3C1TA

Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
320
Chain Sequence
ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the inhibition of grape dihydroflavonol 4-reductase by flavonols
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
molecule keywords dihydroflavonol 4-reductase
total genus 111
structure length 320
sequence length 324
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c1tA00
2R6JA 2WD8A 1R15A 1V9LA 2VN8A 5JLAA 5KIAA 1V3VA 4TMFA 3U4HA 3NT4A 4IXTA 1DBVO 3VH1A 3U09A 2YQ5A 3ZV5A 4BMSA 2CVQA 1J6UA 4TVBA 1MUUA 1WMBA 3U4DA 4DUPA 4WKGA 5LDHA 4DPKA 1PJBA 2VTEA 1HL3A 3B20A 1VSVA 4AJ4A 2PH3A 4CODB 4E21A 4H16A 1PJLA 1I10A 3ITKA 3K96A 3RVDA 5L51A 5DOVA 3BMNB 2PR2A 3RJ5A 3PYXA 5IDXA 1XQ1A 4OKNA 1KETA 3S2EA 3V2GA 1BW9A 1MB4A 3JQ8B 3ST7A 5FFFA 3DFZA 3OQBA 3JQGB 1EFKA 1HSZA 3C1AA 3IP1A 4DL9A 3LZ6A 4GX5A 4INAA 1T2CA 5JO9A 5TLSA 1C1DB 2CF5A 3QA9A 2Q46A 4XQEA 2HO5A 2WYVA 4ZHSA 4TROA 4HV4A 1JDJA 1A4IA 1YL5A 3VH3A 1A9YA 1EBUA 1HZZA 3E9MA 4E2WA 4XRGA 2Z5LA 2Q2WA 3EVNA 3TOXA 2B36A 5COQA 1Y5MA 4BGVA 2IZ1A 5A4DA 4YRBA 3VC7A 3N74A 2AEFA 1KC1A 3O38A 3A06A 5A3VA 1TT5B 5KVCA 2DPGA 3AI1A 4HP8A 5ILOA 4B3HA 4OSPA 4FN4A 1AHHA 3MJCA 1RYEA 1YRLA 1DRVA 4Z9FA 1EMDA 2WTBA 4RF5A 4LRSB 3GY0A 1U9JA 4WCFC 1FXSA 3JQ8A 5B4VA 3TJRA 4HFNA 1ONOA 2HMTA 4JNKA 2UDPA 4M54A 5AQ1A 4HFRA 1FMCA 4KTTE 4YJFA 4ESOA 2PZJA 3SXPA 5EJ2A 1LDMA 2GO1A 3RUCA 1GL3A 4CV3A 4EW6A 4R4JA 4R3NA 5DBIA 2O7QA 1V8BA 4OL9A 3F5SA 4IZIA 3FCOA 4R5MA 4DREA 3AM4A 4IMRA 2A4KA 5DF1A 3GGPA 3NJ4A 4WLUA 4XA8A 2I3AA 3ZNQA 3KTDA 4DYVA 1UH5A 1ZK1A 1GUFA 2J5KA 4GBJA 1ISHA 3Q3CA 3O4RA 1GADO 3I1JA 2QX7A 3G79A 5MGBA 1M67A 2ZJ1A 4EYEA 4I5DA 1VI2A 2ZB7A 3B1FA 4CR7A 1NAHA 5KKAA 3H2SA 4FJ0A 5FEUA 3ETDA 3W4JA 3H7AA 3NRCA 1MA0A 1VLLA 4IZHA 2Y1CA 4IJWA 4RPGA 1IE3A 1EE2A 2BHLA 1GV0A 2D5AA 3V2UA 3WOHA 3QWHA 4E2YA 3HB4X 3VKVA 4BKOA 4J2HA 1VJ1A 3LLSA 3TQHA 4F45A 3GR6A 3GQVA 3AFNA 3TL3A 4FFRA 3AUTA 3H5RA 2HRBA 1TVEA 4BB6A 2GCGA 4Q3DA 4L4RA 1DOHA 3FWZA 4JLWA 2DBZA 1X13A 1DPGA 2HCTA 1SC6A 2AG8A 4J4HA 1R16A 3DMTA 5KWEA 2NADA 4CMHA 1GQYA 4YJGA 3MZ0A 5FF9A 1M2WA 2X0NA 5L4SA 4CM8B 4FIZA 3LT0A 4YEDA 4BNIA 4GX2A 1QYXA 3VPHA 1VPDA 4P38A 4DTIA 4DC0A 5HWSA 5JXWA 4F6LA 4W7IA 2GN9A 3QE3A 1BVUA 4GQAA 2GN6A 2G17A 2DVMA 4P22A 1VSUA 4KUGA 3GLQA 6LDHA 4J43A 4TWRA 3WQRA 1CIVA 2WMDA 3AM5A 3F4LA 2R00C 1KIFA 4BGEA 2ZB4A 2IYOA 1PJQA 1H9AA 1EQUA 2C07A 3EVTA 4JK3A 4PIVA 4YQYA 2G76A 1LJ8A 4ALMA 3EDMA 3GUCA 5K6AC 4IGFA 1UAYA 3F1LA 4TVOA 3G1UA 2Y66A 3WX0A 2GGSA 2O23A 1P1FA 2ZTMA 2X0RA 3P5SA 4J3FA 4J9UE 2GR9A 4BNLA 1C3VA 4A0SA 4J7XA 3SEFA 1QORA 5KJ6A 1P1KA 5JMPA 3DZGA 3WNQA 1SZJG 2EHDA 1U2GA 2AQ8A 1XIVA 2VTDA 4AICA 4NIMA 3BMOB 4D42A 5JO0A 2PK3A 3M6IA 1JA9A 4CMIA 4NPCA 3QWIA 4U6QA 1N1GA 4D43A 4W6ZA 1P74A 3EK2A 4XYGA 4DPMA 3WWYA 3C1TA 1XG5A 1PJ3A 4B7UA 1XYGA 2WE7A 5BNFA 3ICCA 3H3FA 1CQIA 2WD7B 2GRAA 3L4SO 4IM7A 4CM4A 3ADPA 4XD2A 1NPTO 1DAPA 1UDAA 4OOEA 2ZYGA 4HFMA 3SC6A 4IPTA 1EUDA 5C7OO 3OMLA 4IDFA 5U4QA 3R1IA 1L7EA 3CMMA 3HJAA 2CY0A 5JAMA 5TF4A 5CEEA 1A7AA 4CLXA 4UVIA 2D59A 2DPHA 4KUEA 4Y67A 3GVPA 2NWQA 4OAQA 4RORA 2FHSA 1F8FA 1JKIA 2O3JA 5IAAA 5TX7A 4UVHA 3WGOA 5I9LA 4IGEA 2J5RA 4YWJA 1TB4A 5A9SB 3NAQA 1C0LA 1HETA 3WWZA 7MDHA 5JBIA 5ICMA 3UW3A 2VNSA 1X15A 1NPYA 1WZEA 1T1RA 1H6AA 5DOZA 2IEDA 4Y8VA 4CV1A 3DC2A 4IDGA 4YT8A 3CIFA 3AY6A 3I9OA 4WCFA 4J9VA 1QRRA 5T8KC 6ADHA 2QIOA 3BTOA 1YO6A 3FHLA 4GPD1 3QHAA 3PLRA 4K6CA 4IDDA 4PZEA 4EGFA 4B4UA 3UVEA 1HXHA 1BRMA 1VL0A 4AJNA 3GGGA 3JQ6A 3U0BA 4XKJA 4J7CA 1I2BA 5B4TA 4AL4A 4YJGB 5F1PA 3IKTA 1KY5A 1LNQA 3ENKA 3JQEA 2RH8A 5FWNA 1ZBQA 3DZIA 1YDWA 4LSMA 1LLDA 3HNPA 5HTOA 5T5QA 4MVJI 2FZWA 3DDNA 4O0LA 4B3IA 1NWHA 1DIBA 5I8ZA 5JDCA 1HEUA 1PJTA 3GFGA 4IBOA 4Y6PA 4D3SA 2JCVA 1MP0A 2EJWA 4ZU3A 2B4QA 5IZCA 3RU9A 2IE0A 2RHRA 5J23A 1Q0HA 5JCXA 4DLLA 3IQDB 2W90A 3MJEA 4BKUA 4GVXA 3JQAA 4Z9XA 4CM9A 1NR7A 4O63O 3I5MA 2VOJA 3FF4A 1E1KA 1XGKA 4FGWA 1PS9A 2E4AA 4GAEA 5COAA 5GZ6A 5C7IO 2JL1A 4RPHA 2FR0A 4YPOA 1YH3A 3PIIA 2OMEA 2HAEA 3LF2A 4Z9YA 1LU9A 3FPLA 3ZWAA 5HM8A 2BF7A 3H6KA 3RASA 1QP8A 4DQXA 2CF6A 5K9ZA 3JQ9C 2OO5A 1EFLA 2NACA 5DT9A 1E3IA 1I36A 2DUWA 4OGWA 1O94A 4R1UA 3RAJA 4KP7A 4WOJA 1K6XA 1H0KA 3AU9A 3AI2A 1MFPA 4GX1A 4J7UA 3LF1A 3PJGA 4EEZA 3R6DA 1F12A 4E0BA 4QX6A 2CZCA 3IJPA 2EP5A 1ENZA 4J91A 4MKXA 3TN7A 1H6BA 1T4BA 5AXCA 4WK6A 1U3WA 3ZWNA 4BNVA 3GDGA 2X0IA 4G2NA 3VVCA 2X9VA 5U9CA 3JYQA 5GY7A 3KEOA 1JN0A 3BZUA 4PG8A 4J2OA 3WGYA 4M86A 3UCEA 1AXEA 3PIDA 4Z0PA 4CQLB 3HUDA 4TRNA 5T64A 3PHLA 4HX5A 1UXHA 2VZ9A 5IXSA 3VPGA 4BNKA 4FJ1A 2UVDA 1T1SA 1YB1A 3AU8A 2O4UX 4JBGA 5JY6A 4KOAA 4MVJG 1E77A 1TI7A 4A7PA 2XXBA 4CM1A 4ALKA 2OBYA 2J6IA 4EJMA 5L4NA 2UV8A 2Y05A 4IQGA 5G0VA 2PZLA 3WQQA 8ADHA 4A2CA 1ZXLA 3WYCA 4HBGA 2ZTLA 3CTMA 3ENNA 5I7SA 3DXFA 3E6AA 4PLVA 1GCOA 3OEYA 1E7YA 2Q1TA 1AN9A 2ET6A 3F1KA 4WECA 1PL7A 3BTSA 3BHJA 3E03A 1LQUA 4UVGA 1FF9A 1GYRA 5T6BA 1EBFA 3WIEA 3FR7A 5FYDA 4Z0TA 2ZTVA 1PIWA 1U3VA 3WTCA 3W8DA 1GAEO 1K0UA 1SCUA 3IUPA 4BGIA 1YOVB 2EERA 3ADOA 3QW2A 4O5OA 3VPXA 4IIUA 1RYDA 4YT4A 1ZVMA 3AM3A 2YYYA 1BDMA 4OHUA 3WGHA 1XELA 3PFWO 1HF3A 1NVTA 1UUFA 2H9IA 4LVCA 4PG4A 5L4LA 2P9GA 1LSJA 5DBFA 4HWKA 1Z6ZA 1X7GA 2X8LA 3QVTA 4MVJE 4K6FA 4TRMA 3HHPA 2C5AA 1DB3A 4AJKA 3EUWA 1HYHA 4ITUA 1A5ZA 5CEJA 3PQEA 4A73A 4YJHB 5JDIC 2I5PO 4NMHA 1X0VA 2OORA 5L9AA 2IZZA 4LCEA 3BHMA 3PTZA 3UCFA 2ZCVA 3EZYA 3M2PA 1ZSVA 3WICA 4KWIA 5JW6A 2O3UA 5IDYA 3PHJA 4XQGA 2JFGA 3H9JA 3INTA 1MC5A 4LVUA 3GNSA 1ADGA 4GWKA 3RWBA 2UAGA 2JJYA 4U5QA 3LLVA 4GLOA 3ZV4A 4D7AA 1GFSA 1QG6A 3K2BA 5JCJD 1Y81A 2NQ8A 2UYYA 3UAGA 4ALJA 1P44A 3M1AA 3O8QB 3D4PA 3GZ4A 4L0QA 4L75A 2SCUA 2PTGA 3DHEA 5F3RA 2V6BA 2C20A 2Y1GA 3RFVA 1IOLA 4ZICA 4CLDA 3L4BC 5G2OA 1BMDA 2V65A 3D0OA 1SBYA 3OJFA 2BRUA 4E5NA 2A92A 3DBHB 4IMPA 4Q3AA 1I32A 4BNNA 4CJXA 1L1FA 4DMMA 3K5PA 4GGPA 2CD9A 1JTVA 4R51A 2CSUA 3L9WA 4PVCA 1D1SA 3KXDA 3GVHA 3GNQA 2ZYAA 5JNLA 1V3UA 4J0FA 1E3JA 3PFFA 1WP4A 2YHIB 1E1MA 2CMDA 3RUAA 4RO0A 4CQLA 1G6KA 3OIFA 5IZ4A 4D41A 5IN5A 1PL8A 1SMKA 2VRCA 4MIEA 2WE8A 4RVHA 4XWYA 3INGA 4BKRA 2JD2A 3GVCA 2GASA 2GERA 3E82A 5AXBA 1VJ0A 2R2GA 3CKYA 1EQ2A 4FFOA 3HADA 1SB9A 4E5PA 4Q39A 4ZRNA 2X5JO 3H9UA 3NTOA 1BXGA 3KETA 1LUAA 2ZATA 4E4YA 5AXAA 1X7DA 4L4XA 1CJCA 3I9MA 3PGJA 2Y1DA 2NM0A 4M89A 2O48X 4UUPA 4IJVA 1QYVA 3RIHA 3RI3A 4OMUA 5DP1A 3KHUA 1M6WA 2VRCD 4M49A 3JQ9A 3TPCA 2HSDA 1D3AA 1T4DA 2G0TA 4KQWA 2QRKA 1Q1NA 2VUUA 3WS7A 4A26A 3T4EA 2VHXA 3ZWMA 5C3MA 4FC7A 1YDEA 3C7DB 2G5CA 4ONEA 3ZW9A 4YT2A 2VWHA 2CDCA 3RBVA 2PH5A 3L77A 1I0ZA 1PWXA 3IC5A 2XPCA 4GMGA 1C0KA 1P33A 4YAGA 3D3WA 3GDOA 1NAIA 1VE9A 2WD7A 5CEFA 5K6AA 5I9MA 1BGVA 5AXDA 2FMUA 2H63A 3I4CA 3VAZA 4CLRB 4R54A 3GF4A 3KV3O 4CUKA 4N7RA 4S1VA 4E5YA 4JP2A 1DHTA 1ZMOA 4YYZA 1PGQA 2X23A 4E2ZA 3DAFA 2EF1A 2BGKA 1PGNA 4G5HA 4WGGA 4NJOA 1VKOA 2HUNA 2A35A 3DMYA 3V2HA 4WUVA 1VRWA 3O26A 5COBA 3WGGA 3H9EO 1KEUA 3ABIA 4NZ9A 2Q49A 3JD0A 1P3DA 1T2FA 3OA2A 5G0TA 1EVIA 3ZU3A 1KEWA 1GYQA 5TIIA 3I23A 4ZA2A 1P45A 4R01A 3PGXA 1AHIA 4OM8A 1Q7GA 2VWQA 3ZHYA 3GPIA 3OBBA 4YRDA 5G0UA 4YBZA 1Y9AA 1FK8A 2HMVA 3FRJA 1DLIA 2IEBA 3HDYA 2YFQA 4NFYA 1KC3A 4LRTB 4O59O 4CUZA 1H2HA 4RLHA 1JLLA 2Q2QA 3LT1A 1JWAB 2P9CA 3BMCA 1Y7TA 3AWDA 3WLFA 1DHRA 2W98A 3E1KA 4FC6A 4MVJF 2TMDA 1O5IA 2C2YA 1ZFNA 2O3SA 2WM3A 2JD0A 4RCVA 1J49A 3QWAA 1B26A 3TZQA 1NWCA 1YBAA 5JDIA 1NHWA 3W6UA 1NFRA 3ULKA 1PWZA 1M75A 5CP8A 2H5LA 4KDEA 3HFSA 3FTPA 3MJTA 4FFNA 4B3JA 4YTEA 3BMQA 5JAIA 4ZGWA 2DM6A 3ROQA 4JBHA 1XR3A 4YJFB 5BQFA 3GAZA 4RQUA 2O2YA 4BL5A 3SX2A 4N5MA 4E5MA 4B8WA 4DIBA 1NASA 1N9GB 1VL6A 5T67A 1R4NA 1WDKA 5CAEA 2X9NA 2DTEA 2NSDA 2IXAA 1OI7A 3CUKA 4XZ3A 2HMUA 2OXIA 3D5QA 3DOCA 2O50A 5LDGA 1PGOA 3MTJA 5JS6A 1WAMA 4II2A 2OP0A 2I9PA 1IPEA 5ER6A 4IIVA 3PI7A 5ITVA 4FQ8A 2AG5A 1F14A 1ZH8A 4TZKA 3L4BA 3OJLA 1I8TA 1GEGA 4YXFA 3K92A 1MG0A 1YQXA 4XJSA 1Y8RB 4UREA 1W8DA 1LDEA 3TFOA 3JYLA 2NVUA 5HS6A 8LDHA 2DUUA 1XDWA 4XEHA 4C4OA 3ROKA 1MC4A 3VDRA 1Z7BA 2P4QA 2Q3EA 1I3KA 1WXDA 1HDYA 2OFPA 3G49A 4JGBA 4EI2A 1O0SA 2QG4A 3C7CB 3UN1A 1DRUA 1PR3A 3GG2A 4LMRA 3Q6IA 4CL8A 3ZWCA 4XGNA 1B0AA 3CINA 2X0JA 2VWPA 1DFGA 2B5WA 3GK3A 3FR8A 2FZEA 2Q4EA 4DBZA 2BH9A 4LSWA 5TSDA 4CMCA 3IAHA 3QQPA 1CQJA 4JJIA 4O6VA 2C82A 1Y1PA 2EXXA 2W2KA 1IYZA 3AUSA 3I9LA 3ZWBA 4O1MA 2PNFA 1HLDA 3V1YA 2E48A 1VC2A 2PGJA 1DJNA 3WTBA 4BMVA 1O89A 1X1TA 1DAOA 1NFFA 4EZBA 5DCYA 3L9XA 4WPGA 4U6SA 4ZVVA 1DDOA 3ORFA 3NV9A 5BSFA 3F3SA 1DC3A 4U7WA 4MVJH 3EW7A 4NFSA 4RPKA 2E6UX 3CZRA 3SLGA 1EVZA 1KOLA 4AJEA 1HTBA 2DTDA 3LQFA 3PLNA 4TKLA 3F4BA 3V1UA 3LDHA 3KSUA 3W8FA 2FSVA 3KBOA 5C37A 2VYND 1QKIA 4PN3A 1XLTA 1MGOA 2HK8A 4YR9A 4DMLA 2GDZA 2VRBA 2AMFA 3K9QO 4JROA 1DJQA 3CXRA 2V6MA 1SO8A 3DOJA 4GWGA 4BNHA 2QQ5A 4IJKA 4NQZA 1U8XX 5G0SA 3PQFA 3INRA 1PEDA 3PZRA 3DHNA 1ZK4A 1F0YA 5ES3A 5TNXA 3SVTA 4XR9A 1GPJA 2Y93A 2RBEA 2HDHA 5I8WA 4AJIA 3CEAA 3FWNA 3DBRB 3GZNA 1NQ5A 3WGZA 4DVJA 4DPLA 1B14A 1CYDA 4A03A 2O3TA 4PZDA 4CMBA 5B1YA 1J4AA 3DZFA 3F9IA 1PTJA 2NUAA 3RC1A 5T57A 1EVJA 1ZSNA 2JFHA 5H82A 1ZUD1 4H15A 3RU7A 4BNGA 5LC1A 9LDTA 3H9QA 1ONPA 3IIEA 3U4IA 4M1QA 4CMIB 1ISJA 2D8AA 1JU9A 2X7HA 5JY1A 3B1KA 1C0IA 1I2CA 2E49A 2TMGA 4Z3DA 5CG1A 3GEDA 3RSHA 1U7HA 4HY3A 5A04A 1LSUA 1U1IA 2UUPA 1P0FA 4AJLA 2PZMA 3TFQA 1WLYA 4MKZA 1HE2A 4BQPA 4OYRA 5I7EA 1NYTA 3GMSA 5IXYA 1FDVA 1TT5A 3LK7A 4NU6A 1DC5A 2CFCA 1J5PA 1D7OA 2BI7A 3G1TA 3JQFA 2LDBA 4F46A 3M1LA 1P1HA 4NK5A 1LDYA 4GVLA 3DBVO 2Q1SA 3L0DA 4QEDA 5HS4A 1GPDG 1ZIDA 3G0OA 1HSOA 5A05A 4AJ1A 4L4SA 3B6ZA 3WJAA 4I9NA 5IFLA 2Z95A 4ZQEA 4MDHA 1I30A 1MX3A 4DWVA 5ADHA 3JTMA 4CM6A 2YHIA 1HZJA 1M66A 2DTXA 1ISFA 5DDIP 4JX8A 4IDCA 3GN2A 2NV6A 4PG7A 1F06A 2AXQA 4I5GA 3BIOA 3PJEA 5DZSA 2Y0EA 3MJSA 4MVJA 4OQZA 3D3EA 1E3LA 2LDXA 1H2BA 2J3KA 1DO8A 1E3EA 2ZJ0A 1KEVA 3RCBA 2HQ1A 1GY8A 1LQTA 4XQ9A 3RQSA 4IDAA 4UUOA 1ORRA 4UULA 4XGIA 4Q3NA 4GKVA 5B4UA 4NJMB 3P2OA 4RVGA 4MP6A 4OOFA 1MFZA 2VNAA 4CMEA 5BNTA 1MG5A 3COSA 3L6DA 4FSHA 1QV7A 3P7MA 2C7VA 5EQFA 1C1DA 4YDRA 1SPXA 1OZAA 3C1OA 2JKVA 3CPSA 4D0RA 1X7HA 4MVJM 2JAHA 4RGBA 1LXCA 5U1PA 1O6ZA 1LDGA 2XOXA 1U2DA 3GHHA 3DWFA 7ADHA 2CDAA 3C24A 2YJZA 2NNLD 3UFXA 3NGLA 4BO6A 1HRDA 3GGOA 4TZTA 1HDGO 3OICA 4W99A 5AOVA 2QZZA 1FJHA 4JP3A 1PL6A 2BMAA 2O3RA 3DBRA 2YV3A 3A4VA 3VOSA 5C5IA 1LTHR 4XYMA 3R3JA 3WSWA 4RQTA 5L7WA 3O03A 1KERA 1B8PA 4ZQHA 2B0JA 2HLPA 1ZJZA 2V6FA 3DEYX 4OSOA 4Y9DA 5JYDA 2FR1A 4RVUA 3WR5A 4GSKA 1V6AA 3DFUA 1P0CA 2XF8A 4ALLA 3O9ZA 4BO4A 2GUGA 4IJUA 3MWDB 1WNTA 1A4UA 4EITA 1UR5A 3GFBA 3K2EA 1GZ6A 1ZZEA 4WOKA 1QYWA 2CNBA 3ASUA 1DIRA 2I3GA 2ZKLA 2AQHA 3ZU4A 4K26A 4TKMA 5KVQA 3BAZA 2ZCUA 2PGDA 4URFA 3T7CA 3QVXA 4CM5A 1N2SA 2PD3A 2Y99A 4XIYA 1BDBA 1LRJA 2NVWA 3P19A 3UCXA 3NTQA 5L95A 2WSBA 2O3QA 1SAYA 1I01A 1Z75A 3JQ7A 2H1SA 1MXHA 4BUCA 3HWRA 4EUFA 4I9UA 1A72A 1PQPA 2IZ0A 2EEZA 3ZCXA 3RUFA 2CVZA 1HWYA 1ONNA 2P91A 3ETGA 1BXZA 4FB5A 2NLOA 4RF4A 1MXFA 2X86A 1R4MB 2ZYDA 4CMAA 4E13A 4U0KA 2CDBA 4NK4A 1OC2A 4CMJA 4ZQGA 4C7JA 4BO8A 3DTYA 4UEJA 3AI3A 4HADA 3WYEA 4XJTA 3H5NA 2NU6A 1Z74A 3ZNOA 3ZWXA 4WASA 2GZ2A 2EWMA 2HRZA 2OL4A 3K6JA 4X54A 2FR8A 2A9FA 1E1LA 3DAGA 3OQ6A 5CDUA 1Q7CA 3ZHZA 1PS8A 4J1QA 2PY6A 3OSUA 4MO2A 3GRPA 1W4ZA 2OHXA 1K2WA 3FD8A 4I08A 2OGUA 4YRAA 2VWGA 4XGKA 3VKUA 4RZHA 3H3JA 3DHYA 3LVFO 5A03A 1R0KA 2O7SA 2F1KA 3G3EA 1E6EA 4N18A 4J16A 1LEHA 3RUDA 3QVOA 1H94A 1UZNA 4TRRA 4DXHA 1FDTA 3ETEA 2NQTA 1U5AA 3A9WA 2YUTA 1O95A 3QY9A 1A71A 3GH3A 3RC2A 1JVSA 4LCJA 3F47A 1UP6A 3S55A 2B69A 4II3A 4FS3A 4RDHA 3ZWYA 4CLOA 2WYWA 1E3WA 2PKQP 2JCXA 3AUUA 5ENDA 3S2IA 1CWUA 2NVUB 3NUGA 2YDXA 4YJDA 1Z7EA 3U49A 2DBRA 1U3TA 2WWRA 3R3SA 3GN1A 4OO3A 5L7YA 3Q9UA 3NKLA 2OUIA 1K6IA 1R6DA 5H83A 1M6HA 5EN4A 3T7EA 2P2SA 2DQ4A 1ID1A 2B83A 3C85A 3O8QA 4NI5A 1UP4A 1EVYA 3WJ7A 1IHXA 1ISIA 1E92A 2NTVA 1PQUA 4YAEA 1SEPA 5DP2A 4HNHA 4CUJA 1ZK0A 3VHRA 3ONEA 1P9LA 1PZFA 1AXGA 2IXBA 3KSDO 3MOIA 4YQZA 2J8ZA 4ND3A 5I9NA 1EK6A 4BGUA 4B79A 3ZZNA 3TNLA 3W1VA 3ASVA 4N54A 4E2XA 3WFJA 1DIGA 1L7DA 3B1JA 4RVSA 2XXJA 4RJTA 5G0WA 3X2EA 3PWZA 4UVEA 2DBVO 1T25A 1G1AA 3GUYA 3WQSB 4CM4B 5A02A 4OXYA 4E3ZA 3MTGA 1LRKA 3ANMA 4J4BA 2NVBA 4WNCA 4YVFA 3NEPX 4R9SA 1IHYA 1LDBA 5CHEA 4CLRA 3JQ7B 1PGPA 2DAPA 5A5EA 5G4KA 4TSKA 3Q1LA 2YQ4A 1CDOA 4Z3KA 2I6TA 4KTVE 3WFIA 1ZK2A 3MCVA 2ZQZA 2VOEA 4W4TA 4PLTA 1B2LA 3A14A 1BWSA 5CPBA 3ZW8A 2AHRA 3U62A 3KLPX 1E5QA 1K5HA 4DLBA 1EDZA 4MOWA 1KVTA 2DKNA 3ZNNA 1YBMA 1KVUA 2ZB3A 4I9HA 3OIDA 4PRKA 1GUYA 2NTJA 2PA3A 3JQAD 2GSDA 4IQ8A 1B8VA 4WCFB 1XU9A 2VZ0A 3IKVA 3VH2A 3ZN2A 1OFGA 3IDSA 4OXNA 3MJ4A 3U4CA 2Q1WA 1EDOA 4WEQA 1EK5A 5B37A 4FFMA 2J3JA 1RKXA 5ER9A 1D4FA 2FOIA 4Y6SA 4P8RA 4ROSA 2NU8A 3WNVA 3ZWWA 1TXGA 4GGOA 4CQMD 5ITWA 4D44A 3JYOA 3NTRA 4FJ2A 5A1TA 1S6YA 1Z82A 2PWZA 2BGLA 4ND4A 4M87A 3UKOA 5DN9A 3BMCB 3E9NA 4B7XA 3FBGA 5DCWA 2ZK7A 2BKAA 4GX0A 4XYBA 3OETA 4PRLA 4NHEA 4PLPA 3DTTA 1B16A 3TRIA 4MP8A 5AYVA 1WVGA 3NGXA 3QSGA 1YBVA 5IG2A 3JSAA 1YWGO 4U0JA 3E5RA 1U5CA 3DAPA 5DULA 2FPGA 3KYDA 1XQ6A 1GEEA 1YJ8A 1U28A 5JE8A 3OF2A 3W6ZA 3OEWA 4CQMA 1UZMA 3DONA 5ENVA 5HRUA 2VCYA 1H93A 2B35A 3FNFA 4YAJA 4FR5A 1JAXA 4BOYA 3Q2IA 3JQBC 3TZCA 2WEKA 3LU1A 1HDOA 4L74A 1DSSG 1C1XA 3RFXA 3Q11A 1OC4A 1LI4A 2IYPA 3E5MA 1ENOA 1QXSA 4W82A 4ZQFA 3KYCA 3CH6A 1WZIA 3AOEC 5EINA 1NBOA 1UXKA 2NTNA 2I76A 1JVBA 2NU9A 3IOYA 4W9NA 1VM6A 3GOHA 2HMWA 1XA0A 1N7GA 1J0XO 2Q2VA 1GU7A 1UJMA 3H8VA 1R66A 3JQFC 4J90A 1YQDA 3GRKA 4DGSA 4Z6KA 1XSEA 2WYUA 3JD3A 2QYTA 4NR0A 4B4OA 4P4NA 2XAAA 3L6EA 3HDHA 4ZJUA 1PR9A 1PU2A 4C7KA 4R41A 4R1TA 4CM8A 4D45A 3IMFA 2RCYA 3VTZA 5IN4A 4R69A 2DU8A 4D46A 4WJZA 1NVMB 5C7LO 4KWHA 2W2LD 4AG3A 1A9ZA 3RC9A 3STHA 3OJOA 4IDBA 1HKUA 4XDYA 4QT0A 1DEHA 4NBTA 1YL7A 2QYSA 3EHEA 3I6QA 2GLXA 4XIJA 3ZWOA 2DFDA 3H4VA 3FN4A 4ALIA 3JYPA 3W4KA 1KVQA 4XB1A 1NM5A 3BMQB 4IUYA 5G4KB 2P9EA 1I3NA 3FNHA 4CM9D 3WYBA 1IY8A 1LC3A 2OP1A 2YY7A 3OIGA 4ZD6A 1H6DA 1SNYA 4XDZA 3FSRA 4BNZA 4NBWA 3VDQA 1E6WA 4Q3EA 2Q1UA 4R5HA 3WBBA 1X0XA 2I67A 1GR0A 2D1YA 2WJPA 1LBEA 2AE1A 4CMEC 3N7UA 1BW9B 1K6JA 3VZPA 1BTOA 1GZ3A 2AW5A 4FCCA 3QJ5A 1ZK3A 2OOSA 3HQ4O 3TZ6A 5KJ1A 2O2SA 5AVOA 3SC4A 4IS2A 1E7RA 3OP4A 1F8GA 2JHFA 4DQUA 2C5EA 5KTKA 3KRTA 1AUPA 1Y5RA 4S3MA 5TGDA 2B5VA 4UAGA 2QRJA 4BNWA 3OA0A 4ND5A 2X5KO 2EKLA 5GMOA 1O9BA 4BNTA 3GA0A 5CDTA 1LDNA 1BSVA 1E6UA 1UZLA 1B7GO 4BHTA 4TRJA 3LSYA 3GG9A 3MWEB 4KMSA 3HDJA 4PLFA 2V7PA 4JN6B 3V1TC 1YONA 2DFVA 3NX4A 3L6OO 1ENPA 3IJRA 1LC0A 1KYQA 3K73O 3PQDA 1N5DA 3ZU5A 2DLDA 2J3IA 2PFGA 3KYDB 5L3ZA 4EJ0A 2VHWA 1UAGA 4E6PA 4PLHA 3ONDA 4CR6A 4E5KA 5BSGA 1BG6A 3QWFA 4BO3A 3RKRA 5JAZA 4LGVA 1NPDA 1R4MA 1Q0QA 5KNLA 2H6EA 4PZCA 1GD1O 3HG7A 3JQCA 5JC8A 4JBIA 4XX0A 4QECA 5EL0A 5GZ3A 5TRTA 5A9RA 3FNGA 3Q2KA 5EERA 2EP7A 1E7QA 4L9RA 2UUOA 3AW9A 1E7WA 1PJ2A 3D3WB 3PXXA 1ZEMA 4FGSA 3OQ1A 3M2TA 3KVOA 1LSSA 3TDKA 2G82A 3TZHA 4EDFA 1O8CA 4RLSA 1ISMA 5EMHA 4G65A 3WGTA 4FFLA 3JYNA 1P1IA 4FOOA 1H5QA 1DFHA 1NQAO 5I7VA 2Y67A 4DLAA 5DBGA 2AEMA 4J0EA 4ID9A 5LCXA 2OZPA 4GH5A 3EAGA 1E3SA 2BI8A 3ZH2A 3EYWA 4ILKA 3LYLA 2VT3A 1S7CA 1Z73A 3NDIA 4OKIA 1LLUA 3CE6A 3OECA 4BO0A 1SOWA 1X14A 3SBOA 2BD0A 3PWSA 4HXYA 4EJ6A 3WMXA 5K0ZA 3BHIA 3UICA 3D5TA 3I9JA 5F1KA 5L40A 3WMWA 3G17A 1MV8A 3DR3A 3I52A 3QLJA 3RKUA 1CETA 1YJQA 1KS9A 3L07A 2DT5A 4D3DA 3JQAB 2HJSA 1HDRA 2Q99A 3C3XA 3DOOA 5IF3A 2YW9A 1TEHA 3QV1A 1ML3A 2Y1FA 2AA3A 2YV2A 4RL6A 1E5LA 1PZGA 3NDRA 2AE2A 1SOVA 3GMDA 1SEVA 5TQVA 2QRLA 2Y0CA 4OIMA 3PHIA 3PRJA 1GDHA 4BIIA 5IJZA 5I7FA 1UXIA 2FWMX 3VZSA 2X58A 3AOEA 1U8FO 1I5RA 3TF5A 4CV2A 1GUZA 1PS0A 1XEAA 4W9NC 3UHAA 4CV0A 1T26A 2RAFA 4ND1A 2POQX 5A5FA 1GZ4A 4QFCA 4GMFA 2GD1O 4HFJA 1EE9A 2C59A 1X1EA 3KSZO 4XB2A 1E7SA 3K8ZA 2BFMA 3BMNA 4QSMA 1ISGA 5TJHA 4KUHA 1HE4A 5TJ9A 1ZMTA 1ZW1A 3WGIA 1M76A 2IRWA 4IXWA 1GQQA 3UOGA 4RVDA 4TQGA 2Y0DA 1U4SA 1T2DA 4BNMA 1PSDA 3R0IA 3U9LA 5KJCA 4YACA 2RH4A 2X9GA 3KZVA 1JKJA 2J5QA 4OJNA 4PFJA 2RHCA 2BFAA 4ALNA 3D1LA 1HDXA 3K31A 1B15A 4I5FA 4MIYA 3KLMX 3TOZA 2YHUA 1YB5A 1KEPA 5KKCA 4AJHA 3DQPA 3AY7A 4UEOA 4WLNA 1OOEA 3AY3A 2FSSA 3H9GA 4JXKA 1XHLA 4PG6A 3VPFA 2PGLA 3LC1O 1I33A 1LLCA 4BV8A 5GZ1A 2HK7A 5MDHA 2PD6A 1Y8RA 3BMOA 4JCOA 1Y9EA 2YZ7A 1Y8QB 3RFTA 1YE3A 3GC6A 1NQOA 2VQ3A 3IP3A 3UH1A 3ZI0A 4A27A 3DZHA 3WB9A 2C0CA 2EGHA 2GZ1A 2Z1MA 1YB4A 3NYWA 3IL2A 3GEGA 2YDYA 4LISA 2JCYA 5BR7A 2GN8A 5TT0A 4OQYA 2VUSA 2EKPA 1ADFA 3PWKA 3Q9NA 5TT1A 1E7MA 1C14A 1G0OA 4HUJA 4CPDA 1LLQA 4AFNA 5L45A 1FDUA 5BSEA 2HJRA 1GV1A 2ZTUA 1GQ2A 1HDCA 2X4GA 1F17A 3PJFA 1GCUA 1D1TA 1N8KA 3S8MA 5KVSA 3LC2O 5G4LA 4MVJD 4H7PA 1D8AA 2BFOA 2Y1OA 1YKFA 2BGMA 3DBLB 4B4WA 5EQDA 3OJEA 5EPOA 2YFHA 3GT0A 4AVYA 5B12A 2AEJA 1DLJA 2I66A 3QIVA 2Z1NA 2VT2A 1PJ4A 4WLEA 2DBQA 2GYYA 4MPDA 4K1LA 1XKQA 2AQIA 3F46A 1KVSA 1HYEA 4EBFA 3LT4A 4YT5A 4R3WA 3A28A 5ILGA 3Q0EA 3UXYA 1OMOA 4BO7A 1QYCA 1WPQA 3DL2A 1LSOA 4FDAA 4PG5A 2P5YA 4H3VA 2FP4A 2Q4BA 5DNAA 1I24A 3U5TA 1WWKA 4Q9NA 4XQCA 3PDJA 1C1XB 1ADBA 1N1EA 2P4HX 3ROMA 1CERA 1VKNA 3PPIA 1DFIA 3KYCB 1HLPA 5JYEA 1Q7BA 2HU2A 4FPXA 3QP9A 1EUCA 1NR1A 4DIOA 3GVIA 4RF3A 3FPCA 1UDCA 3T4XA 3VZRA 2HK9A 4E33A 4UVDA 4IQ0A 3B70A 1Y6JA 5JAQA 2GNAA 1WW8A 1KY4A 4BMNA 5A3JA 3DBHA 3WIDA 1CEQA 2C2XA 1Q2XA 2JHGA 3ROPA 1I3LA 3E18A 1K3TA 1BXKA 1VJTA 1YXMA 3WDSA 5L7TA 4OXKA 2B4TO 4CLOB 2F00A 1E3WB 1NHGA 3CZMA 2EW2A 2HMSA 3NJ8A 3DO5A 3RROA 1V3TA 5FI3A 5BT9A 3TWOA 4CM3A 4XCVA 1QV6A 4AJ2A 4IINA 1DC4A 4CLEA 3JQBA 5THKA 1W0CA 1YOVA 1FDSA 3PYLA 3OHSX 4I8XA 4JJFA 2G1UA 5JCJA 2EIHA 1RM5A 2EJVA 3JCZA 4KQXA 4BNFA 5JFOA 1ULSA 2V6GA 5CG2A 3D7LA 4NDNE 4DA9A 4A10A 2W2KB 4J1TA 5HBRA 1HYGA 3IUSA 4YAKA 3NT5A 4WE3A 1P1RA 4M8SA 3V8BA 4B4VA 4EEXA 1ZXBA 3D4NA 2W4QA 4WNIA 5A9SA 1P1JA 3K30A 3PP8A 4YJHA 1XCBA 1QLHA 1SB8A 1JWBB 3OJ0A 4BKQA 1JQBA 3N58A 1NXQA 2FRDA 3QVSA 2PZKA 4E31A 3JQGA 3ON5A 3PDUA 2GZ3A 4R9RA 4QTZA 4QFDA 2D3TA 4ZQBA 5TS3A 1LRLA 1R0LA 4GKBA 4FFPA 5JSFA 1B3RA 4Y98A 1UXJA 4QUKA 1Z45A 3CMCO 4XYEA 4NG5A 2BELA 4L8VA 4EUEA 1CRWG 4IS3A 3BTUA 4DRYA 3E8XA 3EC7A 2PKQO 4I1IA 4G81A 4PGFA 4D79A 4WCDA 2DC1A 4JJGA 3PK0A 3DBLA 3ITDA 3U3XA 1KBZA 5CPFA 5KOIA 4UEKA 2EKQA 4ND2A 4CMKA 3HN7A 4R68A 3S1LA 3BA1A 3H2ZA 3HDQA 3JV7A 1IL0A 2FY8A 5JC1A 2Q50A 4J1NA 4U8GA 1UXGA 1MLDA 5IDQA 1RPNA 3I3OA 3S2FA 2D2IA 3WGQA 2EGGA 3KUXA 4BNUA 3PHGA 1V35A 5DCUA 3PHHA 4KDFA 4HKTA 1QYDA 4E12A 1R0SA 5F1OA 3H5AA 3TSCA 1FDWA 1GYPA 4GL4A 3KO8A 2PD4A 3QVWA 3RUHA 5L53A 2EG9A 4YCAA 1PJSA 4MIOA 3GNTA 4CM7A 4YAIA 1ZO8A 2B37A 2FPPA 3ZNPA 1ZNQO 2HKIA 4YA6A 1N7HA 5CDSA 5JMWA 3DB2A 4I5EA 1EEHA 3AJRA 4QO7A 3D64A 3PJDA 3W8EA 2FPIA 1JW9B 3MJVA 5A06A 1TA4A 1NQTA 3ANNA 1E0DA 1T2AA 2W2LA 4R1NA 1I2ZA 1PGJA 4D0SA 3KOUA 1I3MA 2QHXA 1H9BA 5TC4A 4J49A 4LMPA 4PLGA 2PLAA 2E37A 4P4LA 4DQVA 3ANLA 4R16A 1ZKMA 3LT2A 2IODA 2QW8A 4JIGA 3UF0A 2VYNA 3A1NA 1DIAA 1RM4A 3PVZA 4AJPA 1PJCA 1YVEI 1U4OA 4DYDA 3I4FA 4RVFA 1ULUA 3S2GA 4NNJA 1WDMA 4J1SA 3GAFA 4RZIA 2X5OA 4L76A 1LA2A 4BB5A 3HZZA 1IPFA 1T2EA 4F6CA 1WDLA 2JFFA 3LC7O 1Q0LA 3D4OA 1DRWA 1N92A 1NNUA 4RDIA 1B8UA 2OBNA 1PZHA 1H6CA 4J4TA 5THQA 3W4IA 2VYVD 4QXMA 3FI9A 3UGKA 1PX0A 2CUKA 2RIRA 5EIOA 3JD2A 4NFHA 3BXXA 3RBXA 2Y1EA 4BQRA 4MVJP 4LK3A 1YGYA 4UUMA 1CF2O 3WSVA 3KB6A 1QMGA 4BO2A 1QR6A 4DIFA 1IUKA 3F6YA 3DZJA 4NH4A 4BO5A 1GTMA 3BYZA 4MINA 1N9GA 3IS3A 3MOGA 3OM9A 2E82A 1BHSA 3OFSA 3CSDA 3GVXA 3X2FA 1XU7A 3FBTA 3VVBA 1B3BA 4BNXA 3MEQA 4NJMA 2P5UA 3ICPA 4FW8A 2X6TA 4FD3A 2ZQYA 1R12A 1YS4A 4GSLA 2D5CA 3EMKA 2VZ8A 4NU5A 5F5LA 2VHZA 1NTOA 4NBUA 4CMGA 4RF2A 4K28A 4PCVA 2YV1A 3UUWA 1P31A 3P2YA 2FN7A 1JAYA 3PEFA 1LX6A 1TLTA 1V0JA 1YQGA 3GPDG 2VHVA 4PLCA 3ZDFA 4EUHA 1NFQA 5H81A 4FOSA 3ZWPA 4ZRMA 2AQKA 4Z0HO 1PQWA 5KCZA 4NBVA 4DC1A 3ZHXA 1R37A 1HE3A 3NDJA 5KJFA 4CQMB 1IB6A 1ARZA 2VUTA 3EGOA 3ONFA 2C29D 3WLEA 4RV9A 4XYLA 1NVGA 1DXYA 3C8MA 3HB5X 3KYBA 4RPLA 4Q3BA 4B8ZA 4Y6RA 4OH1A 1EZ4A 3VH4A 4K9DA 3RUEA 2C54A 1AGNA 4IY1A 2Q45A 1BVRA 3FTNA 4PLWA 3KEQA 3WG9A 3GDFA 3V5NA 5HA5A 1A7KA 2P68A 3EY4A 3HFGA 5KVVA 3AK4A 1NX6A 1DC6A 3I9NA 2EV9A 4AJOA 1QSGA 3QWBA 3AFMA 2X1HA 3RBZA 1ZJYA 4AJJA 1VL8A 5BSHA 3DZBA 3JQDA 1WMAA 3AOGA 4BNJA 4BKPA 4QO8A 1UDBA 2VHYA 4NBRA 4L73A 2WDZA 4WLFA 3TL2A 2Y68A 1Y8QA 1IULA 3RUIA 1DIHA 2JAPA 3SJ7A 3C7AA 1XWFA 1RJWA 4XRRA 4DBVO 3E48A 2W8ZA 5JPIA 5T8KA 1IZ9A 2EW8A 2ZIZA 3HN2A 1RWBA 3SLKA 4E30A 1OAAA 3ZHBA 3SJUA 3VZQA 2GN4A 3HSKA 4W7HA 2BLLA 2D4AA 4LN1A 4PVDA 4BO1A 3BTVA 4LW8A 4JQCA 2X22A 4MJLA 4R1SA 2C7GA 5FI5A 3ZU2A 1AE1A 1W73A 2B4RO 4WEOA 4XR4A 3WXBA 4BVAA 5IDWA 3HE3A 4A5OA 3ZV6A 1W6UA 3NT2A 4CR8A 1P77A 3WBFA 3TZKA 2ILTA 3RC7A 5EESA 1A27A 1ENYA 1YL6A 3GEMA 5JDCC 1TT7A 1EUZA 2NU7A 3GZNB 3ZGYA 5IZCC 3H65A 2O4CA 4D3FA 4CLHA 4CL3A 3PZBA 3AUAA 4KZPA 5F21A 2I65A 1HE5A 3E9QA 4MKRA 2PV7A 1ZEJA 1UP7A 1PZEA 5KJEA 4GI2A 4MP3A 1RM0A 1RM3A 3I6IA 4HNGA 2VYVA 3DMTC 5A9TA 3DZKA 2I99A 2D0IA 2J3HA 4IDEA 1BXGB 1JKFA 1U3UA 1T24A 2JD1A 4BV9A 4M55A 4BS9A 4N5LA 4RPJA 4N5NA 1HDZA 5CFZA 3QRWA 3OH8A 2IDZA 4WLVA 4GLLA 4J6FA 1IZ0A 4FBGA 2PKRA 1C0PA 1ZCJA 3F5QA 4UUNA 5CDGA 4P4GA 4QQRA 4Q3CA 2ZB8A 1OBFO 3JD4A 5BNIA 3VTFA 2A94A 2BFPA 4YB8A 4E32A 1E1NA 1G0NA 1ZSYA 3EZLA 1K89A 1KVRA 3RJ9A 4BO9A 2R00A 5ICSA 1ADCA 3VPSA 3JD1A 3ZWVA 5F5NA 3I9KA 3RD5A 4F3YA 1U7TA 2GPTA 1HT0A 3I83A 3ZV3A 2QZ9A 3FNEA 1R4NB 3GHYA 1QLJA 4PLYA 4B7CA 5CDYA 4WLOA 3KM0A 3PYMA 4ZN6A 9LDBA 2GF2A 1NP3A 2CVOA 4BNYA 4PLZA
chains in the Genus database with same CATH superfamily
3OX3A 3TMYA 4O3MA 5K09A 5JLAA 5KIAA 2O1SA 3BCSA 3QFRA 3U09A 1OTXA 3ZWQA 4MW2A 1SULA 4BMSA 2GBIA 3LWDA 1DXQA 5A4FS 3OHPA 4JLUA 1JE1A 2GAIA 3JZMA 4Z99A 5IHPA 4DPKA 2LGJA 3TLAA 1HL3A 3HKCA 5EVCA 4D81A 1Z6GA 3HXLA 2QVYX 3MTBA 2HA6A 3JATB 3NM5A 3F73A 4EECA 3C3BA 3MB8A 5E38A 3VX3A 2GAJA 2Z30A 3GEBA 2IIQA 3RVDA 3VKFA 3EPJA 1NMEA 4FYJA 3IKJA 4M46A 4Q82A 2JCGA 4WV3A 3RJ5A 4OKNA 1SVLA 1Q12A 3K5WA 4FQ5A 5LJIA 2WSSD 1ZBDA 1PR4A 1ZY2A 1BW9A 1TMKA 4B17A 1THGA 3OQBA 1P6XA 2D13A 1KZGB 3KNZA 5CBKA 3NKFA 4DCJA 1HSZA 3O92A 4RANA 5LB4A 2R9VA 2I8AA 4DDWA 1T2CA 3E2IA 3CQ9A 3SFZA 5JQGA 1QDLB 3B6JA 2ZSHA 3X43A 4KPEC 3HRKA 1QVZA 2EKZA 2F8LA 3Q88A 1U8EA 3FJOA 4TROA 5LD2B 2ACVA 1JDJA 1W2WB 1A9YA 1EBUA 4HDKA 4I6GA 5C32A 4Q24A 2NZUG 2AJ8A 3TOXA 4GSYA 1X7XB 3OQJA 4KQCA 4MCAA 1KI7A 5J40A 1WW2A 2NXWA 2WV9A 3KR0A 2BGGA 1M1XB 3GGSA 4C0HA 2A1UA 4ZT7A 3VC7A 3GJ7A 1WVIA 3IXQA 1QCYA 2IYUA 3CZAA 2HJVA 3HYNA 5KVCA 2XIJA 2DPGA 4HP8A 1YS9A 4LHZA 3UENA 4B75A 1ESCA 4QKQA 4U6NA 4MGZR 3I62A 4QGGA 2P2YA 3EOZA 4TGLA 2WUGA 5CGQB 3BD7A 3MJCA 3UT5B 1DRVA 2Y6UA 4Z9FA 5GAJA 3AIIA 5TGZA 3SNKA 4B6GA 4BZXA 2WWGA 3RB8A 5FT9A 4MQUA 4LZAA 3HO8A 3TJRA 4F86A 5AUOB 3O7MA 5NLLA 2TMKA 2UDPA 4EIWA 2O8EA 3QY0A 4KTTE 2FFQA 4P4SB 4PO9A 4HDSB 4AKIA 2PXXA 2EFCB 5D51S 2XJ4A 1TU4A 2B1RA 2MR5A 1GL3A 2NT4A 3GOQA 4EW6A 3A2NA 4LJ6A 1N78A 3EXHC 3PQ6A 1P4RA 2ECOA 4R4JA 3VI3B 4OL9A 3RSOA 1PK9A 1R8XA 3KD3A 3FCOA 4IZIA 3VC2A 3WMRA 1S2LA 2HPAA 1EXWA 1J33A 1SCNE 1OXMA 4BLSA 3GGPA 4WLUA 4XA8A 1PNQA 3ZQKA 2NT3A 2CSXA 1UH5A 3UMVA 1I1HA 3CZPA 5HG0A 4DSNA 4D25A 4AS2A 2ZSDA 3O4RA 4ZXPA 3MT7A 2M32A 3GFOA 5FPTA 1F0KA 2QX7A 3TTSA 1C81A 5IAJA 4CR7A 1QFJA 2QPTA 4K9KA 4TL8A 1TA9A 1Y3FE 4FJ0A 4CIDA 2HNAA 5JNUA 3NRCA 4XAQA 3ZYZA 5F2EA 5FUWA 1MPTA 1EE2A 2KHZA 5DTJA 4P3NA 2DCUA 1ZUIA 1GV0A 4BE7B 1IVSA 3V2UA 3WOHA 3LO8A 1FP4A 1WOMA 1R4ZA 3MUFA 3LPDA 4DY4A 1ILEA 2Z6UA 2IYRA 1RWOA 3TQHA 4IFTA 3CLTD 4MGKR 4PHFA 3STXA 1WW3A 2JFPA 1LWOA 4DB2A 3GQVA 3AFNA 3IKLA 3P26A 3AHFA 3KR1A 4X91A 3TL3A 5LOVB 2UXCB 2PSEA 2Z4RA 3LP8A 4R2IA 2HHJA 2OO5C 3FYHA 4EHHA 1D07A 3WGLA 4QBTA 4M1OA 3ZE8A 4ENPA 2Q07A 1URPA 1RJGA 16PKA 3IOEA 5KOJB 3FWZA 5IULC 3L04A 2DFNA 3V48A 1A3CA 1YRHA 4JLWA 2DBZA 4BMOB 1X13A 1DPGA 2EZTA 5JR3A 1KQGA 2Z2YA 1CS0B 1LBHA 4AZTA 1Y6GA 2AG8A 2R66A 3UPTA 2AF4C 3UV6A 1HFKA 2QVCA 3DMTA 4WY8A 3O91A 2DKFA 3REQB 2XZDA 4PZZA 4REQB 4YJGA 2X0NA 5L4SA 2P5TB 3ACDA 2QGFA 2OZLB 1FPMA 4CM8B 1X1RA 3OP1A 2ZSUA 4P7KA 4YEDA 1DTEA 3HVRA 2OK8A 2ZVPX 1BMFD 4L07A 1NV9A 1QYXA 2ZRDA 5CK4A 5ULLA 1AJEA 3WZ2A 4KN6A 1L5OA 2XE4A 3ELDA 3QVLA 3S81A 4YECA 5HWSA 3FUWA 4MA0A 1XRSB 1FYXA 4F11A 4F6LA 3E7DA 2QUZA 3VPAA 1T1EA 3EW9A 1J2RA 2GN9A 5TB5A 2ADMA 1AGRA 1JPVA 2CE7A 2JKZA 3IOCA 1ORVA 4RZ2A 4D4GA 1M1YB 5FTLA 3C97A 4O3FA 1ECPA 2I29A 3SMQA 4DLPA 2GF0A 4ZTUB 5TMDA 1LNZA 1VSUA 2IEAA 2ZT8A 1SVMA 1ZD9A 3S1SA 2C04A 2KE5A 3F4LA 1CZRA 4P36A 1TL7C 1FC0A 1MB0A 1TZJA 4BGEA 3I76A 1PJQA 1H9AA 3SHVA 3PGKA 3F97A 3QE9Y 1R6BX 2AL7A 4EG6A 4C3OB 1UAYA 4RK6A 2Y66A 2IXFA 1GZSA 3K2QA 4WWHA 1CP3A 5KYUB 1YFKA 3NM6B 1AOXA 2XQKA 4OQFA 4J3FA 2JFNA 4C87A 3BXEA 4TTRA 1FP2A 1Z5UA 3KHKA 3C3YA 4GICA 5ALMA 1C3VA 2FK8A 3QFTA 1ZICA 4J7XA 5KJ6A 4YRGA 3KD2A 2IHYA 3PEYA 1GVHA 3K4PA 3K0AB 1RXEA 4A0HA 1A69A 4BFXA 2WV7A 1VPTA 1XIVA 4P0QB 4AICA 3WDMA 4G0VA 4Y30A 4HDRB 2FZGA 4P33A 3BMOB 3UA3A 4DB4A 4GZMA 3GJ6A 2AV6A 4K6GA 4LJAA 1J25A 3M6IA 3VHLB 3SSMA 4CMIA 5CLLA 3L0ZA 3ESRA 5F78A 4HDNA 1RAAA 4AQDA 5DSTA 2QTLA 4D43A 4FXPA 3SJAA 1P74A 2ZAOA 5FP0A 3P9PA 4FNOA 3OCJA 3HB7A 2LE0A 3IURA 1PJ3A 4GM4A 3IAM1 3HMKA 4IEEA 1XYGA 4OHOA 3SR0A 3WLNA 3IP8A 3HXKA 4BLVA 1XLWA 3ICCA 4LDQA 4X0EA 1ZHFA 5TMPA 2WD7B 1KFBB 5B5SA 2HF7A 3L4SO 5KTRA 4IM7A 4DMHA 1AVTA 2WSLA 4DDHA 4HDAA 4CM4A 3ADPA 4U2EA 3C3KA 2FF7A 7REQA 1O6GA 4OOEA 4KV7A 1VKHA 3I1FA 4RIIA 2L17A 5KSWB 2VQFB 2YASA 2D59A 4ARBA 2OV3A 1FNSA 2NWQA 1Z5OA 2AN5A 3EVBA 2VYCA 5IAAA 4UKDA 4P83A 1VRVA 3RFUA 1NLUA 2AKAB 4IGEA 3V7WA 3WC4A 3WISA 1G8KA 5EHZA 1AQYA 7MDHA 2FUG6 3VA7A 3RH0A 2ZYRA 3UW3A 2DERA 5D7BA 3HXOA 1UOOA 1X15A 5CYPA 3F8TA 1NPYA 1NVKA 1Z0DA 2I33A 2QLTA 4JIMA 3N0XA 1T1RA 3N2KB 4I0WB 4M0KA 4UU1A 4MQ5A 1W35A 1JH8A 1QC5B 3KUDA 4I36A 2BVNA 4Y8VA 2A5LA 4EHJA 721PA 4OATA 2BSQA 3TS1A 4F91B 1RP1A 2HGSA 3GRFA 2MWMA 5EWJB 2G77B 1D1QA 1E5TA 3FHLA 5ALWA 3T3NA 2WJAA 3PLRA 1ZOPA 3R3VA 2J3LA 3GEHA 2G5PA 4PZEA 5CM9C 3VYSB 1KMMA 1OIXA 3ZE0B 1ZVKA 1U2SA 3IAEA 4GKKB 3UVEA 1BRMA 3A3KA 3PC4A 2DX7A 1SRRA 2W6NA 3EE6A 1WZCA 4J7CA 4MRVA 2H52A 2WWXA 2RB4A 5K3DA 5B4TA 1WG8A 3LXUX 2B94A 3TB4A 4N7JA 1GN9A 4EB6A 1LNQA 2D74A 3AZPA 3UWDA 2G8LA 1UDRA 1TW3A 1GGKA 3L7JA 4R1LA 4CIXA 4E6EA 1ZBQA 3DZIA 1YDWA 1CRLA 3HNPA 1RYBA 5HTOA 2V9ZA 3I2YX 1P0MA 4OJTA 2R3SA 5SYNA 1L7QA 2P65A 3Q15C 4O0LA 2XF2A 1IEVA 1UBOS 3BRWA 4B3IA 3VKGA 4YBRA 1XLVA 2VQEB 1WCV1 3RV3A 5ELLA 1SC9A 1DIBA 2WINI 2R1VA 4AWXA 1GOTA 1HEUA 2PGOA 3GFGA 4IBOA 4ZV7A 2EJWA 1MP0A 2JCVA 4PO1A 4Q7EA 4OXIA 3BOSA 1IN6A 2W7TA 3RU9A 4RYDA 3SMVA 3NNSA 4HK4A 1RRCA 2M2IA 3BK7A 4JI5B 2VF7A 3GIWA 5EJFA 5JCXA 2W90A 4O2AF 2HCBA 2K4MA 4YV7A 2QN1A 4HGYA 4O63O 5C53B 1MZVA 5JG7A 1TZ2A 4XE5A 3KOYA 5COAA 2MINB 5C7IO 3U48A 2EAUA 3KVRA 1C7JA 4J0IA 1GARA 4H7EA 1NJGA 4MUNA 4YPOA 3I8XA 1Y9DA 2IA5A 3UAYA 5DTEA 3W0LB 1M1YE 1RCTE 3LF2A 1LU9A 3G2QA 2GK7A 1RTKA 2BF7A 3QIAA 2O0HA 4U7FA 2PZAA 2ZJ2A 2N0SA 2NACA 5DT9A 1KMHB 4BFLA 2GTHA 4OGWA 4ZVNA 3QBDA 1VHTA 2AFHA 3NCHA 5LBIA 2QUIA 1K6XA 4PPNA 2XKAA 4PYNA 3WLSA 3PKZA 1C7QA 3AVWA 1UKCA 4GX1A 2LWIA 5EMMA 3GW8A 4B71A 2DLCX 4RTQA 1XQXA 2QD4A 3R6DA 4TLDA 1OJLA 3W2EA 2DFTA 1M9NA 3TN7A 2BJVA 1H6BA 3ZWNA 1P61B 2Q0QA 2QW1A 3BWYA 4G2NA 3W77A 4MW0A 3BE4A 2GN0A 1UWVA 2GARA 5ALRA 2WWVD 2NXNA 2ZBQA 1R9NA 2OOKA 3WGYA 3L4EA 4ZI7F 1XROA 1PFKA 5E4TA 2C4UA 4Z0PA 1XPUA 3PGLA 1OTYA 3RVBA 2IFTA 1SXJE 2EATA 5IXSA 3WNZA 4UFOA 1FE8A 1FYEA 4FJ1A 3PWTA 4UPDA 5H8WA 2TMYA 1Y4AE 4IJQA 1VMKA 3ZDXB 1ST2A 3H0CA 3SNHA 4CF6A 1BHQ1 1QB7A 2V0GA 1VLQA 2H48A 3BL8A 2JAWA 3A1FA 4M7PA 4URHA 1QAOA 1TO1E 1TI7A 4FYPA 5CCDA 5DXAA 4ALKA 4EZEA 3SXJA 2GO7A 2PX2A 1JIQA 2VJNA 1UJCA 5C34B 5G0VA 5L4NA 2F62A 5GONF 5DHSA 1OUMA 2FPKA 1JMYA 1EHYA 2AW3A 1T2NA 1A8IA 1FX0A 3CTMA 1N34B 4PLVA 3T99A 4DMUB 4N49A 2Q1TA 3NYQA 4IIJB 2QAJA 2B4YA 2H9YA 4CLXA 3WIEA 1IZ8A 2H06A 1GYRA 5B58C 2WAOA 1JHRA 1X9HA 1Z0JA 4Z0TA 2R25B 2OHOA 4LNUB 1GVNB 3GRYA 4BY9E 2ZTVA 5EWJA 5AW5A 1U3VA 2UUBB 3PDHA 4G24A 4OGLA 2Y92A 3MHTA 4WH0A 1WLSA 3U37A 3ZPXA 3QW2A 4MTCA 1M2OA 4IIUA 4P3XA 5JHHB 1N33B 3WL6A 2ZM5A 1YZHA 3WOVA 3O82A 2X0EA 2AYZA 1ZJWA 1UT6A 1NVTA 5KWJA 1NSYA 3WHIA 5HCUA 4PG4A 3S8YA 1JQ5A 1U9IA 2P9GA 1R10A 2ZJ5A 3A1TA 4HWKA 1QP7A 5HX7A 4ROTA 4UE3S 2FNAA 5KS2A 5AI6A 5FTKA 2WJGA 5JASA 5JV5A 2A1TS 1MA3A 1F7UA 4H0CA 4PY2A 1G5IA 3DMHA 1VE6A 3L0BA 4QPDA 3SR3A 1HYHA 1NLMA 1A5ZA 1X80A 2J32A 3PQEA 4GC9A 4ITUA 4A73A 4OQQA 3BFKA 5JDIC 3O4IA 4WW0A 2I5PO 1BFKA 4NMHA 1TDJA 5ALZA 4V1CB 2EIXA 3NPAA 5L9AA 3W3ZB 5H7XA 3UT6A 3BHMA 3PTZA 4XPZA 2ZCVA 4GLJA 1MOPA 3N8GA 2WZQA 2I4TA 5BRNA 1G4AE 1PP4A 2JIDA 2OXCA 3L84A 1K3UB 4KWIA 2PE5A 3UXEA 3S6JA 4D4KA 4JLNA 4HXGA 2ZUWA 1E2DA 4LVUA 4QUBA 4GWKA 4RD3A 1Z6YA 1NR5A 3RWBA 2G7ZA 4N4AA 1KO1A 3GA7A 4BUZA 2X19A 5FBHA 3C5HA 2UZ3A 4X7PA 1VBMA 4TKUB 5CXSA 2I2FA 3A6JA 1GFSA 2ZRQA 4KNYA 3NR2A 1Y81A 2NQ8A 5JCJD 2UYYA 4M37A 2FEPA 4NTZA 4OIFA 2M1XA 3UMSA 1DAGA 3GZ4A 1ZM3A 3B38A 3IVRA 2SCUA 2WIKA 4IVNA 3K72B 4L75A 1IG0A 5E4FA 4ZK6A 5LQDA 2V6BA 5D84A 2PYIA 3S2YA 4DG9A 5F51A 1VXRA 2Y1GA 1CEXA 3IEUA 1IZZA 5GJVC 2Q3JA 1NE2A 4EG0A 4DV0B 3KLOA 3DB1A 4H4EA 3GAAA 1R8JA 1H2ZA 4G09A 4E5NA 2QE7A 4F2PA 2O8FB 1I32A 3AGPA 1U3FA 3AZOA 3EFEA 3RSCA 1OKKD 1CLEA 2VLBA 3K5PA 4DA4A 2CD9A 3LY8A 1JTVA 3LA6A 2CSUA 3L9WA 4ZOAA 4PVCA 1K92A 3T7SA 3SQOA 3KXDA 1VFNA 2VDWA 4ZZ1A 4HNAA 1J0BA 2Z83A 1DINA 3GNQA 4R98A 5EP2A 3TQTA 2X5NA 3V1MA 1E3JA 3FXAA 2LPMA 1WP4A 5CH8A 1VECA 5CA1B 2C2GA 3ANTA 3RUAA 1H2RS 3UAZA 4UNQA 1G6KA 5IZ4A 5C7YA 3NORA 1H4TA 3RYFA 1FU7A 4D41A 4CN8A 5AW7A 5IN5A 1W85B 3I2IA 1BFUA 2A7XA 4ZMSA 1SMKA 2BCJQ 4XWYA 4MR9B 5ALGA 3NOOA 1NV8A 4JITA 3OFKA 1K7YA 2OYCA 3UV3A 2C94A 5EE9A 1KK1A 1JFFB 3NP9A 3U4QB 1TK2A 3CKYA 2XUOA 1EQ2A 1K7FB 2HPZA 2PYDA 4FFOA 1IZ7A 2J30A 4WHMA 1FNCA 1V2HE 2IS4A 5JSHA 1FSSA 4UHBA 3I0MA 1QF9A 3EBOA 4UOQA 1C9DB 5A4KA 1QPBA 3GZJA 4Q39A 4BX9A 2GMWA 5THXA 2PSDA 3NTOA 3LKVA 4IWNA 1U0SY 3OPYB 4PNZA 4XJXA 3MWEA 2HWYA 1U0BB 4HDCA 3V3TA 3HHEA 4C20A 5KYWA 1ODKA 3R9IA 5TF0A 1M6WA 5JQWA 1ZHHA 2PFSA 4F71A 2HHHB 3SZ3A 2JRLA 2VKTA 4KODA 4I8IA 5CFLA 5K2OA 2X9LA 3A3PA 1K6EA 1T4DA 2OCIA 2BE7A 2W6PA 2ISQA 4LJYA 1HI9A 5C31A 3GRRA 3T4EA 3GJ0A 2VHXA 2UYQA 4FR0A 4FC7A 1YDEA 2PQ0A 3GRVA 1FU8A 2CDCA 3HR7A 3PQ3A 1IUOA 1GTG1 4BX2A 1FVFA 4RNCA 2ZIUB 1PNTA 2GA8A 2RK6A 3L7IA 1E61A 3NHWA 3NIWA 4FGLA 4KK3A 1W96A 4JT4A 4LGCA 3FFAA 1TU3A 2QVXX 3TPFA 4WJLA 4YAGA 1ADJA 2R4QA 3HCPA 2HV8A 3MQFA 3TIIA 4DJEC 3CLUD 1CQIB 4ARUA 1ULZA 3EG9B 5I9MA 5G02A 3ZY3A 1G8HA 1OTHA 3P1JA 5B1SA 3SQWA 3PC2A 4JVLA 1DUIA 3O8OB 3GL9A 1FFXB 2PRIA 2WKWA 3KV3O 2C9YA 4MGEA 4QJ5A 5CBPA 1Z16A 2DHRA 1DHTA 3Q9LA 1ZN7A 4YYZA 3E58A 4E2ZA 2VAWA 3GO4A 4M6WB 2BGKA 3CUVA 2H5IA 3SICE 5CXXA 4B48A 2OCXA 1BE8A 1W0KA 1VKOA 1DO0A 5DYYA 2A35A 4K2HA 3U3KA 3C14C 1RABA 5HFNA 1VRWA 1M8PA 4JKOA 4OHPA 3A3YA 2Z5FA 3DTNA 3H9EO 3ABIA 1USGA 3AH8A 3GBPA 3W7AA 2VP4A 5SZKB 1VSBA 3G2MA 3Q2OA 2VBGA 3DT9A 5F98A 2QGZA 3CONA 1DKQA 3Q3EA 5G0TA 4AZWA 1TGVA 3C8ZA 1GSHA 2DGDA 4FE3A 3ABOB 4KMOA 4WESA 5JROA 1P45A 5JZOA 4BMYA 2JK0A 2LCFA 3PGXA 1AHIA 2OUKA 2EFHB 4XCXA 4OM8A 1TEZA 1P3Y1 2GBLA 2DOKA 3GPIA 1OWOA 4V2UA 1UZAA 4OFWA 1TJNA 1IOVA 1GAQA 2HMVA 3FRJA 2Y9MB 3SM3A 1SBTA 4XFDA 3TAXA 4H1HA 1A9RA 4P81A 2BHSA 4A36A 3KSMA 3LT1A 1LK5A 1XDSA 3N5KA 1JWAB 1H9CA 3BMCA 4BKMA 4RFSA 1E9CA 1DXOA 2WJ4A 3F7TA 2V7GA 4MB2A 1S1MA 2W98A 3CJQA 3E1KA 4M0MA 4KR0A 1Z4QA 1XTSA 1NVUQ 3IQHX 5KQPA 4DZTA 1UMBB 5D3MB 1IPHA 2JD0A 3MHPA 1TZCA 2Q9CA 3QWAA 1NWCA 5BO5A 2P0AA 4FKBA 1K5DA 4Q3OA 4ZEOA 1NFRA 2PDAA 4P5PA 2JJ1D 5CP8A 4ZU6X 2I7CA 3EH1A 5HEKA 2OLKA 3VKHA 4MS3A 3GT3A 3FTPA 3ZJ5A 2EL7A 1ZL2A 4JJZA 3S4YA 5JAIA 4ZVSA 3T3EA 4U7TB 2OAEA 1P6QA 5A5DA 1ESNA 4JBHA 1XR3A 5BQFA 3GAZA 1I51A 2MJLA 2P4UA 3IP6A 3LCJA 4RQUA 4U2GA 3W1VA 3HZOA 1EJ0A 4E5MA 2FQQA 4DIBA 1YQTA 1M2GA 1YR8A 3AG6A 4LDAA 5T67A 1DKLA 1JXQA 1R4NA 2H1WA 1G60A 4EPXA 1BS2A 1BMFA 1OI7A 4G3XA 4ZAXA 1YC2A 4CKWA 5EP3A 3DJYA 3AI7A 3MINA 3OCXA 1UBHS 3FFXA 3H9CA 3G2HA 4ECEA 1LVHA 2QSUA 2WIGA 1KAHA 2Q0SA 4LHSA 3RSGA 3D8TA 2ORVA 4OCZA 2AG5A 3QNMA 4TM7A 2FQXA 1ZH8A 3SR4A 1C7FA 1TYDE 2ZYVX 3OZTA 1TUBB 3BB4A 3L4BA 4HGPA 1T0HB 4UFNA 1W8DA 5BQPA 2XXAA 3T3IA 4C6SA 4M8IA 3P94A 1GQOA 3NP7A 1FU4A 1VCNA 5HS6A 1NI4A 3COZA 3MAJA 3IA2A 5JNSA 2BZGA 1J99A 3S68A 1PR5A 5JH7B 4E14A 2GEKA 2QRVA 1XCGB 4EFKA 4JGBA 2PVSA 1O0SA 3ONWA 4QYXA 1MF7A 3C7CB 1XRJA 3UN1A 2FLKA 3DE3X 1PVVA 1SQGA 3GG2A 2D5IA 4LMRA 1E2KA 3Q6IA 4GXTA 4Y9UA 3H2YA 4ZAWA 1B0AA 4URYR 1U9YA 3CINA 2IEGA 3RTEA 1XAJA 3H1EA 2RC6A 4KVFA 2O9JA 2Z9CA 1P0IA 3CYFA 2C97A 4I9FA 4O02B 4DMFA 5A1JA 4LSWA 5KOJA 1K9VF 5GPBA 3RK0A 1ZR4A 4O08A 3V34A 1S1CA 3TCXB 2W2KA 1KJ8A 1VGVA 4RH0A 4YDSA 4EFNA 5FFNA 3BZBA 5EXTA 1VC2A 3N7AA 4BTLA 1E60A 4CZ2A 5CK5A 4HTFB 5HZGA 4B7ZA 4U8HA 4EZBA 2J5XA 3L9XA 3MC1A 1IHPA 1Z9BA 3CNBA 4HMOA 4U6SA 4O33A 3ORFA 1QVAA 2GK4A 5BSFA 5BURA 1YUBA 3AKZA 1SC3A 2Y9PB 1S3IA 2DJ5A 3EB9A 4IICA 5HKKD 3IEXA 5SY9A 2JIPA 2AIRA 3WRXA 3PQ8A 3EGDB 4PR3A 1USVA 5KQRA 2E87A 2ZWPA 4AJEA 4ZMRA 5C46F 5C8XA 1ZINA 2KJQA 3GUHA 3LQFA 3PICA 4OXRA 2ZSIA 5D7NA 3LDHA 3SHQA 2VJQA 3KSUA 3ZE7A 4RK7A 2QN7A 5EFOA 3ZEIA 3JARB 5FKJA 2HQSA 2OBBA 3NUQA 1MGOA 2ZPTX 1PEAA 3QG1A 3L7MA 3NOQA 1YZTA 4OD0A 2PZEA 4OJMX 1MORA 4YHBA 5BNZA 5C8YF 3PFKA 3QUAA 4BNHA 3NDBB 3DKIA 3HMQA 1UFVA 2XZOA 1ISRA 2ECQA 5BN5B 2NZ8A 3K9LA 1PEDA 3DHNA 1ZK4A 2C58A 3QVVA 3SI7A 4IYJA 2PMCA 2QF7A 4QZVA 1IONA 5EZYB 4JI6B 3M5CA 2O5EA 5ES3A 1GQRA 3HGQA 5TNXA 1CR2A 3BIJA 4P58A 2RBEA 2HDHA 4ZWNA 2J9RA 4AJIA 3M5DA 3P2EA 1PFGA 3KE9A 3DFMA 3M70A 4K9OA 1KNXA 2FH5B 5UKDA 2EARA 1RMQA 4MVYA 4LNHA 2CGEA 3TXXA 5FWYA 1AK2A 1CYDA 2CVFA 4Z4FA 1CEYA 2PH7A 5CLQA 1GRQA 4JELA 3F9IA 3EXEA 1J9ZA 1D2RA 5DM2A 3FSGD 4G5XA 2JFHA 4JXJA 4PPFA 4R7TA 1ZUD1 4DA0A 4H15A 4QDOA 3T1OA 2X1LA 2HQRA 3CUUA 1VJRA 3IIEA 2BGNA 1FTNA 2QZJA 5JS8A 1ISJA 2X7HA 1JU9A 1KJWA 1CUAA 4HDQB 2XCOA 1AK9A 1DQYA 5DHTA 3ZCRA 3CLRC 2NUPB 3MLEA 3RSHA 1N3IA 5CG1A 1MIOB 4MYTA 3HRHA 1BVHA 4LWPA 2LW7A 2QM7A 4NH0A 5A04A 3AEUB 3N5CA 2PZMA 5ERYA 4A5SA 4AJLA 1H0HA 3DVRX 3TW4A 3PR2B 3BWEA 2PJUA 4OQMA 5J1TB 1Y9ZA 5I9BA 4C6TA 2Z8YM 3H1GA 2IP4A 1A9PA 2JI7A 5GVRA 1DDIA 2GNPA 1OIWA 1SZPA 4BVEA 4DR5B 4NBLA 4UPEA 1LPSA 4US1R 4PC6A 5J47A 1V2GA 2YMQA 2LDBA 3JQFA 2OC9A 1LDYA 1RIIA 3COPA 1T34A 3DBVO 3G8CA 5IS2A 1TZKA 1XTZA 2WZBA 1DC7A 1O5TA 2H1VA 5HS4A 1GPDG 1KIMA 1HSOA 1ODSA 3ORSA 4TT3D 3VR6D 4JR1A 3SS7X 4JD5A 2OXTA 4PX5A 1GPYA 2X1VA 3B6ZA 2IYQA 3AIKA 4B74A 3O74A 3GEEA 4W7SA 4RABA 3G5AA 1H5NA 3KAJA 4MDHA 4O4IF 4DWVA 5ADHA 4ZI2A 1XXHE 4DCGA 2WU8A 2YHIA 1EGHA 1HZJA 2OLEA 1GNPA 3G13A 3NXKA 5DN6D 5BW4A 4F21A 1Z35A 4C0SA 3K7EA 4HVTA 3ROFA 3CX8A 4DEYA 3H8WA 3I37X 4DZZA 3BZWA 4N01A 1YCGA 1O9GA 3BXPA 1F06A 2AXQA 3BIOA 1XKLA 5JZBA 1T5BA 1Q0PA 4LV6A 3B9PA 2ZRLA 4XLZA 3JQQA 5AI0A 1AA9A 1P62B 3LL7A 2PRZA 4MSUA 3G8BA 5DASA 2OYRA 1NE7A 2G3YA 2V59A 1E3LA 2I71A 5IH7A 4OKSA 1Z6XA 1C1YA 4TT3A 3VR6A 5B3KA 2WB2A 3G8DA 4IHJA 3HKCB 1QQTA 2J7PD 1LKZA 3E2PA 1RZUA 4ETMA 1YZYA 3ZY6A 3VFDA 2K7ZA 2X77A 1WF6A 1XCJA 4HL6A 3DMNA 4Y0VA 5EP4A 3RQSA 5JS2A 4MQMA 3PNMA 5JNRA 2OVBA 4GKVA 1XA3A 1QCZA 4L28A 2JH9A 1QFZA 2O14A 4EFLA 1XEFA 1YHZA 2YCLA 2PV0A 3COSA 2CV1A 4J0CA 1I3OA 1B4DA 2YS6A 1DBWA 1C1DA 4FZ5A 1SVWA 1ESZA 2XUGA 3TNYA 1OZFA 2XRYA 3ZY2A 2YWEA 2A5FA 1GLVA 2JNWA 2AOTB 1GP2A 2WF7A 2JKVA 3G2IA 3NBUA 4JVMA 4LOHA 4OPMA 5D00A 3ENVA 4MVJM 2XUIA 4HS4A 3HCRA 3JQRA 4ARZB 1QGZA 4L6CA 4HDKB 4BVLA 1T5TA 1ZGGA 1EX1A 3JAWA 4PBTA 5DNVA 1CUGA 3GHHA 3LCVB 4BLRA 3DWFA 4JI8B 5IBRA 1FRVA 7ADHA 4MS4B 3KQVA 5LZ4A 3PNLA 3QE0A 3C24A 4EGAA 4JWKA 5IT5A 4BASA 2C7RA 3DZ8A 5KX5A 1OU4A 2QLMA 5E7JA 4DANA 1UBNA 1L7RA 5JTUA 5AOVA 3E22A 4C2TA 2H5JA 2FUCA 1YDGA 3C5VA 4JP3A 1D9XA 2O3RA 2Y1XA 4Y2RA 2YL2A 1AB5A 1N25A 1QIIA 2R6GA 2YV3A 3A4VA 3BIWA 3PC3A 1LTHR 5AI9A 1KZHA 3GPBA 4MWOA 5JRZA 3W5CA 4R0VA 5L7WA 3O03A 2WJJA 1QAMA 3NYRA 1JJVA 4D56A 2HX1A 2V6FA 3DEYX 4J0JA 5CB4A 2VSXA 2QVZX 2NOAA 2FR1A 3S1AA 4KFUA 5JJBA 4RKFA 1NN3A 1ZQ1A 2I0FA 4B35A 3WR5A 1Q3KA 3TLEA 1UDWA 2YIJA 4JA0A 4PFKA 1K1EA 1R18A 3D8HA 4YCJA 1P0CA 5E95A 4OEHA 5GADl 1IDN1 4RD1A 3O9ZA 2GUGA 4HAWA 1AS3A 2BGJA 3O2SB 1JIIA 1A4UA 1WNTA 4EITA 1UR5A 3K2EA 5BR4A 3ZX4A 2W11A 3VSDA 3L7BA 4WOKA 4F5DA 1D2MA 5CTJA 4BB0A 4QXRA 3PTAA 2I3GA 2PIDA 2AQHA 3M82A 1ZAKA 1EDDA 3QPDA 4OHXA 2EKBA 2ZITA 4L51A 1RAEA 2WNSA 3LY7A 3PCTA 4CIBA 2YS7A 1QS0B 3GJQA 3EQ8A 1SOMA 3PTLA 3QVXA 4XIYA 1SRQA 3RSFA 2FSVC 1QGUB 2NVWA 3D0RA 3CTPA 4BAZA 2WSBA 3OAAA 3IT1A 1X80B 5HSGA 5FULA 5SYAA 1IJBA 1RWXA 1SCDA 3JQ7A 1Z0UA 1GZHB 2V7TA 1KAGA 3HWRA 5ES4B 1R27A 1RQGA 4EUFA 4NBSA 3QKRB 3I73A 3MG9A 2EEZA 2GH1A 4XD7D 4XVHA 5IBQA 5HP4A 2QX9A 4FB5A 3HWSA 4LY9A 1MXFA 1R4MB 4L2IB 1HG1A 4E13A 1YQWA 1IHDA 1NT2A 2WAMA 1Z47A 4NAUA 5A6VA 2YZNA 4TSFD 1FS5A 2CDBA 2V7EA 1NLFA 3J7TA 3GJ3A 3O1IC 4JS0A 4O2LA 2FZLA 4C7JA 4BO8A 5M5BA 3DTYA 4TKUA 4ACBA 5C4GB 1ODTC 3U7FB 3CURA 5E6UA 2OHGA 3JASB 5IC6A 1UBMS 2A1IA 1F5NA 2VHCA 4MUIA 2WR8A 4UBKA 1N36B 4G5RA 3ZNOA 2YXBA 3UJCA 1JMVA 2BHTA 2GZ2A 2HRZA 2PM8A 2FR8A 4B87A 1E1LA 3ZTYA 4OYHA 2ST1A 2JFWA 2PX3A 2PY6A 4LTMA 1T1GA 1MJNA 4MO2A 4PO8A 3IEMA 1EX9A 2PWPA 3GRPA 4TX1A 2CCJA 3PUHA 2ODAA 5DLEA 4ML3A 3V9AA 1JEEA 1K2WA 1QTQA 2AEEA 2WJWA 1ZS9A 2ECPA 3C87A 2GCEA 3Q9SA 3VPDA 1BMTA 2Z5VA 1SCBA 3RT9A 2VWGA 4XGKA 3UG6A 2YQZA 1F6BA 1CTQA 2CHVA 2OCLA 4JJ8A 4L5BA 4NZOA 2W6MA 4PGAA 4U2CA 3TRFA 3GA5A 4I4TF 5A03A 2SECE 1OHHA 1R0KA 2E18A 5KU7A 2O7SA 3C39A 3G3EA 3LNTA 1E6EA 4H9GA 4KLZA 3SSNA 4LG1A 4B34A 3ETEA 1J70A 2QPOA 3PXBA 1WMFA 3IHWA 5JSZB 1N2EA 1MVOA 2Z43A 1KHTA 4LCJA 1LTQA 3GLGB 3S55A 5KVAA 1E9EA 2B69A 1VZ2A 2X8WA 3L8FA 4FS3A 4L1KA 4QOEA 1NATA 5E3IA 3VR0A 2AMVA 2JZNA 4CLOA 2UUAB 1E3WA 2YWBA 3AUUA 1NM5C 3EEYA 3JWGA 3C1UA 3DHWC 4V3CA 4FEYA 4YJDA 2YDXA 2A5DA 1Z7EA 1WXGA 4TMWA 1XE3A 3E05A 1SBHA 1SZCA 4NQRA 4HHEA 4Q48A 4ZZ0A 2H08A 3ODPA 5L7YA 1HNXB 2ATCA 1ZNXA 3HU1A 3PNYA 5LYJB 5ICEA 4OVKA 4NYMQ 5KNDA 1BAPA 4CGZA 2KM1A 1K6IA 4RHUA 3SE7A 2UZ1B 1KYYA 1R6DA 5CA0B 3C43A 2G8NA 1HY3A 2DJIA 3D6MA 1SIOA 4YGXB 4EY4A 2DQ4A 4XWOA 3O8QA 1DUVG 1NXSA 4ZVPA 3ZKWB 3QYPA 3QI7A 1EVYA 3EVGA 4JUIA 3WJ7A 1EFAA 1IHXA 1NUPA 1PQUA 5DP2A 1EVLA 3T8YA 5B1IA 3U3OA 4HNHA 3MA0A 4BUJA 4CUJA 3U60B 5DYIA 2IXBA 4YQZA 1F6WA 2H1FA 2IEZA 2CNOA 1F60A 2J8ZA 2W2XA 3R40A 1D5CA 3O1JC 4ND3A 1JYFA 1UBSB 1JHPA 5C1DA 3TSWA 4FLEA 3WLOA 3ZZNA 4BFWA 3TNLA 3MJHA 3UHOA 4W5NA 3IPXA 1XC7A 2EW1A 4QUGA 2JJ2D 1CQWA 5KNBA 1DIGA 4NABA 2Q8QA 1E4EB 1AZLA 3ES9A 4P32A 4OK3A 4R1OA 4X93A 2VUHB 3G8YA 4IXMA 1DVRA 3N39C 3PWZA 3X2EA 4C89A 1JKJB 3D2CA 2HXYA 3O84A 5CA1A 1Y1KE 1ULTA 2ATEA 3GUYA 4TVKA 5FTNA 3QEMB 1T3HA 3DUFA 3V7FA 4OUDB 1VHLA 1W85A 4RJKA 4WNCA 4D99A 5EXSA 1DJMA 5KU1A 2XTNA 1UBGA 2P67A 1DT5A 5CHEA 1R6XA 5CIYA 2C9MA 3JQ7B 3D3JA 3SF8B 1DI0A 1IEXA 3K0CC 1FFAA 2IPXA 1Z38A 4RJIA 4KQIA 4BX0A 2CJYA 2AOXA 1LVGA 3CNNA 1IHUA 1S3FA 2VOEA 4UDOA 3A14A 1AMOA 1IQPA 4DNXA 1KFCB 5HZKA 4GUDA 3FG9A 2P30A 1IU9A 1MMFB 4HEHA 4I4TB 4KDRA 1U6JA 1EDZA 4DIDA 4PYRA 2OCBA 1I1NA 1WHSB 2QIPA 3ZNNA 1I7DA 3RO7A 3SC2B 1KVUA 4ZQCB 1THZA 3KUKA 2A5JA 1UKYA 2PA3A 3JASA 3JQAD 3O0TA 1M6EX 5GP1A 1GAWA 1DKMA 4IQ8A 5I9SA 1B8VA 2XI4A 3SM9A 3X0DA 3IULA 4AX4A 2QTCA 1Q0RA 3LRXA 3Q0TA 1KRXA 3IKVA 5E6RA 2FFAA 1XRMA 1JB1A 3RAEC 1Q1QA 2IHJA 1TF7A 3B53X 4YCDA 5BWCA 1RWVA 1K9SA 2C8KA 3NIBA 2O8CB 5GONB 1DKPA 1QG4A 3WAKA 3GQBB 3KB1A 4WEQA 1YTLA 1FQKA 2J3JA 3M5PA 4KXUA 4M9RA 4LC9A 2JGDA 1D4FA 1G8MA 1G2QA 1ZLYA 4O4LA 1JLHA 2FJPA 2H2AA 3DJFA 3FVQA 3LWZA 3N0VA 4C05A 4CQMD 5LYJF 3NTRA 3PDIB 4LE1A 2P3LA 3D6HA 5CA0F 5JOQA 2FZ4A 4RV5A 5DHQA 4ZT6A 5A1TA 3H2GA 3RBAA 1PVDA 4QPCA 1EP2B 2GBCA 3UKOA 1S0UA 3BMCB 3QBVA 1H3FA 3FBGA 1XCPA 2P27A 2BKAA 3W3AA 5AJXA 4DBLC 5ECWA 4P92A 2R7MA 2WC1A 1VBNA 4QOFA 1XJQA 4E5VA 3S7TA 1AIPA 1RI5A 4WBSA 1CE8B 5F23A 4PV7A 3BGOS 3SSOA 2Q6OA 3AHDA 2OSVA 3DTTA 4AZ0B 2VBCA 1XP8A 1U5BA 2HREA 1X3LA 2IYYA 2F8SA 3JSAA 1GXSA 4YUXA 3IXLA 3FYSA 1TRHA 4PX9A 2XDQB 4L50A 3KQUA 4HAUA 2IV3A 5IKOA 3BJIC 3ZJ4A 2H1LA 1G98A 3O2QB 4LJ5A 1FP7A 1GEEA 3V6LA 1TLFA 2FZCA 1MW9X 1T9GR 1A50B 2EEPA 5JE8A 4OHVA 4CQMA 3MBKA 2BPOA 5ENVA 3DA8A 3QOFA 4WXRA 3QVKA 3OPYI 4D97A 3EFOA 4MV9A 3K9WA 2ZSFA 4NESA 4EGQA 2D2VA 3JQBC 3TZCA 3ZCPA 2TSYB 4GOLD 4R6XA 1HDOA 3VR2D 1DSSG 1JR3D 3QPBA 1LI4A 1Z29A 5E7IA 1PHPA 2EQAA 2MSKA 4FSDA 2EZ4A 5I47A 1NNEA 1LBSA 2E9SA 1KP3A 3KYCA 4B0OA 1T5HX 1Z6TA 2QG9A 1UXKA 1YKGA 4NJEA 3HU3A 4JGGA 4EKNB 5E4JA 3GOHA 1LPOA 4PC1A 3KP1A 2WU4A 4BQEA 3DL0A 2V3WA 2VP6A 4PPGA 1G8FA 2XZPA 3IQFA 2F4NA 2VH1A 1PT5A 3KPJA 3SBXA 4RZ3A 1GA1A 4ZVRA 3JQFC 2L2QA 1YZUA 1YQDA 4I9GA 4PBRA 4DGSA 3V4SA 2CLEB 2VJPA 2WYUA 4O4JA 3H6HA 4B4OA 5CLJA 4P4NA 4G5QA 3L6EA 1U0JA 2P9BA 1V5IA 2IGBA 2CFTA 4JENA 3W9BA 5EJ5A 2WUDA 3L0IB 4DA7A 4D45A 3IMFA 4C7VA 3VTZA 4FGUA 3FPFA 4I3HA 3IVMA 2AJTA 3EMDA 4PYQA 2DU8A 2ZBDA 3D7RA 1NVMB 1QIGA 4J16C 5K0JA 1GNRA 5C7LO 1QFSA 3IE2A 4BMCA 1A9ZA 4OUDA 4RSHA 3UWKA 4A6XA