A 5F8JA 3BN4A 2RR9A 3F41A 3QRRA 3WAMA 4LR7A 3Q8EA 2P8IA 1ZM4A 2XG8A 4H4KA 2QYGA 2G9OA 1VCBA 3EECA 5LSOA 1IQTA 3MM9B 2FLOA 2KFJA 3KJFB 2BKNA 5IQ6A 2FVCA 3QRPA 1RT7B 3CJTA 4LFBJ 2ZCCA 4MH8A 2LQ5A 3H6NA 5I42A 2GCFA 3MM5B 1N5TA 3ZTRA 2O01C 2DH9A 4N7TA 1HW9A 4KKJA 2K8CA 4DJBA 1AYFA 5EE1A 5D0GA 1B0VA 1YBTA 4Y2MA 5I3UB 1RQ0A 4DBQA 1WX9A 2DLBA 3TO8A 1WXVA 4DUYF 4B9LA 1H2TZ 3I9V9 2Z2ZA 3IBCB 4MDKE 2KO1A 3K57A 3EHVA 4TMAB 2E7VA 2CDQA 3QT5A 3BVZA 4IWOA 4OI0A 4JQWC 2XGQA 2IO0B 4LNNA 4DI6A 1FVQA 2ZBRA 3D68A 3EPIA 2X38A 3KK2A 1SC6A 2W8LA 5HI7A 3UF8A 1FI4A 2WVBA 1WX8A 3X0WA 2C2MB 1HQ2A 2BKOA 2FD2A 4GO5X 3M8SA 2X7IA 4R25A 1OFFA 2VJVA 2FQQB 4JB8B 4X4SA 2ZKUA 1Q8KA 5KG4A 2JVRA 4FS2A 3TA1A 3CJ5A 5L46A 2EI5A 2HIYA 3D1QA 2M19A 3G8QA 1IBLF 1EQ0A 2WONA 1S0OA 2OMOA 5IM0A 2RGFA 4EBCA 4B3OB 2MQMA 1WGDA 1TL3A 3NVZA 4J6IA 4FBJB 1N61A 2PEBA 3KNAA 3MDFA 1G7CB 4QR2A 4K4YA 1BLUA 4CT8A 4HPLB 2N7DA 3K8WA 2KC1A 3GSDA 4PXDA 3UQSA 4TUUA 1SJ3P 4P6VF 2R7VA 4DQPA 2N1VA 3R5DA 4AT1B 2NSCA 2VFTA 1B0TA 5HL7Q 2FBWB 2N82B 1EWCA 2AHOB 1UTAA 3H5UA 5ETMA 1JLGA 4NLWA 4KVGB 4EZJA 2Y1IA 1TGZB 2KG0A 4CHKA 1PO6A 3NS8A 3CDWA 3KKFA 1KEKA 1RWNB 2OD6A 5D0RA 3AI5A 3LYYA 2WK4A 1LWFB 2MKHA 4RW7A 2GBJA 1I5OB 4TQ0A 1HI1A 4QIGA 2ALYB 3PEHA 1E7PB 1Z2MA 1YJTA 3NOCA 4CLKA 1RABB 2R7OA 3M62B 2GGPA 3ZLZA 5E6NA 3WX8A 4F4KA 1V80A 2DHZA 3AEAB 4ZVGA 5JVGQ 1Y5IB 3A13A 1Y56A 3R2IA 3NG8A 4HEA9 1YG0A 3MM7B 4P10A 2KJRA 2VZKD 4KYZA 1I4GA 2K8HA 4A8QA 1FFUA 1TKYA 5HQ8A 3RTVA 2EW9A 3EE3A 3FFIB 1CQNA 4LBIA 4GMVA 4IH7A 4TQ1A 2ACMA 4DOZA 2J5AA 5A8WB 3TEHB 3H90A 4MK8A 1KOHA 5G5HA 2D9OA 4OX9J 4JIOU 3CTRA 3K89A 1C78A 3O1LA 3BDPA 1ZZFA 3KWVA 2HBZB 1SXLA 2LU1A 5D3GA 3ZXVA 5AUIA 4TLRA 3HHLC 4XZ4A 2KRBA 2WXNA 3VH3B 2FVSA 1RU1A 3U1LA 5GMDA 2TSSA 3JTNA 1QQRA 3FCWA 3C6UA 4GKJF 3C15B 3AE6B 1F0ZA 4PWWA 3K59A 1WG4A 4EO8A 4X62J 5FJ4A 1C0TB 3IAS9 2DO4A 3A1QA 3DVNV 1L4DB 2FNJB 1VMBA 1PJ6A 3H7PA 1DYQA 5KFVA 1JJ2R 1UJ6A 2ZH5A 3EGRA 3NP5A 2GJFA 4KHPJ 1FXRA 2ZNYA 3LQVA 1R4MB 1ZETA 2JFDA 5D6GA 4R0EA 2V94A 5LMNF 1FDNA 3FBFA 3R3TA 2K1FA 2R2SA 3MEGB 2UXDF 2GBKA 1V1PA 2KVRA 3NVYA 2DNLA 3HVZA 3CO9A 4OVVA 2QHOA 2CPDA 2NYIA 1XR7A 3MPUB 3UD3P 5HVGA 5GAGI 1AFJA 3SV4A 4L76A 1AXQA 3Q69A 3EGWB 4BWMA 1FK9B 2ZOGA 3H25A 1TTHB 2RDGA 1TKDA 4DR3F 4MKVA 2PE9A 1MG4A 4HI2A 1A0OB 4I6PA 4CIOA 2VKRA 5J2PA 2F65A 2XYGB 1P9YA 1N5YA 4YDXA 4YR0A 1RWUA 3AQPA 4DQQA 2YVCA 1BWVA 3H1UA 2WU5B 5DDRC 1FFWB 4RH6A 1RA7A 2LFVA 4WJNA 3SDLC 4UDUC 2UVVA 2IFXA 2WVCA 4KGTA 4KPYA 3POTA 2MHJA 1FFVA 1CMXB 4OYWA 1L3UA 2Y8YA 5E6PA 3CVKA 4FYWB 3TEGA 4HCPB 2NBWB 3OT9A 3MEKA 4LNKA 1W26A 4X65J 5K14A 3AULA 1D4BA 4M5MA 4UF4A 4DF8A 3A9KA 2JZ3B 4K7UA 4MGYE 3N6MA 1JIHA 4DV2J 1EZZB 2DIUA 4CO4A 1NK5A 1TIFA 3HD1A 2CZ9A 3CJKA 1JCKB 2WGSA 3PIOQ 3CD5A 1KOOA 3G2XA 2KI2A 5F0UA 4ALZA 2AEMA 2V4RA 2L76A 3SCKE 2CPZA 3Q8BA 2J42A 2E5GA 3GP9A 3PO5A 4NZLB 1TUVA 2L48A 4X4PA 4EFAC 5F8HA 4WWNA 2MLYA 3LANA 4U67Q 3W8GA 4RMAA 1RT1B 1XLPA 3UN3A 3KYLA 2GOWA 2RF2B 2BXJA 4WFXA 4YSZB 1PG5B 3I0SB 3C16A 4RU9A 2LMCA 1FKPA 3HVRA 3NNHA 5K8NA 3PREA 4OW0A 1N88A 5L95C 1EIYB 3N4WA 3PRMB 1NSKL 1RT6B 2KU7A 2DR7A 2YQ3A 4X4RA 4JV1A 4DPTA 4WYWA 1NCLA 3DCGA 2L0FA 3I82A 4JI5F 3N5FA 4ECRA 3BBFA 1JLBB 4E8UA 2KQ4X 1HI0P 3FILA 5TSSA 3NS1A 5HO4A 1CJTA 2WXLA 3M3JA 4WJQA 4JI1J 1WE7A 3RR8A 4W90B 1WDDA 3JVZX 2LGSA 4YR2A 1KVIA 5HMXA 3MOJB 3DMJA 1GEHA 1ZM9A 1XMQF 2P9EA 5C2TB 1REVB 4BC7A 3BVMA 1T0SC 3DOKB 2KYXA 1DOXA 2KLCA 1CPZA 3ET6B 1RE1B 3V62A 4AJWA 4KKIA 3FILB 2W55A 2DGXA 4AS1A 2H51B 3KK1A 4DPXA 2O66A 3BGUA 2MX2A 3M8PA 4H54A 1WXMA 4DR7F 3VAWA 3DGPA 3UNYA 3K0JA 3RCZA 4O4GB 3R8BA 1REVA 1N8RT 4NZ7A 4AQYF 5CX3A 4P71A 1JLAB 1NRKA 2YQ0A 4XWWA 2QILA 4BWJA 4LK0M 4HCNB 4F8CB 2QA1A 1FJEB 2HYIB 1E6EB 1VQ7S 4DU8A 3DDIA 2R7WA 3DOWA 2JRSA 3BQ0A 2H5JB 4DL4A 4TV3A 1FEHA 1PILA 3EUB2 2QG9B 2MLBA 1KRHA 1VK8A 3F56A 4N5SA 2WDTB 5EWGA 2W24A 3BSAA 3MMJA 5KG0A 4C8OA 4ECTA 3V81B 4DV7F 2ZBCA 5CYQA 1E9MA 3TL5A 2W7AA 4LQ3A 1P6TA 3MF5A 5F3TA 4USIA 2J76E 1WY8A 3HJFA 4M63A 4DSIA 2AJ0A 1KTQA 3G82B 2IHR1 2R8GA 4K7SA 3UIPB 3QGGA 1PC5A 2C2OB 1R4NB 4RW6A 5BYSA 3GS2A 4RR5A 4IWQA 4FN2A 1T7PA 3NS7B 3FJ2A 2Q66A 4L74A 1OEYJ 3W1SC 3I9V1 4RNOA 2UUAF 2DXEA 2BS4B 2F40A 3SV3A 1J2VA 1S5ZA 1KR4A 1ZKHA 3VR9B 3QLHB 1VRUB 3EA6A 3M6XA 1BQXA 5KT7A 2IO1B 2Y5CA 2L3ZA 3D9BA 4CO1A 2BKFA 1U26A 1T6BX 1RBOB 2WBMA 4LF7F 2PMWA 4YWGG 3TR5A 3UWTA 2XMAA 3UDCA 1X4DA 2UXBJ 2BJDA 2ACYA 1I4HA 2CPJA 2HFNA 4ERDA 1RTHB 1IYFA 1DTTB 3RB0A 4PUOB 3U30A 3DYAB 2RDJA 4CTAA 2HHWA 1RT3A 3I5CA 2BS3B 2JU6X 3RNBC 3ZNID 3D2WA 4USTA 1VS3A 4JI8J 1JXLA 4WURA 4DV4F 2MEKA 4FVCA 2BM1A 3H42A 2O5DA 1K0VA 1PQSA 1RWSA 1FDDA 3P4SB 3UNGC 2QT7A 4NYZA 3RBZA 4JI6J 3RBDA 4HKZE 3ELHA 1RHKB 5KFIA 1PDXA 4RBUA 4G65A 1R0CB 2V5HG 1MWYA 5L1IA 1Y00A 3EJMA 3MAAA 5AZGA 2UXDJ 4B3TJ 3MR7A 1TZOA 4TXSA 4ARIA 3GLJA 2X3DA 1K53A 4QCLA 2E5HA 3PCOB 5I4DA 3T9ZA 2VU5A 3QAQA 4ILRA 2J9CA 3SYZA 1OQ3A 3J80U 2VZKB 5CD4A 3W5VB 2VRRB 2J0QD 4K8RA 5IWAF 1G4CA 1KF6B 1U24A 3N01A 3QGIA 4M02A 2PKOA 3D0GE 4FVMA 5F3ZA 4DV0J 1IBKJ 3VV2B 1GX5A 2A10A 2OUGA 1S1TB 1SJED 1RAJA 3P2BA 2EG1A 3RRHA 1IBXB 1V5IB 2MCNB 3HT3A 3OTOF 3KDOA 3ZXRA 1WEZA 4JI4J 4IWPA 2GIFA 2CJOA 3FZBA 3X3UA 2CHWA 1QE1B 2N9LA 2KHDA 3WANA 2JWUA 3MPYA 4P74A 2VPWB 3UVJB 3V4IB 1WMHB 5E3AA 2MSED 2V3NA 1ACCA 5AE3A 1UGMA 2A2CA 1NPPA 1PGBA 4B3TF 3T5JA 4DX8H 1T9UA 1MMDA 4MKYA 2QCZA 1E6YB 5LMUJ 2JYTA 3MMAB 2IJNA 4MSMB 3JTOA 1KC8T 3EC8A 3BKUA 3DLEA 4A20A 3CCVS 4A8XA 1UKUA 2C42A 3UO0A 4KZ0A 3V4IA 3TJPA 3WAOA 1ACMB 4Q8FA 1WTBA 3RNAC 1YJJA 1WHXA 3ISZA 3D7SB 2RMLA 3DNCA 2GNKA 3W61A 1J5OA 2IVMA 3IP0A 4J9NA 2KL8A 2EK6A 4FBTA 1G6JA 1UPMB 4F7VA 1M1KT 2ZNZA 3QWPA 3TNVA 4DV5J 1RT2A 3QO9A 4C11B 4DPUA 2PEAA 4C4VB 4NX9A 1YI2S 1WKKA 2KKCA 1QVGR 1FNXH 4FXDA 1T0TV 5D4NA 4MGKE 4WXWA 2CJYB 3AB2B 4KH0B 2MEWA 2FCQA 5KFYA 4DV1J 5C42A 3I87A 1X5OA 3P45B 2FJEB 5C7PA 3D66A 3MCOA 3PHTA 3W5XA 3MR5A 3CJQA 2JEFA 3NBPA 3M9MB 4W9EA 2Y1JA 1NYQA 4NL5A 4TYBA 1MMLA 2V69A 2K2PA 5JUMA 4F02A 2J0SD 3NY5A 4WAFA 2CG8A 4OZ5A 4M01A 2R9LA 2IO3B 4CNZA 2YEPB 2MLZA 1KBRA 2IDLA 2FUG1 1ZUD2 2GQCA 1WSVA 4DV2F 1RAHB 3RW7A 3SQGA 2VHGA 3TI0A 3W9HA 3PW2A 4IOAQ 4EZLA 3MHSD 2REXA 2L08A 2IA6A 4F0MA 4ZDNA 4FP9A 1PCAA 1P8GA 5J17A 4C7ZA 3HK2A 4NCGA 3DHWC 1LO5D 5K8PA 1VRTB 4JP8A 5CCMA 4J9RA 1N60A 1IQZA 3HO1A 3KLFB 1I4QA 4MM3A 2KDBA 4CM0A 5D3IB 2DGWA 2ZZNA 2EPIA 4UQGA 3QQCD 3R6LB 1UVKA 4YSXB 4DG1B 4C8ZA 2LEKA 1XR5A 2VPZB 1PAUB 3MCNA 2M17A 3KJVB 2DITA 2IIHA 2GVZB 3GIKA 1R3NA 2IBOA 1WJ9A 1RAEB 1NZ8A 3RB4A 1FXAA 2I2YA 2GAGC 2CQHA 1C4PA 3HIZA 4CNYA 3GTYX 1QUVA 1RHUB 2B4PA 2E7XA 1X4CA 4ZPVR 2PA3A 5J1NA 2JX2A 4O3OA 3DLGB 4FYVB 3ONQA 3Q8UA 3PGEA 2MW5A 3D0HE 3LP2B 3H7HB 2LQ8A 2YKPA 1ZE3D 3TZZA 3KLHB 1X31C 3M30A 4RUBA 3L08A 3DM2A 4JI0F 4Z37A 1BQMB 1YLXA 3CIZA 1IXKA 3GCWP 1RAAB 2AYOB 3JSYA 3PTWA 3HZEA 2JRHA 2OPQA 3DMJB 1X4GA 1MJDA 2JL9A 1T9YA 3TIXA 2UUTA 3R1HA 4M00A 3V6KA 2N7EA 4QR1A 2B6AA 4AUKA 4NNJB 1JLCB 1ISNA 1HMVB 2A6OA 2DRAA 1OPZA 1F2GA 3BF4A 3W9JA 5EE0A 3TZWA 3DLGA 3T1YJ 4CLYA 3EZUA 3BPDA 2CVIA 1XNRF 4DS4A 4DQRA 2BJ9A 4GVLA 1C4AA 2A1BA 1K52A 1T0YA 4NAWB 3A3OB 3TAQA 2X51A 3W5YA 2XTJP 2HZVA 3CC2S 1X4AA 1CJVA 3OD2A 5IC4B 2LJIA 2ZEJA 3BR9A 4Z7CA 5EE9A 3ZYYX 5HJYA 2KACA 2ZOMA 1TZ1A 4ZJLA 1I4RA 4ID8A 4LIRA 3OFGA 4K0KF 2FLNA 1OS5A 4B95A 4WU2A 1FRDA 3ILJA 1XLQA 3DRRB 1U1OA 4G0NB 2N4CA 1PBAA 1YX6B 4HROA 1PJ7A 2XY6A 4KGMA 3KJQB 2LXAA 2H88B 4JI0J 4EZ6A 4CI0B 2H4WB 1SH3A 1XMOF 1XNRJ 4PQUA 4DL5A 4ECXA 2MZ1A 2RKIB 3OTEA 2R42A 3APDA 3BGLA 2HK2A 1LW2B 4ER8A 2PGCA 5D2MB 3TBLD 2J4XA 3P4RB 2HBQB 2YKAA 4F2RA 5KG5A 2DBBA 2EFGA 3TUJC 3PZPA 1WFYA 4DR6F 1TP7A 2C1EB 1JMTA 2ASJA 1XNQJ 3DHXA 1S77D 4PQUB 5C1ZA 4IDKB 2QSDA 2W3SA 4UT4A 2N3LA 1B0PA 1I42A 2FAZA 2N4DA 3L17A 2NREA 1FESA 1IKXB 2WLBA 1VRUA 1HYSA 1RI7A 2ZHAA 5HMYA 2RPVA 3A8JA 2FJXA 3VGTA 2V2KA 3Q8QB 2XMMA 4L72B 4DU7A 2QFJA 2QEJC 1WACA 4XPEA 5H9FK 2KRRA 4YB5A 3IG1B 4XYCA 5AZFA 4GOCA 4WF9Q 4E3CA 2L1AA 1TAUA 2B4VA 5I4MA 3KWLA 2B0GA 1SKSA 3GZNB 1XTZA 2DHAA 4BVUC 1RTDB 5HVHA 2VG6A 3FBBA 3ZTPA 3KLSX 3L7OA 2LA6A 1WR6E 4XDCA 1S6PB 1ZXIA 3NZSA 4CZCA 3QNWB 4NPOA 3Q8CA 3A8EA 2VBXA 4LUBA 2Z58B 1SF0A 4GC6A 4HTJA 5D6JB 4NYOA 2V8VA 2KXFA 3S1TA 2ZJRQ 4EZ9A 4F3QA 1JWSD 4P9SA 2CYYA 5C23A 4RLEA 2OMLA 3IC1A 3FSXA 2DXDA 2Q6BA 1FFSB 3KTQA 2A6MA 3T3OA 1NSQA 3EDQB 2MMYA 2F8HA 1N54B 2ZCBA 1U1KA 2QYCA 2ZJPQ 1SUQA 2EK1A 5F8NA 2LGIA 2HDEA 2HFSA 3HKZD 2KJVA 3FQLA 4ZP9A 2NTSA 2M56B 1NI3A 2QN6B 2BBCA 1BUXA 1VBXA 3J7AN 2F3JA 1GAQB 3DRSA 3HJVA 1ZOYB 3DKDA 1FCLA 2OELA 4DLEA 2GMJA 1RBLA 2BZ2A 1WJ6A 3KLEB 1RAGB 1GXLA 3L09A 2B8QA 3KUGA 5GMEA 1P9DU 4XAKA 1OY8A 1V2YA 4IQMA 3RNFC 4S17A 2JSXA 3EGVA 4FF2A 5IS2A 4FF1A 3ZZTA 2B4UA 2KM8C 4YL8A 2VG7A 3A4RA 4I6NB 4N9F4 5KAKA 4DUTA 2VG5B 2AKWB 2C7MB 1D09B 3KYCD 2E6XA 1MSWD 1F1BB 5KFOA 1DURA 3PM9A 4BKTA 1N5VA 3L95X 5AE1A 3KLEA 3Q0AA 2JVCA 4YHHF 2R8JA 3KJNB 2VC0A 3AV8A 1ZAVA 2A3JA 4PQAA 3M9NB 1Q8BA 1R8AA 4ED2A 2XI3A 2IBKA 2XZWA 1VIOA 1SIWB 3ETMA 2B76B 4C8YA 2YX4A 4UOFA 2V2QA 1FD6A 3OJ4B 1EARA 4RCOA 1CC7A 3IWNC 1A9NB 3JQMA 2YKMB 4ECQA 1UJ5A 3JYUA 1GT8A 3VTIA 2F5GA 3HK0A 4H4OA 3DHIC 3OW2R 2Y3YA 2HRUA 1NDLA 1F2HA 4ZRKA 1I4PA 3FK4A 4LSNA 3R1LA 1NJIT 4UY8T 1Y9OA 2YQ1A 1X9MA 4ILMA 1YJVA 4RJVA 2PPHA 2PIIA 3ZDTA 4RW8B 1GXTA 3PEJA 2IC3B 2GA7A 4LFAJ 3AECB 3ZNGC 1TFYA 1DLOA 3U4EG 1RWKB 4RWWA 5JZEB 3M2UA 1E8WA 1SB6A 3OPKA 2INDC 1AZSB 1M94A 2DKOB 3THTA 3RUIB 2N9KA 4RBTA 2G3QB 2H1YA 3BR8A 1FWLA 3DVGY 1AYEA 1S0VA 1GPXA 4MJSB 3AA8A 2J7QB 5C24B 1VC6A 4RO0A 1ZW7A 2MRPA 2RDIA 3MHYA 4NCGB 4FPIA 4FLHA 2CU1A 2ADCA 3H59A 2NXNA 4X4TA 4LF6F 3GCXP 4RL1A 3TRGA 4KTQA 3MHZA 2W4CA 2JWNA 3AQOA 2J9EA 4LF8F 4Q0BA 4CLZA 2Y8WA 3OHBA 4LFAF 4PWDB 2WWZA 1WNEA 2XNRA 4RNFA 4J9KA 4U7UK 1VDHA 3R2TA 1YWXA 1CJKA 3W60A 4NQKE 4LNIA 4MJSA 5T8IA 3KUDB 1YRTA 5A0YA 1SBBB 1FIQA 2P9CA 4BKGA 3AU4A 1M90T 2UP1A 3TA2A 1S76D 2L9NA 4HTIA 1K8RB 4MH0E 2W8KA 5DRKA 4OZNA 3A3NB 4R8UB 1VJKA 3ZZOA 4ES2A 3SFEB 2Z2LA 2BOAA 2NCNA 2KWVB 4U6PA 2B5JB 1ET9A 4DPWA 2MYFA 1EF5A 1XD3B 1LOUA 1DRZA 1BQMA 2C2DA 5HBMA 1R6YA 3MMBB 2DGQA 4G1QB 4LDTD 3HSDA 3W8PA 2ALZA 3ENVA 4OZJA 2DY1A 3BGFA 2GMIC 1SJRA 1BY9A 2AF6A 4TVAB 2JXXA 1RAFB 4DL7A 2PT0A 3NGRA 5AT1B 3QATA 4BBNF 1MLAA 4KX6B 4YY3J 3FC4A 4EEWA 4M0WA 4BHQA 5I3QA 1M5KC 2IYDB 1V6EA 1S6QA 3N79A 1ZP0B 4NZ6A 4GMKA 1OMSA 1YX2A 1WR1A 4CQNA 1QT9A 1Q0NA 4DN9A 3MC0B 5HMWA 3SXLA 1Z4UA 4ZPWR 4FJVB 1NBFC 3X23A 2FC9A 5GMKa 4J9OA 1RTIB 2WOMA 2OPPB 4WKYA 4JLCA 1VRQC 5EN1A 3GZNI 2OGUA 2DB1A 4DV4J 1NXIA 1OSDA 2MA9B 2OO4A 3L13A 1UWAA 5ETKA 3FRYA 2WONB 2CJBA 2CJNA 5IM0B 4I68A 4ASWC 5TR5A 4ECVA 1T8EA 4DXAB 1UVIA 2MXYA 1TL3B 3FKBA 3OL6A 4LR8A 1KSPA 1HARA 1L5UA 4ZIWA 4QWDA 3CO0P 1Q8IA 1RKIA 4I2PB 2ASLA 3C3LA 2V0NA 4IQXA 1UMJA 2G4DB 3Q86A 3KWMA 5IKCM 2UU7A 2LGDA 3OXFA 3MR2A 3HX9A 2KQ7A 1YJ9S 1L0XB 2OFGX 4Y3CA 2XGPA 3WQPA 3AEBB 1IJFB 5F41A 2VH7A 2CWKA 2BJEA 4GDKB 3TEYA 5CYMA 4ZP8A 4PG8A 4NQLB 3WBZA 2J0KA 1IKXA 4OJ1A 1FTCA 1ICEB 1SL0A 3AHPA 2QMWA 1G3OA 1X4EA 3GG0A 1UBQA 1VQKS 4IRCA 1Q4RA 4O3NA 2OJWA 3AB5A 3NRZA 2MBOA 4HJKA 2V63A 4ELVA 3EFUA 3I6PA 1TY0A 1D3ZA 2DNHA 1K50A 5BYQA 1QSYA 2MZJA 4PS7A 2UUWA 3C2PA 2DBYA 1S1WB 1MG7A 3AE3B 1MU2A 2ZVNA 4WWPA 1EUVB 2V6AA 4YMEA 1RKJA 5FR3A 1U49A 4XK8C 2SEBD 1E7UA 2AJQA 5A8RA 1T05A 3IAS1 4FULA 2M70A 2OPSB 2WRMA 3ULHA 3DBHI 4PYUA 2CA9A 2X1BA 3EZOA 3FFIA 2XY7A 4HDHA 2JSVX 2BANB 3MEDB 3DBLI 1DJ0A 1HZ6A 3BQ2A 2IRYA 4C0OC 5L9XA 3VAIA 5J2MA 1Q53A 4I4BA 2ZM6F 1WGKA 2KDMA 3E2EA 2L8JA 1SEBD 4AXJA 3OLAA 4I56A 4AOFA 4QW8A 2KMCA 5CABA 1RTJB 2ERRA 2MDAA 4KHRA 4HXDA 1FDAA 4KY3A 4RGOS 2HBYB 4UQTA 4PYAA 4DSEA 4WCEQ 3MEEB 4EU0A 4ZN3A 1R4MI 3LB8C 5FLXU 6AT1B 3RBEA 3OTDA 3ZZ0A 3G86A 3NRBA 1UW9A 2IDEA 5KFDA 5GMVA 2KYZA 1JLFB 4ZP7A 1M1GA 3D1OA 3S2AA 2E5LJ 5J2MB 3QJPA 5IO9A 2U2FA 4OZBA 4W4MA 1T03B 4F3OA 2WNMA 2RB7A 2E1PA 3MFGA 4F50A 2VQEF 3K9OB 3Q6BA 4USAA 2EBEA 2CG4A 3ITHB 2ZD1B 3CJ4A 2WSCC 3DRSB 5DPRA 2R7TA 4CLLA 3B78A 1BC6A 2ZH4A 2V8GA 2K5PA 1WHVA 4OI3A 1X4BA 3MM8A 1HL6A 4ZPBA 3FBEA 1GG3A 3MUMP 3QFWA 1Y4ZB 1RT5B 1MROA 5DG8A 3RZFA 3SCLE 3QMQA 4B3OA 1JWBD 3P8BB 5ETNA 4A8OA 2XEXA 5LXYA 1RYJA 4C9DA 4MKAA 5B0AA 2ZW0A 4KFBB 2K3UA 2Z30B 4NI2A 3ZXWA 1ITPA 2DNQA 3AOAA 4DV0F 4USJC 1LWEA 2UV8A 3F44A 4TYAA 2XBPA 4GXBA 1PBUA 2P6SA 4A47A 1GOZA 2GI9A 2ILZA 4MMOA 1H38A 3V81A 5IOIA 4CH1A 3MJ5A 1QM9A 3QT7A 1GC6A 4C7QA 5L1JA 4OYIA 2BRKA 3ZO7A 4KDIC 3KLGB 3R5JB 4RM8A 4AL5A 3RUBL 2UYZB 1KHVA 2ZDOA 4YB6A 2YNHB 4J91A 2XNAC 1N0UA 1LXDA 4J9UE 4RZRA 4LTUA 1S49A 3GPAA 3G96A 1U2FA 1LWFA 2CXEA 2KYWA 2PLPA 2IPOB 1MN7A 1R89A 2NZ4A 1IR2A 2DY9A 2QMXA 3K5NA 1NO8A 2MZRA 2WVFA 4GC7A 1HNXF 3NGUA 3KH0A 2E5IA 2KT3A 1WUUA 3IR7B 4HDGA 3RD2A 4K5RA 2EEYA 1N6QB 5I3PA 5H92C 1TL4A 5KFTA 1JWWA 1WXSA 2ZC4A 3ZNHB 1I1GA 3MPDA 1WC5A 6FD1A 2CPYA 4IOBA 1TK5A 4LRCA 2KJ6A 3IT4B 1D9FA 3TQ1A 3VAMA 4PUOA 2W01A 3ZRCA 4OHXA 1UEUA 1QAYA 1TL7B 3NAIA 4OHZA 2Q3PA 5HVFA 2KDFB 1VISA 5BO4B 4ANDA 2C3PA 3DDNA 4DV5F 1WRDB 2JDJA 2AW0A 4IOIE 2F9DA 4OJ3A 4ZP6A 1GAOA 2D74B 3NKYA 1O8BA 2GIQA 4GDLA 2AWTA 2FGOA 2C2NA 4OZAA 2BABA 4M5GA 5KT6A 1WC4A 5C2GA 1N6ZA 2WVEA 3C15A 4LR9A 3QIDA 2PW9A 2AJ1A 1ROEA 2COLA 4OYAA 3FGVA 5HFYA 2HQDA 5KG7A 1DQ8A 1VQ5S 1GNUA 4DR7J 3PSEB 2HFOA 4PABA 4X64F 2LEAA 1C0UA 1F3FA 2R8KA 3R2DJ 2WAQD 1N52B 3Q89A 1FX4A 3FBCA 4AE5A 2ASDA 1S1VB 1TR0A 1WC1A 1V1PB 3DWGC 3AH7A 2DWQA 3C8YA 4ICVA 2XNQA 2RQMA 1YX5B 2LUMA 3MECB 3AMZA 4MT5A 1EQMA 4FYXB 1WORA 2AEJA 3PYFA 4PT5A 4ZVQB 5DQHA 5LSRA 1VJWA 1FK9A 4ZJOA 5HLFB 3UDLA 2GFFA 4CRJA 1FXIA 1TKGA 3WC0A 3OQ2A 5J2NA 1EWYC 4W9FA 3HD2A 4ILLA 2M88A 1HQRD 2NMQA 2HBRB 3ZFVA 3UD4P 2J9DE 2C5LC 1HHSA 5KG3A 1WSPA 1BMLC 2HVEA 3HHDA 1SJ4P 3EXYA 4CO3A 1RB0A 1H72C 4EEYA 1RM6C 3N6NA 5LXRA 3QARA 1U2CA 2BWES 2N9PC 2VH1A 1YJRA 1L3TA 1Q78A 4ED8A 1QUPA 4A4JA 1S6QB 5E3QA 1C9FA 3PW7A 1GFWB 1L3KA 2ZKTA 2V68A 4QJVA 2FPHX 2K25A 3GQCA 5CHCB 4DN0A 2EFVA 2AV5A 3I5AA 3CC4S 3UPFA 3UW1A 1YZ7A 3ZDMC 4IFYA 4B17A 2WXKA 1OWXA 4FN5A 4B3SF 4X66J 2FUG9 4RKUC 2LMIA 5K14B 3IRXA 1SE3A 2KO3A 3Q8SB 1Q5VA 1NLKL 3FSIA 4OI1A 5DPSA 5DQIA 3MAQA 1EU3A 3NEKA 4HI1A 4K59A 1Q5YA 3T6JA 4R3DA 2QLXA 4ZVRB 3U7DA 3RG6A 2UXCJ 4ZPTR 2IM3A 1KLGD 4C4VA 3WALA 4WQMA 3QX1A 3QQ8B 3IRWP 3E8OA 2JZ5A 3QPIA 4ZLPA 3BY4B 4UOCA 3JQJA 2CQIA 1S12A 1HXYD 2V4LA 4ICUA 3I3TB 5B7WA 5B08A 3DXBA 1NHVA 2LI5A 4HDQA 2H3EB 2LZ6A 1V86A 4WP9A 4UZCA 3ZIMA 1MN9A 1DGJA 1GC7A 3TUIC 2CPFA 5KFJA 3AM9A 1W25A 1WGHA 3H0PA 3QIJA 2L9DA 1N32J 4C2MA 4JUZA 2UUAJ 3HUIA 2I9SA 4NMXA 5L1LA 4ANVA 1VLBA 1VCTA 4CLSA 3NGTA 2XYHB 1IBMJ 2DHHA 4LSZB 4QIEA 4H2AA 3DBHB 2VODA 3D6HB 2D69A 2J8SA 4IM2A 1TUGB 1WYWB 3RB3A 3SEOA 4ZVTB 1DOYA 1IR0A 3D6FB 3TVYA 2EKIA 2HJ8A 3UN5A 2KLGA 3SU8X 3N6LA 1WF2A 4CYUB 4DG1A 2FVRA 3CCZA 2XYPB 4OV1A 2W25A 1E8YA 4NLSA 4U95A 1YIJS 1SJHD 1ZBTA 1D5MC 3C6TA 4JV5F 2DZIA 1YJNS 4NY0A 1ZA2B 3IR6B 3RN9C 2WTFA 4HWIB 3OUYB 4N6EB 2W9BB 4F3MA 4P75A 1YVFA 3QGPA 1N32F 2JOQA 4MYUA 1EP4B 1SKWA 3KOAA 2RSUA 5LNK1 3QZ8A 3N20C 1TS4A 1E5WA 3M8PB 2C3UA 3AY0A 4HACB 2VQFF 2V67A 3R7NB 1V1OA 1TELA 3DGPB 3W9IA 2YKOA 1FRHA 3EYZA 2CJ9A 2HLTA 2LGXA 2G0IA 1FRIA 4IO9Q 1SL2A 2VBWA 3BYYB 3C6TB 3VHTC 4QBUA 1YJIA 4WU3A 2CWXA 2K7JA 5LMNJ 2AJ2A 4IR9A 1UGJA 3PJXA 3MMCB 2BQ3A 3KG0A 4P7VA 1N33J 4PS8A 3I32A 3EM1A 3AN1A 1MHXA 3P1MA 2MKYA 4N77A 2QJ3A 3LJ3A 1PYSB 4DLGA 1KTKA 1WRIA 3DBRB 1CJVB 5BXIA 1D1UA 3KMQA 7AT1B 4B6WA 2VA2A 3MFHA 3VAKA 2EC2A 4ECYA 2KWUB 2MQNA 1ZA1B 3OR2A 1YJ7A 1EKSA 2RUSA 4DHVA 2DISA 2P9GA 2MLXA 4OYPA 3CD7A 1FD8A 3DN9A 2D3BA 3FEZA 1FKAF 5DZ7A 1U1NA 3OAWA 4JI7F 5BR8J 1LW0B 3MXHP 3L54A 3HVTB 3VAGA 3TEWA 3IWXA 2AQ1B 5G5GA 3TA0A 4HHHA 2D3GA 4MACA 3NZ3A 3LGHA 4M1KA 1TYGB 1FXTB 2HIQA 1R8BA 4P72A 2Y5BB 1LW2A 1TKTB 2ZE2A 4P2MA 1J8CA 4LREA 3M1VA 2J6TA 1EJ7L 2HQIA 2LYVA 4US8A 3IA0A 2QO3A 1KTVA 2DNNA 2DGOA 2JLGA 1BXTA 4DBGA 4WWSA 1DAXA 2W7OA 3ZNJ1 4HL9A 1RAXA 2W2MP 4U7UD 1Y10A 1RTHA 2B7CB 1YNTE 3RFZB 2GJ2A 1YN4A 3HKWA 4C3KA 2KWDA 1DQAA 1HHTP 3MR6A 2FC8A 5DZ6A 2QFIA 3UGBB 3QT6A 2GS8A 4A55A 1TKTA 4FF4A 1FNWA 3MAHA 3C16B 1LK5A 5HAOA 3R9LA 3GE8C 3AT1B 2LA4A 2JHEA 1WHWA 1TS5A 1V5TA 4IYQA 3WIUA 3QYYA 1U47A 2KDOA 3O5TB 2LDYA 5LXIB 1U4BA 1GQEA 2VICA 3AXCA 3CF6E 2FTRA 4ED4A 3OHAA 1WELA 2RMMA 5FK9C 1QAJA 4Y2KA 3TOQA 2M0GB 4PYDA 4O3SA 2XMKA 3HMJG 2E1MC 1X5PA 2KXNB 3OXLA 2GAHC 1S4FA 2VOPA 2QMTA 4DV6J 3MTNB 4KKOA 4N59A 3TEZA 3GMGA 3N5BA 5D7GA 5D0EA 3ZTOA 1JJCB 3W66A 2P6TA 4TQSA 3K5PA 3Q3FA 1S6PA 4OYMA 4M8MA 5DS7A 4P16A 3PRDA 4WTOB 3I0RB 3OVSA 3DOKA 1RLCL 2Z0DB 5CZVA 3ZGZA 3OFHA 3JW0X 3PV1A 3LP0A 4KGVB 1SQEA 1V3ZA 3GJSB 5F8IA 4LF1A 2X8XX 4LCDE 5FD1A 1UWXA 2RDHA 1CS4A 3KLVA 1QE1A 1NKCA 2H4YB 2K7KA 1U0HB 2J8AA 4HH1A 3T9NA 3OL9A 2ZVOA 1Y11A 4RUCA 3ZTDA 3MFIA 5IFMA 3LPEA 1GMWA 1DARA 1FNMA 1Q7LB 2GC8A 1N5QA 1ENFA 4UTGA 4DSFA 1FWKA 5FR6A 2N9EB 1JLCA 1HHQA 4DL0C 3AEEB 1TZ0A 2CNOB 4LFBF 1TT5B 4LF8J 1WEYA 4J37A 2GBMA 1ZTTA 3W63A 1JXEA 2MKJA 3NG0A 1NI2A 4OZ2A 4LBPA 3UR0A 1UBIA 1P3QU 3V6CB 3IGVA 1F2RC 5J2NB 5DDQC 1NMEB 3VTUA 5T14A 1IPGA 4DFJA 3CIRB 1IM4A 2J0XA 3I96A 4DQOC 4ZITA 2M2BA 1M5SA 3PZ7A 2XMJA 2DENB 2EKEC 4KGKA 2YKNB 3C19A 2YNFB 2BB6A 3ENWA 1L3VA 2EG2A 1NK8A 1PIEA 4L75A 1JB0C 2HRTA 3GYGA 3R97A 1REGX 4QQBA 4IH5A 2LHDA 1EU4A 3W7BA 3V05A 1U1QA 1AUDA 3CNQP 4QAYA 4X66F 4HHJA 5LSLA 2XEWA 2DYBA 2YWKA 2MQOA 2YBVA 3GV8B 3BSNA 4M5JA 3ML9A 3N9YC 2E7WA 1JXVA 5D0HA 5IN7A 3U52E 3DFEA 2LHEA 4ETXA 2ZH7A 1P27B 2WSFC 3LAKA 4B3SJ 4JWUC 4W9JA 2C3YA 1S1XA 4H4OB 4MT1A 3C46A 3PRVA 4II3B 1HBUB 4Y34A 1AFIA 4JGHB 2LFIA 3SQGB 3MR3A 3VFKA 2OTLS 1N56A 3VXWA 1A5RA 1IP9A 4F67A 4RW8A 4EI2A 2V4JA 2HEKA 3CJ2A 2AD9A 1G2EA 2Z59B 3MTJA 2KM8B 1PFDA 4REZA 2ZJDA 2C22A 4M8NA 1URNA 4DCPB 2EC0A 3IBEA 2V2VA 2MKCA 1M1HA 2ZUGA 3KLFA 2DAJA 1YKWA 1J7AA 1TMMA 1X8DA 3M05A 3IXSA 2MGZB 3FEXB 4DMZA 2HS0A 1JWUD 2DGSA 4MEMA 1WJ4A 3PG9A 4HVZA 4NLGA 1UFLA 1V3RA 1E7VA 3EDRB 3AB4B 3RZAA 3DGVA 3I4PA 1U8SA 5D94A 4KE5A 3OSPA 3BEGB 3H8YA 2DVIA 3APFA 2HAFA 2LUEA 3BYTB 2MSTA 1VQOS 1N48A 3QCAA 1JWAD 1PGZA 2NQPA 2NBUA 5K8OA 3SFGA 1K8AT 3P5BP 4ZPAA 1RWMB 5E0OA 1LNQA 2N0SB 2YVSA 2IY1B 2W3RA 1WJNA 1N36J 4W9HA 4DUZF 1RCOB 4P73A 3R66C 1TBEA 2WDQB 2KT2A 2OPQB 4BC9A 3PX4A 3RAXA 5EUHA 1JNRB 4QPTA 1RWVB 2YX1A 2FVPA 2GBNA 4ZCIA 2BWFA 1IKWA 2QGFB 4B9SA 3O6QA 2FCSA 1A70A 1VOMA 3M32A 4OL8A 4CO0A 1DZ5A 3TX8A 2N7CA 2CNNB 3E01B 1ZS6A 4K3BA 1KQKA 2ZBQA 1CQMA 3G6XA 5HG2A 5A6WA 4NAWA 1NPKA 5DCNA 3U27A 3UVJA 2DJWA 2Y1LB 2G2OA 4KT0C 4MK9A 4HACA 5HBMB 3L9ZA 4F04B 3D4JA 1RACB 2RAQA 3MMBA 5F8MA 1S3SG 4MSQB 4NPNA 1C2PA 3AE7B 1FRKA 1BWEA 4ANUA 4JX1C 2ZVIA 3GE9A 3ALBA 5IA7A 2ADBA 4WFBQ 2DGUA 3M8QB 1XO3A 3ZZYA 1WXQA 3EX7B 2MB0B 4MELA 2OEDA 2F7VA 1UELA 2QE5A 2J6UA 1FT8A 2ZHOA 3DRRA 1X5SA 5HHDG 1RT4B 2IM1A 2B8PA 1N5SA 1NZAA 2HTME 2JRIB 1QVFR 2H5IB 4NCBA 2W2PP 1U09A 3IG3A 5LXHA 2UUBJ 4DR1F 4YT0B 5RUBA 3DI6B 2VJUA 2WHIA 4EO6A 1SC1B 2MSSA 3IM8A 1NJYA 3FVYA 3L7UA 3OR2B 1DOIA 1VD2A 1YBUA 2FZCB 3B2GA 4I67A 1HNWJ 2OPPA 1HQEB 3Q8YA 2B56A 1RT4A 3A8IA 1U1PA 3CEDA 1PJ5A 4HR2A 3RRGA 2V3SA 2NLWA 4FJZA 3BO2A 2DT9A 1YRUA 2ZH9A 2QC8A 1R43A 4HK2A 1XMQJ 4P7IA 1U45A 1H74A 2ROGA 4YTMB 3L4PA 1XN9A 2IA0A 3D67A 3BO4A 3JB9k 1ZTWA 2VA3A 4J90A 5A8KB 1QY7A 1HEZE 4IRDA 3CCMS 1HYSB 2BEFA 4JI3F 4TQRA 3DRXA 3QAEA 4F26A 5F9LA 4RU2A 4KSEB 1HA1A 1V49A 6FDRA 3EPGA 1UVJA 1XF5L 3ZJTA 3GV7B 1HQEA 3BBBA 3GFXA 2Z56B 1AWDA 1HWUA 2RD5C 4KHMA 3DLKA 1WJUA