3C1OA

The multiple phenylpropene synthases in both clarkia breweri and petunia hybrida represent two distinct lineages
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
MEKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPDSTPSSVQLREEFRSMGVTIIEGEMEEHEKMVSVLKQVDIVISALPFPMISSQIHIINAIKAAGNIKRFLPSDFGCEEDRIKPLPPFESVLEKKRIIRRAIEAAALPYTYVSANCFGAYFVNYLLHPSPHPNRNDDIVIYGTGETKFVLNYEEDIAKYTIKVACDPRCCNRIVIYRPPKNIISQNELISLWEAKSGLSFKKVHMPDEQLVRLSQELPQPQNIPVSILHSIFVKGDLMSYEMRKDDIEASNLYPELEFTSIDGLLDLFISGRAPPPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The multiple phenylpropene synthases in both Clarkia breweri and Petunia hybrida represent two distinct protein lineages.
pubmed doi rcsb
source organism Clarkia breweri
molecule tags Oxidoreductase
molecule keywords eugenol synthase
total genus 119
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c1oA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3c1oA02
4M54A 5G0UA 3WGOA 4A10A 4DPKA 3WGYA 1HLDA 1ONOA 1G6KA 1WZIA 3JQDA 4R5HA 2ZTVA 4YBZA 2YZ7A 4BNFA 1Z74A 5AQ1A 2O2SA 3AOEC 3U5TA 4YT4A 2J5RA 5KKCA 3DQPA 3RD5A 3G1UA 2F00A 1EUDA 3PYLA 2X23A 4LN1A 2WSBA 1KIFA 1T4DA 3GEMA 4WK6A 4IJWA 4FJ2A 1VL8A 5A9TA 5U4QA 3JQ9A 1C3VA 2A94A 3IIEA 4CMBA 4BNJA 1R12A 5TRTA 3PJEA 1LC0A 3KLPX 2Y1EA 3U3XA 1H2BA 3WJ7A 1NHWA 3A14A 1A72A 1R66A 2ZQZA 3HDQA 3H9EO 4LSWA 1U1IA 1UDBA 2YQ5A 4Z9XA 1GL3A 3WIDA 4WE3A 3NJ8A 4GX0A 1PJ2A 4NFSA 2EV9A 5JDIA 3GUYA 3JSAA 3NV9A 4NBRA 4BO7A 1F14A 5ADHA 3ROPA 4XD2A 4TMFA 3H5NA 1XU7A 3ABIA 4QFDA 1DAPA 3GNQA 5F5NA 1ENYA 1VKNA 3ST7A 1K3TA 2X0IA 3ETGA 2DBRA 2VTEA 4J0EA 1B8PA 2X58A 1LEHA 2VZ8A 5A03A 1B0AA 2RHCA 4IMPA 3U9LA 2IRWA 1BVRA 3E1KA 3KBOA 3OA0A 5K9ZA 3IS3A 2QYSA 2AHRA 2BRUA 3LC2O 2AE2A 2GCGA 3E48A 2YHIB 4WUVA 4Q3BA 5JNLA 2LDXA 2NQ8A 3DONA 4AL4A 4PLYA 1I5RA 4YJHB 1B2LA 1UXIA 5GZ1A 1RM0A 3BMOB 1XSEA 5JDCC 1TT5B 1IUKA 3NKLA 3WSVA 3KTDA 3WQQA 3T7CA 1BRMA 1WLYA 2Z1NA 5A9SA 1QYDA 1SC6A 3DZJA 3FR7A 2C20A 3QQPA 4EZBA 2EEZA 1YOVA 2D59A 4I5FA 1DLJA 4M55A 4BO9A 4E31A 2HK8A 2PGDA 2B36A 4BO3A 4H3VA 3C1OA 3HN2A 1KS9A 2NTNA 4BL5A 1BSVA 1DIGA 1VJ0A 2OXIA 1YXMA 1ZH8A 5L9AA 5C37A 1VL0A 5JDCA 5H82A 1EQUA 2GZ3A 4Z3DA 3U62A 3SX2A 1GPDG 4RV9A 4HUJA 4Q3CA 2B83A 1EE2A 1WWKA 2HLPA 2PGLA 4M89A 4YA6A 5JCJA 1GQ2A 1VM6A 4ZRMA 1LSOA 2CUKA 2OP1A 1I3MA 2EXXA 5DCUA 1ID1A 2VOEA 1SB9A 4YAJA 1KEVA 3AM3A 5GY7A 3HQ4O 4U0KA 2HQ1A 3GDOA 3PLRA 4CM9A 4BB5A 3FNEA 2FOIA 1VSVA 4Z9FA 4WLEA 1P33A 3DTYA 2HJSA 4DYDA 1PQUA 2VHWA 2DFVA 4GQAA 1S7CA 4PLTA 3WLFA 2Y1CA 4E5MA 2J8ZA 2JAPA 3D5QA 4FJ1A 3GNTA 4OO3A 3RAJA 1WMAA 1H93A 3C7DB 2JCYA 2PD4A 3QLJA 3H65A 4MKRA 5JAMA 1NPTO 1QYWA 2C2XA 4JQCA 4W9NA 4GBJA 4E2WA 4K6FA 4PLWA 1ISMA 1SOWA 4MDHA 3B20A 3RJ5A 1YJ8A 4MVJD 4YB8A 4KTVE 1D3AA 4G81A 1T1SA 1LNQA 4E5PA 4W4TA 5TGDA 3FD8A 4DWVA 2X8LA 4N18A 2ZIZA 2QZ9A 4MP6A 1YB5A 1A5ZA 1YL6A 2IE0A 1GEGA 5G4LA 1I3LA 3NT5A 3LT1A 2IXAA 4JP3A 1Z7EA 3P5SA 4CMJA 1E6EA 5FI5A 3TZHA 1ZXLA 4PRKA 4E2YA 1HYHA 1DC5A 4DYVA 4BNZA 1PGJA 3FWZA 2V6MA 3RCBA 3VTFA 2GLXA 5DZSA 4L74A 4D0SA 2CZCA 5FWNA 3IKTA 5ENDA 1LX6A 3VDRA 3Q3CA 1HDZA 3OEYA 4KP7A 2HRZA 1GZ6A 3IUPA 1N1EA 5HRUA 1J0XO 3D3WA 4QFCA 2BI8A 4J91A 1DJQA 1H9BA 3GLQA 3KUXA 3ZWVA 4YAGA 4XRGA 1MG5A 4HBGA 4YT2A 4TZKA 4JNKA 3ITKA 1IE3A 3E5MA 1JLLA 2Y66A 2OOSA 3BIOA 4E5YA 4DBZA 2CDCA 3RFTA 4N54A 2WYVA 4ZVVA 5IXSA 4B4WA 3E82A 1UH5A 4U7WA 3ZU3A 3F4BA 3RKRA 4PVCA 3W4KA 4KDFA 4XGIA 3KYDB 1WDLA 2AG5A 2Q2WA 4NNJA 1Y1PA 1IB6A 2JL1A 1BW9A 1SZJG 3BMCB 4PGFA 4AJLA 1Z75A 4II2A 4MP8A 5HA5A 2AW5A 2ZYGA 4IPTA 3DEYX 3COSA 1PS0A 4CQMB 1R16A 2YFHA 5G0VA 5I9LA 1FF9A 3UFXA 2HO5A 3ZNQA 2GF2A 5JMWA 2JD2A 1DIHA 1K0UA 1Y9AA 4RDHA 4D44A 4CM3A 3GDFA 2VWPA 4MVJI 2CVQA 1DEHA 4HX5A 4DC0A 2PA3A 4CLHA 3JYLA 3WSWA 1ZFNA 4ALMA 2PZLA 1C0IA 4BNXA 4PN3A 4FW8A 4RDIA 3JD1A 4EBFA 1VJTA 3EK2A 3JV7A 3DAFA 1QP8A 1LRKA 1T25A 4J3FA 4CUZA 2AQKA 3F3SA 4J4HA 1NX6A 4NFHA 4CLRA 2GPTA 5I9NA 3RWBA 5JPIA 5KJ6A 1PZGA 1ADBA 3BAZA 2IEDA 1OI7A 2G5CA 1SB8A 1P31A 2VWGA 1O9BA 2HK9A 3DO5A 3PYMA 2HRBA 5IN4A 4NU5A 4A7PA 1X13A 2ZTMA 3PTZA 1QMGA 2DAPA 2P4HX 5A1TA 2AQHA 1H6DA 3PIDA 3CSDA 4AJNA 2V6BA 2YYYA 1O94A 4YTEA 2C7VA 4J7UA 4NMHA 3V1TC 3QWHA 4OJNA 1NQAO 4UUMA 2FR0A 4CL3A 2DPHA 1GZ4A 3EC7A 3W1VA 1GYQA 2I66A 3JQ9C 5AOVA 2NQTA 3K73O 3V2HA 3ONDA 1LQUA 2UVDA 3GN2A 3UCFA 4W7IA 1QLJA 1VI2A 3CIFA 4INAA 2FZWA 2GO1A 1I3NA 4RPKA 1EUZA 3UF0A 1PX0A 2AEMA 4DC1A 1X1EA 1HKUA 1EDOA 1D7OA 4CMIA 4WEQA 3WR5A 3CEAA 1ISFA 3WS7A 3WQRA 1FDWA 3GFBA 3OQ1A 5DCWA 1B15A 4XQ9A 1P1HA 5CPBA 4BOYA 4RPLA 4EI2A 2I99A 2I76A 3PWZA 5LDHA 3WTBA 3JQAB 2BFAA 4KTTE 3WQSB 5TT1A 1VSUA 2X0NA 2VT3A 2ZB7A 3RKUA 3DZGA 4IBOA 4DPMA 3PP8A 2X0RA 1SOVA 4N5NA 2NNLD 4BIIA 5JY1A 1ZK0A 4P22A 1DC6A 5JYEA 1E92A 4J9VA 3JQFC 3WICA 1KVRA 1U3TA 1B3RA 1U9JA 2JFHA 2P9GA 1BW9B 1YE3A 3BMCA 3WNVA 3O4RA 4HFNA 2FN7A 1WW8A 5K6AC 4OMUA 2ZATA 4XWYA 3OIDA 1NPYA 4Q3EA 4CMGA 5BNIA 1E1NA 2Y1DA 1EVZA 1HEUA 2XPCA 4RLHA 4EGFA 3K92A 4FS3A 4UUNA 1PJSA 3ITDA 2ZK7A 2Q1WA 1T2EA 4BO1A 1GUFA 3IQDB 1NBOA 3ZHYA 4JBIA 1AUPA 4XX0A 4XIYA 3GFGA 4Z0TA 3W6UA 4IUYA 3OJFA 4IGEA 4TKMA 1UXJA 1UZLA 4FFNA 3EYWA 4RF5A 1D4FA 5F1OA 3RUAA 4BNIA 3M6IA 5TT0A 3R6DA 4P4LA 2I67A 5AVOA 2W2KB 5LC1A 4DMLA 1X15A 3D3EA 1WP4A 4JGBA 1DIRA 3LT2A 3L9XA 3BHJA 2EP7A 2FZEA 5JS6A 4KWHA 1HXHA 4L4XA 1TT7A 1O5IA 4PVDA 2FRDA 4QXMA 4R16A 3L4SO 2YW9A 3HB4X 1ISHA 4GKBA 3H3JA 1NXQA 2O3QA 2Q50A 4M87A 1NAHA 3C8MA 2B0JA 2BFPA 3PZBA 1YBMA 3RJ9A 3AFMA 4BV9A 4S1VA 5T6BA 3JQGA 5TNXA 2EWMA 4EUFA 1NYTA 3BZUA 3CH6A 1A9ZA 3FSRA 3DZBA 4FGWA 5KIAA 1H0KA 3PHIA 5HS6A 5KVSA 1R0LA 4YRDA 4RF3A 5A3VA 3QJ5A 4MVJP 1YL7A 4BKQA 5F1PA 4RO0A 4KZPA 4KQXA 4D3SA 2X1HA 4RPHA 4XYMA 4MKZA 1LI4A 5JAQA 4BNTA 3PJDA 4D43A 1YRLA 5L51A 2CFCA 4ND5A 4AJJA 5AXBA 3I4FA 2O50A 2V65A 4J1TA 4UEKA 3WNQA 1U7TA 4R3NA 1RPNA 3IC5A 1IZ0A 3V5NA 3LT0A 4AJEA 1ORRA 4MKXA 1ZNQO 3AFNA 1AN9A 1GUZA 2W2LA 2J3JA 4XR9A 1JWBB 4DLLA 3RUDA 1PSDA 3ZNPA 1PZHA 2WYWA 2EGGA 1PR9A 1Y9EA 2A92A 2DTXA 2YV3A 4CQLA 1EQ2A 3TDKA 3QSGA 2NTJA 3QWFA 3AM5A 1ZMTA 1UZNA 3JQBA 3LYLA 1V3TA 3KEOA 2D8AA 4IM7A 4TRJA 4EYEA 1UXKA 2RCYA 2QRKA 4YXFA 3JQ8B 3C7AA 4S3MA 3V1UA 3IJPA 1JA9A 4FCCA 4R3WA 5JXWA 3RVDA 1GYPA 1ENZA 4DQXA 5G0TA 3VPGA 4IXTA 1UUFA 1B3BA 3C24A 5L4LA 1E7MA 4XDYA 3TJRA 1I36A 2JCXA 4WLFA 1MG0A 5EINA 1CJCA 1YQGA 4YT8A 3CMCO 1P74A 3MTGA 5L95A 3HN7A 3I23A 4PG5A 1KETA 3RU7A 5DBIA 3HNPA 3GVCA 3IJRA 1E7QA 1EFKA 4CLEA 3ZZNA 4CUKA 2JHFA 3ZI0A 1ADGA 2YUTA 4HV4A 4E21A 4D7AA 3TWOA 3EY4A 4GMGA 3ZWNA 1QXSA 4R9SA 4FDAA 3JQ7A 4LMRA 2NU8A 3R1IA 5I7FA 1DAOA 3I5MA 3W6ZA 2NACA 2EKLA 3KYCA 3LSYA 4NH4A 4IDCA 5IJZA 1GQQA 4RQUA 3BHMA 3N58A 3PHHA 4MOWA 3WGIA 1UP7A 1X7GA 4L8VA 1A27A 1Y8RB 4OYRA 5MGBA 2D1YA 2G0TA 5COAA 2O3JA 2W8ZA 2CVOA 2P5YA 2VUUA 3DR3A 4RJTA 4EUHA 1KVTA 3RBZA 5J23A 2X86A 4FJ0A 3GG9A 1G0NA 3OA2A 5U9CA 1GAEO 1GD1O 2CSUA 1C1DB 2VHXA 3PQDA 4EW6A 1E3JA 4OXNA 1IZ9A 3L07A 1B26A 4RGBA 1FJHA 1U28A 5IDQA 1P3DA 4NBTA 3ZWPA 3Q2IA 3X2FA 3KSUA 3ROMA 4ZICA 1A4UA 3ZWXA 4UEOA 2JKVA 3K96A 3OJEA 3ZU4A 2DVMA 2YHIA 2EERA 1I10A 4XCVA 1B14A 5B4VA 3H9JA 2AA3A 3PPIA 3BMOA 1WNTA 3INGA 4YJHA 4BNWA 2ZYDA 5B12A 4I9HA 4QSMA 3NAQA 3EW7A 4OKIA 3PEFA 4AJKA 2BFOA 4F45A 4FFPA 1Q7CA 1KERA 1J49A 5JCJD 4DREA 3MCVA 4Z0HO 4WOJA 2J3KA 2VWHA 2XXJA 1H6BA 1H2HA 5HWSA 3JQ8A 3FTNA 1KC1A 3LZ6A 1LXCA 3RUIA 2NVUA 5AXCA 4CM9D 2HUNA 2XOXA 4DUPA 1F8FA 4O1MA 2VHYA 1HZZA 3WTCA 3TF5A 1DB3A 3OIGA 2PKQO 3FR8A 1UXGA 2EHDA 2C54A 4MIYA 3UUWA 3WJAA 3WIEA 3ZV6A 1ARZA 1VL6A 4JIGA 4XJTA 2B35A 4LMPA 1EK5A 5BSGA 3DHEA 3HDJA 3PWKA 2R2GA 1DFGA 1NQ5A 1GEEA 2WDZA 2H63A 4XYLA 3HDHA 1BMDA 3ZHZA 1UDAA 1ZSYA 2HMSA 5U1PA 3GN1A 3W8DA 2HDHA 2PKQP 1PTJA 5DP2A 5C7IO 4ITUA 3TL3A 4X54A 3E9MA 1GPJA 4W9NC 3G17A 3L9WA 1PS8A 3UCXA 1ULSA 3UKOA 1E3WB 3OHSX 1PS9A 4CM4B 1I0ZA 1R0SA 2YJZA 1HE4A 4RZIA 5DBFA 4FFLA 4QTZA 4BVAA 4BGIA 4O0LA 2FPPA 5FYDA 2VHZA 9LDBA 1CRWG 4NQZA 1EVJA 2EKQA 4BNNA 4RL6A 3LK7A 4B4OA 3LC7O 3SEFA 3QP9A 4YQYA 3HE3A 1QR6A 4WOKA 1BVUA 2PH5A 2G17A 1EEHA 1JKJA 1KBZA 4UVIA 3M2TA 3MJEA 1YBAA 3OM9A 4KQWA 4TRNA 3RFXA 3GT0A 1QYXA 2EP5A 3ZV5A 5AXDA 3GGPA 1VKOA 3KEQA 3WMWA 4CV2A 2VZ9A 1NVGA 6LDHA 4UEJA 4CMAA 5A9SB 3O9ZA 4PG6A 3BTOA 3GMDA 3OIFA 1WVGA 5JY6A 5LDGA 3IOYA 3PXXA 2JFFA 2JHGA 4XYGA 1T24A 2DUWA 4GWGA 2VRCA 1HL3A 5GMOA 2BGLA 1PWXA 3LT4A 3Q6IA 3RBVA 5A4DA 5JC1A 1IHXA 2RHRA 4ONEA 1PL8A 2ZB8A 3LLVA 4K9DA 3PRJA 2FMUA 2DFDA 1X0VA 3SC6A 7MDHA 1NQOA 4E13A 5KOIA 3RSHA 3DWFA 2G1UA 4BO5A 1O95A 1ZW1A 5B37A 3W4JA 3OMLA 2PFGA 2X6TA 1YJQA 3FNHA 3GRPA 4YQZA 4UUOA 4YAKA 4OL9A 4WPGA 4PLCA 4I5GA 5H81A 4QX6A 1MLDA 4UVHA 1ZIDA 3SC4A 1P77A 1BXGB 1PZFA 4MVJE 4RPGA 1K89A 1YBVA 3I9KA 2DPGA 4J49A 3DZFA 5F3RA 3RUCA 1E77A 3HDYA 4WJZA 4BB6A 3RC2A 1RYDA 1RWBA 2YDXA 4MIEA 1SAYA 2X9NA 3H5RA 3Q9NA 3KYDA 4BQPA 3DTTA 4CR6A 5JBIA 3DAPA 3IP1A 5KJEA 3I83A 2AXQA 2VYVA 2DKNA 3KOUA 1GR0A 4K26A 5CDSA 3KVOA 1P44A 3PDUA 2BD0A 5TLSA 2YDYA 4WKGA 3INRA 1B16A 4XKJA 1BXGA 3TN7A 1M67A 2P9CA 4U0JA 2X5KO 3T7EA 4WCFA 4CM6A 4CQLB 5L7YA 1LUAA 2JD0A 3KRTA 4KDEA 4LCJA 1KVSA 1XHLA 2GN4A 2H5LA 1BGVA 2J6IA 4FD3A 1N9GB 1N5DA 4FSHA 1XA0A 3K6JA 5KTKA 1SEPA 3FPCA 1UP4A 1ZJYA 1ULUA 1JVSA 1F12A 4C7KA 2W4QA 4RVGA 4FFOA 1PJTA 1LSSA 3UXYA 2OMEA 4TVOA 2YHUA 1HWYA 2BH9A 1DOHA 4J1SA 4H16A 5AYVA 2PLAA 3L77A 4NK5A 4CM1A 3PI7A 3OBBA 1YS4A 5AXAA 5JCXA 5DP1A 1NHGA 5FFFA 4NHEA 1PJ4A 5IG2A 1GZ3A 4H15A 1A7KA 3F6YA 1DIBA 4XDZA 4MP3A 1HF3A 4XZ3A 1HSOA 2FP4A 1E1LA 3FRJA 4AFNA 2VWQA 3A1NA 3EGOA 5IZCA 5DULA 4DVJA 1RM5A 2ZTLA 1WMBA 3C3XA 1NWCA 1R4MB 2B5WA 4KWIA 4R9RA 3ZCXA 2DC1A 5EIOA 4CMEC 1I30A 1LDYA 3O03A 3F1LA 3O38A 3QVOA 2GERA 3JQ6A 3N74A 5EJ2A 2P68A 3JTMA 3GC6A 1G1AA 1QLHA 3MEQA 4CM7A 2GD1O 1YO6A 2NU6A 5JMPA 1T4BA 2P91A 4CL8A 3ASVA 3GZNA 1TI7A 1QKIA 4WASA 5T5QA 3GAZA 1F0YA 8ADHA 5C5IA 2ZKLA 3OH8A 3JQCA 2GUGA 2NTVA 1DFIA 2Q49A 3WFIA 3DOCA 4GVLA 4E4YA 3DHNA 4JP2A 5KVVA 2PZKA 1DRUA 3S2GA 5A02A 1CERA 1YKFA 3IAHA 1V9LA 3AUAA 3AOEA 4B4VA 5TIIA 1ZK1A 4W99A 2O3RA 4BGEA 4CMCA 1PZEA 4M1QA 2NV6A 3QA9A 4L76A 3WGQA 2Y93A 4P38A 5KVCA 3G79A 3Q11A 1I2BA 1XCBA 2RH8A 3BA1A 4Q39A 3U4HA 4NU6A 5EQDA 4IDFA 4AJ2A 1U4OA 1AE1A 1DHTA 1N7HA 1V3VA 1MXFA 4LK3A 3UHAA 1AHHA 3RU9A 3MTJA 3RI3A 1T26A 3MOGA 1NTOA 3KM0A 1IY8A 4GGOA 1RJWA 5IDWA 2B4QA 4RCVA 4EJ0A 3L4BC 3A4VA 3MWEB 1I2CA 5CDTA 2X4GA 1PL6A 3NTRA 1Y8RA 1YONA 1HE5A 1LDBA 2Y0CA 3PFFA 2E4AA 3EVTA 1W6UA 3H3FA 3JQAD 3ZNNA 4BKOA 4TRRA 4CMEA 3QV1A 3WGHA 3G0OA 5BQFA 3VVBA 3H2SA 3SVTA 2O2YA 2OZPA 2E82A 2C07A 3JYQA 2GN8A 2J5QA 2WYUA 5CDYA 4ZQBA 2R00A 2QRLA 1XKQA 2IEBA 4Q3AA 2Q1SA 2JFGA 4RVHA 4N5MA 4BNUA 1E3WA 1XELA 3QVTA 4QEDA 1FMCA 4IS2A 3HHPA 3EDMA 4BHTA 3D4PA 4DXHA 5HTOA 4R1UA 1EBUA 4B3JA 2IZ0A 4C4OA 4CM8B 4UAGA 1SO8A 3IMFA 5CFZA 2YQ4A 4ZQHA 5JW6A 2PZMA 1XGKA 2FSSA 1V6AA 4OSPA 5DT9A 2HCTA 4OSOA 3MWDB 4Q3NA 4YJFA 3UAGA 2WM3A 1U3WA 1U7HA 2B5VA 1YQXA 4GKVA 3S2FA 2W90A 3IUSA 3I1JA 3TZKA 3DFUA 3G3EA 2BKAA 1V0JA 1OZAA 3JCZA 4IZIA 4OHUA 4IDBA 5EQFA 4PZDA 4BNKA 2E6UX 3UGKA 2I3GA 2Q4BA 4QECA 2BELA 1ZSNA 5TC4A 3GVPA 4D79A 2VUSA 2EG9A 1QRRA 4CMIB 1D1SA 2D3TA 1CQIA 3S55A 1XLTA 4IQGA 5ER9A 2D0IA 4CJXA 2PNFA 3LF1A 4GI2A 3RQSA 1DLIA 2GNAA 1YDWA 1PQWA 3ZWAA 4M8SA 4DPLA 2B4TO 4PG4A 2GN9A 3ADPA 4YWJA 1VRWA 5GZ6A 3FNFA 5JO9A 3TPCA 3S1LA 3ETDA 1KVUA 2YFQA 2A4KA 4RPJA 4AJPA 2O3TA 5KNLA 5KVQA 5COBA 2W98A 1GY8A 2HMTA 4P4NA 2D5AA 5I7VA 4IIVA 4TKLA 1L7EA 5IF3A 1EDZA 2Q46A 4AJ4A 4KOAA 3L6DA 2UYYA 4A5OA 4XIJA 4W6ZA 5TS3A 3QRWA 3FCOA 2NVBA 4Y6PA 4DIOA 3EVNA 3VTZA 4NDNE 4A27A 1WDMA 1YL5A 3BTUA 2GRAA 3NDRA 4J16A 2OGUA 2CMDA 4J7XA 4O63O 3VKVA 1P1JA 4I9UA 2WE8A 1NR7A 4FBGA 1Q7BA 3PQEA 4BGVA 1JVBA 4BKUA 4XGKA 4TVBA 1HDOA 4Z3KA 1NVTA 2ZCVA 3H2ZA 4LISA 1GDHA 4XA8A 1ONNA 3B1JA 2PKRA 4EUEA 2Q2VA 1Q1NA 1HE3A 4NBWA 4YEDA 5TX7A 4NPCA 3AI2A 4EDFA 2QRJA 4G2NA 3UW3A 1LSJA 4RORA 2HJRA 3GGOA 3LLSA 4PFJA 3UN1A 3I9JA 4MIOA 4B4UA 1ISGA 3ETEA 3LF2A 3U4IA 1ZZEA 4AJ1A 3DZHA 4UREA 5KJCA 3RC9A 2EGHA 4YJGB 4LVUA 4ZU3A 2C5EA 1GTMA 4DLAA 1M6WA 2AEFA 3SBOA 4OH1A 4O5OA 4D3DA 2O7SA 3GOHA 4NJMB 1B7GO 5C7LO 3DMTC 1OC2A 2DTDA 2YV1A 5B1YA 2IDZA 1RKXA 2C59A 1C1DA 4RF2A 1E7RA 1LDMA 2NU9A 3KB6A 4RVDA 5KCZA 3A9WA 4G5HA 2C82A 1NAIA 5ES3A 4IMRA 3ZWYA 1A7AA 3H8VA 3V2GA 2I9PA 2PY6A 4J1QA 1E6UA 1Q7GA 4WLOA 3TSCA 5IZ4A 1GFSA 4P4GA 4TSKA 4R1NA 4ZRNA 3OJLA 5IZCC 1LRJA 3GPIA 4O6VA 3L6OO 4GMFA 4CMKA 4ROSA 3BYZA 1L7DA 4WCFC 5EN4A 1U2GA 3JQGB 3VC7A 3DMYA 4DL9A 3B70A 4L75A 1Y8QB 4QO8A 2GN6A 2GZ1A 1PGNA 4IGFA 5BR7A 5JYDA 4EITA 1NQTA 3DDNA 4FIZA 4D41A 3AY3A 4KMSA 5ITVA 4EEZA 3AU8A 1U4SA 1Z73A 4OIMA 4XR4A 4ZD6A 2EJWA 3IDSA 3NT2A 3DZKA 3NGXA 2V7PA 5T67A 3HFGA 1Y6JA 4LRTB 5C3MA 1J4AA 4U5QA 1H6AA 2C0CA 4A0SA 3NTOA 3CZRA 4ALNA 1LQTA 3DBLA 1U5AA 4I5DA 2Y1OA 3PJGA 2VRCD 3V1YA 1NFQA 3K8ZA 1DPGA 5DF1A 3ANMA 4Z9YA 2ZJ1A 1E3IA 1NFFA 4BNYA 3P2YA 5A3JA 3CKYA 3MZ0A 4QO7A 2OO5A 3I52A 1UZMA 2Z1MA 4B79A 1QG6A 3E9QA 4E3ZA 4N5LA 1MUUA 3DBRA 3KYBA 1I32A 3VH4A 2AQ8A 3FI9A 3HADA 2C5AA 2P5UA 4JJGA 5JFOA 3LDHA 3OJOA 1LLDA 1I2ZA 3GR6A 4NR0A 4FGSA 3FTPA 4IJUA 1MXHA 1N92A 1Z7BA 2CDBA 2O48X 2UAGA 4Y9DA 4LGVA 1Q2XA 4QUKA 2Q45A 3O8QA 3H9UA 2Y68A 3TOXA 1OFGA 4BO4A 1P0CA 2WJPA 2VYNA 3PWSA 4XEHA 1ADCA 3OP4A 2IYPA 1O6ZA 2PD3A 5BSFA 2VNAA 1H94A 2BGKA 3VPSA 3GY0A 1AHIA 3ZV3A 2VYVD 3WYEA 3VPXA 2PTGA 5THQA 1DSSG 3ZWMA 4ALKA 3A06A 2CVZA 4JROA 2Q2QA 5H83A 1XG5A 1N2SA 4BQRA 5HM8A 2FSVA 1HYEA 2X0JA 3SJ7A 1BDBA 1K6JA 4HY3A 1WPQA 2V6FA 2X5JO 3JQEA 4L0QA 2B37A 3FBGA 3U4CA 1ISIA 4IDGA 2PR2A 2UDPA 3GNSA 3I6IA 3KYCB 3CTMA 3GAFA 3NX4A 3WXBA 2X5OA 3B6ZA 1LLCA 1ZKMA 1Y8QA 2BF7A 1MB4A 3D7LA 3GA0A 3VH3A 4CUJA 4E2XA 4JXKA 2HU2A 2HMUA 2UV8A 2VZ0A 2VYND 4JJFA 1E7SA 1P9LA 4ESOA 1GYRA 3K9QO 2GR9A 4DA9A 1ONPA 2Y99A 1NWHA 1PR3A 1R37A 2FPIA 4ZQEA 4PLHA 4BNLA 2GASA 3MOIA 4NJOA 2A35A 2X22A 3I6QA 3NDIA 3MJCA 1B8UA 4BKPA 3D3WB 1MC4A 3EUWA 3ENNA 1ZO8A 2JD1A 3JD0A 4YCAA 1GV1A 3I9NA 3WMXA 2D2IA 3VH1A 4NFYA 4J4BA 4LCEA 3OQ6A 4MINA 2O4UX 5KKAA 4U8GA 2LDBA 1BXKA 3NEPX 5DNAA 4CMHA 2NLOA 3U09A 3GZ4A 2HMWA 3HB5X 1LLQA 3HFSA 5DCYA 4B7UA 3D4NA 1H9AA 4Y98A 3NJ4A 1E3SA 2O3SA 1J6UA 5B4UA 2GZ2A 1NNUA 3C1AA 4ALIA 4LSMA 3FBTA 4I1IA 3WGZA 2H1SA 3BTVA 3ZNOA 4R51A 4DTIA 1C0LA 4MVJF 1YWGO 5HS4A 4Z6KA 1SPXA 4JBHA 4NK4A 4H7PA 2TMDA 2OP0A 3TL2A 5TJ9A 4NI5A 3U4DA 1ZVMA 3PYXA 3P2OA 4R01A 2BFMA 5I7EA 2OL4A 1O8CA 1VJ1A 2EW2A 3D4OA 5F5LA 1O0SA 1X14A 3GGGA 5L45A 1K6IA 1T2DA 1C0PA 2EW8A 5CAEA 1OC4A 4YJFB 5DOVA 5TSDA 3K2BA 3JYPA 2CF6A 3CPSA 4OXYA 4IJKA 2OBYA 1EBFA 3ANNA 1EK6A 4R1SA 1Y5MA 3JQ7B 1BWSA 3UCEA 4XB2A 1LJ8A 1DXYA 3ZH2A 1IYZA 3WGGA 2CDAA 3LVFO 1T2FA 1ZEMA 4TWRA 1D1TA 2WD8A 3PJFA 4JBGA 3O26A 2GSDA 1NPDA 1HSZA 2NWQA 4K6CA 4BMNA 4O59O 3GVIA 1WDKA 3AOGA 3HSKA 3DL2A 3H5AA 2NADA 3WOHA 4R69A 1L1FA 1HDGO 1IL0A 4UVGA 5FF9A 3M1LA 5EPOA 1DRVA 2B69A 2ZYAA 4E33A 1XYGA 3FHLA 4ZGWA 4IJVA 4OM8A 5BSEA 4ZQGA 5CDGA 3OECA 4DIFA 2E49A 4YVFA 1U8XX 3TQHA 1NM5A 4R1TA 1E6WA 4RVUA 1Q0HA 4JK3A 4MVJH 4P8RA 3TOZA 3BMNB 2ZCUA 1P1RA 2CD9A 1H5QA 2XF8A 3EHEA 3VPHA 4BO6A 2CNBA 2DM6A 1DDOA 4IDEA 3PGXA 4IS3A 1MP0A 5DN9A 2G82A 3E6AA 4BKRA 3D1LA 1E7YA 3ASUA 5IFLA 1FDVA 1ZK3A 4WCFB 3TZQA 4A73A 3PDJA 5CG1A 1N7GA 1XR3A 1LDEA 2FR1A 4YYZA 4E0BA 1BDMA 6ADHA 2FPGA 3D64A 4J43A 2VQ3A 4PRLA 4L9RA 3WX0A 4YDRA 1FXSA 3F1KA 3WDSA 3EAGA 2DBZA 2PWZA 3DAGA 5CDUA 1IPFA 3H6KA 3VZQA 5KJ1A 3GHYA 3QWAA 5COQA 3ZN2A 3RBXA 3VKUA 2RAFA 1NP3A 3DZIA 4ZHSA 1T2CA 3K2EA 1M66A 1LC3A 3ZDFA 1QYCA 2D5CA 1LLUA 5T57A 4ILKA 1Y5RA 3FN4A 1I3KA 4CQMD 3ZV4A 2Q4EA 4Z0PA 3P19A 5IDXA 3QE3A 3NUGA 4GSLA 5JDIC 2JCVA 3S8MA 3OQBA 4CV1A 1N1GA 5JE8A 5ILOA 5FI3A 3KSDO 4PG7A 3SLKA 3T4EA 3SJUA 1AXGA 3ROQA 2J3HA 2AE1A 1KEWA 1B8VA 1R15A 2OORA 1Q0LA 4M49A 3L6EA 1C1XA 4FOSA 5TQVA 4WGGA 1P1IA 1C14A 3KXDA 4LRSB 1CQJA 1E1MA 4IQ8A 3PHLA 3S2IA 1HT0A 3QWIA 3I3OA 4JLWA 1HLPA 1Z45A 4D45A 4EJMA 3NDJA 4FFRA 3AM4A 2O23A 3MJ4A 5TF4A 3WG9A 1P1KA 4NJMA 4GVXA 3RUEA 1ZEJA 4E32A 1KEUA 3GRKA 1VLLA 4JX8A 2Z95A 2NU7A 1UXHA 5A04A 3FF4A 3GEDA 4NBVA 5ENVA 4D3FA 1R6DA 3EMKA 4YPOA 3M1AA 2Q1TA 2Y1FA 5CP8A 5EL0A 2I5PO 4PIVA 4FC6A 1NVMB 4XQEA 2EIHA 4FC7A 4MVJM 1PJQA 1XU9A 3GVXA 3PGJA 3K30A 2X7HA 1YB4A 4PLVA 1M76A 3WWZA 4CM5A 3IKVA 1K6XA 4BNVA 2Q1UA 2UUOA 1GADO 3F5QA 4UULA 4OQZA 1HTBA 3F47A 4FOOA 4BMSA 1DBVO 1BG6A 1SMKA 4QT0A 1Q0QA 3UVEA 2DU8A 3AUUA 3ICCA 3OFSA 4GX1A 2BGMA 2DLDA 4U6SA 3VZRA 4C7JA 1CYDA 5G4KB 3E03A 1DC3A 3CE6A 4DGSA 1JQBA 1MX3A 1TVEA 1Y7TA 3AU9A 4LW8A 1NFRA 2J3IA 4D42A 1TLTA 4HFMA 1EFLA 3BMQB 1YDEA 1JDJA 2Z5LA 3QVSA 4K28A 5L3ZA 2HMVA 1PU2A 3PK0A 4NZ9A 1H6CA 2EKPA 2VTDA 1ZK4A 5A9RA 1RYEA 1W73A 1OAAA 3AWDA 3UOGA 2NSDA 5CEFA 3AI1A 3E8XA 3CUKA 4M86A 2RH4A 2C2YA 2XAAA 4RZHA 3NTQA 3VOSA 3B1KA 1JKIA 2HK7A 2V6GA 2QW8A 1IOLA 4Y6RA 1SNYA 1MGOA 1T2AA 4CLXA 5L7TA 3WFJA 1W8DA 1ENOA 3LC1O 5T64A 3O8QB 4ALLA 4J90A 4GPD1 3ZW9A 5HBRA 3F9IA 1ADFA 1EVYA 3QVXA 2H6EA 3I4CA 4MPDA 3CINA 4XRRA 5JLAA 3R3JA 4R54A 4TQGA 3U49A 3TFOA 1V8BA 1U8FO 1PGPA 2AG8A 1M2WA 3M2PA 1FDUA 1RM4A 3MJTA 4UVDA 2OFPA 3JQFA 4OKNA 4ND4A 3D0OA 2Y0EA 4YRAA 1IULA 8LDHA 1I24A 4WECA 1R4NA 2H9IA 1Z82A 3B1FA 3R3SA 4CR7A 3PVZA 5DBGA 2PZJA 1LSUA 1VE9A 2GGSA 2QYTA 3Q1LA 1EE9A 3I9MA 7ADHA 3DC2A 5I8ZA 4YJGA 4AG3A 4YJDA 3D5TA 3NGLA 4GH5A 4J7CA 3ZU5A 4B3IA 2JAHA 2Y1GA 1PEDA 3MJVA 2IXBA 3ICPA 1DRWA 1ML3A 4RF4A 3JYOA 3OETA 4CR8A 3PQFA 2C29D 4IY1A 1X7DA 4L4RA 3GPDG 2FHSA 1SEVA 4ZQFA 4PLZA 1PWZA 3GQVA 4R68A 3GK3A 4YR9A 1TEHA 1A9YA 5F1KA 4FR5A 3KLMX 1E1KA 4IXWA 3GEGA 3L0DA 4WLUA 4PZEA 2BI7A 2ZTUA 3FPLA 1XIVA 1F06A 2QG4A 1GV0A 4CLDA 1G0OA 2WMDA 5G2OA 2RIRA 3SLGA 5TJHA 2O4CA 2WTBA 3VZPA 1CEQA 1LU9A 1YQDA 2ZJ0A 4R41A 3JD4A 3WBFA 3AK4A 3E5RA 4E6PA 2YY7A 2VUTA 3AY7A 4I8XA 3WYBA 3RROA 4OOEA 1U3VA 4F6CA 1I8TA 2BLLA 4L73A 1BXZA 3TRIA 1ISJA 4J2OA 1UP6A 2Y05A 1I01A 4J9UE 1DFHA 2AMFA 2HAEA 3FNGA 5BT9A 5IDYA 4B7XA 3SXPA 3ZU2A 3GMSA 2ZB3A 3P7MA 4HP8A 4J1NA 3PHJA 4AVYA 4GX5A 3ZHBA 3ANLA 2E37A 3DBLB 4IINA 1HDXA 4BUCA 5JAZA 4CLOB 4F46A 5C7OO 1PJLA 2IZ1A 1D8AA 1MFPA 1VPDA 1HDRA 1QSGA 2GYYA 4KUEA 3ZWWA 4R4JA 4FB5A 4BS9A 1W0CA 3WLEA 3E18A 1QV7A 2OUIA 3WWYA 2XXBA 3KV3O 1ZMOA 4YAEA 4J4TA 1EZ4A 1T1RA 4OQYA 5K0ZA 1R4NB 5K6AA 1N9GA 1CWUA 1VC2A 4F6LA 5L7WA 2FY8A 1K5HA 4CLRB 1PQPA 3ON5A 3DBVO 4ZA2A 3TZCA 4CV0A 1IHYA 1N8KA 3C85A 4Q3DA 4CQMA 4JJIA 4CV3A 3GHHA 3AUSA 3GG2A 5BNFA 1EMDA 3DHYA 2A9FA 4WEOA 4YRBA 1P0FA 3RFVA 4HKTA 2Q3EA 1ZJZA 1FDTA 1JN0A 1TXGA 5I9MA 1GQYA 5L4NA 2E48A 3VAZA 1GU7A 4MO2A 4GSKA 4DQVA 3VZSA 2ET6A 5ICSA 1J5PA 4RQTA 3ULKA 2ZQYA 3HUDA 3T4XA 1HRDA 3GF4A 1MC5A 1X0XA 4D46A 1XQ1A 3Q0EA 3Q9UA 4I08A 1JU9A 4GWKA 2HKIA 4AJIA 1X1TA 4W7HA 1Y81A 2PV7A 3WBBA 1LA2A 5KJFA 3RC7A 4HFJA 1PJBA 2IZZA 4A26A 1DIAA 2O7QA 3OICA 4LVCA 5A5FA 5CEJA 1LDGA 3HZZA 1TA4A 2I65A 4PLGA 4F3YA 3H7AA 2TMGA 3JQBC 1RM3A 1OMOA 3NYWA 4PLPA 4HNGA 2HSDA 5THKA 1ZK2A 1UJMA 4BNHA 1V3UA 2DBQA 3KZVA 3L4BA 1E7WA 2QX7A 1CIVA 4DIBA 1ZBQA 2QQ5A 3DMTA 3H9GA 4WNCA 5A5EA 1XQ6A 5ITWA 3W8EA 4HXYA 4QQRA 4DLBA 3RC1A 2QIOA 1UDCA 2R6JA 1HDCA 2BHLA 1MA0A 3OF2A 4HNHA 3VVCA 4BV8A 1W4ZA 3JYNA 2O3UA 3IL2A 4IDAA 1YB1A 3LQFA 3PZRA 1NASA 4E5NA 5CHEA 3V2UA 2W2KA 4Y67A 3H4VA 4AJHA 4AICA 1C0KA 1EVIA 2OBNA 3QW2A 4XQCA 1NR1A 4J6FA 2WD7A 3JQAA 5IAAA 1KC3A 1E5LA 3TZ6A 4BGUA 4AJOA 4BNGA 2DQ4A 2PD6A 2EJVA 2B4RO 1AXEA 3STHA 4IIUA 4BMVA 1R0KA 3DXFA 4CM4A 1ZSVA 3WYCA 3E9NA 5BSHA 1C1XB 3EZLA 2D4AA 2W2LD 1MFZA 3HWRA 1PIWA 2WD7B 1SBYA 2VRBA 4YACA 1E0DA 3RASA 4PZCA 3DB2A 4B3HA 1P1FA 4OGWA 5JO0A 1LTHR 1PJ3A 3GDGA 5IN5A 4XGNA 2UUPA 3F4LA 4D0RA 2G76A 1UAYA 2POQX 2FWMX 3DBRB 2EF1A 1R4MA 1WAMA 1IPEA 5L40A 2VHVA 2RBEA 5BNTA 1KEPA 1YVEI 5CPFA 4E30A 1EUCA 3JD2A 3GUCA 3HG7A 5JC8A 1ZUD1 2CY0A 4DRYA 2DT5A 5L4SA 2PH3A 1DHRA 4UUPA 4J0FA 3GVHA 1E3LA 3KETA 5GZ3A 1ENPA 1CETA 1UAGA 3GH3A 1HE2A 3IP3A 5T8KC 3AJRA 1WXDA 3QHAA 2NVWA 3VPFA 3WGTA 4JN6B 1JAYA 3ADOA 4CM8A 5DDIP 4PLFA 4E2ZA 4R5MA 1YH3A 1GCOA 3AUTA 4HADA 1U5CA 4URFA 3NRCA 5L53A 3G1TA 2ZB4A 3F5SA 1E3EA 2VN8A 3VHRA 3CXRA 4FFMA 2CF5A 4GAEA 4BO8A 3KO8A 1TB4A 3HJAA 5G4KA 4YT5A 3A28A 2VT2A 2Y67A 3BTSA 3OSUA 2NM0A 1ZCJA 1BHSA 3OJ0A 3QY9A 4W82A 1FDSA 1LDNA 4PCVA 4NG5A 1HDYA 4GGPA 1A4IA 2P2SA 1AGNA 1Z6ZA 2DBVO 5LCXA 4L4SA 4CODB 1M75A 5KWEA 3Q2KA 2IYOA 1TT5A 4XYBA 1U3UA 3DBHB 4N7RA 3ZHXA 3ZWOA 1KY4A 1DJNA 4FQ8A 3GZNB 1K2WA 3ZGYA 4ZN6A 1JKFA 2ILTA 4RVFA 5CG2A 5CEEA 4NIMA 2PK3A 4G65A 3LU1A 5ICMA 1KVQA 4XYEA 2X9VA 1KY5A 4IDDA 4A03A 3UH1A 3ENKA 4ND2A 3AW9A 4E12A 5I7SA 1DC4A 2NVUB 1F8GA 1X7HA 4UVEA 3DBHA 1I33A 3CMMA 3INTA 3PFWO 4WLVA 4B8ZA 3ZWCA 3ROKA 4CPDA 3K31A 3I9LA 4ND1A 3FWNA 1S6YA 3VH2A 4HWKA 2NUAA 5A05A 5JSFA 5ER6A 1BTOA 3U0BA 4E5KA 1GCUA 3ONFA 5F21A 4J2HA 3ORFA 4MVJA 4A2CA 2C7GA 2J5KA 5MDHA 2R00C 1KYQA 3KSZO 2P9EA 4OAQA 4IQ0A 3JD3A 3CZMA 3QWBA 3UICA 5EMHA 5A06A 1MV8A 1P45A 4YAIA 2PGJA 4TRMA 5T8KA 5I8WA 1KOLA 1E5QA 4Q9NA 3DOOA 4ALJA 4EJ6A 3RUFA 2YV2A 5JAIA 3ONEA 4XB1A 4B7CA 4GLOA 1V35A 1XWFA 2QZZA 4EEXA 4KUGA 4WCDA 2Q99A 4MJLA 1FK8A 3F46A 5FEUA 4NBUA 3OEWA 3X2EA 3H9QA 5B4TA 1HETA 2VOJA 4GLLA 2VCYA 1UR5A 2I3AA 2SCUA 3AI3A 3R0IA 1SCUA 4IZHA 1QV6A 1PL7A 4GX2A 1JTVA 2QHXA 3EZYA 3RUHA 1QYVA 3BMNA 5EESA 2WE7A 1DO8A 4II3A 1YGYA 4GL4A 3C7CB 1PJCA 4PG8A 2WWRA 3ZWBA 2DUUA 1U2DA 3ZW8A 3KHUA 2IODA 4XQGA 3PIIA 1CDOA 1ZXBA 3QVWA 2JJYA 3W8FA 3DOJA 4WNIA 4TZTA 1A71A 3DFZA 3WB9A 1JW9B 1PGQA 5G0SA 2P4QA 2DTEA 4DQUA 3N7UA 4FN4A 4JCOA 4TROA 2X9GA 4OOFA 4DMMA 4Y6SA 4ID9A 5G0WA 1M6HA 1OOEA 3PLNA 3BXXA 2AEJA 4DBVO 5IXYA 1XEAA 3G49A 5DOZA 4RLSA 2OHXA 4ND3A 4ZJUA 1F17A 1JAXA 5EERA 4WLNA 1XDWA 4XJSA 4K1LA 2GDZA 1HYGA 3V8BA 1QORA 4I5EA 2F1KA 4CLOA 3W4IA 3NT4A 3BMQA 3C1TA 4KUHA 4RVSA 1HZJA 1PGOA 4Y8VA 4B8WA 4I9NA 4FPXA 3TNLA 2I6TA 3AY6A 3S2EA 9LDTA 1JWAB 3VDQA 1CF2O 1OBFO 1WZEA 1YOVB 4BNMA 2BMAA 3RIHA 3PHGA 3MJSA 2AQIA 4BO2A 1GUYA 2WEKA 3QIVA 3I9OA 3TFQA 2VNSA 1O89A 4U6QA 1LBEA 1LRLA 4OXKA 4BO0A 4HFRA 5ILGA 2Y0DA 2FR8A 3BHIA 4MVJG 3K5PA
chains in the Genus database with same CATH superfamily
1R0RE 4M54A 2R7NA 2I7TA 2Z2XA 4DPKA 2PWPA 2I7CA 2EX0A 1HLDA 3OU7A 3FUCA 2ZTVA 3IAS6 4HQRA 2ZYWX 1MAUA 3CEPB 4JEMA 4Q9HA 5K2MA 4IIGA 1XZHA 4YT4A 1C80A 1EK1A 2AF3C 4NYJQ 2O1WA 5KKCA 4YRNA 2E5WA 1ZA2A 4KIWA 3X1XA 1A5SB 1UBCA 5KYYA 3Q6NA 9ATCA 4F3TA 5DW0A 1ZNWA 2X23A 3HR7A 1EFHA 1AG9A 2QLNA 3X1WA 4N49A 2DHCA 3E23A 4GI3A 5D00A 1GAXA 4P2GA 4IJWA 2GM3A 5TVGA 3I2YX 2W70A 3VJMA 5BMOA 2MU1A 1PW5A 1SGWA 2F17A 1C3VA 2A94A 2ZAYA 1M1ZA 4Y9RA 4ZRDA 4BNJA 1R12A 4M36A 4YCSA 1HKHA 2P4EA 1QBKC 1DU4A 1WCYA 3RSSA 3VGJA 2Y4OA 4LSWA 4WIAA 5KYXB 3VNUA 3A9TA 4J2TA 1XNGA 4Z9XA 1V8OA 3NJ8A 4GX0A 4BHHB 1PJ2A 2IYVA 4L0MA 3NV9A 1IM5A 4MQEB 1QRSA 3B1ZA 4OI0A 4NBRA 3AR8A 4CDNA 5ADHA 1GPAA 4TMFA 3DAYA 3ABIA 1HGXA 2IOYA 1ORDA 5BOSB 1ENYA 2HDOA 1VKNA 3IEUA 5LQAA 3QEAZ 3ETGA 2QM0A 5BVHA 2JNWA 4D0GA 4POAA 1YVRA 2UYGA 2VTEA 1B8PA 1YJAA 2C9MA 1J2TA 2FB9A 1LEHA 3MBIA 4LRXA 4RSHA 4TUYF 1T36B 5CM2Z 3C45A 3UJ7A 4IMPA 1AKNA 1YTUA 1XX6A 3CT6A 1V5FA 4IHJF 3F96A 1R5JA 1JUDA 1U9CA 1Z5GA 2IRWA 3MB8A 2AC2A 3H8SA 2EU8A 3WE7A 5AW3A 1L8QA 1VL1A 2B82A 3ZEIA 3ADCA 3KBOA 1B6SA 1W2HA 3HN6A 5K9ZA 3LC2O 4W9RA 1FFGA 2YHIB 3KOOA 4NNPA 2OV1A 4Q3BA 1P19A 1ODKA 3K0CC 3GEEA 3K0FA 2QYOA 4KFSA 2QP9X 3WO1A 3QKUA 1B2LA 2WWTA 1KH2A 3SOZA 2YN4A 3E84A 1IUKA 1SVOA 4FU0A 3WQQA 4ESVA 3F2IA 3T7CA 3V8QA 5A9SA 3A4NA 5AVRA 2IOHA 3AR7A 3DZJA 3G9TA 2C20A 1W4RA 2OKGA 2ORIA 2QEQA 3LHIA 4EZBA 3K70D 2EEZA 5T4EA 2D59A 4I5FA 1J2UA 1DLJA 4HRVA 4X90A 4E31A 4YUZA 1DAGA 5B3JC 1KWGA 1W0KA 5FUVA 3H11B 4ZT5A 2A58A 1XTTA 4H3VA 4NSNA 4EABA 1FQWA 1KS9A 4BL5A 4HNQA 2O2EA 2ZRGA 5DRYA 1CR4A 4L9AA 5IYZB 2BH2A 1J00A 3SYNA 1TCUA 4WFQA 2BW0A 4FYMA 5L9AA 3A3PA 3NB0A 1KQPA 1N5IA 5ESXA 3FHJA 1ZCBA 2O7RA 3E7PA 1Q0UA 2A1UA 3QTBA 3RPEA 5JDCA 2FOXA 3BSYA 4REMA 3JPYA 1FSZA 1BYUA 2WFLA 3DVQX 3OE7A 1S3GA 4RV9A 5AKXA 5DO9A 5FRDA 1QFMA 1YSCA 2DZDA 2GRUA 2JH8A 4TSFD 3LXRA 1CD5A 1ZDMA 5DBEX 3P20A 2WWYA 1VZ2A 4FUTA 1GTZA 4OB7A 1GQ2A 1VM6A 3KKNA 2I2CA 1P18A 2Q41A 2E87A 3KR2A 4ENRA 1LSOA 1G18A 5DCUA 2JGFA 4ZI7A 1I4DD 3K35A 2YJ5A 1SB9A 3N5CA 2VP5A 1GRNA 1UBKS 2KBFA 1DO2A 4LRUA 3QLTA 3OHPA 2HQ1A 4U0KA 4IFEA 5GY7A 4ER7A 1E6LA 3GDOA 2GB4A 1OXVA 4V39A 4G23A 4WOPA 1YI8A 3ROZA 3V4PB 1LNSA 3UJHA 5LB4A 4HQNA 1EDEA 1VSVA 2MSWA 3DF9A 4REOA 4A6EA 4FX2A 1X9IA 2A5GA 5E6SB 1NY5A 5LWHA 4BEVA 2HJSA 4DYDA 3TBHA 2C8LA 1S7CA 3I62A 3WLFA 3RVOA 1WUIS 1IHDA 1Y82A 1VP9A 1SIWA 3VO8A 2BE9A 3I01A 3N0WA 3MSCA 4FJ1A 1OY1A 1U6JA 3B6JA 1N6IA 1QH0A 4QPZA 1E1CA 2P1ZA 4Z8YA 4TN5A 2PD4A 2WWWA 3NHRA 3Q3EA 3QLJA 4IOMA 4NVRA 3ZU6A 2IZ7A 3BM5A 5JAMA 1QZUA 5KU7A 2YOGA 4W9NA 4GBJA 4LSZA 1TQ4A 3CJRA 3R7FA 1SOWA 4MDHA 1CJKC 2R1TA 2IELA 2WW8A 3B20A 3BJIC 4YB8A 3RJ5A 4UPEA 5EJ4A 5EKSA 4U7HA 4JI3B 3T1VA 3EF1A 2FUNB 3RS0A 2X8LA 3LMKA 3ZDZB 5F3WB 1HYBA 2QZ9A 2ZSHA 3NHWA 4Q1BA 4RPIA 3KJIA 2BMFA 5DYWA 4Q4JA 2BFFA 1A5ZA 1SULA 1YB5A 2NYAA 4BZXA 1OZHA 1YUBA 2Q7XA 4JP3A 1GT91 4GYWA 4M0CA 2CVFA 221PA 4ZYWA 1GSIA 2ZSUA 1RU3A 3TZHA 2JLSA 3AIOA 1EFUA 4XPZA 5I9SA 4QT4A 4JDUA 1DX6A 2RGBA 4DYVA 3PEEA 4GPEA 1ZN9A 2J9RA 4UNPA 1AC5A 1IUOA 5EKTA 5C8ZA 1A69A 3N2YA 1XEFA 5KNBH 2O1XA 3DFMA 2ZXUA 1B8NA 4CIVA 2D13A 2CC2A 2CZCA 3AUYA 3Q7RA 3NAGA 3VR4D 3ZE0B 4D0SA 1WZNA 2F1RA 3LY5A 3VDRA 4EW2A 1F9EA 3DNFA 1G5RA 3ZE8A 2QTZA 4XWWA 3O5AA 1GZ6A 5HRUA 2RD2A 1J0XO 1NNEA 2R6ZA 2QI9C 2Y6UA 4HDNA 1DJQA 2VSQA 4PICA 4FYYA 3N5KA 4JR0A 3ZWVA 1T0UA 2OG2A 3NHKA 2BE7A 5FTMA 1QF7A 5FUMA 4HBGA 4TUYA 3ISVA 2VS1A 4EATA 2RKWA 2RHOA 1K7CA 3T1OA 2Y66A 2WUFA 3TW6A 3ZGOA 2XADA 1L4EA 3A1DA 4DBZA 4B17A 3RFTA 4TTSA 2QM7A 1Z6XA 4HJRA 3GEIA 4BAUA 4QG7A 5MGNA 3BGWA 4AIIA 1XROA 2ZW9A 2J59A 3F4BA 3RKRA 5C9ZA 4GUAA 2NIPA 1WDLA 4B6OA 3N28A 1N3YA 2K4MA 3R3YA 3AKDA 2A0UA 4O4IA 1PE0A 2C2BA 1ZLYA 5FWYB 3OZVA 2P3SA 3EPLA 4IPTA 4I8IA 4TVSA 6PFKA 1JWLA 2ZRIA 1QHYA 3MSXA 2ZJ5A 5I9LA 5LXTB 5SZIA 3UFXA 3ZNQA 1P2UA 3ICVA 5JMWA 1IJEA 2R0QC 3GDFA 1D2MA 2B1RA 4BRZA 1RWXA 5TPWB 5K01A 4DC0A 2QTTA 4TSRA 5KZMB 1GGVA 3HY6A 3JYLA 2L42A 4MWSA 2PZLA 1V5EA 4L6CA 1LKZA 1VFPA 4WKOA 1FRFS 4BNXA 2IC5A 3ZE1B 4G8CA 5EEHA 1FY2A 4FW8A 2QLJA 4WN9B 3TK1A 1WB9A 3B3AA 3MAJA 4LNHA 5TQ0A 5ENZA 1SU6A 5JS7A 3FHTA 3RC8A 4HQ0A 4IX9A 5CK4A 1L4HA 3KJNA 4HEA6 2EFDB 1HUQA 1U1CA 4WGFA 5I9NA 5AW5A 4CLRA 2GPTA 3ILVA 1GLNA 4X9XA 1A0OA 1IU9A 2GN0A 2Y1LA 4GRAA 2WFMA 5BOVA 2LCIA 2HHAA 2VHUA 1ADBA 1Y3IA 4JAVC 2IEDA 1MO3A 5CA1F 2G5CA 1A9RA 1SB8A 1KEEA 4YRJA 1Z22A 3AFGA 3NP7A 3KVRA 3ZE2B 5IN4A 1M6NA 3R9KA 4XFJA 4P3OA 3L0SA 4F7WA 4KRYA 4CBVA 4F7DA 2QSJA 1DAEA 2BFFB 1H6DA 5DB4A 4OFXA 4MUKA 3CSDA 2V6BA 1CULC 1O94A 2F90A 2FN3A 3GLIE 2C7VA 1EJ2A 4ES6A 2WAXA 4J7UA 4NMHA 3T3DA 3V1TC 4RTRA 3QWHA 3D0QA 1XZ8A 4JGIA 3AT1A 4OJNA 5DGTA 1Z2AA 4P5PA 4UUMA 4CL3A 2Q4OA 1GZ4A 3EC7A 4PCUA 2PH1A 5ANRB 1KF0A 3BGVA 3A1TA 4DRZA 1QK5A 3T4UA 1X1QA 2FG5A 1XHEA 1NOKA 4IGIA 3WGMA 4W7IA 5HKKD 5ALMA 1QLJA 3P8ZA 1E2MA 4IWYA 4MRAA 5CUQA 5GGXA 4LWOA 1F3OA 3NC1C 1F38A 4RPKA 2JEZA 3CPEA 4G26A 4C2BA 1RT9A 3WS7A 2VEDA 3WQRA 2HW8A 3CNLA 4L8GA 3OQ1A 1RPJA 4XQ9A 1OF1A 1DKRA 1PR4A 3SKYA 1Z36A 1QS0B 1T36A 4GBGA 1GITA 5CH3A 3W5CA 2I76A 2JPDA 2HT6A 3H42B 3A36A 3PWZA 1HDIA 2BMVA 5H68A 3W1WA 4C20A 4CIDA 2BFAA 3GU3A 5I3ZA 2HLDD 1U2DC 2X0NA 4DPMA 3HXLA 2GCNA 4B3RB 3N2KB 2X0RA 2C83A 3PHBE 5AI8A 3ORHA 1PR2A 3F3YA 5DM4A 5JNUA 3Q5DA 1IBKB 3Q3JB 1N8TA 1E92A 4J9VA 3MUOA 4M1TA 4XPIA 5JALA 1NVEA 3N05A 4MR9B 3ZLVA 5FX2A 2KWIA 2QAGC 1Q0TA 1W87A 2X7JA 3LCMA 2V1UA 4KV7A 1A1VA 5K6AC 1FFXB 3JASA 4NENB 2G63A 3OIDA 3DV0A 4WW0A 1C4XA 4TLEA 1MRZA 5JQGF 1UC5B 3K9NA 5DXJA 3K9GA 1IEXA 3VYUB 2II6A 4KIUA 4UUNA 2B1QA 1NUHA 3I2JA 1OWLA 1JB1A 3CUVA 3ITDA 4AF8A 1JIQA 2Q1WA 3GUZA 2IYAA 5B7NA 4LYFA 4IHJB 1GUFA 3T3IA 2HXGA 1RC1A 1ZL0A 2FMHA 1F4VA 1M1NB 2QR3A 2Y9MB 3BB3A 3HXKA 1JR4A 3IAM1 3V8MA 3ZHYA 4Z4HA 2ZYIA 5JAOA 4EY5A 3MWGA 1AUPA 1XPRA 2ZI3A 4FT4A 1SQ6A 1CZNA 2FRDC 3R44A 1VPWA 3FTEA 1GQFA 1XB2A 2IDJA 2XVMA 4E5VA 5HQ3B 3I6MA 3DSRA 4TKMA 5C35A 5ICCA 1T6BY 3EYWA 2IWHA 2HLNA 4WSOA 3RUAA 4BNIA 4TGLA 1FNCA 3R6DA 1H2RS 1YS7A 2YL2A 2Q5CA 1BCSA 3D3EA 3DZ8A 3OKCA 1WP4A 1WCWA 4H35A 5C8DA 4OJTA 2VCHA 4B2IA 1U8AA 3G6KA 3L9XA 2MMGA 4AK9A 2EP7A 5EE5B 1P0IA 2I03A 5LA6B 4DCGA 1KFJB 4O4JA 1HXHA 4MTCA 5B7GA 1MW9X 4EQZA 4QXMA 1WHTA 3T5MA 5KQRA 4R16A 3L4SO 2YW9A 2HCJB 3HB4X 1MZPA 1EJ6A 3W3AA 1NXQA 4QATA 4RQBA 4UBKA 3C8MA 4JI6B 1QIKA 1UM8A 2YH2A 3MW8A 4FXPA 1YBMA 2OV3A 1Z4OA 4E15A 3Q6MA 4BV9A 5DCLA 5J2UB 2PUCA 1V7PC 4DCCA 1T8RA 1XZNA 2BGJA 5TNXA 1VXOA 1WULS 1NYTA 3CJTA 3I3SR 3MPOA 4AWXA 2ZCJA 1A9ZA 4M9ZA 5JZSA 1L4UA 3HB1A 3OZCA 1H0KA 3EXG1 3PHIA 2R7LA 2PBRA 2VNIA 4YRDA 5YASA 4AZ0B 5KVSA 1YQUA 4MVJP 2LVBA 1A9XA 4PR0A 4BKQA 1FTGA 2F1IA 1NV8A 3P97A 3O95A 3I5UA 1HMYA 2J9ZB 2P2YA 2CHUA 2X1HA 2XCLA 3L1UA 4QAJA 1LI4A 4XYMA 5HQJA 3PJDA 4BNTA 2JBHA 3OEHD 3R7LA 3IPCA 2CFCA 3KTAB 1AB6A 2FJ0A 1X3LA 5A6SB 3SF8A 4GGMX 2QP3A 2PGAA 3STUA 1NN3A 2XUOA 1B4DA 1J56A 2YHBA 1W1WA 1RXWA 3UK7A 5HOEA 4CF7A 3ZTTA 3SWWA 3EXFA 1RRKA 4RD1A 2G67A 2ONKA 4D5EA 5CIYA 4DB2A 1BVHA 1OT5A 1Z08A 3IC5A 1KZ6A 3GELA 3SMVA 4YRKA 1CQIB 3NCTA 2HMAA 4Q4AA 1ZNQO 2BJVA 3A1CA 1R9NA 4QZVA 4YO8A 4LF6B 1EP3B 1R0YA 1RHRA 1OLXA 1B43A 2B0CA 2W2LA 2FEWB 2DHQA 2BC9A 2YINC 3GYGA 4L9WA 4TXMA 4ZVMA 3V9AA 2XCQA 1KI9A 1DRKA 1WP9A 4QEZA 1ONBA 5IUNC 2IIVA 3OWHA 1JGTA 1PR9A 3MD9A 1E98A 4HRXA 4NBNA 2XDWA 1IBLB 2G8NA 2XMQA 4J0CA 1X7XA 2G6TA 1H0RA 1ZMTA 3LYLA 3OCZA 3AP2A 4K5QA 4MA5A 2WU3A 1RRMA 3OM0A 4RCYA 2QGNA 4V3BA 1MA3A 2C3YA 2I55A 1OLXB 2WIBA 1Q44A 5ALHA 2TS1A 1I13A 3TTXA 4DCOA 4WAUA 1JXMA 1L5OA 1ENZA 2NOAA 1RAGA 4JCCA 4LUCA 4DEVA 1GG2A 1B3BA 2HF8A 3C24A 4W5HA 1GGKA 1NUUA 2D8MA 1R74A 5AKEA 3AHHA 2JCXA 4WLFA 1JL3A 3C70A 2JJ2A 3B7PA 3UW1A 3T9AA 4ARAA 4KGDA 2J31A 3IT0A 2R8BA 2FSHA 4MS1A 2WQ6A 4DM7A 4INJA 4IJMA 1JAZA 2H18A 4QYIA 4H27A 5K3FB 2SKEA 1H22A 2Q21A 5D7NA 1XZAA 5HG0A 5TMDA 3RU7A 4X8MA 5EFOA 1RLOA 1E7QA 3I0ZA 4JXJA 2WZDA 1O6GA 2AW3A 1DELA 2VYFA 1F2VA 3LKBA 4MI3A 1JDPA 4QULA 3X2SA 4CUKA 4UTVA 3OZTA 1W5FA 1S8NA 2FWIA 4DR6B 2Q6OA 4HAOA 1GFIA 4D7AA 4E21A 3TWOA 3EY4A 3GLGE 2XTJA 5DK6A 3T6KA 5C80A 1QXSA 3D54D 1E4OA 4R9SA 4JI7B 3KLNA 8AT1A 4LMRA 4TL9A 4WMLA 1DAOA 1E1DA 4QYIB 3I5MA 4F06A 2J07A 4CKWA 2C2HA 4N9WA 1DZ3A 2GM9A 3A4YA 5LN1A 2NACA 1DC8A 4IDUA 3WL8A 4KGZA 5IJZA 4N9QA 4XVRA 5FT9A 4BUJA 2AWNA 3PHHA 2Y92A 1H4VB 2AJLI 1A27A 5B53A 1U99A 2HIMA 3DB1A 5MGBA 1BIFA 1AQUA 1JFRA 2V6IA 2HH9A 2MDTA 5COAA 3WMFA 2O3JA 2G9UA 2P5YA 1ZQ1A 1EGAA 4V2IA 2C95A 2ERCA 3I2GA 3JVEA 4DJDC 5JRJA 3PFCA 1KAGA 2IQIA 1YFZA 3B48A 1BGWA 3FVQA 3LVQE 4NICA 4Q9KA 1T9ZA 3K71B 3VHXA 5BNWA 3AZQA 1GD1O 1ORTA 2CSUA 4KGXA 2X7XA 5IAJA 4EW6A 1CEEA 1BHQ1 1BE0A 5ALZA 2FFQA 5AUQA 2F55A 1CQPA 5D87A 1NLFA 4WY2A 2AKYA 2BDEA 3FPBA 3ZWPA 4QDZA 1ECCA 2SBTA 3KSUA 4N8EA 5ESDA 2JI6A 1ZIYA 3LRPA 4INOA 3ZWXA 3OJEA 1E62A 2IVZA 2DUJA 4RFLA 3T3GA 3AUKA 2C42A 3WBJA 2OV6A 4Q66C 4XCVA 3TEMA 4C78A 3TECE 4YJKA 1I5OA 3H9JA 4KK4A 1QQBA 4RL4A 1RMYA 3ONNA 3UJ9A 2G04A 4D8YA 5F9FA 5CB4B 3K5HA 1SCJA 3DJFA 4K6MA 1YZHA 3PEFA 2HHLA 2QMOA 4AY4A 3M5CA 3PDWA 1KERA 1J49A 5LOVF 1M7HA 4FGUA 2EQAA 4QBTA 1LW7A 3TZEA 3AW8A 5D85A 4WOJA 1O5TA 2JGLA 4ZAVA 4Z0HO 3T5DA 1SKMA 3HBAA 5DX8A 3QXHA 4JLAA 2UUBB 4MCJA 2IPLA 1LH0A 2H16A 3JQ8A 3FTNA 3GLSA 2R8RA 3HJTA 2NVUA 4FD2A 2C2OA 3KEGA 2ZSBA 3EGXB 1C7RA 1UINA 4O1MA 1W2WB 1HZZA 2VHYA 3D7RA 2ZI5A 3LT5A 1AUVA 2EHDA 4ARSA 4L08A 1RKQA 2ZYUX 3HJRA 2AXPA 1BGXT 3AUFA 3FJYA 4WRRA 2B35A 3HKBB 3SKVA 2R44A 4FHEA 1EK5A 1N2OA 3T7RA 2C5GA 5BSGA 1DMSA 4LF9B 2H1IA 4Z4EA 2P9BA 2R2GA 3SJCA 2YC2C 1UBFA 4CEIB 3IDQA 3WI7A 4XYLA 1Z0KA 4EI7A 1ID8A 2XE7A 3ZG6A 1FNSA 5IVKA 1V5GA 4M9CA 1ZSYA 2UYQA 1MVNA 3QVGB 4Y2XA 2NZJA 4LTDA 1ZD2P 5DP2A 3IEMA 3EEOA 1MVOA 1R50A 4ITUA 4RS3A 5ALGA 1F6DA 2IHBA 1N3BA 3G17A 4TKVB 4F1WA 1EH5A 1JE1A 2QX8A 3L9WA 4ARBA 1ULSA 3OHSX 3THOA 1BNCA 1PS9A 4B8YA 1BMFA 1VHLA 2GMWA 2JFQA 2YJZA 5IT9A 4L16A 4YRLA 2FU5C 4OATA 4ER0A 5JXWA 5EJ9A 2PVCA 5BR1A 2C4NA 1KMQA 2KS6A 3WQBA 3V55A 2NO5A 4NG4A 3O74A 3EZFA 5FL7D 4D0LB 4EYOA 4YV2A 3GJ5A 1W46A 3I8OA 4HVAA 4P7KA 3LK7A 3OX2A 4B4OA 1AURA 3TQQA 5I4IA 4YQYA 4ZI3A 4EBBA 4ITVA 3W5DA 1BVUA 2PH5A 2R7AA 1JKJA 2G77B 2GPYA 1WPXA 2ETXA 4IIEA 4HGOA 3HBMA 3U3ZA 1V4NA 1YBAA 3OM9A 1JTFA 1HFJA 4AG5A 1R0CA 1WZ2A 1VE6A 1J20A 2ZIXB 1YQ9A 3SZRA 2GARA 3PUZA 3PL1A 1HEYA 1K3UB 2JFUA 3G2JA 3IT2A 3GGPA 2MINB 5AXDA 4LWZA 4CV2A 4DA6A 2ZTSA 2ODAA 5KEIA 1NVGA 4MK4A 5KUTA 2WICA 1Z2CA 2QTCA 1Q95A 1W9HA 3IUYA 2QT1A 3MT7A 2JIBA 5FNZA 1Z4LA 3KJQA 5H3HA 4RACA 2J30A 5JY6A 4NCBA 2JFFA 4IVPA 2O1EA 3ZTYA 2DUWA 3PQ4A 4G8JA 3GFVA 4LJ4A 4EFLA 2WWVD 5KNDA 2CLIB 2IW1A 1S4QA 1F2TB 1IHXA 2O7VA 2HQOA 2R25B 2H9YA 2RHRA 4JSTA 3CW2A 1JG6A 1P72A 1T9DA 2AKAB 2W6IA 4K9DA 4MMYB 3PRJA 5HP4A 3L0YA 2ZBGA 1S01A 5GONA 1UOPA 1EP2B 1T34A 1CT9A 4HUTA 1OIWA 1XEXB 1HPLA 4FR2A 4X6XA 3RSHA 3BCHA 3CONA 4ODIA 2J3QA 2RJOA 1GG5A 3H2HA 5AKKA 3ODPA 3E8MA 3OO0A 3W4JA 3R8FA 2PJUA 4RYDA 3H4IA 3OMLA 4C21A 3R6LA 2DKOA 1YJQA 3FNHA 2RGGA 3IE1A 3LXXA 4PLCA 5DLDA 3L43A 3TAUA 2NO0A 3N8GA 4RDXA 2XD9A 3M9XA 3C8UA 3NNNA 4C3VA 4QG3A 4C0KA 4DDHA 5DIZA 3K4PA 3KPVA 4XI9A 3OP1A 2IH2A 2C2WA 1PLJA 3QMWA 2ZPAA 1R7RA 1P0MA 1MQ9A 1RYDA 3AF0A 3PKZA 4ONEA 3KYDA 4NBSA 4LYYA 3C7KA 3F4KA 4M6WB 1A8UA 5HJ7A 3X1DA 5BR4A 3OTHA 3BRQA 3STWA 4MI9A 2HSEA 3KVOA 3KXIA 1Z13A 1YNSA 3PDUA 2YDYA 2HM7A 1RYYA 4JGGA 1WXIA 2GPBA 2VSOA 3HU1A 4OGLA 4XKJA 1RBQA 1YZYA 4PIMA 3UAWA 4WCFA 2XUPA 3JAWA 5L7YA 4REQA 4OP2A 4Y1RB 4L95C 4F5EA 4LCJA 1WHTB 4KXUA 1KI4A 2H5LA 4IIXA 1KA9H 2PU5A 2VPXA 1CVIA 4C0LA 3NHPA 1XYVA 5LQUA 2YS7A 4ZCTA 1AUXA 1AX9A 5HKLA 3R4CA 4RXTA 2GYUA 1O97D 3I09A 4OXQA 3D6AA 4C7KA 5EWLB 1WCIB 3SNKA 1UPCA 2DWOA 1TVKA 1NX9A 2Z4TA 1LSSA 1WUTA 2FLWA 4NONA 2CFTA 2LBPA 2OMEA 4TVOA 1FFAA 2YHUA 4J1SA 1EFRA 1DOHA 4H16A 1J25A 1XN1A 1JLKA 1UBOS 2QLLA 5AXAA 4OV6B 4WXMA 2VHQA 1MTZA 4RETA 3I28A 2P41A 2VRNA 5DP1A 3RYTC 3KSBC 4EJSB 4L85A 1PJ4A 3KNZA 3IR7A 5IG2A 2MIIA 2MSKA 2PAAA 2QQEA 2YWEA 3GJXC 2BGIA 3W1EA 2GYWA 1PD0A 4GPZA 1BDHA 1K98A 4GD3Q 4FI3F 3ZCQA 1KK2A 1OKKA 1TYEB 2JDIA 2WV9A 4GP7A 5FL7A 2VWQA 2JA2A 3R0JA 5EMMA 3DH0A 2XVZA 3A1NA 5F5XA 5DM60 4J76A 1H1TA 1PR0A 1RWOA 3D6UA 5E6RB 5CLJA 1NWCA 1OT3A 3KKPA 1R4MB 3O90A 4D3XA 1FLVA 2E21A 4RHFA 3WHIA 3ER9A 3WLOA 5EIOA 3GFFA 3ZCXA 2Q07A 1I30A 1L5FA 1LJLA 3O38A 1GILA 1W4AA 3QVOA 4ATNA 3QOFA 4UDNA 1L7MA 2XWQA 1QLHA 5ELXA 3MEQA 3IV9A 4QLBA 2RI6A 5AI0A 2GD1O 3CVYA 2NU6A 5KTNA 1T4BA 2P91A 3B36A 3Q3VA 1IEVA 5E3HA 1Y3BE 4CL8A 4EZEA 3ZVNA 2J4CA 3B9PA 3NYRA 4AU1A 1QIJA 1O94C 5T5QA 3HNRA 3ZTWA 3LA6A 5ALVA 2QMUA 2WA2A 3K9BA 4AN4A 3JQCA 3OLZA 3U61B 2BDUA 4JZKA 1E2BA 3MLAA 1IUNA 2VQFB 4FM9A 3DOCA 1LV8A 3CYFA 4MVXA 1Z15A 3PD1A 2MR6A 4QPJC 2Z83A 4MKHA 3Q8WA 3C6BA 1JPUA 1ULHA 4UU8A 5A02A 1VG9B 3IT1A 1CERA 1DC7A 2JFZA 2ONZA 4QGAA 1J7JA 2H85A 4S04A 2C3PA 3UA3A 2ZUWA 3LYUA 1Z7WA 3AOEA 4B4VA 4D6YA 1CYEA 4HDNB 3AKCA 3AVYA 1J06A 1MRNA 3OLYA 1XRSB 2O14A 4MB6A 5LBUA 4DQDA 5G41A 1KI8A 5EWMB 4LJ7A 4EECA 5KBYA 1NMSA 1JG1A 2O5CA 3NW9A 2NV6A 2A0YA 2UUCB 2Y93A 1HNNA 3U4HA 3UJPA 3OQMA 2IYQA 2I8LA 2J85A 4AJ2A 1KAQA 3EXFB 4QBIA 1E94E 3O8NA 4REQB 1YV9A 2DHDA 1AHHA 1ISSA 4D4KA 1MJFA 1G7RA 3MTJA 3BGIA 3ONWA 1M6VB 2QG9A 3MOGA 2H5IA 2WRZA 4GGOA 3SM3A 5JJBA 4G1BA 1RJWA 1V1JA 4HEJA 4IZ6A 1QFZA 2B4QA 4OHMA 2NO7A 3KB1A 3MWEB 5ES4B 5KX5F 2D5BA 3IERA 2X4GA 3EGIA 4XVCA 2EFCB 4NZPA 1LTQA 1Y8RA 2ANBA 1HE5A 2Y0CA 3IIJA 3PFFA 2P4SA 3DBIA 5TEWA 3TPFA 3GPLA 1W6UA 3WAJA 3W34A 1T9HA 4TRRA 1JHRA 1OWOA 2WF7A 3NDPA 3IEIA 4K2HA 2G6BA 3KZOA 1Y98A 5EHIA 5HFJA 3RJTA 4I4TF 3VVBA 5KQSA 3TLYA 4Z4GA 2J9XB 6Q21A 4MARA 1JB9A 1NBIA 1U0SY 2ZJ2A 3PUIA 5TEVA 4TL8A 5EHGA 3K0KA 3P0HA 3TX2A 3V7WA 4QGSA 4DR7B 3AP1A 3F98A 3JYQA 2NXNA 4N3NA 3QY0A 2GN8A 2BEUB 1K7EB 3GJYA 3O31A 3P0EA 3PGVA 4OL0A 4U39A 1MRSA 2WYOA 4Q1AA 2QRLA 2UXDB 3DO8A 3VO9A 2VAPA 2JFGA 5BQ3A 1SK9A 2G08A 3H1FA 4RVHA 1L5KA 4BNUA 4X20A 1O03A 2XDQA 3KL4A 3ZJVA 2PTHA 1TM4E 2BIFA 4DXHA 4C01A 4KO3S 2WAYA 3HBJA 1T3HA 2QD2A 1FW8A 3CH5A 4EHKA 4CM8B 4AZVA 1SO8A 1IN8A 3H75A 1E3DA 1NBHA 3V1NA 5CFZA 1RQNA 4NMLA 5JW6A 1XGKA 4XUDA 1XKLA 4OSPA 2QENA 4KSYA 3UANA 5JHHB 1ETUA 1CHDA 2O2JA 1RLUA 3HFRA 4MQEA 2HCTA 2MYUA 3HB7A 1CUCA 3ROXA 4BMXA 5KDDA 5JJCA 4ZTUB 3WRXC 4YJFA 1PZMA 2WUEA 3T7IA 1WM1A 3BXFA 5ALNA 1NI3A 3IQIX 2W90A 3F78A 2QJRA 1OHHA 1C8VB 2V0NA 3HWX1 1WY5A 1RCTE 1ZPDA 3GRCA 3P32A 1V0JA 4XIFA 2ATCA 4F2HA 2GPWA 2XB9A 4TUYB 4BNKA 5HUHA 2E6UX 4DUGD 1UBLS 3EXIB 3RTGA 2D0PB 1PV1A 1U2RA 2RKOA 4QECA 1G7TA 1ZSNA 4WL0A 3K1ZA 4CT5A 4ND8A 1DQRA 4WESB 1ZHOA 3GVPA 3UZUA 3O8OA 4QUAA 2Y2VA 1KMCA 3DV0B 3LKDA 3UK1A 2OAP1 4CMIB 2VXOA 1D1SA 1XTPA 3FNQA 3II6X 4JODA 1E2DA 3KZCA 2C9OA 1PTKA 2VBCA 4HMPA 3K70B 5EZYF 4HQFA 2DHRA 2IYRA 5B1DA 5DRTA 1Q16A 1E5TA 4D1YA 1BS1A 2OZKA 3T3MB 2AZMA 1BCRA 1EX6A 2XZPA 2ZRNA 1U90A 2BZSA 4F6RB 4AKHA 1FRQA 5JO9A 8ATCA 1P7YA 1CY0A 4NL4H 3T1TA 3BOSA 3MPUA 4V2UA 4COOA 3IV6A 1V48A 1AV7A 5COBA 2BFCA 2EKBA 1JDBB 4P4NA 2XZDA 3QW4B 2G0AA 1WLSA 4FDLA 1WMDA 1C3EA 4GM4A 3ZXXA 5IF3A 1SA0B 2AD1A 3L6DA 4KOAA 4EG3A 4FE7A 2VSNA 2EVWX 4EGQA 1D5WA 5KAMA 2C5SA 2BMJA 1NSTA 2XLCA 1L5HB 3QI7A 4UXJA 1S2IA 5H4HA 4QJ4A 1QQAA 2I4NA 2O6LA 3MGCA 1CU1A 2CCJA 3VTZA 5K8CA 1AA6A 1XMIA 9GPBA 3NH9A 4A27A 1WDMA 1YL5A 2PUEA 2HZBA 3VKVA 1AQYA 1C29B 1PEKE 2CLSA 3D8HA 3KAKA 1C0EA 1LS6A 3DMPA 1ZS9A 4MEJA 4Y2SA 1Q7BA 3OE7D 3ZIUA 1X9GA 4QL3A 4BKUA 4XGKA 2B2CA 4N03A 3MFQA 1HDOA 2H92A 2DULA 2F1OA 3GCWA 1NW6A 2ACEA 3B1JA 1T6YA 2AIRA 1Z6PA 3PKIA 4B81A 4EUEA 6YASA 1L5WA 3G9UA 1WF6A 5EQTA 5HEKA 3BQ9A 5LBIA 4PC6A 1AU9A 4NBWA 4ROTA 3C5EA 4MUEA 5JASA 1UBRS 5ERGB 4I3FA 4DLZA 3JZMA 4XWAA 4C3ZA 2DWQA 3MAAC 2GPAA 2YJ4A 1MN6A 1YHNA 2PXCA 2ZVDA 2XMBA 3A4MA 4RORA 5ED0A 1G55A 1VE5A 4RQAA 3UN1A 1ZOIA 1L5RA 2CXUA 3HZRA 3I9JA 4MIOA 3EG9B 1TVKB 3ETEA 5ERYA 3N8NA 4B4UA 5AIBA 4RKWA 1CUGA 4MITA 5KJCA 5KX5A 1NP7A 1Y7IA 1RMQA 2QN9A 4NOLA 3Q8KA 2CHEA 1JLMA 2NV0A 4LVUA 4ZU3A 1GPNA 1SFRA 2BUAA 1WEHA 2XJ9A 4ND7A 3R76A 2AEFA 3AUJB 1Z6AA 4D3DA 3ZZTA 3KAJA 2O7SA 4ENUA 4NJMB 5C7LO 4OLAA 1OC2A 5FPKA 3BWMA 4J0QA 4UTNA 4EY8A 5TDHA 1RKXA 2OZEA 3A4LA 4HB4A 2C59A 1C1DA 2PRZA 2XDAA 4RF2A 4E11A 5B36A 1E7RA 4AY3A 2R6AA 3S2SA 3EVCA 5A5VA 1XXHB 3A9WA 3COYA 4G5HA 1H1DA 4W5OA 4LDZA 4RVNA 2EQBA 4IMRA 1RS0A 4KHPB 1EGVB 3I32A 1UDXA 1Y5IA 3RNLA 3V2GA 2PVSA 1FXUA 1G42A 4G9BA 5J2TA 2BPOA 1R0BA 2PY6A 4J1QA 4RCZA 5CLFA 1Q7GA 3TSCA 16PKA 5JBIA 1VCNA 4P4GA 3UWPA 1YUMA 4CTJA 2Q6KA 4R1NA 4XJVA 1ZVVA 1XMPA 4BFYA 4PYIA 3GPIA 1D04A 2VNKA 4O6VA 1K8YB 2QJWA 4QUBA 1VLZA 3KXPA 1L7RA 3OE5A 5JIBA 4JJ6A 2J48A 2OGTA 3BYZA 1L7DA 4RLFA 4WCFC 2FUG6 1HZZC 2Y71A 4KE8A 3VC7A 1WNFA 3SIPA 2ZYVX 4QO8A 3EMBA 1SHLA 2G83A 2PFKA 1ICIA 1CJBA 3QMVA 3DVLA 1VL2A 3FDZB 3QOYA 1A97A 2HEIA 4HZUA 1SZDA 1Z8NA 1Q19A 5EJ5A 5ITVA 4KMSA 1GNPA 1ZI6A 5LDDC 2JGMA 4FT2A 5HIAA 2IU4A 3QX8A 1N2ZA 5F4BA 1JV2B 4QM7A 3A6PC 1I7SB 3IDSA 2J41A 4ZV9A 4U3JB 4BFSA 5T67A 4E7OA 1C3LA 1JG4A 1CKEA 4MYHA 2IYYA 2UYCA 1NU8A 4WT7A 2XNDA 1UK9A 3B5JA 1T5IA 2YC4C 4TL6A 4U5QA 2C0CA 4KKXB 1HO3A 4MWTA 3IHKA 1Z8DA 3E7XA 1IWPB 5JSYA 3IAS1 4GOMD 1LQTA 3DBLA 4I5DA 2XUGA 3PJGA 3HXOA 4D4MA 2GZMA 5EUQB 3L2OB 1NFQA 1OW3B 5GQSA 2ZWAA 4QPNA 4QYTA 1WF3A 2XECA 1G5HA 1XMVA 3EIXA 4TKUB 5GPBA 3ZKWA 4Z9YA 3E35A 3AHIA 4EKYA 3SZGA 4ZCQA 1IHOA 4FYIA 4CDGA 3CUTA 1NIJA 1VKHA 1ZYUA 2YJTD 5A3JA 1KGSA 4QO7A 1ZU4A 2XXAB 2OO5A 4OHCA 4DMCA 5TR9A 4GW3A 1UZMA 4R7GA 3NOOA 3NUZA 3M6LA 4B79A 4O2RA 2JFWA 5JOQA 2G7MC 4RJKA 4N5LA 2ZWMA 3DBRA 3K7EA 2AQ8A 2M6LA 3MQ4A 4JJGA 3GPCA 3LDHA 3E9CA 4H7IA 4BXOB 3FTPA 4AUMA 1MXHA 1N92A 1Y8CA 1Z7BA 2OM2A 4N3BA 3UCXA 3P9KA 3M0EA 3ZHVA 2OQIA 3BH0A 4BGDA 1USIA 1VRVA 4UTRA 3BREA 2PDAA 1NRXA 3H9UA 1JI0A 1TTHA 3R09A 4WZZA 4BO4A 2EATA 4J3NA 3UKDA 4KK3A 2RHHA 2WJPA 4XEHA 2R6FA 4ZEVA 2JZCA 1SBCA 5BSFA 5I51A 1P81A 4HAYA 1U98A 5BSTA 3TI7A 2QRVA 1HG1A 4JU8A 4RA9A 1RRFA 2BGKA 5DHSA 3VPSA 3WLHA 5DNWA 1YD7A 3C6MA 3VPXA 3PDCA 5THQA 1DSSG 1U02A 3ZWMA 2ZT7A 4KXVA 4KN9S 2I71A 2VHTA 1CVRA 2XGMA 1MVLA 3EOAI 4JROA 5F51A 4IDNA 1WSAA 1I7NA 3A05A 5H83A 1VYUA 1CQXA 2FSVA 1GFZA 2X0JA 2XYHA 2HX1A 3OPYB 2Q5QA 3EARA 2UZ3A 3U7QB 4B48A 4BEWA 4LXGA 2X5JO 1F2TA 3H99A 5FO0A 1NVDA 3MB5A 4EARA 2DR3A 2IBSA 3WLSA 2B37A 5IT5A 2AMYA 1T0IA 3UJ3X 3WXBA 3OZWA 1K6MA 1A9PA 3FLAA 4B40A 5HSGA 2C2GA 1A2KC 4PW0A 1Y8QA 3WSTA 1MB4A 3EIFA 3GA0A 2B25A 3CCBA 5ADUS 3AVTA 3LLCA 4LXXA 2FWJA 5KMGB 3HXTA 3BWBA 2H59A 4BECA 2X77A 1JHVA 4P3YA 3KCQA 3VR5H 3LQKA 1E7SA 4JJFA 2XUQA 3O2QB 3IQHX 3T52A 1JSXA 2GR9A 1VYTA 4LF5B 5LQJA 1AK1A 4WY8A 1PR3A 3MYYA 4MLCA 1D2NA 1S96A 2HJHA 4ZQEA 5ITZA 1W19A 2UU9B 2EX1A 3H9CA 3LOUA 5IUKC 4V1CI 2FSPA 3MOIA 4OP1A 4KXWA 4HJXA 3WNDA 1P60A 4ZARA 5B6IA 2X22A 3VSEA 1H2EA 3IUNA 4FFBA 3T0IA 2H1LA 3LFUA 3PGMA 5BW6B 2PQ2A 2OXTA 1UZUA 2AN5A 5ECGC 5ARCA 4BKPA 3D3WB 3EUWA 2C7RA 2DERA 1D0SA 4DLTA 2FE1A 4YCAA 1RI3A 4MGIR 4O4HF 2AB0A 3VH1A 1FRZA 2FW7A 3C14C 3GO4A 3UHPA 5J4KA 3SZUA 5LMCA 4MINA 4NS4A 1CZRA 1WVMA 4DREA 3C3WA 1BCRB 2XTAA 1N2CA 5FTNA 4CMHA 4DA0A 1XF9A 3LAWA 2O1SA 2BM9A 3U09A 1O0CA 3K05A 1E0AA 3HB5X 1LLQA 1KMHB 3UV6A 3TLMA 3L1HA 1QP0A 4Y98A 3L7MA 1WQ1R 4MYUA 1L5QA 3KZKA 1J6UA 1WB4A 4KAFA 1NNUA 4ALIA 4NCHA 2OYCA 3FBTA 2R7MA 1A04A 4I1IA 3L4JA 1M2OB 3KELA 3CRRA 2BSXA 4JASB 2PLNA 4AN0A 2TMDA 3P2IA 1EM8A 4U7GA 1EFTA 1RD4A 3ECCA 4FGLA 1Q22A 2XNKA 3AB7A 1CIJA 1GAJA 3G2QA 1RAIA 4FNOA 4NI5A 3W05A 3WV5A 3PYXA 3IBC