3C1OA

The multiple phenylpropene synthases in both clarkia breweri and petunia hybrida represent two distinct lineages
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
b'MEKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPDSTPSSVQLREEFRSMGVTIIEGEMEEHEKMVSVLKQVDIVISALPFPMISSQIHIINAIKAAGNIKRFLPSDFGCEEDRIKPLPPFESVLEKKRIIRRAIEAAALPYTYVSANCFGAYFVNYLLHPSPHPNRNDDIVIYGTGETKFVLNYEEDIAKYTIKVACDPRCCNRIVIYRPPKNIISQNELISLWEAKSGLSFKKVHMPDEQLVRLSQELPQPQNIPVSILHSIFVKGDLMSYEMRKDDIEASNLYPELEFTSIDGLLDLFISGRAPPPTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eugenol synthase
publication title The multiple phenylpropene synthases in both Clarkia breweri and Petunia hybrida represent two distinct protein lineages.
pubmed doi rcsb
source organism Clarkia breweri
molecule tags Oxidoreductase
total genus 119
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c1oA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3c1oA02
1KS9A 3R3JA 5TS3A 3PHIA 3O8QB 4E2ZA 3P2OA 1B16A 5EL0A 1KVQA 2HK9A 2WE8A 3DOOA 1VSVA 2Q50A 4WLOA 4G81A 1EUCA 4FPXA 2VYVD 7ADHA 2QIOA 3A4VA 5DNAA 3F6YA 1NHWA 3D5TA 3FBTA 4GMFA 1GTMA 1NQTA 2I6TA 3EY4A 1KEWA 2QRLA 3LT4A 4MVJF 4YJFB 4FGSA 5KIAA 4E0BA 2JD2A 2D8AA 4PIVA 2BHLA 4NNJA 3O26A 1PWXA 5ICMA 1P1IA 1E3IA 5BNIA 4NDNE 1O94A 1JKJA 3DEYX 3K30A 4ITUA 1NWCA 1I2ZA 5FWNA 3BMQA 3K96A 5ADHA 1YXMA 2Q1SA 4OYRA 4P4LA 1YL5A 2HQ1A 4LCEA 3D5QA 2UUPA 3ETGA 3L6EA 3PP8A 1O89A 5HS6A 2W4QA 4DQUA 4YWJA 3JD1A 5TLSA 1SAYA 1UXJA 5EERA 2YZ7A 4KQWA 1Y8QB 3QWFA 2AHRA 2Q1TA 4NU6A 1HDRA 3RBVA 1B7GO 1ML3A 3VTFA 1RKXA 1GFSA 2DU8A 1YBAA 4F6CA 1LRLA 1ZCJA 3DZBA 4KTTE 4A5OA 3ZNQA 3PHGA 4UUNA 3FNFA 3O9ZA 4YAKA 4WLUA 4CL8A 1JVSA 2BELA 4GBJA 2WSBA 3N74A 1F0YA 4HNGA 3WMXA 1BW9B 4EJ0A 3GUCA 1U4SA 5DBGA 1PJTA 1WWKA 2AQ8A 4ZQHA 1GUFA 3FF4A 3TZ6A 4Z0PA 4YCAA 1GPDG 3JQBC 2OP1A 1HETA 4BNHA 4Y9DA 1QV6A 4HFJA 4CR6A 1DDOA 5ITWA 2EKLA 4U8GA 3IKVA 1Z6ZA 3IDSA 1ISGA 2B37A 4II3A 4L9RA 1LLUA 4XQCA 4H7PA 4LISA 1VSUA 2BMAA 2FY8A 2P68A 3COSA 3SLGA 1BTOA 3GEMA 4L4RA 3HDQA 1R16A 3T4EA 4R1UA 3KYBA 3L6DA 3OEWA 1Y5RA 3WWZA 5BSFA 1ID1A 1Q7CA 5A4DA 4D0SA 2Y1OA 2VZ9A 4RPKA 1I01A 1YDEA 3Q11A 4R9SA 3HDHA 3RBZA 5L95A 1GZ4A 2GN4A 1AHHA 1E1LA 1R6DA 2X8LA 3DAFA 3PLRA 4GX1A 4NH4A 1EMDA 3CMCO 3HJAA 4TRJA 3DONA 1HE2A 1LUAA 1A7AA 9LDTA 4ROSA 5G4KB 2G1UA 3WX0A 5L45A 3F5QA 1S7CA 3GOHA 4OH1A 4WECA 3QWHA 3RD5A 4E31A 1DPGA 3VZRA 2VUSA 4ZHSA 3AFNA 2I65A 3HB5X 2HLPA 3TF5A 5H82A 2NQ8A 4QO8A 1BXZA 1GEEA 5DBFA 3W4JA 1EFKA 1M6WA 5JXWA 4CLOA 2BI7A 2P91A 3M1LA 3MCVA 4Q3EA 3PVZA 3WDSA 1W6UA 3KM0A 5A1TA 4CM6A 1J49A 1VKOA 2PGLA 1PJSA 3CE6A 4ND5A 4W9NC 3JYNA 5ENDA 4JBHA 3IP3A 4K6FA 4GQAA 4XEHA 5C3MA 1T24A 3OM9A 2A9FA 3L9WA 3CXRA 5IFLA 3BMCA 1QLJA 4JJIA 2HKIA 3GA0A 4OKIA 2J3JA 2EKQA 4B3HA 1PJQA 4N54A 2C2YA 3GMDA 5KOIA 3GRKA 4U6SA 3GVCA 4ZN6A 4Q3BA 3GVHA 1TT7A 1B3BA 3BTOA 3RC7A 5JDCC 4ZQEA 5BSHA 1WDKA 5DCYA 2W2LD 4JIGA 5IDWA 2AQKA 2AA3A 5EQDA 1LEHA 2AG8A 2DC1A 3KLMX 3VKUA 4F6LA 3OQBA 1BHSA 3NJ8A 1PQUA 4WLEA 5ER6A 1GDHA 1PX0A 3DFZA 3R6DA 4J7XA 4ZRMA 1O5IA 3V1UA 5K9ZA 1ZMOA 1P3DA 3I9LA 1Y9EA 1GQ2A 4KWHA 1PU2A 2VOJA 4WASA 1D1SA 2EGHA 4FFRA 4BNGA 4I08A 2VHWA 3NTRA 1I33A 1EE9A 2GSDA 3WMWA 3QV1A 2JL1A 3KV3O 1ZH8A 3PDJA 4TMFA 1N1GA 4OHUA 3W8DA 4DBVO 4EW6A 2DFDA 2QQ5A 1XU7A 2DFVA 2Q49A 4M8SA 4CLXA 4FB5A 1DFGA 4XB2A 2VRBA 4BKOA 1GUZA 4IPTA 2HRZA 3W8EA 3RROA 1XR3A 3DC2A 4MPDA 1RYEA 4ILKA 2BLLA 1VPDA 1GYPA 1KVUA 4S1VA 1NQAO 2FZWA 4EDFA 1KETA 1QLHA 3T4XA 1K5HA 5G0UA 1EBUA 1PGQA 3ONEA 3E5RA 2FMUA 3Q2IA 4RVHA 1MUUA 1GV0A 1HWYA 3H9UA 3F9IA 1FDWA 4J49A 3H5AA 1T1SA 3V2GA 2H9IA 3ST7A 2C7GA 4GH5A 1HDCA 2B4QA 1ZK0A 2GERA 2Z1NA 1TA4A 4PRLA 3NT2A 5DN9A 4CL3A 4RPHA 1GAEO 1I2CA 2B5VA 4M1QA 2HJRA 4BMVA 2Z95A 3PQEA 5B1YA 1BG6A 2YDYA 3WNVA 2SCUA 2CD9A 5IDQA 2RCYA 4DUPA 3OJLA 2VT2A 4A10A 2G76A 3NJ4A 4XZ3A 5K0ZA 1X7DA 4YB8A 4MIOA 3S8MA 2C59A 3D3WB 5K6AC 3BYZA 2LDBA 4MINA 4QX6A 4W7HA 2HMVA 1Z7BA 3NEPX 3DBLB 1XYGA 1YJ8A 1OI7A 4MKRA 2RIRA 3Q9UA 2DPGA 3W6ZA 2DQ4A 1GY8A 2WD7A 3PFFA 3ANMA 3CH6A 3OIDA 5A3JA 3DBVO 1ADCA 4IBOA 4DVJA 3RJ5A 4ALJA 1KERA 1P1JA 5ENVA 3BHJA 4YT8A 1ZBQA 2X5KO 3F1KA 4R51A 5KNLA 4XIYA 2ZKLA 5IXYA 2PV7A 2AE2A 5ICSA 5JY1A 3A1NA 1DJNA 4O0LA 1MC5A 2ZB8A 1H9BA 3KRTA 3OP4A 3B70A 3U62A 3FTPA 4KTVE 4BO4A 3ADPA 4IY1A 4OQZA 4N7RA 3ANLA 5TQVA 4QTZA 4CMIA 4QO7A 1DB3A 1YONA 3V5NA 2Y67A 4WE3A 4DL9A 3MJ4A 1A71A 2Q1WA 4G65A 3F3SA 5A9TA 4XDYA 1PR3A 3NDRA 1J0XO 3KTDA 3C24A 5A05A 1W73A 2D5AA 1XEAA 3AUUA 5B37A 5JC1A 2HCTA 1ISJA 1UZLA 2EWMA 2D59A 1DIGA 5B12A 3BA1A 4LVUA 1KVTA 3RUAA 2FP4A 5I7SA 1SZJG 1A7KA 1DC6A 4CM8A 2BFPA 3OQ1A 3DAPA 5FF9A 5GZ1A 5G0TA 1EVZA 2EW8A 1BXKA 4WK6A 4CMEA 5T64A 3FRJA 3VH2A 2OMEA 2JFFA 3O4RA 3GPIA 1K89A 2X86A 4B4UA 4YAGA 4KMSA 2FOIA 3DBHB 6LDHA 4XYEA 1V6AA 3CIFA 1L1FA 1LDEA 2CDAA 4DIOA 5JCXA 1OAAA 3KXDA 4ND3A 1XGKA 1FMCA 4CQLB 3FPLA 3LC7O 5THQA 1ENOA 4EITA 1NR1A 4CM4A 1A4IA 4HX5A 5BNTA 2PK3A 4QXMA 4CR8A 3PRJA 1ZO8A 1TEHA 1C1XB 4TWRA 2YFHA 2WJPA 3OQ6A 4M87A 4YRBA 4WOKA 2ZB3A 3ZNOA 1I8TA 2XOXA 4JBIA 5COAA 4AJIA 3EUWA 4XYMA 3ITDA 1JN0A 2D3TA 1W4ZA 1YL7A 3MWDB 4ESOA 1NFQA 1M76A 3LF1A 4A27A 1HE3A 1E0DA 2C82A 4J1NA 2D1YA 3EGOA 4MVJD 4P38A 1GYQA 4FIZA 2EERA 4N18A 5BQFA 4ZD6A 2VTDA 1U2DA 5KKCA 1IL0A 4ID9A 1K2WA 4LMPA 1IULA 3QVWA 3PDUA 1KEPA 3AU8A 3JSAA 4W4TA 2QZ9A 1A72A 5TGDA 3NGLA 5G0VA 2O2YA 3Q0EA 3L4BC 4KDEA 2FWMX 1VL6A 4WLVA 1BSVA 2OOSA 3KB6A 3ROPA 1LC0A 1PGJA 4IIUA 5IG2A 1F14A 1L7DA 4D0RA 4MVJG 2HDHA 1DAPA 1NBOA 2AEFA 2ZCUA 3OFSA 4M89A 3RC1A 5TJHA 2GPTA 2RAFA 2FR0A 4MP3A 3BZUA 3ASVA 3JCZA 4BL5A 3IKTA 3Q9NA 5FI3A 4JP3A 5HS4A 3PZBA 4Y6RA 3W4KA 3PEFA 1DO8A 1P44A 4K1LA 1TI7A 3DZFA 3DR3A 4NBWA 1U8FO 1NAHA 1LXCA 1AHIA 2E4AA 2H6EA 2NACA 5AOVA 2D2IA 3DQPA 4M55A 4JK3A 3CZMA 3PWSA 1GEGA 2EGGA 3TPCA 5F1KA 3V8BA 1PZHA 3JQAD 4J7UA 3U4IA 3I52A 5AYVA 2CVOA 3BMNA 3JYPA 2JD1A 3PLNA 3WGOA 1SPXA 1ZK1A 2D5CA 3NX4A 4IJWA 4Y8VA 3ETDA 3PFWO 4DA9A 2YV3A 4BNXA 3HFGA 3U9LA 3GN1A 2TMDA 5BR7A 1A9ZA 2O3JA 1LDMA 1M2WA 4O63O 3ONDA 4IDBA 2IRWA 4JQCA 1A5ZA 4R3WA 1FDUA 5JLAA 4XA8A 3PJEA 1SOVA 4JJFA 2FSVA 2YHIB 4E5PA 3SJ7A 1FDTA 3PHLA 2NWQA 1E1NA 1BVUA 1QMGA 2WYVA 3S2EA 2J8ZA 2VZ0A 1XQ1A 3GNSA 4DWVA 1E3LA 3EZYA 4B4VA 3CINA 3VAZA 4ZA2A 3G17A 3RUCA 3ZWNA 3QVTA 1R4MA 1SB9A 2Q46A 3PK0A 1DEHA 1EUDA 2W2KB 4PLCA 1NASA 2YQ5A 1IPEA 2YDXA 4CM9A 5HTOA 4HBGA 1WNTA 1BGVA 4MDHA 9LDBA 2WD8A 2CUKA 3DTYA 4H15A 4UEJA 3GN2A 1I2BA 3KO8A 4NR0A 4O5OA 1IB6A 1VLLA 1YDWA 3K2BA 2CNBA 1UUFA 1LLDA 2OGUA 2JAHA 2V65A 3LC2O 2FPIA 1GR0A 3JQ9C 1EVJA 1GYRA 4RQUA 4A26A 2VZ8A 3S1LA 3H8VA 3DDNA 4GX5A 2RHRA 3FHLA 3GC6A 3K5PA 3GZNB 1TT5B 2YY7A 1P1KA 1EDOA 1GZ3A 1BMDA 2B4RO 4BNYA 1ENYA 3HFSA 5JC8A 1NR7A 5JDIA 3DMYA 3WNQA 3D0OA 2GGSA 4A2CA 2BH9A 4F3YA 5BSGA 3DZJA 4DPKA 3JD0A 2C54A 3I83A 1M66A 4GGPA 1OOEA 5C5IA 2X23A 4TVBA 2O4CA 5U4QA 1X15A 2DUWA 4EUEA 3HDJA 4ONEA 3M2TA 1IZ9A 4PVCA 4QQRA 1NFFA 1HZZA 1MGOA 1UJMA 5DBIA 4GWGA 3HN7A 1HTBA 1HE4A 2R6JA 2I3GA 4R69A 3INGA 3H9JA 2Y1FA 4F46A 3LC1O 2D4AA 3RUEA 1NQ5A 4ND1A 2Y66A 1GL3A 4R54A 4AFNA 2YYYA 3QE3A 1WPQA 1Q7BA 1DIAA 3OIFA 5IXSA 3JTMA 4PLTA 2EP7A 5EESA 5BNFA 2ZYDA 7MDHA 1QORA 3P2YA 4XRGA 3ROQA 3MWEB 4GI2A 4RF4A 3GG9A 1LRJA 3S55A 4ZGWA 2G17A 5KJEA 1LQUA 1QKIA 1SOWA 3KOUA 3C85A 1NVMB 4E5YA 1WP4A 2JJYA 4RZIA 1N9GA 3OIGA 2DBZA 3BMQB 1QYVA 2CSUA 4GGOA 1GZ6A 4TSKA 3AOEA 4UREA 2PD3A 1B14A 3FD8A 4UUMA 3D7LA 1AXEA 5TNXA 1EK6A 2GZ3A 1CRWG 3F46A 4MVJM 1K0UA 1V3TA 1LU9A 1N2SA 2XPCA 3CEAA 4AJKA 2WDZA 4R16A 3AUTA 4NI5A 1UDBA 1O8CA 5FEUA 1XIVA 1YO6A 1YBVA 1M6HA 1ULSA 3GR6A 5F3RA 2Z5LA 4NMHA 5T8KA 3AOGA 2DBQA 5L7WA 4XGNA 1E5LA 3AWDA 3BIOA 3GEDA 2X5OA 2HMTA 2UUOA 4I1IA 3WYCA 4A0SA 3ASUA 4YAEA 1ZXLA 4MO2A 2Y1GA 4MJLA 1QG6A 4PCVA 2ZATA 2V6BA 1P0CA 2JCVA 3OHSX 3TN7A 4RPLA 2PWZA 4LRSB 1LDNA 2ZB4A 4IDFA 4JNKA 4RF3A 5GMOA 3ZWCA 4EBFA 5IZCA 3GEGA 3ICCA 1Q2XA 1EUZA 1V9LA 3SVTA 3KZVA 3PPIA 5JCJA 3WS7A 5AXDA 1AXGA 4FS3A 4CODB 4LSMA 1YB1A 4OO3A 1OZAA 2I9PA 4URFA 2NV6A 4YT4A 1C14A 1PR9A 2IZZA 4DBZA 3UCEA 4QFDA 3ZWVA 2Y68A 1OC4A 4RV9A 4W6ZA 2C07A 2FSSA 4FOSA 4JXKA 5TRTA 1LC3A 5A02A 3D4OA 3WYBA 3DHYA 3ENKA 4YRDA 1WZEA 2QHXA 3CKYA 4B3IA 4EJMA 3CTMA 5IF3A 3EZLA 3RC9A 4PLHA 1JAYA 2V6MA 3U09A 4CM9D 3K92A 1KEUA 4CJXA 1KIFA 3WBBA 4J2HA 3F47A 1V8BA 4L4SA 3ZWWA 4CV2A 4NBTA 1HZJA 1LDGA 2G82A 2I76A 3DB2A 4NJMB 4J2OA 4B79A 2A92A 4MIYA 4E2YA 1CF2O 4YJGB 3HZZA 1FJHA 1KY5A 3F4BA 1YH3A 3E1KA 2XXBA 4WNIA 3K9QO 1ZKMA 4NFYA 4E5MA 1YB5A 2PKRA 2DTXA 3QLJA 4BNNA 1E6WA 2YV1A 3JQFC 1GCOA 1O95A 4Z6KA 2CY0A 3AM3A 3ROKA 1IY8A 5AQ1A 4Y98A 4UEKA 1QXSA 4FJ2A 2VRCA 1JVBA 3GNTA 5JAQA 4BKRA 1X0VA 3HG7A 1N7GA 4U0JA 2OHXA 1DLIA 2RBEA 3UCFA 3WYEA 4BO9A 3FWNA 3OA0A 4D43A 4IXTA 3EVNA 3CUKA 2CZCA 2DBRA 3UAGA 1U9JA 4JLWA 4Z9XA 4BVAA 3A14A 2QYSA 3BMCB 4A7PA 5KJ1A 1R66A 4BQPA 2HK8A 3OH8A 4PLVA 3GAFA 1YL6A 3HDYA 3PHHA 5CEEA 3I1JA 5CHEA 4TKLA 1YJQA 3E9NA 3X2EA 4RPGA 4MVJP 1Y81A 1CETA 3O8QA 3SXPA 4QFCA 4CM1A 2Y1EA 4NG5A 4LMRA 3IS3A 2H63A 5KJCA 4R1TA 2E49A 1E92A 5JPIA 2IXBA 3KEQA 4E30A 5CFZA 1PS8A 4OXYA 1YQGA 3GVXA 3DOJA 1T25A 3E82A 5TT0A 1G0OA 3NRCA 1DRWA 5G4LA 4YJFA 3ZN2A 3UVEA 2NU7A 3PI7A 4OAQA 1EEHA 4AJ2A 3HSKA 1A27A 4OJNA 2ZCVA 3VPHA 3ZU5A 4RORA 4RDIA 4R1SA 3UW3A 4DXHA 1H6CA 1U3WA 2P4QA 4BO5A 5IAAA 2AQIA 1A4UA 3KSZO 2AE1A 4BO0A 3DZIA 4D79A 2NM0A 2EEZA 1U5CA 5DCUA 1ORRA 1LTHR 1ISFA 2QX7A 1P1HA 4J0FA 4XGIA 4J9VA 4FJ0A 3S2GA 5CDGA 4J4TA 4RPJA 1O9BA 3IL2A 3FCOA 3M2PA 1UH5A 2GD1O 2VHYA 2WM3A 1KOLA 5L4NA 2PA3A 3C1AA 2IEBA 1CEQA 1U3VA 4UUOA 1PSDA 3RJ9A 4DPLA 1R0LA 1WDLA 2X4GA 1DC5A 4OXKA 1Y8QA 2O3TA 3EC7A 5T57A 1I5RA 1MP0A 3JQAB 1G1AA 4XWYA 1ONNA 3H9EO 3P5SA 4XYGA 2WE7A 1X1EA 4WCFA 3PXXA 2F00A 4Q3DA 5T5QA 1HSZA 2ZYAA 3UCXA 2JD0A 4PRKA 4PLZA 2GYYA 4II2A 1AUPA 3GDOA 5JAZA 1HT0A 1LLCA 1ZEJA 1H6AA 4IINA 1KEVA 2X5JO 3SJUA 4ALIA 4E5KA 3QIVA 3ZWMA 2WTBA 3CZRA 1BW9A 3TL3A 1BRMA 1SNYA 2AG5A 3U49A 3JQ8B 3ZWXA 4DREA 2PKQO 4IS3A 1ADGA 3JQBA 3VVBA 5L53A 1B26A 2ZTVA 3V2UA 4OKNA 3GAZA 4MVJI 1Y8RA 1F12A 2Y1DA 2BGKA 5LDGA 3E5MA 1U28A 4R68A 2VOEA 1MFZA 2WD7B 4BGEA 1QR6A 4DMMA 4J90A 3TJRA 4UAGA 4G5HA 4YDRA 4N5NA 1L7EA 3V1YA 4OL9A 5CG1A 3DTTA 1MLDA 1Z82A 4O6VA 2EV9A 1E7MA 5F1OA 4BV8A 1BDBA 5IN4A 1EQUA 3I6IA 5DULA 3GVPA 3WSVA 1Z7EA 3QWAA 1ZFNA 4E2WA 4RVSA 3AI3A 5TX7A 4C4OA 1N7HA 4PFJA 1NWHA 5L7YA 1LI4A 1IZ0A 1UXIA 4FQ8A 1E7RA 3AK4A 4Q39A 3JQCA 2JHFA 4Z9FA 4NIMA 2YJZA 1IYZA 1CQJA 1AE1A 3A9WA 4UEOA 1UZMA 3IQDB 4Z3KA 4HXYA 4PLYA 1QYDA 2Q3EA 3RU7A 3WFJA 5JYEA 2R00C 3L77A 1EDZA 3ENNA 2EF1A 1F06A 1HDGO 1I36A 4PG4A 2Q2WA 8ADHA 1VJ1A 4FCCA 5C7IO 5IZ4A 3U4HA 4D7AA 1BVRA 1WMAA 3PYLA 1E3EA 1FDVA 4PG7A 1X1TA 3E48A 4WCDA 4YVFA 5GZ6A 3JYQA 3UOGA 3ZHXA 1KBZA 1HYGA 4CLEA 3AI2A 4E21A 3E9QA 5U9CA 4W9NA 4IXWA 1GQQA 3DOCA 2OO5A 3PJGA 4KUGA 2OL4A 4RZHA 4CLRA 5L40A 3WGYA 2PNFA 1PL7A 3TNLA 2C29D 3JD3A 4CMAA 3BTSA 1FF9A 2Q2VA 2PD4A 4EJ6A 3FTNA 1ZNQO 5A9SA 3PGJA 1IHYA 1C0PA 1XG5A 1TB4A 5JDCA 1YQDA 4O59O 5FFFA 3RKRA 2OUIA 1FDSA 5KJFA 3UF0A 5KVVA 3QVOA 2X0IA 2Q1UA 4J9UE 5J23A 1IOLA 4AJLA 4RVFA 2JFGA 1N1EA 1B2LA 2FZEA 4B7UA 4MP6A 1XQ6A 3VDQA 4R4JA 1PQPA 5TC4A 1F17A 3KEOA 2DAPA 2RHCA 3ORFA 4UVHA 4NZ9A 5KJ6A 2VHXA 3C7CB 4R1NA 4CQMA 1HL3A 4KUEA 5F5NA 2DKNA 3FNGA 2C0CA 1WW8A 3I6QA 1N92A 1XWFA 4N5MA 4DGSA 1WZIA 2W8ZA 3VPSA 2HO5A 2R2GA 2ZTUA 4R41A 1PJCA 3RUIA 4O1MA 3EW7A 1GD1O 3U3XA 3MZ0A 3KSDO 4RQTA 1NM5A 1DIBA 1B8UA 1LJ8A 2QZZA 1BXGB 4NU5A 1NPTO 5I8WA 2C5EA 2HMUA 4FFPA 4CV3A 1H6DA 1T2CA 3HNPA 4OM8A 5G0SA 1HKUA 4OOFA 1PL8A 4DC1A 4G2NA 3RUHA 1ENPA 2CVQA 3IMFA 3K8ZA 4WGGA 4EYEA 5A5FA 2HMSA 3H5RA 1WLYA 2Z1MA 2DTEA 4OSOA 4MVJE 4BKQA 3OJ0A 2QRKA 5DF1A 4DC0A 4LW8A 1XKQA 3DBRB 3H2SA 3GMSA 3G1TA 3KYDB 3QA9A 5JMPA 1IPFA 2DLDA 1R0SA 5A3VA 4CLHA 3D3WA 3GVIA 5K6AA 1NVGA 2OZPA 4YJDA 3PIIA 1GQYA 3NYWA 4GL4A 1E6EA 2ZYGA 4YBZA 2Q4BA 2O48X 1U8XX 2OXIA 3DBLA 3RVDA 1ARZA 4BNFA 4YR9A 3LDHA 3RUDA 1Z74A 3OMLA 4YEDA 3B20A 1ADBA 5I9LA 1LSOA 1PZEA 1PTJA 4P4GA 4BNTA 5KVQA 2P5YA 1K6IA 3MJSA 3QRWA 2AMFA 1H2HA 1U3UA 3I9MA 4XRRA 4E2XA 1SC6A 3NTQA 1AGNA 4HP8A 4NBVA 4L76A 2E48A 2ZB7A 4AJOA 1SEVA 1U1IA 2VHVA 4LSWA 4GSLA 1V3VA 2O3RA 4D45A 3RQSA 1JTVA 2Q99A 1TVEA 1UZNA 2X0NA 4ZQGA 3DXFA 4NK5A 1WVGA 3PWKA 2BKAA 4U6QA 3UUWA 3H9GA 4Q3AA 4L4XA 1BDMA 3VH3A 1G6KA 4ALKA 3P19A 5COQA 1GV1A 3HWRA 3UKOA 3ABIA 1E77A 4OOEA 1S6YA 1ZIDA 3MJEA 4C7KA 3L07A 5A06A 1CERA 3GGGA 3A28A 4MIEA 2GZ1A 1XELA 2IEDA 4GSKA 4I9NA 1PJ4A 4BMSA 4JBGA 1C1DA 4QT0A 1U7HA 4YPOA 2Y05A 4J3FA 2AW5A 4DQXA 1ZSNA 2FN7A 4XKJA 1LNQA 2X0JA 3GHHA 4IJUA 2A94A 1DAOA 3AFMA 3GPDG 3M1AA 4XQGA 2DTDA 2O2SA 4ZQBA 4BNMA 1XU9A 5JW6A 4PLWA 3AU9A 1PJBA 3ZWAA 2CFCA 1TLTA 1PJ2A 2RH8A 4GVLA 3KYCB 1E3WA 1PZGA 4GAEA 2B36A 1VKNA 2Y93A 3JQGB 2PD6A 4CQLA 2CMDA 3ZWYA 2LDXA 3FR8A 2VT3A 1I3MA 1PS0A 1Q0HA 1BWSA 2AXQA 4AL4A 3ZW8A 4GWKA 3AM5A 3LLVA 1DLJA 8LDHA 4DYDA 3D4PA 3NV9A 1E1KA 3SEFA 1HXHA 3VZQA 2IZ0A 1E3JA 3PWZA 4HNHA 3AY7A 4BNKA 1PS9A 2NVWA 3CMMA 2VYVA 3F4LA 2GN9A 3GG2A 3PHJA 3OETA 3ZWBA 2J3IA 1HDXA 4IDGA 5EN4A 5GZ3A 1GCUA 4OXNA 1G0NA 3SBOA 4DLAA 1UP4A 3M6IA 4K9DA 3HN2A 4E32A 4BO6A 2GUGA 1X7HA 4WLFA 5DOZA 3NUGA 3WLEA 4IDAA 1UDCA 1YOVB 1NFRA 4E4YA 2C7VA 1N5DA 1I0ZA 5DCWA 5TT1A 3L4BA 4JROA 4NQZA 3WR5A 4AICA 2OBYA 3IJPA 3I9KA 1MXHA 3D64A 3VZSA 5JE8A 3ZCXA 4BNUA 4IGFA 1CQIA 2FPPA 1XA0A 3ZV3A 4FR5A 1C3VA 3FPCA 2CDBA 3KBOA 4M54A 4RDHA 1MB4A 3H65A 4BNJA 3EHEA 3GNQA 4XR9A 4GMGA 1N9GB 3G3EA 1PJLA 2PY6A 4FD3A 4CUJA 2Y0EA 5EPOA 1RWBA 3HHPA 4YT2A 2IZ1A 3H4VA 4YJHA 4CUZA 5T67A 2I3AA 4ZJUA 4HWKA 4BNLA 4AJEA 3DMTC 1QV7A 3QY9A 3HE3A 3BMOB 3W8FA 5TIIA 4TROA 3JQ7A 4ND4A 2X7HA 1D7OA 3HADA 1LDBA 1DSSG 4PVDA 2VUTA 3H6KA 4B7XA 3JQEA 4RF5A 5FYDA 1LBEA 4GX2A 1OBFO 4RGBA 4TZTA 4BO2A 3GGPA 4QSMA 1H5QA 2F1KA 4XGKA 2QG4A 4KDFA 2I67A 3KETA 1HEUA 4YQZA 1HE5A 4BUCA 1EK5A 2YHIA 2IYOA 1XHLA 3QW2A 1MX3A 2VQ3A 2X22A 3VDRA 1X13A 3WTCA 1YQXA 3OF2A 3L0DA 1CIVA 3E03A 3OBBA 1FK8A 3VPGA 3DAGA 3JD4A 5L4LA 1PWZA 2P4HX 4NBRA 3UXYA 1I3KA 2BFOA 4DQVA 3TSCA 2OBNA 3D4NA 4HADA 4D42A 2PR2A 4PGFA 3DHEA 2NADA 3MJVA 3ON5A 3F5SA 2TMGA 2HAEA 4I5GA 5L9AA 1OC2A 5GY7A 2B69A 2Q4EA 5EMHA 1PZFA 3RI3A 4DIBA 2WYWA 5A04A 1V3UA 3ZNNA 1LSSA 4B8ZA 3VZPA 4CPDA 2VNSA 2POQX 1MV8A 1LX6A 1RPNA 1Z75A 2NVUA 3Q3CA 4YRAA 1ENZA 1EVYA 1MXFA 1RYDA 3WJ7A 3K31A 2NU8A 1D1TA 3WGHA 4R9RA 1R12A 1IE3A 3EK2A 4HKTA 3TOXA 1SEPA 2XF8A 3JQ9A 1UR5A 4L75A 3ZV6A 3GQVA 5L4SA 1MFPA 2EJWA 2NTJA 5L7TA 5HBRA 4X54A 1DOHA 4CMJA 1Y9AA 3GZNA 1TT5A 2JKVA 3FNEA 3PJFA 3GRPA 4RF2A 1ZEMA 1H6BA 4KP7A 3ICPA 3WSWA 3K73O 3R0IA 4AJNA 4Y6SA 3I9JA 2HU2A 1YGYA 4P4NA 3V1TC 1U3TA 4HFNA 5CAEA 1NAIA 1LRKA 1QP8A 1QYXA 4J0EA 1NHGA 3OSUA 4Z0TA 4FC6A 3C7DB 3WGQA 3JQ6A 3PYMA 4TKMA 5JAIA 1LLQA 5B4VA 1KC1A 1R4NA 2Y0CA 1K6XA 3H3JA 2VNAA 5KTKA 5L3ZA 2VTEA 4XYBA 2W2LA 3E6AA 4YAJA 2ZTLA 1P74A 2UDPA 4WPGA 4YYZA 2BI8A 1E3SA 3PGXA 4YXFA 2PZJA 4GVXA 4D3DA 2YFQA 3GLQA 3UGKA 4GPD1 4FOOA 3BXXA 2IXAA 3MOIA 4NBUA 5TJ9A 2PFGA 3K2EA 1LQTA 4GKBA 3OEYA 5DDIP 5JAMA 4OIMA 5HRUA 2PLAA 3VC7A 1NVTA 4PN3A 3U0BA 2PTGA 3GGOA 1I24A 2VCYA 4I9HA 4K26A 3HB4X 4KOAA 3ZH2A 1YS4A 5I9MA 4DPMA 5A03A 2DUUA 1N8KA 3ZHYA 4XJSA 4EI2A 4U0KA 4IZIA 1NPYA 3LU1A 4IQ8A 4N5LA 4B8WA 4YQYA 1JKIA 1XDWA 1JA9A 3WQQA 4YACA 3SLKA 4NHEA 4XX0A 1YKFA 4GKVA 1I10A 4KZPA 3L4SO 4YT5A 1E7YA 2BFAA 4Z3DA 1ADFA 4FFLA 2VYNA 5JBIA 4XCVA 1U5AA 2HRBA 3DZKA 1JKFA 4OGWA 2X1HA 4PZDA 4CLOB 3WBFA 4EZBA 4YAIA 1UP6A 4LN1A 3QWBA 1DRUA 1P1FA 4P8RA 1JW9B 4AJ1A 3OA2A 3TOZA 5EQFA 4CMKA 4WOJA 3NKLA 4J1SA 4P22A 4BQRA 3ZGYA 1JQBA 4IS2A 4XQ9A 1ONOA 4WCFB 4WCFC 4ZVVA 2NUAA 4PG8A 2XXJA 4TRRA 2VWGA 2P9EA 3AUSA 4BOYA 4Y6PA 2VWPA 4J16A 5I8ZA 4CM7A 1ZW1A 3ZZNA 2V6GA 1B3RA 4CMCA 2GLXA 1HYHA 1VC2A 2ZTMA 2OFPA 3ULKA 2J5KA 2CVZA 3KSUA 3GT0A 1MC4A 1NQOA 4RJTA 1J4AA 3GF4A 3WB9A 2HK7A 2PGDA 3NTOA 1H93A 2NU6A 2NTVA 4ZRNA 3ZDFA 4H3VA 5CPBA 1Y8RB 4J4BA 2O7SA 3I5MA 4S3MA 1MA0A 3MTGA 5T6BA 1PGNA 2ZJ1A 1B8VA 1F8GA 3OJFA 4FBGA 1OFGA 3QWIA 4LCJA 4UULA 4HFMA 4WEQA 3WQSB 5JY6A 3RBXA 4NFHA 3ZHZA 1WAMA 3B1FA 2AEMA 1ZXBA 3KLPX 3IUSA 1C0LA 5EJ2A 5JS6A 4D46A 1HDYA 1KVRA 3NT5A 3ZWPA 4L0QA 2J3HA 4IMPA 4DRYA 3DZGA 3BTUA 3LVFO 4BNZA 4J7CA 3L9XA 4IJVA 3TZCA 4IQ0A 3EDMA 5TSDA 1JU9A 2NTNA 4B3JA 3ZWOA 3INRA 2EG9A 2IDZA 1I3LA 4E33A 1P1RA 3VVCA 3W1VA 5F5LA 4NJMA 1LSUA 2E82A 5LC1A 2GNAA 3GFGA 4ZU3A 1XSEA 4HUJA 4YJGA 2W90A 4LRTB 1B8PA 1DIHA 3ZNPA 2UVDA 5IDYA 1X0XA 1YE3A 3WJAA 3QQPA 4CMBA 1CDOA 4HFRA 3LQFA 1XCBA 1ONPA 2IE0A 4JJGA 4J1TA 4MP8A 3ROMA 3BHIA 3JQFA 4RL6A 5CP8A 1RM0A 1H0KA 5CDYA 2Y0DA 1OMOA 4IGEA 4K28A 1PGPA 5CPFA 4B4OA 3D1LA 4OSPA 4PLPA 2H1SA 4BIIA 3LZ6A 1HYEA 1HRDA 2C20A 3ZU3A 5JMWA 4D44A 1V35A 2PH5A 2PGJA 2JAPA 2PZKA 3DFUA 4CLRB 3EMKA 1E7SA 4FSHA 1NTOA 3IUPA 4QEDA 2YV2A 3S2IA 4ALNA 2J6IA 2NU9A 1DC3A 1Y5MA 2AEJA 3QJ5A 3BAZA 4FGWA 1A9YA 5A9SB 2HSDA 1U4OA 4UVIA 3JYOA 5IJZA 4MVJA 1C0KA 4I5DA 4CMGA 2I99A 3ANNA 4IDCA 1E1MA 4BO3A 3MEQA 2CF6A 3RC2A 4BGVA 5JCJD 3TZQA 1GPJA 4I8XA 1M67A 4CR7A 3RKUA 4CMIB 3TL2A 1EQ2A 1VJ0A 1Z73A 3C3XA 4R3NA 1M75A 1J5PA 3I9OA 1ZZEA 5BT9A 4BKUA 3TQHA 2B0JA 3VH4A 4CQMB 3GFBA 5G4KA 3U4CA 4ALMA 1VI2A 3AJRA 4IDEA 3NT4A 2JFHA 1Q0QA 5I7FA 1H2BA 4AJJA 3RCBA 1X7GA 2WEKA 2GN6A 5DP1A 3SX2A 4CM8B 2J3KA 1GUYA 4ZQFA 3WIEA 1UAGA 3W6UA 1HF3A 3NGXA 2J5RA 3AY3A 4RLSA 3C1TA 4DYVA 1PIWA 1I32A 2C5AA 2IODA 3DZHA 4CMEC 3JQAA 4BGUA 1WXDA 4PG5A 4Q9NA 5B4UA 3VOSA 4WNCA 5KVCA 2VYND 3PYXA 3G49A 1E7QA 3VHRA 2UV8A 5JSFA 2WWRA 3B6ZA 3VTZA 1ZK4A 4XJTA 1QYCA 1T4DA 3GH3A 3K6JA 4NJOA 1JDJA 3RASA 1P0FA 2VRCD 2BGMA 4UVEA 4BB6A 4CM4B 4Z9YA 3OICA 1VE9A 4XQEA 2QW8A 5L51A 4UUPA 3TRIA 4JCOA 5KCZA 2JCYA 3E18A 1VRWA 5AXCA 3WGGA 2B35A 3MJTA 4AJ4A 1UAYA 3JQ8A 4WUVA 1E5QA 2I66A 1EVIA 4RLHA 1RM4A 2GO1A 3H9QA 4KWIA 4JX8A 3S2FA 1ZK2A 2BFMA 3LT1A 3I9NA 1GADO 3EVTA 4EEXA 4IM7A 4MVJH 3FR7A 5KKAA 4F45A 5JFOA 3F1LA 5IN5A 4B4WA 1NNUA 4E5NA 1T26A 4DLBA 3JD2A 1DBVO 1T2FA 4A03A 5F21A 4IJKA 5CDSA 5KWEA 2ZIZA 3ZV5A 1ZK3A 2B5WA 5DT9A 3LSYA 3PTZA 2EIHA 3B1JA 3AM4A 4A73A 4E12A 1P77A 4W82A 3RFVA 4BHTA 2GF2A 5ILOA 5LCXA 3G0OA 2PKQP 1P31A 3DL2A 5F1PA 3STHA 4AVYA 5DZSA 1VJTA 1X14A 3OJEA 1HDZA 5AXBA 5EIOA 3WXBA 4FJ1A 3TFOA 4BNIA 4XIJA 3G79A 2EXXA 2BGLA 2G5CA 5G0WA 1K6JA 2YHUA 3TZKA 3GY0A 3D3EA 4WEOA 1DRVA 2R00A 1ZMTA 2PH3A 1T1RA 4W99A 1Q0LA 1SMKA 1U7TA 2P2SA 1FXSA 1UXHA 4RCVA 1C1DB 3FWZA 3QVXA 3CPSA 5DP2A 5ILGA 3T7EA 4CMHA 1HLPA 4K6CA 4MOWA 2XAAA 2EKPA 3NDJA 4FC7A 2A4KA 5ER9A 3BMNB 3R1IA 2DPHA 1T2AA 2ZK7A 2I5PO 1UXKA 5A5EA 5FI5A 1RM3A 1T2DA 1EBFA 4IQGA 2YQ4A 3FN4A 2YUTA 3E9MA 4U5QA 5TF4A 3RIHA 4RVGA 3WWYA 3GUYA 4JGBA 3TFQA 3C7AA 3LLSA 5C7OO 3C8MA 3T7CA 1KY4A 4KUHA 1O0SA 4DLLA 3H3FA 2YW9A 2B83A 3VH1A 1E3WB 3X2FA 2P5UA 4PZCA 4EUFA 2NQTA 1SBYA 1LSJA 4HV4A 4J6FA 1LA2A 2O3QA 3W4IA 3N58A 4RVUA 1UXGA 3VPFA 3RFXA 3GK3A 4BB5A 4IIVA 5B4TA 1CJCA 1T4BA 1EE2A 2RH4A 3ZHBA 2G0TA 2ILTA 1DXYA 2V7PA 3WICA 1CYDA 3CSDA 2X9GA 1Q7GA 2EJVA 4TVOA 2EW2A 3JYLA 2GDZA 2J5QA 1VM6A 3FI9A 4XDZA 3O38A 5H81A 3JV7A 5I7EA 1RJWA 4CUKA 1R4MB 3UH1A 4BGIA 3O03A 2FRDA 4BO8A 3WGZA 3U5TA 3INTA 1U2GA 2ET6A 5HA5A 3WG9A 4PG6A 2DVMA 2E6UX 3VKVA 4BNWA 3LYLA 1YBMA 4DMLA 5I7VA 1HLDA 2FHSA 4EUHA 2NLOA 3C1OA 5ITVA 3QSGA 1SO8A 4R01A 5ES3A 2VWHA 3OECA 3AUAA 3Q2KA 4BMNA 3GDGA 1RM5A 2DT5A 4I5FA 4LGVA 3H5NA 5JNLA 4L73A 4M86A 4ND2A 4Q3NA 1ZJYA 1Z45A 2EHDA 1W8DA 4Y67A 4BNVA 1JAXA 3NDIA 4L8VA 3KVOA 1BXGA 3PZRA 4L74A 4DTIA 3I23A 2BD0A 4D3FA 1ISHA 1HDOA 2P9CA 3FBGA 3DHNA 1R15A 1NP3A 2X9NA 4J43A 4Z0HO 5JO9A 4E13A 3LK7A 3DBHA 4BS9A 2X9VA 2GCGA 2X6TA 1KVSA 3PJDA 4XR4A 3WIDA 2Y1CA 1QYWA 5COBA 5JDIC 3H2ZA 1QRRA 3UFXA 5EINA 1I3NA 2NNLD 4KQXA 4YJHB 3WFIA 5CEFA 5U1PA 4ZICA 4LVCA 2DBVO 1DHTA 3NAQA 1C1XA 4QUKA 1DJQA 3DBRA 3QP9A 1LDYA 2P9GA 3JQ7B 2WYUA 3KYDA 4FFOA 2GR9A 4R5HA 1MG0A 4XD2A 4UVDA 4LK3A 3WTBA 3I4FA 4RVDA 1Y1PA 5H83A 1PL6A 2H5LA 3AW9A 1F8FA 3TDKA 3RSHA 3IC5A 1ZSYA 2V6FA 3SC6A 3TZHA 2HJSA 1ULUA 3WLFA 5HM8A 3AI1A 1PGOA 4CM3A 3EYWA 1UP7A 4GLLA 1DC4A 1XLTA 1JLLA 4GX0A 3G1UA 4I5EA 3QVSA 4JP2A 3A06A 3B1KA 3I4CA 3RWBA 2FR1A 4FDAA 4FFMA 2FR8A 2WMDA 2O23A 2B4TO 2QYTA 5BSEA 1TXGA 3GHYA 3I3OA 2O4UX 3H7AA 3ZV4A 4BO7A 1MG5A 3IAHA 2GN8A 4E3ZA 3PIDA 4OQYA 4IMRA 2Q45A 1PQWA 1E6UA 1JWAB 4CQMD 1UDAA 2UYYA 4BKPA 3IJRA 3AY6A 1YVEI 3HUDA 1PJ3A 4DIFA 1D8AA 3GZ4A 2CDCA 1V0JA 3OJOA 4IDDA 3DO5A 3GDFA 2Y99A 1E7WA 4CV0A 1CWUA 1ISMA 1ISIA 4NFSA 4INAA 4U7WA 2IYPA 2NVUB 3DWFA 2O3UA 3KUXA 4TRNA 3VPXA 3AOEC 4BV9A 3BTVA 4I9UA 1P33A 4FN4A 4AJHA 3EAGA 2JCXA 2W98A 4XYLA 2FPGA 4EGFA 4J1QA 4GLOA 4ALLA 2PZMA 4WJZA 1GU7A 4PZEA 4YA6A 4CV1A 1YB4A 5AXAA 4W7IA 1NYTA 5JYDA 4YTEA 3WQRA 2NVBA 5JO0A 1Y7TA 2VN8A 3V2HA 5C7LO 4MKZA 2UAGA 4FFNA 4R5MA 4TZKA 3KYCA 2JHGA 5AVOA 5C37A 5LDHA 1D4FA 4M49A 3JQGA 5T8KC 1O6ZA 1NXQA 1IUKA 1DIRA 4HY3A 3PQFA 1VL0A 1C0IA 3Q1LA 4XB1A 1T2EA 2OP0A 1I30A 3IIEA 1R37A 1W0CA 3E8XA 1VL8A 1YWGO 5A9RA 1AN9A 1Q1NA 2ZQZA 4H16A 5MDHA 5DOVA 3LT2A 5IZCC 3ONFA 1R4NB 3SC4A 2O7QA 3MTJA 3UN1A 1R0KA 5HWSA 4BO1A 1ZUD1 3L6OO 5G2OA 5CEJA 3UHAA 3MOGA 1WMBA 3UICA 1NPDA 2BRUA 3WGIA 4FW8A 1EZ4A 1P9LA 2W2KA 5CDTA 1JWBB 1J6UA 2GASA 1B0AA 2NSDA 3BHMA 4MKXA 1B15A 2OORA 4WLNA 3ZU4A 2PZLA 5IDXA 3KHUA 1YOVA 4AJPA 2AQHA 2CF5A 4E6PA 5MGBA 4PLFA 4IUYA 4B7CA 3ADOA 4CLDA 2HMWA 3FNHA 3JQDA 1NX6A 1YRLA 3ZU2A 3R3SA 3ZI0A 1EFLA 4RO0A 4D41A 3LT0A 1ZVMA 2C2XA 4TQGA 1P45A 3IP1A 3WGTA 4CM5A 2GZ2A 2Q2QA 4IZHA 4C7JA 1KYQA 4D3SA 3PQDA 3N7UA 1D3AA 2D0IA 4PLGA 2X58A 5CDUA 1H94A 1IHXA 3IOYA 3QHAA 2O3SA 3Q6IA 5CG2A 4EEZA 1HSOA 1DHRA 1H9AA 3U4DA 3P7MA 2GRAA 2ZQYA 2BF7A 3HQ4O 4J4HA 3RUFA 1K3TA 4Q3CA 3RAJA 3DMTA 1PEDA 6ADHA 4J91A 5I9NA 4NK4A 4AG3A 2EP5A 3BMOA 3LF2A 3ZW9A 2O50A 1WDMA 1KC3A 1QSGA 1SCUA 4NPCA 4OMUA 4WKGA 1DFIA 2X0RA 3ITKA 5THKA 2VUUA 3FSRA 4TRMA 2ZJ0A 1DFHA 2E37A 4UVGA 3ETEA 2QRJA 5KVSA 3RFTA 3RU9A 2A35A 3TWOA 2VHZA 2VWQA 4JN6B 3WOHA 3MJCA 1SB8A 2HUNA 1ZSVA 1Y6JA 2DM6A 4QECA 1ZJZA
chains in the Genus database with same CATH superfamily
3B78A 4HPWA 3MWYW 1VMKA 4E2ZA 3P2OA 2OD2A 2WE8A 3JZFA 1E2UA 1OAKA 1USIA 4GP6A 3TLKA 4Q66C 3U39A 4BX0A 4G81A 2VRWA 1EUCA 1RWKA 5EI5A 2VYVD 4MQFB 7ADHA 5DNAA 3A4VA 2D00A 3THRA 2OLKA 1XEFA 2I6TA 5KNBH 2PX2A 5FL3A 2QRLA 4YJFB 3UM9A 5KIAA 4U7PB 3GRVA 2G07A 2I29A 5CRIA 4CCYB 3QX8A 2IOYA 3BGDA 3O26A 1DTEA 1PWXA 1RKBA 2ZSUA 4OI2A 1Z5UA 4LUCA 1ZHFA 5BNIA 1JKJA 1XTBA 4I7EA 4GECA 2I87A 4F5DA 2WAYA 5D2CA 4EYSA 1L5QA 3VSAA 5CA0B 1I2ZA 1GN8A 1TRKA 2R8YA 2IS1A 4H6PA 2ZGVA 4IIYA 5TY0A 4Q01A 5AM3A 3NXSA 1YXMA 1YFKA 4C08A 3FMFA 3KSMA 4OYRA 3MC1A 1CS0B 1R0RE 2O8EA 1AK9A 2HQ1A 2J7PD 3O1IC 1F0NA 3ES9A 2UUPA 4LCEA 3ZJ4A 3VQTA 5HS6A 3AIKA 3QBTA 1KEKA 4Y6GB 2QTVA 4YWJA 1P5ZB 3JD1A 5EPEA 2YKGA 1SAYA 2R8EA 4A15A 4KQWA 3W5AA 4ARCA 2IGBA 3QWFA 4DV2B 1SC9A 4RX1A 4YDSA 5EFZA 4MDEA 2AHRA 2QN6A 1P9OA 3PNPA 4YAUA 2UXBB 4F86A 4U7HA 3HJUA 4K9RA 2NP6A 3U80A 1ML3A 2B34A 3KQSA 3KV1A 4L5BA 2DU8A 4N8DA 4OHOA 1YBAA 2KLBA 2OCLA 3DZBA 3PFKA 4KTTE 2X0FA 2XMSA 4ZI7B 4YFVA 4UUNA 1XCOA 1KZ4A 4Y2UA 1QGUA 1ZP6A 1YI1A 5DX8A 2JFNA 3OMWA 1EXVA 1XTJA 1FEZA 1CR1A 2IF0A 2JGIA 3GQBA 4WLUA 2BELA 4CL8A 1XDUA 4GBJA 1M54A 1VHDA 3N74A 3OLWA 1F3LA 3HU2A 1QE0A 1TFUA 3BRSA 4M1OA 1TM7E 1G5TA 1HG1A 1PJTA 3T95A 1GUFA 3FF4A 3F6EX 2X2EA 4G07A 3TZ6A 4Z0PA 4A8PA 3RAGA 2MSKA 2QTAA 2QRGA 4JUCA 3QTBA 3SYRA 3OKCA 2NT3A 2JLRA 4BNHA 2OZVA 1XCPA 1VMAA 4LBYA 3U61B 5EIXA 3K9HA 4CR6A 5FX2A 1NNEA 5DBHX 4EF4A 1Z6ZA 3GMTA 3IDSA 4XQCA 2WF5A 1LLUA 2Z0MA 2PX5A 5IEBA 5J1TB 2NU9B 4LISA 4UMEA 5TPZA 1VSUA 4FINA 2P68A 5K2MA 2BGTA 2HJWA 3SLGA 3X1WA 1KWGA 4FS8A 3FUVA 4TTVA 4I4TA 3GEMA 4OA5A 3H1TA 2N47A 4MARA 3GV0A 5KREA 4BLVA 3OOEA 2ZRBA 3L6DA 2C61A 4EG3A 1ID1A 4Y18A 1ACMA 4V02A 4ESEA 1H0SA 4L7QA 1CUCA 1SUCA 5F77A 5EWMA 8OHMA 4J94A 2C92A 4AK9A 1TLLA 3E35A 1L5HA 2W2NA 2DF8A 4XOIA 3TKLA 1XI2A 2VJPA 1D5WA 1E79D 4MHTA 4O0MA 4JVLA 4UC0A 2O8FB 3VGJA 1UT8A 2CXXA 2O6LA 1OLUA 1ZCFA 2G4LA 3DE1X 2YR0A 3ZBUA 3L1UA 1KKLA 2ONKA 4H1UA 3KG2A 5E7QA 5KOJB 2NZXA 3AXSA 3WX0A 3F5QA 3BF8A 1S7CA 1VKJA 2E1PA 2ECQA 1DTWB 3TMAA 3UMGA 4E31A 3CZ9A 4M21A 3D7SA 1E9BA 2FQYA 5B2ZA 3R9WA 2WNHA 1IOVA 5AKGA 1P2UA 4KDCA 2VUSA 3X1ZA 4ZHSA 1BMQA 3ONVA 3PC2A 4MAAA 3ICOA 1AS3A 3N5KA 5JZVA 1BXZA 3FM9A 4FLMA 1DBSA 3R41A 1UANA 1RHMA 3KE9A 3W4JA 1EFKA 5AVVA 1WW3A 3N0RA 1DEKA 1E0KA 3SZRA 3FA2A 2BI7A 1PF7E 4NZPA 4Q1CA 1W6UA 3KM0A 5LQAA 4K40A 4C43A 2JGDB 4HJRA 1Z7WA 2IUTA 4U7JA 1J49A 3HP7A 2ECOA 2ZPUA 1L1EA 1T35A 2IVZA 3RS3A 1ULTA 3N87A 1UEXC 4Q1AA 5ENDA 3IP3A 1MENA 1MCZA 2OO5C 1OFTA 1M1ZA 2F8LA 1OFVA 1LBTA 2WPDD 3ZD8A 1FTNA 3FGOA 3DOIA 4OJTA 1TC2A 4AZWA 1TAGA 5LL6P 4PC7A 4R9NA 2HKIA 2NP7A 1NJ1A 4Q7JB 4H18A 2BE7A 4OKIA 3ZLBA 4N54A 4AWBA 3HXPA 4HEJA 4RGVA 5FPQA 4B2IA 3HBMA 3GVCA 3K9LA 4M83A 2M6SA 1L5LA 4Q4JA 3ZHSA 2JI4A 1XD2A 3GVHA 3OCJA 4ZYUA 3GRUA 4LXIA 4TOIA 5JARA 1CUJA 1QH1A 3AF3A 1CU1A 3QKTA 4N5IX 5D6OA 3PRKE 5AUQA 3RC7A 3WNCA 5AOCA 3FTFA 2B0CA 4X64B 1BDHA 4JIGA 1MQ9A 3WMGA 2JBHA 2AQKA 5KYXB 1LEHA 2DC1A 3KLMX 3MGKA 3VKUA 1JFRA 5K05A 3LOUA 1NUPA 3AHGA 3NJ8A 1ZVVA 5LXTB 3DFZA 4O4LF 4J7XA 4ZRMA 3V1UA 5CFRA 1SCNE 1ZMOA 4PONA 3ZR4B 1Y9EA 2A9PA 1RI1A 1Z0FA 4KWHA 2HHHB 2EX0A 1VOTA 1T5SA 4LHWA 4BLQA 1NW5A 1U8ZA 4WASA 1FW6A 2AR9A 4DXAA 4G0ZA 5FB3A 2WHQA 3CRMA 3BDAA 3SIXA 5EUBA 4BNGA 1KDTA 1P62B 1BMTA 1I33A 4CIYA 5FL7A 3Q3VA 3RFCA 2GSDA 3LCMA 2AFIE 3TI9A 1ZJ6A 2ODPA 5KYWA 4GT1A 4D3ZA 2J07A 2X41A 1ZH8A 3AEXA 3KV3O 1N1GA 3PDJA 4EW6A 4KR6A 3UUFA 2QQ5A 5IVIA 4GR4A 1ZIYA 4XB2A 1AX9A 4BKOA 2ZS7A 1YR6A 3W8EA 3QPWA 2P0AA 3C3KA 1W7AA 2R6DA 2ZUVA 3DC2A 1RHRA 3DMHA 4X84A 3AYXB 4DLYA 9ABPA 3AESB 4TMYA 4E22A 2HSEA 4RKFA 5EA2A 2PFKA 4J3JA 5FBQB 1NQAO 2I8AA 1M7HA 3HY4A 4H7IA 1KETA 1QLHA 3LQKA 4TYPA 5J5VA 4AAYA 3ONEA 3Q2IA 5LOVF 1MUUA 3CA8A 3LY8A 3Q7TA 3UJ9A 3F9IA 2QAJA 3OOYA 4J49A 1MT3A 1O4VA 1JAIA 2ZRJA 3EEOA 3HPQA 4JP1A 4M37A 2C7GA 3EPHA 2B4QA 3SXUB 1ZK0A 3UAYA 2Z1NA 1TA4A 2G6TA 4RPHA 3BXFA 2HBZA 4MV3A 1YB7A 1NUHA 1TYDE 3ENVA 2PU5A 4WD3A 1XJCA 1A9PA 1GAEO 1HNNA 1I2CA 2B5VA 4JLMA 1AKWA 4LJAA 5HRAA 5JROA 1YZLA 1JHDA 4GS5A 1ZIOA 4FLEA 4FZ3A 4Q16A 1N0IA 5DGCA 1W5BA 2G28A 2VT2A 4XZ3A 4A10A 4C03A 4R2LA 3R0QA 1TU3A 3AP2A 2E6KA 4BP9A 3AHFA 4MDFA 3WL5A 4ME6A 3KSBC 2G9NA 4HQKA 4C5BA 2JW5A 4BEWA 2LDBA 5DNDA 3KT3A 1Z13A 5ERGB 2IUYA 2A84A 4W7HA 2OQRA 3DBLB 2NPIA 2YZMA 1J25A 2WI8A 1OI7A 2RAPA 3O91A 4MKRA 4EHLA 2P2ZA 2DQ4A 2SNIE 4EW2A 2AJ8A 4WK2B 3MB5A 4YUXA 4MR7B 3AWIA 3CEHA 3DBVO 1ADCA 2QVGA 3R3ZA 3HVHA 4IBOA 3WV4A 1ZU4A 1O9HA 3EGDB 3WZMA 4B35A 1TA0A 1N2HA 4ALJA 3GLFA 3G68A 4XXHA 3UMSA 4I14A 1FFWA 1FP4A 4EQ6A 5IANA 2DWOA 4YP7A 2VNJA 4YT8A 3HXOA 4UBIA 1J39A 4LMAA 2IZOA 4ZT6A 2OBFA 5EVJA 1T8RA 2JLBA 3D4LA 5KNLA 4XIYA 4C05A 2AE2A 2P9ZA 4K6KA 3V33A 5ICSA 5CIYA 1I1OA 2K5UA 2HFJA 2ZB8A 3KRTA 1NKTA 3OP4A 2OYRA 1ZC4A 3ADPA 4AY3A 1EFVA 3ANLA 5AI0A 3V34A 4EF6A 1DBWA 3BQ9A 3CF2A 3KOXA 5LA6F 1SXJA 4HVLA 5HKBA 3OZ7A 5KPDA 1OWPA 2BYTA 4XD7A 2Y71A 3ITNA 3KVRA 5DSTA 1TK3A 3V5NA 3ZE0B 1R9MA 1PW5A 2Y0BA 4RMJA 2XOKA 4PY2A 1V1RB 3B2QA 1A71A 1IN5A 1X77A 4MW5A 3BZWA 3VO2A 1WU8A 5A9TA 3O47A 1PR3A 2GD2A 1QZTA 3I39X 4G9EA 3S2YA 2VHTA 1W73A 3LQRA 4RJTA 2HCTA 3TUZC 2EWMA 5K8LA 1DIGA 1REQA 1NI5A 4FR2A 4LVUA 4PX3A 3RUAA 2FP4A 4LBVA 5I7SA 1TF7A 2PWYA 1R6BX 3AUXA 3EQZA 1J24A 4WKOA 3ZCUA 1R7RA 4IG4A 3OQ1A 1ANKA 3DAPA 4BVHA 5H9VA 1XZPA 2XB8A 5G0TA 2I1WA 2PUEA 4TZ0A 4FD2A 2CV0A 1FUIA 1WOYA 2PSFA 1F4VA 1ZM2A 3AHDA 4KMRA 1G9SA 1OW3B 3VH2A 3O1HB 2JFFA 1MJGA 1QONA 1TA9A 1XN4A 2PH7A 2VF7A 3IKMB 3R5FA 5EIEA 1UPBA 2J09A 1W6RA 2YWFA 4KMSA 2FOIA 2H0RA 3HLYA 3BQMB 3OMXA 2JLXA 2IJGX 2B92A 1YMVA 1JVNA 2WG1A 1PDVA 1TD1A 1TKCA 3A1CA 1XGKA 4ND3A 3TRFA 2PVSA 4KWEA 5THQA 1E6LA 4O2RA 2Z98A 4P33A 1NR1A 4CM4A 5EP1A 4DLVA 3VOTA 4QXMA 3PRJA 3O75A 4JJ4A 2FCAA 5CM2Z 3RIXA 4ZYVA 2JCSA 3O4VA 3W3ZB 1CT9A 2BP7B 5FLEX 1DPFA 2Q1XA 1GAQA 4JBIA 1G64A 4LY0A 3G8BA 4GC9A 5EZQA 2RG7A 2SECE 1DQPA 3NBKA 5LQMA 1ZRNA 4QDOA 4RV4A 3WAGA 2QQGA 4HQ6A 5C53B 5ADUS 1WPRA 4K1XA 1NFQA 1KZGB 3KQTA 1QCZA 2HEGA 2QZPA 1M76A 1JDUA 1WY5A 5DM4A 1FTWA 5JD3A 3ODGA 2C82A 5F2OA 3F3KA 1Z4QA 2C8LA 1V4BA 4EUSA 3WY9A 4KE8A 1RJ9A 3EGOA 1O4WA 2QSZA 4FKMA 4JLOA 5AVRA 4H7EA 3CVVA 1ULZA 5DNWA 1NLMA 3IA2A 1L9KA 1M2OA 4N18A 1LFDB 5KKCA 1IL0A 2LWIA 4ID9A 1PD1A 2PEYA 4LMPA 3DP7A 1XZIA 1G21E 3QVWA 4LECA 2N42A 2IPLA 3AU8A 5UKDA 3TRKA 2VYCA 1RI2A 1D2RA 2XCLA 4MUXA 2O52A 1ECFA 2O2YA 4WVLA 1DG3A 3U3DA 1W46A 3ZH9B 1ZJWA 2Z6AA 2WU1A 3RRZA 1OYWA 1BE0A 3LDUA 3UMFA 4DJDC 1LC0A 4Y2JA 4F3RA 1F14A 1L7DA 2VHUA 3HP1A 3WKCA 4D0RA 2HDHA 1II0A 3II6X 3OFSA 4MMYB 4M89A 4CKYA 3E53A 4D8XA 2JLWA 3CTPA 2P1ZA 5JTUA 2D0OB 4MP3A 1XFAA 1VPVA 3MF4A 1B0UA 3GT4A 4JI6B 5FI3A 1XFDA 4C1BA 1MZPA 3PEFA 1IEXA 1P44A 4K1LA 2B99A 3DR3A 2F3RA 2VJQA 4EB3A 2IHZA 1DV1A 5F73A 4G0XA 3TK1A 1VJGA 2NACA 4ZAVA 4D9IA 3CT4A 3LHSA 1MOZA 1GN9A 1CB7A 4JYPA 5LP6B 4XM0A 4Y2PA 4C4AA 3DYVA 1RKVA 1YHZA 2C88A 3IUEA 2EGGA 4GO1A 5AVTA 4JFAA 1PZHA 3JQAD 3BRWA 3U4IA 3I52A 5AYVA 3V55A 1NKVA 2CVOA 4BB0A 3JYPA 5LD2B 1UDXA 1U3FA 3K0KA 1ZK1A 5JS1A 2X77A 3AINA 1JAZA 1MORA 2AD1A 2WUVA 3EGWA 2J3EA 3IP5A 5DM0A 4AP9A 3M83A 2HNBA 1QK5A 5KYKA 1G3IA 2AZ4A 2EGUA 3HFGA 3R6GA 4NBLA 5BW6B 3G59A 5BR7A 1ZUNA 1B74A 1AM4D 1YJ5A 1E2DA 3LO8A 3ONDA 4HGQA 1O08A 1VBFA 3CF6R 1WCIA 3PXAA 1LW7A 2BZGA 5IJAA 4XA8A 1IY2A 3PJEA 3T7SA 2QRMA 5FPYA 3OTIA 1G3UA 1IHPA 3C3EA 1B73A 2FSVA 4KHZA 4E5PA 3SJ7A 2FSUA 4DM3A 2P79A 4RIIA 3B51X 3LY7A 4R0VA 1YFLA 3BE8A 2SHKA 2FEMA 3OEHD 4J2TA 1F60A 1CJBA 4G1FA 3L4KA 4D8YA 3ELWA 1E1NA 3U9TA 3GUHA 4YGYA 5FI1B 4AO7A 4G5GA 3S2EA 2J8ZA 1R9GA 1XQ1A 1XMJA 2QAIA 2G70A 3E9ZA 1ZBDA 3P0JA 4BEVA 1E3LA 2H9AA 4UD2A 3NEJA 3O8DA 2FJPA 2ZIAA 3M6UA 5ALKA 1DG9A 1MHPA 3COJA 3LGXA 3ZWNA 1QCDA 2PZEA 1JHPA 3HB7A 3CX3A 1BCSB 1EVKA 3F97A 1MJHA 3PK0A 4AMGA 1OE0A 4ACAA 5C46F 3CVYA 2YDXA 3C6QA 3FAKA 4FEGA 5HTOA 1JTFA 2L82A 1M7GA 2VSQA 4HBGA 3S44A 2Q62A 821PA 10MHA 4XLLA 5BW5A 3GJ3A 3LW7A 5EHQA 1W5FA 2QTTA 3UOAB 4G4SP 5AI5A 3WHIA 1W2WB 5TQJA 2B1IA 5BRNA 4O5OA 3FVVA 2PX0A 3M4ZA 5C8YA 1YZKA 3E7DA 1EG2A 1UUFA 3GPBA 2PX4A 2NO6A 3PRYA 3F0TA 1ZNZA 3LC2O 3FLMA 4CN8A 1JQLB 1QKKA 2GXUA 2XVAA 4MS4B 6NULA 1GYRA 4W7SA 2UUBB 1QNFA 1XVAA 4Q3OA 3TH5A 4BFUA 5CW2A 3DDNA 4GX5A 4QDUA 2QQEA 1XMPA 3QKSB 4NJEB 1EDOA 1S4QA 2B4RO 1T4CA 4ISCA 3SWWA 1LTKA 1N36B 4MMXB 3MYYA 1J0DA 4C4PA 4C0JA 5CLGA 2XQJA 3DMYA 3ND6A 1U7PA 3WNQA 4B2LA 1V8PA 2ZIFA 4Q82A 4DMUB 2BH9A 3Q3HA 4F3YA 4HN4B 5A6SA 4I50A 5BSUA 4ER7A 5BSGA 5CAEB 3GLGB 1JJBA 1BROA 2P0YA 2ZI7A 3GJXC 5IC5A 5DM70 2AI2A 4UW9A 3I83A 4XCXA 4CL0A 5JFTA 4AY5A 1XVIA 2IEGA 4TTSA 1QOQB 1SCUB 1M1YE 4GGPA 4TMXA 5EJ5A 1IIRA 5JEDA 4TVBA 5U4QA 5JNVA 4RMNA 2APJA 5FWYA 2O0JA 2DUWA 1BE8A 4MHOA 1QS0B 3EGCA 3LC0A 1AZSC 3EPPA 2I78A 3M2TA 4KNWA 4HSGA 2QBYB 4PVCA 2ZG6A 3ZGZA 3AQIA 3AEQB 4HTAA 4OMCA 4JOSA 1MGOA 1EXNA 5M3BA 5EZ6B 5KU1A 4ZREA 1V25A 2LV8A 1UBLS 2VHEA 4GWGA 3BWEA 3ZJYA 1OWOA 3UQZA 1R0XA 2ECKA 2I3GA 3H0CA 4G5SA 4UE6A 1K7EB 4AYWA 4WZ6A 4DUZB 5ECWA 3IAAA 2XXAA 4ZU6X 3ZCPA 1L5FA 5DT2A 1QAQA 3CC8A 5JSZA 2XVYA 5E2AA 2JLAA 3T5CA 4ODIA 2WVAA 2YYYA 1U1GA 3ZJVA 1WPQA 1Q3TA 3DDUA 4TKUB 3OZFA 2BEKA 2ZI5A 3OIFA 4NCXA 5AM1A 2O54A 1UM9B 1Y89A 3F6CA 2QUAA 1MJNA 4O4IA 5DGHA 3T7JA 3WL4A 4XVRA 5FBWB 3LDFA 2VBIA 5FKJA 3SKXA 1OFUX 4FFSA 4QDXA 3DL0A 5JS8A 2G08A 4PU0A 3PQ2A 4K9MA 5JXHA 2QRVB 1ZH2A 4UFNA 1AO0A 1DO2A 3WLOA 5HG0A 2XD4A 3EXG1 2I2DA 5K3SA 1LRJA 2D2FA 2XUQA 4W1RA 1Q7EA 3S55A 3MYRA 2G5PA 3OT1B 3T3HA 4WA7A 1U0EA 1QB8A 1QKIA 1SOWA 3KOUA 3MS4A 3HK2A 4P80A 4K9LA 4KI0A 2EIXA 3IEXA 1NVMB 4MPTA 4RAOA 3RSGA 3VHQA 1WP4A 4EFDA 2CLDX 1LH0A 2RE8A 3BMQB 1RPTA 3GMIA 2HRDA 1KFJB 2COUA 4IOLA 3ZCRA 1ZI8A 4YPFA 1UT6A 1II8A 1YBFA 2IYVA 3AYZB 1N2BA 2FE4A 2LPMA 3AOEA 3QV2A 4RTOA 1YRWA 1B14A 5G53C 1VXRA 3L06A 2FZLA 2QU7A 3FD8A 3KPWA 3D7LA 1U2EA 3MLBA 4MWEA 1AXEA 3M49A 4JL8A 2EF0A 4FOTA 1EK6A 4LI3X 3UJ7A 1Q92A 3KXIA 4IYRA 1CRWG 3F46A 4MVJM 1O2DA 3OP1A 5C81A 1DL5A 3EIXA 1XKTA 1URPA 3N2EA 5AW4A 1P8JA 2PXAA 3CEAA 4HEA1 4QOJA 4NI5A 4QDKA 1V2GA 4QYIA 3JALA 3SR4A 1YBVA 3ZS9A 5AM5A 5KKNB 3GL9A 5ISMA 2NUAB 4AMBA 2SKDA 5FO0A 2A9QA 1TQ6A 3DV2A 5BURA 3RC8A 1W4AA 4Z3OA 3AOGA 3PFHA 2DBQA 3T3DA 1M83A 3V7UA 1XAGA 1GKUB 2CZGA 4GPAA 1OH6A 2P40A 1OPRA 3BIOA 4NV0A 1YE5A 3FYSA 3GEDA 1WEKA 2UUOA 4NRDA 1HLFA 4QG3A 2XDWA 4C7OA 1AKNA 1GRQA 3UB2A 1Y42X 3ZTWA 2XAUA 4IMJB 4RTKA 1N6HA 1PT5A 3N3BC 4FOPA 4KQFA 1HH4A 3GYGA 5BSRA 3STXA 4ZMBA 4R6XA 1A88A 1O7JA 1DKRA 1P0CA 3OHSX 4HH0A 2IU6A 2EVWX 3HU5A 3TN7A 1JHAA 4JKYA 5C80A 1LDNA 4B09A 1WP9A 5IZCA 4JEHA 3OM8A 4E1AA 4YRCA 3GEGA 2BFEA 2NU6B 2F2TA 1KR5A 1L7PA 3DCNA 1FFDA 1T3LA 3BZBA 4PBSA 3SJAA 5ES4B 1CHNA 3SVTA 4DV4B 1RXIA 4JY7A 4NG4A 3ZC3A 5J2UF 3WS7A 2F6RA 5AXDA 4F1JA 5TMPA 3TBKA 1F8XA 3RYIA 4O2BB 5DSZA 4URFA 1OZAA 2I9PA 3O73A 4YT4A 3IE1A 2OY0A 3N53A 1PR9A 3EXAA 2JLSA 2YJ3A 3P32A 1NLZA 1A2OA 1Z2NX 2QT0A 3UNXA 4TKVA 5C1IA 2O5CA 4QFDA 3VXKA 1BA3A 4LFBB 3TM4A 2XT6A 3RRFA 4IX9A 4W6ZA 2C07A 4JI2B 5DRTA 2IP1A 4UOZA 3CB4A 2HV8A 2C5FA 2QHXA 1SKBA 3UH0A 4TTPA 1GGEA 1LLFA 221PA 2I2CA 4CBVA 4E7PA 1XD8A 4PLHA 4URUR 2GI4A 4YX9A 2V6MA 2A8YA 5F4ZA 4MUKA 4CJXA 4G6ZA 2I3DA 4RC9A 4EYQA 7MHTA 1W30A 3F47A 1C7FA 4CV2A 3B5EA 1I14A 3DB2A 4MIYA 4JC5A 1US8A 2OENG 4KXXA 4JGIA 1K1EA 3E8MA 2GLTA 1NLUA 3TNJA 5DASA 1YH3A 1XRLA 3E1KA 3NHZA 4P5PA 4RJLA 5E9QA 3SP1A 1GPUA 3E7PA 2HV9A 1ZKMA 4NFYA 4TSFD 3MMXA 1YB5A 2OBMA 3N7TA 2PKRA 3QLJA 4BNNA 3NDPA 2IKQA 2B3DA 1XQYA 3AC0A 4YUZA 5LFAA 1M1XB 2AFIA 3GWGA 1KMQA 1O95A 721PA 1H5NA 4BVLA 4MV5A 2G4VA 2BDTA 4C0LA 1R6UA 3MCAA 3ROKA 1K88A 4P34A 2OGTA 2FRVA 1CJSA 2QPAA 5IAGA 4WXEA 4CEJB 4R0MA 3GNTA 4DLWA 4XCQA 5JAQA 1X0VA 3HG7A 2QD5A 3KDAA 4P2GA 4U0JA 1EA5A 4BKRA 1G20A 5JH7F 3G5MA 3RIYA 3U7RA 3N9IA 4AUMA 5HZHA 1M5UA 5BW4A 1E1DA 3CUKA 2ZYWX 3PF8A 3WK7A 4JBWA 4ZZ1A 1AJEA 3K32A 3L7JA 4BVAA 2X76A 4JGGA 3RIMA 3GGDA 5EJ8A 1JA0A 2FX2A 4A7PA 1TW2A 2Q5OA 2ZITA 2XVXA 3OH8A 1NSTA 4TYMA 2BGJA 3G0GA 1RD4A 3PHHA 3IMEA 4KSYA 4BBAA 3NC1C 2FQXA 2ATCA 3LUGA 4UBMA 2NUBA 4X24A 1YJQA 3NONA 4KLRA 1SVKA 3X2EA 4Y30A 4MVJP 1Y81A 4Q1EA 4PO8A 3SXPA 4UEWA 3DMPA 1W0KD 1KI7A 3CNEA 4LMRA 4NG5A 1DVRA 3EXFB 4GI1A 1FVFA 2IOHA 3I2YX 1ZNYA 1MQSA 4MCAA 3CLSD 4S1TA 1J42A 3TKYA 1R5JA 2C04A 3N0VA 4WY5A 4L5IA 1YQGA 1BQ4A 3KB1A 1IDOA 2Q5FA 2RHOA 1TTHA 4PSAA 5E3JA 3QX3A 4KW7A 2O8DB 1I2MA 2WJVA 4UCFA 1KRHA 2YC4C 2G63A 1EEHA 4OAQA 3VMFA 1USVA 1WG8A 3L5OA 2OV6A 3WRXC 3ZU5A 4TT3D 2C97A 4DXHA 5AW6A 3L8CA 3UV7A 3RK4A 1JYEA 3ZXXA 4UDXX 4BO5A 1A4UA 3ZZTA 3CEJA 2DHRA 1QVZA 5AW0A 4C2BA 4L02A 5H02A 2EEZA 4HG2A 5DCUA 4P0TA 1ISFA 4FJ0A 5CDGA 1RLOA 3N5CA 1O9BA 1IXSB 1OBVA 1KARA 1OH5A 1M73E 4BN4A 1FYFA 1XC7A 3LUCA 1XJ5A 4UARA 1CZOA 2ADFA 1RQNA 1NLYA 5AVXA 1SBHA 4FZJA 1DC5A 4OXKA 2DE0X 2Q28A 4FNMA 1J8YF 3L0IB 4N4AA 5EXTA 3VNBA 3CLHA 2XKKA 2G8LA 3R0ZA 2WJ4A 1RMYA 4XWYA 3Q8KA 4O8ZA 1AGRA 3H9EO 5ETJA 3GRZA 1X1EA 4WCFA 3HLTA 3V7FA 2ZYAA 3UCXA 2PWPA 4PQRA 4EKDA 1VIYA 2L19A 1EWTA 3HFJA 2YWRA 4HVAA 521PA 3JXEA 5JLJA 1AUPA 1VMEA 2OQVA 1LLCA 1SCDA 5DI3A 2BGUA 2XNDD 4H17A 4X1YB 2I2FA 2FXIA 2SCUB 3UJ8A 2BKXA 2VRNA 1TU4A 1RJGA 2P65A 3BIXA 3Q6MA 3QM1A 4LHYA 4LV6A 3ZWMA 1ZRMA 4EHHA 4ER0A 2DB3A 3LHKA 3UBTA 1SNYA 2AG5A 1R8SA 3U49A 3EE6A 2C77A 3A1EA 2YWDA 4JBYA 4LRYA 4DREA 3MWKA 2LD4A 3JQBA 3K4PA 3PNVA 4R8MA 5CFQA 1CLUA 5CCXA 3K7EA 3KOMA 3PFGA 5HX7A 2A5GA 4OGFA 3QVLA 3T9CA 1G59A 4MVJI 1Y8RA 3TTSA 2Y1DA 4EA6A 2BGKA 2HRRA 1KFBB 1SCJA 1HMYA 1T36A 4MULA 1NYLA 2WD7B 4YCBA 5EJ7A 4UAGA 4V2IA 5K0BA 1L4YA 1XOIA 4DV5B 4N5NA 3S1AA 4B3CA 4ZHQF 5EKUA 3DM9B 1YFJA 4OL9A 2PFSA 1TL7C 3GH1A 2Z56A 3OU6A 4MUIA 3UT5A 1CUYA 2EV9A 1POXA 1BDBA 1HURA 4MGYR 3RDPA 4JJEA 1AHPA 1YR9A 3ND8A 5DULA 4OQFA 3QWAA 4C6RA 2PGIA 4M3NA 2PL9A 4ZMSA 4BMCA 4E2WA 4RVSA 4UHJA 3ESQA 4C4OA 5LB4A 5JMTA 4PFJA 1N2IA 3CBQA 4QASA 2HYDA 3B60A 2FQWA 4FCWA 1EFPB 3GJRA 3SX0A 3O8OB 4ROTA 1I4OA 3ZGOA 3VPBA 1UXIA 4FQ8A 1E7RA 4IIEA 2WJWA 5CVUA 2W00A 3K0SA 1LK5A 1GNQA 2IBTA 3CX7A 3SD7A 1JV2B 3IX7A 4DOMA 2JEOA 1AE1A 1PEAA 3EVDA 2H16A 3IQDB 5IP5A 4B3DA 4HXYA 2QVLA 3IELA 2MSDB 2OECA 5JAHA 2EDAA 4S05A 1K98A 5JYEA 1MO4A 3DLHA 2Q6IA 1DO0A 3LW8A 2EOAA 2X19A 4MS3B 3ZLUA 3EEFA 1U9IA 4PEVA 1G21A 3R77A 3AVTA 2WF9A 1VJ1A 4I66A 2ZWVA 4GUDA 4MPRA 1Z4MA 3LL4A 4J0KA 3B3GA 5FIUA 4PSKA 3VX4A 4PG7A 1JHVA 3RQIA 1TLFA 1JBKA 4J07A 1UBTS 3GW8A 3A4YA 5GZ6A 4Q7QA 1BKDR 3BD9A 4ILEA 2WTEA 5FA8A 1KBZA 1HYGA 2C94A 5TARA 3E9QA 5U9CA 5JU6A 1L5YA 1ZLYA 4BLWA 2G71A 2XUJA 3DOCA 3SIPA 1JIVA 2OL4A 3CN7A 1PT6A 5HGXA 4G85A 2XMRA 2OYCA 1ZS9A 3WGYA 1E9SA 1OTYA 2YOGA 4JSRA 1EGVB 3PFCA 4ZVPA 3TNLA 2DG2A 5BT8A 4QJIA 1VLMA 5SICE 4IKOA 2Q2VA 3LO5A 3H2KA 4EJ6A 5CA1F 1PT9A 3LFTA 4NSNA 4DT1B 5A9SA 3KKLA 3QVMA 3WGKA 3MM4A 2PL5A 4XTRA 2OO7A 5LPNA 1RIIA 2D1SA 1IONA 3FI0A 1VYTA 4L0DA 4HAIA 5JDCA 5FFFA 1VYVA 2OUIA 3H1EA 3BCSA 1M0TA 5KJFA 3QVOA 3CU5A 3OQJA 4CEIA 1T13A 2ODEA 3U19A 3DDCA 3IMGA 4RFVA 5L3RA 1VCIA 2JFGA 1H4TA 2VJDA 1B2LA 2GFQA 4B7UA 3PX2A 3WKDA 2QPLA 4C88A 3CO0S 4Y0VA 3VDQA 4M0EA 4B40A 5DLEA 2JAWA 1SUIA 2J87A 1SOMA 1FOEB 1U2GC 1YGPA 2KBEA 3MRXA 1TDJA 4TQUS 4V0KA 2VHXA 4WINA 1Y34E 4ZT4A 4EX7A 1HL3A 5KJ6A 2V5UA 5I51A 2HDOA 1JSZA 3RSCA 2Q7XA 5E2IA 1G8JA 5HCIA 3I6QA 5GONF 5LZ9A 4F06A 1XWFA 2IPXA 1Q84A 2W8ZA 3QLTA 3EDCA 2VHCA 3LZDA 1TC1A 3SSOA 2R2GA 3VPSA 4DA7A 1GQSA 3HB0A 3H4IA 1G6Q1 4FLFA 4O1MA 3URMA 4LDRA 1Q20A 1Q0PA 4PSUA 3KSDO 5LUAA 1CY2A 2H1RA 1TCVA 1GZ5A 2WJAA 4HRAA 1B8UA 2SBTA 2QZZA 3V7YA 2AC7A 1A98A 1BXGB 3F8WA 3H5TA 4BP1A 3S5UA 4LJKA 2NXWA 1H6DA 3FOAA 1JLRA 1UF9A 3R3HA 3HNPA 2WSIA 4OM8A 1B23P 5EHZA 1N78A 2JI9A 2MWMA 1IQ0A 2ZUWA 4JR2A 3LUHA 5GOZA 3RUHA 1PFUA 2CVQA 2RGXA 2XB6A 4FMPA 4H1VA 2IZ6A 4OP3A 2A30A 1BGWA 3HCBA 1WLYA 3NHPA 2Z1MA 1HTWA 1Y7LA 2FMXA 2PH1A 4HTFB 1N2EA 3SM3A 2I22A 3UB4A 1EZ1A 4DC0A 1XKQA 3DBRB 3H2SA 3CYFA 2P1RA 3GMSA 3AF1A 2VEDA 5KYYA 4NXNB 5KX5F 1NI4A 2DLDA 4IV8A 4D9JA 2RD2A 4RSHA 1Y8CA 4HNTA 2OGSA 3PC3A 5HIIA 1A9TA 3EF0A 1KDZA 2OZPA 5A5DA 3OOHA 2ZYGA 5CFNA 2Q4BA 1ZD9A 1U8XX 2OXIA 3RVDA 2Q9CA 1ARZA 1O97C 1T0BA 3K0CC 3HDTA 4MH0R 1Z74A 1EP9A 3RUDA 4D82A 1NZFA 4D0LB 1PZEA 1DRKA 1PTJA 4P4GA 4CF5A 2C7OA 4CEHA 4WH0A 4WXPA 3PD7A 5KNDD 3CLTD 3P4XA 1KJ9A 2P5YA 3O5AA 5EE1A 5B2EA 1P4RA 1WA5A 4NBVA 2FPKA 3PXGA 2QLNA 4Y7DA 1UBGA 2YCBA 1TUGA 4GSLA 4F72A 1V3VA 3CJTA 5A71A 2R85A 2FR8C 5K99A 5JTTA 2ZU6A 1QM5A 2D1RA 1V9CA 1FE8A 3O8CA 1M1YA 1JTVA 3NPAA 4DYHA 1TVEA 2X0EA 4TTRA 1G7TA 5KOHB 4NK5A 3JQRA 5BN4B 1XZBA 3UUWA 3H9GA 5AUNB 4Q3AA 2VHQA 1AQLA 3G6WA 4L4XA 4Y0AA 1EUDB 3ZY2A 4L51A 1G6KA 4LWPA 4RU1A 3G2JA 5COQA 3VH3A 3HWRA 1ETHA 1CQWA 3AT1A 5K6RA 1XRPA 4GR5A 3DA8A 5IT9A 2AC2A 4ZOBA 3M7IA 3PQ4A 1N2JA 2WM8A 4B7XA 3JAMA 4KR9A 2FJ0A 2FRXA 3GGGA 1PR2A 3FE2A 4JJ8A 4RIEA 1XELA 3ZPXA 4E5VA 1C41A 1ZAKA 4OQDA 4LHXA 3R3XA 4QT0A 4YQFA 1DBIA 1F4LA 3EEBA 1P1BA 3FGPA 2VK1A 4FFDA 4RA6A 2DQKA 3TLJA 3R5HA 2CNDA 2WSYB 2X0JA 2A94A 1DAOA 2P9BA 3B1ZA 4RV5A 4I99A 4IQ4A 2WJ3A 4LHEA 1G8MA 5E8JA 4ISBA 2OZKA 4DWOA 3NHWA 2PMFA 2RI1A 3GPDG 4NS1A 4CQJA 1HI9A 4H0NA 5JISA 3KC2A 2PVCA 2O2SA 4P58A 3DXXA 1A9OA 3K0FA 4ZQBA 4JI7B 2V74B 4PLWA 2WJHA 3DKRA 3ZWAA 3O3OB 3B52X 2ZIUB 1RCTE 1SU6A 2CXTA 3KYCB 1MZVA 4RJ2A 4AMZA 4DR7B 4DNXA 1D2CA 4RM3A 3WSTA 1HG0A 3FR8A 3IHTA 1OPXA 1PJZA 2VDVE 1SCAA 1IZZA 5AI8A 1N6PA 1JFVA 1H0RA 3PUHA 3WISA 2PMCA 1E1RD 2LCFA 3WLLA 5LN1A 4GWKA 2W43A 4GMKA 3KEMA 4MPPA 1PJRA 2J32A 3LBIA 4HMPA 3RV3A 3D4PA 3NV9A 1E1KA 4OBBA 4EJSC 5GPBA 1K7CA 4E6EA 4DV1B 2ECFA 2VYVA 3GG2A 1FNMA 3B36A 3AZOA 3OTWA 3OETA 2VR1A 2XBUA 2J3IA 4IDGA 2BRUC 1ACLA 3AHEA 5EN4A 2C4HA 4O4HF 5I47A 1G0NA 1JR3D 2W7TA 3G7SA 4EECA 3HCFA 3M6IA 5E1OA 5TF0A 4BO6A 1VJDA 2JK0A 3K4HA 3BJEA 1L1RA 3LCCA 4WLFA 2Y1KA 4ZDIA 5K7SA 3WLHA 3WLEA 4IDAA 1YOVB 2R8ZA 3Q3JB 2BGWA 2W0MA 4HPJB 1N5DA 3EULA 2D54A 5D00A 4EUNA 3RNLA 1G7CA 3I9KA 3X43A 4RELA 2ZBVA 5DHRA 3T5AA 3VZSA 1VP3A 2GBLA 1B41A 1F48A 3LFUA 4RVOA 5CDFE 1V7QA 5KSZA 2ZRKA 4YQEA 1E3DA 1AGPA 1CQIA 2FPPA 1AQ6A 4KEAA 1XA0A 1ZD8A 4YBRA 1S2DA 4I3HA 1TU0A 2J7PA 5LIPA 1LPAB 2P69A 2QRZA 4FR5A 4Q4DA 4Q7LA 3FPCA 2CDBA 3O21A 2AG1A 1UPTA 2EFHB 1UMKA 3H65A 2C3MA 3SR0A 2BBWA 4DMFA 4DLRA 2IELA 3LV8A 1KL7A 4PYNA 4RLQA 4N7MA 1L7NA 2FG5A 2XCIA 4U9IS 4UDYX 2IWRA 3LFHA 1X6VA 1YZHA 1N9GB 3TIFA 4BBPA 1DOZA 4FD3A 3HJNA 3P8ZA 4GRIA 3MQ2A 2QL6A 3N2ZB 1RWBA 4AX4A 1Q5PA 2IZ1A 1JILA 4YJHA 4CUZA 4CDNA 1Z0SA 2I3AA 2FUG6 2VDRB 3H2GA 2JAQA 3IVGA 3MSCA 2CLSA 1X1RA 1ZIPA 1QV7A 2YN4A 3GB9A 4C87A 2VZLA 2QRNA 4XWGA 5EWLA 2YVAA 3GCGA 2NO5A 3IAS1 3U1TA 2II6A 4QQKA 3HE3A 1N75A 2YRWA 1U8YA 4PS1A 2QN8A 4B9EA 3H2JA 4RJKA 3UMRA 2QTBA 2P67A 3IJEB 3QIAA 4BBJA 3EFOA 1K0FA 3EC1A 4HO1X 3UJ3X 3OESA 3HADA 2OBXA 3UT0A 1O6GA 2XB4A 3I45A 4PVDA 5F9MA 3S2SA 1U0BB 2P4UA 1OV4A 3C6BA 3E22A 4DS3A 1USWA 2CJPA 2XGJA 3EIQA 2YZ2A 4TZTA 4GX2A 1OBFO 2BGNA 2LP4Y 2PSHA 3BJIC 1SUSA 3IPXA 4RUKA 4DMRA 5K8IA 2RK6A 3TSWA 1OA0A 1J7JA 2QG4A 4KDFA 3RKSA 4IWNA 1VGQA 2CE7A 2VDWA 3CKMA 1U04A 5EZSA 3KVYA 4ARVA 3KETA 3K6SA 2P35A 4MV0A 4MB2A 2YHIA 1XAJA 1NIPA 1RAEA 1ULBA 4TL9A 3H87A 2O1EA 4H4CA 2D1QA 4N0QA 4OU4A 1QHHB 1T9AA 4RSRA 4RWZA 3A9VA 4DQLA 4FE3A 2X22A 1RPZA 1P7CA 2WWYA 1C5KA 3BIJA 3E03A 1FK8A 5CB8A 2PPLA 2R6CA 3MAJA 3UXYA 3KZXA 3TLEA 4DQVA 2OBNA 3D4NA 3ROFA 3WRYA 3EXEB 2V0NA 4HADA 5LIRA 4HB0A 4EPXA 4B48A 4KGZA 1PI3A 4JV5B 3BG5A 1P73A 5GP1A 3RHTA 3ILYA 4P4TA 3F5SA 2OCYC 4M0DA 4WCVA 2HAEA 3P2IA 2C99A