3C1OA

The multiple phenylpropene synthases in both clarkia breweri and petunia hybrida represent two distinct lineages
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
MEKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPDSTPSSVQLREEFRSMGVTIIEGEMEEHEKMVSVLKQVDIVISALPFPMISSQIHIINAIKAAGNIKRFLPSDFGCEEDRIKPLPPFESVLEKKRIIRRAIEAAALPYTYVSANCFGAYFVNYLLHPSPHPNRNDDIVIYGTGETKFVLNYEEDIAKYTIKVACDPRCCNRIVIYRPPKNIISQNELISLWEAKSGLSFKKVHMPDEQLVRLSQELPQPQNIPVSILHSIFVKGDLMSYEMRKDDIEASNLYPELEFTSIDGLLDLFISGRAPPPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The multiple phenylpropene synthases in both Clarkia breweri and Petunia hybrida represent two distinct protein lineages.
pubmed doi rcsb
source organism Clarkia breweri
molecule tags Oxidoreductase
molecule keywords eugenol synthase
total genus 119
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c1oA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3c1oA02
3M1AA 2DM6A 1WPQA 3D3WA 4WE3A 4D7AA 1LSOA 3A9WA 1KC1A 3QWHA 3DZBA 1E3SA 1DEHA 1EMDA 2GNAA 4A03A 1HZZA 5KJ6A 2Q46A 2TMGA 2AHRA 5A9SA 1NP3A 1BXKA 2Q50A 1I10A 1V9LA 4WLVA 1UDBA 5KJFA 1JWBB 3DBRB 3JD4A 1QSGA 1ZCJA 2OO5A 4LISA 4WEQA 4ESOA 1OFGA 1NXQA 3PWKA 1YQXA 2EKQA 1L1FA 3RAJA 5HM8A 3PQEA 4L73A 1PJLA 1DRVA 3LYLA 1EK5A 1J49A 2C0CA 5B12A 3RUIA 4IM7A 1SO8A 4PLCA 4WLOA 3A06A 2VHWA 3A28A 4WKGA 4I1IA 4OOEA 4BO9A 4CMHA 4XA8A 2EWMA 3DBHA 1EFLA 2WWRA 1EE2A 3SJ7A 1GUFA 2YFQA 4J2HA 4BV9A 4G81A 3DHYA 4I5GA 4L4SA 2H5LA 4DL9A 2WEKA 2YHUA 3H4VA 1E6EA 1Z73A 1MFZA 2HK7A 2AG5A 4GVLA 1E3EA 1HDRA 1UXIA 1PGQA 4QXMA 1BTOA 4E32A 1VJTA 4H16A 4I9HA 3D64A 1M6HA 2G0TA 1XLTA 3GVCA 4MVJH 1NPYA 3PHHA 3FI9A 3WS7A 4R9SA 1LX6A 1VC2A 2GR9A 3B1FA 5KWEA 1NASA 2CNBA 2HK8A 2OL4A 3JD0A 1RPNA 1T2DA 3EZYA 3B1KA 2FR0A 3H5NA 3BZUA 4B3HA 4CLOB 2CDAA 3ONEA 2PFGA 4IJVA 1HYGA 1DIHA 1LJ8A 4XKJA 4L74A 4CV3A 3HFGA 1CQJA 2EIHA 2ZTUA 4ZQBA 2IE0A 2VHXA 5AXDA 5IF3A 3QIVA 4FFMA 4XGKA 2A4KA 2GN8A 1BWSA 3I83A 1B8VA 3KSDO 3C8MA 3OECA 2C07A 2E49A 2X6TA 2OZPA 3MWEB 1SAYA 3RUCA 4X54A 1SEPA 2YV3A 3CEAA 4JCOA 4CQMB 1H6AA 5TT0A 2PTGA 1N2SA 3BTVA 1PGJA 4TRMA 4KQXA 1NHGA 2RHRA 3P2OA 4FB5A 3WJAA 4II3A 1R4MB 4GGOA 2D2IA 1IHXA 5JDCA 3QVSA 4R1SA 1RWBA 3RCBA 3MTGA 1HSOA 3ZNNA 4PFJA 1XELA 3GDGA 2QZ9A 3G79A 3S1LA 1GL3A 4YJFA 5IDQA 4Z6KA 2GN9A 1DRWA 1FDVA 1JQBA 5BNTA 3AOEA 1C1DB 4J90A 3ICCA 3VPFA 2D5CA 2NU7A 1Y9EA 3PHIA 4WCDA 2Y1FA 4DC0A 2D59A 1P1RA 3PGJA 3WYBA 4BOYA 3O38A 3JYQA 3I6IA 1R4NA 2GPTA 2BI8A 5COBA 1EVZA 5DCUA 1P1JA 3OF2A 3VPSA 1E7YA 4DUPA 1H2BA 1O5IA 4ITUA 3VPHA 4BHTA 1T1RA 3I4FA 4MIOA 2D5AA 4JK3A 5L7WA 4W9NC 3JYNA 2Q99A 3GEMA 3ICPA 2HU2A 2QYSA 3GVHA 1K6IA 2O4UX 1YONA 4J3FA 4XQEA 5JY6A 2ZKLA 4CUJA 2JHGA 5TNXA 2DUUA 2NVBA 1BSVA 1X15A 2HMTA 1E1NA 1O0SA 1B26A 2WE7A 3Q6IA 3GGPA 2AMFA 4RLHA 4RQTA 4UEKA 1IE3A 1B3BA 1UH5A 4Z3DA 4A73A 4FQ8A 4CMCA 1BMDA 2PKQO 1FMCA 3BXXA 3WQRA 1SB8A 4Z9YA 5HRUA 1E1KA 3WB9A 1JA9A 1KEUA 2BLLA 5U4QA 2OORA 1EBUA 3NJ8A 4D79A 1NQTA 3GEDA 3GRPA 4IINA 5FEUA 5I7VA 5B4VA 3KEOA 2P2SA 4JJFA 2EW2A 2WJPA 1EZ4A 1LC3A 5C3MA 2GLXA 2NTNA 1OI7A 1ONPA 2VRCD 4KP7A 3BHIA 1QLHA 3OIGA 3SLKA 4LN1A 3NTOA 3V1YA 5CDUA 1HE4A 2W2KB 4IZHA 4J1SA 4L75A 4E2YA 4J6FA 4MVJM 4NMHA 4WK6A 1R0SA 1ZEMA 3GRKA 4KUHA 1G0NA 2XXJA 3KETA 3O8QB 4RVDA 4UVEA 4XYLA 2C7GA 1OBFO 1PJ2A 2IXBA 3AUUA 4IDBA 1I3NA 2QX7A 3LC7O 3U9LA 4NIMA 1QV7A 3IL2A 4Q3BA 3ZI0A 5L4LA 1Y8QA 2WD8A 3DXFA 1QG6A 4J16A 4K6CA 3H9QA 4HWKA 2W98A 4PRLA 5C7IO 4MDHA 2NTJA 1O94A 1T2CA 2YDYA 1C1XA 2ZB4A 4IBOA 3VZQA 4B7CA 2HAEA 4XYMA 3FCOA 4BV8A 1M76A 3DAPA 3HDJA 3E9MA 4B4VA 2O3TA 3H9JA 2LDBA 5H82A 2OP0A 2A92A 1HDXA 3U4CA 4I5FA 3IOYA 3NGXA 1DSSG 4E31A 4NBVA 4IGEA 1BVUA 1QKIA 2DLDA 2G1UA 3S55A 1AGNA 4GL4A 1BXGA 3L9XA 2NNLD 2P5UA 3VVCA 5IDWA 2GUGA 5EESA 4D44A 5JNLA 3EW7A 2AEMA 2J8ZA 3QA9A 1LSSA 3BTUA 8ADHA 5CDGA 3PFFA 3ZGYA 3C3XA 4PG8A 1GPDG 2AEFA 4D43A 4I9NA 1YVEI 4BNYA 5B1YA 4XDYA 2GN4A 1ZK4A 2VNAA 2NSDA 3PYXA 1NVMB 1TB4A 2PZLA 1EFKA 1L7DA 2O3QA 4BQPA 1Z6ZA 2Y99A 5I9LA 3NT2A 4IS2A 4IJUA 4BNJA 4BO1A 4CUZA 1NFQA 3DWFA 1H94A 2POQX 1VL0A 1IOLA 4A7PA 3AW9A 3R6DA 4QO8A 1DIGA 1JKFA 3ZNQA 5G0VA 8LDHA 2VUSA 4U8GA 2O50A 1GCOA 3GFBA 4D45A 4YAKA 3ZWNA 5HWSA 3JQ6A 3K2BA 3OJFA 1X14A 4R1UA 1W4ZA 3MWDB 3PYMA 2GN6A 4CR8A 3UCXA 2VTDA 2PWZA 1FDSA 1FXSA 4KUEA 5LDHA 1VSVA 4OSOA 1I30A 1S7CA 2GSDA 2PH5A 4JXKA 4LSMA 4CM3A 3QRWA 3HNPA 2HUNA 5BNIA 1JKJA 1WVGA 3ZHXA 4BMSA 3KSUA 2G76A 1NHWA 1BW9B 2Y67A 4A5OA 2BKAA 3V2GA 4BKOA 2UDPA 3IKVA 2ZJ0A 5DP2A 1YS4A 4UAGA 3KYCA 1TLTA 5J23A 3KBOA 2O3SA 2VHZA 3FTNA 4YJHA 3GR6A 3FSRA 4CMBA 3TPCA 2DFDA 1PGNA 5CAEA 4GX0A 4HFMA 1YH3A 3KEQA 4YRDA 4ALKA 1P1IA 4I5DA 1P1FA 2Q1WA 3NV9A 3I23A 2X0IA 4CL8A 4RPHA 1PTJA 3PRJA 1BVRA 5T6BA 2PD6A 2GD1O 4J4HA 2EJVA 3DBLB 3MOIA 2QG4A 1XQ1A 4F46A 1Z82A 5KVVA 5U9CA 1WNTA 2HMSA 3COSA 3WG9A 4DQVA 1I5RA 1U3WA 4BO0A 1DOHA 1I0ZA 3DTTA 4IJKA 1K6XA 4UUMA 5A5FA 3ANMA 1PR3A 1P9LA 4DYDA 2HKIA 4B79A 2DBZA 4CV2A 1G6KA 2ZB7A 1T4BA 1TXGA 1U7TA 2FN7A 2IDZA 2X8LA 3PXXA 1FDTA 4NBRA 4WLEA 4HUJA 1LBEA 1T24A 3LK7A 5ITVA 1FK8A 1LLCA 4CM8B 4XX0A 4M1QA 4KDFA 1JVSA 4HFRA 5JSFA 3GG2A 4GSKA 4GWGA 1J6UA 1ZSNA 2ET6A 3W4KA 1ZFNA 3SEFA 2X0NA 2W90A 3HQ4O 5IZCC 2ZIZA 3KLPX 2NU8A 1Q0QA 3IJPA 4QX6A 5F3RA 1CWUA 1ZK0A 4YEDA 2WD7A 2XXBA 3DB2A 3VZRA 4H3VA 1CETA 3PLRA 1K89A 3H2SA 4ZICA 1YQDA 1NVGA 3IP3A 1BDBA 3TDKA 4BB6A 1QV6A 2HCTA 3CMMA 1XIVA 4N18A 1U4SA 4CMEA 1DLJA 1HZJA 1T4DA 3BMNA 3PVZA 1BXZA 2PZKA 1PGOA 4M54A 1GZ3A 4CQMD 1A7AA 5TIIA 3CINA 1UZMA 2W2LA 3G3EA 3RQSA 2X5KO 4Z9FA 3LZ6A 4WEOA 5DBFA 1EE9A 2PLAA 5G4LA 1E7MA 4UUNA 5IN4A 1LDBA 3K96A 2GO1A 1R12A 3FD8A 3GAZA 3KYCB 4ZRMA 2H1SA 1PJ3A 1VKOA 2CD9A 3OP4A 1K2WA 2EP7A 3W8FA 3ZWAA 3AJRA 5FWNA 4IIVA 2NLOA 1DC3A 2Q2VA 1Y8RA 3QV1A 3L07A 3CPSA 4DRYA 1ZSVA 4Z0HO 2VRCA 4BNLA 5K0ZA 1ENOA 4DIBA 2Q1UA 3DZFA 1I2CA 2O2SA 4PGFA 1E7SA 3PWZA 1YOVB 4MIEA 2YV2A 3GMDA 1E3WB 2BMAA 3AU8A 5JFOA 4IXWA 2VYNA 4CQLB 1C1DA 1J0XO 1NTOA 1V3UA 1Z7BA 3DHEA 5L3ZA 5F5LA 2GASA 1GD1O 1KC3A 2YZ7A 5JC8A 3D4NA 3E9NA 3GZNA 3CXRA 4J1TA 1GUYA 3LT2A 4BNWA 4CR6A 1QYDA 1ZXLA 2C54A 4QUKA 1PJCA 1RYEA 1YWGO 1JDJA 2GDZA 3DHNA 3R3SA 3EDMA 3UUWA 2V6GA 3ANLA 4I8XA 2PNFA 3HG7A 2FP4A 3U4DA 5CPBA 1YGYA 2FPIA 4R3NA 1NPTO 3S2EA 3E18A 3ONDA 3FN4A 4CQLA 5CDYA 1LTHR 2EHDA 2VWQA 1TI7A 2V6BA 3NGLA 3ZWPA 4OQYA 3VKUA 4WUVA 1YOVA 2E48A 2EKPA 3LVFO 3OJLA 3I3OA 5HA5A 3DOCA 4TRJA 1QP8A 1KY5A 1EVIA 1PS8A 2O7SA 4C4OA 1PZGA 3RU7A 3DMTA 3LT0A 2ZCVA 5EPOA 3DR3A 3SBOA 4YJGA 4TROA 1I3KA 2D4AA 3WOHA 1X7HA 1SMKA 2I6TA 3E9QA 3RROA 4G65A 5ITWA 2JJYA 4ZN6A 1E77A 5DBIA 5JAQA 1VKNA 1A4UA 3G1UA 2UV8A 3O4RA 1M2WA 3W6ZA 1V0JA 3V2UA 4EGFA 5CFZA 5AXAA 1IY8A 4NU5A 4XB1A 4RVGA 2B69A 3PJFA 3E03A 3L9WA 1CRWG 9LDBA 3EUWA 5MDHA 5CDTA 3JQFC 4IDAA 1UDAA 4ND2A 3E5MA 3TF5A 1DIRA 4JP3A 1ENZA 4CODB 2X7HA 3ZU4A 2JCVA 1EDOA 1CQIA 3U0BA 4JIGA 4EJ0A 5CEFA 4RF2A 1NWCA 3P7MA 1U5CA 2HSDA 3R3JA 3HFSA 1MFPA 1X1TA 3H9UA 4RDHA 1Q0HA 3H3JA 4B7XA 3L6OO 2FZWA 4R3WA 3KZVA 2E37A 3AUAA 3K9QO 4CM8A 1PZEA 2ZQZA 1ZJZA 1K3TA 5AVOA 3N7UA 3RC7A 1E92A 1ISJA 4M49A 4Q9NA 2O7QA 3TZKA 4ZVVA 2C20A 4BGEA 2OGUA 4E5PA 3VPXA 1CJCA 3MJEA 3WIDA 3QP9A 1E5QA 1C0IA 3WYEA 5EQDA 2ZB3A 3DO5A 5A3VA 3F9IA 3I1JA 5JO0A 3INRA 3TFQA 4NBTA 2LDXA 1NM5A 1HKUA 2I99A 4YAEA 1O95A 1VE9A 4D46A 4CLHA 5DZSA 2GYYA 3BYZA 3D4PA 4BO6A 5TT1A 5IFLA 1SC6A 2JD1A 1I33A 4YWJA 3WWZA 2NQTA 2CF5A 4BNHA 4FJ1A 3TWOA 5JAMA 1E7RA 4EEZA 3X2EA 1C0PA 4XJTA 3Q2KA 2H9IA 5DDIP 2YV1A 3V2HA 1B7GO 5ES3A 3QHAA 4YAIA 4DGSA 2FPPA 4IXTA 1ADGA 4B3IA 2AXQA 1ZW1A 4PLWA 1LU9A 3WQQA 4PZCA 3L6DA 1E1LA 3PJEA 2NVUB 2V65A 5JYEA 1GCUA 4JBIA 5TJHA 4J1NA 3AOGA 1B14A 1GQYA 4CM9D 5JMPA 5KNLA 4XZ3A 4CUKA 4LSWA 2FHSA 4E5MA 1IPFA 5JAIA 2PY6A 5ENVA 2EW8A 3TN7A 1YO6A 4ND1A 1CDOA 5T8KC 2VWGA 1H9AA 3GDOA 1GYRA 4L4RA 2JD0A 3SC4A 3JV7A 4DPMA 5A02A 5T5QA 1JKIA 1DFIA 2V6FA 2GZ3A 2X0RA 3WTBA 2JD2A 4KWHA 1ARZA 4W7HA 1VSUA 1U7HA 1IZ0A 1F06A 4MVJP 1F8FA 4M55A 1JVBA 5JDIC 2FMUA 4N5LA 2VN8A 4RF4A 4BNIA 5ER9A 4J7CA 2RCYA 2FZEA 4HNHA 1JTVA 2IEDA 3NEPX 1DHRA 3QVTA 4WJZA 5ILGA 3SC6A 3ROPA 1ISGA 1U5AA 5AXBA 1SNYA 1XU9A 3A14A 1O8CA 2VOEA 3ZZNA 2ZK7A 3ZWMA 4J43A 3HDQA 1B16A 4LRSB 6ADHA 2XF8A 3WMXA 1VI2A 4N5NA 2NTVA 3WGGA 4IY1A 3RKUA 4TSKA 3ABIA 1D8AA 5TRTA 2DKNA 3FF4A 4MPDA 3S2IA 3IC5A 2BFPA 1PQPA 2J5KA 2YDXA 4OH1A 3UAGA 1NFFA 4XYBA 4YJDA 5JY1A 1V3VA 4NFHA 4XCVA 1ZJYA 3ZNPA 3WFJA 4PVCA 5EIOA 4IJWA 1VLLA 4A2CA 3GQVA 4AJOA 4CLRB 5JDCC 3PWSA 1PWZA 4DA9A 1GYPA 2GCGA 4JQCA 2NU6A 1MG0A 1KVTA 1ZEJA 4XYEA 2NADA 4XWYA 1WDLA 3LLSA 2BF7A 1NBOA 3C1TA 3R1IA 3AOEC 4OKNA 3D5TA 4GI2A 4XRRA 5T8KA 3HDYA 3OICA 3ITDA 2GERA 3GN1A 3NAQA 2EF1A 2I3GA 2PZMA 4D0SA 5GZ6A 3G0OA 1H6DA 5EQFA 4II2A 2YQ5A 3Q0EA 4YT8A 3ITKA 3O8QA 1N92A 3PTZA 3DFUA 2D1YA 3OH8A 4MIYA 1FDWA 1QYXA 4P22A 2Y1CA 1M66A 3CZRA 4CM9A 2AE2A 1ZNQO 4AJEA 2W2KA 1X7GA 1P31A 4WLFA 1R6DA 2EGGA 4I9UA 2Y0CA 4BIIA 4NU6A 4E5YA 1TEHA 5COAA 4BGUA 4XYGA 4CMIA 2OHXA 3Q9NA 3S8MA 3GH3A 3UN1A 4EDFA 1YE3A 2VRBA 4EUFA 4MOWA 2YFHA 2BELA 2PD4A 1RJWA 3FWZA 4LCEA 2EERA 4BKPA 2BFOA 1LSUA 2X0JA 1GAEO 4NR0A 4FFNA 1KVSA 4R68A 1CERA 4WOKA 1TA4A 3TJRA 1LRKA 3QE3A 3DAGA 3JQDA 2QRLA 4MVJI 3AI3A 3M2PA 5F1KA 2PGDA 4YACA 3NUGA 4E13A 3GNQA 1C3VA 3TSCA 4C7KA 4P38A 5IXSA 1ZBQA 4BGVA 1NWHA 3RC1A 3RBVA 3LF1A 3AY6A 2HMVA 1IYZA 2NM0A 3ZU3A 4AJIA 5JMWA 1UAYA 1F14A 1IULA 4OQZA 4Q3DA 1B3RA 4UVDA 2DPGA 5JW6A 2I66A 2ZCUA 3TL2A 3WNQA 1YRLA 2CY0A 3WGYA 1M67A 1K5HA 2O23A 4BNNA 3RUHA 3WGHA 2DAPA 1LI4A 1X1EA 4CMKA 4N54A 2A35A 2UUOA 1R66A 2B35A 3L0DA 3F5QA 5KKAA 4RZHA 2OP1A 1KEVA 2Q2WA 1JAYA 4LW8A 1LDMA 1EDZA 4R5MA 4RVUA 5DN9A 1LLDA 3T7EA 1R37A 3WGTA 4CM5A 5L40A 1DRUA 1ULUA 1R15A 3QWBA 2GGSA 5G0TA 2Y1EA 2VTEA 5JCJD 4PG7A 3V8BA 3UCEA 1H9BA 4CM7A 5BR7A 3N58A 1PL7A 3PIIA 1CIVA 3GUCA 3EAGA 1HLPA 3MZ0A 4QO7A 1N8KA 4KZPA 5IZ4A 1A4IA 2YY7A 3OA0A 1PGPA 1NPDA 3WGIA 1HRDA 3BA1A 5KOIA 3V5NA 1JAXA 2BGLA 3PQDA 3W1VA 4J7XA 2VHYA 4U6SA 1T2EA 2J3IA 3RUEA 1XKQA 7ADHA 3QWAA 3MCVA 5ICSA 1I2ZA 3ULKA 3OEYA 3NDJA 3BMCB 5AYVA 2VZ8A 2HJRA 4CMIB 2CF6A 4YB8A 2VQ3A 1PL8A 3ZH2A 3U09A 3GNSA 3JQ9C 4MVJD 1EEHA 4DBVO 4RPGA 3I9MA 5CPFA 1KIFA 1GUZA 5G2OA 1ZSYA 1RM0A 1ADFA 5IG2A 4H7PA 2VT2A 4CLDA 4KDEA 3QQPA 2FR8A 3D4OA 3RUFA 1D1SA 3GG9A 2Y1GA 4Y9DA 3JQAA 1HDCA 3KB6A 1HE2A 4BNFA 4OOFA 4K1LA 2X23A 5BNFA 1KS9A 5A4DA 5H83A 1RKXA 3K92A 3UKOA 1Y5MA 2HMUA 1YJQA 2DTDA 4CM1A 1PU2A 5DBGA 2FRDA 4AJLA 4GGPA 1DFGA 1XU7A 2Z1NA 2JFGA 1E3JA 4YVFA 3DZGA 1WAMA 5IN5A 4ROSA 3F4BA 1SEVA 3WX0A 4DLBA 4Y6RA 1WDMA 3HB4X 1HE3A 3E48A 1PJQA 3L77A 4E2ZA 3OIDA 1ZH8A 3F1KA 3LQFA 4J4TA 3ADOA 4WECA 2XOXA 2HRBA 5GY7A 4NG5A 1XR3A 3OHSX 5FI5A 1VRWA 4BNUA 3PK0A 1DDOA 1PZFA 2EV9A 2G82A 3F6YA 5H81A 4U6QA 4D3SA 1Z75A 1WW8A 4M8SA 1N7HA 2YUTA 1VJ0A 1XHLA 2JL1A 3WNVA 3JQ7A 2B4TO 3GMSA 3JQ9A 1LQUA 4P4GA 3EVTA 2VWPA 2H63A 3ROKA 4E4YA 2BGMA 4W82A 4PLVA 3OIFA 2HK9A 3BHJA 5TSDA 3DBHB 1Y5RA 1DJQA 2CVZA 1XCBA 1HWYA 2CVOA 2QZZA 4ALJA 2VT3A 4OXKA 3WXBA 2C29D 1I8TA 1WZEA 3B1JA 2Q2QA 2BHLA 3FNGA 3SJUA 1ZVMA 3WLEA 1TVEA 1R0LA 4ALNA 4CPDA 5JXWA 4YQYA 3FNFA 4BNKA 3ZNOA 4YRBA 2QRJA 3RC9A 4O0LA 5A3JA 4ILKA 4J7UA 1X0XA 3H5RA 2RHCA 2HLPA 1UUFA 4GLLA 2C5EA 4BNTA 1DLIA 3WSWA 4BNMA 3WBFA 5TS3A 5BSGA 2X58A 5JYDA 3I9KA 3OSUA 3ZU2A 1PQWA 3FR8A 3GUYA 3U4IA 3EHEA 1ISHA 1VL6A 5AOVA 4OJNA 3TZHA 4HV4A 3S2GA 1QLJA 2Q1SA 4M87A 1JWAB 4RVSA 3OEWA 3NX4A 2WE8A 2C2XA 5FF9A 1PSDA 3H65A 4TZKA 3FPLA 1P0CA 4U0KA 4U5QA 1ZKMA 3RIHA 4UEJA 3W4JA 4Y98A 4ZU3A 4R4JA 2W4QA 4IDDA 4DMMA 1DC4A 1U4OA 2YYYA 3D3EA 1JLLA 5EJ2A 4EYEA 4BO3A 2IYPA 5I8WA 3RVDA 3FNEA 2IZ1A 4Q3NA 5I7SA 3BMNB 5A1TA 2P68A 3GGOA 4LGVA 3E8XA 1MP0A 4TRNA 2Q3EA 2DFVA 1DHTA 1K0UA 1U8FO 3B6ZA 1HEUA 1ID1A 1IPEA 1B2LA 1NFRA 4XIJA 5FFFA 4BMVA 2CDCA 4JLWA 1M6WA 1HT0A 1ZK2A 2WD7B 3VZPA 3ZN2A 4Q3CA 3DZKA 3GHYA 5DT9A 1CF2O 3PFWO 1UXKA 3BAZA 1TT5B 5T57A 4ZD6A 4E5NA 1PX0A 2CMDA 5T67A 3UCFA 1PIWA 2PH3A 4YJFB 1KY4A 4FPXA 3F4LA 5F1OA 3I9JA 4OM8A 4IMRA 1B8PA 3ASUA 5CHEA 3EK2A 1HSZA 2J5QA 4GX1A 2I5PO 2Q4BA 4PLGA 3AM3A 2QHXA 4DVJA 1DC6A 3JQGA 1YB4A 1N9GA 4JP2A 4FOOA 3AUSA 2JAPA 2X86A 1PEDA 3FR7A 4J9UE 3HJAA 2IYOA 4WNCA 3VPGA 4BKQA 3E1KA 5JBIA 4NQZA 4A26A 2AW5A 3O26A 2R6JA 1ENPA 3ZDFA 3IIEA 3RC2A 1WWKA 2O2YA 1HYEA 2PR2A 2VCYA 3JQ7B 3GPDG 4TQGA 1XA0A 2B4RO 3CUKA 4CV0A 1PS9A 2O3RA 3GPIA 1EUDA 4B4OA 4BO2A 1V35A 2Y05A 5DULA 1LXCA 1E7WA 5A03A 4GX5A 2G5CA 4DLLA 2YW9A 1YL6A 1ISIA 3FNHA 3IJRA 1U3TA 4OMUA 4QEDA 5I8ZA 4R41A 1NQ5A 2ILTA 3UICA 2AEJA 4FGWA 4TKLA 3IUSA 1E3IA 3PHLA 3EZLA 1FJHA 3LLVA 4DXHA 1LDYA 4A10A 4BNGA 1EUZA 2CSUA 4GAEA 1NR1A 3IP1A 1GV0A 1Q0LA 3JYLA 3DOOA 3BHMA 4R1TA 2Z1MA 3QW2A 4MVJE 3VKVA 1MC4A 3MJSA 2UVDA 1IZ9A 5I7EA 4ZJUA 4E12A 4JROA 4Q3AA 3WGQA 4DPLA 1P1KA 1DB3A 2OBNA 1PWXA 1GY8A 3IAHA 3IUPA 3V1TC 1NX6A 4HFNA 5G0UA 1KVRA 3P19A 4HXYA 2BI7A 4ZHSA 1I36A 1VM6A 3PEFA 4MVJA 4NBUA 5KVQA 4DIOA 1O6ZA 1UZLA 4RL6A 3GLQA 3C7AA 1P77A 2O48X 4FFRA 1XEAA 4HBGA 5LCXA 3C24A 4OKIA 2CFCA 5KJEA 4O59O 3W8EA 4YR9A 4BVAA 1HDYA 4WCFC 2H6EA 3RD5A 3UHAA 2J6IA 4NJMB 4FC7A 3AWDA 5G0WA 3VZSA 5TGDA 2HJSA 3H6KA 2ZTMA 3VDQA 1PJSA 3DL2A 4ND5A 5FI3A 2WYWA 2X9VA 2P9CA 4IQ8A 2P4QA 4URFA 1AHHA 2JKVA 3QY9A 4CLXA 2HMWA 3OETA 4KOAA 3F3SA 4RLSA 2J5RA 1J4AA 3I9LA 4MINA 3UVEA 3ZV6A 1M75A 4HNGA 3VH1A 3PZRA 2B0JA 4U7WA 4PCVA 4RVHA 5A04A 1ZIDA 5G4KA 1E1MA 4KTTE 4QFCA 1Q1NA 2BFMA 3K5PA 4JJIA 1SB9A 5I7FA 3K8ZA 4EITA 5ICMA 2QIOA 3DFZA 5K6AA 2AE1A 5F5NA 2JCXA 2NVUA 3OJ0A 5IAAA 4D0RA 2D8AA 2C7VA 2DBVO 3GHHA 3GK3A 2EEZA 4HKTA 1ZUD1 3CKYA 4ALLA 3STHA 1ZMOA 1W8DA 2I9PA 4HFJA 4YT5A 1OC4A 2DUWA 3M1LA 1X0VA 3WYCA 4PLTA 5DCWA 1EBFA 1NR7A 1H5QA 2Q1TA 4J9VA 3NKLA 1C1XB 3KM0A 5DF1A 5AXCA 1A7KA 2AA3A 2WMDA 3KOUA 3ZWBA 2X5OA 1HLDA 1W6UA 5AQ1A 4DIFA 5L53A 2IRWA 1A9ZA 1WP4A 4RV9A 5IDXA 3DONA 2CUKA 3KYBA 3OMLA 3RFXA 4BO5A 5KVCA 4K9DA 3L4BA 3GZ4A 3O03A 4MKXA 5DOVA 4U0JA 5EN4A 5A9SB 1SOVA 1JW9B 3CSDA 1Z45A 2P5YA 1ENYA 1Y81A 3GOHA 5T64A 4NJOA 3WTCA 4BUCA 3ZWXA 4EBFA 1W0CA 3JQBA 5HBRA 5EMHA 1HDGO 1GR0A 2I65A 1UZNA 4L9RA 1WXDA 3RBXA 1EVYA 1GQ2A 3TZCA 4DC1A 5GZ3A 3OQBA 5EERA 4J91A 5L45A 2HQ1A 4MKZA 3D5QA 3U5TA 2DT5A 3AM5A 4OHUA 4GKBA 4JGBA 2B4QA 3FBTA 3JD3A 1N7GA 3E5RA 3GFGA 2J3HA 5F1PA 3ZHYA 4ND3A 1YXMA 2PA3A 2DU8A 4DMLA 4ZGWA 4B8WA 1B8UA 4BKRA 3HZZA 3B70A 5C7LO 1IUKA 4H15A 4BNVA 5C5IA 2R2GA 4XRGA 1A5ZA 5KTKA 1H0KA 4P4LA 1E3LA 2UUPA 3E82A 4RF3A 3E6AA 4ALIA 4GPD1 3PIDA 5DCYA 3ZCXA 4BB5A 1X13A 3BIOA 3QLJA 3H8VA 4AJ2A 3PJGA 4KWIA 2YHIA 2VYVD 1OZAA 4JX8A 3OJOA 4CLRA 3WIEA 3TRIA 3QJ5A 4YTEA 2OUIA 1L7EA 3DMTC 1O89A 2VZ0A 4WASA 2OBYA 4I5EA 1Q2XA 4RJTA 3ZV3A 4J0EA 4ZRNA 3C1OA 4BO7A 4YJHB 2VNSA 3VH4A 5F21A 1LNQA 4KQWA 1ISMA 4YJGB 2VWHA 4ZQHA 3RFTA 4FFOA 4FS3A 4S3MA 1YL5A 3ANNA 4M86A 2FOIA 4TRRA 4WPGA 1LDGA 3AU9A 3RSHA 1GZ4A 3F47A 2RBEA 4MVJF 5L4NA 2AQKA 4GBJA 4LCJA 4D41A 3KVOA 1R0KA 4BL5A 5KCZA 2EKLA 4YT4A 2Z5LA 4OGWA 2WM3A 2C2YA 4LVUA 1T2FA 4K26A 4AJJA 3V1UA 5ILOA 3BMOB 1UR5A 3LDHA 3A1NA 1X7DA 2B5WA 1KETA 2P9GA 1V6AA 4GH5A 2AG8A 3AI2A 2W2LD 4M89A 1N5DA 1XGKA 4B3JA 1Y1PA 3G17A 4XGNA 2DPHA 2WDZA 3H2ZA 4HX5A 4ALMA 3Q3CA 3DZJA 3GVXA 4HY3A 3GZNB 5HS4A 2PKQP 4EI2A 3MJ4A 4IGFA 4Q3EA 3ON5A 3ZWVA 1GV1A 2QRKA 1YJ8A 2IZZA 1B15A 1C0KA 4R9RA 2FY8A 3VHRA 2PGJA 3GNTA 3R0IA 3UW3A 1XYGA 5B4TA 3H3FA 1E3WA 1WMBA 2C5AA 2FPGA 4QTZA 3WGOA 4BMNA 1LSJA 1GZ6A 3CE6A 2DTXA 3N74A 2ZJ1A 1U8XX 1FDUA 3OFSA 2Y68A 4FW8A 3ROQA 3WMWA 4CLEA 5JDIA 4YCAA 3FWNA 3O9ZA 2J3JA 5TF4A 1ORRA 4RF5A 1ZXBA 3M6IA 3OM9A 1BXGB 3EYWA 4XR4A 4PN3A 1UP4A 3HSKA 5THQA 3U4HA 3FBGA 2JAHA 2X1HA 3PJDA 5L7TA 1C0LA 1H93A 2Z95A 3KHUA 1GEGA 5JC1A 1I32A 4WOJA 2DBRA 3L4BC 3ASVA 4UULA 3GA0A 3KYDA 4XR9A 3OQ6A 4CMJA 4R54A 5EINA 4FSHA 5JE8A 3KO8A 2BH9A 4C7JA 2Q49A 3U3XA 1A9YA 1XQ6A 4RZIA 1ADCA 3UF0A 3WLFA 2PKRA 2PZJA 4NH4A 3GVIA 2WSBA 4KTVE 5L51A 2ZYAA 4E2XA 5IXYA 2IEBA 3PI7A 3B20A 1PS0A 1RM3A 2V6MA 3NTQA 4PG6A 5C7OO 4D42A 1WMAA 2Y93A 3DAFA 1DXYA 1LC0A 1P74A 1ONNA 2Y1OA 2C82A 1G0OA 2I76A 2PGLA 1P1HA 3RU9A 2R00C 3T7CA 1LA2A 1WLYA 3VDRA 2HRZA 3RUAA 1F12A 4GX2A 1Q7BA 1KEPA 1VPDA 3LT4A 4QQRA 4DPKA 5A05A 3IMFA 3PGXA 3DDNA 3K31A 4R1NA 4AICA 3X2FA 1HL3A 4LMRA 1PJBA 2W8ZA 4EW6A 4XIYA 4O6VA 2CZCA 3ONFA 2GZ1A 2BD0A 2JFHA 1XDWA 5G0SA 1S6YA 3WGZA 5G4KB 3AK4A 1HYHA 1EVJA 3EY4A 3QSGA 4PRKA 4UEOA 3ZHBA 4PLPA 1W73A 1YB1A 3HHPA 1JN0A 2QYTA 4J4BA 5CEJA 3PDUA 3AM4A 3DBRA 3IDSA 4RGBA 1EUCA 1LLQA 1N1EA 2XAAA 2EP5A 3D7LA 4L8VA 3T4XA 4BKUA 4PG5A 1IHYA 3CZMA 1CEQA 3H9GA 2O4CA 3KV3O 4FR5A 4J49A 4W9NA 3HN2A 3I9NA 2E6UX 1MB4A 4AL4A 3BMOA 3JD1A 1AXEA 4Y6SA 5BSEA 3NTRA 3VH2A 1MC5A 3KUXA 3HB5X 4AFNA 1ONOA 1Y6JA 4RPLA 5L9AA 3C85A 3F1LA 3ROMA 4RCVA 4DLAA 1IL0A 5IZCA 3LT1A 2OMEA 4PIVA 7MDHA 1DJNA 3EGOA 5TLSA 5TC4A 1MUUA 5FYDA 3ZHZA 1R16A 2B37A 1BDMA 3P2YA 5CP8A 3WDSA 1KVQA 4F45A 1PJ4A 4JJGA 1KEWA 2VUUA 4Z3KA 2Y0EA 3NT5A 3L6EA 1SOWA 1LRLA 2ZQYA 5BSHA 3IKTA 3RI3A 1O9BA 4INAA 5JLAA 1R4NB 5CG2A 3IQDB 3QVWA 4NZ9A 1JU9A 1NQOA 2EGHA 4HADA 2C59A 3OBBA 2YHIB 3GVPA 4NFYA 4UREA 3HWRA 3AFMA 4CJXA 1RM5A 4TMFA 4R16A 2EJWA 5ER6A 5HS6A 3DOJA 5DOZA 1A72A 4WNIA 4A27A 3DQPA 4RPJA 2FSVA 5KKCA 2JHFA 4NHEA 3QWFA 3AUTA 1T2AA 2NWQA 1GQQA 1AHIA 1LRJA 4IUYA 2O3UA 2ZTVA 3M2TA 4XGIA 1HETA 3WBBA 1GYQA 4DWVA 1VL8A 4GVXA 3HADA 5THKA 4OL9A 3DC2A 2X9GA 3GT0A 1P44A 4DQUA 2VOJA 4E3ZA 1U3VA 4AJHA 1GPJA 3GY0A 3HUDA 4ID9A 1J5PA 2CVQA 1NQAO 2X5JO 1KERA 5GZ1A 5BQFA 3LC1O 2ZYDA 1EQUA 3TL3A 4Y6PA 3MOGA 1Y8RB 4GMGA 1I24A 4B8ZA 1BG6A 1XSEA 5TX7A 4JNKA 2EXXA 1Q7GA 3Q9UA 1YB5A 3RKRA 1UJMA 5CDSA 2ZB8A 4ZQFA 3CMCO 1AXGA 2P4HX 1GEEA 4ND4A 4XEHA 4R5HA 3RUDA 1TT5A 4O63O 3W8DA 1YBVA 3PYLA 3EVNA 2B5VA 1GU7A 4TKMA 3JQ8A 1T25A 3VH3A 3PZBA 4L76A 3D1LA 3VTZA 2X9NA 3FPCA 5JCJA 2VZ9A 1LQTA 1MXFA 3OJEA 3CIFA 4FIZA 3UGKA 2QW8A 1F8GA 3UXYA 4HP8A 3TOZA 1Y8QB 1UP6A 4IIUA 2IODA 1ZMTA 3VC7A 4YA6A 5L7YA 5A9TA 3MJVA 3BMQA 2P9EA 3DMYA 4YPOA 4IS3A 4LK3A 4YAGA 4FBGA 2OXIA 2NUAA 3OA2A 2RH8A 2X4GA 2BRUA 4XQCA 3ZWWA 1HE5A 3G49A 3RBZA 4OAQA 1GDHA 4WGGA 4S1VA 4RVFA 4ONEA 4W4TA 3VTFA 3ZWYA 3KLMX 4E33A 2YQ4A 1U1IA 3F46A 3QVXA 2NQ8A 4KMSA 4FGSA 4FDAA 2JFFA 1NYTA 2NU9A 4NFSA 3ZW9A 4RORA 4EUEA 5K9ZA 1H6BA 3JQFA 5EL0A 4FOSA 5TJ9A 1DAOA 1LDNA 4N7RA 1EK6A 1GTMA 1UAGA 1YBMA 4DBZA 2NV6A 5CG1A 1DBVO 3IS3A 4EUHA 1P33A 3FHLA 2UAGA 6LDHA 4DQXA 4MP3A 1V8BA 1DAPA 1YDEA 1DO8A 3D0OA 2P91A 4RQUA 4UVGA 3DBLA 4GSLA 1PJTA 4RO0A 1CYDA 3I5MA 2F1KA 4G5HA 3MEQA 4DTIA 1G1AA 1H2HA 3D3WB 4W6ZA 3GDFA 4NJMA 3L4SO 2SCUA 3MTJA 4JN6B 2RH4A 4J0FA 2FR1A 5IJZA 3TFOA 4IDFA 3RWBA 1BGVA 3A4VA 3WFIA 1E6UA 4R69A 4EEXA 5C37A 4E2WA 2DBQA 4CR7A 5JAZA 1T1SA 4KUGA 5KJCA 4O5OA 5DP1A 1LUAA 4Z9XA 3ZWCA 1E0DA 3PQFA 2V7PA 3NDRA 2DQ4A 4B7UA 4B4WA 2NVWA 1WDKA 4BS9A 4B4UA 4D3FA 1VJ1A 3PPIA 3U49A 4XJSA 4XQ9A 2Q45A 4YBZA 1BW9A 4PLHA 1NVTA 3AY3A 1D3AA 4J2OA 4AVYA 4CM6A 3TQHA 2GF2A 2I3AA 4OYRA 4NNJA 4FN4A 4PVDA 1Y7TA 3C7DB 5IDYA 4W7IA 4K28A 4YDRA 3QWIA 3PHJA 2I67A 2AQIA 4R01A 3HE3A 3ZV4A 4XQGA 3TZ6A 1AUPA 4TZTA 1I3LA 3EMKA 4TWRA 4E30A 3FTPA 4D3DA 5I9NA 3JD2A 4MO2A 4JBGA 5A5EA 4FD3A 3K30A 4NI5A 1QXSA 3WJ7A 4RDIA 1I3MA 1A71A 3Q1LA 1ULSA 4TVBA 3JQAB 3DTYA 1P3DA 1R4MA 1UXJA 1E6WA 3JQEA 4FFPA 3SXPA 2QQ5A 3JYPA 1MGOA 1FF9A 1D7OA 3K6JA 4IQGA 4NK5A 3WQSB 3ORFA 4R51A 5I9MA 1OOEA 4CQMA 1XG5A 4K6FA 5JCXA 1N9GB 4OO3A 5LDGA 1ZK1A 3I6QA 4ZA2A 3DZHA 4NPCA 4AJ1A 3NJ4A 4MP8A 2D3TA 3BMCA 2B83A 4L4XA 3GF4A 4YT2A 3C1AA 1QORA 5B4UA 4WLUA 3ZWOA 4XB2A 4WCFA 1K6JA 1UP7A 4BGIA 1GFSA 4UVIA 2A94A 2O3JA 2VUTA 4E6PA 5JPIA 4ZQEA 3JQCA 1MG5A 2IZ0A 3DBVO 2G17A 3ETDA 4OIMA 4CLOA 4Q39A 1OMOA 1H6CA 2UYYA 3PDJA 4AJPA 2FSSA 1MXHA 3EC7A 3LC2O 1SBYA 4F3YA 3ZV5A 3HDHA 1Z74A 3GGGA 3PP8A 1T26A 4PZEA 3H7AA 1QMGA 4L0QA 1LDEA 4AJNA 2Y66A 2WYUA 1XWFA 2ZYGA 3JYOA 3Q2IA 2D0IA 4G2NA 3JSAA 4MJLA 3ENNA 1UDCA 1E5LA 1I2BA 2WYVA 1P0FA 1PZHA 3KXDA 4FC6A 4LVCA 3KYDB 4GLOA 5A9RA 3AI1A 3DZIA 1PR9A 1YDWA 2PK3A 3G1TA 3W4IA 1ZZEA 3VOSA 1QYCA 2AQHA 5L4SA 1WZIA 4YAJA 1KVUA 5U1PA 5GMOA 4P4NA 2CDBA 3CTMA 1QRRA 3INGA 3BTOA 3Q11A 1KBZA 4IQ0A 1ML3A 5ADHA 4XD2A 2PD3A 1N1GA 4IDCA 4OXNA 5K6AC 4E21A 1F0YA 4IDEA 2R00A 2Y1DA 1DC5A 3H5AA 3I52A 4A0SA 5TQVA 2EG9A 4UUPA 2HO5A 3ST7A 2RIRA 4LMPA 3ETEA 1MX3A 4EJMA 1DIAA 2XPCA 4PG4A 1ADBA 1AE1A 1OC2A 4QFDA 4CM4B 2Y0DA 1KYQA 3INTA 4Y67A 5L95A 1KOLA 1RM4A 3UFXA 4IPTA 1PQUA 4E0BA 2VHVA 1QYVA 3GC6A 2FWMX 4I08A 3TOXA 1UXGA 3MJTA 3AFNA 4OSPA 4PLFA 4CL3A 3LU1A 1TT7A 1A27A 2AQ8A 4CM4A 3ETGA 1MA0A 1U3UA 2HDHA 4TVOA 3UOGA 2ZTLA 3H9EO 1NAHA 1ZO8A 4DREA 3VVBA 5A06A 3HN7A 5HTOA 4QT0A 1QYWA 3NYWA 3JQBC 5LC1A 1GADO 3AY7A 1DFHA 5MGBA 3WICA 4LRTB 2YJZA 1IB6A 3TZQA 3BMQB 4O1MA 1U9JA 4AG3A 3GN2A 3NRCA 5B37A 4FCCA 3ADPA 3GEGA 5COQA 2TMDA 1C14A 1HXHA 3LF2A 4E5KA 1NNUA 3KSZO 4Z0PA 4YYZA 2J3KA 4CV1A 4RPKA 1RYDA 4GQAA 1V3TA 4UVHA 3KRTA 2E4AA 3NT4A 2Q4EA 4MP6A 3JCZA 4PLYA 3VAZA 1HDZA 4BO8A 3T4EA 3I9OA 3JQ8B 1HTBA 1MV8A 4MVJG 4P8RA 2IXAA 3I4CA 2X22A 2OFPA 3C7CB 4WCFB 2ZATA 3ZU5A 4XDZA 1U2DA 4AJ4A 4CMEC 3WWYA 1I01A 2GRAA 1D1TA 4EJ6A 3QVOA 1EQ2A 4WLNA 1HF3A 4CMGA 1YKFA 1DIBA 1F17A 4IDGA 9LDTA 1E7QA 5JO9A 1MLDA 3ZW8A 5KIAA 4AJKA 1AN9A 2DC1A 5KVSA 2BFAA 4NBWA 1SPXA 1BHSA 1SZJG 1B0AA 4FJ2A 4FJ0A 3F5SA 4PLZA 1HDOA 3PHGA 2A9FA 1P45A 3JQGB 1Q7CA 1BRMA 4J1QA 5CEEA 2PV7A 3P5SA 1U2GA 3W6UA 4BNZA 3SX2A 2JCYA 3UH1A 4CMAA 4PZDA 2VYND 2DTEA 1OAAA 1D4FA 1U28A 4MKRA 1Y9AA 2DVMA 1UXHA 1YQGA 2GZ2A 4YXFA 5JS6A 4BNXA 4EZBA 1QR6A 3RJ5A 4FFLA 3KTDA 2NACA 5KJ1A 4DYVA 1LEHA 3ENKA 5BT9A 4IMPA 4UUOA 5ENDA 4QSMA 3RJ9A 4Y8VA 2RAFA 3LSYA 1SCUA 4N5MA 1NAIA 5DNAA 3SLGA 3SVTA 3JTMA 2B36A 4IZIA 4Z0TA 4BQRA 4OXYA 2E82A 4F6CA 2F00A 2VYVA 3FRJA 4F6LA 3NDIA 2OOSA 3MJCA 3JQAD 4NK4A 3RFVA 1YBAA 3RASA 4YRAA 3PLNA 3S2FA 4ZQGA 2WTBA 4W99A 4GWKA 3WSVA 3TNLA 3K73O 4GKVA 1LLUA 3U62A 3GAFA 1ZK3A 5BSFA 4JBHA 4QECA 1ISFA 1PL6A 3WR5A 4BO4A 3BTSA 4GMFA 1DPGA 3DEYX 1YL7A 2BGKA 3CH6A 4NDNE 3K2EA 4YQZA 3OQ1A 1Z7EA
chains in the Genus database with same CATH superfamily
3M1AA 4QVGA 3QY0A 3K9LA 4L51A 1LSOA 3A9WA 4CDMA 1DEHA 1ZU5A 1Z29A 5I7HA 4ARCA 1L7OA 3HVKA 3TRFA 3CB2A 5KJ6A 2Q46A 2VF2A 1NM5C 4IXNA 2IZ6A 3I92A 1OXKB 5JNSA 2AHRA 2IUUA 4BVKA 5A9SA 1RE0A 4BX2A 1JYEA 2GZDA 1I10A 1WXHA 3HXOA 3G13A 5TB5A 1V9LA 3KVNA 1MQ9A 4LUCA 3JD4A 2C9CA 3HMKA 3WADA 1YJCA 1ZCJA 3RVKA 2BIFA 1D1QA 1NU6A 2OGWA 4ESOA 1OFGA 2ZAOA 4LS3A 4A36A 3DULA 1H8ED 2NU9B 3FAZA 3QJGA 2BDUA 5C8ZA 1YRBA 3D4IA 3GRCA 1XCPA 4CKCB 2GM4A 5DK4A 2PUTA 3FSGA 4MRMA 3LYLA 3FVVA 4HMQA 3RUIA 2XA9A 4BFVA 3L43A 2C8VA 1NW8A 3SE7A 3GLHA 3A28A 1XEWY 3U3MA 3UQYS 1PR5A 5TQ2B 4F7DA 3DBHA 5AM5A 1OLUB 5BQ5A 1EE2A 2OHFA 4KX3A 4B6GA 4MJ7A 4D8YA 4KQIA 1GUFA 3RS3A 1AUVA 2DWPA 4NZYA 4MARA 2OORC 4J2HA 1K8RA 1XPRA 3A70A 3R7AA 4I5GA 2Q28A 3MTAA 4L4SA 3QTBA 1AMOA 2ZJ7A 1CS0B 1JLSA 1Z73A 3H4VA 1MFZA 4GVLA 1BDIA 4F72A 3R8CA 1N2IA 1UXIA 1M1NA 4QXMA 4DMRA 2GQ0A 2WF9A 1ZS9A 2V7EA 5BN5B 1EIWA 4ZIRB 2ZUFA 1Z2CA 2CHFA 3S2ZA 3D64A 1T13A 2G0TA 1KZ7B 2Z6VA 3FI9A 5I4BA 1XRJA 3IKLA 3B1FA 3B9BA 1YRWA 5IVDA 4OI2A 5EEGA 4X64B 4FCWA 2FW7A 1XRNA 2BTOA 4RACA 2X14A 10MHA 5D6NA 1IB0A 3WMFA 1JE0A 4BX3A 1NGSA 3LBHA 4CLOB 3ONEA 3DTVA 3KJGA 1F0PA 1Z2AA 1C8KA 4GOLD 4DIUA 1QP0A 4V39A 5EIXA 1ZW6A 2ILVA 4I1YA 4IJVA 5EKDA 3SF8A 1DIHA 3SS8A 4D3ZA 4XKJA 5ECGC 1JG2A 3RJZA 1CQJA 3ZY4A 5INTA 4M46A 2IE0A 3UGQA 1NVDA 1L5LA 2WVAA 2QZPA 2B1GA 4QPZA 4FFMA 2CE2X 4XGKA 4HZUA 4RMHA 1E2DA 4JLVA 1YJBA 3KSDO 2G70A 4PZYA 4DGQA 2DKFA 3AB7A 1C7QA 1QVVA 1J0EA 1CJVC 1JSZA 1N2JA 1SAYA 1SEPA 1Y3IA 2FH5B 2ZYHA 3DZDA 4FGJA 4OUDB 5CCDA 6AT1A 1GN9A 2F8TA 2H1FA 3IV6A 3GQBB 3I9V1 3GUHA 3CEAA 3IT2A 2F1HA 3VJMA 4B2IA 2C94A 1LWOA 4V2UA 5E1BA 5TT0A 4G8BA 2VT7A 1N2SA 4URVR 1PGJA 2QTGA 2UYHA 4UQPA 1WS6A 4MW2A 4TRMA 3FSEA 1A8QA 1VLZA 1DTEA 2B9EA 2RHRA 1CRQA 3IPRA 3FGPA 4LBVA 2QN9A 2N42A 5JI3E 1IMOA 1X80A 4HYYA 4NYIR 1ONSA 3COZA 5KOJA 4AKIA 1HR0B 3MELA 3IIMA 4GGOA 4WVLA 5IX8A 1SCAA 4A1OA 3NHJA 1L5QA 2DQZA 4DA6A 1L8OA 1I9CA 1RWBA 4XIFA 2P2NA 4PNEA 1PZMA 3RCBA 5K0JA 1ZMXA 5FUQA 1XELA 4MLCA 3GDGA 3TD6A 2QZ9A 3FVWA 1G38A 5REQB 3UAOA 1TCVA 3TX2A 5LB2A 2C84A 3E4DA 1OIVA 2IYYA 3DBIA 4N5HX 5BNTA 4EZIA 5ECYA 2FW9A 3AOEA 3Q6NA 3VPFA 2F64A 1NUQA 1TQ4A 1Y9EA 4LBWA 3UWDA 1O08A 2CJPA 2D59A 3PGJA 4MYHA 4B43A 4BOYA 1XLTC 2ID7A 1II8B 2LCIA 2V97A 3O38A 3BJEA 3F8SA 4RLFA 4EKEA 4JJZA 2B82A 1EVZA 1P62B 1ZPDA 3RYCB 1E1RD 1PV2A 2A0YA 2ZJ4A 3BXGA 1IJFA 1XCGB 3B2NA 3HA3A 4IHJF 4RA6A 3TLBA 4ITUA 4BHTA 2HF9A 1PR6A 4F9FA 3I4FA 5EWLB 5L7WA 1WVIA 2D5AA 2ID4A 2VPXA 2WKWA 3AGPA 2Q21A 4PZZA 4W9NC 2ZR9A 2O1SA 3GEMA 1WUYA 5AUQA 1C3EA 1SQFA 3TRKA 5A4AA 2AOXA 2I34A 1ZGJA 1YONA 2ACWA 1RI2A 4J3FA 3EOBI 4XQEA 5CB8A 2ZKLA 2X2OA 2R8OA 2R85A 3LYUA 3OJWA 1KO8A 4J07A 1CDZA 2NVBA 4H0CA 5TY0A 1PWEA 1EUQA 2B1JA 3C3JA 1E2HA 4N9QA 2GTIA 1X15A 3IJ5A 2YXLA 3IMGA 3IEKA 1O0SA 1KP3A 2YX1A 3ZEIA 2WFAA 4RQTA 4UEKA 1TUIA 1Z18A 1T5BA 2IYTA 2CXOA 1KKUA 3ZPXA 4EO7A 1QQTA 1RLIA 4CMCA 4CVNA 2B7CA 3DS8A 3PNLA 2Z04A 3ETLA 3JQRA 3V8VA 5BWBA 2RHWA 3BXXA 4BXOA 2R86A 2DUNA 4B3DA 1T9KA 3BBPA 3SDBA 5HRUA 2VK1A 5F35A 2RE8A 1Y1KE 2PS1A 5KHLB 1VIYA 3O84A 5A5GA 1JPVA 3GLSA 4JKOA 3R0ZA 5TR9A 5TPZA 1XZCA 2OC4A 2OORA 3B8EA 3NJ8A 4UNIA 1ZVJA 3LDUA 4ZYZA 4IINA 3BK7A 3SOZA 1OBHA 4ACAA 4KOEC 4DCPA 1H3NA 2BMFA 5KDDA 3UMBA 5B4VA 4RHXA 2P2SA 4I3FA 3U3RA 3SDZA 4N82A 1WABA 3RGGA 1MW8X 1PT6A 4IXMA 3PUZA 4W8HA 3THYA 1YDFA 1ONPA 1R0BA 2YMMA 5LSAA 3BHIA 5DE3A 5IVHA 1X6VA 3DWEX 1W34A 2X76A 2W2KB 3OPXA 2ZOSA 4J1SA 4L75A 1AURA 3IUJA 4E2YA 1AUOA 4QKQA 1DG3A 4NMHA 1JJAA 4WK6A 4R7GA 3G5TA 4PYQA 5ALLA 4DY6A 1KZ4A 3GRKA 1SKYB 2SECE 3O8QB 4EO9A 1A69A 5EZYB 2WHXA 1AF4A 1Y3HA 3QE4A 2C7GA 1OBFO 1PJ2A 3AUUA 4IDBA 1XXLA 5FYQA 1VB3A 1A5AB 3HKCA 1G7TA 4WZZA 3VYUB 1WSBA 2XH8A 4NIMA 4CBVA 3EC2A 3ZI0A 1JQ5A 4ZYTA 3GZTB 3U4AA 2QMZA 2IOQA 4CCWA 3A37A 5AK0A 1CE8A 2PUHA 1TJYA 1U6JA 1U2RA 1ZITA 2XAUA 1R0WA 2WTEA 3DXFA 3ER6A 2XHZA 4HWKA 1IN4A 1FFGA 1H1DA 4GM1A 5CDUA 1F7UA 4K5QA 1GCAA 1O94A 4FK8A 3U81A 4O2BF 2GCPA 3CZCA 1HA3A 4CKWB 2JHAA 4IP0A 1T4GA 3J7AC 4XYMA 1QO9A 1UPTA 4UBMA 2JFUA 1C9KA 2YH2A 4IRXA 4PNZA 4JT9A 2JFWA 4MI6A 2XCRB 1SZCA 4NBNA 4XI9A 3H9JA 4I6JA 2ZBVA 3O82A 4X6YA 5EP1A 1NUTA 3DEKA 3RTCA 4ZI7A 5A3SA 3U4CA 2ZWIA 2IK8A 4I5FA 5DWDA 1YU6A 3V9AA 3A4IA 3RWOA 2WVHA 4IGEA 2VYQA 3MMXA 3UAXA 1W1UA 2V98A 1M2KA 2G1UA 2IYVA 1SGWA 4QDXA 1BJRE 4FHDA 1BXGA 3L9XA 4LXTA 4QVKA 4AULA 1ZH0A 3KOOA 4OA8A 4O2BA 2ZIXB 4RY0A 1VQ1A 3T9AA 4OG2A 821PA 2J8ZA 2G80A 3LY7A 1TKCA 1Z2OX 3QA9A 1LSSA 5CDGA 5FDFA 4PG8A 5K2OA 1A9TA 4G86A 2AEFA 4QNNA 1WR8A 2GEDA 3WAGA 1YVEI 5B1YA 1SKYE 2VBIA 3REQB 1ZK4A 5KTPA 4QHTA 3GJXC 1BH6A 2NSDA 5FV7A 3OLVA 1IEVA 1TB4A 4IDNA 1G5FA 4OX9Y 4NMXB 2ZRHA 1O58A 1Z6ZA 4MQ4A 4RA9B 3WMRA 4TZ6A 4IJUA 2BCEA 1NFQA 3I30X 4PO8A 5DYGA 3IDAA 1EVEA 4LE0A 1VL0A 1BC5A 2SKEA 1A0OA 1NOKA 2EFGA 4TV9F 4OLBA 4QO8A 4RXUA 2O19A 1GG5A 4CT0A 2V54A 5HMMA 5C1DA 5EP3A 4K2HA 1GCOA 4H35A 1CVIA 4B80A 4RNDB 3ZWNA 5DHFA 1I4EB 3I4LA 4GPBA 3PYMA 5ESRA 5KYUB 1PFUA 2G0NA 2ZRNA 4DEVA 1RP1A 3UCXA 3SJCA 2B34A 1FDSA 1FXSA 2KPOA 3JPWA 2BUAA 4KUEA 1I30A 2PH5A 1Q95A 3H9BA 4LSMA 4OHCA 4K03A 4Z4CA 4MW6A 2REOA 3HNPA 2HA3A 2KQUA 3D8UA 1ODFA 1JKJA 5B53A 4BMSA 3U80A 2ZIXA 4UHFA 2Y67A 1BW9B 2ZBDA 2BKAA 3DMHA 4BKOA 3BRWD 4Q4HB 2UDPA 4BLUA 1QH8B 4TV9A 4MK4A 1DCFA 1C9DB 3G85A 1HK7A 4P83A 4GPIB 3FHTA 2X4IA 1FRQA 3NHWA 1SRQA 2QK4A 4HAWA 4X8MA 1RLOA 2I87A 3HR7A 1RZRD 2DFDA 4LOJA 3QVJA 4YP0A 1TO1E 1YH3A 4LRYA 4YRDA 2E6KA 4DR5B 1ECFA 1P1IA 4H0FA 2DWQA 2JIZD 4E88A 4ECAA 2Q1WA 2WD9A 5EZ5A 4MS1B 1ZH4A 2WBLC 3NMUF 8AT1A 3RVSA 4UE2A 1H0SA 4D97A 4DBLE 3EZFA 4RPHA 3R3HA 4PX3A 2C2ZA 5TE9A 1ZU4A 1BVRA 3LRXA 5JZOA 5T6BA 3IPXA 4MTLA 1CE8B 3MD0A 4C6SA 3MOIA 1VDMA 2QG4A 3QLTA 1XQ1A 4F46A 5KVVA 5FORA 1WNTA 3KJIA 1EFHA 3WG9A 4DNXA 1I5RA 1U3WA 4BO0A 3ZDZB 5SV2A 1F48A 2YN2A 2VJOA 2XEXA 4TSFD 1V1RA 3RIMA 3B13B 1TZCA 1E59A 1PR3A 1P9LA 2OB1A 3EQ7A 4JS0A 4U7FA 4DYDA 1IH8A 1Z39A 2KB0A 1XZEA 5F2EA 3DF7A 4CV2A 1G6KA 1T4BA 1TXGA 1OWMA 1VFNA 4PC7A 4F1JA 1FDTA 3L18A 4HUJA 2PMDA 3PQ7A 2HWYA 2EL7A 1FFHA 1T24A 5K0LA 3AF3A 3ZD6A 5CJPA 4CM8B 4JI8B 2V1UA 4CF5A 1ESDA 4CL0A 3P97A 1JVSA 1U0OC 4GSKA 3S4YA 4OH7A 3U9SA 3IAUA 3ZXIA 1ZSNA 2ET6A 3ND8A 3FCEA 3GP3A 4OXQA 3KKLA 4AG5A 3QM1A 2Q6IA 3NV7A 2W90A 1DCKA 2D13A 2X1MA 3LUGA 3HSSA 3TMYA 5IZCC 1QE0A 1T10A 2GJSA 2OFFA 1MO2A 4L4UA 4FHZA 4O4HB 5GVSA 3ZDBA 2I1VB 3OQMA 3CRZA 1ONBA 1RWMA 4MS4A 1FYFA 1ZM7A 1E9RA 2H2AA 4OQDA 1XZHA 2CLHB 3X1YA 4MV1A 3TTXA 2WD7A 1T4MA 4ZVOA 4M8LA 4WXPA 1X1RA 3VZRA 2GAIA 3GZJA 4LTMA 1NVGA 3CEMA 2HY7A 3Q7QA 3KNZA 4OEHA 5H3LA 3NUZA 1VLVA 3D2CA 1AGYA 2WSSA 4UU8A 1P2FA 1KNXA 3C0KA 3CMMA 5EGNA 1U4SA 5KTOA 1NT2A 1XROA 3WLIA 1SXQA 2ZYVX 2HR1A 1EM8B 3EXIA 4AXXA 3IUQA 3M9XA 1GZ3A 4M54A 4CQMD 1TZ2A 2QJFA 3E9DA 1NXVA 2K5UA 4BE9A 2X5KO 3FKJA 4GZMA 2M98A 5ES4B 2X0KA 3R3UA 2XEDA 3F8WA 4MQBA 5G4LA 2C95A 1JHVA 3NWOA 4UUNA 3O0DA 3RREA 4TTQA 3V33A 2ZE6A 3LOUA 3AUJB 1RW4A 3WVNA 1YDGA 4M9CA 5J9FA 4ZRMA 5HCUA 2CD9A 2BZ0A 1K2WA 1Y1QA 2EP7A 2AGVA 3Q8WA 1N2BA 5EWLA 4YRKA 5FWNA 3CPSA 4P32A 4EFMA 5K0ZA 4BNLA 5ETJA 1VDZA 3D4BA 4I3HA 4DIBA 4KBFA 5DGCA 1QCCA 5IUJC 1SVUA 3NHYA 1E7SA 3MUFA 4PGFA 5BV7A 1E3WB 2BMAA 1G5PA 2QZ4A 3GA7A 4Q19A 4CQLB 1J0XO 3CKKA 4G8DA 4CYMA 4HQFA 4KODA 3LQYA 3PRHA 3OE7D 4URXR 1GD1O 1KC3A 1JQ3A 3I1IA 3SHFA 3PGVA 4G9BA 1GVHA 2YYAA 4NE9A 1KYZA 2VAXA 5BW4A 1XDUA 5BSMA 2AG1A 5HQTA 3ER9A 1P29A 3ROZA 2VSOA 3N28A 3VO8A 4M2LA 5C8YF 3QU2A 5FLKA 5C35A 2HU8A 2C54A 3H87A 4QUKA 3PCXA 4YJ2F 1D07A 3D0KA 3GLFB 5H7XA 3DZCA 1RYEA 2GDZA 3U4QA 3UUWA 4F4CA 2V6GA 1H8HA 3WGLA 3K9WA 3DE0X 1GGKA 3S2EA 3SC3A 3S6JA 2XNDA 1M2JA 1U0NA 4BVGA 3UMFA 1GRVA 5H16A 3ZIDA 4CQLA 1U5BB 4ENRA 3A32A 3CPEA 2VHQA 2ZR0A 3PPYA 4WUVA 4QU0A 1WXXA 2LNDA 2VDMB 3OJLA 1SUWA 3DOEA 5HA5A 4ARZA 2JFYA 4FUTA 4ZVKA 4TSRA 5CDFE 5JBNA 3EXEA 1LVGA 5C9ZA 2OCKA 4JDUA 1EVIA 2CXQA 5B7NA 1VG8A 3RU7A 4ZK2A 2RGEA 2D5LA 4LF4B 2ZCVA 1KQPA 5EPOA 3SBOA 4YJGA 3KUCA 3LPLA 4EY3A 2ZRJA 3AF4A 3OHMA 5DGIA 1A88A 4KFTA 4WN3A 3WOHA 2NPOA 5BMVF 3BWXA 2YZKA 1UMBA 4X7RA 1HQCA 3O4JA 4AKEA 4E94A 4B5KA 1I6KA 5AJUA 3MGGA 3R41A 2AV6A 3OKAA 2C5SA 1RWNA 4IJ5A 5HF5A 3WLLA 1CHNA 2VXCA 4DLTA 1E77A 2EQBA 4INOA 1A4UA 1QIMA 1KMQA 2NZ2A 2UV8A 3G1UA 3ZYZA 2FW8A 4EGFA 4MYSA 3X1JA 4XQ0A 4RVGA 4FXPA 3ILHA 3DMDA 4U7DA 1ULTA 3E03A 4RKFA 1RS0A 1T6BY 3VBCA 1W36C 5MDHA 3ZXSA 1DOAA 5F5XA 4OK5A 5CDTA 4HAXA 1P7VA 1UDAA 1Y0BA 3EC1A 3USZA 1PD1A 3E5MA 2R48A 1X39A 1ORWA 4UASA 1CS0A 3SF0A 3ZZUA 4JP3A 4QAJA 2C1EA 3C14C 1ENZA 2VZLA 3FA2A 4PGAA 3ZU4A 5LQKA 3LP6A 3AYXB 1AZTA 2VP9A 1M54A 4JIGA 1T36B 2FFHA 4X5OA 4RF2A 2JFVA 1E0AA 1U5CA 1KSFX 4AKHA 2HSDA 4JLNA 3KAKA 4HD8A 5KYWB 5T4FA 2YV5A 3W9SA 2P8JA 4FFWA 4GI5A 4RDHA 2HZ7A 4YUXA 2QJTA 1GGHA 1U0SY 1Q77A 1KZYC 1K8YB 1KFCB 2E37A 3HV2A 1H4TA 1EX9A 4YJ3B 3EZ7A 2ZQZA 5AVOA 3RC7A 2AFIE 4CM8A 3BC1A 2GK4A 4GM0A 4TT3D 1GT6A 4CEHB 3OX3A 1ZI6A 4BVEA 2O7QA 3CH7A 1E2QA 2VJQA 5AKIA 5J4HA 3COJA 5LLSA 4BGEA 1OW3B 1QPGA 1U99A 5AI8A 4CT4B 1ZJ4A 4Y1RA 1BEUB 3MAAC 4Q9AA 1KS2A 4HNRA 1KP9A 4Q9HA 4LI0A 4L4YA 1RBMA 4WRRA 4ER0A 3INRA 3H8WA 4INPA 3BB4A 3DLTA 4GYYA 4XGRA 3I01A 4D46A 2O1WA 2GHIA 2IEGA 5E7IA 4N76A 1GLVA 3B5IA 5CT9A 5DZSA 2W2TA 3ORSA 3D4PA 1NXTA 1SC6A 1MW9X 4I50A 2I62A 1FX1A 4MYCA 1ZD4A 4B6OA 4UCXA 2REBA 2QLBA 1CUGA 3AHFA 3TWOA 5JAMA 4F91B 2JBWA 1P4SA 4MSUA 4NS1A 4LOIA 1F8UA 1C0PA 2LD4A 1KJNA 2QPTA 2H9IA 4XJTA 2YV1A 1B7GO 4ZO7A 4EL0A 2FPPA 1VJDA 4B3IA 3T7DA 4UNQA 2AXQA 1X92A 2VJMA 4EHNA 2JDIA 4TTJA 5LOVF 3AEKB 2OV2A 1ZZGA 1KJQA 2Q3JA 4TL9A 1FLAA 1H2ZA 2AOWA 3K53A 2OCAA 2ZI6A 3F97A 4WZBB 2NVUB 1RI3A 2NXEA 4J1NA 1NW4A 3AHIA 5LA6F 2C7OA 4CM9D 1IXYA 3WYNA 1P73A 3IT3A 1TU0A 5GONB 3I0NA 1WB9A 3N2GB 5JAIA 1NVBA 3ZCRA 2O2DA 3B53X 1W48A 2WTMA 2EW8A 3EGDA 3LMKA 2I4RA 4ZVLA 3NHBA 3TN7A 4F4DA 2GEUA 2VCHA 1L4EA 4ND1A 2IF0A 3LCRA 3O9MA 5EVCA 2HM7A 5T8KC 4C3OB 1EGAA 3BWDD 4AQDA 3UM9A 1F60A 8MHTA 5D7NA 1YI0A 3GDOA 4L4RA 1R4ZA 2JD0A 1B6TA 3JV7A 1NT4A 4MWTA 1JKIA 2VSXA 2FP4B 3ZJYA 5EUMA 1ARZA 3WL8A 3E9ZA 1NF9A 3E2PA 2CGEA 1W29A 3OG9A 5B36A 5KX5F 1FJGB 4YJ2A 1T0PA 2DHDA 2QD2A 1QHYA 2BZSA 2R87A 4M55A 4LJSA 4UU1A 2JIDA 2FMUA 1C4OA 3CEJA 3D8BA 4N5LA 2VN8A 3DO8A 4PHFA 2O7NA 4RF4A 5AVJA 3QITA 2WSYB 4E08A 4AO6A 4KW7A 1OT3A 2GCOA 1SR8A 4BEVA 3V46A 4HNHA 5LR6A 2IEDA 4CCSA 3ZX4A 1OGYA 2OILA 3RT1A 3E1GA 1N3IA 4WJZA 4YECA 2GYUA 3FXAA 5ILGA 4JI4B 3IDQA 3S1AB 4WESA 2JGKA 1DAEA 1FS4A 2AVDA 3HKDA 5DTJA 3A2LA 3NPAA 4LF5B 2XYVA 1XU9A 2E0IA 3A14A 1O8CA 4KPEC 5TQJA 3HDQA 4R8LA 4U9UA 3ZVMA 3HGTA 6ADHA 1ZR2A 1BVYF 4M9SA 4D9NA 5LWHA 4L78A 4GYWA 1ZC3A 1XX6A 3RRBA 3WGGA 1EFAA 3RKUA 5HQ3A 4EI8A 2VP3A 4J0QA 4BJ1A 2B1IA 3STWA 3SQWA 3A1FA 3EIHA 4A0GA 2XCUA 2J9RA 4FGKA 4A23A 2YDXA 5I47A 4DIMA 1P7PA 2ZUBA 3FZQA 4C08A 4D9MA 4QT4A 4NFHA 3JWIA 4XCVA 4Y6GB 2CE7A 5ADVA 4V0NA 3OMXA 5EIOA 3D6AA 1VP3A 4IJWA 1SIUA 2ZU6A 5KUTA 1G21A 2GBGA 1JLMA 4BU1A 2YY5A 1G17A 3PWSA 1PWZA 2GCGA 2BFDA 1R88A 4RPCA 3BAFA 2NU6A 1GG8A 2PUEA 5SZIA 4EHHA 4GOJA 5CA1F 1XD9A 1ZEJA 4JY7A 1W5BA 5GM2A 2R79A 5BORA 1OASA 3KSBC 3WKDA 1NBOA 3R1IA 1VKRA 2YL2A 3H75A 3AR8A 1W8IA 2Q0SA 1Z15A 2WPDA 1H8EA 2VP5A 4YBRA 3OICA 4UFNA 5K09A 3V4OA 2HA6A 2N46A 3H2HA 2XTAA 2PZMA 3EMDA 3IIKA 4MQEA 4R98A 4U2EA 3DJFA 5DTIA 5EQFA 1N0WA 1P8JA 2VDWA 3K15A 4YT8A 4I7EA 1S0UA 3O8QA 4OMCA 1N92A 3OH8A 1J5XA 4X1IB 4MIYA 1FDWA 1QYXA 3S3TA 1K0FA 2BISA 2Y1CA 2CW5A 4EZEA 1M66A 1K5GA 4MIKA 5JRJA 3TB4A 1J0BA 2ZVJA 2Y0CA 1EU1A 4QPDA 5COAA 4PZAA 3PDHA 1Q50A 3A4NA 2QD5A 1R8QA 1W85B 4HS4A 4MGEA 4X93A 5CVCA 3UN1A 4EDFA 2P62A 3NUQA 2EARA 1AKRA 4AP9A 3RVPA 1RJWA 5CM2Z 1GPYA 5FCDA 2B6NA 3FOZA 3ONVA 1EK2A 3YASA 4FNAA 1WG8A 4R68A 1KVSA 3GD7A 1TA4A 3EGCA 3COVA 4TKVB 3K0SA 2XDQB 3HY4A 3QKRA 3DAGA 5FNVA 2OK7A 4MVJI 4UOEA 1SQ0A 3CF4A 2CZQA 4DJFC 1ATZA 1JEDA 1S7GA 1B93A 2AK2A 1JXMA 1MZPA 1ZBQA 3TGWA 4CZ2A 4KREA 2HMVA 2NM0A 3FPFA 3JX9A 3QG5A 1IMJA 5TEWA 2C57A 2AWOA 1VHWA 4KXLA 4OQZA 3T52A 1XKLA 3LUCA 4N03A 5E2IA 2IP4A 1BFUA 3V1KA 3BQNB 1DGQA 4FOLA 5JTTA 2C3UA 1BH2A 2EZTA 1U9YA 2O23A 4NS4A 3LOQA 4YNBA 5EHZA 1LI4A 1X1EA 4CMKA 3MWYW 3AVXA 2UUOA 2NUPA 1F2VA 2AZMA 2B35A 2NUPB 3L0DA 4OYLA 3DHVA 3KUDA 3RARA 1KEVA 4I1PA 1E3TA 1LDMA 3OHPA 1TM2A 1EDZA 3TUJC 1H0RA 4DR1B 3PC2A 3T7EA 5KNCA 2RGUA 5CYFA 2UVPA 4H17A 1DRUA 1ULUA 2Q4OA 2E4UA 1T8YA 3WOVA 1IRXA 5J5VA 4LF6B 7ABPA 5JCJD 2QVCA 1MIOB 1W9HA 1H9BA 4RHYA 3RVJA 1WZNA 4M83A 3UCEA 4FFBA 3PIIA 3Q8MA 3DCIA 4YP5A 1GL6A 2NUBA 3B3QA 3FUUA 3THWA 1N8KA 2F9MA 4DMKA 2GAAA 4A82A 3P0IA 2YY7A 4LJYA 5EJ9A 1NPDA 4FNGA 1HRDA 5A6VA 3FFWA 3MRSA 4KWCA 4X94A 4RTMA 3WGIA 4LNUB 4Y1EA 4XJVA 5H68A 3GRAA 3GO4A 3GLIB 4PX2A 2FPRA 5EHGA 4Q1CA 2VHYA 1XVUA 1H5UA 2DQSA 1SCJA 2YN4A 1T2EA 1XZBA 1V37A 1GPH1 1MVLA 1ZM2A 3RUEA 4Z7NB 1A8IA 5K0EA 7ADHA 1I2ZA 3OQIA 4JL8A 3OEYA 4QYWA 1GA4A 4P58A 4B2LA 2XZOA 2HJRA 5AK6A 3V8PA 5HF8A 4CMIB 5ULLA 1FSFA 2XLCA 3LVQE 1ODLA 1PL8A 4YS6A 2BKVA 1ZJ6A 2HSEA 3FFBA 4IO1A 3GNSA 3JQ9C 4GL2A 1CUZA 2F3PA 4WKPA 5BVHB 1NLYA 1J8DA 4FEYA 2C1ZA 2C2BA 4ME6A 3I9MA 2IELA 3KYIB 2C8LA 4H6WA 5EKUA 1YJ5A 4OVKA 2H52A 4IYRA 1AGRA 1RM0A 4LX8A 5IASA 4AMUA 1WCWA 1XUOA 3E5NA 4TT3A 5GVRA 3QQPA 3D4OA 1ODTC 4KN9S 3LFUA 1NYQA 2PZ8A 3KLNA 3LP5A 1EFPB 2QDXA 3QUTA 4OOFA 3K0AB 5D51S 5FOSA 3WAKA 1MVOA 2RI6A 2W2XA 1DX4A 4K1LA 4RY2A 3L1IA 5BNFA 1JA1A 5A4DA 1QK3A 2H1OA 3DVSX 4EG1A 1Y5MA 1UT8A 4MQMA 1ABBA 1T6ZA 2QRZA 4CM1A 2X9QA 5KAPA 5ALUA 4AWAA 5DBGA 5A5VA 3EPRA 1DFGA 2MSEB 3A4TA 5K4HA 3EISA 1CUYA 3PUIA 4FQ5A 3HO8A 4YVFA 5DM2A 1XE3A 3LX8A 1QB7A 1WAMA 4LQLA 3T94A 2PGOA 2ISCA 3WX0A 1K4YA 4Z3OA 3Q7EA 2FEMA 2CLMB 2R1UA 2XCLA 1KI8A 2E55A 4II7A 4E1VA 1MDFA 1I1OA 3QTLA 2E4XA 1ZH8A 3OCJA 4M0KA 4P3NA 3ZYCA 1IZYA 3ADOA 2G9ZA 3DKKA 3C3PA 2XYGA 4AI6A 4MR7B 1XR3A 2AMJA 1QO7A 4DJTA 2YWHA 1UFRA 5CNMA 5FI5A 5GONF 3HZOA 2ZI5A 3H5WA 5E1OA 4ZU1X 1Z56C 3SM9A 4Q34A 4MRNA 1SHUX 2A1UB 1Q1GA 1FU7A 3KZCA 2EV9A 3F6YA 4QUGA 1FOEB 2J9ZB 4ZANA 1UEXC 2OHVA 5AM0A 4MX8A 2QL6A 3Q7TA 1ZVQA 2OQIA 4XUCA 3ICWA 1NZJA 2B4TO 4G97A 2V7BA 3GEPA 1VIVA 1LQUA 4BMCA 4LOKA 3GUUA 4I50F 2VAVA 5TMBA 4DSAA 3QVKA 2BGMA 3A27A 4M1KA 4PLVA 3OIFA 2HK9A 2PFSA 2ZCJA 2WR8A 3DBHB 4LHVA 1Y5RA 3VZCA 1Z28A 1NYRA 1DJQA 3VDNB 3UANA 2CVOA 1KDTA 2A3RA 4EK9A 13PKA 1PFKA 2BGNA 2C29D 2GPNA 3D81A 2BHLA 4WY8A 3SJUA 2ZRKA 4E14A 1ZVMA 3M6UA 3WLEA 1MRSA 3UAYA 1TVEA 4ALNA 4C2TA 2XRFA 4C0XA 4YQYA 2R7AA 4DV6B 3B8HA 4NRDA 2AN9A 1R7RA 3R09A 4N7BA 2HJWA 3HBLA 3DL0A 3M4NA 4O0LA 2Y9MB 3ZHQA 2PPVA 3GA5A 1B0PA 1X0XA 2ONYA 1YB7A 2RHCA 4Q7KA 5E3IA 3TGLA 3DMGA 4BBPA 3S70A 1U2DC 1G19A 3WSWA 5MFPA 3KP1A 1PFQA 1FYVA 2WIFA 2Z9BA 3I9KA 5AHWA 4ZZ3A 3NHZA 3FR8A 3GUYA 2FSUA 3LY9A 2CYCA 1C3LA 2CHUA 4KSCA 3ZLTA 3EN0A 1EQAA 1S89A 2ZIUB 2J59A 4GW3A 3TZHA 4HV4A 5EZ6B 1QLJA 2Q1SA 5LYJF 2WOJA 1JWAB 3T99A 3PE4A 3R0JA 2WE8A 2C2XA 4UMEA 2Q5JA 4UKDA 4E22A 3E9YA 4Z4GA 1B4DA 5ENZA 1S3IA 4RTLA 3L7OA 4EH1A 4GPAA 2W93A 4G9EA 1HKHA 5F7JA 1PZXA 3VU3A 4DMCA 2ACVA 2H0QA 4F6RB 3JVVA 2N3ZA 4L8WB 1CKEA 3I42A 3D3EA 2JJ2A 3KSRA 1J9GA 4DNPA 2JAWA 5ICCA 4EYEA 5IH7A 2O2JA 1KK3A 5IM4A 2IYPA 5I8WA 1BU8A 1L7QA 3FNEA 4EY7A 2FQWA 2J67A 3FWYA 5I7SA 3BMNB 4PCUA 1ZG3A 3HCBA 1IAVA 2OAGA 3UK6A 2EKZA 2P68A 4DV0B 4IWNA 4QXQA 3A25A 3SXUB 3FGZA 2FLKA 3ZD8A 2O59A 2QM7A 4A9AA 4CU5A 1E2LA 3I45A 1ANKA 2GVZC 1MX5A 1IPEA 2YJ3A 1Q2UA 2OFOA 4XIJA 4BMVA 4D3XA 2BZGA 3HL0A 3ZD9A 4JLWA 1SIOA 1S8NA 2JIPA 5BN3B 2MMGA 1NLUA 2O05A 2I7XA 3OLXA 4Q3CA 3GHYA 4DCVA 3PIRA 2ATIA 1TT5B 1VLQA 2YFKA 4ZD6A 1B43A 2WI8A 1DQZA 3KB2A 2ODEA 4KPUB 2OWEA 4M1ZA 4UTXA 2ZE8A 2H06A 4BFWA 4YJFB 4KQFA 1VJRA 3EGWA 3HN6A 3NBUA 3F4LA 4FPXA 3EZ2A 1R5JA 4PZ9A 4ZO8A 4MLDA 4MCIA 1C9JA 3ANYB 3D2AA 1B8PA 2BM0A 2F43A 4PXSA 3FSJX 2Z5VA 2QG6A 1EHYA 2FX3A 4EI7A 5KB3A 4TV8B 4Q12A 4N48A 2J5QA 4F38A 1SXJE 2BMVA 3AM3A 1CJUC 3DFIA 6GPBA 1XZFA 3T3EA 4FOOA 3QPVA 3CX6A 1FP6A 1U02A 2C2WA 2PX8A 1KEKA 3UJNA 3VNVA 3L93A 3LQ1A 2JAPA 1I0IA 2XGSA 2HV8A 4A8JC 2OECA 3HJAA 2IYOA 4WNCA 3RQIA 4GNRA 3EDYA 2GF0A 3CNEA 4BKQA 4RQAA 4DLNA 5LNK6 1T36A 3O8LA 4NQZA 2OO3A 3TKYA 4F2DA 3ND5A 2M32A 4GXQA 4IAOA 5CT8A 5DLYA 2QX8A 3P2IA 1KFJB 2VCYA 3FTEA 3TR6A 5IYZF 1PS9A 2O3RA 2O54A 3HDTA 1EUDA 3QFRA 5EI5A 4HF7A 1VPVA 5KNCD 1E2IA 1TDJA 3H1AA 1S2DA 3TRJA 3ZKWA 4DM4A 1EB8A 4TYYA 4OXRA 1WW3A 2EBFX 1I1NA 1NUSA 3MXTA 3PRKE 3URKA 3V1NA 1GQSA 2FSIA 4PPQA 3PT9A 4C0JA 4EP1A 4F85A 4R41A 4OQEA 3C4JA 4C87A 3UJCA 3R40A 2AEJA 3BD7A 3MT7A 4FGWA 1UBUS 2Q5IA 4TKLA 4RTSA 2OCXA 2NMVA 1WDTA 3STXA 2GK3A 4OTZA 2OY0A 3LLVA 1IWPB 1LDYA 2IUEA 2Q9BA 2RHOA 3CE9A 5JFTA 3W90A 4BNGA 2Q5HA 2RDMA 4GAEA 1NR1A 1PT5A 2VATA 1GV0A 2WKRA 4LSGA 4YRTA 5FUWA 4DKXA 2YS6A 3L7JA 1E1CB 1GUBA 2FPSA 4ITVA 2FQXA 4JOQA 1JILA 5F2OA 1OVMA 4LWPA 5HYVA 2BFFA 1K98A 5EHNA 2QYOA 3CUEF 3WGJA 4FI3C 4RZUA 4WY5A 3D4LA 2V7XA 2C2MA 2AC7A 3I2GA 4JROA 2VDRB 4DDHA 1WO8A 3P9ZA 1DB3A 2OBNA 2QLFA 3QENA 2OBMA 1THTA 2FJ0A 2Q27A 3EXEB 3IUPA 3V1TC 2W22A 3QHQA 5CIWA 5G0UA 2GETA 3P19A 2HRRA 4IZ6A 3WLKX 4MVJA 5KVQA 5EJEA 2WOOA 1PYOA 4J75A 5D3KA 4BIMA 1CY4A 2O48X 3K70C 5B6PA 1N0IA 3DJYA 2J3QA 3H1BA 1HT2E 3OSZA 4V0LA 3C24A 1FX0B 5HX7A 2NP6A 2PVPA 1YZTA 2B4AA 4I4TF 3WL3A 3TTUA 3UHAA 3O8OA 2J85A 5JMWA 3BREA 4FC7A 5FBVB 2DJIA 2KS6A 3PS9A 3GLFA 3ZXXA 3U4QB 2CC2A 1DRJA 2ZTMA 3H6KA 3PNMA 2G5TA 4UHBA 5AWFC 3OOEA 2MCFA 3T1VA 3T06B 4DCCA 8OHMA 1JYSA 4IQ8A 2P4QA 3QEJA 1AHHA 1H2FA 1VSBA 2JFQA 1OV4A 1YQQA 4PNHA 4V0ME 3UBMA 4CLXA 3KQMA 5SY6A 4RLSA 5EWMA 3TFWA 5HIKA 2XVYA 1JA0A 1OXUA 1TKRA 4P5PA 4JVMA 2MMCA 4IIJA 1FFAA 3JU3A 4D1YA 4D80A 3ZR4B 1R0XA 3AXTA 4YDSA 3SR4A 1USIA 2FSGA 4JL5A 5DJ5A 3UMMA 4U7WA 1L7PA 3QLVC 1JIQA 1TPZA 3H9CA 2I1QA 4PCVA 3DKRA 3VSAA 4H6VA 2HADA 3I12A 1RQRA 5EUQB 1MNQA 1YE5A 4QFCA 1MIOA 4LJ4A 4V38A 4J7AA 1M2GA 3DXXA 1NUHA 4EITA 4BGDA 2QIOA 3LY5A 1VPTA 5ICMA 5KSYA 3DFZA 1DI0A 5ALNA 1MEEA 2VCEA 3OP1A 4F97A 2BEWB 1VJCA 1CSEE 3OJ0A 4ZVMA 4BMXA 2L82A 1CG6A 1WL8A 1XV5A 2VUIB 1A3CA 5JJIA 3GHHA 2B20A 2OPBA 4A3SA 1RC8A 4HKTA 4U3JB 1IY0A 4P7GA 3STHA 4YRQA 3W5VA 4C0WA 1ZMOA 3E15A 2Z5GA 1OC4A 3R6TA 5EJGA 3QPUA 3CB4A 1K7EB 1PSZA 5DNYB 4ISCA 3WYCA 4PLTA 4MWCA 5IJ9B 1EBFA 1PVOA 3VJLA 3GRVA 3COWA 1H5QA 4YRFA 3VUEA 4Y2HA 1RWWA 1MH1A 2NO4A 1RFGE 3KM0A 3TI7A 4BVFA 3EDCA 3ZWBA 3WL6A 2X5OA 5F98A 1J33A 4GUAA 3TDNA 3NHMA 3RYHA 4QYSA 4HH3C 1V6CA 5AM4A 1AOXA 1JEOA 1MX1A 1SJ9A 2AYZA 2M1XA 3GFPA 4NH0A 4NMLA 2GO7A 4PR3A 3OPNA 5IDXA 5ELLA 1QX3A 4Z4FA 3OMLA 3ILXA 4IKEA 2XDQA 2NZUG 3QKRB 4M7PA 3MRXA 5CJ2A 1ZVVA 3GZ4A 5EN4A 3TBHA 1JHUA 1K06A 1V25A 3HJNA 3KLBA 3ZOZA 1P9RA 2GRJA 2IIPA 1HC7A 2QQEA 3NIFB 4Y2VA 4ETNA 2IVZA 2XYQA 4NJOA 1FLNA 1HNNA 5HOQA 3JQBA 1XPOA 4R81A 1U0TA 4Y1GA 1ZESA 5EMHA 1BWRA 5EVJA 7GPBA 2QLJA 4UDYX 4OQFA 2I65A 3IAEA 4L9RA 4BRZA 2DG2A 3TLXA 3K9BA 1NJ6A 4JZKA 3W9BA 3VX4A 2RSLA 3OQBA 2OVBA 4US0R 3QFCA 5ALKA 5EERA 5BOVA 4OI4A 3BXFA 3RRZA 1JHXA 4DQKA 5KX5B 5JEEA 3U5TA 2DT5A 4MRAA 4ZXFA 3PNPA 4P36A 3PITA 3TIGA 5I7AA 2BFNA 5K45A 4GKBA 4Q9DA 2HGSA 5DLDA 3IRVA 2PA0A 3CW9A 1WV1A 3E5RA 1EP9A 2D1QA 2XMBA 3AR3A 5F1PA 4OLFA 4BRWA 1YXMA 1G2IA 4BP9A 2XCIA 4N7JA 1B8UA 2R751 3B70A 3BILA 4OP3A 5C7LO 5LKAA 4WD3A 3KKKA 3SLRA 3ZHXA 1B6SA 4BCCA 1H0KA 3DMPA 1C81A 3RS4A 3E82A 3HJGA 1E5XA 4DCSA 1DUIA 3BF7A 3PIDA 3ZCXA 2HQRA 2O20A 4E1AA 3Q98A 3IIIA 4N6NA 4NEGA 1OZAA 2XUFA 3OJOA 4CLRA 3QJ5A 1P2BA 1L7EA 1SHZA 2J0EA 2QKYA 2XUQA 3WK9A 5KTYA 2EIXA 4MUAA 4WASA 4I5E