3C1TA

Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
320
Chain Sequence
ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroflavonol 4-reductase
publication title Structural evidence for the inhibition of grape dihydroflavonol 4-reductase by flavonols
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 111
structure length 320
sequence length 324
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c1tA00
4Y8VA 1G0OA 4IZIA 4DBVO 1ULSA 2IEBA 5I9LA 1EE9A 1HYGA 3U4HA 1R12A 1DAPA 1KBZA 4NU5A 1CQIA 3VH3A 2AE1A 2Y1CA 3DC2A 2YY7A 1QKIA 4JBIA 2FSVA 1PS9A 4CM9D 4INAA 5TJ9A 1NQ5A 1XIVA 3AUAA 4XYGA 2O23A 5T57A 4RVDA 2QW8A 1IHXA 1XHLA 4HFNA 2I3AA 4D0RA 2IZ0A 4E0BA 4QEDA 1K5HA 4C7KA 3JD1A 4NJMB 4IDFA 3L4BA 3FCOA 1UAYA 2FPGA 1ZK4A 3KUXA 3HJAA 4RQUA 1LDYA 3OQ6A 4CLOB 1LRJA 4KQXA 4JXKA 1G6KA 3ONDA 4LVUA 5A9SB 5BR7A 1T1SA 2BFPA 1UZNA 3PP8A 1KEWA 1SB8A 2GYYA 3PHIA 2G82A 3RFXA 3RUCA 1GZ6A 5IDXA 3WYEA 5I9NA 4B3IA 2IE0A 2IXAA 1P44A 5ICMA 2YQ5A 3GOHA 2VOEA 4CMJA 2I6TA 2JD0A 1EUZA 2I3GA 5L9AA 3LT2A 2ZTUA 2O7SA 3BHIA 1VRWA 2O3JA 4MO2A 2ZK7A 3RUDA 1LQUA 1U4OA 4JNKA 5GZ1A 5H81A 2NLOA 3AW9A 3TNLA 4Z6KA 3KYCA 4DC1A 4M49A 2DQ4A 5DBFA 3MJSA 1D1SA 3JQCA 2VUUA 4NBRA 3WGIA 1OOEA 3LF2A 2DTXA 3QWAA 1IB6A 1J5PA 1HLDA 3I9KA 1JAYA 1N9GA 4E2WA 4L76A 1X7GA 3WLEA 3EW7A 3O8QB 5CDYA 5FYDA 3D4NA 4XX0A 5TS3A 4CM3A 2Y0CA 4BNFA 4EITA 3WSWA 4QSMA 2VN8A 1DBVO 3CMCO 1DAOA 1MP0A 5BT9A 4CV0A 1QV7A 4R5HA 1JVSA 1BXGB 2NTJA 1HETA 1LX6A 1N1EA 4IJKA 3ZWVA 4OQZA 3AWDA 2RCYA 1HDRA 1XR3A 4UEJA 1OAAA 2CMDA 2DBVO 1CWUA 4A27A 1JN0A 2V65A 2HUNA 4UREA 3UCXA 2FPIA 3LLSA 1UZLA 3PTZA 4K6FA 4P38A 4PGFA 3IKTA 3DOOA 1B3BA 4I5GA 4PVDA 3FNHA 4Y6RA 3RI3A 3UCFA 4BO3A 1Z82A 3DDNA 2FWMX 1YVEI 4AFNA 1B2LA 1GYRA 3K2EA 4J7CA 1A9YA 1MG0A 2GDZA 4B7XA 2W90A 4M54A 2W2KB 1RWBA 1UXKA 1W6UA 5IJZA 2PH5A 2Y93A 4GVLA 4CMAA 3DTYA 3ZH2A 5DN9A 2P91A 3K5PA 4F45A 3DZKA 3DBLB 3RWBA 2J6IA 1E7YA 4DPKA 1ONNA 1KYQA 5DP1A 4A0SA 1VSVA 4BNHA 4HNGA 3F1LA 1E1KA 1E92A 4B4VA 5AXBA 1MFZA 2H63A 4J9UE 4CLDA 4XB1A 4ZU3A 3GNTA 3Q0EA 2OBYA 3T4XA 3KXDA 3L0DA 5B12A 3K92A 4R41A 4XJTA 2PWZA 4YAJA 4Q3BA 1E77A 2D1YA 1E5QA 2E6UX 3IKVA 2CUKA 4IQ0A 4JJGA 2BELA 1WNTA 4BQRA 3ZWMA 1WXDA 5DNAA 2PGLA 1JKIA 2Y1GA 4J2HA 3LC7O 2R2GA 3DEYX 1HEUA 1JVBA 1UP7A 4FC7A 4XYMA 2J8ZA 3INGA 2ZYAA 1E7SA 2H1SA 1T2EA 1U28A 4J7XA 1VJTA 3AFNA 1SBYA 4H15A 3WTBA 4AJNA 2PK3A 4OIMA 5G0SA 1YOVB 3A06A 1VKOA 3EGOA 4WCDA 1IZ0A 2JJYA 4B7CA 3BAZA 2C82A 4P8RA 1PTJA 3PDUA 1E3SA 4BO5A 1PGOA 3ZU3A 4GSLA 4XGNA 4O5OA 4BNGA 1SZJG 4BHTA 2D8AA 2Q49A 2ZTVA 1F12A 1PEDA 1Y5MA 2YV1A 4IGEA 3MJVA 1AXGA 5AVOA 1Z74A 1FJHA 5A9TA 4E5KA 2DTDA 4OOFA 3AY7A 5KVSA 4TZTA 4O63O 2NSDA 3GAFA 5TT1A 3QWBA 2B35A 1O8CA 4HKTA 2I9PA 4MVJF 1AHIA 2FHSA 1X7HA 2VT2A 2AQKA 3GH3A 3UOGA 1JU9A 1KY5A 1JWBB 4K6CA 4R54A 3RKRA 3U4DA 1GYPA 1X14A 2BMAA 1VSUA 3E9MA 4TRRA 3DAGA 3JQ8B 4DTIA 3RSHA 4TWRA 4YBZA 4GQAA 3ZNQA 3I9MA 3JD0A 1A71A 3D3WA 4I8XA 2F00A 5DP2A 4BNNA 3UCEA 9LDBA 3WDSA 1ZJYA 4EI2A 4IDGA 3RD5A 3RUAA 1I36A 4CLXA 3MTJA 3RC7A 3M1AA 4MVJE 1N2SA 4J43A 4RVSA 4E33A 2ZB7A 4RF5A 1HXHA 1Y8QB 3LQFA 4BNXA 4R16A 2JHFA 1UXJA 4WASA 5F1OA 3ZCXA 2NU8A 4HADA 1R0LA 3E82A 3U4CA 4IMPA 5CDTA 5DBIA 2Q4BA 2Z1NA 4M89A 3BTOA 4DPMA 4BMNA 2X9VA 3GNSA 1VPDA 1EVZA 2HMWA 3JQAD 4RPKA 1E1LA 1OFGA 1V3TA 1W8DA 2ZTMA 4G81A 4NNJA 4DMMA 4U8GA 3WQSB 2LDXA 4KP7A 1IPFA 3DAFA 1OI7A 4NK4A 3WGOA 3DBRB 2PZMA 2Y99A 4U0KA 3NTOA 2O3QA 1BXZA 3W4JA 4FGWA 3PFWO 5CEEA 5CHEA 5EERA 1H6AA 1PJSA 3L9XA 3TL2A 5L95A 1BVRA 2NU6A 2Y68A 4YACA 5T6BA 4KDEA 5CFZA 1LC0A 1VKNA 4XR9A 3OBBA 4Y9DA 2ZYDA 3DZBA 3FBTA 1I30A 1FDTA 2HDHA 3OH8A 3P19A 3ICPA 1E6UA 4RORA 4CQLA 2CNBA 4Y6SA 2P5UA 1YB5A 3DZHA 4TKMA 1FDVA 4JP2A 1SC6A 1KVTA 4MKRA 5BNFA 1UP4A 3B1JA 3BYZA 4J91A 4AJOA 5JSFA 2VYVD 3AUTA 2EGHA 3X2FA 2OGUA 4MVJA 2BFMA 3ORFA 4YJFA 2YFHA 2BFOA 3GPIA 4W82A 3WGHA 1A72A 1HZJA 2GD1O 1KC3A 4LN1A 3ONFA 2UAGA 1CIVA 2DBRA 1HE5A 4J1SA 1PGNA 2BRUA 3KV3O 1GQ2A 4URFA 4XIJA 4WLOA 1H93A 1KIFA 2WEKA 5EJ2A 5KCZA 2PNFA 1EK5A 2Z1MA 2HRZA 3A9WA 3H2ZA 2FSSA 3JCZA 3JYQA 3QLJA 4M87A 1F17A 1LDNA 2JFGA 1YJ8A 2VYND 1BVUA 3EY4A 3ROMA 1C0PA 3R1IA 2B83A 3U62A 5JMPA 1LNQA 3N58A 3ADPA 1I3LA 4YVFA 4PLVA 5ILOA 2B69A 2Y1DA 4E13A 3I9NA 1LA2A 4ZQHA 3FBGA 4Z3DA 3V2UA 3VPGA 3AU8A 1SEVA 3CINA 1WMAA 4WNCA 3SX2A 3TWOA 1NM5A 4DXHA 2HKIA 2IEDA 4LRSB 1GQQA 1E3EA 4MIOA 3EMKA 1NTOA 3I52A 3NJ4A 4OMUA 3VAZA 3HG7A 1DDOA 3LT4A 3KETA 1Z75A 3D4OA 4FD3A 3V2GA 4CODB 3KZVA 1UDBA 2LDBA 3JV7A 3AFMA 4I08A 2HMVA 4J0EA 5BNTA 3PYMA 5ENDA 4YT8A 1T4DA 3P7MA 2R6JA 4CQMB 3LSYA 2JHGA 4IUYA 4LVCA 3ZZNA 3C1TA 1QMGA 1CJCA 4L75A 3PZRA 4IY1A 4LISA 2QYSA 2ZCUA 3JQFA 5G0VA 5A3VA 2JFHA 4FC6A 1SNYA 3JQFC 3VZQA 4BMSA 4IQ8A 3W8DA 1UH5A 5BSFA 4BO0A 3WSVA 4YJDA 3U5TA 1XG5A 2AHRA 3GNQA 1U9JA 2Y05A 4KUGA 1C1XA 1Q7BA 3V5NA 5I9MA 3GRPA 3AM3A 5AXDA 4ZICA 5TC4A 5L53A 1Q0HA 3GZNA 3MOIA 4BVAA 4TVOA 5A4DA 4OOEA 1T26A 2PTGA 2NNLD 5BSGA 3UVEA 3W1VA 4R3NA 1Z7EA 1I0ZA 3JQGB 1V8BA 4ROSA 1B7GO 3EVTA 3O26A 1ZVMA 1Z7BA 3W4KA 3U4IA 3SJ7A 5A05A 2X5JO 1QLHA 1J4AA 3X2EA 4DLLA 4MP3A 4CM5A 3G49A 4NMHA 3VPXA 1E6WA 5U1PA 1ISMA 5EQFA 1ENPA 1SCUA 1ZEMA 1LC3A 4YRBA 3RASA 1P0FA 4BNZA 1Y1PA 4KTTE 3BMOB 1JKJA 2C07A 4NFYA 2W4QA 1GUZA 3A14A 4X54A 5A5EA 1BWSA 1XU7A 2PV7A 2TMDA 3TZKA 1MXHA 2EW2A 1EUDA 3OETA 1U3WA 2O48X 2OZPA 4GWGA 4NBWA 1H6CA 2B4TO 3OA2A 3OEWA 4NFHA 2V6BA 5A04A 1ULUA 1R4MA 2QG4A 1DIRA 1W4ZA 1W0CA 3GAZA 2UYYA 3GLQA 3HZZA 4PLHA 4ZJUA 5KTKA 4D79A 1GD1O 4YB8A 1LBEA 3Q11A 2V7PA 4J6FA 1BDBA 1YWGO 3G1TA 4DA9A 4QXMA 2J3KA 4J1NA 3LU1A 1CQJA 4AICA 1B0AA 4E5PA 3H5RA 1UR5A 2PD3A 4RZIA 1AXEA 1SOWA 1U2DA 1DRVA 4XRGA 3C7AA 2Y1OA 4Q3AA 4EUEA 3OFSA 3NV9A 1EE2A 5C7OO 3SLKA 5KJCA 4GMFA 3JQDA 3AOEA 3GG2A 4BO2A 4TQGA 3KHUA 3AOEC 1KERA 4YWJA 4JK3A 3PWKA 4J0FA 2Y66A 4YEDA 1PJQA 3R0IA 5TQVA 2GZ2A 4AJIA 1N7HA 4D3FA 1YBMA 3KEQA 3IJRA 1LSUA 3PK0A 1YB1A 1YH3A 3E03A 4BNYA 2IDZA 2JD1A 4G5HA 2VWHA 3PGJA 1IHYA 1PGQA 3T7EA 2PGJA 4ID9A 5ILGA 2YHIB 1UP6A 3NGXA 3PWSA 1E3LA 3IOYA 3GR6A 3RU9A 2QZZA 4O0LA 3GVIA 3ZU2A 2GN4A 4LCEA 3B1KA 1G1AA 4CM4A 2OHXA 3SJUA 3K6JA 2DAPA 3KOUA 3AOGA 1Z73A 4UEKA 1GPDG 3M6IA 2DUWA 1RJWA 5DBGA 3NKLA 2GN8A 2C7GA 4NK5A 4XA8A 1XELA 3QWFA 4IMRA 3TL3A 2NTVA 4IDBA 4M86A 4EJMA 4EDFA 1GV1A 3INRA 3H8VA 3DFZA 4CMIA 3RQSA 3ZU4A 5KJ1A 1H9BA 2ZB3A 4BO4A 1S6YA 2B36A 3QVXA 1NQOA 1ZSNA 3AY3A 4L8VA 3I3OA 2BLLA 3STHA 1TT5A 3JYLA 5JAIA 4W7HA 1VE9A 4LK3A 3H9GA 1WDKA 2JD2A 4BNKA 4MVJP 5IXSA 5JNLA 1PR3A 1E6EA 4WK6A 3TRIA 4K26A 2WWRA 4J4TA 3BMCB 4RPGA 1YQXA 4XEHA 4BNMA 1PQUA 3U9LA 4B4WA 4EW6A 3KSDO 4XYEA 3S2EA 5A5FA 1YGYA 2R00A 3LVFO 2EGGA 2G17A 2IYOA 3P2OA 4B4UA 4I9UA 3UKOA 4XRRA 3CMMA 2R00C 4OSPA 1ISHA 1ZMTA 1ZZEA 2C7VA 3R3JA 1R66A 4ALLA 3FSRA 1NVTA 2AQ8A 3N7UA 3O38A 1M6HA 1PL8A 3DHEA 4U7WA 4UVDA 3S1LA 5IDWA 3GT0A 1EVIA 4CM9A 4R69A 4N7RA 3GGGA 3R6DA 1MG5A 4WLEA 4TRJA 4E31A 1GTMA 2PKQO 1FDSA 3I83A 4QTZA 1BGVA 3EZYA 1NBOA 5KIAA 3MEQA 3TSCA 3DOJA 2BGKA 2O2YA 5F3RA 4CM7A 1H0KA 3WGZA 2YYYA 4NH4A 4PLTA 1SAYA 4WLVA 1HKUA 1UXGA 1ZW1A 3ENNA 1P9LA 3GRKA 1U5CA 3Q3CA 4LMRA 4PZEA 4RVGA 3S8MA 3ZNNA 4DQXA 5L45A 2F1KA 1B14A 1I01A 3VDQA 1M2WA 2HJRA 2G1UA 3G79A 1I5RA 3F46A 4A7PA 1TEHA 5IAAA 3AI1A 1A7AA 3I6IA 3RJ9A 1NWHA 5JXWA 3GMDA 4TKLA 1E7WA 3WB9A 1YL5A 4J2OA 1Y9AA 4FSHA 3VZPA 1LXCA 4XYBA 1JA9A 4CM1A 2RH4A 3SBOA 1NR1A 5KVCA 2OXIA 5JDIA 4O59O 1T24A 1F06A 2VWPA 5G4LA 3W6ZA 5LDHA 1NHGA 4NJOA 1M75A 5JDIC 3A28A 4OAQA 5CG1A 4IZHA 3ETEA 1ZSVA 4YJFB 3PPIA 4CLHA 4CMCA 3NT5A 4XYLA 1EFKA 4BNJA 3ZWXA 5MGBA 3AM4A 2NQTA 3F4BA 1JAXA 2WMDA 5AOVA 3MJ4A 5B4VA 1EBUA 3LYLA 2J3JA 4ALJA 4BQPA 4BNLA 1U8FO 2FZWA 1ZEJA 3JQEA 4RF3A 2VUTA 3UFXA 1W73A 1NNUA 4IS3A 1C0KA 4YT5A 3OIDA 4L4RA 4E2YA 4DREA 2AQHA 3TPCA 3L4BC 1HL3A 2PD6A 2CVOA 5FI5A 2C0CA 4R1UA 2ZIZA 4J4HA 4YJHA 2AEFA 4OGWA 5IN4A 2C5AA 3JD4A 4ND5A 2JCVA 1U8XX 1LSJA 4Q3CA 4ILKA 5TGDA 2AEMA 3KLPX 4LW8A 2QQ5A 4OO3A 4NU6A 4L9RA 1DJQA 1N8KA 1GR0A 2YV2A 1NP3A 2X0RA 3QE3A 4ONEA 4YJGA 2GPTA 3ZWOA 2EKPA 2VZ9A 4P4GA 4R3WA 4BNVA 2OO5A 2Q3EA 4BB5A 4YAGA 4NZ9A 1EZ4A 3GHHA 3WNQA 2DPHA 2W2LD 4OH1A 2JFFA 5FEUA 3U49A 1E0DA 1AHHA 1KY4A 1VL8A 2CVZA 5K6AA 5K6AC 4PLCA 3ZV3A 3O9ZA 2O7QA 3OJLA 2VRCD 4EBFA 4TROA 5EQDA 4E3ZA 4JP3A 3IUPA 5F1KA 4EZBA 5JY1A 1GQYA 3AK4A 5G4KA 3DMTA 4FJ1A 4BGVA 3DMTC 5LDGA 1V6AA 2QX7A 3IJPA 3VVCA 1K0UA 2IYPA 1VJ0A 1ZK1A 3F5QA 4OXNA 4CR8A 2Z5LA 1NAHA 2O3TA 2ZYGA 1HDGO 3MJTA 4ZQEA 3S55A 3ZWNA 4A03A 4CLRA 4BNUA 1EEHA 1MLDA 1TI7A 4W6ZA 4J9VA 1HE3A 4A5OA 1B8PA 2O2SA 2Q2VA 5DT9A 2ZB8A 1R4NA 5L3ZA 4GVXA 1YQGA 4AJ4A 3U09A 3BMNB 2B4RO 3IDSA 5ER6A 4CV3A 2NU9A 3JYOA 2PZJA 4DGSA 1TB4A 3JD2A 4YDRA 2YQ4A 4DRYA 1HSZA 4GKVA 2GN6A 1ENOA 2EERA 1O94A 1UUFA 1HDXA 4WGGA 3QY9A 1N5DA 3S2GA 2CD9A 1Y5RA 2Q46A 2DBZA 1KC1A 1O0SA 1V0JA 1YJQA 4Q3DA 3UF0A 3F9IA 4HV4A 3OSUA 3GEGA 4D7AA 4PVCA 3K2BA 2ZJ0A 1K3TA 2Y1FA 4IIVA 1BHSA 3B20A 5BSHA 4R5MA 2X0JA 4I5DA 2I66A 4J90A 5I7EA 1YBAA 4IJVA 4QECA 4MP8A 1PS8A 2IXBA 4P4LA 4P4NA 2BH9A 3OQBA 4N5MA 4E6PA 5CG2A 4TRNA 4Y98A 5EL0A 4M1QA 4G65A 4MINA 4CL3A 4CQMD 2C5EA 4DPLA 2YZ7A 2EIHA 3DO5A 1B8UA 1HDCA 3DTTA 3WWYA 4DVJA 3ZNPA 1CF2O 4LCJA 4MVJI 1EVJA 4ZQBA 2EJVA 2JKVA 1E7RA 2SCUA 4U6QA 5L7WA 2P5YA 1MC4A 3WLFA 5CDUA 4KUEA 1JDJA 3K9QO 3UN1A 5CAEA 4QX6A 2O3RA 1RM0A 2GZ1A 1PGJA 3AI2A 4DYDA 1JWAB 6LDHA 3C24A 3TOXA 5T67A 1E5LA 1I2CA 3GEMA 1QYCA 4MVJH 3HN7A 1MV8A 2PLAA 4ALKA 4FB5A 1Y8RB 5JBIA 2Q2QA 5I7FA 4Z0HO 3PJFA 5U4QA 4KWIA 4AJ1A 3H9JA 4NBUA 3RFVA 4KQWA 5TT0A 1KVRA 3ANNA 1ISGA 5HWSA 3DBHB 3PQEA 1BG6A 1WZIA 1EQ2A 2B4QA 2EXXA 3DZGA 3G0OA 3WNVA 2NWQA 3DBVO 2D3TA 3WTCA 1Z6ZA 4B7UA 2EP5A 5A06A 4JCOA 4BKRA 6ADHA 4MKZA 4E30A 4R1TA 3ENKA 5G0TA 2X0NA 3W4IA 1V3UA 3DHNA 4PZCA 3JQAA 1SEPA 1U7TA 2RHRA 3NT2A 4MPDA 3GVXA 4ALNA 2D4AA 1WW8A 3LT0A 1ZKMA 3FF4A 4DUPA 3S2FA 4QFCA 1BSVA 3ZWCA 3JQ7B 3JQ6A 3UAGA 5JO9A 4RQTA 1ZIDA 2I67A 5TNXA 3TZHA 1P1RA 1NQAO 1B26A 4D3SA 3KYDA 1PR9A 1B3RA 3PJEA 3C7CB 1DC3A 3FR7A 3ZI0A 1LSSA 1R15A 2AE2A 2D0IA 2HK8A 4RLSA 2VUSA 3QWHA 2HMSA 3NTRA 1F14A 3EYWA 4FJ0A 4KZPA 1ZCJA 4II3A 4E2XA 1P0CA 4FS3A 1WP4A 3HHPA 1NFFA 1XA0A 3JD3A 1OMOA 2P4QA 4CM8A 4CMIB 4D44A 3KEOA 3KB6A 1K89A 2RHCA 3HN2A 2BI7A 2JCYA 3VPHA 2QYTA 1U3TA 2VYVA 4DMLA 1TT5B 1SOVA 4EUHA 3VKUA 3PHJA 3PYLA 5FF9A 1EVYA 3OECA 1GFSA 1QYDA 3CEAA 3UXYA 5LC1A 1P74A 3TZ6A 3L6OO 5DULA 3PI7A 5HBRA 1AE1A 3DONA 3OQ1A 4MJLA 5H82A 1XLTA 2C59A 3EC7A 3ZWWA 4XDZA 4F46A 3FD8A 1T2DA 2I99A 2AXQA 2DFVA 2O3UA 1GAEO 3FWZA 5ICSA 3NX4A 1GEEA 2UUPA 1TVEA 4DQVA 3CH6A 4GGOA 1G0NA 3GK3A 1YBVA 3GPDG 1YS4A 3G17A 4OL9A 5DZSA 1B16A 2UUOA 3ZHXA 4DBZA 4I5FA 4YYZA 4DLAA 4HFMA 2HU2A 4A10A 3WS7A 3QSGA 2ET6A 2VYNA 3FPLA 3ZV6A 4E12A 4GBJA 3ZW8A 3I5MA 3ASUA 1H2HA 1E3WA 4WCFA 5BQFA 1PJ3A 1IYZA 1E7MA 2PZKA 1QORA 4R4JA 4WCFC 2DU8A 1ZK3A 3NAQA 2YW9A 2WYUA 3AJRA 3PHHA 2W8ZA 1I24A 4DQUA 1LDEA 1ZK0A 1VJ1A 2PR2A 2QRLA 3VVBA 5KVVA 4RPLA 1KEPA 3LC2O 1Y6JA 4JBHA 3SLGA 5JDCA 2B5WA 2RBEA 5T5QA 1LLCA 5JDCC 3QWIA 1SMKA 3ROQA 2Q45A 3ST7A 4N5LA 3BMQA 3CZMA 3NYWA 2CF6A 4XQEA 4XWYA 1PS0A 4RLHA 3ZU5A 1Q0LA 1GZ3A 3QV1A 4Z3KA 1HRDA 1EBFA 3M1LA 1WLYA 5CPFA 2VWGA 2GLXA 4AL4A 4EJ6A 5L4SA 4J1QA 2V6MA 3WMXA 4ND4A 1EDOA 1KEUA 1YQDA 4LRTB 3NUGA 1A27A 4W9NA 4CMEA 1ISJA 1FK8A 5DF1A 4W9NC 4TMFA 3MCVA 1S7CA 4CMEC 3WGGA 3LZ6A 5TIIA 1DFGA 4AJKA 3LK7A 3PXXA 2G76A 3E5MA 1QSGA 5F1PA 2GN9A 1PZHA 3RKUA 4JGBA 5DDIP 4UAGA 4AG3A 1EK6A 1V35A 1LJ8A 1PJ4A 4NJMA 2IZZA 1VC2A 4JLWA 1NPYA 1P1JA 2Q4EA 5JAQA 1R37A 1UDCA 4DIOA 4YJHB 4MOWA 3GGPA 4ND1A 2BGLA 3D64A 2J3HA 3QP9A 5ENVA 2CSUA 3PQFA 4NG5A 3Q9NA 1PIWA 3GN2A 3DFUA 4HFRA 4GX1A 2GERA 2XOXA 1RM4A 3H6KA 1K6XA 1QYXA 1GCUA 1NFRA 4Z9XA 5L4LA 1P1HA 3DR3A 1KVUA 1X0XA 3OICA 1KVQA 4XQCA 1HDOA 4UVIA 4U5QA 3WICA 4KMSA 1O95A 4E5NA 3GDGA 3O03A 5T8KA 4HXYA 1VLLA 3KYCB 5T8KC 4AJLA 3P2YA 4BL5A 1XGKA 3LDHA 5A3JA 4GI2A 1UAGA 2FY8A 4CPDA 3ETDA 4I5EA 5F21A 1ZSYA 1ZO8A 4NI5A 4PLZA 1U5AA 3GVPA 4HUJA 3HDYA 1H2BA 2JL1A 1QV6A 3I23A 2V6FA 4FJ2A 1N9GB 3HUDA 1QP8A 1IUKA 3NEPX 2HAEA 1PJCA 4ALIA 4E5MA 5GMOA 1PL6A 1P3DA 3FRJA 1M67A 1Q0QA 3O8QA 5COBA 3V8BA 5JCXA 5JYEA 4RVFA 4KDFA 3G1UA 2NACA 1UZMA 3TQHA 3L9WA 3SEFA 4MDHA 1ZXBA 1BXGA 1U2GA 2HO5A 4FDAA 2OUIA 4ZGWA 1IPEA 3AM5A 1E3IA 4UVHA 2WE7A 5KJ6A 4Y67A 4B4OA 5FWNA 3KO8A 4N18A 2UV8A 4WOJA 2DUUA 2J3IA 4IPTA 5A03A 4TZKA 3RVDA 3MWDB 1YL6A 1UDAA 2DVMA 2CY0A 2W2KA 4IINA 3RBZA 1PSDA 3A1NA 1J0XO 1GCOA 4KWHA 5HTOA 2P4HX 3ADOA 2GCGA 4UULA 3MTGA 5TSDA 1NR7A 9LDTA 2AEJA 1HTBA 1MUUA 1ARZA 3EZLA 1RYEA 3FI9A 5T64A 4WJZA 2Y67A 4RF2A 4EEXA 4YAIA 2OFPA 1X15A 3PIIA 5F5LA 3K73O 1DJNA 2GZ3A 4WLUA 1CERA 1H6DA 3LC1O 4GLLA 3AUUA 3QIVA 3DZIA 2VTEA 2VOJA 4UUOA 3E8XA 1BDMA 4P22A 1DSSG 5KWEA 1NYTA 2GASA 1PWZA 2X58A 4RZHA 3RIHA 3KSZO 4S3MA 4EYEA 3NRCA 5EMHA 1C0IA 4FN4A 2Q2WA 2GF2A 4YQZA 1ZJZA 2EKQA 4FFMA 4WUVA 4IDEA 3I4CA 5ER9A 1K6JA 3GHYA 3BTVA 4L74A 1OC2A 5CDSA 2ZJ1A 1D3AA 3FN4A 3ZWAA 1DFIA 3CXRA 2V6GA 3VH1A 2WYVA 5C7IO 4J1TA 1PL7A 4RPJA 4AJPA 1WPQA 1AUPA 2IODA 1XQ1A 3JQBA 4IJUA 4GL4A 4ALMA 4ZRMA 5IG2A 3HDJA 3JQBC 5JW6A 3M2PA 2AQIA 1ADFA 1LDMA 1A7KA 2EEZA 3WOHA 5I8ZA 5DOZA 1PJLA 4BGEA 3PGXA 1AN9A 2WM3A 1WZEA 3JTMA 2WYWA 1ZH8A 4FCCA 3N74A 2PA3A 1Q7GA 2DT5A 4J7UA 2J5QA 5JC8A 2WD7A 3L07A 2ZQZA 3GDOA 4XIYA 2G5CA 2P9CA 1C1DA 1HF3A 3ITDA 1HE4A 4R9SA 2DTEA 5JCJA 3UH1A 3RC9A 3PLRA 5A1TA 4K9DA 4MIEA 3IIEA 7ADHA 3PLNA 5JYDA 1QRRA 1U1IA 3IQDB 4K1LA 2X1HA 1LUAA 5IDQA 1WVGA 2VTDA 2DBQA 4FFPA 4WLNA 1ENZA 5JC1A 4NBVA 3VKVA 4BKOA 4B3HA 3FNGA 1X7DA 2X22A 4J3FA 1I3NA 4YA6A 3IC5A 1E1MA 1RYDA 2NQ8A 2VRBA 1MX3A 4CLEA 3D3WB 5C3MA 4IM7A 1E1NA 3JQ8A 3SC4A 3Q2KA 4BKUA 4R1SA 3TZQA 5C5IA 3FWNA 3GC6A 3OMLA 4BB6A 1XKQA 2FZEA 1ADGA 3NJ8A 4OJNA 1R6DA 4PLGA 1Y7TA 3U0BA 2YDYA 4GKBA 4MIYA 4RCVA 5BNIA 1O89A 4PG6A 3BTSA 3I4FA 4O6VA 5FI3A 4H7PA 2FOIA 2PGDA 2X9GA 3RCBA 4F3YA 2Y1EA 5ADHA 3VDRA 5JPIA 4CUJA 3DB2A 4E21A 3CIFA 4GX2A 3ZWBA 5H83A 4IIUA 2VNSA 5B1YA 2BHLA 1NQTA 4YRDA 5EESA 2X9NA 3WR5A 1V3VA 3H9EO 5TF4A 4AVYA 4D3DA 2E82A 4RO0A 4CL8A 3CE6A 2Y0EA 4GAEA 3D7LA 3SC6A 1MFPA 1PJTA 4FQ8A 1O5IA 3F4LA 4R68A 3W8FA 1JLLA 2B5VA 1GU7A 3DBRA 5DCUA 2YV3A 4BUCA 2BI8A 2E49A 3KYBA 5B37A 4CV2A 1F8FA 5HS4A 4FFOA 1P1FA 1VI2A 4FFRA 1DFHA 4GH5A 2C54A 3O4RA 1U7HA 1H6BA 3PIDA 4OKNA 1F0YA 2H9IA 3CSDA 4W7IA 3UICA 5I8WA 4BO8A 4CQLB 2CDAA 1M6WA 3L6EA 3NTQA 3JYPA 2VHYA 4TRMA 4UVEA 1YB4A 1E3JA 4FR5A 3GF4A 1I2BA 1LU9A 1V9LA 1M76A 4XQGA 4DLBA 5AXAA 2GGSA 3LF1A 3QVWA 2W2LA 4C4OA 3WGTA 3DXFA 4GSKA 4L4XA 3ANLA 2YDXA 4ESOA 2P68A 3HFGA 4RGBA 3GFGA 4ZRNA 1FDWA 5C7LO 3GZ4A 1D7OA 4WKGA 1C3VA 4OXKA 3ZNOA 4PRLA 3IL2A 3I6QA 1C14A 4I9NA 1ID1A 5KVQA 2IZ1A 2AG8A 1IE3A 4XKJA 3D4PA 1CETA 4JX8A 1BXKA 3K30A 2OBNA 3CTMA 4BV8A 2HLPA 3W6UA 3EK2A 5G2OA 1LSOA 3GY0A 5TRTA 2NM0A 1DC5A 1E7QA 5K0ZA 4YCAA 3UHAA 1D1TA 2EW8A 2XPCA 3PWZA 1YXMA 4OM8A 4EUFA 4PLWA 1TT7A 2ZATA 2YJZA 1N1GA 4DYVA 3PJDA 1BW9A 4AJJA 5F5NA 3NDRA 4Z9FA 3QVSA 2EHDA 1PWXA 4CUZA 2TMGA 2FMUA 4IDCA 1HSOA 1YONA 4YAEA 4EJ0A 5TJHA 4Q39A 3WGYA 4O1MA 4DL9A 4H3VA 3HFSA 3ZGYA 1IY8A 3L77A 1I3MA 3NDIA 4H16A 4ND2A 4XQ9A 3RUHA 5JO0A 1NFQA 3DL2A 2UDPA 4RV9A 3T7CA 4BO9A 3E9NA 3IS3A 4PG4A 3P5SA 4W99A 5GZ6A 1BMDA 2YUTA 3HSKA 2X5OA 3WX0A 4JJFA 2CFCA 1HE2A 4FOOA 1Z45A 2Q99A 4IBOA 1X13A 1WWKA 4Z0TA 3L6DA 1JW9B 1YO6A 1ZMOA 4JBGA 1PU2A 3ASVA 3MWEB 2NU7A 4CQMA 3WIDA 4IS2A 1U4SA 1OZAA 2BKAA 2DFDA 3RC1A 3OP4A 3MZ0A 5CEJA 5L7YA 2X86A 2A4KA 4YXFA 5GZ3A 4DWVA 4YTEA 2GR9A 1RM5A 1C1XB 1KEVA 1RM3A 4NHEA 5A02A 2P9GA 5JY6A 3GZNB 3OA0A 3Q2IA 2RAFA 1DXYA 1J49A 4QO7A 3E48A 2VHXA 4YRAA 1P45A 3RU7A 2C29D 2AG5A 1XWFA 5ITVA 3C3XA 4BS9A 2VZ8A 3GEDA 3V1UA 3HDQA 3JQGA 2QRKA 3DZFA 3VTZA 2WJPA 3WYBA 1BTOA 3RROA 1KETA 3F1KA 3K96A 3OIGA 4PG7A 1QYWA 4QFDA 1KOLA 4ZVVA 1JQBA 4XGIA 1MC5A 4AJEA 1H9AA 5GY7A 5COQA 4CM6A 2ZB4A 4GWKA 4PIVA 4AJHA 1IL0A 1GYQA 2HQ1A 1M66A 1LRLA 2ZQYA 3AU9A 4R9RA 4XCVA 4FFLA 3ZHBA 5JS6A 3B1FA 2AA3A 1ONPA 3TJRA 5HS6A 3RJ5A 3F5SA 3KM0A 2CVQA 4BOYA 3MOGA 1LLQA 2XXBA 5IN5A 2WSBA 3BA1A 3BMOA 3AUSA 3DQPA 2BD0A 3QRWA 4UVGA 5THKA 4UUNA 1YKFA 3PHGA 4FPXA 1CDOA 2O4CA 2J5KA 5I7VA 1R4MB 4EEZA 1MXFA 1TXGA 3VPSA 1PJ2A 3DZJA 1OBFO 3E18A 4UUPA 4MVJM 5G0WA 1QG6A 4QT0A 1LI4A 3A4VA 3E6AA 2H6EA 1VL6A 1PZGA 3FTPA 4D43A 3ZW9A 1ORRA 2H5LA 4BV9A 3HQ4O 1DO8A 1GDHA 4BKPA 4RL6A 4F6LA 3ICCA 2FR1A 3E9QA 3ROKA 2X0IA 1EMDA 2OL4A 4NIMA 4PLYA 1PQWA 1Q1NA 1GUYA 1UXIA 3ZDFA 3PZBA 4PG8A 1NPDA 1XSEA 2GRAA 3QVOA 1I32A 2D2IA 2X8LA 3PEFA 1GY8A 4FGSA 3V2HA 5IZ4A 1R16A 1YDEA 1NWCA 2I76A 4ZA2A 3ZHZA 1X0VA 2EG9A 4B8ZA 4BGUA 5IDYA 5BSEA 3WBFA 1HZZA 2NVWA 3OF2A 3TFQA 1TA4A 4XJSA 4EGFA 5IFLA 3NT4A 4CV1A 1L1FA 1SB9A 4IXWA 3TZCA 3MJEA 2YHIA 2X23A 3D1LA 8LDHA 2JAHA 4FBGA 2WD7B 1HLPA 4CM4B 4K28A 3COSA 1C1DB 3RC2A 3HNPA 1LTHR 2G0TA 4HBGA 3TDKA 3VOSA 1ISIA 4PRKA 1YL7A 1DB3A 3L4SO 3WXBA 1DIHA 4QO8A 1KVSA 3SVTA 2VWQA 4PZDA 5JLAA 2E4AA 2EKLA 3PFFA 5JFOA 2P2SA 4DC0A 1XU9A 4F6CA 3WMWA 4R1NA 1N92A 5B4TA 2QRJA 2Q1TA 3EDMA 2CF5A 4Q3EA 3IAHA 2PZLA 3ZWYA 2HRBA 3B6ZA 4FOSA 1EFLA 3GGOA 3H2SA 3AI3A 1TLTA 3RBVA 3JYNA 4BNTA 2GSDA 4OQYA 3VH2A 3GN1A 1DLJA 5J23A 1SPXA 4L4SA 2QIOA 1CYDA 2VHWA 2OP1A 5A9RA 3BMCA 3IUSA 1D4FA 2RIRA 1DEHA 1ZXLA 2FRDA 2NV6A 3PJGA 5AYVA 4KOAA 4U0JA 4JQCA 3B70A 3FTNA 3HDHA 2OMEA 1CEQA 2X6TA 4G2NA 4BO6A 1GV0A 5EINA 2HMUA 4NFSA 1BRMA 3DMYA 4NDNE 3H9QA 3QJ5A 1IOLA 5ITWA 4MP6A 4FFNA 3H3JA 1ADBA 2D5AA 3LLVA 4XD2A 1H94A 3NGLA 5K9ZA 3ABIA 4J49A 1YDWA 1J6UA 2BF7A 2C20A 5B4UA 4I1IA 1A4IA 3RBXA 2NVUA 1MA0A 4PCVA 4ZHSA 4Z0PA 1WDMA 3LT1A 1XCBA 2E48A 5TX7A 3I9OA 3GVHA 3R3SA 2UVDA 4L0QA 3VZRA 4ZD6A 1NAIA 4E5YA 5DOVA 1LLUA 3E1KA 1DHTA 1UXHA 4WLFA 3F3SA 3H5AA 2X4GA 1Q7CA 5L51A 3ULKA 3OHSX 5ES3A 1NASA 2VQ3A 3GMSA 4D46A 4J16A 4XB2A 4ZQGA 4D41A 2Q50A 1NPTO 3FNEA 4II2A 1T2CA 1GADO 4U6SA 3W8EA 1ISFA 3BTUA 2GNAA 3EAGA 3QHAA 2C2YA 1PGPA 5KJFA 3IP3A 3OIFA 4JJIA 1DIGA 3OJOA 1GZ4A 3H4VA 4CMGA 1T2AA 3WIEA 2PD4A 4TVBA 1PJBA 2FR8A 3TFOA 1P1IA 5KKCA 1QYVA 4GX5A 4R01A 5JAZA 1LEHA 5HM8A 3EHEA 1X1EA 3M2TA 1XQ6A 4B79A 1WMBA 1I3KA 3JQ9A 1YE3A 2EP7A 2DKNA 1H5QA 3RUFA 3EVNA 3QQPA 3JQ9C 4WNIA 3DOCA 3OJFA 1O6ZA 3ZV5A 2Q1SA 4JIGA 4BO7A 3KRTA 1RKXA 2OP0A 4YQYA 4BKQA 1GEGA 4CLOA 1GPJA 4HFJA 5JAMA 1I8TA 5A9SA 5CDGA 2D5CA 1L7EA 1I10A 1BW9B 1ONOA 2HMTA 3BHMA 3D5TA 3PRJA 3ZHYA 4QUKA 4JROA 1IULA 5EN4A 2I65A 1QLJA 1AGNA 2CZCA 5TLSA 4YJGB 5EPOA 3WJAA 1P31A 4D42A 3DHYA 2DLDA 1P33A 3K8ZA 3ETGA 1GL3A 2HK7A 3BXXA 4BNWA 1ZK2A 2NUAA 1ZUD1 3ONEA 4OXYA 2IRWA 3E5RA 4RDHA 2WTBA 2XXJA 4MVJD 4Y6PA 4IXTA 3WQRA 4D0SA 4IDDA 4IDAA 1PZFA 1K6IA 4WECA 1B15A 2HJSA 3PYXA 4S1VA 4PFJA 2ZKLA 2A92A 3WYCA 1HDYA 2JAPA 5DCWA 5G4KB 5CPBA 1ENYA 2GUGA 1R0SA 1Y9EA 2BGMA 2C2XA 2DM6A 2O3SA 4FW8A 4E4YA 2VCYA 1LDBA 4UUMA 4WOKA 4A26A 3VC7A 2A35A 3KSUA 3VHRA 5JMWA 4BO1A 3CZRA 4CLRB 2PH3A 4Z9YA 2XAAA 4B3JA 5LCXA 3H9UA 1T4BA 1R4NB 1I2ZA 3Q6IA 2B37A 3UUWA 2XF8A 4PLPA 5AXCA 1DIAA 3UW3A 1DC6A 3H5NA 3VZSA 3C8MA 5FFFA 1LLDA 4DIFA 3ANMA 3BMNA 2HK9A 3U3XA 1HWYA 4GX0A 1PZEA 1PQPA 4GGPA 2O4UX 1U3VA 2B0JA 4ZQFA 4BMVA 1A5ZA 3PVZA 1NVGA 5C37A 1FF9A 5IF3A 2JCXA 2GO1A 3S2IA 4WPGA 1Y81A 2EWMA 4AJ2A 4M8SA 1HDZA 2A9FA 3PDJA 4E32A 3ITKA 5L40A 3DBLA 1HT0A 1FMCA 4BNIA 4WEOA 2FPPA 2PKRA 3RUIA 3HB5X 4N5NA 5JE8A 2WE8A 2ZTLA 3RAJA 4TSKA 1VM6A 2YHUA 1JKFA 2POQX 3ROPA 4C7JA 4RPHA 3OM9A 1ML3A 4B8WA 4FIZA 4ND3A 4PG5A 4YPOA 3T4EA 3INTA 4NBTA 4ITUA 3C7DB 2QHXA 1B8VA 2W98A 4PLFA 1WDLA 4RVUA 2FN7A 3OJ0A 1PX0A 4CR6A 1EDZA 3CKYA 5MDHA 3D5QA 1T2FA 5KNLA 4WEQA 2O50A 3F47A 3I9JA 3ON5A 2DC1A 5KJEA 1OC4A 1FXSA 2RH8A 3KTDA 4R51A 3BZUA 3EUWA 3WQQA 3RFTA 4HY3A 1XYGA 3JSAA 3WGQA 1Y8RA 3Q1LA 3ZN2A 1YOVA 2CDCA 3CUKA 1P1KA 3I1JA 1A9ZA 5HA5A 3WFIA 4LSMA 1QXSA 3DBHA 5DCYA 4XR4A 1NX6A 2VHVA 3GQVA 2J5RA 1ZFNA 1DLIA 3F6YA 5CEFA 5CP8A 3C1AA 1CRWG 1U3UA 5U9CA 1ZNQO 2Z95A 2EJWA 3HB4X 3JQAB 3OEYA 2PY6A 2I5PO 1EQUA 2PKQP 2D59A 1FDUA 4OKIA 5HRUA 4BGIA 4XDYA 3SXPA 2BFAA 4RJTA 1X1TA 5IXYA 4JN6B 4RDIA 3RUEA 2VT3A 4A73A 2CDBA 8ADHA 5THQA 5KKAA 1T1RA 4GPD1 1DIBA 5KOIA 3OJEA 3FR8A 1K2WA 4LMPA 3UGKA 3JQ7A 4ZN6A 4CMHA 2X5KO 4YR9A 3GUYA 3KYDB 3GG9A 3IP1A 4N54A 1A4UA 1T25A 2X7HA 3NDJA 3WJ7A 4KTVE 2DPGA 1VL0A 4XZ3A 1MB4A 3HADA 1N7GA 3KVOA 2A94A 2OOSA 1Q2XA 1I33A 2YFQA 4LGVA 4OYRA 5EIOA 3GA0A 4OSOA 4Q9NA 4YT2A 1DC4A 2NADA 1ZBQA 3FNFA 2AW5A 4MKXA 4BIIA 1P77A 1DOHA 2VNAA 3D0OA 4MVJG 2E37A 3PHLA 1GUFA 1NVMB 1LDGA 1YRLA 4CM8B 4QQRA 1NXQA 4KUHA 2Q1WA 3BIOA 5L4NA 3BHJA 3GDFA 4CR7A 3DAPA 4RVHA 3HWRA 3WWZA 1Y8QA 3WFJA 2WD8A 3H65A 3QA9A 1F8GA 5I7SA 3ZWPA 4NQZA 4CMBA 1QR6A 2NTNA 3HE3A 2Q1UA 1RPNA 4LSWA 3H7AA 2P9EA 2PFGA 4IGFA 4CMKA 3WBBA 3GUCA 4NR0A 3VPFA 3GVCA 2EV9A 4CUKA 3V1TC 4A2CA 2EF1A 3QW2A 1DRUA 4NPCA 5L7TA 3TN7A 1DRWA 2ZCVA 5G0UA 1HYEA 1L7DA 1R0KA 2ILTA 2WDZA 1KS9A 2FP4A 3QVTA 4IJWA 5COAA 4YAKA 2NVBA 1LQTA 3DWFA 3VTFA 2AMFA 3H3FA 4HP8A 3C1OA 4YT4A 3GFBA 4M55A 4L73A 2VHZA 1XEAA 3C85A 1WAMA 3VH4A 1EUCA 4WE3A 2HCTA 4CJXA 3D3EA 1DPGA 1E3WB 4RF4A 4WCFB 5JCJD 3TF5A 1O9BA 2NVUB 2FR0A 1HYHA 1NHWA 4UEOA 1IZ9A 3Q9UA 3KBOA 1JTVA 4I9HA 1D8AA 2OORA 3FHLA 4GMGA 3WG9A 4DIBA 5IZCA 3V1YA 1C0LA 1DHRA 3KLMX 3FPCA 2VZ0A 4E2ZA 5IZCC 1UJMA 2Y0DA 3AY6A 4Q3NA 3TOZA 4OHUA 4W4TA 1ADCA 4IQGA 4GLOA 1XDWA 4HWKA 5AQ1A 4HNHA 3G3EA 2VRCA 3BMQB 2HSDA 3IMFA 4HX5A 7MDHA 4J4BA 4D45A 1SO8A 3ZV4A 4PN3A 1MGOA 4XGKA 3MJCA 2QZ9A 1LRKA 3CPSA 3PQDA 3I9LA 3K31A
chains in the Genus database with same CATH superfamily
2PUGA 5BUQA 1USIA 2AYZA 3JPWA 4C06A 1E94E 4C14A 2Z0MA 2ZI4A 2W2OA 3H0CA 3UAXA 1IHDA 1UWKA 2O54A 1ULSA 1PEYA 3H5TA 3R0ZA 3OLWA 4WN3A 1EDBA 4X7RA 1DAPA 1YFJA 1KBZA 1KDRA 3VH3A 2AE1A 2X42A 4IXNA 3CQ9A 2YY7A 3HXPA 3C3BA 1QKIA 3PNLA 4CM9D 1PS9A 5HQ3A 2IH5A 4INAA 1A9PA 3LHSA 1ZRNA 1VKZA 3N0WA 4N9QA 4EIWA 1H9CA 2FSVC 4A91A 1K7FB 1P0MA 4AZ3A 5T57A 2PRJA 1TCUA 4X91A 3SHVA 1XTUA 2QW8A 4HUQA 1XHLA 1C7EA 2C92A 2GETA 2I3AA 5FPTA 1HM5A 3F96A 2ZDQA 4QEDA 4J3NA 2H9AA 3UT0A 1J24A 3JD1A 4PHHA 1WB5A 1NVVQ 4I4IA 3BXHA 4OHCA 4B6PA 5C9ZA 1ZK4A 1ZAKA 1YBFA 2RHBA 2AYXA 3HJAA 3L0ZA 1Z0SA 3L40A 3N2KB 4NENB 4RQUA 4DLKA 2NXNA 4KQXA 3SKVA 4ZT5A 2ZRMA 4JFAA 4AZTA 3E5NA 3WMRA 3DF9A 5A9SB 1T1SA 2BFPA 2CZGA 2PT9A 5BQ5A 1H23A 5P21A 3PGA1 3LX5A 4JQOA 4WZAA 1G5HA 2R8OA 2WJZB 3HM2A 1JBEA 2JJ8A 2ZWOA 3AIKA 4AF7A 1W9MA 4W1QA 1GZ6A 4WFKA 1L5LA 1DEAA 2QIPA 1ORTA 2ZYUX 4QBGB 1T91A 1Z0KA 5AHRA 3GOHA 4CMJA 2I6TA 1EUZA 1UPTA 4GOJA 5H1YA 3K2QA 2XWSA 1N9KA 3OZFA 4Y9RA 3J81A 4JXXA 2XJ9A 2ZJYA 1E9FA 4GYYA 1BA2A 1ELOA 2BBOA 2RHGB 3OQPA 3WK6A 2GHQA 3PPVA 4C5CA 4HBZA 2O0HA 2J09A 2QNRA 5D7NA 2NLOA 4KOEC 5AW3A 3TNLA 4Z6KA 2NZJA 1AKMA 3FY4A 2JCBA 2PSEA 3MT8A 4WTOA 4ZQCB 3T1VA 1HEYA 5B7NA 4LSGA 4DC1A 2H65A 3RIXA 3L3BA 2PS3A 3DMFA 1T8WA 2CXXA 4B4DA 2A0YA 4NBRA 2YMPA 4REQA 2FFHA 2ZRHA 3QWAA 4D9BA 3C15C 4NPAA 5K8UA 2WVHA 5B5SA 1HNZB 1JR3A 1WD5A 2JGDA 2WHPA 3OC0A 4L76A 3UB2A 4QVIA 1SUEA 5FYDA 1DAGA 1KQFA 1DWPA 2P75A 2Y0CA 1GKUB 3CFYA 3FMPB 3WSWA 4EITA 2NP6A 1NV8A 1PFKA 1YE5A 3CMCO 1DAOA 1K06A 1CUIA 3DPUA 1NI3A 4M83A 4QOHA 3OOSA 3DJFA 5LQDA 2PUEA 3RUPA 4DIKA 1OFUX 4IJKA 5F2EA 1CR0A 1JMVA 3N39C 3AERA 4AG5A 2C78A 1HDRA 4HATA 4UEJA 1OAAA 1VECA 1VJ5A 2ZWAA 3FJ1A 3O21A 4DV3B 2O6LA 3H1GA 3IBSA 3MMZA 3UCXA 5F12A 5KQGA 1ZR2A 2VJBA 3PTZA 4K6FA 2WILA 2WF9A 4PGFA 3VU0A 3RI3A 1B3BA 1NVWQ 1ACLA 2GWRA 4G0YA 1C8BA 3H5OA 4TMZA 1NXWA 3UCFA 2CJWA 3MIZA 2JNWA 4YV0A 2FWMX 1E3MA 4GM4A 4J7CA 2DHRA 2ETVA 2WOJA 4NV1A 1A9YA 3MCZA 1UFKA 3OZSA 2J3DA 2VATA 2XMDA 4EHKA 2AX4A 5IX8A 1RWBA 2C9BA 1W6UA 1WB6A 2WM9B 5AI6A 4UTOA 1E2DA 4IF4A 3MMXA 3PDIA 1VPVA 4CMAA 4F2DA 3DTYA 1YOBA 2P62A 2WV9A 1E2MA 2XMGA 3EZNA 5DN9A 3TFWA 4F45A 1G8KA 4P86A 4FE4A 3GLFA 4B3CA 1L1EA 3CU5A 2A78A 1IJBA 1MJNA 4K1XA 4LBVA 1XRPA 3RWBA 5JQGF 5DP1A 1J0EA 1KYQA 1DAFA 2YL2A 5DNYB 1RCUA 3U4QA 1R0XA 1W75A 5C3UA 4E94A 4HNGA 1F38A 4B4VA 1DCTA 1JT2A 1UWCA 2CMKA 2E4WA 4HD8A 4Q4JB 1CYEA 1L7BA 4MTCA 4UZSA 1I2DA 3EJWA 5JWHA 3T5BA 1TYCA 3MD9A 3QU9A 4MICA 1GNQA 2H3EA 4R8SA 5B12A 4R41A 1T5HX 2VAMA 4YDHB 2D7DA 5F3WB 4LY6A 1ZX1A 5L3QB 4JJGA 1G6Q1 4IQ0A 1TE2A 3E53A 4WAUA 3ZWMA 2BSAA 4F5EA 1XLWA 1WXDA 3O8DA 5C5DA 2XUPA 3EEOA 3H19A 4JODA 5DEOA 5K0JA 2R6FA 2QE6A 3LC7O 2QTLA 2QLFA 1JIQA 1HEUA 2KQUA 3OP1A 4FGUA 3DLHA 1G60A 1DGQA 1UP7A 3I05A 1WKCA 1PZMA 2VP0A 3INGA 3R7FA 3R23A 3GDHA 2C9MA 3WLLA 3DDWA 2WJVA 3TXXA 4QPZA 1U28A 1U3GA 1VJTA 2C2OA 2E1RA 4J7XA 3HUEA 3AXSA 4XQ0A 1O94D 3B7WA 3GUUA 1OGIA 3LUCA 4HWRA 3VYUB 1YVPA 1AZWA 4AJNA 4MUFA 1DDIA 2AG6A 3WKAA 3GLGA 4CCWA 2XNDD 1P73A 3PFNA 4WCDA 3P9QA 3ESQA 2JJYA 3WLSA 1JV2B 1THGA 4OHFA 4P8RA 4IDQA 2SKCA 1NV9A 1E3SA 3A7DA 2J0UA 2MWMA 5JI3E 1Y82A 1PTJC 3PX7A 1V1MB 1XA4A 1PGOA 2GRJA 1H2EA 2YXEA 3W5JA 3ZJYA 2EU8A 2HSJA 5JTTA 4KO4S 4PC3A 1SZJG 3G2IA 3PUJA 5BRJA 2R47A 5HUHA 1MAVA 2D8AA 4P4SB 1V37A 1X3SA 4NBKA 5C8YF 5C5EA 4MHTA 4WY2A 3B9BA 4NBLA 1INLA 1EFTA 3HA3A 2NVOA 1UQTA 3TKYA 2WF7A 1UPBA 2JIMA 1L3IA 1ZD1A 2DTDA 3NTUA 4OOFA 3OTWA 1NVXQ 2PX4A 4OFWA 4DZTA 3AY7A 1X7WB 5KVSA 2QBYB 4TZTA 5LJIA 2OBLA 1A50B 1AT1A 2GJKA 3PNVA 3LUGA 1MCZA 5TT1A 5HK9A 1O8CA 3D0KA 2I9PA 4HKTA 3U3MA 3C4VA 4GP7A 1EVLA 3WV5A 4F9TA 2Q6IA 2VT2A 1NNEA 2QTVA 4QXPA 4MW1A 4QBIA 2WD9A 3RVMA 1JHRA 4XFKA 3SQLA 3LUJA 3GLSA 3UOGA 4DQDA 2ZROA 2PXAA 5BYKA 1VHQA 1DWOA 4QOEA 5K4HA 3DAYA 1QO0D 1GYPA 2VFAA 5AW6A 2HY7A 1WXWA 1CUEA 1BX1A 1VHDA 3JQ8B 2H4YA 3LY5A 4UMEA 4DTIA 4GQAA 1U04A 2HNBA 3UWSA 1WXQA 1SWVA 3JD0A 4BNNA 3SWWA 2OZVA 1Q0UA 2I91A 3HCOA 4IIJA 4D92A 5KTOA 3T3OA 1N0UA 3RD5A 3EA5A 1RPTA 2QEQA 3S3TA 4CLXA 4MVJE 5AH0A 2IHNA 4RVSA 3UMGA 2DH6A 2DRIA 3CVYA 3AR9A 4YMUA 1Y8QB 2HTEA 1UXJA 3HCAA 4O1HA 3RS8A 3ZCXA 4QT4A 5DWDA 5A4KA 5J2UF 1UMBA 3EPRA 4XH9B 1FXUA 3CN7A 2F55A 1R0LA 1U80A 1DAMA 5HNKA 5CDTA 1YQTA 3C5WP 2Q4BA 1AKEA 4IJ5A 4DPMA 4K88A 3KAJA 5KYXA 2X9VA 1XTBA 3GNSA 5AI5A 2LUOA 1MHPA 1RADA 4XVUA 4Y0VA 4BFZA 5FWXB 1V3TA 3RK1A 1W8DA 5IBRA 3Q3IA 1CRQA 2AOWA 2NSYA 3BGOS 4B87A 1YS6A 2IIPA 1OREA 3WYFA 1Z5GA 1XKLA 1QDUA 1ZINA 4MTLA 1W1WA 3D54D 3PDWA 1KP3A 4UBMA 3DAFA 1SWWA 2CK3D 2DQYA 2ZBEA 2BTQA 1HE1C 3T99A 4LXTA 3C43A 1MRZA 1G41A 3OY7A 4KN8A 4C1BA 3DFKA 4GI3A 1SA0A 1L5HA 1RWQA 3AKEA 1FW6A 4OCZA 1EXWA 3KL4A 3L46A 1E2GA 121PA 1R00A 1EZ1A 3L9XA 2QROA 2P9HA 1CUUA 1EUCB 3TL2A 2MOKA 3FUVA 2X4IA 5CT9A 1KZ9A 2NU6A 2Y68A 2Z5FA 3QG5A 4YACA 1H5UA 2BFDA 2QN7A 4KDEA 4XR9A 5EKXA 2JI4A 2ZYDA 3FBTA 2HDHA 3KOOA 3FGZA 4L6CA 2B92A 4IHKA 2I4MA 2NXJA 3JSXA 2VDUE 4X61A 1DV1A 1WMSA 2OESA 4EEKA 2QN2A 2WWIA 2CXRA 1CS4C 3UKDA 3AR5A 4DQKA 5KYUB 4Z2YA 3DSRA 3DZHA 2V7UA 2D8MA 1OH5A 1NW3A 4K5QA 3DQZA 2C5FA 1Y48E 2FN8A 1T3GA 1SVUA 3PPXA 4J91A 4AJOA 8AT1A 1GSHA 3I92A 3TQQA 1TC1A 1Z8FA 1YB2A 3P0RA 4YJFA 4DMUB 4AS3A 3NETA 1ZONA 2BFOA 4HX9A 2ZWMA 4G1VA 3EB9A 4LNUA 4QYMA 1JFLA 3CW2A 2WINI 3FF1A 1KC3A 4PFSA 1AZLA 4AKEA 1HOXA 3WDLA 4ZDWA 3G82C 5EVJA 1APBA 3ONFA 5GIOE 3PSHA 4V1CI 3A4YA 4J1SA 4LYHA 3QW4B 3UIEA 4BNDA 3EGVA 2COEA 2A58A 5LNK1 2A3RA 1YVDA 3Q7EA 4MGZR 3TW8B 1X74A 4CTNA 5KCZA 1RXYA 2AR0A 3F9RA 2EJUA 4F92B 5LYJF 1FNMA 1V7PC 3D5EA 3HKDA 2IUUA 2Z1MA 4EYQA 2HRZA 2HA0A 2Z30A 3I9V6 4L5AA 3TRFA 4NCBA 1E0SA 1RIIA 3I2GA 5KDLA 2ZT6A 3JYQA 3QLJA 1WXXA 1T2UA 1WXHA 2Y76A 2Q4OA 4HDQB 1K68A 1PJAA 4M87A 3L0IB 4L15A 3DFIA 1EUYA 2AH5A 3NWBA 1QFSA 2RAUA 1BVUA 4Y6QA 1C0PA 4UHCA 2WB4A 5AICA 1B4DA 1AK9A 1VDMA 2R96A 4G01B 4M1KA 1HTTA 4ZQHA 1TZCA 3FBGA 3KSMA 3FVQA 4YP9A 4Z3DA 3V2UA 4CKCA 5DYNA 1SEVA 3NBQA 3C8DA 1E0JA 3RODA 5IVPA 4DXHA 3JPYA 4D9NA 3LCJA 2IS6A 2GM4A 1BOFA 1WO8A 1Z16A 3VU9B 3A04A 4RFSA 2F3PA 3Q7PA 5LA6A 3KZ1E 1YR9A 2FX5A 3BFKA 4MIOA 2P6UA 3OCZA 4GS5A 3UYLA 3NJ4A 5K3FA 4OMUA 4Q3OA 5IM4A 4G0NA 1E4EA 1X3LA 1DDOA 1MZVA 3KETA 4S05A 5I7FA 3ZDZB 3HL4A 2FJPA 4S1OA 4YRNA 3MRSA 4KXNA 2WTXA 4CODB 2GPSA 3S4YA 1BEUB 4OQLA 1DKRA 1Q7RA 3WGVA 1XRMA 4YP1A 5ENDA 3WLMA 4L1KA 1JJIA 5ITZB 2CE2X 2UYOA 3CUTA 3ZHVA 4CQMB 4YJ2A 5FWYB 4IUYA 1SXPA 1ESEA 1QQ5A 1AS0A 2RDMA 4LISA 1PWEA 3Q9SA 2ZS9A 1FJXA 2ZCUA 4V0KA 1T3LA 2J46A 3C5VA 4ZCSA 4JEMA 2JFHA 3HUUA 3K6SB 1I6MA 4BMSA 4NBNA 1H66A 4BRUA 1NG1A 2JKYA 2Q6TA 3KTAB 3LPDA 3H2GA 4HXGA 1NNLA 3MCWA 5C32A 1U9JA 2Y05A 5EXPA 3TE6A 5L3SA 4U2DA 3V5NA 3R5HA 1SQ5A 1EA7A 3AM3A 1ZKDA 3KQQA 4KRXA 1Q0HA 3FDZA 4U8HA 1ULAA 4OOEA 1T26A 1H4TA 3Q98A 2OHFA 1O96B 2CWWA 4W7SA 4ZVTA 4M38A 4D9EA 5BSGA 3UVEA 5HZHA 4QVKA 1RKQA 2R6CA 3MPOA 4OY3A 1KE2A 4R3NA 1PBTA 1Z7EA 2W8BA 3WGMA 1I0ZA 4FYMA 1RQNA 4ROSA 4FSXA 3SCZA 2CL0X 4B0OA 2C9CA 1B7GO 1GZUA 3O26A 2QTZA 1US8B 3NZEA 4N7JA 4OP2A 2B1QA 5DHAA 1Z7BA 3IEIA 3U4IA 3RYFA 3SJ7A 2DSNA 5A05A 4QELA 3C3MA 2X5JO 1SXJA 4BXOB 1GAWA 1P7VA 3ZK8A 4DM3A 3QENA 5FTJA 4CM5A 1C2TA 4FWTA 3VNVA 5FL7A 3PXCX 2Z3ZA 5U1PA 4GR5A 4HGRA 4KXLA 4S2UA 2J41A 1KYXA 5EQFA 3ZBTA 1X7ZA 2O8BB 2EWWA 2VDVE 4CHGA 4EBBA 1FVHA 1GG9A 1LC3A 1HLGA 2IKSA 1PJZA 4YRBA 3RASA 4OXXA 3FLMA 3JALB 1Y1PA 5LBUA 3WNCA 4ACAA 1BDIA 1C4KA 2Z4RA 2Q2OA 1NNI1 4X1YA 5KAMA 3GLHA 1C8VB 1CIPA 3DNMA 5LL6P 1K5DA 4X41A 1RHMA 3M8KA 4GWGA 1GUBA 3MGCA 3O1HB 5CGQB 3RIYA 1IB0A 2JI7A 3QFRA 3A2KA 4PNEA 3FSGA 3QF4A 3IBYA 4PLHA 4ZJUA 4H3SA 1DIOB 5DTRA 2UYHA 4E1BA 4KKVA 2TMYA 4BQSA 1CJBA 3EDCA 1EHYA 2JJ2A 4MV6A 1K5PA 4PQFA 5KX5B 1TJNA 1NJSA 1UZAA 4IEFB 2J6HA 3REFA 1EXNA 3HFJA 3LU1A 1CQJA 4NE7A 5ESXA 2DPYA 1HX7A 3ELBA 2PD3A 4RZIA 1SOWA 3HEAA 3C7AA 4JUFA 3CUEF 1I4DD 4IICA 5KI6A 1U2DC 4B46A 1T0HB 3EZGA 3NV9A 3RR2A 3CEPB 2BMVA 1OI4A 4TQGA 1XQWA 5BQ3A 3ID6C 4YWJA 5LXTF 3WL5A 2C4KA 2Q7DA 3W78A 4Z2AA 3EXG1 4RTOA 4DUYB 2Y66A 3I5UA 2BFNA 1PJQA 3R0IA 3ER6A 1REQA 3W3AA 1N7HA 1XQYA 2WTAA 3IEXA 2WNHA 4PIMA 3PK0A 4AF6A 1YB1A 2XGGA 3E03A 2JD1A 1U9CA 4X85A 3DV0B 2ZOSA 4M9CA 4OREX 4URHA 5LQAA 2A2ZA 3CG4A 1P39A 1QHEA 1SUWA 2M1ZA 2YWRA 3NBAA 4CG0A 5AM4A 1ZR4A 3UFBA 1K3FA 4O0LA 4CZ2A 3RQIA 2BUCA 3GVIA 2FQ1A 3L43A 5HZMA 1AB5A 3M5DA 4AN0A 2FVXA 4CM4A 4FONA 2D1TA 5IAKA 4B6SA 4A9AA 1E1DA 4CIBA 3URMA 4UEKA 3M4NA 1SURA 3OJXA 4M4SA 2HF9A 5FRDA 1XK7A 4M76B 2DUWA 1ODSA 2R5FA 4HYEA 5DBGA 3R9IA 3RVPA 3UAGA 1ORIA 1JR6A 2OAGA 4NK5A 4P7JA 1CR1A 1XELA 1W1UA 3AZOA 4H35A 4YRCA 2QGFA 3RB8A 4F4CA 1NLZA 3E0QA 3L79A 3TNJA 2FE4A 4H6WA 4M86A 2W48A 3VR3A 4EDFA 4EJSA 2H18A 5ALRA 4YHBA 4G1BA 2AOTB 1QHFA 2IIQA 2G9VA 3PQ4A 1L5VA 4ZEWA 2C2GA 1TT5A 2NZVG 1R9GA 1FJ2A 1VE9A 3GEPA 4HVAA 3EZ2A 4JMLA 4P32A 5JNLA 2JD2A 1OR8A 2G7ZA 4MVJP 1PR3A 2HWUA 4K26A 4PO9A 1NUAA 3BMCB 4RPGA 3FVWA 1L7PA 2XVXA 4MARA 5LKAA 3QJGA 4XEHA 2DR3A 4BWFB 1FC0A 4TWIA 1URPA 4B4WA 4PCAA 4EW6A 4KWEA 4GL2A 5D1NA 2R00A 4RADA 2F67A 2EGGA 3LVFO 2IYOA 4NJEB 5DRTA 1SBCA 1YA4A 2ONKA 3NYRA 5IW8A 2WIFA 2EARA 3VO1A 3GA5A 2Y1LA 3FSRA 3O38A 2PX5A 1W4AA 2WU8A 2GXSA 3V32A 1M6HA 1PL8A 4U7WA 2FPSA 5BQOA 1MJHA 2NZXA 3GT0A 4PHTA 1WUHS 2FGKA 1KOFA 4CWAA 4BP8A 4H31A 1MG5A 4AIIA 4TRJA 1CTQA 1OROA 2W2XA 3QMWA 5AVRA 1NZDA 1J9ZA 4M1YA 5KIAA 1I7SB 3MEQA 3L1IA 3G9ZA 5LUAA 4IEIA 2APJA 2NUTA 4KU4A 1H42A 4OJQA 5F3RA 3ZXYA 1ZH4A 4CM7A 4FHGA 1CEEA 2CYCA 1DQZA 2IHVA 2YYYA 4ABTA 1HFEL 1K8RA 1HKUA 2HDOA 2QI9C 4MNTA 4FKMA 4UCXA 2HGSA 2F3UA 2RKWA 3S8MA 3TAUA 2NAPA 3LLMA 4N0DA 1QE5A 1IMOA 5BWMA 2OM2A 3KCNA 1B14A 2J31A 1ZM2A 3LGAA 3MMNA 4DXDA 2JF0A 3SXUA 3NWEA 1DINA 1GU0A 1A7AA 2EZ8A 3I6IA 4NU0A 3VO8A 5KSYA 2NQ2C 1GPLA 2H0AA 2QU7A 2B6HA 2WP8J 4B1FA 4L3OA 3WB9A 3ZIDA 1Y9AA 4F04A 1QH9A 1QQ6A 1JA9A 3O31A 5AUPB 3WB2A 4CEIB 4YCSA 1U9IC 3AC0A 3HHEA 4MRMA 1IC6A 5DT2A 3RYHA 5KVCA 4UDOA 3N6VA 1X2EA 3N7AA 4L3WA 3ETLA 5JASA 2QV7A 1V16A 3AETB 1LBHA 5LDHA 3TIXB 1SQFA 3KG2A 4NJOA 3IELA 4DDWA 1ZJWA 3A28A 3ETEA 1OLSA 5KQMA 4QJ5A 4TQAA 4CMCA 4TMTA 4BVGA 2WHEA 1TLLA 4TM7A 4W6QA 3LKVA 3VSCA 5AR1A 1NYRA 3ZLVA 4N6GA 1Y8AA 1DKPA 1KYVA 3WNZA 1KRWA 1VCOA 1WF6A 5MGBA 5LLSA 3AM4A 4TSRA 1JAXA 3ACBA 5LQCA 3MJ4A 2R8YA 1FP7A 4M9SA 1EBUA 4YMGA 5I7WA 4ALJA 1A5AB 1C9DB 3E9CA 3W8RA 4NDZA 2P0AA 5DLQC 4AW9A 4R2HA 2OY0A 4GYKA 2N3ZA 5DO9A 5FFNA 1Q57A 2IW3A 3OE1A 1XPRA 2PUDA 4JJ6A 2HHLA 4DREA 2AQHA 1RLTA 2IT1A 3IR7A 1HL3A 4RHYA 1Z35A 3IP5A 4NYJQ 2C5BA 1J97A 1E9EA 2VLIA 2VZLA 2RAVA 4ZHQF 1QVRA 1JIIA 1WEHA 1SCAA 5LMUB 2LD4A 4XVRA 1DPFA 1FEZA 1XZCA 4HJXA 1U8XX 3HO6A 2WPDA 3EA4A 1K4KA 3GAMA 5TGDA 3AT1A 2OKGA 3OESA 4UOQA 1G20B 3S0JA 2BZGA 2GBLA 2D00A 4OO3A 2WLSA 2XB4A 4C3ZA 2V0CA 4L9RA 3TD9A 1DJQA 1VQ1A 1UJ6A 2X0RA 1AKYA 1IH8A 3ZWOA 2XB6A 2ZRAA 2GPTA 2JARA 4GE3A 2EKPA 2FZ5A 2BEWB 5CH3A 2WJ3A 4BNVA 1QE0A 3KXIA 5JNUA 3SFVA 3DH0A 1EZ4A 3A6ZA 4J76A 3MINB 4NZ9A 4KQ2A 3MNFA 3DWGA 5FEUA 2JATA 1AHHA 2Q7XA 1KY4A 2L17A 1OYYA 2CVZA 5LOVF 4ENPA 3DEJA 5K6AC 3B51X 3BXFA 1JFFA 5LQSA 3T54A 2MSKA 5F1KA 5HDQA 1YZKA 5JY1A 2XBMA 5FI1B 2KS6A 3FHJA 5TS2A 3EASA 5G4KA 3UWDA 3DMTA 4DJTA 1W36C 4KDRA 4HEA6 5DXFA 3C48A 3UJAA 3X1ZA 3N6XA 4BGVA 2V7XA 4KSCA 4PYJA 5B36A 1Z06A 1F0PA 3MM4A 1TUIA 3GRZA 3VVCA 1O9GA 1RYZA 3OQVA 3GLIA 2JLAA 1VJ0A 4FCWA 3GRFA 1BGXT 4N49A 4OXNA 1NAHA 2O3TA 2ZYGA 3AR6A 4ZQEA 5FPKA 3LCCA 4GDMA 1E69A 2XQVA 1KSGA 3G0IA 2RONA 4CLRA 1N6RA 4L6IA 3TLGB 3UGTA 1HE3A 2PM8A 1YZFA 3BJMA 2B4YA 5BY2A 2ZTHA 4Q24A 4IRXA 1R4NA 5L3ZA 2P6OA 3TK1A 2DY1A 2VA9A 3LVQE 4TXLA 1XTZA 3ROZA 4CV3A 1G5RA 1XRJA 3B8EA 4DBLE 3NWPA 4KO1S 3JD2A 2VQEB 2PAAA 2IYSA 4DG5A 2F2TA 2R4UA 2Z09A 4ECEA 3RWMB 1HSZA 4GW3A 5D6OA 4B75A 2WSMA 2VDOB 4I6GA 3W2FA 5CITA 3K0SA 2DHEA 3OLQA 4F06A 2AUMA 3LC0A 3EXG2 1F2TA 4C3OB 5K45A 2CV0A 1BDHA 1LBSA 3THSA 3T9AA 2QM8A 1RR6A 3WRXA 1EZZA 1V0JA 1DQYA 2VP5A 2G77B 3IVXA 4KQ6A 2XDWA 3V97A 4D7AA 5JSQA 3B5EA 2R8RA 3K2BA 5IJ9B 4ZAVA 4IIVA 1EGHA 1DBWA 4IFBA 3B20A 4R5MA 2X0JA 2XCSB 3IQWA 1RFLA 4J90A 4Q1AA 3T0FA 1YBAA 3MUNA 3NBKA 4QECA 3IAS6 3SVLA 4P4NA 4D4JA 4RJKA 4XM2A 3SMVA 2ZRNA 3EIEA 4E6PA 1BWRA 2BY4A 2X7XA 5KCMA 4Y98A 6Q21A 4MINA 3MA0A 3SBDA 4CL3A 1F8XA 3GGSA 1RT9A 4CQMD 1OVMA 3NVAA 1EGMB 4P35A 3T52A 1HDCA 3CJRA 3VR6D 5HP4A 1GL9B 3BCUA 4IWNA 2ZRDA 3KLBA 2G70A 3WWYA 1CF2O 4UFOA 4D82A 4TMWA 4LCJA 4PHFA 1HORA 1X80A 4ZQBA 1KFCB 1EFUA 3IXLA 2SCUA 1IXKA 4G4SP 2I2XB 4U6QA 3QU7A 4DNFA 4ZCMA 3TQRA 4KUEA 1OI3A 2XUDA 3DMGA 3K9QO 3IP9A 3ZBPA 3TLYA 2O3RA 3W5CA 4KBGA 4HC4A 4FT2A 4CG1A 3AI2A 4H7HA 1TMYA 3C24A 1A1SA 3TOXA 4C04A 4FHFA 4MVJH 1E6LA 4G5SA 4L2IA 1A5TA 3EQ7A 3CLSC 3GJ5A 3SFTA 2MINA 4FB5A 5JBIA 3TLBA 1IY2A 1JLKA 4DBLC 2XNJA 4ZGGA 2X2EA 4DM4A 1VCHA 3TYXA 1ISGA 3G8AA 4QGSA 2C3UA 3MWJA 4L51A 2RAPA 2YN0A 3DBVO 4OHOA 1ZUNB 2EP5A 4JCOA 3MPUA 4PPNA 4TSFD 4BKRA 6ADHA 3HCFA 4MKZA 1K7SN 3TNDA 4IDPA 4ARVA 3W2TA 2RJOA 3CCBA 2WF8A 3ENKA 4P08A 1C7JA 1ZM9A 4FXPA 2V9ZA 1V3UA 2CL5A 4MUNA 4PZCA 1GZSA 2RHRA 4E6EA 2VTKA 4GNRA 1IHUA 5JSYA 2P1ZA 2D4AA 2RGXA 4C0AC 2PUVA 1NT2A 2NZYA 3QFHA 3UGQA 3G5TA 3S6JA 4DCSA 2C5SA 1XD9A 2ZSBA 2F48A 4F2WA 2A84A 3P2IA 1O6CA 2A0WA 2ZYRA 4P36A 3O47A 4XLTA 4ZOLB 3H0KA 1W8IA 2V8OA 3IULA 3L8YA 5JO9A 3WKDA 1Y1SA 4CL2A 1ZHOA 5CYGA 1NQAO 1BD4A 4D3SA 2MR5A 1A9TA 4NSNA 3TSOA 5KNCH 2MJLA 1OX6A 2A5FA 1W4LA 1C2YA 1UKVY 3FGNA 4K81B 2D0IA 4TN1A 2HK8A 4M1ZA 2YJ5A 4RLSA 2VUSA 4YJKA 5F4ZA 4UMDA 2NUPB 1S1MA 3PEYA 3P45A 4P5EA 4QZVA 5JI2E 2DSTA 2UUAB 1KAOA 1CIJA 5IASA 1P0CA 2Q9CA 3TM4A 1WP4A 1PT9A 2ZR0A 2C8VA 3NWOA 1S2DA 1II8B 4YROA 1VL1A 1OTHA 2W71A 3JD3A 3G2NA 3EDQA 3H17A 4MQFB 1Q0SA 1NVVR 3CUVA 4PPQA 3K15A 4JSRA 5EIWA 4C0QC 3TIIA 3HN2A 1QHHA 2G07A 2VDMB 1UMDB 3PE6A 3CLTD 4JUAA 3CV3A 3MT7A 2P6PA 2VYVA 4IRUB 3AO0B 4DKXA 2NUBA 2LRHA 3ELWA 1M7HA 1T9GR 2AR7A 1SG0A 2FQYA 3CZ5A 2C4WA 5FF9A 5LZ2A 3UAWA 1H3EA 1AQIA 4NZOA 1I4EB 4PSKA 3AXTA 4HRXA 4NNOA 2I6XA 3UXYA 4MJ3A 4B44A 4D3XA 5GTDA 5KSWB 1P74A 3KC2A 4IRMA 1M6NA 1OXXK 1XOIA 3L84A 3PI7A 3IDZA 4MHSA 1AE1A 3DONA 4DQLA 1RXWA 1BIFA 3TH5A 3HCWA 4LHSA 3RS2A 1WETA 3AV3A 3N75A 2R25B 4F46A 3PC4A 1YCFA 2NXCA 3SDZA 4Q1FA 1XLTC 1YNSA 3G2MA 4C78A 4BYMA 1CRPA 3WO1A 1GEEA 3EN0A 3NFYA 3Q40A 4GGOA 4D4GA 1G0NA 2JH8A 3GPDG 3O9VA 3X1WA 1YS4A 4K9SA 4ASUA 2UUOA 2IOFA 2XDQA 1BE0A 3T1OA 5DWQA 1T9CA 4HFMA 1GNLA 1RFGE 4FGKA 4Q37A 4E03A 5ALNA 4ENTA 3QSGA 3FHOA 2JBAB 3UJDA 3T0IA 2IJGX 2VSYA 3FPLA 3IVAA 3UPTA 3CZCA 1Y6GA 4PPGA 3ZW8A 3IA2A 3Q41A 3RV3A 3SKYA 2AOUA 1IYZA 2PZKA 3WRYC 3L93A 4H7DA 4UC0A 1P6QA 1YJ5A 1EAYA 3NAQA 2ZRIA 2FA9A 2UVPA 2WYUA 3AJRA 3QFSA 2C4NA 2CFSA 1I24A 1VG9B 2HBYA 4O4HA 1L4YA 1ZVQA 4YBRA 4DQUA 3L6RA 1QGOA 2FUG1 3F4KA 5KVVA 1KEPA 2JK1A 1PQYA 1D7AA 1OFVA 4IYRA 4JBHA 2HIGA 4MS1B 5CT5A 1VOTA 3H87A 4PR0A 1CP3A 5JDCC 3QWIA 1X7XA 1P1BA 4UPDA 4XVCA 5KTPA 4YR7A 5EJEA 2JFQA 2EVWX 3ST7A 4K6OA 2CF6A 3DVLA 1TIPA 4NZYA 4XWYA 4OB6A 3RGGA 1PS0A 4BKPA 5C2JB 4EVQA 1Q0LA 2YICA 3DNPA 3K35A 4U2CA 3OU6A 3VKWA 3LRTA 5HGJA 2FW7A 3DVQX 4I66A 3IVCA 1SVWA 1ECGA 4UEWA 3Q8KA 2VWGA 1G3MA 1RAFA 4AL4A 1OBHA 1ODCA 2BRUC 5D1HA 1PI3A 4EG7A 4DANA 4J1QA 2ZKIA 2GZSA 2B7BA 1SHZA 2IBMA 4URWR 1KEUA 1FRVA 3E7WA 1IN5A 3SSAA 2V58A 4RSHA 2ZVPX 2C96A 3KR0A 4OQXA 4BE4A 3LCRA 3JQPA 3GELA 1BD3A 1DWQA 3JVIA 3P0HA 2VK4A 3F97A 1QC5A 4G0QA 2YRXA 2O1SA 1S7CA 1Z5NA 2PUWA 3D6TB 4MI6A 5TIIA 1DFGA 1IY0A 1VA4A 2G76A 2P0EA 3MMPA 3ET5A 4HAVA 2CNWA 5F1PA 1LVUA 2GN9A 1RJFA 1YU9A 4JGBA 3I2JA 4Z3OA 5DDIP 4UXIA 1LCIA 2FWRA 3MBOA 1EVKA 1LJ8A 3MWKA 3PFKA 2IZZA 3NCTA 4JLWA 2AXNA 3Q5GA 4U6NA 1NPYA 1P1JA 4MEAA 4YQEA 3N07A 3KD3A 2EFDB 3CVWA 5JAQA 4R83A 4KMOA 1PK8A 1Z18A 5TMDA 1QYRA 4ND1A 2PDAA 1SVKA 1MOZA 3K8YA 3HFRA 4MQUA 2X9LA 3BWBA 2H59A 2CSUA 1SRQA 2I71A 3IKTA 1PIWA 3B3FA 3GN2A 4TKUB 4R71A 5AI0A 4GX1A 2YKGA 2GERA 2XOXA 3ASYA 3MWGA 4PAQA 3WO0A 3KJGA 3D59A 3IPXA 1E99A 5CNJA 1O08A 2WZQA 1Q44A 3DR3A 4GMXA 3OICA 1NJ2A 4UAVA 2REBA 4XQCA 4ED9A 1RQRA 5E1OA 4ZCLA 3WICA 3SQXA 1Z0FA 2NG1A 3OKCA 2R87A 4LX0A 4RIEA 1ND6A 2GEKA 3O03A 5AVJA 1GNRA 1X19A 4BL5A 3L8EA 4YS6A 1P1CA 5JSUA 2ILVA 4RKRA 1AB6A 2HLHA 4K8RB 4BWVA 3OZEA 4ER0A 2FXIA 1UAGA 2ZI9A 2FY8A 2ZEJA 3NB0A 4GI2A 4L9SA 3C6MA 1ID8A 2QPTA 3THWA 1WLSA 2GDJA 4PLZA 3GVPA 4M7RA 3G2HA 3PEVA 1QQBA 1QV6A 4IHQA 4DMKA 1QF6A 3V4PB 3ADDA 3I8OA 4HVTA 4ZPJA 3CY6A 4MH0R 1PUJA 4ALIA 3E2PA 5GM2A 3M9XA 1AZTA 3U1VA 1Q0QA 4UD2A 1N78A 3ESCA 1COWA 3KB8A 5JYEA 1X8KA 2V45A 1Z88A 1EIZA 1NLMA 1U8EA 4RVFA 4TZ6A 3G1UA 3G0HA 1AD2A 1YUNA 4MDHA 3VA7A 3HA5A 3QK7A 2HO5A 1M6EX 3PB3A 3P0EA 4FDAA 5T3UA 3ZWQA 1AV7A 2OUIA 3DE3X 1QP4A 2FPIB 3HBFA 3DW3X 1L5SA 4MUKA 3WI7A 3LWDA 3CR8A 1A76A 1E3IA 2VI5A 2CKMA 4BEVA 2WE7A 5DISB 4BVJA 2YMQA 2NU9B 1QR2A 2RKOA 4ZOQI 4ZGBA 2BFWA 3CNQS 1W49A 2DUUA 1GGVA 2J3IA 4AYTA 1O54A 3AFHA 4BBAA 1RYNA 2VPQA 1YL6A 1UDAA 2DVMA 2IU0A 2A9OA 2OR3A 2PN1A 3HJTA 2QRVB 1YJXA 4HGNA 4UARA 4C5BA 3OF3A 5I3CA 2WZBA 1N9ZA 1PSDA 2OILA 3A1NA 3UXEA 4HH0A 5HJ5A 3EVEA 3QNWA 1A77A 2P4HX 4LX8A 4GLJA 3MUEA 1JQ3A 2G1AA 1P4JA 4HK4A 5TSDA 4MX8A 4EAQA 1E0AA 2C1ZA 3KZXA 3MTEA 5TR9A 3Q72A 5BSKA 3ZDCA 5JMTA 3WMEA 1MUUA 4NAHA 2QQ0A 3TR5A 1RRPA 1FUYB 3ENQA 3BM5A 3EEFA 4RF2A 4EEXA 4EF6A 1ZYUA 5E0KB 4JUDX 1X15A 2QPAA 4ITRC 4Y9TA 1U8AA 3A9SA 3JQRA 3L0BA 1GA6A 4ENQA 1G2IA 3NBUA 2GILA 1XMOB 1CERA 3F8TA 4OA5A 2WWXA 2ICAA 4F5WA 3AUUA 3KUDA 4KQKA 4EFNA 2VXYA 1KEKA 1PEAA 2WSYB 2XR1A 3P0FA 3PTLA 1YSCA 1V41E 2I1VB 2OQ2A 1QYIA 1BDMA 1XHFA 4M0EA 3PFCA 5E2AA 3OZIA 5HG0A 4QE3A 1U0NA 3NHSA 1CZKA 5KWEA 2UXCB 2QDKA 2I78A 1V26A 3BL8A 1PWZA 1TKAA 3CLVA 5EIFA 2X5XA 4EA7A 4H1VA 3B89A 4CCYA 1AS3A 2Q1YA 3R7WA 1C0IA 1EX1A 2HU8A 2VDPB 4RJLA 4D56A 2Q2NA 4F97A 4YQZA 1Y1KE 5TEWA 3Q7IA 1ANKA 4WUVA 4IDEA 3IOBA 1H1LA 2B82A 4MULA 1CCWA 2AJTA 2O8CA 1NUHA 3TI9A 2YS7A 5IT5A 2JGMA 1R8XA 1DAHA 3BXPA 3NHKA 3O0DA 4B31A 2ZJ1A 1QG0A 4F9EA 3AEXA 1J8QA 2Q1XA 4AZSA 3ZWAA 4RTJA 2W70A 1BWPA 1ZNWA 4WVFA 1Q0ZA 4J1TA 3AKDA 4MGIR 2VEOA 2NYRA 4RPJA 3UB3A 1LWOA 5AW1A 1BFDA 1CDEA 1CUZA 2IODA 1Y9DA 2OLKA 4PHCA 4KAJA 3RGWS 2HGZA 5CJJA 1FDRA 3KOWA 2VJLA 4GL4A 4ZO6A 4AS2A 1FP6A 3QTTA 4MV4A 1ZGZA 5DTMA 4ALMA 2ZRJA 4Q18A 3H1FA 4EYKA 2ZBGA 3FYUB 4O8ZA 2AQIA 5IC6A 2EEZA 3ITNA 5A6SB 3CZPA 2ARKA 4QXQA 4ANFA 1U99A 5TF0A 1KSHA 3ADBA 2Q8NA 1F4VA 2ZIUB 2BMEA 1AN9A 3PGXA 1VPLA 1QANA 5CFLA 1NN0A 2IHJA 3FOCA 2PA3A 2VF7A 1Q7GA 2DT5A 5ALWA 1CHDA 1M1NB 1N2XA 3BKXA 4F4UA 2XYPA 1HF3A 2E4UA 3ITDA 4R9SA 2CNOA 2O8EA 2SHKA 1P6XA 1S2LA 2ESRA 5ARBA 2CLMB 3ZDAA 1W30A 2H4WA 3KQVA 4G07A 4TV9A 4MIEA 4TXNA 3TLEA 1YTUA 2JJMA 3FCCA 3M6LA 3PLNA 3GGDA 2G4VA 3IUNA 1AKRA 2ATCA 3I6BA 2HF2A 4IH4A 4MHOA 1TJ5A 1TPYA 2DBQA 1VHJA 3P96A 4FFPA 4WLNA 5LU9A 3EGXB 1DTEA 2L2QA 4NBVA 4B3HA 3WWDA 1IN1A 3GRUA 3KV1A 2I9KA 4EHLA 3B1XA 3CZAA 1MABB 2X22A 1I3NA 1JG1A 2JAOA 2KM1A 2ZYVX 3MG9A 4YA6A 3L41A 1N5KA 3T34A 1MX3A 4JU8A 2YN2A 4RVNA 1Z36A 1OLXA 1UKCA 4JL8A 2H17A 1NMSA 1RD4A 3TZQA 5C5IA 1IOZA 3KTFA 1YZQA 3PGLA 1Q14A 1U8ZA 2FKNA 2ZW9A 3NR2A 1Y7TA 1I6LA 3ZIAA 1KHHA 4OFBA 2VJPA 2OWEA 2YMMA 4HF7A 4R2WA 4GKBA 3VFDA 4RD4A 3VR1A 4FDMA 1OIWA 1C7ZA 1O89A 3BTSA 2FOIA 4LJ6A 2CUNA 3O3NB 3ABSB 2J4FA 5EUBA 1Q74A 4AG6A 5CVTA 2AW3A 1LK5A 4LE2A 4N40A 3SNHA 3CLRD 3V1MA 1R6UA 5ADHA 1K9VF 2EFCB 3IP8A 2IOQA 5B1YA 3P0IA 1OH8A 4YRDA 1NQTA 4MYCA 3RFUA 5EESA 3LUDA 1MRSA 3HNOA 3HVRA 4Q5IA 1X38A 4D3DA 2PZFA 2HHCA 4Y2VA 1Z63A 2Y0EA 3IB6A 3OZXA 4RA6A 3SC6A