3C1TA

Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
320
Chain Sequence
ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the inhibition of grape dihydroflavonol 4-reductase by flavonols
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
molecule keywords dihydroflavonol 4-reductase
total genus 111
structure length 320
sequence length 324
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c1tA00
4XGKA 1DB3A 3U9LA 3VKVA 2R00A 2TMDA 2B4RO 2CVQA 3KSUA 4BNNA 2NADA 4D42A 1P1HA 2F1KA 3Q9UA 5DOVA 2VUTA 4RPGA 3E18A 1DIRA 1JLLA 2X9GA 4FFPA 4AJJA 1PL8A 1WDKA 3BTUA 2EJWA 5JLAA 1S7CA 2EG9A 5IZCA 3HFGA 5DP1A 1NHGA 3JYOA 3NX4A 4E4YA 3ZNQA 3WTCA 3KM0A 3ZNOA 1G6KA 1GPJA 1NNUA 4E12A 3WGYA 3Q2KA 4ZHSA 1WLYA 2NTJA 5JNLA 4OXNA 1DIGA 3QSGA 4FDAA 4NNJA 4YAKA 2PZLA 5JBIA 1CYDA 4LCJA 2PD6A 3UHAA 2WWRA 3ZHYA 4AJOA 4PVCA 1HTBA 2NTNA 1EQUA 1LC0A 3LSYA 2E49A 4FOOA 4HKTA 4GBJA 3HN7A 3GEDA 1OC4A 3GDGA 4BGUA 3NAQA 4CMKA 2DFVA 2DM6A 3JQFA 3Q11A 4MIEA 1KC1A 3AY3A 1EDOA 3TSCA 4ZQEA 3S2EA 4PN3A 1M6HA 1XU7A 1C0KA 3UN1A 2G0TA 1JU9A 1Y5RA 1VKNA 3PDUA 4UUPA 2BI8A 2AG8A 3KEQA 4CLEA 4NU5A 1BHSA 3V8BA 3U4HA 4BKPA 4CR7A 1EE2A 3DO5A 1U3WA 2P4QA 3GVPA 4Q9NA 3OF2A 5IAAA 5AXAA 4NZ9A 3BZUA 2O3QA 1P0FA 3CMCO 1KETA 3ZGYA 4NJOA 4XYGA 3IP3A 4IDGA 2HKIA 2NNLD 4TMFA 1VL6A 1I3NA 4FB5A 4JP2A 3ICCA 3I9MA 4HP8A 3ORFA 4YACA 2PZJA 2FR0A 4U6QA 3U3XA 1VL0A 2AHRA 4KWIA 4ZQFA 4ND4A 1LC3A 2J5RA 5CDSA 1PGOA 1Z7EA 5HS6A 3DC2A 3KLMX 1FDUA 4YWJA 3EK2A 3OJEA 1EVJA 2GASA 1HDCA 5AXCA 2J5KA 3L4SO 1A27A 3DMTC 1OBFO 1C0LA 4WNIA 4F46A 4AJEA 2W2LD 1HSOA 3NJ8A 2BKAA 4RQUA 3RJ9A 2BFAA 2FPGA 4IDFA 1OC2A 1GZ3A 4RVFA 1JQBA 4ROSA 2ZTMA 3L9WA 3GUCA 2JCVA 3OIGA 5EESA 4GMFA 2BFOA 2QHXA 3OQ6A 1UXKA 2I3AA 1VJTA 1R4MB 2ZB3A 1Q2XA 3DZKA 1W73A 2QZ9A 4BGEA 5BNTA 3TZ6A 4YBZA 2Q1UA 1O6ZA 1ISGA 1QORA 4BKRA 4BO7A 4DXHA 4IIVA 3WGHA 2O3JA 5IZCC 2G76A 3PWKA 4A2CA 5HWSA 4MJLA 1B16A 1NFQA 2VUSA 3FF4A 3Q9NA 4D0SA 3C85A 2HMWA 1OFGA 4HADA 2OO5A 3I9OA 5ES3A 2Y1GA 1GTMA 2IXAA 3JQAA 3C7AA 1DIHA 4EZBA 5KVCA 4KDEA 2YQ5A 1AXEA 3ICPA 2ZB7A 4ND3A 1C0PA 1D8AA 4RPKA 5JC8A 2C2YA 1T1RA 2P4HX 3ZV3A 4AJHA 1C1DA 4J0EA 3H4VA 3WSWA 3OQBA 2PZMA 4FJ0A 4LN1A 3AFNA 3QVSA 4WLVA 4LGVA 3PPIA 1B3RA 1YB1A 4WLNA 2Y1EA 1XG5A 2A94A 3NRCA 4LRSB 1BDBA 3HZZA 1IOLA 2C54A 2BRUA 4NFHA 4GX2A 4EBFA 1RM4A 2P5YA 1D4FA 4FQ8A 5JDCC 3DZFA 1Q7GA 3U0BA 4FOSA 3JQBA 3UFXA 2Q2VA 1DXYA 4AJLA 2EGHA 4YYZA 3PWSA 3BMOA 4H7PA 1WNTA 1X15A 2RH4A 3DFZA 4JGBA 3UAGA 1IPFA 1EMDA 2B4TO 3LVFO 2V6FA 4N18A 1XEAA 3AI1A 3INGA 4G5HA 3D4NA 4B7XA 1E7SA 3HB5X 1LDGA 1JKFA 1TEHA 1H93A 4AJNA 4L9RA 3O26A 1R4NA 4YJGA 2PK3A 1ML3A 1DRWA 1ZSYA 3HQ4O 1TVEA 3QWHA 1PQPA 5B4VA 3WOHA 2WTBA 3TPCA 4J91A 2WM3A 5BSEA 1PGNA 3JSAA 4R69A 5CPBA 3ADOA 4PG5A 5FYDA 3TOXA 3BA1A 1MXFA 5I7SA 1HDOA 5DBIA 2A4KA 1ZIDA 2QRJA 1V3UA 3QE3A 4IZHA 1PR9A 3BMQA 4ZGWA 5TNXA 5K6AC 2FMUA 1DC3A 1Z74A 5THQA 4QXMA 3F1LA 4NBUA 1N92A 1MA0A 3ETGA 1RPNA 2VYNA 2FWMX 5F1OA 2Y66A 4J9VA 3V5NA 5CG2A 4WCDA 3JQ8B 1NAIA 3ONDA 1B0AA 5BSFA 3O4RA 5JMWA 3ITDA 4BNHA 2P9GA 4I9UA 3RUIA 4RV9A 1O95A 1UZNA 1SPXA 4L76A 5GZ6A 2DBZA 3CUKA 3RFVA 3O8QB 3QWBA 4ID9A 2GD1O 2VQ3A 3GT0A 2X5OA 1V8BA 2J6IA 3AY6A 4L74A 2GGSA 1QYXA 3SLKA 1ZFNA 4D7AA 5KCZA 1P1KA 2HDHA 5JS6A 3FHLA 3JQ7B 2C5EA 4K28A 3QWAA 3I4CA 4A26A 3PFFA 4BIIA 5CAEA 1O89A 4ZU3A 4JBHA 4O1MA 3H5RA 1GEGA 2B5WA 4YT4A 2NVUA 3WICA 5IDXA 1P1RA 2AQKA 2HUNA 1L1FA 4AFNA 4CV3A 3M1LA 1XYGA 1JKIA 4AJPA 5JC1A 1YH3A 3ROKA 4XDYA 1ENYA 5LDGA 4JJFA 4F3YA 1TT5A 3I1JA 2DPGA 5L51A 5C7OO 2C20A 2GRAA 3AFMA 5T8KC 4BV8A 3U49A 1HYGA 4Q39A 1KBZA 3GNQA 1XGKA 4CMJA 3FTNA 3QVOA 5L45A 2VWHA 3OP4A 4ALMA 4YJDA 1UUFA 5I8ZA 2A35A 4CMIB 4J0FA 4WASA 4I1IA 1NASA 2CVZA 3ZHBA 1N7GA 1YQXA 4BVAA 2UVDA 1GZ4A 3AJRA 4A10A 4LMRA 5L7TA 2OL4A 3DHNA 3P2OA 2DC1A 1N9GB 4Q3EA 3BIOA 5DCUA 1R6DA 4Y9DA 3E9MA 1UXIA 3WQSB 1Z7BA 4U6SA 2ZTVA 5B12A 1E7QA 4GMGA 3TFQA 3NUGA 1GZ6A 4GWGA 3K31A 3OMLA 3RBZA 4RVDA 3OECA 4INAA 3RQSA 5BT9A 2O4UX 3GR6A 4O63O 3EAGA 3STHA 3MJTA 4LCEA 2VOJA 2VYVA 3GZ4A 1U3UA 3JYPA 1EE9A 1LDBA 4ALLA 1B3BA 5CFZA 1HZZA 1FDTA 4NBTA 4E3ZA 1GCUA 2AEJA 1Y9AA 4KOAA 1HLPA 4CM3A 4K6CA 5TF4A 1KY4A 5GMOA 4Y6PA 1TT5B 1E5LA 5KKCA 4J1SA 4J49A 5ITWA 4PIVA 5GZ3A 3U09A 4CR8A 4BL5A 5K0ZA 1HZJA 3C24A 3QWFA 4OGWA 5L9AA 3UICA 3A28A 3WG9A 2HK8A 1Y6JA 2DKNA 1FDSA 4G2NA 1I2ZA 4JN6B 1JVSA 4QFDA 3ZWYA 1HWYA 4MIOA 3O8QA 4KMSA 1AHIA 3OJ0A 3FNFA 3WGOA 3WS7A 4D79A 3KSDO 4M55A 3GGGA 3WYEA 4UVHA 3D4OA 2RIRA 1E3LA 1YJQA 1HEUA 3C7DB 3F4LA 4R68A 5KVVA 3G1UA 2EKLA 3ONFA 4PLHA 4HFRA 4CM4B 3IC5A 3S2FA 3PHHA 1RM3A 1NWCA 3F6YA 3NGLA 1CQIA 4OQYA 1MV8A 2C0CA 1PWZA 5GY7A 4PG8A 1XKQA 4KTVE 3W8DA 3E5MA 1J49A 5B4UA 4IJUA 1PJCA 4RVUA 4BNJA 4EUHA 4OQZA 4CM9A 3PYMA 4RPLA 1E5QA 3T7CA 4JIGA 2AA3A 4MKRA 2G5CA 3TRIA 5DOZA 2YQ4A 4TKLA 4E2ZA 1NPTO 1FMCA 3SVTA 1UDAA 4YA6A 2D2IA 1U3VA 2AQ8A 2VOEA 4MVJF 2C07A 3PI7A 4YQYA 4BGVA 3AM5A 3VVCA 1P77A 2Y1OA 5DN9A 5MDHA 4CR6A 2HK9A 1MUUA 5A9RA 3PYLA 1UJMA 3KYBA 2XXBA 4MVJG 4O6VA 1ZMOA 3DXFA 1OAAA 3VH3A 3GVXA 1U9JA 2WDZA 4IMRA 1ISHA 1IYZA 2ZJ1A 2HRZA 3E8XA 2IYPA 2HO5A 3DBHA 1K5HA 3VZQA 2VYVD 4QX6A 2FP4A 5ENVA 3MJVA 3ETDA 5KJCA 1KOLA 1M67A 4NBWA 4D41A 3VPSA 4DPMA 3DAPA 3L6EA 3LU1A 2H6EA 2BD0A 3BTOA 3KXDA 1BVRA 1OOEA 2B69A 4B3HA 1IB6A 1HYHA 1X0XA 3WXBA 4XB2A 3ZWVA 1PEDA 1H6DA 1EDZA 3G0OA 4DPKA 4KQXA 5U4QA 1ZK2A 1PJLA 3OQ1A 3Q1LA 2PD3A 4GL4A 4XIJA 1JAYA 1CF2O 1LRKA 1U4SA 5A06A 2OORA 2PR2A 5L40A 1MFPA 4RZHA 3NYWA 3GVIA 3RROA 3ZV4A 3QA9A 4FJ2A 4XDZA 1W0CA 1Z45A 4E6PA 1H6AA 1Y81A 3SXPA 1AXGA 2OGUA 3F1KA 3EY4A 4TVOA 4MKXA 4B3IA 1E92A 1LJ8A 4DLBA 2Y1DA 4YAIA 5IN4A 1U5AA 2GZ2A 3HADA 3D3EA 1KVRA 1PJSA 1PWXA 4PZEA 2VZ8A 4E33A 3TQHA 1F8GA 1PGJA 4F6CA 4JXKA 4AJ1A 1WDLA 1YQGA 4EYEA 4QUKA 2Q50A 1ZO8A 1Z6ZA 3CPSA 3EW7A 3ZHZA 3SJ7A 3RUCA 3EZYA 4DC0A 1ISIA 3D7LA 5CDUA 2E48A 2P9CA 2YHIA 4IUYA 3FWZA 3L4BA 1R0SA 2B4QA 2EW8A 3I83A 4TROA 5F5NA 4Z0PA 4AG3A 4WCFA 1YRLA 3NGXA 1H94A 1FK8A 3P19A 4H15A 1GQYA 4LW8A 4QECA 5T64A 2WE8A 4PLVA 3CKYA 3NDJA 2IODA 4DQUA 4FPXA 5B1YA 3DWFA 1NQAO 2WEKA 4R16A 4K9DA 4MKZA 3S2IA 1XSEA 1E6UA 2CUKA 4ALNA 4Z0HO 4CUKA 2J3JA 4XKJA 5TSDA 5A9SB 4B4OA 5G4LA 2RBEA 2J3HA 2I76A 2YY7A 3L6DA 4L8VA 4Q3BA 3DDNA 2AMFA 3VOSA 3TZCA 2AQIA 3BMNB 1U5CA 3VPXA 1U28A 5L4NA 2D8AA 3TN7A 3QIVA 1U2GA 1KYQA 3JQAD 3PLNA 4NHEA 2PA3A 1B8VA 3JD2A 1NR1A 3DEYX 3CH6A 2QYTA 4D43A 3EVNA 2X4GA 1BXGB 1U3TA 3GAFA 4TWRA 1YXMA 3W4IA 4AJKA 2VUUA 2HMUA 1KVTA 1QRRA 4C7KA 3CZRA 4FFNA 1KVUA 3B1JA 2X22A 2I9PA 3IKTA 3N7UA 4YRBA 3HWRA 2IYOA 4IQGA 1RWBA 2XAAA 3BAZA 2IZ1A 1SAYA 1VL8A 4OSOA 1ZEMA 4I5FA 2AEMA 3CINA 4PRLA 3VHRA 3WFJA 4ZRMA 3VDRA 5BSGA 3N58A 1IHYA 4R54A 1B8PA 2XPCA 5HA5A 1NPDA 3JYQA 4MVJA 5MGBA 3AOEA 1U8FO 4EJ6A 2PFGA 4BO5A 4DMLA 2W4QA 5CG1A 8ADHA 5KJ6A 3L9XA 4DTIA 4JBGA 3DOCA 3M6IA 3I3OA 1MX3A 4OOFA 5ITVA 4PFJA 4Y67A 3HDQA 5IN5A 3KHUA 2UAGA 1NAHA 3RUEA 2GN4A 3PTZA 1LRJA 4EJMA 1LLCA 3C1AA 1ISFA 1SOWA 4IPTA 2NSDA 3OJFA 4U0JA 4HX5A 3A06A 1HE2A 3SJUA 1IL0A 4D3SA 4J16A 5JAMA 1IY8A 4PCVA 3RD5A 3TFOA 4UEKA 2WYUA 3OA0A 3WQRA 1VLLA 4LMPA 4RF5A 1X13A 5IF3A 4CLHA 2PGLA 4XYMA 4BO2A 4FGWA 1WDMA 1T2CA 2UUOA 3IUPA 1E3SA 3E1KA 2HJSA 4P22A 5AXDA 4CMEA 4BB6A 4MVJM 2IEBA 5CEJA 4I5DA 4Y8VA 4JCOA 4IDEA 4R1SA 5KVSA 5IDWA 3EDMA 3MCVA 2CMDA 1M76A 4IXWA 2E82A 1HL3A 3H3FA 4DGSA 4IMPA 4BB5A 4DUPA 3DAFA 4W9NC 2X8LA 3D64A 3V1TC 1ORRA 1P9LA 2WD7A 3LT4A 1I30A 2VHZA 3OSUA 5L4SA 1EBUA 4J4BA 4BO1A 2DPHA 4J90A 2O3TA 4OM8A 1NWHA 1XU9A 1GU7A 2JCYA 3MTJA 4HFJA 4Z9YA 3ZWXA 1F17A 2PNFA 2A9FA 2B83A 3LF2A 4HXYA 2X0NA 2HU2A 3V2HA 3GHHA 1BW9B 5G0SA 3IKVA 2RHRA 4U5QA 4XRGA 1SBYA 2EERA 5EINA 3UW3A 4OXKA 3ZI0A 2HCTA 5H81A 4NBRA 5KOIA 2FY8A 5L53A 3GEGA 4JK3A 4LSMA 3KOUA 4BQPA 4L73A 1P33A 3LYLA 1IE3A 2UYYA 3BHMA 3VPGA 1K3TA 5FWNA 1HYEA 1WZIA 3FBTA 4BNKA 4CMCA 4CQMD 3KZVA 5ER9A 4FFRA 1DRUA 2HK7A 1UXGA 3ITKA 4FFOA 3RFTA 5TT0A 4B7CA 5JYEA 1LXCA 2NWQA 2D5CA 3ZWPA 1HETA 1ZK1A 4WUVA 1P1JA 1PZFA 3HN2A 3S2GA 2HRBA 4L75A 4IQ0A 3PHLA 4A0SA 9LDTA 5BSHA 5DF1A 1N1EA 4ZICA 3RUAA 3K30A 1WXDA 2AQHA 3F46A 5KNLA 3ETEA 1ISJA 3NT2A 1LSUA 3JQDA 4FN4A 4YAJA 2BF7A 4MOWA 2Y99A 1RKXA 3GRKA 4GGPA 1ULSA 1P45A 1ENZA 2AEFA 1GQQA 1ZSNA 2FRDA 4WOJA 3CSDA 1KEUA 2BGKA 5A04A 4NQZA 4U7WA 5TJHA 1IPEA 1LLDA 3CMMA 4R1UA 1WP4A 4JNKA 2GLXA 1SB9A 2PKQP 1R37A 1SEPA 2JHFA 4QO7A 3HE3A 1T26A 2PY6A 3FRJA 4ITUA 4BNIA 3WFIA 3G3EA 1IZ0A 3PHIA 3RKUA 3GHYA 3GEMA 1K2WA 3ZW8A 3FPCA 4RVSA 1PIWA 4YQZA 5U9CA 2Y05A 2X0RA 3VH1A 4UVGA 1YDWA 4XD2A 5T57A 1TA4A 1A9YA 3CXRA 2V7PA 3MJCA 4ALKA 1ZZEA 1L7DA 3WGTA 4CM1A 3O38A 4XRRA 1JAXA 1GD1O 5ICSA 4IGEA 2O23A 3G1TA 1A7KA 4TRMA 5LCXA 4HNGA 1YOVB 1F14A 4J3FA 5JSFA 3CE6A 1P31A 5CHEA 4CM8A 1ZUD1 3UKOA 4XYEA 1QKIA 1XIVA 3SX2A 3L6OO 4YAGA 3EMKA 4XQEA 1MG0A 2C82A 2WYWA 1T25A 3ENKA 3K92A 4BHTA 4FW8A 5AVOA 3WTBA 3FNHA 2VCYA 2HMSA 2ZB4A 5JAQA 1ZCJA 4CM7A 1HSZA 2VRCA 3PGXA 4CMGA 4NIMA 2R2GA 2A92A 3VTZA 1JVBA 3WMWA 4BMSA 5JDIC 3AM4A 2HAEA 2PV7A 2EKQA 2VHVA 3DB2A 4GX0A 4PLFA 4Y6SA 2OFPA 2DTXA 3PHJA 3B1FA 2NV6A 3LC1O 1BGVA 1U4OA 5JYDA 1H9AA 2W2LA 2JFFA 2Y68A 4OO3A 5AYVA 4WLUA 2R00C 2JFGA 5I7EA 4JROA 1E3EA 1B15A 2VNAA 2DUUA 3PXXA 4KDFA 4NJMB 5IXSA 3ZWAA 2EP7A 1AHHA 2O3RA 4H3VA 1ZXBA 4NI5A 2IXBA 3H9UA 1B26A 3NDRA 3RUFA 4XIYA 3ZW9A 1MB4A 2YV3A 1WZEA 4PRKA 3AI3A 4OKIA 2NLOA 3BYZA 2EXXA 2OMEA 3K96A 4CQLB 1SB8A 3RJ5A 5C37A 1JWAB 1Q7CA 1D7OA 1F0YA 3D3WB 5I9MA 3VAZA 3WGZA 1Y7TA 2JAPA 1NR7A 1SOVA 3ADPA 3EHEA 2CD9A 3UCFA 3B6ZA 1NVGA 3SC6A 5G2OA 4E2YA 3D5TA 3C3XA 2NQ8A 2EW2A 1V0JA 4R51A 4Z3DA 3RC7A 4E5KA 2E37A 3Q0EA 5K9ZA 1RM5A 2HSDA 1BW9A 3HG7A 3D0OA 3RVDA 1GFSA 3RC2A 1AE1A 3DONA 1EZ4A 2YFHA 2VNSA 2XF8A 3GDOA 4PLTA 4BO6A 1P74A 3FR8A 4TQGA 1DBVO 4EI2A 1JA9A 3TL3A 4L4RA 4ND5A 2ZTLA 5T6BA 1DHTA 2GN9A 5DCYA 3ASVA 3O03A 3NT4A 1GR0A 1P44A 5KWEA 1PGPA 3E48A 5COAA 2VWGA 2V6BA 2JJYA 4EUFA 3BMQB 3PWZA 3JQGA 3ONEA 4A03A 1ENOA 3QWIA 3NDIA 4CODB 3A14A 2WJPA 4FD3A 4FSHA 4CPDA 2FSVA 5IZ4A 3UF0A 4WJZA 4WOKA 3EVTA 4UEOA 2EF1A 4WK6A 1UAYA 3H65A 2H5LA 2EP5A 3WR5A 1F12A 3OM9A 1X7DA 3W4JA 3S1LA 3WQQA 2JAHA 5GZ1A 1E0DA 1EFLA 3ZU5A 1VPDA 2Q46A 1T4DA 2FZEA 2GN6A 4PG6A 4BKOA 4L4XA 3GLQA 4LVCA 4EW6A 4YT8A 5ILOA 1KVSA 1E7MA 4A73A 1DEHA 4ALJA 3DZJA 4NMHA 4E5MA 2YDYA 4DL9A 3INTA 2UDPA 3KUXA 3FI9A 2G17A 4QT0A 4YRAA 1ADBA 5G0VA 1DFGA 3SLGA 3GOHA 2NU9A 2GZ3A 3QLJA 4B7UA 4IBOA 1T2AA 5DULA 1LNQA 4LK3A 1HF3A 4CLXA 2O4CA 1ID1A 2NVBA 3H9JA 4B8WA 3ANMA 4U8GA 2GERA 4WLOA 4ZQHA 3P5SA 1CERA 1J4AA 5JDIA 4IINA 3COSA 2PGJA 4QFCA 1LSOA 2V6GA 3DZGA 4IIUA 5KVQA 3GG9A 2YUTA 1WVGA 4W82A 1R66A 2ZJ0A 5A3VA 4XCVA 1PTJA 1ZEJA 1AN9A 5ER6A 1RYEA 3PGJA 2EIHA 1K6IA 2H1SA 1X1EA 3VKUA 4DBZA 1T2FA 2X5JO 3GH3A 1ONNA 4JQCA 2GCGA 2EHDA 1WPQA 3QV1A 4E5PA 1VE9A 4CL8A 3GVHA 3A4VA 1I2CA 4IM7A 1FXSA 4P4NA 1GAEO 2WD8A 3ZDFA 3DBRB 3DZBA 4D46A 1Y8RA 1UP4A 4RPHA 3JYLA 4MO2A 4QO8A 3ON5A 3GGPA 4UVIA 2NUAA 1ZW1A 3BMNA 1E3JA 1DJQA 2PTGA 3PQFA 2VRBA 2POQX 1CJCA 3OIFA 1DAOA 2QQ5A 4PZDA 1N9GA 3ABIA 4MVJE 1GUFA 2BFPA 4G81A 3L4BC 3BTVA 3CZMA 4R1NA 3WYCA 1U7TA 1X14A 1YL6A 1PQUA 2X0JA 3D3WA 2O2SA 1DPGA 3VPFA 3UXYA 2JHGA 2DBQA 1DFIA 3NT5A 2R6JA 3C1OA 2OP0A 1PL7A 2W98A 2EEZA 4CMIA 1S6YA 1ZXLA 4KTTE 4B4UA 4NK4A 3LT1A 4M49A 1CRWG 5ICMA 4OKNA 5AQ1A 1YB4A 4IQ8A 2I5PO 2P68A 2YV1A 1E3WA 4N5LA 4NPCA 2LDBA 3INRA 3GNSA 3T4XA 2TMGA 5EQFA 3RAJA 4YTEA 3LC2O 1MG5A 5TT1A 3WNQA 5JY6A 1IHXA 4TRJA 3GY0A 4UUMA 5A5EA 2YHIB 2ZYAA 3QHAA 4A7PA 1KERA 3ZWNA 1JKJA 3OEWA 3JQ9C 4EITA 3A1NA 2FR8A 3IJRA 1E1NA 4II2A 2FZWA 3D5QA 1LU9A 3KV3O 4XYBA 1D1TA 3W6ZA 1Z75A 3OBBA 3ZNNA 3GZNA 1DC5A 4BO8A 3KBOA 1PSDA 3RI3A 3WWZA 3PJFA 4GAEA 3TL2A 4J7CA 4GX1A 1Y8RB 4OL9A 2C29D 3DBRA 3K5PA 2X23A 1X7GA 3IOYA 1F06A 2BMAA 3VZPA 4BO9A 3CTMA 4XWYA 4D45A 5COQA 4BNMA 1HLDA 1Y9EA 1ULUA 5ADHA 1QG6A 3I52A 4BNZA 2D59A 3OHSX 1DOHA 1LDMA 2Q4BA 3E82A 4DQXA 4B79A 4J9UE 4CM8B 2CNBA 4RQTA 4EGFA 2B35A 4AJ4A 3V2GA 1YOVA 3BXXA 1JWBB 2X6TA 4R5MA 1C1XB 2Q1WA 3RWBA 4A27A 5CDTA 3DMYA 4BO0A 3EUWA 4E0BA 1OMOA 3V1YA 5L95A 4W4TA 1NM5A 3DBVO 3I9JA 4Z0TA 3PDJA 2YHUA 3RSHA 2IRWA 2V6MA 2BFMA 2ZK7A 2IE0A 4O5OA 4UVEA 4CMBA 2ZCUA 5JO9A 3MOIA 3GQVA 1Y5MA 4FGSA 4W9NA 3KB6A 7MDHA 3RU7A 2X0IA 1PQWA 3AK4A 3FD8A 4J4HA 2VHYA 4GVLA 1DFHA 2PH5A 4BUCA 4KUHA 3ZZNA 1K89A 2YW9A 4OH1A 5I7FA 3ZV6A 1ZJYA 4NH4A 4OAQA 3MJSA 1SCUA 3LZ6A 1CDOA 1YS4A 3F5QA 1PR3A 1QR6A 3HSKA 2NVWA 2X9NA 4ZRNA 2HQ1A 1E6WA 1EFKA 3L07A 4TRNA 4NDNE 3GA0A 3AUAA 3WX0A 1B14A 4LISA 5I8WA 1HRDA 1I32A 1D1SA 2AE2A 2ET6A 2B5VA 5C5IA 3AOGA 5B4TA 1H2BA 1UDCA 2IZ0A 4TZTA 1IUKA 2Q1TA 1MLDA 3OIDA 4RZIA 3EGOA 1GQ2A 4KWHA 3TWOA 4DREA 5JFOA 4Y6RA 2OXIA 5FF9A 3JQGB 1N5DA 4TRRA 2OHXA 2CY0A 2VRCD 2YYYA 2VZ0A 3NTOA 1C1DB 3AWDA 2Y0EA 4PVDA 1UH5A 2I65A 4CV1A 1MC5A 3OFSA 4IGFA 2DQ4A 3I9LA 2O2YA 5FFFA 1A5ZA 1ISMA 4GSLA 2P2SA 4DWVA 3PZRA 1I0ZA 1Z73A 3HFSA 4R1TA 4E13A 4Z6KA 1E3IA 1WMBA 4GPD1 1UXHA 1N1GA 3G17A 5HBRA 4GVXA 2BI7A 1CIVA 1BXZA 1EVZA 1WAMA 4E5NA 5C7LO 4CLDA 4HV4A 5I9LA 1XQ1A 4FR5A 3JD4A 4BNYA 1N7HA 3WLEA 3WSVA 3PRJA 4IJVA 4PLWA 1I33A 3BMCA 1EK6A 2QIOA 4E30A 4KQWA 3KRTA 4CQLA 3F9IA 3FPLA 5TQVA 2EKPA 3PQEA 2CVOA 2VWQA 4TVBA 3X2FA 1ZBQA 5TX7A 4WKGA 2H63A 3KYDB 3GRPA 3PIIA 1PX0A 4NK5A 1LDEA 3HNPA 1ONOA 1PZHA 2Q3EA 1I3MA 5F1PA 1PU2A 3KTDA 1EBFA 4GKBA 4NJMA 4C4OA 1L7EA 1QYDA 1JTVA 1YDEA 4J1NA 3W4KA 1KEWA 5TIIA 1I01A 3EC7A 1U7HA 2HMTA 5JAIA 5HRUA 3QQPA 5EL0A 1ONPA 4OXYA 2J3IA 1BWSA 1W6UA 1UP7A 3JD3A 2I3GA 3JYNA 3QRWA 3WIDA 2I6TA 3QVXA 4R01A 2RH8A 3U4CA 4F45A 4DYVA 3NJ4A 3KVOA 1ADCA 1WMAA 4M8SA 2QRKA 5JCJA 2X7HA 2RAFA 1HXHA 1BVUA 1K0UA 4R5HA 3CEAA 1R4MA 3IJPA 2GPTA 4F6LA 3H3JA 1Q7BA 4OHUA 1O94A 2C5AA 4J7XA 3R3SA 3H9EO 1QYVA 3HUDA 1A7AA 1V9LA 4R4JA 1O5IA 4CMEC 4YJHB 4P8RA 3LLVA 2AW5A 4YB8A 1A4UA 5KJFA 1QV7A 3UGKA 4JX8A 5A9TA 3I9KA 1DC6A 3K2BA 1P0CA 1YGYA 2JKVA 2D5AA 3HDYA 2D4AA 4H16A 2Y1CA 4DPLA 2FHSA 1C14A 3VDQA 1B7GO 4RDIA 2PWZA 4WLFA 4RF2A 2I66A 3WB9A 6LDHA 5EMHA 4TKMA 1EK5A 3E9QA 1GEEA 5FI3A 3GK3A 1D3AA 4YEDA 3RUHA 1ZK0A 2ZQYA 3GAZA 1N2SA 4HFNA 2DU8A 3AUSA 1O8CA 5G4KA 3VTFA 2BLLA 2NQTA 4J1TA 1E1LA 4RJTA 2LDXA 5A5FA 3H2SA 2Y1FA 1DSSG 4BNTA 1V35A 5IJZA 3UOGA 4MVJD 4CM5A 1KEVA 4RO0A 4D0RA 3T7EA 5F3RA 4TZKA 1O0SA 1U1IA 4L4SA 3GN2A 3PP8A 3ULKA 1NP3A 1LQTA 1MC4A 3ZNPA 3K9QO 1PJ4A 5H82A 3IQDB 4ZQGA 4GWKA 4PLYA 1LEHA 2B0JA 5IXYA 3Q2IA 1GUYA 4RF4A 1XR3A 1NX6A 4E21A 5AOVA 5A9SA 4N5MA 3GF4A 4K1LA 4BO4A 4MVJH 1M2WA 1LTHR 5HTOA 2OZPA 3TDKA 3B1KA 2VHXA 3PJDA 4RVHA 4RORA 4Q3AA 1ZKMA 2VT3A 3OH8A 4PG4A 1H2HA 2CSUA 1HDRA 4BKQA 5EIOA 3IS3A 3LT2A 2CF5A 3BHIA 3UVEA 3NTQA 1OZAA 4OOEA 4PLCA 2FOIA 2OOSA 1SO8A 5L7WA 3I6IA 4WCFB 4YT5A 1I8TA 2NACA 1GYPA 2EWMA 2VTDA 1SZJG 4BNVA 1QMGA 3UCXA 1LQUA 2BH9A 4S1VA 4KUEA 4FC7A 4YJGB 3O9ZA 2GNAA 2QRLA 1J6UA 3TZQA 3VH2A 1EQ2A 4CMHA 3PLRA 1W8DA 1R12A 3OJLA 3GFGA 4AJIA 5TJ9A 1RJWA 5U1PA 5BQFA 2Y67A 1R16A 4EUEA 1NQOA 3ZWOA 2GF2A 2CZCA 2ZYDA 1X0VA 1KY5A 2YV2A 4M54A 4ZVVA 3U4DA 3H9GA 3PK0A 4FJ1A 4OMUA 4UREA 4D44A 3Q3CA 1I36A 4WLEA 1J0XO 3JQ6A 3WNVA 5IG2A 5CDGA 3H8VA 2O3UA 1VSUA 1YL5A 1WWKA 1QYCA 3W1VA 3QJ5A 2X58A 3QVWA 3ROQA 1EUZA 2GN8A 4L0QA 2GUGA 2VWPA 3VZSA 2FPIA 3IL2A 4JJGA 3RUDA 2NM0A 2CDAA 1HDXA 1GYQA 1MGOA 4GGOA 3K2EA 4U0KA 3WBBA 3AI2A 2Z1NA 3DHEA 1PZEA 3GFBA 4Q3NA 4W7HA 1TB4A 4URFA 3GC6A 3WGQA 4DMMA 1HDYA 4UULA 4NFSA 4DQVA 4B3JA 1PJ3A 4K6FA 4YJFB 4CL3A 2DBVO 1EUDA 2DAPA 4II3A 1EVIA 5DBGA 4AJ2A 2GO1A 2GDZA 2J3KA 1DRVA 4GLLA 1YVEI 4KP7A 4MPDA 3W6UA 5TGDA 3PFWO 4QQRA 1B2LA 3U4IA 8LDHA 4A5OA 2FR1A 2YZ7A 4NBVA 1FDWA 3R6DA 3WWYA 1P1FA 1KIFA 1VKOA 4CQMA 4Z9XA 2PKRA 5CEEA 4DLLA 3PHGA 1ZK4A 2ZTUA 1FJHA 4XGNA 1E6EA 4IZIA 1W4ZA 3MZ0A 1X1TA 5DP2A 1XELA 3DZHA 1O9BA 1LSSA 1DO8A 2NU6A 1BSVA 1NYTA 3GUYA 3FNGA 4IY1A 4ZJUA 3FTPA 4FBGA 1BMDA 4OIMA 3ZWWA 1U8XX 5A1TA 5IDQA 1T24A 2J8ZA 2YFQA 5JCJD 3RFXA 4N7RA 1H6BA 2IEDA 5G0UA 1AGNA 5DT9A 3EYWA 1BG6A 5B37A 4BNGA 3PEFA 1H5QA 2DTEA 3JTMA 4HNHA 1XLTA 3IMFA 1QLJA 4E32A 2P5UA 3D1LA 1BXGA 4OSPA 3W8EA 1ZVMA 3F3SA 5T8KA 3E9NA 2UV8A 3BHJA 3I4FA 4WEQA 3DQPA 2BGMA 3JQFC 3JQ9A 2XXJA 3IP1A 1J5PA 3E6AA 1NXQA 4PLGA 5G0TA 3WJ7A 5C7IO 1T1SA 1ADFA 3S8MA 1I10A 4Q3CA 1K6XA 4ESOA 3FR7A 4OYRA 1NQTA 5A4DA 4GX5A 5IDYA 3PVZA 4W7IA 1E1MA 3RKRA 4I5GA 3FNEA 3AW9A 1XDWA 4RF3A 4RGBA 1ADGA 2I67A 4Q3DA 5G4KB 1UAGA 3DBLA 3DR3A 1FF9A 3WLFA 4BOYA 4BNFA 4XX0A 1LI4A 4HWKA 1H0KA 1PJ2A 2Z1MA 3DFUA 1UZLA 5JMPA 5KJ1A 4WE3A 2CDCA 3LDHA 4XR4A 4CV0A 1DHRA 3DTYA 6ADHA 4WEOA 1E7RA 3GMDA 1G1AA 3A9WA 4RLHA 4RVGA 5KIAA 3GPIA 5EQDA 3L0DA 4DRYA 2QX7A 2JD2A 1QXSA 4B4WA 3PJGA 5LDHA 4YJHA 3NTRA 1KVQA 1ARZA 4PLZA 5IFLA 2VYND 5G0WA 1PZGA 2DUWA 3C7CB 3B20A 2G1UA 3OJOA 4IJWA 3C1TA 1DIAA 2B37A 3DHYA 4LVUA 1GY8A 4X54A 4XGIA 2RHCA 2BHLA 2FSSA 4CLOA 2WSBA 3DTTA 2QYSA 4G65A 3WGIA 1GPDG 4DIBA 3OETA 4LRTB 3MOGA 3AUUA 4HUJA 3SEFA 3RIHA 1JDJA 1N8KA 2BGLA 1DAPA 1M66A 3GZNB 3QP9A 3Q6IA 3ANLA 1Q1NA 2DVMA 2Q4EA 2HJRA 1VM6A 4XB1A 3LK7A 3PZBA 3H9QA 1PS0A 4RDHA 3ZWBA 1DIBA 2W2KA 4BKUA 3H6KA 1GCOA 1PGQA 4R41A 3KYCB 1ZNQO 5DZSA 1C0IA 3RC9A 3P7MA 1QLHA 1NFRA 4DA9A 3MTGA 3VPHA 3UUWA 5L3ZA 1QV6A 5EPOA 4GLOA 3MWDB 1E3WB 4IDAA 1WW8A 1GYRA 1SC6A 1RM0A 3KYDA 4JJIA 3R3JA 4RPJA 2VZ9A 2P9EA 3ROMA 4FFMA 4NFYA 1VJ0A 1YL7A 4DIOA 3DAGA 5BNFA 3DL2A 3ZV5A 3MEQA 4KZPA 1E7YA 1YJ8A 4M89A 1GADO 1GV0A 4MVJI 1YBMA 3OA2A 1NBOA 4J2OA 2C7VA 4P38A 4J1QA 2NVUB 3BMCB 3UH1A 2C2XA 5TC4A 3DBHB 3ZU4A 2QG4A 1V6AA 4I9NA 4GSKA 3JQ7A 4J7UA 5DBFA 1GDHA 4DIFA 1K6JA 4M87A 5F21A 3AM3A 3KO8A 1TI7A 2W8ZA 4NG5A 3ASUA 1U2DA 1YE3A 3R1IA 2C7GA 4FCCA 4BS9A 5EN4A 4CLRB 1ZJZA 3I23A 2HLPA 1NHWA 1ZK3A 5TS3A 3LLSA 1PJBA 5AXBA 3JQ8A 2PZKA 2AG5A 3GPDG 3E03A 3F5SA 4N54A 3ZU2A 3C8MA 5CEFA 4HBGA 4CM6A 1MFZA 4MP8A 1QYWA 4E31A 1PS9A 3DOJA 4EJ0A 3M1AA 4E2XA 4YXFA 3QVTA 4W99A 1TT7A 4CJXA 5A03A 4J4TA 1A72A 4ILKA 3HDHA 2PKQO 5I9NA 3RBXA 3IDSA 1LUAA 5KKAA 2CF6A 2X5KO 3VC7A 1LSJA 1MXHA 3I9NA 1ZH8A 4M86A 1I5RA 1H6CA 1NTOA 3HJAA 4RL6A 4UUOA 5T67A 5BR7A 7ADHA 4CM4A 2FPPA 4QSMA 4K26A 2RCYA 1G0NA 3V1UA 3H5AA 5A3JA 1R4NB 2W90A 3TJRA 1R0KA 4YR9A 3L77A 5JDCA 4XR9A 1XQ6A 3FSRA 3RU9A 4CLRA 1G0OA 3T4EA 1BDMA 1Z82A 2SCUA 4IDBA 1I3KA 1LDNA 3PQDA 1V3TA 2DTDA 3DOOA 1KC3A 4EEXA 4BNLA 2V65A 4D3DA 2VT2A 3AU8A 3KEOA 4ND2A 2X9VA 2Y93A 3BMOB 1Y8QA 1DC4A 2VHWA 4YJFA 2AE1A 4LSWA 1A71A 3R0IA 1GV1A 1NQ5A 1UDBA 1LX6A 3ENNA 2IZZA 3GG2A 4DYDA 5CDYA 3PYXA 4P4GA 5HS4A 4FFLA 1XCBA 2OBYA 1UXJA 4BGIA 2GYYA 3AU9A 2PH3A 4J6FA 4HY3A 5F1KA 1JN0A 3B70A 2ILTA 1HKUA 2E4AA 1UP6A 2HMVA 4GKVA 4ONEA 3NEPX 4N5NA 3WJAA 4YCAA 2B36A 4BQRA 1C1XA 1LA2A 4MIYA 4P4LA 1M6WA 3TZKA 3GMSA 3ST7A 4MP6A 4ZD6A 1E7WA 3PIDA 4XQ9A 1QP8A 3ZU3A 4O0LA 4XQCA 1VI2A 2Q2QA 1ENPA 4ZA2A 1Q0QA 4BNXA 4W6ZA 4I9HA 4IS2A 1OI7A 2W2KB 4GQAA 4QEDA 3TNLA 1A4IA 4PLPA 3QW2A 1UR5A 1Y1PA 3RC1A 1KS9A 3JQAB 3I5MA 2GZ1A 3AY7A 1F8FA 5THKA 3EZLA 3KLPX 4B8ZA 2Y0CA 4YVFA 3BTSA 4R3WA 4I5EA 3M2PA 1B8UA 3DMTA 4IDCA 3WGGA 2P91A 4E2WA 4E5YA 3JD0A 4BV9A 2WYVA 4AICA 1TXGA 1YKFA 3ROPA 2ZB8A 4JP3A 2Q99A 3ZN2A 1YBAA 2Y0DA 2PLAA 3D4PA 1SMKA 3H5NA 4NU6A 3WIEA 4BNUA 5CPFA 1E1KA 4GI2A 5BNIA 4NR0A 4MVJP 4UVDA 3GN1A 4HFMA 3X2EA 1HDGO 1V3VA 3LF1A 1PJQA 2JCXA 1MP0A 4RLSA 4BNWA 1LLUA 2Z5LA 4J2HA 3V2UA 3TF5A 5JO0A 1NFFA 1R0LA 3WMXA 1I2BA 4J43A 4CMAA 3F4BA 5C3MA 1XHLA 1EUCA 4JLWA 4M1QA 3ZH2A 1T2EA 2H9IA 1TLTA 3DBLB 4I08A 1GUZA 4UAGA 3M2TA 2D0IA 3JQEA 1NVTA 2C59A 4WPGA 5HM8A 1VRWA 3FN4A 3VH4A 3PJEA 4ALIA 1LBEA 3RCBA 5JW6A 3SBOA 3CIFA 1IULA 4PGFA 4DBVO 2Q45A 4OJNA 1AUPA 2FN7A 3K6JA 3TOZA 4ZQBA 3F47A 5LC1A 1GL3A 2DT5A 4CLOB 5COBA 1YQDA 3G49A 3DZIA 1PS8A 1YONA 1SEVA 3FCOA 5ILGA 4AL4A 1T4BA 3ZWMA 4DLAA 3ZCXA 2CDBA 2X86A 2ZCVA 2ZQZA 4JBIA 1KEPA 2NU8A 5I7VA 4YT2A 2XOXA 4DVJA 5A05A 5JXWA 3NV9A 3OICA 3WDSA 2JD0A 1DJNA 1CEQA 1P3DA 4XQGA 2IDZA 3WBFA 2QZZA 2PD4A 4QTZA 4PG7A 5J23A 4KUGA 2DFDA 4BMNA 2ZKLA 3HB4X 3ANNA 5CP8A 5TLSA 1JW9B 2Q1SA 4WGGA 1DLJA 3KETA 4BO3A 4O59O 4WCFC 3E5RA 4D3FA 1HT0A 2PGDA 3RBVA 3K8ZA 3OEYA 2YJZA 5L7YA 1Y8QB 4CV2A 5H83A 1XA0A 2O7SA 3HHPA 3U5TA 5A02A 3IIEA 3G79A 2GR9A 1E77A 4XJSA 1ZMTA 4UEJA 1A9ZA 1T2DA 5KJEA 1EVYA 2VTEA 1PJTA 5KTKA 1M75A 1DDOA 2D3TA 1BTOA 1IZ9A 2ZIZA 1I24A 3JD1A 5EERA 2JD1A 2E6UX 4XZ3A 3ZHXA 5FI5A 4R9RA 5JPIA 5JY1A 4YAEA 4R9SA 2O50A 4MINA 2EJVA 5ENDA 2BELA 1YBVA 3GVCA 4CUJA 4GH5A 4R3NA 4RCVA 2JL1A 1YB5A 1HE4A 1P1IA 4XEHA 5T5QA 4C7JA 1H9BA 2ZYGA 4EDFA 9LDBA 3JQBC 4YPOA 4BMVA 2O48X 1ZSVA 1HE5A 2Q49A 1HDZA 5F5LA 1HE3A 1UZMA 2GSDA 3HDJA 4Y98A 2NU7A 1Q0LA 3MJEA 3NKLA 2AXQA 1NVMB 4Z3KA 3W8FA 1LDYA 3K73O 3MJ4A 4DC1A 3GGOA 2Z95A 3LQFA 1C3VA 2Q2WA 3SC4A 4IDDA 1X7HA 1VSVA 5TRTA 1YWGO 4CQMB 4XA8A 5EJ2A 1DLIA 5DDIP 4CUZA 1BRMA 2OP1A 3AUTA 2G82A 2YDXA 4FS3A 3H2ZA 4PZCA 2I99A 3VVBA 4S3MA 2EV9A 2UUPA 3IAHA 4MP3A 3U62A 5K6AA 4WNCA 5JAZA 3QY9A 2VN8A 1BXKA 3GNTA 2X1HA 3ZWCA 4XJTA 5DCWA 4Z9FA 1SNYA 1FDVA 1I3LA 3IUSA 1NPYA 2CFCA 2DLDA 2O3SA 2QW8A 2J5QA 1LLQA 1VJ1A 4AVYA 4WECA 1VC2A 4ND1A 2NTVA 2D1YA 2WD7B 1EEHA 5DNAA 4MDHA 3RASA 1LRLA 2O7QA 4YDRA 2F00A 3FBGA 4FC6A 4B4VA 4XYLA 5JCXA 3GDFA 1RYDA 4IXTA 3UCEA 3FWNA 4I8XA 4FIZA 3WYBA 2ZATA 4YRDA 3KYCA 3MWEB 4IS3A 3LT0A 3N74A 3P2YA 3JQCA 4UUNA 4TSKA 1QSGA 1YO6A 4IJKA 1CQJA 3JV7A 5FEUA 1CETA 3TZHA 1XWFA 3VZRA 3JCZA 3H7AA 1R15A 5L4LA 2WMDA 1PL6A 5JE8A 3I6QA 4CM9D 3LC7O 3S55A 3KSZO 2OUIA 2JFHA 1CWUA 2DBRA 2EGGA 2WE7A 4EEZA 4ZN6A 1Q0HA 2OBNA 3AOEC
chains in the Genus database with same CATH superfamily
2X0KA 1NQVA 4POAA 5F23A 3M5WA 2TMDA 3E8SA 1W44A 4BNNA 1DAMA 2VHQA 1EVEA 3D6JA 2GJ9A 1EWQA 5JCOA 2XNSA 4WERA 2F1KA 5DOVA 3B9BA 1PT8A 5FT9A 4H1TA 2VUTA 1NQWA 4MW1A 3ZJUA 3C8ZA 1I4LD 1YDMA 4FYPA 5DNWA 1BH2A 3VR0A 1Z5ZA 2HADA 2X9GA 3KELA 4DOMA 1PL8A 3BTUA 1NBMA 4C3UA 3T7JA 2I87A 4GO1A 4AURA 4CEJA 1QX4A 2O2EA 4IGIA 1IN8A 1HT1E 1TX4B 2VBGA 3AHHA 2XT9A 4AP6A 1G6KA 2RGUA 4EMUA 4S2EA 5TGZA 3I8XA 3WGYA 4TS1A 4OXNA 5FWDA 4B2LA 2I2DA 2F1JA 4NNJA 3EXHB 2HEIA 4DJ5X 2DSTA 5EZYA 2PZLA 2RJOA 3EAQA 4QASA 1CYDA 4LCJA 1D2HA 4KVAA 5EXPA 3ZHYA 4AJOA 4BN4A 2MYPA 3R5SA 5H1YA 3X1ZA 2IBTA 1UDRA 2NTNA 1EQUA 3ONVA 3UWKA 4BEWA 1AMOA 4HKTA 4QATA 2ODBA 3GEDA 1UFKA 1UWLA 5DTQA 3NAQA 4CMKA 1M9NA 1NDQA 2DHRA 3PEUA 4X0EA 3B3QA 3Q11A 4KSBA 4ZKDA 1CDEA 1ORIA 2HLDD 3B8HA 3TSCA 1ZRNA 3S2EA 4AYTA 4PN3A 1O2DA 1XPJA 4PQFA 2AFIB 1JA1A 2G0TA 5FLKA 4YXWA 1JU9A 1Z0AA 3T6KA 3KXKA 2AN3A 3BRSA 3KEQA 4WQMA 4NU5A 2QQEA 4Q4DA 5AOBA 1DAFA 2L17A 5LXTF 3VTKA 3U4HA 3PLAE 4FFVA 4BKPA 1EE2A 1Z36A 5EPEA 3DJYA 1FYEA 2P67A 5IAAA 4MUHA 4Q6BA 5FWAA 5DLYA 5CX1A 4ENPA 3ZIUA 4NJOA 2OM2A 4BFVA 3IP3A 1TQ2A 3RIXA 2UUCB 3HFRA 3QJYA 3RVPA 4JP2A 3ICCA 5IMBA 4YACA 2BM1A 1QWOA 4NJEB 4GMDA 1YJ5A 3ZKWB 1L4EA 4FZJA 4PS1A 4CWAA 3OLWA 4LJYA 3D2CA 1XTPA 1S2NA 2BEUB 2IE8A 2IIBA 1IMOA 2XCTB 1PHPA 1RCUA 5DI3A 2BISA 1IQPA 2GB4A 2VHEA 3AL2A 1J23A 4I9GA 4OATA 1SHKA 4QHYA 3HPRA 3UAVA 1RLJA 4RL4A 3OJEA 3UOWA 3HXPA 2C1EA 4PRYA 1HDCA 2Y2VA 3N5KA 4ZIRB 1A27A 3LBAA 4MPRA 3SKXA 1NBAA 2XVXA 3E7DA 1C0LA 4F46A 4X66B 4AJEA 5K0FA 1HSOA 2I8AA 1HMYA 3VNRA 1CUAA 5IT9A 1I5OA 4HJRA 4RQUA 5AJUA 3S0JA 4FMPA 3RJ9A 1G4UR 4PIMA 1U3GA 1OC2A 4IDFA 1DZIA 5ICCA 3PX7A 5CITA 1RPZA 1BHJA 1JQBA 1J90A 3WHLA 3GUCA 5EZQA 5FTJA 3GXOA 3OIGA 5AKGA 3Q9SA 5E9QA 5LUBA 4GMFA 1OY1A 2QJOA 1J9GA 1QHHB 1VJTA 1LQ2A 1R4MB 2ZB3A 3MMNA 3DZKA 4P5EA 3MS7A 4BGEA 2OVBA 3FYUA 4XFJA 4BKRA 2K2WA 3RRZA 4BO7A 2DP4E 1PE0A 4IJ6A 4OQNA 4PAWA 4E5UA 5IZCC 4PGMA 4Q1VA 5HWSA 2XB2A 4Z51A 1O96B 2LZ0A 1VLZA 1NFQA 1SD2A 2B2CA 2WIFA 2ZT8A 3E05A 2GZHA 4K7JA 4D0SA 3L4KA 3VKHA 2XBLA 4HADA 4LI0A 5AFSA 1NMYA 1F4VA 2XJ9A 2PXHA 5I7UA 3QM1A 2Y1GA 1EUDB 1GTMA 3JQAA 1WG8A 3C7AA 5A5DA 5GGXA 5DW3A 5F7ZA 1UKZA 4JBWA 3AR9A 2ZB7A 4AMUA 1WUTA 2P65A 2XHZA 1P73A 2C2ZA 5ALGA 2WQ7A 4R81A 1Z9BA 1W581 2P4HX 3H4IA 3WISA 3ZV3A 4AJHA 5BRJA 4L8LA 5MN4A 1N34B 3H4VA 3WSWA 1AS3A 2PZMA 4LVNA 1WBJB 5FL7D 3VZBA 4FLEA 2V9ZA 3OZSA 3AFNA 1NRJB 4IIBA 2W37A 3NHJA 4LGVA 1Q77A 1TAQA 3ZYCA 5BN3A 4HAUA 2IU6A 5KWJA 4WLNA 3ZVNA 2OHJA 2Y1EA 4MB2A 1LLFA 4OYYA 2BRUA 3B82A 4NFHA 2GAAA 2MYUA 3KUDA 4ND7A 4KFTA 2AMLA 4LJ6A 3NBAA 3DZFA 3FDZA 3GZJA 2FPKA 3ZVRA 6REQB 5K03A 2VJPA 9ABPA 4FOSA 3JQBA 1CP3A 3RAGA 3GX1A 5LQMA 1VYHA 2JS7A 1MOSA 3MGKA 3VXKA 3PWSA 3U13A 1X15A 4COOA 1I13A 1NLMA 2I8CA 2RAPA 3OCYA 1IPFA 3B3FA 3O4GA 4WFIA 3M5DA 2B4TO 1RLUA 3ZU6A 1OJ7A 2Q5IA 4BXOA 2ZDHA 4OK6A 1CR1A 2A1TR 3W2FA 4R1MA 1Q74A 3V4VB 1LDGA 2GXAA 2WWWA 5CCDA 3O26A 1C1YA 3QNUA 2QTVA 3CX3A 4YJGA 4YRSA 2BGRA 3HDTA 3IR7A 1ZIPA 3BUSA 4Q7QA 2WU3A 3TPCA 1LBSA 2WM3A 3KVYA 1M2OB 5TEWA 2RC5A 5CPBA 1GNQA 4CEIB 4YMTA 1RPJA 2FK8A 5FYDA 4UE6A 1NVKA 3CVWA 2JFZA 4LTMA 2UZIR 3UEOA 1MF7A 3TLCA 3F7NA 4PV7A 4CRWB 2EEPA 1NU6A 3IILA 3EFEA 1CZKA 3VYRB 4QGGA 3P0FA 5LQAA 5IBQA 4ZGWA 3TZBA 3D7NA 2O52A 1YTUA 3FKJA 1OWMA 3TW6A 5KNBD 5DLQC 3ZCTA 2C5LA 4WHMA 3H5OA 4TYQA 2FPWA 2VYNA 1Y8ZA 3EY9A 4J9VA 4EHBA 5EKSA 1NAIA 5AKLA 3OCVA 1PK8A 4R9VA 3A4LA 3UOGA 3VYWA 2XYGA 3O4RA 1FIUA 5EEHA 5JISA 3IAXA 1O95A 1JYFA 2I2WA 2QTMA 2ZR8A 5GJCA 1OILA 2IP1A 1ODIA 1UZNA 2FNAA 4D0LB 1VL1A 1SPXA 2RGBA 2CXOA 4FEEA 5DLEA 4ZCQA 2CKDA 1P8AA 2DBZA 2DPMA 2UVPB 5GZ6A 3RFVA 1QGZA 3RVOA 2II6A 1X87A 1XEXB 4IH9A 2QLTA 5EYPB 3KXPA 2J6IA 4FFWA 4L74A 3EJWA 2RGXA 3SLKA 1ZFNA 2YWDA 4P3NA 4TMVA 1DTWA 4D7AA 1CYEA 5KO2A 4HDKB 5DH9A 4A26A 4HN9A 1O89A 1QTRA 4BFSA 4EGCB 3OTQA 5DGCA 5EIXA 3EODA 4YT4A 2NVUA 3LLUA 2C7RA 4I55B 4CV3A 2WUEA 5ARDA 3M1LA 1UCFA 3A05A 1U0LA 2E89A 3CO5A 4FZ3A 2LBPA 4K87A 4ER5A 4XDYA 4GGMX 4NAHA 4JJFA 4LV8B 1XVLA 4KJZA 1TT5A 4NQRA 4XDHA 5LDGA 2NXNA 2NO0A 4AQDA 4D4MA 3I1JA 5L51A 1H1LA 2ZBRA 1PX2A 4WXHA 3HU2A 1NZJA 1GLNA 3DLHA 1Z5WA 4AZWA 4YRFA 5IULC 4FKZA 3QVOA 3RJZA 2VWHA 4KO3S 2O8NA 1KO5A 2QMZA 1U2DC 4FGKA 2NAFA 5J5VA 4J0FA 4I1IA 2AKEA 4LC9A 1ZD2P 1N7GA 4BLVA 2UVDA 5JT1A 2J09A 4CVNA 5K0NA 3S4YA 3D6MA 1IOZA 4EHDA 2OL4A 1YI0A 2VDRB 4IIDA 1YMVA 4JJKA 2DC1A 2XOKD 4WINA 3SZGA 1REQB 2WIAA 3BIOA 3TR0A 1PL0A 4CTKA 1R6DA 4Y9DA 3BD7A 4DV3B 3BA6A 3AT1A 2RGAA 3E9MA 4YONB 1EFHA 1PKXA 1BX3A 4AF7A 1Z7BA 5B12A 1G8HA 1ZM2A 1M34E 2D2EA 4RSRA 2ZDGA 3R76A 4O4LB 3K1AB 1GZ6A 3SQNA 2G77B 2XY4A 3STWA 1NJ1A 1AKVA 4M1OA 4QLOA 3E15A 2JLCA 4KAFA 3RQSA 4ZMRA 5AW4A 2ZIEA 3GR6A 4O63O 3DMPA 4MUKA 3EAGA 3U9LA 4GDFA 4JR0A 4LCEA 1UWKA 4ON9A 4V0ME 1BWQA 3P0JA 3EG9B 3R41A 3GZ4A 4RSGA 1QB8A 2OQ2A 2BFEA 2DWQA 4K9LA 2ZWAA 3F5DA 3RYIA 3GLHB 3CF0A 5AKYA 4K6MA 1TMYA 3PR1A 5BSMA 1GCUA 4LQCA 5FOXA 3ODPA 1HLPA 2CJYA 4JB3A 1RAAA 2ACKA 3HXLA 3EXIB 3K32A 2DWUA 4RTKA 4Y6PA 2RHOA 1E59A 3ZDAA 4BMPB 2ONZA 4LE2A 4W8GA 4DDWA 2JBAB 3LV8A 1K7EB 4J1SA 3IXQA 3QXSA 1GOTA 2FYTA 4CKCA 5BR1A 2OV4A 4V38A 1A95A 4BL5A 4F92B 1NMQA 3B6MA 1NUTA 2P0AA 3LUHA 3H84A 4P3KA 2BEWA 3IA2A 4A23A 4B6JA 2R97A 1HZJA 3OLZA 4IIFA 3H1TA 1Z26A 4IFTA 3ORYA 3IMCA 5L9AA 2A9OA 1MT0A 1GRCA 5TPZD 2GVNA 3RT1A 4EA6A 1Z56C 3C74A 4JB8A 3VKGA 5HUHA 3IT0A 3KS9A 3EIWA 3E9DA 2J41A 3R0XA 3W5IA 3QLVA 2OYSA 3EPJA 3EDCA 1JVSA 1E3TA 4F2PA 3O8QA 4KMSA 5BT8A 4RS4A 5FL7A 3THYB 1FQOA 3CUWA 5DE3A 2MJLA 4RDCA 4QSHA 1FMTA 2B1IA 3GGGA 3TFQA 3WYEA 2BEJA 1Z37A 2JJ2D 2LCQA 3D4OA 4G01B 2F4VB 1YS6A 1LK0A 5AUOB 3F4LA 2E2WA 1XRSB 3G1UA 3ZXUB 1IOWA 2YZNA 3I30X 3MNFA 3PR3A 3U7RA 2QN1A 2CB0A 2RHLA 4CM4B 1B4DA 2A14A 3PHHA 2A2ZA 2IV7A 2O0JA 1K3UB 2RGRA 4REMA 5GY7A 1CQIA 1MV8A 2UZAA 3MTEA 1WB9A 1X38A 3JRWA 2WV9A 4LMBA 2B0CA 3WL4A 4RWEA 4WZBE 2CL0X 3TQOA 2XSZD 4YC7A 5KWSA 4YP9A 3TRFA 3LCMA 3GUHA 4OQZA 3T7CA 1E5QA 2OFFA 2HTEA 2G5CA 1J2UA 2GN0A 4F2HA 4QEKA 4A15A 1M1NA 4ZWNA 4QOSA 1C7FA 2QLBA 4UCFA 4R0MA 2PWYA 1XALA 5C52B 5CFMA 4C6TA 4E51A 1CF9A 2XCLA 1YNOA 3EDRA 2RAUA 2D2IA 2BFCB 4YUWA 3ZBUA 1ZA2A 3QNWA 4LY3A 2GK7A 1UBEA 1ILWA 4RZSA 1P77A 4AF8A 3MQ2A 1VGRA 3EBLA 4AMZA 2YMMA 3AHFA 2ZR0A 1UJMA 1DUIA 3KYBA 3OQPA 3BJIC 4KLRA 2XI4A 1FTGA 2WJZB 5FHRA 1XLVA 1ZMOA 3WLIA 4J0CA 5KOJB 4D80A 1Q50A 3QI2A 4G86A 4OHMA 1BZYA 5D6NA 3VH3A 4H0FA 1L4LA 2LP4Y 2QY6A 4IMRA 2WDZA 1ISHA 4W1SA 3SX4A 2NUBA 2I03A 2HRZA 5HDQA 2IYPA 2WUWE 5AVWA 2NGRA 1JG4A 3DBHA 2G1PA 3KVRA 3VZQA 3AVQA 3P9RA 4PZPA 1FRNA 4GL2A 3ETDA 3G5TA 5EP4A 1QCYA 4NBWA 4MGHA 1PRYA 5BN4B 3RIGA 5HIMA 3WV4A 1Z2PX 3DHVA 4MCHA 1SQFA 3BTOA 4YRTA 1BVRA 2B69A 1IQUA 1SC3A 1Z4QA 3DOHA 3L7DA 1H0HA 5LIPA 2OGWA 3EOZA 1U0EA 2GAJA 3HCWA 4WBNB 5CA1B 4KQXA 2VH5R 1ZK2A 1I4EB 3OQ1A 3PV0A 4GL4A 3RM3A 5HGJA 5L3SA 4FCWA 5LKAA 4H9GA 1CF2O 3HCPA 4P9NA 3TJMA 1TZCA 1ZYUA 2I6UA 2HH9A 2D7DA 2J85A 3OOYA 4WZAE 2PMDA 5L40A 1RBZA 3O8OB 4GZMA 5K3AA 1CUFA 3AHEA 1TDJA 3W9UA 2YYZA 4LF9B 3WGLA 1WOMA 4FJ2A 3H97A 1H6AA 1XTIA 2JGJA 3O0TA 4TVOA 1SCJA 5J2TB 3NAMA 5ICEA 1JF8A 1RXEA 1XZQA 1E92A 2VTVA 3ML1A 1LJ8A 4DLBA 3HY6A 2BE7A 2D74A 2HHJA 2I4TA 1G18A 3S40A 5KYKA 3PS9A 3D5EA 5KTYA 1PW5A 1KDYA 3KUUA 4ABTA 4EAQA 1G8AA 3O93A 1PTJC 1KVRA 2W2NA 3K9NA 4OL0A 1CRLA 2NV2B 4PZEA 4MRPA 3TQHA 4GOKA 3OPYA 3LCVB 5C7YA 1PGJA 1YCDA 2F1HA 4QU8A 2ZJ6A 4LXGA 1EFRA 1UJNA 3H2HA 3OE7A 3LM8A 2C2MA 3PUHA 5LJLA 3E2PA 5DYIA 5GONB 3WKEA 3OJXA 1ISIA 2P9CA 2XZTA 3T7SA 4ESEA 3D7RA 3O74A 4PQYA 1YHZA 3ZZTA 3FWZA 4TROA 2VNKA 4NE2A 5C46F 1NN3A 3ANXA 4AG3A 2HXGA 5EJFA 4KWCA 4B3FX 1K7SN 1V7ZA 2BBWA 1JFVA 4MULA 1FK8A 1JSCA 2I7VA 4P98A 4NXMB 1K5DA 1A2QA 4EMTA 3RANA 4LW8A 4HAIA 4QECA 2ZYHA 5HQJA 1G8GA 2WFLA 4M3NA 3NATA 4FBLA 1UXOA 4O2RA 5E4JA 2A9KA 4EX6A 3OURA 4XUEA 4F56A 4FEAA 4DQUA 4O08A 1ND6A 1T9CA 2WG2A 2AJBA 1JYEA 3W5VA 4EKYA 1ZIYA 3EIOA 1XRPA 2APJA 2AG0A 3OHMA 1P7WA 1XRJA 2J32A 1DKPA 1A8QA 3OLQA 4CCYA 4CUKA 4DCCA 1NY6A 2AR7A 4H0NA 1HORA 4WKOA 2ZUSA 2CMGA 2DSNA 4B4OA 3MXTA 2RBEA 3HJUA 3CS3A 2IQIA 4KN6A 3IUBA 1H4SA 2J3HA 2DOKA 1UOEA 1P19A 2GYVA 3L6DA 4L8VA 4WW0A 1XKLA 4Y2JA 1WKVA 2AMFA 2DY1A 4RTSA 3H9CA 4HZGA 4XPZA 4G0QA 1AZWA 2AQIA 2P90A 1U9IA 3BMNB 1GLGA 1U5CA 2YWHA 3K0AA 1HOTA 2KX7A 3SICE 4ZDJA 3ZYZA 1X39A 4EFDA 1C4OA 3FCEA 1KYQA 2P5SA 2UVPA 3AINA 3JQAD 3Q8WA 3L43A 1DG9A 1H2FA 2FMXA 1N4DA 3DEYX 3LRTA 3TOSA 2X4GA 5SYNA 3HY3A 4CI9A 4TWRA 1ZICA 3OQHA 3PDIB 4HQ0A 1M72A 1E0SA 2IUUA 3W4IA 4AJKA 3JAKA 3RABA 1QQAA 1QRRA 1YZQA 4MUBA 3A9CA 3RYCB 2JAWA 3SHFA 2R6HA 2CYCA 3N7UA 2YXDA 3A37A 1CS0B 3O7MA 1S5PA 3MT0A 4I4IA 4IQGA 1RWBA 2XAAA 4N5IX 4DMKA 1VL8A 3F7MA 4NKRA 3KKKA 1HI9A 1VFNA 2AEMA 4KR0A 5DXAA 4ZRMA 2V7QA 5CLIA 3VDRA 4W5QA 4R54A 4DDHA 3IXLA 3N39C 1K8XB 3U4QA 4HK4A 2P7HA 3AVVA 1UDWA 2OV1A 4IV5A 4R8VA 2AC2A 1NJSA 2XADA 1WL8A 3BM5A 1CZHA 1QZUA 1CQXA 4KO1S 4EJ6A 3LNTA 3EWAA 2L18A 3CPHA 1TYBE 3BPSA 3L9XA 2CLSA 3N6RA 4JBGA 5CLJA 2QTCA 1CRPA 1J8FA 4C4PA 3TRJA 2H4ZA 4PFJA 1TCBA 1I2AA 3L8YA 1NW6A 2JFPA 2VPXA 2PDAA 3HDQA 3KHUA 4IDPA 4NCAA 1UZAA 4ZAGA 3W06A 1KR5A 3PTZA 1NVVQ 4LZOA 4PO3X 4FYJA 5CIQA 4EJMA 1L5LA 3WE7A 2NP7A 3W9YA 2YX1A 2GH1A 4KSCA 1LLCA 4UNIA 3PE6A 1R8XA 5EVCA 5LWQA 2NSDA 5BNZA 1QH1B 1F1JA 4HX5A 3A06A 1U7PA 3FNBA 1IL0A 4DWJA 1IY8A 2YMLA 3PNOA 4JCCA 5KSZA 1N8SA 4FONA 1GCIA 1X13A 1IHPA 2J9RA 1HFEL 3M83A 1Y5IA 4KGZA 4RHXA 4HNVA 1XMPA 2Y9MB 3B38A 2X40A 4DBZA 3UT0A 4UNRA 1FA9A 1WDMA 1Y1SA 4LHXA 2ZANA 3E1KA 3ZCSA 1KQPA 1T5DX 2QYOA 3O8OA 4CMEA 4MVJM 3HUTA 2CMHA 5BSRA 5JAUA 2JEOA 4UHEA 3A9SA 4TTTS 3QSYA 3C48A 4FWTA 1S2MA 3MCVA 1JR4A 2VSXA 4L7VA 3OUUA 4IXWA 1IDN1 4G0MA 1L5NA 2EFHB 3H3FA 4DGSA 2IHKA 5LMUB 4DUPA 4TXJA 3DAFA 3R7WA 3T3OA 2AFIE 3V1TC 2YWEA 5DBOA 1ORRA 1P9LA 3SMQA 4GZ3A 3KDPA 4R2KA 2EF0A 2HA0A 3DA8A 4NX2A 2I3BA 1Y34E 1EBUA 4CDNA 1ESZA 2DHQA 2DPHA 3ZZ1A 4J90A 4OM8A 1XU9A 1GU7A 3MTJA 5ERXA 1XLTC 4HQLA 3ZWXA 3WGUA 1XN1A 1ZCBA 1PJ8A 3LVQE 2WINI 1A04A 3O75A 3IVCA 1NBMD 3DW1X 2HU2A 1V5WA 4PR0A 4RH3A 1BW9B 3KZ1E 3L1IA 1TJ4A 2PUAA 3ETNA 1SBYA 2W6MA 1C7ZA 4MRMA 3C3CA 2ZUCA 4EQ6B 3ZI0A 4TYYA 3K2IA 3OLXA 1ZW6A 4NBRA 4NPAA 2BCJQ 1NXOA 1U4NA 2ZE6A 5L53A 4MMXB 1AM4D 4K88A 5JQGF 2AUMA 1K98A 4JK3A 4LSMA 4NE7A 5KC9A 2RG1A 2WG1A 3I61A 4H1UA 2IF2A 3LYLA 1IE3A 1C7EA 1W49A 2UYYA 3GEPA 1K3TA 5H02A 3VPGA 5FWNA 3FBTA 4DRZA 5JNTA 4DCMA 1KO8A 3IDOA 1GQSA 3WYDA 2D2FA 3FNRA 1DRUA 1YB6A 3AEKB 4KGVA 2OPHA 2ZM6B 4DR2B 3NU1A 4M9XA 4ZIRA 4UFOA 4B7CA 1ZM4A 2ZZKA 1KXZA 4D57A 2JLVA 2NWQA 1QRAA 2D5CA 2BLNA 2ZYIA 2OO5C 1QX3A 4NYJQ 4F5EA 4WUVA 2H8GA 5DMHA 3MELA 1PZFA 2B6NA 1LPNA 4MPPA 4IQ0A 1ZRSA 2J33A 4Z1OA 3PT9A 9LDTA 1YZFA 1N1EA 4M7OA 3O1HB 4Y9UA 4X8MA 2WHRA 1FNNA 3NWEA 1K4KA 1WXDA 1LI5A 3F46A 5FFNA 3Q10A 4D25A 1A8HA 1W1UA 2BUBA 3NT2A 1ISJA 1XAGA 3ABOB 3DT9A 5CM2Z 4MKIA 4P4SA 2BF7A 3TPZA 4GGPA 2FU5C 2WFAA 4KE8A 3CJTA 1YTLA 1ULSA 5CX1B 3DV2A 1CB0A 1G4HA 1Q6ZA 4IWNA 4PFSA 3WXBA 3R09A 3ZCVA 4WNYA 5A04A 5AVZA 4Z53A 2Q6IA 3L7JA 1CR0A 4MRAA 3G02A 3IULA 3OUTA 3OKPA 4KE7A 4R1UA 3W2EA 4XI9A 1SB9A 4NBKA 5JJLA 4ZAXA 2R62A 2JHFA 4KMOA 1RWMA 1XZIA 3C3EA 2PY6A 3GMTA 4JI6B 3KB2A 1SKBA 1JSZA 2VNIA 4RJKA 3RFUA 3RKUA 4AZ0A 4DB4A 3U56A 5IT0A 4I81A 4S1OA 3OOWA 1K2WA 4BRSA 3O3OB 1Y63A 1PIWA 3DZCA 1H8HD 3JQQA 1FUKA 1TZJA 2XYHA 1ZCFA 1PV1A 4RFSA 4TX1A 1FDOA 1MB0A 5T57A 3BWCA 1A9YA 3FHTA 2JJQA 3GFPA 2Z3ZA 4NMLA 1I5EA 1LJLA 3OCZA 3QZUA 4RHCA 5F52A 4UTPA 4ENWA 1N33B 2Q3LA 3O0DA 1YMUA 3O38A 1JAXA 1FFEA 4M7WA 5FEMA 3G8CA 2IWRA 4JWKA 5ICSA 4JJEA 1CNEA 1A7KA 3DLCA 4FI3F 2X6QA 5EHGA 4HNGA 5J5AA 4ERNA 4ZZ3A 5FCDA 1D04A 1D2NA 1OWNA 4LG1A 3VR5A 4B85A 1CVLA 4GZLA 4XYEA 5DBEX 1XIVA 2WU8A 3SX2A 3VBCA 3L01A 4RLQA 3EMKA 1KSFX 2ORED 4Q12A 4ETIA 4OBBA 2O8CB 2WYWA 1L7XA 4FW8A 4WMLA 1YDFA 1DV2A 4FWIB 2ECKA 4XUCA 5FKJA 3Q9LA 5JAQA 3QOFA 1C3EA 2HWWA 2WG0A 4LJAA 3GXBA 5FX2A 1Y37A 1CV2A 1QHGA 1V39A 2NZUG 4NIMA 2R2GA 1UK6A 2ZXUA 4JVNA 2A92A 1QPBA 1T5BA 5ALSA 5DM60 3B8EA 1KNQA 3E7FA 4BMSA 2HAEA 5D5HA 2R1VA 2C99A 5BR4A 2FOLA 4PPGA 3NNSA 4RK7A 5EGNA 3GLFB 3MSCA 2A7XA 4PLFA 4QRHA 2AI3A 2J6CA 2XMDA 2DB3A 2X8WA 1Z18A 1GIAA 3B1FA 3WHKA 4HMQA 1QFYA 1RI1A 5JYDA 4ISBA 2W2LA 2XNCA 4LHWA 5CB4B 2G0NA 3ABQB 1PV2A 3MCZA 1E3QA 4WK0B 2Y68A 3WMRA 5LMCA 2C4NA 4G37A 4WLUA 4AWBA 2BRUC 2JFGA 2HXSA 1AS0A 1GPUA 3KOZA 4G9EA 1E3EA 1B15A 1OFTA 1PT7A 3PXXA 4KDFA 1Z5UA 5IXSA 3VNQA 4S1NA 3TIFA 1AHHA 2O3RA 2AWOA 3AESB 3LUGA 4H3VA 4A8TA 3IEMA 3GRRA 2IXBA 1MDBA 4YRLA 1HV8A 7ABPA 2A9RA 2IFTA 3RRMA 2OSBA 1NLYA 3LTNC 4E70A 1TZ2A 4DAOA 5H3CA 4N82A 1BQ3A 1QH8A 3AI3A 4FW9A 4OKIA 5DX1A 4G1BA 1TYEB 2BSXA 1KFJB 2PL5A 3LNCA 4RKFA 5JD3A 3K96A 4JR1A 3UK0A 4CQLB 1SB8A 2ASEA 2V7XA 3E81A 3RJ5A 5LOVA 3REQA 1L4GA 3VISA 3D3WB 3C3MA 5I9MA 3F6EX 4XCQA 5FBHA 3L0IB 5JAOA 1VHDA 2LW7A 1ZU5A 4AXBA 2GM3A 4LJRA 1T1IA 2IYEA 2PT7A 3ADPA 1WF6A 1X9HA 5ALPA 2Q5CA 1AKEA 3UCFA 3B6ZA 1YUNA 1Q7TA 4KIGA 3LVRE 1UBSB 3EFOB 4E2YA 2BR4A 1CY0A 1Z0SA 3C3XA 2EW2A 1V0JA 4GHWA 5EMMA 5EYPA 4Z3DA 4JI4B 4E5KA 1QGED 1WD5A 5EOVA 3Q0EA 2HSDA 2PX8A 1BW9A 2ZITA 3THSA 3HG7A 5BW5A 5C1OA 1ZN2A 1AHPA 3QV2A 4FYXA 3S2ZA 3DS8A 4L5BA 1JFRA 4XOIA 4I50A 1IQ0A 1ABFA 1TLLA 2EFDB 1OH6A 4B71A 2VFAA 3GLFE 1TK2A 3Q8MA 4P7BA 2IOHA 5LDDC 4ESHA 1TJPB 3IO3A 2ZBEA 4TS3A 3R3ZA 5AT1A 3A27A 1D2GA 4DA8A 3O03A 3R8FA 1U99A 1FYVA 1GR0A 2XUQA 3EQZA 4H7EA 4PYIA 3ERCA 3LUKA 4HDRB 5COAA 1EUYA 2JEZA 2ZWMA 4JXJA 4O2LA 2QMOA 1EU1A 4TMTA 1RKQA 3PWZA 1OLXA 1G8FA 1ZD1A 3R6TA 1HE8B 1VYTA 2QPTA 3QVKA 4A03A 2WJPA 1G20B 4FD3A 4FSHA 1THMA 5P8WA 3MW8A 3P4UA 4GPEA 4CPDA 4DXAA 4QE3A 4M4SA 3TEMA 3UWMA 1B76A 1GT91 1XVTA 1II0A 2ECQA 2EF1A 4D8WA 4L5YA 1MRNA 4RE5A 5KSYA 4A92A 1X7DA 2VXOA 3S1LA 4G89A 5E38A 3B52X 5GZ1A 2PE5A 1HR0B 1WKCA 1OBOA 2HRDA 4LWOA 1W88B 2NPIA 1T4DA 2FZEA 4PG6A 1QFXA 5TPWA 3GJXC 1G20E 4L5CA 3ZE0B 4RTPA 2LNDA 4RBNA 3HO6A 3DUFA 1DEHA 2QJWA 4FX5A 2IEYA 1NC3A 1TMGE 2YDYA 5AM5A 1OFUA 5C8YF 1NI4B 3KUXA 3A6GA 2Z83A 1LPSA 3K0CC 4QT0A 4B3CA 3D8BA 4OCZA 1FX0B 4PXYA 1ADBA 4Q1AA 1H5UA 3SLGA 1PO7A 5B7NA 3RTEA 2NU9A 2GZ3A 1KOFA 2P35A 4IBOA 1W5TA 1DJOA 4MUJA 5D1HA 5I9IA 1GDDA 4EVIA 1P0MA 5K6RA 3NANA 3QENA 4LK3A 1ID1A 3RPEA 4CBVA 1UC4B 4BVLA 1F6BA 2Z04A 1XYYA 3W8NA 4BFTA 3LKZA 1CERA 2HA6A 1OZFA 3AEXA 4FGJA 4IINA 2PGJA 3WLOA 4NCJA 3J81k 1N3IA 3QUQA 4IRUB 2F8SA 1T6YA 3A3PA 1WVGA 1R66A 4AQ7A 1GR1A 2ZBDA 2E4XA 4UZEA 4XCVA 5KNDH 3GLIA 1HE1C 3QE4A 1H2WA 3GZTB 1G21B 3R7AA 3TLBA 1FTWA 1K6IA 5DB4A 1RRMA 2E1PA 3EFHA 5FBRB 2P75A 3RHFA 1FSZA 3VKUA 1G38A 1SKYB 5I3ZA 4NS4A 4OLBA 2JI8A 2W0SA 3JWEA 4JQCA 3JAKB 3U9SA 5EPUA 3UAOA 1SK9A 4DV6B 3ZD6A 5AI0A 3F9RA 4HS9A 1N2EA 2BZGA 3DE4X 1KEEB 1KOJA 2GRJA 3K9FC 1IVNA 4Y2TA 4DM7A 3ZDFA 5IASA 4DJEC 2WD8A 1IZZA 3NYIA 4AS2A 1Y8RA 1GPNA 1N78A 1O6BA 4UVIA 2NUAA 4M46A 1NUQA 1M3SA 1VKHA 1WXHA 1ELOA 3IAUA 3ZKAA 3FYUB 4GKJB 1PSWA 1N77A 1Z88A 4PAQA 1DAOA 4DLWA 4PZDA 3HACA 4BBPA 3ABIA 4EB3A 3EGVA 4HUQB 3JAWB 4R1NA 2YC2C 2VAVA 2V3WA 1X14A 2MSCB 1PQUA 3T61A 3BSFA 2BM0A 3D3WA 4TYNA 2QDXA 3LCJA 4LK2A 4TMWA 3L7BA 2YV5A 3PX2A 3UXYA 2XZLA 3NT5A 1JJ7A 3ASZA 2R6JA 3U39A 3C1OA 1DIOB 2OD9A 1PL7A 2OP0A 1ADJA 3KNZA 3GT3A 2Z0MA 3PQ6A 1CNFA 1S6YA 4P4UA 4B4UA 1ZHOA 2ENWA 2V0NA 4IEEA 1NF8A 5AWFC 2YICA 4X44A 5AQ1A 2WFLB 4IQ8A 4X7PA 2JJ1A 4FR0A 1FNBA 2YV1A 4HBZA 4N5LA 2PKYX 4WD3A 2LDBA 2P1RA 2PBLA 5AM2A 1QZXA 1LS1A 2X4IA 3O8BA 3RHTA 1XMOB 3R9KA 3I28A 3LC2O 4JY7A 1COWD 2XCUA 1EGVB 1IHXA 2VYQA 1XV5A 4GOND 3SF8B 2ZRQA 2ZUUA 3DLTA 4A7PA 4P5DA 3C0KA 4YJ3A 4YR9A 1Y7IA 3JQ9C 1G21E 3IBGA 3A1NA 3P9YA 4II2A 2FZWA 1WB6A 3D5QA 3PXUA 4FZRA 4MH0R 3W6ZA 1XXHE 3NHRA 4GM4A 4IYJA 2GYUA 2NXCA 5EFOA 2W8BB 4BO8A 1U1CA 1PSDA 5CIYA 3GLFA 4ZVPA 1CCWA 2ZRHA 4P0QB 4HNAA 3QY0A 4JEIA 4MV1A 4A0QA 4OL9A 3THXA 3AF0A 3IOYA 1FVXA 4R3UC 13PKA 2AFIA 2BMAA 2VUIB 2H51A 3CTMA 3OX4A 1BN7A 2OGZA 2R8EA 4XWYA 3G59A 1Y1RA 3C8DA 5BMOA 1B73A 3E23A 3IT2A 3RGGA 3ZCQA 2WI8A 1PLJA 4HUTA 1QG6A 1NP7A 2AOTA 3ZHSA 3FOBA 5IWCA 1IMJA 4Q9AA 5CT8A 4TKVA 3D8SA 3W5AA 1UQUA 3E82A 1I6MA 1U3DA 3LBHA 2QLJA 3VJKA 5BORA 1E69A 4A8PA 4U00A 4CM8B 2O57A 3CWZA 4G09A 5IVDA 1L7MA 3AXTA 3H16A 1YOVA 1TQDA 2RK3A 4MSUA 5EJ5A 4XWTA 4L9SA 3STYA 2CLFB 2DUNA 3O8CA 4J3NA 4J07A 2DERA 5L3SB 2QRUA 4G5RA 3EUEA 4K40A 4OMFG 5C31A 1POXA 5CDTA 1SKMA 3KSRA 2XYVA 2VDKB 4DMGA 1ODKA 2VS1A 3DBVO 4I3FA 4DKXA 4Z0TA 1X3SA 2ONKA 3BJEA 3GA5A 1H05A 3OFND 5T4FA 4YPVA 4EUNA 4CMBA 5CH3A 4W5OA 2ZCUA 3GB9A 3THRA 4IDQA 2MR5A 1JLLB 1SUCA 5HMLA 5HJEA 3B1ZA 3CT4A 2IIQA 3RU7A 4C89A 2ZBGA 4LRWA 3FD8A 2AC4A 1J5XA 2VHYA 4MEBA 1WHSA 4ZCIA 3QBJA 1NN5A 1JDBB 5ALKA 5KTPA 4R1OA 3GJTA 4O4LF 4BCDA 2H2AA 2YW9A 2QSJA 1TQ8A 3M6VA 2IPOA 3SYNA 4N65A 4QUGA 5J63A 4A0GA 3V4SA 1SCUA 4GOJA 1SD1A 2AZDA 2RC6A 2Q1YA 4HGNA 4D9HA 3CZ4A 4YN3A 4YRMA 1N5KA 3MRVA 4EA9A 3HSKA 1G5IA 3ANSA 4RVNA 2HQ1A 4ZRNA 5EP1A 3SEAA 4NDNE 1OH8A 3BX1A 4KHPB 2K6GA 1TPYA 4LISA 4DXDA 4RD2A 2YXPX 1HRDA 3PF9A 5DHRA 4YCMA 3ZBQA 1D1SA 3AP3A 1ABEA 5C5IA 2RGWA 3FFXA 5B4TA 1F6DA 2G36A 3X2SA 5ALNA 5JRJA 4DR4B 1A8PA 2OMKA 3I4LA 1IUKA 1RXUA 2QQ0A 1GLVA 3OIDA 4LOHA 5FA6A 3OLCX 4HWPA 4G07A 3ED5A 3TWOA 5KYWA 1A98A 5ESRA 1XD9A 4Y6RA 1JHVA 1R9NA 5EJ4A 5JFOA 3SM3A 5KC8A 1UANA 3WK5A 3JQGB 1NW5A 4MLCA 2OHXA 2QZPA 2CY0A 1GG5A 1RI5A 4TRRA 2LR0A 2V03A 4H08A 1KAQA 2ZI7A 4DLSA 1P4SA 2D1RA 2G09A 2QX8A 2BFNA 3G9XA 3OCUA 1CPYA 2EWVA 2QW0X 4TV8F 4X24A 4Z9AA 3ZK8A 2Y0EA 2HJVA 5A3SA 4CV1A 2PPVA 1MC5A 5FFFA 2J30A 1EDDA 3SYMA 3Q4GA 4Q05A 4Z9BA 1P7PA 1X9IA 3WDLA 1E9EA 1JR2A 3A04A 1A5ZA 1E64A 1SRRA 2YJGA 1YUBA 2V98A 4JC4A 1X7YB 2GEVA 4L4ZA 4CEHA 3TIVA 4GPD1 1WMBA 4HSEA 3K8YA 4I19A 1UAAA 3G17A 1G5QA 4RENA 5HBRA 3ICWA 2IU0A 2JVIA 2XBUA 1CIVA 3N53A 1BXZA 4HAVA 4JUCA 1H23A 4O29A 1RPAA 2ETXA 3V4OA 5JI2E 1MX1A 5GIPE 4M8IA 5I9LA 1U8EA 3R40A 1F0NA 3JXEA 4TMZA 4KYVA 5E4TA 1N25A 4O2BB 5KU1A 4G0WA 2WHYA 4GI3A 1XCJA 1T10A 3TLEA 2CT8A 4BNYA 3MLBA 3ESYA 1U6IA 3WSVA 3PRJA 2VP4A 3FBWA 3B12A 1DQRA 1EYZA 1EK6A 2QIOA 4E30A 2WJ6A 5LQDA 1SCBA 3ILYA 5TQVA 2F6RA 3QQ5A 3PQEA 5B57C 4TVBA 3VVBA 1FU7A 2VATA 2PXAA 3CEJA 3HVHA 3L82B 4KN9S 4QBKA 3CRVA 2MSLA 1T0BA 2O8VA 3PIIA 4G3XA 4DJDC 4NK5A 1U0FA 1QP0A 2DXIA 3PA8A 1G8YA 2OECA 2C1XA 2ZAMA 3U3MA 3FGZA 3LRXA 1SC9A 3NCHA 5TXGA 1FBTA 1I3MA 4EI9A 5KYGA 2WABA 4OHYA 1IN1A 1EBFA 2CFTA 3U61B 2E7ZA 4NJMA 4C4OA 3FJ1A 5IUJC 3DL7A 5C4GB 4C43A 3LBIA 5G1OA 2PAAA 3TCKA 4L8GA 4J1NA 3PI6A 3N2IA 3W4KA 1XCPA 3PCXA 1KEWA 1PR0A 1SCIA 1T5OA 2JC3A 3AJ9A 4CNQA 1JQEA 3QQPA 3T0FA 2R7MA 4OAOA 4PHHA 1FSSA 2DUJA 2FX3A 2HRQA 4CFSA 4KQHA 4ZOAA 1CK4A 2Z6VA 3ND9A 5KTNA 4O4HA 1AKMA 5AM3A 3U48A 2IYVA 2A0UA 3CNNA 4R01A 4F45A 5EHXA 1N75A 2W6OA 4O1IA 1NG1A 4LYFA 4O2AA 4DT1A 3LHKA 2WVJA 5JCJA 3RS5A 1PUJA 1WA5A 1HXHA 1BVUA 2AYYA 2Q27A 1A9OA 3L4EA 3KAPA 4WN3A 4LXXA 2Q0HA 2Y0PA 4DC9A 1G64A 3WZLA 3CEAA 4TL6A 1RSZA 2GPTA 1K75A 4ZDIA 1YQTA 5IC4A 1YUMA 4OHUA 2G9QA 2QN9A 1BFUA 3FX2A 4DEYA 2B4KA 1XJ5A 1A7AA 1RRKA 3L6RA 4R4JA 2PX4A 3OE7D 1B42A 1QDEA 1FC0A 3LGSA 3LLVA 1DT3A 5HX7A 3UGKA 1MAVA 3G2IA 3TLMA 4XLLA 5JS1A 3A6LA 3K2BA 1YGYA 1Y89A 2WSSA 3NEAA 5ED4A 5AVJA 2D4AA 4H16A 1SFRA 4MYSA 3SEQA 2Y1CA 3KD3A 1SBZA 4FMCB 2FHSA 4DPLA 4FB4A 3NVDA 3VDQA 2C03A 3L8GA 5A6SA 1ADYA 2WZDA 3FF1A 1M5TA 3QJGA 1G98A 3Q12A 1JE1A 1EK5A 2GARA 3E9QA 3TH5A 1D3AA 2VA9A 5FLEX 2BE9A 3NWPA 1A9SA 2GF0A 1N2SA 4HFNA 1R9GA 4FK8A 5BQPA 4QUIA 4QC2A 1YR6A 3T1YB 1KPHA