3C1TA

Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
324
structure length
320
Chain Sequence
b'ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroflavonol 4-reductase
publication title Structural evidence for the inhibition of grape dihydroflavonol 4-reductase by flavonols
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
total genus 111
structure length 320
sequence length 324
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c1tA00
5F1KA 1MV8A 3VPHA 3JQEA 3ZU4A 1V3TA 4NDNE 3F4LA 3OQ1A 1ISIA 2CZCA 4RVDA 4NJMB 2I3GA 3QLJA 1ISMA 2NNLD 4O63O 4RCVA 1I24A 3IC5A 4RVSA 5CHEA 4JBGA 2RHRA 3VPFA 3H5RA 1UXJA 1SB8A 1PU2A 1H9BA 1X7HA 1XELA 2XAAA 2JHFA 3QVTA 1LRLA 2B69A 1QV6A 4TQGA 4CUZA 3PZRA 4JBHA 1AE1A 1L7DA 4XGNA 4CMGA 1XLTA 1M6WA 5IXSA 2O3TA 1T24A 4OJNA 5THQA 2RH8A 5TX7A 4RVUA 1E5LA 2CFCA 2ZJ1A 1DFHA 2FZWA 1KBZA 5JMPA 4XYGA 5AXDA 4BS9A 3RBXA 5ITVA 1DSSG 1D7OA 2FMUA 3JQBA 1ZK4A 1RYDA 4FFMA 3RIHA 2X1HA 5IDQA 4W4TA 3RUAA 2G82A 3WIDA 1G0OA 4BNKA 1QORA 3DDNA 2OZPA 3W8FA 4A2CA 3R0IA 4ALLA 3DMTA 1SBYA 3G79A 1Y5RA 3I9OA 4I9UA 3TZKA 2F00A 3PQEA 1WAMA 1W73A 1BMDA 1LQUA 3L6EA 1NAHA 3NT5A 4PLHA 5CPBA 3JSAA 1Y8RB 4YCAA 2YHIB 3U4IA 1U28A 4HFJA 5TGDA 1PQWA 3ZH2A 1FJHA 1K6IA 3HQ4O 4OKIA 1H94A 5C5IA 1O95A 1Y5MA 1ZNQO 3AM3A 2ZATA 3DZFA 3D5TA 1PS9A 2VQ3A 2Y1GA 5CG2A 5JMWA 5FWNA 1NQ5A 1YVEI 1YBAA 1Z73A 1VI2A 3GN1A 3V1TC 4OYRA 4BNTA 1GY8A 1S7CA 4OSOA 3SJ7A 2GUGA 4YTEA 1A4UA 1VKOA 3DZKA 1X13A 4W6ZA 1HEUA 3OA2A 1JDJA 4FJ0A 2C5AA 3ZWAA 7MDHA 4PIVA 3GAFA 1H6BA 4BO3A 1NM5A 4TRJA 4D3DA 1LDYA 1ULUA 2PR2A 4BKQA 1QRRA 3Q1LA 4Q3CA 3W1VA 3AFNA 1NNUA 3ZN2A 4DBVO 4I1IA 4XX0A 1HT0A 2ZTVA 4UEJA 2FR8A 2CDCA 2BFOA 3L0DA 5JPIA 4D79A 1MXHA 2PH3A 3EW7A 3FNHA 4NK4A 5CG1A 1SOVA 4DQVA 4QFDA 3HNPA 3MOIA 1DC5A 2D1YA 5T8KC 1XQ1A 1U2GA 2VWHA 3SLGA 4H15A 3WICA 2IYOA 4ALNA 3GVCA 3UCEA 3LT4A 2WSBA 5G0VA 2GLXA 1PWXA 5LDGA 1I3NA 2X9GA 4C7KA 8ADHA 3K5PA 3PFWO 2H63A 5BNIA 2JKVA 3RFTA 3LQFA 4B3JA 3UVEA 1CF2O 1GEGA 2EV9A 4WOKA 3ZW9A 4FCCA 5K0ZA 4I9HA 5I7FA 3LC1O 1GFSA 2IYPA 1MLDA 3E48A 3GK3A 1R15A 4IDGA 5GMOA 2GRAA 1M6HA 3AFMA 1L7EA 4KUHA 2H9IA 4BVAA 4D0SA 3H9JA 4Q3AA 2NQ8A 2Q4EA 1HETA 4QX6A 4LRSB 3OHSX 3X2FA 3DZJA 2BF7A 1T2CA 5FI3A 4YT4A 4QFCA 2YV3A 4BOYA 4BNJA 2SCUA 4CL3A 1UP4A 2VYND 1B3BA 3ZHBA 3NGXA 4MVJM 1FDTA 4OGWA 3JCZA 2HLPA 1JN0A 2GF2A 3PK0A 4O0LA 1GUFA 3WNVA 2AEMA 2EKLA 1MC5A 2VHYA 3PHHA 3JQ8B 5K9ZA 3JV7A 4B8ZA 3TFOA 1Y6JA 2WEKA 4DLBA 4CMHA 1UXIA 2PK3A 4AJPA 2JAHA 5JS6A 3IKTA 4CV2A 1PJ3A 1JAYA 3DMYA 3RQSA 5G4LA 4MVJP 2JJYA 4PN3A 4YAKA 2X4GA 3CIFA 3O8QB 5CDSA 4QSMA 2VUTA 4BGEA 2DBQA 4IBOA 3IP1A 1Q2XA 4E30A 2UUOA 3COSA 3JQ9A 4RORA 5CEEA 1CEQA 1YXMA 1ZO8A 1LSJA 3GHHA 3I1JA 4IJKA 4GSLA 1HDYA 4FOSA 1QV7A 5IFLA 1PS8A 2NQTA 3KXDA 3OFSA 3VTFA 1GL3A 3KHUA 4BNMA 2Q99A 3Q6IA 4E4YA 1DFGA 4WLEA 4U0JA 2BI7A 3NTRA 4XJSA 5TSDA 4A73A 1ZMTA 4YJHA 4WKGA 2D4AA 4GGPA 2QRLA 2O50A 5KJCA 4E5KA 1GUZA 3AJRA 5COBA 2VWGA 3CMMA 4L4SA 4R5HA 2IXBA 3QJ5A 5F5NA 1UXHA 1E1LA 1J4AA 4DPKA 2AEJA 2FR0A 1TI7A 4KUGA 4M1QA 1HE5A 2J5KA 3GDGA 5KWEA 1XKQA 4DL9A 1Q7BA 4PZDA 4YRAA 1ZJYA 4INAA 5KKAA 3IKVA 3UXYA 2YFHA 4QEDA 4OQZA 2FP4A 3AUTA 4HNHA 4RF4A 1O5IA 3F46A 3GY0A 4MIOA 4BO7A 5I8WA 3C7DB 4BHTA 1S6YA 3HJAA 4OXNA 3KBOA 2B4TO 2Y05A 1SCUA 4FW8A 1CYDA 4FOOA 3DHNA 2VT2A 3D4OA 1DDOA 4BKPA 3OECA 3TWOA 2JD0A 2EKPA 4P38A 3K92A 3G17A 2OXIA 3PPIA 1JVSA 4WK6A 4DBZA 5THKA 2GGSA 2O7SA 4J49A 2O3JA 1P33A 2YQ4A 4RQTA 2EHDA 1WXDA 4RF3A 5AYVA 1DAOA 3ASVA 2EIHA 4MVJI 3GFBA 4OOFA 3PQFA 3RC2A 1LNQA 3V1UA 3E1KA 3L6OO 4JX8A 2C7GA 3M2PA 1LLDA 1PZFA 5DOZA 3H3FA 3LZ6A 3LDHA 4MVJF 4K6CA 2IXAA 2D59A 5T64A 1AXGA 1U3VA 1EVZA 1H2HA 1XSEA 4FFRA 1K89A 3E9MA 4RPGA 2PH5A 4R01A 2EF1A 3JYLA 4KTVE 5CDUA 3ROPA 3KETA 1VJ1A 2YJZA 2PZLA 2AE1A 3DQPA 3FI9A 4UUOA 4BGVA 2JHGA 4YRBA 4E5YA 3VC7A 4XDYA 5CDTA 1ENOA 1XHLA 1ZCJA 4XRGA 1ZK1A 4HFMA 5KVVA 3DAFA 3GZNB 5TQVA 1SB9A 3EZLA 3G3EA 2Q45A 1XIVA 2I9PA 1HDXA 3O9ZA 3EVTA 2HUNA 4IXWA 1Z75A 3TZCA 3UUWA 4WJZA 4TVBA 5JDCC 3ONEA 4R1SA 3KV3O 4IDFA 2FRDA 1U5CA 3AY3A 3DOCA 2JCYA 4TWRA 4BO9A 3JD0A 3DHYA 4HFRA 1HDRA 5KJ6A 3AM5A 1T2EA 1ZSNA 3HDHA 3JD4A 4U8GA 3Q9NA 1GAEO 3KLPX 1LJ8A 2DLDA 4JCOA 1MC4A 1NX6A 3FSRA 1K6XA 3GPIA 4U5QA 4XD2A 1EDZA 3JQFC 4W7HA 5T8KA 3WWZA 1R0KA 4CQLA 4WASA 3EGOA 4FJ2A 3D3WB 4XCVA 1LBEA 1OC2A 4RDIA 3H2ZA 3KZVA 3E82A 1HE2A 4CV1A 5CEFA 3CE6A 1HE3A 2Y1CA 4RLSA 4XGIA 1I3LA 5KTKA 1WNTA 1U1IA 2G5CA 5ENDA 5JO0A 3DFUA 3GEGA 3OH8A 2QZZA 4EBFA 5F1PA 3GDFA 3I6QA 3NKLA 3GRKA 1P0CA 3WSVA 4O1MA 1H6DA 1HSOA 4I9NA 2HCTA 3P2OA 3DBVO 3CMCO 4YAJA 1K3TA 2PD3A 2Q2VA 4M89A 5CFZA 4J90A 4IQGA 3HZZA 3VKUA 2BFPA 4JK3A 1N9GA 2D0IA 1WW8A 3B1FA 2PKQO 4D43A 4A27A 3FBGA 2AQHA 3E5MA 3MJ4A 3ENNA 3TN7A 5U9CA 2R00C 3DBHA 3RUDA 2CUKA 2NADA 1E77A 1NQTA 3H65A 3JTMA 1DIGA 3UW3A 1DRVA 3NDRA 3VTZA 2ZB7A 3BZUA 2VHWA 3AI1A 3KOUA 5GY7A 3T4XA 1YRLA 2WWRA 3NJ8A 4II2A 2XPCA 1RWBA 1P9LA 4CLOA 2RCYA 3CPSA 5JAMA 3KYBA 3VAZA 9LDTA 1ZKMA 1PEDA 5EERA 1TA4A 2Z1NA 2PD4A 1I30A 3R3JA 4UVHA 4ZICA 1F06A 3GMDA 5I9MA 5F5LA 1NAIA 4BO4A 1P1IA 5AQ1A 1TT5A 3HDJA 4XEHA 5EPOA 3SEFA 1T4DA 4M55A 4YJFB 1IPEA 3ZWYA 4E6PA 1W6UA 2PKRA 2PGJA 4E21A 4ND5A 4R9RA 4CV0A 3VH2A 5G0WA 2UDPA 4RVHA 4DPMA 5L95A 1U3WA 1PQPA 1ZZEA 2OP0A 3OIGA 3B1JA 1YWGO 5GZ1A 4N18A 2HSDA 3U49A 3F6YA 5EMHA 3F5SA 2C29D 4F6CA 3KYCB 1N7GA 5LC1A 2VRCA 3E6AA 3JD2A 2YYYA 2HMWA 3V5NA 3GG9A 3U62A 3L9XA 3OA0A 2JD2A 4OSPA 2OUIA 5G4KB 5JDIC 4C4OA 3PFFA 2BHLA 1E7WA 1DC3A 3RU7A 3DC2A 3JQ7A 4QQRA 4UEOA 4CR6A 2B0JA 3I5MA 3QWBA 3VPSA 4EUEA 5J23A 3K2EA 4MVJD 1KY4A 4ALKA 1I5RA 4NPCA 3E8XA 2GZ2A 1YDWA 2Q1UA 2B4QA 1BWSA 4XZ3A 5KJEA 2QX7A 3LYLA 2DFDA 2VUUA 4A26A 3P5SA 2DM6A 3STHA 4TKMA 4L73A 2GZ3A 1YJ8A 3I9LA 1KEPA 1BRMA 1X7DA 1N9GB 2X0IA 5BQFA 9LDBA 5H83A 2NWQA 4MP8A 1KVTA 5C7OO 2EW2A 3DTTA 4XQEA 2ZB4A 4HKTA 5DP1A 3AI2A 1FDWA 2GZ1A 5HM8A 4WGGA 3S2GA 4AJLA 2O3RA 3EY4A 1WZEA 1Y8QA 2FWMX 5F3RA 3RD5A 3EAGA 1P44A 5CDGA 2JFGA 3GPDG 1NR1A 3GLQA 5DDIP 1ONOA 1YH3A 3ULKA 1NPDA 2PKQP 2P9EA 1ZSYA 1ZK3A 3MJSA 2FHSA 2P4QA 5COAA 3OQBA 3DWFA 3Q3CA 3RC9A 2H6EA 3I9JA 3WBBA 4WUVA 1TT5B 4PLTA 3FRJA 3UOGA 5IG2A 1YJQA 2B37A 5IZ4A 5IZCA 1OMOA 2BGMA 1LXCA 4J43A 4QO7A 4BNWA 2O3SA 2PA3A 1LA2A 2DKNA 3G49A 2V6FA 1GYQA 4CLDA 2UYYA 3KLMX 3H7AA 4BV9A 4R9SA 3GRPA 3WDSA 4J7XA 1E1KA 4B8WA 1I36A 2R6JA 3C3XA 6LDHA 1UP6A 3AUSA 3SC4A 1QKIA 1M66A 4XR9A 4DIFA 2EKQA 3DOOA 3U9LA 1XEAA 1HXHA 4CLRA 5KVQA 3HB4X 1X1TA 3LLVA 1HYHA 4RPHA 1YL6A 3DZBA 4LVCA 3ZWPA 1GADO 1DB3A 2H5LA 4WE3A 4FBGA 3LK7A 4NJMA 1MA0A 1LC0A 3JQ7B 5JO9A 3PJEA 3EK2A 4LMPA 4CQMA 1XWFA 1X0VA 4OOEA 2NVWA 3I9KA 4FFPA 3WGGA 3OICA 4J2HA 1IULA 4TZTA 1OFGA 3I4FA 3KRTA 3KSUA 4GKBA 4KUEA 2IZ0A 1C14A 1NVTA 1UH5A 2PV7A 2P5YA 2JFHA 1DXYA 1YGYA 4YBZA 4RO0A 4PG8A 4ZVVA 3CH6A 2YV1A 1EQ2A 2X9VA 1EMDA 1HSZA 2BFAA 2GR9A 2DC1A 1C0KA 4MKZA 3BTUA 5F21A 4D3FA 4EEZA 1X14A 1A7AA 1DPGA 1JTVA 1Y8QB 4HNGA 1ZSVA 4UEKA 1C0LA 3W4IA 4GH5A 2NU6A 1QLHA 1VM6A 3AUAA 3BTOA 1GCUA 2Q1SA 1DIBA 1BSVA 2VNAA 2JCXA 4I5DA 3WSWA 5JFOA 4XB1A 5A5FA 1DRWA 1O9BA 4GKVA 2D5AA 3ABIA 2X58A 3H8VA 1E1MA 1F12A 1Y8RA 2IODA 2YHIA 3DZIA 4ILKA 4TMFA 1LU9A 4XYLA 1B8PA 3N58A 1BDMA 1DC4A 1VSUA 2RHCA 2X8LA 2CF6A 2P4HX 1PZHA 3EDMA 3LF1A 3U4HA 3JQAB 1CWUA 2HRZA 3FF4A 3I23A 1NXQA 3KSZO 5ES3A 4PGFA 4DYVA 3LSYA 3K31A 2W8ZA 4IMRA 3S2EA 3S55A 1SEVA 1PQUA 4L0QA 3KTDA 4PRLA 1DIHA 1EE9A 5I9NA 4E0BA 1SPXA 5DP2A 4BO6A 3RUIA 1W8DA 4J4HA 4IDCA 2GN4A 3ZV6A 2DBZA 4GQAA 3WMWA 3AI3A 4R1UA 2RBEA 4TKLA 3WFIA 1OI7A 4MINA 3B70A 1H93A 3U09A 2J5QA 3EZYA 4LGVA 2VNSA 5KCZA 4KP7A 1YL7A 4CQMB 5B4TA 1YS4A 2DBVO 3NTOA 2D2IA 5TJHA 3WTCA 1O94A 5L51A 4U0KA 4B7XA 2E4AA 2WYUA 1IZ9A 3OJOA 3PP8A 2W4QA 3DB2A 2NTJA 1WMAA 5EQDA 1T1RA 1E92A 1Z45A 4IZHA 3BAZA 1R0LA 1OBFO 4J1TA 5TLSA 4AJ4A 3HFGA 3WJ7A 1I33A 3OIDA 3ZV3A 4Z9FA 4IDDA 3OQ6A 4B7UA 1SZJG 3K6JA 2O23A 4JJIA 1J6UA 4K9DA 3TL2A 1E3JA 4XIJA 1NFFA 4DUPA 4IDBA 4P4GA 1KVSA 4GVXA 3RKUA 1KEVA 5CP8A 3JD3A 2E6UX 1E7RA 1EVIA 3IQDB 4CMJA 5JY1A 3D5QA 3DO5A 3GGOA 3INRA 4RF2A 5HA5A 2VZ0A 5DULA 3BHMA 4RVFA 2Y99A 3UCXA 5MGBA 5JDIA 3PDJA 3RC1A 3SX2A 1U9JA 1KYQA 1ZJZA 2IZZA 4D45A 1ZK0A 3PHLA 3PLNA 4NZ9A 3ZGYA 4OMUA 4ALMA 3H5NA 4L74A 3OJ0A 4NFHA 2J8ZA 2JFFA 1N2SA 1QYXA 4D42A 4OM8A 1DJQA 4LW8A 4Y6PA 4YAIA 5TT0A 2E82A 4XJTA 3FD8A 4GSKA 3CZRA 4DGSA 1YQGA 4MVJH 4HFNA 4AICA 5L7WA 4EJ0A 3PJGA 3UGKA 3JQ8A 5BT9A 1HDGO 1U8XX 5AXCA 5L40A 3DBLB 1TXGA 2B5WA 2Z1MA 4WNCA 5GZ3A 2BGKA 1PL8A 3ONFA 2PY6A 3ONDA 4YACA 2IDZA 3KEOA 3O8QA 4XQGA 3L9WA 3NJ4A 3DAGA 1U4SA 1Z7BA 3AU9A 2ZYDA 3RBZA 4BQPA 4BNVA 4ZN6A 3EHEA 1ADCA 2BI8A 3KB6A 4OHUA 4YAGA 4GX2A 1LC3A 2Y1OA 3KSDO 1LX6A 1H6CA 3GVIA 4J9UE 5B37A 4ZJUA 1E3IA 3RJ5A 1H2BA 4LMRA 5G0UA 2VOEA 1XQ6A 4L4XA 4D46A 3ETDA 1LLQA 2DUUA 1WMBA 3IAHA 4AG3A 2ZTLA 3FN4A 3ZU5A 4NK5A 2ZB3A 3ROMA 4YAEA 2BKAA 3OETA 1E3WB 4GWKA 3JD1A 5TJ9A 2OFPA 4WLOA 1GV1A 2C5EA 4DPLA 1CRWG 2GN9A 3GH3A 1UZLA 4E3ZA 1Q1NA 1I3KA 2CMDA 5A9RA 2WYVA 4L75A 4ND4A 4Q3DA 1OZAA 2Q1WA 2ZYGA 4UAGA 4NMHA 5H82A 3PI7A 1UXGA 1IY8A 4C7JA 3ROQA 2OGUA 4JQCA 4CPDA 5A9SB 5COQA 4Y67A 3SBOA 5JYEA 1K5HA 3QVXA 4P4LA 1BHSA 2CY0A 2Q50A 4J16A 1JVBA 1XYGA 1U8FO 4JLWA 3WFJA 1E3LA 4IMPA 1T1SA 2X6TA 3QY9A 1CQJA 3FNEA 4L4RA 3GEMA 4R69A 1JKJA 3P2YA 3ICPA 2WE7A 3JQ6A 5C7IO 1RM3A 4E33A 4TRRA 1R4NA 3K8ZA 4J2OA 3W4JA 4CLHA 3I9MA 1BTOA 1ID1A 4RZIA 2EEZA 4FDAA 1NVGA 4PRKA 4CM8A 2HK9A 2VHZA 1UUFA 2G1UA 3QRWA 4A7PA 1I3MA 3TL3A 2AA3A 3JQGA 4BNHA 1P1FA 2DPGA 1TEHA 1EVYA 3C1AA 4IS3A 3WYCA 4RJTA 4EUHA 2VZ9A 1XG5A 4WCDA 3V2GA 5LDHA 3FR7A 4NQZA 4OIMA 1M2WA 5MDHA 3WR5A 2GERA 5A02A 4CJXA 4Q3EA 4RPLA 1LTHR 5JYDA 1YKFA 4PCVA 3DEYX 4NI5A 3U3XA 3MJTA 3QQPA 3NEPX 4E5PA 3F9IA 2XF8A 4Y98A 1AUPA 3ANMA 4MJLA 1GR0A 2IEBA 4FR5A 4J91A 4J4TA 1CDOA 3TQHA 1PJ4A 4JXKA 4DA9A 3R6DA 4KQWA 4CR7A 1XDWA 3WXBA 3DL2A 2NVBA 4BNUA 1WDMA 1M67A 4IDAA 3MZ0A 4RLHA 4HP8A 2HU2A 5IDWA 3RI3A 3BMCB 1U3UA 3GZNA 1HYEA 4JNKA 4ZQEA 2Q2WA 2C0CA 1W4ZA 4AL4A 3IJPA 1NPTO 4GX0A 1RKXA 4MOWA 2C07A 1JKIA 1B16A 4BKUA 1FXSA 4JBIA 1HF3A 2P91A 5IN5A 1DHTA 1PGOA 2Q3EA 5T6BA 3RFXA 4YT8A 1ENZA 4MPDA 2FSVA 1MG0A 5FYDA 4BB5A 3ST7A 1FDSA 1JU9A 1ONNA 4BL5A 3GZ4A 3UN1A 1MX3A 5JW6A 3ZCXA 3GHYA 5T5QA 1NFQA 1NVMB 3GQVA 1PJSA 1KY5A 4ESOA 3IOYA 1O0SA 1DRUA 4NNJA 5HTOA 4AJ2A 4E2YA 1VJ0A 5TS3A 3JYOA 4KWHA 5BSHA 3T4EA 2HO5A 1A7KA 2DTEA 1NPYA 3D3WA 1HDZA 3VPXA 2V6BA 1C3VA 1ADFA 1R4NB 3GVPA 1XU9A 3ZHXA 5HRUA 4CM8B 1ZFNA 5B4VA 1KEWA 4BKRA 5L4LA 2ZCVA 3UCFA 1CJCA 3JQGB 3PWKA 4MDHA 5ER9A 1P1RA 2ZTMA 1DIRA 1NQOA 4FQ8A 4G65A 4YT5A 3F5QA 3OF2A 3F4BA 3ENKA 1KERA 1ZMOA 4H7PA 3WGQA 4EZBA 4JGBA 3TRIA 4Z6KA 1PJTA 5IZCC 4PVCA 4XWYA 3V8BA 5U1PA 1WWKA 2I65A 3D7LA 2EERA 1QMGA 1G0NA 4GLOA 4X54A 1P1KA 5IDYA 1U2DA 3WIEA 2POQX 4BNZA 5IJZA 2CD9A 3TF5A 4J1QA 1IE3A 2P9CA 5DN9A 2ZCUA 3GT0A 2GCGA 2HMUA 2CF5A 3E5RA 3WGYA 3L07A 1BXGB 3IUSA 1MG5A 4IJVA 4GMGA 1YOVA 4W82A 3GAZA 3GC6A 2W98A 3VDQA 2AMFA 4EJMA 2EWMA 1YDEA 1OC4A 3WX0A 1E5QA 1WPQA 4W99A 1B14A 2VUSA 4KQXA 5GZ6A 1IOLA 3CEAA 5KOIA 1UDCA 1A9ZA 4M54A 2GDZA 1R6DA 3IJRA 2O3QA 3PWZA 4BO5A 5DCWA 2W2LA 4DLLA 4F6LA 4TSKA 1LDNA 4YJFA 2NACA 1Y1PA 3QE3A 1VKNA 4LN1A 3V2HA 1PL6A 5K6AC 1P0FA 1GZ4A 1N1EA 1PR9A 1ZXLA 3INGA 4CR8A 3RKRA 3HSKA 4ZRMA 6ADHA 4EEXA 3TFQA 4BMNA 3C85A 1PGJA 3VHRA 4BNXA 3ANLA 2B5VA 4BGIA 2Q1TA 3S2FA 3ADOA 3D0OA 5TRTA 1P3DA 4TRMA 4PLCA 3FPLA 1PJQA 1DFIA 2WD7B 2ZTUA 3KYCA 1BXZA 4KOAA 1WDLA 4Z9XA 1I10A 3TPCA 4E32A 4Q9NA 5JCXA 3H9EO 3O03A 5KJFA 2Y66A 1D1SA 5G4KA 4H16A 5IN4A 1ZEJA 4FC6A 4D44A 1GYPA 4BQRA 2FY8A 4R3NA 3LC7O 3A1NA 2Q4BA 3EMKA 1EFLA 3CTMA 1M76A 3ETEA 1HRDA 2HMTA 4CM9A 4KDFA 1BW9B 2YQ5A 4ID9A 3RASA 4KMSA 3PJFA 3Q0EA 2AQKA 3NGLA 1YB1A 2DUWA 1LDBA 3ZZNA 1JQBA 3D4NA 4E12A 3FTNA 1Z82A 3ZU3A 1ZIDA 3AUUA 1KS9A 1QLJA 4PLVA 3G1TA 1XA0A 3CXRA 3Q2KA 3O26A 3AM4A 1NWCA 2JAPA 3INTA 1YOVB 2EJVA 4L8VA 2GO1A 2X7HA 4R16A 5TIIA 4FC7A 5JC8A 2QG4A 3QWIA 3BMQB 2HMVA 5TF4A 3KVOA 3PEFA 2GPTA 2IZ1A 4P4NA 3RUEA 4GL4A 3BMOB 4B4WA 1H5QA 2C82A 4EDFA 1EUDA 3H6KA 2OMEA 4LSMA 4O59O 4YB8A 3CSDA 4F46A 4A0SA 5TNXA 3VVCA 4A03A 3GDOA 3QWHA 4PZEA 4B79A 3AWDA 4YR9A 4B3IA 5BSGA 2ZQYA 3AOGA 4UUMA 1T26A 5JAIA 1NHWA 2HAEA 4M86A 1F8FA 1LDGA 3D4PA 3K96A 1BXKA 1A9YA 4IZIA 3OEYA 1NBOA 1NASA 3VZRA 4EUFA 2Z5LA 1H9AA 4BNGA 3ASUA 1YE3A 1UJMA 2ZYAA 3U4DA 1N5DA 3SJUA 2AG8A 3RROA 1I2ZA 3IS3A 4ZU3A 3H5AA 5L53A 4MP6A 4BNYA 2O3UA 3NDIA 1ZXBA 3NX4A 4GBJA 1Z6ZA 2YDXA 4FFLA 1U4OA 4NBVA 1QR6A 1Q0LA 3M1LA 4GMFA 4OXYA 4XQCA 4NU6A 2WDZA 5DT9A 3HWRA 3WTBA 4DREA 1T4BA 3QHAA 2PFGA 1L1FA 2IEDA 3FPCA 2BELA 2HJRA 4NBRA 1Z7EA 3BA1A 2BFMA 4WLUA 3ZNNA 4IQ8A 4YVFA 4DTIA 4M49A 4RV9A 4YQYA 2HK8A 4N5MA 3L4SO 3ZI0A 4FS3A 1V9LA 2GSDA 3K2BA 2YUTA 5CEJA 1UDBA 3OIFA 5HS6A 1ENYA 2LDBA 1BDBA 3KO8A 3PZBA 4ALIA 5IDXA 4CL8A 3FHLA 3M1AA 4B3HA 5JE8A 3N7UA 4IGEA 2YW9A 5ENVA 4EJ6A 5A05A 2X22A 3HN2A 1C1DA 4QUKA 4A5OA 5ILOA 4YPOA 3VPGA 5A4DA 2Q49A 1UP7A 3MWEB 2WE8A 1GV0A 3MJCA 1LQTA 2I6TA 4PLYA 2RAFA 3BYZA 3QW2A 1FDUA 1PSDA 1V8BA 3L6DA 4BNNA 5JAQA 1W0CA 3LVFO 4CMBA 2VRBA 4CM6A 4L76A 3VZPA 1SAYA 4GX5A 1HDCA 4P22A 3BMNA 2BMAA 4FGSA 1PX0A 2D5CA 2PGLA 4NBUA 3W8EA 5JC1A 2QZ9A 3AW9A 1GQYA 3EVNA 3UICA 3JQAA 3GNQA 3UAGA 2DFVA 2I76A 4FN4A 4ND1A 1T25A 3TJRA 3PLRA 4WEOA 5G0SA 2D8AA 3RUHA 4BMVA 3LT2A 4GVLA 3WQQA 4DVJA 1GDHA 4IY1A 2GASA 5I7SA 4J1NA 2CSUA 3W6UA 1ISHA 4DLAA 1U5AA 2JL1A 3FBTA 2QW8A 3WBFA 2IRWA 3ZWVA 3LLSA 4ITUA 1K2WA 1PGNA 3V1YA 1DOHA 4CM4A 3DXFA 1YB5A 4CM1A 5C7LO 1V6AA 2ZIZA 4RQUA 1DAPA 1K0UA 1LDEA 4XDZA 1F8GA 4BO0A 4HV4A 2ZKLA 1EVJA 4Y6SA 3K73O 4YWJA 3K9QO 1KVRA 3DBRA 5BNTA 3E9NA 1V3UA 4ONEA 1EE2A 3HE3A 2WJPA 5TT1A 3DR3A 3O4RA 2W2KA 2X5OA 4I08A 2O7QA 2HJSA 2Y1DA 4J6FA 4BKOA 4NR0A 1MP0A 5HS4A 3GG2A 1LLCA 2W2LD 5K6AA 1ZVMA 3H9QA 1KEUA 4M87A 1X7GA 5ICSA 5JAZA 4LISA 1WP4A 5HBRA 3D3EA 3MWDB 4TROA 1HL3A 4B4OA 5T57A 1I01A 3I9NA 1DJNA 4PG4A 1ZBQA 4ND2A 4XIYA 5EINA 3TZHA 1C1DB 1IYZA 1SNYA 4AJJA 3ZHZA 3WMXA 2QYSA 7ADHA 3U0BA 4Z3DA 3DONA 2AQ8A 4YT2A 2DVMA 3NUGA 3W6ZA 4S3MA 5DBFA 2NVUA 2O2YA 5EIOA 3JYQA 5BSFA 3BIOA 4JJGA 1VL8A 3WGTA 1E6WA 1E6EA 2EXXA 3AY6A 1GU7A 3OSUA 1AHIA 3BMNB 3H3JA 2FN7A 3GUCA 4HXYA 4WECA 1NYTA 4E2XA 2QYTA 1CQIA 3E9QA 4U7WA 4CMIB 1ZW1A 2CVOA 3PIDA 1GQQA 4FFNA 5B1YA 2AQIA 2X23A 3E03A 1H6AA 1DHRA 1Q0HA 3C8MA 3W8DA 4CM9D 4XRRA 4PG7A 2X86A 2WYWA 1VL6A 2HMSA 4E5MA 4W9NA 4CMAA 2XOXA 2WD8A 3GGPA 2AG5A 5KVSA 2DPHA 4UVIA 4J9VA 4EI2A 2HKIA 2P9GA 3BXXA 2GD1O 1IUKA 1T2FA 3DBLA 4CM4B 4GLLA 4UUNA 1BVRA 3HDQA 4MIYA 5L7YA 3H4VA 1IHYA 1WLYA 4R3WA 3TOZA 3WQRA 2VTEA 2X5JO 4BIIA 2QRKA 2P2SA 1IZ0A 3DBRB 4Z0TA 2I5PO 3D64A 3WNQA 3TZ6A 3H9GA 3UKOA 2W2KB 5L9AA 3SXPA 4XQ9A 3OMLA 1HZZA 1ARZA 4WCFA 4FB5A 2VOJA 4N54A 1IL0A 3FWNA 1VJTA 4PZCA 4QXMA 4XA8A 1DBVO 1E3WA 5A1TA 4RVGA 3AOEA 1VLLA 5JY6A 1E6UA 3UH1A 3R1IA 3RJ9A 4YYZA 4DC0A 1O6ZA 3ZNPA 1GYRA 1SO8A 3NTQA 1I0ZA 3UF0A 4JROA 1V3VA 5BNFA 3VZQA 3D1LA 4GI2A 1H0KA 2BGLA 1GZ6A 5C37A 3C24A 2BLLA 2QQ5A 2GNAA 4OAQA 5ADHA 2NVUB 4D41A 4BO8A 5A9SA 1D8AA 1WDKA 3ZNQA 5A5EA 3OEWA 1B8VA 1LRJA 3JQDA 3RCBA 1MFZA 2VRCD 4PLZA 4IM7A 2G17A 4CMKA 5BR7A 1I2CA 5AVOA 2DTDA 3WGZA 3PDUA 1ZK2A 1VRWA 3ON5A 1ORRA 2OBNA 1FDVA 1AGNA 1OAAA 4DQUA 2P5UA 1O89A 2Y0DA 3GUYA 2V7PA 2Q2QA 4BB6A 3FNGA 3BTVA 1ZUD1 3A9WA 1E7MA 3QP9A 3WLFA 3E18A 1XCBA 3DAPA 3OJLA 4PLGA 2VYVA 4XYEA 4YJGB 5TC4A 4B4VA 3O38A 2HRBA 3LT1A 5JBIA 2R2GA 3NRCA 1ADBA 1YONA 2ZB8A 2O48X 3DHEA 4ROSA 1DC6A 3WGOA 3S2IA 2QRJA 4HUJA 5KJ1A 3PGJA 3DZHA 2PD6A 5DOVA 2X0NA 4K26A 1JWBB 4U6SA 5EESA 4GX1A 1GUYA 1YBMA 2CDBA 1ADGA 2O2SA 2NV6A 1CIVA 2TMGA 3C7AA 2Y0EA 2EGHA 4WCFB 5A9TA 3VOSA 2NSDA 4YDRA 1VC2A 1PR3A 4TZKA 1C1XA 1JWAB 2Y93A 3VH3A 5C3MA 3BMCA 1R12A 3JQAD 1MGOA 4UULA 2DU8A 3IIEA 2A35A 5I7VA 4IQ0A 4IXTA 1SOWA 2A94A 1NR7A 3L4BC 3GEDA 2Q46A 1OOEA 4HY3A 1E7YA 1TLTA 2Y68A 3ZDFA 2HK7A 4BO2A 3WWYA 1MB4A 3CUKA 3GVHA 1IB6A 3NYWA 4OXKA 1F14A 4JP2A 2VCYA 2O4CA 1UZMA 3MTGA 2B83A 2NM0A 5FFFA 1EUZA 4LCJA 4DC1A 1WVGA 2PZKA 3KYDA 3HDYA 4AJHA 1XU7A 5JCJA 1C0IA 1LLUA 3EC7A 5EJ2A 1GEEA 4I5GA 5A3VA 2VWPA 4J7CA 1K6JA 4RPJA 4CQMD 4DMLA 1E3EA 3ZWXA 4JN6B 3ZWCA 3ICCA 1UDAA 1M75A 1BGVA 1AN9A 1ML3A 1J0XO 3MOGA 2PNFA 3NV9A 1E7QA 1KETA 4UVGA 4Z0PA 4DMMA 4K6FA 5EL0A 2C59A 3T7EA 4TVOA 3I3OA 3WG9A 4N7RA 3IL2A 1V0JA 1B3RA 4PLPA 2PTGA 4PVDA 2OO5A 4LRTB 4AJ1A 3ZWOA 1UR5A 5KNLA 3GF4A 1PIWA 3LF2A 1PS0A 2E48A 4LSWA 1AXEA 1U3TA 1B26A 1T2AA 2NTNA 1PZEA 2FOIA 2YDYA 4HX5A 1ISFA 1I8TA 1JLLA 3F3SA 4R68A 2Y1EA 4PG5A 2VHVA 3MJVA 1Y7TA 4AFNA 1EBUA 3M2TA 3SC6A 4KDEA 2VN8A 5A04A 4FIZA 1WZIA 1E7SA 3NDJA 3FTPA 3NAQA 3GMSA 3PVZA 3WQSB 1JA9A 2CDAA 3A14A 3BHJA 4TRNA 1BXGA 4IPTA 1EUCA 4PLFA 4AJKA 2PZJA 2NTVA 5EQFA 4QECA 3VH4A 4CUKA 3DOJA 2AW5A 4I8XA 1C1XB 3JYNA 4Z0HO 4ZGWA 1P1JA 4R54A 4BNIA 1NFRA 3PHGA 1KIFA 2BRUA 4R51A 4DYDA 3CINA 2Y67A 3PHJA 3PXXA 3QVWA 3A4VA 4DWVA 4YEDA 3KM0A 3GNTA 4J4BA 4WLFA 4CLEA 3M6IA 3IUPA 4J0EA 2BD0A 3PIIA 4CUJA 1HLPA 1I2BA 2EGGA 4NBTA 2OOSA 2C2YA 5AOVA 4D3SA 4AJNA 2J5RA 3KYDB 4B4UA 4EITA 3RAJA 3KUXA 3A28A 4IINA 4MVJA 4I5EA 1V35A 2VWQA 4K28A 3JQCA 1RM0A 2P68A 2ILTA 4FPXA 4KTTE 3PYMA 3PHIA 3WYBA 3S8MA 2WD7A 4GGOA 2YFQA 4BUCA 5I7EA 4S1VA 3PYXA 4WNIA 3FR8A 4AJIA 3U4CA 4NU5A 1A27A 1UXKA 1P74A 3MCVA 5CPFA 2VHXA 1PWZA 4PLWA 3F47A 1PJCA 1EFKA 1JW9B 3KEQA 3RU9A 3A06A 3C7CB 4NFSA 5JSFA 2W90A 2FZEA 3AU8A 1N1GA 2FPPA 4II3A 1PGPA 1KOLA 2J3KA 1BW9A 4HWKA 1NTOA 2FR1A 4IS2A 5DBIA 3HUDA 3MJEA 5DZSA 5A3JA 3PJDA 4LVUA 3RFVA 1D3AA 2BH9A 2YV2A 1QP8A 4WOJA 2E37A 5IF3A 1DEHA 2VZ8A 4YQZA 4BV8A 3HB5X 2X5KO 5G0TA 3G1UA 3DZGA 4MVJE 4MKXA 4PG6A 4Z3KA 3PYLA 3P7MA 1Y9EA 4CV3A 3HFSA 1ZH8A 4RDHA 3ZNOA 1PJLA 3QA9A 3TOXA 1B7GO 2HDHA 3BMQA 3HADA 4DIOA 3OJFA 4QTZA 1KVUA 1VPDA 2E49A 3BMOA 5DF1A 5KKCA 1EK5A 1PTJA 1YB4A 3TNLA 1TT7A 1I32A 4Y9DA 5FEUA 4XYBA 4PFJA 4OH1A 4MIEA 4QO8A 5U4QA 1NP3A 1J49A 2VYVD 2X0JA 4U6QA 1LRKA 1E3SA 1Y9AA 2XXBA 1EQUA 4A10A 1FMCA 3GVXA 2A4KA 3CKYA 4YJHB 2B36A 1R4MA 4OKNA 4Y8VA 4J3FA 1F0YA 1N7HA 5FF9A 4FJ1A 1Q7CA 1A4IA 2O4UX 4ZHSA 1FF9A 4RGBA 4YRDA 2PLAA 2DBRA 3UFXA 2B4RO 1DLJA 5L45A 4NHEA 3RUFA 1QYVA 1ULSA 1IHXA 2EP7A 2I99A 3PQDA 4MVJG 3ZWMA 5F1OA 3I52A 3K30A 4CMEC 1GCOA 3PGXA 1MFPA 2C20A 1YL5A 2ZK7A 4UVDA 4UUPA 3ROKA 3ZU2A 2EP5A 1HDOA 1X15A 4ZQBA 5AXAA 4M8SA 4FD3A 3SVTA 3L4BA 4HBGA 1X0XA 3FWZA 1VSVA 4MP3A 3LT0A 5HWSA 1HYGA 3IDSA 4WPGA 3VVBA 2PWZA 4AVYA 3WLEA 3ETGA 4NG5A 4IIUA 4OQYA 4Y6RA 1EK6A 4XGKA 4DQXA 1GPJA 3IMFA 4W9NC 2DAPA 1JAXA 4LK3A 2IE0A 5LCXA 2DT5A 3EYWA 1EDOA 5CDYA 2J3JA 2Y0CA 5JNLA 2AE2A 4O5OA 3JYPA 4CM3A 3GA0A 1R16A 1TVEA 5JCJD 3GGGA 4RPKA 5DNAA 4N5LA 5DCYA 3OJEA 4R1NA 3U5TA 2G0TA 2ET6A 1LUAA 2D3TA 1RM4A 3UHAA 1HWYA 3LU1A 3RVDA 4F3YA 1NWHA 4WLVA 2I66A 2I67A 1TB4A 5I9LA 1C0PA 3ZV4A 4WCFC 1B2LA 1E1NA 4G2NA 3CZMA 4JP3A 3QV1A 3G0OA 2V6MA 4OO3A 4IGFA 2H1SA 4N5NA 4AJOA 3AOEC 1CERA 1R4MB 1PJBA 2UV8A 2NU9A 1DLIA 3FNFA 1LSOA 1VL0A 3GR6A 5DCUA 1G6KA 1N8KA 2DQ4A 1HLDA 1NQAO 1LEHA 1Y81A 1NHGA 1YQXA 1GTMA 1ENPA 3I4CA 1P77A 3GOHA 4ZQFA 4E5NA 1UAYA 3RC7A 1B8UA 3HN7A 2EG9A 2TMDA 3TZQA 3N74A 1QYDA 3ADPA 4WLNA 4CODB 3ZV5A 3T7CA 1HZJA 2WMDA 1BVUA 1D4FA 1X1EA 5CAEA 3JQBC 3OM9A 2J6IA 3VH1A 5JLAA 2OHXA 2PGDA 1A72A 3ZHYA 4BGUA 4MKRA 3H2SA 2JCVA 4R41A 4HADA 4NFYA 3NT4A 4ND3A 4CQLB 4IJWA 3DMTC 4E31A 1VE9A 1DO8A 1YBVA 1J5PA 2A9FA 4G5HA 3ZW8A 3WGHA 1ONPA 2GYYA 4XR4A 3ITDA 4ZQHA 4BNFA 1Z74A 1QSGA 3ANNA 2YHUA 2EJWA 1MUUA 1UAGA 4EYEA 5H81A 1T2DA 2EW8A 4Q3BA 3SLKA 4XB2A 2YY7A 1QYWA 4NH4A 1CETA 2Y1FA 1KC1A 3F1LA 2WM3A 1SC6A 1QG6A 4J0FA 1XR3A 3WB9A 1ZEMA 4JIGA 4UREA 1QXSA 3H9UA 3MEQA 4L9RA 1GZ3A 2ZJ0A 2NU8A 4W7IA 2GN8A 5L3ZA 1ISGA 3HHPA 3AK4A 4ZA2A 4NIMA 1U7HA 1PL7A 5L4SA 2UUPA 1IPFA 1GQ2A 4Q39A 1LSSA 3R3SA 4O6VA 4RZHA 4EGFA 1D1TA 1LI4A 3DBHB 3WS7A 3TDKA 4UVEA 1BG6A 3VDRA 3BTSA 1ISJA 3HG7A 2AXQA 3S1LA 1PJ2A 4CMIA 4E13A 4RF5A 8LDHA 3C1TA 2CVQA 1EZ4A 5A06A 1G1AA 3ITKA 5KIAA 2LDXA 1YQDA 4CLOB 2I3AA 3GN2A 2WTBA 4DRYA 3B6ZA 1F17A 1AHHA 2Z95A 4R1TA 1LDMA 3PTZA 4J7UA 5B4UA 5ER6A 1QYCA 3QWFA 5I8ZA 4XYMA 2OL4A 2FPIA 3RBVA 2YZ7A 2B35A 2C54A 3NT2A 3BHIA 1HKUA 4K1LA 4H3VA 4URFA 1E0DA 3DTYA 1YO6A 4NBWA 1EBFA 3QWAA 1LSUA 4J1SA 1P45A 4GWGA 1UZNA 4KZPA 3B20A 2FPGA 1XGKA 3ZWBA 4RL6A 3WGIA 5ILGA 4LCEA 1MXFA 5FI5A 1P31A 5BSEA 1PGQA 1RM5A 2F1KA 3Q11A 3IP3A 2X9NA 2QHXA 4Q3NA 1RJWA 1R0SA 2C7VA 5KVCA 3ZWNA 2AHRA 3DFZA 3B1KA 1B0AA 2NLOA 3ORFA 2AEFA 4FGWA 4OL9A 4B7CA 5A03A 4EW6A 4ZD6A 2PZMA 1KVQA 4ALJA 2VT3A 2ZQZA 3V2UA 4FFOA 4WEQA 5L4NA 2CVZA 4I5FA 3VKVA 3OBBA 4CM5A 5IAAA 1HE4A 1A5ZA 2CNBA 2VYNA 2XXJA 1SEPA 5JXWA 1O8CA 2HQ1A 2RIRA 3X2EA 5G2OA 3W4KA 1HTBA 3ZWWA 2OBYA 1Q0QA 5IXYA 3VZSA 5JDCA 4YJDA 4IDEA 1R66A 4NJOA 3Q9UA 5B12A 4IUYA 1SMKA 3QVOA 2J3IA 2X0RA 3F1KA 3RSHA 4DIBA 4D0RA 1N92A 4CMEA 1GPDG 1Q7GA 4CM7A 1FK8A 3LC2O 2J3HA 1R37A 4QT0A 5T67A 3RWBA 1B15A 3FCOA 3RUCA 3I6IA 4R5MA 4BNLA 4IIVA 4BMSA 1P1HA 3TSCA 3JQFA 1EEHA 4DXHA 3PRJA 2DTXA 3EUWA 4E2ZA 2OORA 4CLXA 4AJEA 4P8RA 3WYEA 2V65A 4ZQGA 1KC3A 2FSSA 3C1OA 4CMCA 4MO2A 3QVSA 3JQ9C 2NUAA 2VTDA 1A71A 5ITWA 2QIOA 4YXFA 3L77A 1RPNA 3WOHA 4IJUA 5AXBA 3P19A 4ZRNA 4F45A 2JD1A 4YA6A 2GN6A 4YJGA 1DIAA 3I83A 4Z9YA 4FSHA 2RH4A 3Q2IA 5DBGA 2C2XA 1JKFA 3QIVA 5ICMA 3WJAA 3AY7A 4G81A 3PWSA 4GAEA 2G76A 4BO1A 4E2WA 1PZGA 3QSGA 1RYEA 2NU7A 3GNSA 2R00A 3MTJA 4KWIA 4R4JA 1GD1O 2UAGA 2V6GA 5L7TA 1U7TA 2UVDA 4GPD1 2OP1A 4XKJA 5EN4A 4D7AA 3OP4A 4JJFA 4CLRB 3GFGA 2A92A
chains in the Genus database with same CATH superfamily
5CFNA 3ER9A 3ZX5A 2BOVA 3Q40A 4BFCA 3F4LA 3ZCRA 1ISIA 3HO6A 3VGJA 3QLJA 3CLSC 4RCVA 1I24A 3IC5A 4PZPA 5AKXA 5CHEA 4C14A 4RXMA 3VPFA 3CEHA 3H5RA 1PU2A 1X7HA 1XELA 4W5NA 1FVFA 2IUSA 4K6GA 2UXDB 4IDOA 2GK3A 1CZUA 3QVTA 1WB6A 3LYAA 3PZRA 1AE1A 1L7DA 3HYRA 4JBHA 5CLQA 1XLTA 4OQEA 1M6WA 4C4YA 3T7KA 2Q2OA 4JXXA 2Q5CA 3E53A 1I4WA 1RPAA 5JWRA 5C2JB 4MRVA 3D54D 1YVDA 4YUVA 2FZWA 1MNQA 3NHLA 2EX1A 2OCAA 5G1NA 3W5AA 3R41A 2I71A 4IW3B 2GEVA 1EK0A 4QTUB 3LWBA 1G18A 4TL8A 1G0OA 2VYQA 4OGGA 4TV8B 4H7JA 4YJKA 2YMLA 2OZPA 3W8FA 2QTTA 5HIMA 4ALLA 1QGOA 3L8ZA 1C3XA 2IYYA 4U2BA 5IANA 2WMOB 1SBYA 3DMTA 2CLFB 4K9LA 4M9RA 2JLVA 1G1MA 1CNFA 4OY3A 1IB0A 4I9UA 3TZKA 1W4AA 1IPHA 4BMCA 1W73A 2GT1A 5DCLA 1RXIA 1P4GA 4BEWA 3AXTA 1LQUA 4PLHA 4ZMSA 4KR7A 1RI4A 2BHTA 1IXKA 3JZIA 3SZUA 2MR6A 2H1WA 4GPEA 3SBXA 1ZNZA 2FOLA 3UK0A 2ISQA 3W7AA 5KU1A 3U4IA 4KQEA 1U28A 4OK6A 3GRRA 4DR4B 1YS7A 2A9RA 4FXPA 4Q9HA 1FJHA 1I80A 1K6IA 4MJ7A 3ZH2A 1U3CA 1LVHA 2Q41A 4O1IA 3V7UA 4LE1A 2IHTA 3BSWA 1P2GA 4U02A 3ZY3A 1P60A 3B12A 5EJ9A 1L7OA 3R7DA 4MHTA 4BVKA 2ZJYA 4MKHA 3DZFA 4MUGA 1VHTA 3AETB 1PS9A 4UATA 4DCVA 1C80A 5FWNA 2Z6QA 1YVEI 5EY5B 3IGFA 5G53C 4ENPA 1VI2A 1NXPA 3GN1A 1GG2A 3ZVRA 5E4TA 3SZMA 4KPYA 4U4AA 3GARA 4G5RA 2NO5A 4OSOA 4CI0B 9ATCA 1JI3A 4MPJA 2GUGA 4YTEA 3RVOA 2YWEA 4MW5A 2GM4A 2B82A 1VKOA 2JZCA 4NAVA 1WMDA 2ENWA 3ZUPA 7MDHA 2V1UA 3TJZA 4PIVA 1NBEA 4C6RA 5HYVA 2FUEA 1ZUNA 3GLUA 5AHOA 2O19A 5ESRA 1NV8A 4YYEA 4HGYA 1LDYA 1ABEA 3RPEA 4BKQA 1W59A 1QRRA 2SNIE 3Q1LA 4Q3CA 2FRDC 1JHVA 3LHSA 2WK1A 2CB9A 2MMCA 1MQSA 1BN6A 2I7VA 4M0UA 2I34A 3QHQA 4LKOA 4I1IA 1CK4A 5TV2A 2QLBA 1HT0A 3NHYA 2ZTVA 5FPQA 4QEZA 1JXMA 4YPFA 4BIMA 2I7CA 6REQB 5J43A 3WFZA 3FNHA 2PH3A 2R751 1WHSA 3FUWA 4QFDA 3OCWA 2GHQA 3IV7A 3KPWA 3COJA 4TTSA 2V7GA 3D02A 1FEZA 4C6TB 1ZM2A 1U2GA 2D13A 4Z51A 1H0SA 1E5XA 1U0TA 3UCEA 2RGNA 5UKDA 5EQJB 1TMKA 1OI4A 3L0ZA 2GLXA 4P3KA 4PR0A 1JLRA 5LDGA 1P4SA 2QD1A 1UJ5A 3DOUA 1FNMA 4RADA 3VPCA 4DSUA 2GEUA 1FYVA 2H63A 2VA9A 2JKVA 4MWZA 3RFTA 3L7DA 4XWTA 4M9ZA 4UM7A 1UJNA 1W75A 2PS3A 2J5BA 1Z6TA 3DKVA 3KKLA 4WOKA 3ZW9A 3I3SR 5HRAA 1M0TA 5K0ZA 2DWCA 4IF6A 1DV1A 4C2BA 1ECBA 1OWPA 2GTIA 3BH7A 1CV2A 3DE5X 2IYPA 3NCHA 3MGKA 4M99A 3Q1KA 4W5HA 5HZGA 5J47A 1NVWQ 2C78A 4ZVTA 1GRCA 3OLZA 1M6HA 1OBHA 4D9NA 5LB4A 2EF0A 3E7DA 3T9CA 4OMDA 1DCMA 1XN4A 3T9DA 1YFJA 3X0DA 2O5CA 1KEEB 3SG0A 4D0SA 2EW1A 3H9JA 1YE8A 1ZCFA 2NQ8A 3HB7A 3PNSA 2Z1DA 1HETA 4RE6A 3T3GA 4LRSB 5CFLA 4Y0AA 4YRFA 3IJEB 4DJTA 2O8FA 2IW1A 3DZJA 3OTHA 5CH5A 4BOYA 2YV3A 4GOXA 1U1DA 1IBRA 2SCUA 3NC1C 5EJAA 1EH5A 1B3BA 2VYND 3OE5A 3R0JA 2QNBA 1DQZA 3BRSA 1EYZA 4BJ6A 1FDTA 4KLAA 3BZWA 3N3BC 1KH1A 3HVRA 1RBYA 2OPHA 1JN0A 3PK0A 1CRPA 3KOMA 3QZUA 2VSNA 1CUXA 3NASA 4MPPA 4A1FA 3LPAA 5C7YA 1SKQA 1WSDA 1VMIA 4URVR 3TFOA 4RU1A 5DB4A 1DRJA 1P6XA 3R24A 5PGMA 1G3MA 3RRBA 1X7YB 4I14A 4DLBA 1UXIA 1ZI9A 5JS6A 2WPNA 4A6EA 1PJ3A 2O57A 4UEQA 1JAYA 1ZOSA 3K53A 4H6VA 3DMYA 2ZCJA 2IH4A 2Y0PA 3DJYA 4PZAA 3CVOA 5BMVA 2WNHA 3CIFA 3QKIA 2OHIA 3O8QB 5JS1A 2N75A 5CDSA 1L5KA 1NR5A 3OC6A 2ZTHA 5B3JC 3IP1A 1AKNA 4GE0A 2H11A 3JQ9A 3EIWA 4RORA 3NBQA 1CEQA 3KB8A 4I4TB 3GUHA 3PEUA 2R7AA 2Q4OA 2CXQA 2A1UB 3DP9A 3JZFA 3L7MA 4ZMRA 3D8TA 1HDYA 1WHSB 1UAAA 5AJVB 4FOSA 2UU9B 1NRIA 1AJEA 1Q5PA 4U00A 1GL3A 1NZDA 3TO5A 3BS4A 3AXSA 3TSWA 4HWRA 1PG5A 3OHPA 4LECA 4UXHA 5ALUA 3DZDA 3ZQ6A 2C92A 4EHHA 4OJYA 2CXUA 3HBAA 4FYIA 3INYA 3U1VA 4CN9A 5IFKA 2PUDA 2BM9A 3K9NA 4WLEA 4U0JA 4KMMA 1SIWA 5ALMA 4ABYA 2QG6A 1QKKA 5TSDA 3GD5A 2EFCB 1KYYA 2IHZA 1BN7A 2I2CA 3COYA 1WTCA 4WKGA 3EDRA 4IUCS 1T3ZA 2QRLA 1GVHA 2O50A 4V0RA 5JNVA 1VPVA 1BYUA 1WW3A 4HDCA 5KJCA 3OQNA 3SR4A 3OCYA 4Z99A 1TLLA 5FPTA 4DR1B 1JR3D 2G9ZA 2VJKA 1UBRS 1UXHA 3OJXA 3OPYI 1E1LA 3ENZA 1TI7A 6Q21A 2FPMA 1HE5A 4TM8A 3CCFA 4ZZ2A 3FHOA 2ZT8A 5AM0A 1Q22A 1R88A 2HWKA 4LYJA 4QARA 3AIMA 1XT6A 2W5UA 3FG9A 4YRAA 4L5BA 1E5DA 4I1OA 1L7QA 3ZHSA 5JOQA 2O8FB 1XZCA 5D7BA 3O95A 3AUTA 5D86A 2NIPA 5FDFA 1V7CA 4YC7A 1TEVA 1CQJB 4MIOA 4BTVA 5I8WA 4GBED 3VDXA 2HADA 4BHTA 3KOWA 1ZCAA 4OXNA 2HSZA 4K9KA 3T3PB 1G4UR 3NYIA 4MUXA 5C53B 1SCUA 4F1WA 3LZCA 4FOOA 1THZA 3DHNA 3QHPA 2VT2A 3KPJA 4CKBB 1J25A 3OECA 2WZDA 1RWQA 5TQ0A 4UTRA 2F3PA 1NJ2A 1Z33A 2EKPA 1SHLA 4YQEA 3W5VA 2VJMA 3DOHA 3E3NA 3AB7A 3QJYA 2G08A 4IGKA 4DBZA 4QA9A 2H2HA 3UB4A 3VR6A 4HD8A 3L1KA 2O3JA 2XODA 1P33A 2O2IA 2YBDA 1FXUA 1EBBA 4M1MA 1FFXA 2NUTB 2QP4A 3CF4A 4GOMD 1UBKS 3ASVA 4Y1RA 3V4ZA 1JT2A 1BFKA 1F7UA 5JQGF 1VZ3A 4MQUA 3S7ZA 3PQFA 4BLTA 1GQFA 4JGIA 2Q5FA 4IVNA 1OPXA 2HA5A 5DOZA 2QRNA 1HFWA 2Z0MA 3A3YA 3H3FA 5A3QA 4K6CA 2D59A 4LF4B 3VJLA 2CKDA 2R8BA 2AI2A 3CQ9A 4U7GA 3V97A 3WZLA 3H5WA 4Q4AB 4R01A 5EEHA 3RNOA 3KETA 3ZU6A 3C97A 1VJ1A 1ZN2A 4YCNA 2JHGA 1N2XA 4XDYA 5AVYA 3RYTC 5CDTA 4XRGA 4O2AA 4ENQA 1ZK1A 3NOOA 4FYKA 3DAFA 4HFMA 1NRXA 2W2PA 4JWKA 4L4ZA 4PCUA 4W5WA 2Q45A 1XIVA 3IH5A 4FYYA 3AFIA 1ZUWA 2WQZA 4S12A 5GIOE 1X74A 3IAS6 3IBTA 3O8RA 2MR5A 4ETIA 2W22A 4RCYA 3ACBA 1DJMA 3OEHA 5P21A 4L0MA 2IWRA 5LD2B 2FQXA 5JDCC 2WF6A 4QAQA 1I2MA 3Q7RA 2XDQB 4B0OA 3VO9A 3WIBA 2G5GX 2JCYA 3JD0A 4HLQB 1GGHA 1O97D 4DY6A 5LVAA 3RIYA 3I6BA 1T0PA 3BFPA 3KWLA 2ZOSA 4X94A 5T4FA 2X0EA 1ZSNA 3CNLA 3GRAA 4NXMB 2WSIA 3Q9NA 4RY2A 1GAEO 2QM7A 1MC4A 4JCOA 2FETA 1K6XA 3GPIA 1T9BA 3EZNA 3L7LA 2HBYA 4ZAGA 4HYTA 5J58A 4W7HA 4YMWA 1E1QD 1JPNA 1T4MA 2P8JA 5K3FA 5T8KA 3WWZA 4NRDA 1PJ8A 4PAWA 2OORC 5B1SA 1SCUB 1KTVA 4XCVA 2O2JA 3SFTA 4O4HF 5L3VA 1LBEA 3SDZA 1ODKA 4FP9A 1VP3A 4RDIA 3H2ZA 3QA3E 4U9UA 1QP7A 3K7EA 3I73A 3R9XA 3D6AA 4XGIA 1VYTA 4OYYA 1I3LA 1S5PA 4YBRA 2FZCA 2CFTA 5H8WA 4QPNA 1U1IA 4AQ7A 3DZ8A 5JO0A 3UM9A 4EGQA 3OWHA 2F1RA 4KXYA 3LWZA 1H8HA 1U4NA 1UJBA 1T2UA 4S0ZA 1M8KA 2GARA 1P0CA 3GRKA 1OREA 3NKLA 2W2NA 1IBKB 4Q7EA 1FFXB 1AOXA 1H6DA 1BH2A 2YASA 2BFEB 5AVTA 2I4MA 4Y1RB 4HDKA 1KI3A 5EPUA 1K3TA 4BATA 2EBWA 3PD1A 4FFVA 5F77A 2Q2VA 5CFZA 1G5HA 1ZJ6A 4CETA 3UJ7A 2Y0BA 3VKUA 3HJTA 4JK3A 4H0CA 2J59A 4W5OA 2ZSFA 2PKQO 3TUJC 2WUWE 2KBFA 1JG7A 4FUQA 3B2NA 4PF1A 3ENNA 4XE5A 3TN7A 5U9CA 2JLZA 1NQTA 2BSXA 2EFHB 2PR7A 3JTMA 421PA 5L8VA 3AX6A 3UW3A 1DRVA 4F2PA 1TD1A 4KBGA 2I1VB 1KTIA 4FIDA 4OHBA 4ABTA 5GY7A 4JT4A 2WWRA 4O2AB 3NJ8A 4ML3A 4RENA 2XPCA 5FPYA 3STWA 2FFQA 4NZMA 4MUHA 3ROTA 3MQ4A 1HX7A 5BVGA 4G2TA 1Y1KE 4CLOA 2OHJA 1MOPA 1BAPA 3CPSA 3IO5A 2IEYA 5F33A 3KYBA 3RYFA 3VAZA 5EERA 1U6KA 2KJQA 3R3JA 3W1WA 3GMDA 3SOZA 4OGFA 4I2VA 4CYMA 1QOZA 4MR8A 4TXHA 5CYGA 1P1IA 4JHLA 5DO9A 3PTAA 4DCCA 2QGNA 3DCYA 4O3FA 3LE8A 1FA9A 4XEHA 1JYEA 5EPOA 1Z7YA 4AWBA 4C3UA 1JHMA 4G0UA 4R6WA 1UKEA 2KMLA 2NZ2A 1S2IA 1G16A 2PCLA 2PKRA 2QTHA 4TQAA 3ZXUB 4E21A 5KREA 4OK5A 4CV0A 4Z5XA 3B3AA 4N0MA 5F9FA 5FEMA 2PGAA 3OZAA 2VFAA 2H4HA 3M0EA 3UWPA 3I61A 4DCSA 1QPGA 3RDPA 1G9TA 1Z6GA 3B52X 3OCVA 5L95A 1PQPA 2CVFA 3EZFA 3SXJA 1NNSA 1YWGO 2XW6A 3B1JA 3HI6A 3ZZ0A 2WJIA 5EMHA 4YUYA 2QJWA 2F43A 1XTQA 2YVUA 4F6CA 1SVOA 3NOQA 4L8GA 5DISB 4FBMA 4Z7QB 2WAMA 2VRCA 1QH1B 2P9FA 3CVXA 1FJXA 2YYYA 4EBBA 4LGYA 3MLEA 2OK8A 2QNRA 3OA0A 1IZ7A 2RKOA 4GZMA 1YQQA 3ANXA 5KYYA 2SBTA 3KZNA 5JDIC 1Z6AA 1NQUA 3C70A 4D0NA 1DC3A 4J6EA 3K9GA 3KL2A 3QBDA 4CQNA 4QQRA 4UEOA 2X76A 2RI0A 3BSYA 3FYUB 4HDMB 3D8UA 3I5MA 3JAKB 1DBIA 1C2YA 4G4SO 3ZHRA 4EUEA 2WVJA 3LYUA 4L9AA 2ZUTA 4ALKA 3BGSA 1P2SA 2LE0A 1N5JA 3E8XA 2IVZA 2XTJA 1YDWA 3LKBA 2B4QA 1BWSA 2QX7A 3LYLA 4HDKB 1AQLA 5SZKB 4A26A 2DM6A 5HKAA 4TKMA 1NYLA 1YJ8A 4GECA 2LUOA 2W6MA 1KEPA 5ALLA 3LPDA 4A03A 2X0IA 5BQFA 3E2MA 4DV7B 1SZCA 4NQRA 4MP8A 2ACWA 1KPIA 4RKQA 1NOKA 4XQEA 2ZB4A 5IKPA 1AQIA 2XRFA 3U3MA 4LJAA 4CFYA 3SWWA 1W1WA 1V41E 3S2GA 1JH9A 3CUSA 1IHDA 2JLBA 4P82A 5FPKA 2FWMX 2Z2YA 2FDCA 5LIRA 1G66A 3URKA 1P44A 1UADA 3AHFA 1L1RA 5FO0A 4E1AA 4E51A 1NW7A 2WWIA 4BX0A 2QEQA 5LP6F 3QEAZ 2HD4A 4F8YA 1YDFA 1YV9A 2WJHA 4AKTA 1Y33E 2PKQP 3ULKA 3GLIA 1G5IA 2AN1A 2FMTA 3RYFB 2O0MA 2WWXA 1KH3A 4RL4A 3LY9A 4BNDA 3THYA 2EX0A 2RB4A 1CVLA 3AF2A 5DPMA 2IDJA 2CJFA 3I9JA 4M0LA 1TCVA 4WUVA 2C84A 1M2KA 4KXNA 3FRJA 5T6MA 5FAKA 5IG2A 2W37A 5J5AA 3ZZUA 5AJTA 4ZFNA 3P2IA 3PXDA 3W7VA 2Z6VA 4ZHQA 1LXCA 2IWHA 2IYXA 3EVBA 3P26A 4J43A 4U2GA 4QO7A 3AMVA 1LA2A 5FPSA 5AIBA 3F67A 1UEJA 2ZIEA 4FZVA 1QFYA 4UDXX 5DM4A 1Y4DE 3ZXYA 1IU9A 2G7ZA 4ILEA 4E46A 4BV9A 1QF7A 1FMTA 5CB4F 2G6BA 2GF0A 3QXSA 4UZEA 1PSWA 2GPNA 1I36A 1NULA 2J9ZB 2AC7A 3PQ5A 4H1WA 1FDRA 1T13A 1X9GA 3VOBA 1L5NA 5BWLA 2JDIA 2F43B 3AUSA 3SDSA 5E95A 4ZVSA 3MMSA 2V7QA 1PR4A 3CF2A 1J0EA 2EKQA 4XR9A 1YVRA 4JLAA 4K03A 4C9BA 4JB2A 4N0DA 1QP0A 3PE3A 1ZWLA 2O20A 3HB4X 4JYCA 4RPHA 5F1YA 4ZEVA 2HX1A 1YL6A 1X1CA 3G6KA 4G5GA 4LVCA 2EFJA 3ESZA 2XB4A 1GADO 5HVNA 5HZKA 2J67A 3IB6A 1VLQA 4J16C 3SM3A 3LK7A 5LMUB 4PZ0A 1LC0A 1GPBA 1D7AA 5JO9A 3PJEA 4E1VA 7REQB 1BFUA 1JZSA 3F3KA 4LNAA 2D0PB 3CWZA 2XJ9A 2VL7A 4OVKA 4YN3A 4DHEA 1DUVG 3M4NA 3I9KA 1XZBA 2AOXA 3QM1A 4FFPA 4KBYA 1ZD5A 2GHRA 2FW6A 1IULA 5IVDA 4AKHA 4MB2A 2HPAA 4E15A 3KRTA 4LY6A 4OTZA 3OEHD 2J0SA 3IP8A 4HTFA 4NDAA 3W5HA 2PQ2A 1SA0B 3JWPA 1NVTA 5FT9A 1NLMA 2JFHA 3A1VA 3CBQA 1SXQA 4F1KA 1E2DA 2GYWA 5K6RA 3MXTA 4TYWA 4YBZA 4PG8A 3L79A 3CH6A 3C14C 4NARA 1EQ2A 4G4SP 1YNSA 3IUBA 4AZ3B 2O5RA 1EMDA 1VIMA 1Y98A 2XGMA 2Z58A 3W05A 2GR9A 1LNZA 2DC1A 2FEXA 4D3FA 1QIHA 2J6CA 1X14A 1JTVA 4C89A 4ZZ1A 5K45A 1C0LA 4QU0A 2C1EA 2V9PA 5D2CA 3FGPA 2H9YA 2OD9A 1MA3A 4BWFB 1OZFA 1DQYA 3HZOA 3KEFA 2R0QC 2DH5A 4NE9A 1E59A 1WE2A 3GLIB 3T0IA 4ZVVA 4DLXA 3H8VA 4BFYA 2HWXA 1IG0A 1MX9A 2YHIA 4BNDB 5TY0A 5JAIA 1B8PA 3N58A 1G17A 3D6NB 3CA8A 3EARA 5BV7A 2P1RA 2DH6A 2RHCA 4FE4A 5EOVA 3KUCA 2NPFA 1YHZA 3GD7A 1JAHA 1IEVA 3KQVA 1N8NA 1M34E 3QX7A 1ZGAA 2ISSD 3I23A 4K8RB 4W7SA 5AI6A 3A2NA 3CZCA 3KSZO 3A6GA 4ZHQB 3RU2A 4LJ6A 3QITA 1ADYA 3BRWA 3K31A 2Q0QA 4B6SA 2W8ZA 4HAVA 3S2EA 4JC8A 1SEVA 1EPUA 1EE9A 1ZGBA 4L5AA 1Z16A 4P0TA 1LK0A 2JIMA 5G1OA 7MHTA 1R5JA 2NXCA 1PNTA 3L4EA 3OQIA 5EZ6B 3DEKA 3MN1A 2TMYA 2CMFA 2OAP1 1X80A 2A4MA 3WB1A 4E0BA 5JC1A 1PT5A 4KK4A 2RAVA 1J2YA 1M6NA 2C9CA 1WD7A 1DJLA 2W8BB 4PS0A 3WMWA 1L1QA 4R1UA 5FJIA 5K0GA 5K7SA 3HKDA 2I55A 3R20A 3HCBA 4PV7A 1PR2A 1KSHA 3IAM6 5C80A 3L8YA 1OI7A 3M5PA 4NZZA 4QLAA 4I9FA 1K4KA 2LTAA 3IDFA 3M3HA 1BS9A 1K66A 1ODCA 1X3LA 3L6RA 4LGVA 4C3OB 1JFLA 4QD3A 1GA4A 5ES4B 1V7PC 4C0KA 1HQYE 1YL7A 1ZD8A 2YR0A 4QHTA 4XGRA 1APBA 1D1PA 3AG6A 4QVKA 4AZSA 1CG6A 3LPLA 1O94A 3SZ3A 3V7YA 4IDPA 3WTCA 4V0ME 4DMRA 2A14A 3HU3A 5IWAB 1E2HA 4FS8A 2IHUA 1IZ9A 5LQAA 5TMPA 1HC7A 3GPLA 1I2DA 4DEVA 2YKGA 2YW2A 1Z45A 2W42A 1W85A 3HB1A 5BSUA 4ZAYA 3TMYA 3MC1A 1DX4A 3OF3A 1R0LA 2VP3A 1DP4A 2VVTA 4J1TA 4HPXB 4AJ4A 2AYYA 3HFGA 5F2EA 4TLLB 3WJ7A 2QN9A 3OIDA 3W2TA 3KB1A 3OQ6A 4B7UA 1SZJG 4G8JA 1SUCA 4QGAA 1O87A 3MPUA 1X8XA 4BX8A 1G8MA 2FWIA 2LCFA 2OQ2A 2CJWB 2QT1A 4YRQA 4D97A 3U40A 3DDWA 1QHGA 1FTYA 2WV9A 2XIQA 4Q9AA 5KAMA 3UAXA 1BD4A 3M9WA 3EZ2A 1Y5NA 2GAIA 2XUPA 1VQ1A 4FU0A 3LUAA 1P75A 5FWYB 3W79A 3LX5A 3WKEA 1BQ4A 1QTNA 5D01A 1US8A 4CMJA 4D9IA 3GZJA 1GLGA 4I1VA 4Q15A 2H65A 3MUOA 4R2XA 4RVFA 4BX3A 3UCXA 2CJPA 1N75A 5EIBC 5HK9A 1KU6A 2IZZA 3AHDA 3PLNA 4N49A 4NZ9A 1CUJA 1FP2A 3SS9X 3BCUA 3ZGYA 2IIPA 4L74A 2GBLC 2JBWA 2P4EA 4K6KA 1S9DA 3EH1A 1N25A 5FH9A 1QYXA 1G2QA 1F4LA 1UEIA 1SXJB 2XUOA 1XWIA 1CZOA 4OM8A 4Y6PA 5I3ZA 1Y82A 2IOFA 4DG5A 3CB4A 1IG3A 4WIAA 1WDWB 3OCCA 4HL6A 3L1JA 3CLRD 3JWEA 3LVRE 4V3CA 2XOEA 3UGKA 3JQ8A 1VHLA 1TUEA 5DIZA 1JEDA 3NPMA 1X80B 3OLYA 3VNVA 2YRFA 1NMYA 2RGRA 2WFAA 5AXCA 5IH3A 3DTVA 4BB9A 2F3RA 2ZSJA 2B5WA 2Z1MA 4LYEA 4WNCA 3SEZA 3SYKA 5C35A 2B7BA 3R2JA 3Q98A 1CY8A 3GYBA 1K63A 3HKDB 4CIDA 2B78A 3WGJA 2XYVA 1V4BA 3ONDA 4YACA 1YZNA 3VV3A 1RWNA 3MT0A 5AT1A 3EXHB 3V46A 5D1NA 2RGBA 4V0KA 4MV9A 4EY8A 3KXPA 3OTOB 3D4BA 3I72A 3DAGA 3M33A 1VLVA 4F38A 3ADKA 4CQJA 2ZYDA 4JUFA 4AY4A 5HPYB 5LZ2A 1ADCA 2ZEJA 1GPWB 1FMJA 2EWVA 2SICE 3TB4A 4EI9A 1JP7A 4JUIA 2AUMA 1ZGHA 5DLYA 1WU8A 2CL6X 3F74A 1ZYUA 4LDJA 4MDYA 4KR2A 5GTDA 4OI2A 2VOEA 4L4XA 4MYHA 1W85B 1QU3A 3ETDA 3RRZA 3DMRA 5M7EA 4C30A 1EFRA 3DE7X 3KHTA 2O7NA 2ZTLA 4JSRA 4K8OA 3R3WA 4KWEA 3H5IA 2COEA 4NAHA 4IDNA 4QDKA 4JYZA 1GQRA 2GFHA 3VR4H 3U4QA 2XMSA 4WLOA 4RESA 4DPLA 4HLDA 1GSHA 3DT9A 4RK0A 2OAQ1 4BWGA 1RRGA 3Q7TA 5IARA 3MHTA 3H9BA 1V8DA 4Y1FA 1I3KA 1GOTA 2CMDA 2IPOA 1KO4A 2YHSA 2Z2KA 3DF7A 3K09A 4Q3DA 3T5CA 3VKGA 5LMNB 1OZAA 2ZYGA 4NMHA 2X41A 4LBYA 1J90A 4J0HA 3AVTA 1PR0A 4YALA 4RV5A 4C7JA 5CXSA 5JZ9A 4RYDA 4X7PA 3ROQA 4UEWA 5IT0A 2HHAA 1TJYA 3KKMA 4KXWA 3RS7A 3M4YA 4KNYA 1EM8A 2JDID 1M6EX 2DEUA 5A9SB 3RK4A 2XWSA 3NZEA 2QSUA 3SBOA 4P4LA 5EWMB 2AX4A 1AB6A 2IC5A 3FSGA 3RIMA 2JFNA 1SBNE 3AR7A 1W4CA 3EIOA 4Q16A 1U8FO 4KW7A 5C8ZA 5KHOC 1GARA 1CJKC 2E6KA 4HCJA 4Q4DA 4R84A 4TWIA 1NDQA 1SVWA 1RZ3A 5F2OA 3SXUA 1ILWA 2QUIA 4RETA 4Y6OA 3KKKA 1SVNA 1RJDA 2GFQA 3FPBA 4GT1A 2P6PA 1DKRA 1JKJA 1V2GA 2OG1A 4TTRA 5CJ2A 1OYWA 2W0SA 3F8SA 2NZWA 3ICPA 3JQ6A 5KYWA 1BDHA 3R77A 3QH4A 1L3IA 2DUMA 2GBCA 3W4JA 2G28A 3LUFA 3ZS8A 2XDAA 4X8HA 1CPYA 4PRKA 1W2WB 2XB6A 3C98A 4IFEA 1GILA 1E1RA 2WV7A 4ZYXA 1I3MA 4AWAA 1F9AA 2AA3A 1C9DB 2NSYA 3CR3C 3GBVA 4HS4A 4MQLA 4P80A 3K0FB 4BNHA 2EKBA 1EVYA 3C1AA 4RJTA 4RWZA 3TR5A 4BVHA 3V2GA 3BWEA 4BBJA 5C5CA 2ZT6A 2O7RA 3WMFA 1J2UA 2HDOA 3L0BA 2ODQA 4GPBA 1S2NA 3PE4A 3RHSA 3L1HA 4A4DA 4CIWA 5KSPA 3DEIA 1E5TA 1RCFA 1YDHA 3DEJA 3HGTA 1F4VA 4FQ7A 3ZXXA 5HKBA 1YKFA 1U9YA 1ND6A 4TMZA 3V80A 2EARA 2E9SA 1UPCA 3AJDA 3V7WA 1RS0A 2JI9A 3NBKA 3F9IA 1W5EA 3OHMA 2GEBA 4MJLA 2GZDA 2ZUSA 4ISCA 4F3CA 2EIXA 4YCDA 3L0YA 1WQ3A 2H51A 2JFXA 2Q3BA 1RI2A 1PJ4A 1EJ6A 5TXGA 3R6DA 4DA9A 1JYFA 3C39A 3CW9A 2IYAA 2WWHA 1NG9A 3RS9A 4A92A 1M67A 3D7MA 3MZ0A 4RLHA 3U4QB 8OHMA 5IDWA 1P3JA 1P4HA 2ZRGA 1PQ4A 2AF4C 3HYLA 3R76A 2ZZNA 2HNAA 2VHTA 3B6JA 3ZLTA 1MVLA 2I4TA 3GJ0A 1RYBA 2FZLA 2Q2WA 2Q62A 3DMGA 3BJIC 1JIVA 1IMOA 4RFSB 3IJPA 4AL4A 4MA4A 5KHLB 3PJRA 1MJGA 4PRZA 1EJBA 4X63A 3IUJA 2C07A 2H08A 4YRIA 1JKIA 4V39A 7YASA 3G9ZA 3IP7A 2P91A 2PHZA 4Y2HA 3IXLA 4F4DA 1X2BA 4G6ZA 1EM8B 2NXWA 5T6BA 3SHWA 3E35A 4YT8A 2PFSA 2YVAA 4BXOA 2R62A 3AR8A 3W9UA 1MG0A 1GPH1 2HDWA 1XRQA 1FSSA 4BB5A 1FDSA 5FP0A 1U2EA 1VE1A 2DFPA 1T8SA 3ZCXA 3GHYA 4UCXA 1YCDA 5AM1A 3WADA 3B7WA 3UBTA 5HTOA 3I37X 2OGZA 4KR0A 4NNJA 4QAJA 4S35A 1T2VA 3IO3A 3OE4A 1SXHA 5TS3A 4JL5A 1YZLA 1E6MA 1R3DA 2C5FA 4C21A 5BSHA 5IULC 2G0AA 3E5NA 4HO1X 5AHKA 2HO5A 1O94D 1FPQA 1A7KA 3UWSA 1KI1A 1NPYA 3B3JA 3C5EA 1LY1A 4NCKA 1C3VA 2V6BA 3GVPA 1Y5LA 5I9SA 3VPXA 3ZWKA 5A6VA 2OBMA 3AB8A 1OF1A 1Y37A 5GVRA 2WF9A 4BKRA 5BMVF 2ODEA 3PXGA 3QFCA 5L4LA 2YV4A 4OHRA 5FHRA 1CJCA 1FS5A 1FSGA 1EE1A 2REQA 1L5FA 1Q12A 2XE7A 3N05A 3PWKA 4Q05A 5ER9A 2CE2X 3SK0A 4DJAA 4FQ8A 2GETA 1YS6A 3F4BA 4Q3LA 1KERA 1N77A 3VA7A 3TRIA 5F7JA 5BR1A 5CLGA 1D2MA 1OZGA 2HA2A 4FTWA 4Q4HB 2YZGA 5FCDA 5CTJA 1KI8A 1MORA 5SY6A 1PVOA 1UM9A 2H2IA 1RLMA 1KK1A 4BVJA 2EERA 4JVNA 1KL7A 2WAYA 4BLRA 3PNPA 5JISA 2VJLA 1P1KA 1I4OA 1U2DA 3CVYA 5HGJA 1QZTA 1T6YA 1USGA 1IE3A 1BCSA 3K2IA 1XVUA 2QAJA 5CYOA 2PPVA 3MS4A 2Q07A 3O74A 2D2VA 2QUHA 3WGYA 3L07A 5AI8A 4X7MA 1BXGB 5ADWA 1NX9A 5F76A 2HEIA 4JNCA 4GMGA 3E3MA 5KS2A 1SBQA 1VJRA 3K0EA 3SHFA 3QENA 3VR5H 3DLHA 4NF2A 1J2EA 3FFXA 5KEIA 2EWMA 2V58A 1ULTA 1G20B 1YDEA 3OWOA 1E5QA 1M1XB 1Z3CA 1ZKDA 3BK7A 1SN7A 3GA5A 3IMGA 2VUSA 3EGWA 4KQXA 4QBGB 2QLMA 5FTJA 4DQ0A 4YRKA 2H1IA 4S24A 4X20A 2XGSA 2JLWA 2GOYA 5AKJA 1A9ZA 2P77A 1N33B 5CLJA 2JRCA 2O3QA 5CDFA 4OHVA 4QPDA 5DCWA 2VEOA 2CLHB 2YOHA 1WF3A 1OH5A 3AESA 4HGOA 1V43A 2B61A 1LDNA 2WILA 3PGLA 1SUIA 2IV3A 2X1LA 4YJFA 1Y1PA 3DTVD 1VKNA 4LN1A 3V2HA 1H4QA 1P0FA 4JZKA 3TNYA 1FYDA 4LOLA 5IJXA 4JLDA 4CR8A 3RKRA 2EATA 3DAOA 3FKQA 3HSKA 3ME5A 4B31A 2II6A 3IMCA 4D9GA 4GM1A 4EEXA 5YASA 1UT8A 1EXNA 3C85A 1ZESA 2H4FA 5EHQA 4HLNA 4R2LA 3ANLA 4D9EA 2B5VA 2XE8A 4LDZA 3DJFA 4C1BA 4FI3C 2Q1TA 3KIPA 1PJAA 3VO8A 1P3DA 3EQ9A 1WULS 2X5XA 4NMMA 4PX2A 4LF6B 1PJQA 3DOFA 2FSHA 1DFIA 2DHEA 2QR2A 2WD7B 3KYCA 1OWMA 1FMFA 1U2SA 1XTBA 3IKLA 2G9RA 2N42A 2O52A 3KPUA 4OUDB 4X60A 3V1KA 5DNCA 4MI6A 2CD7A 3USZA 1KHTA 1Z4IA 3WGUA 5KJFA 5G4KA 2QP9X 2RGXA 4JUBA 3SIRA 1VMEA 3I2FA 1J8VA 3QBTA 2FZGA 3RAGA 1O96A 2Y92A 4D44A 4BQRA 1RQNA 1RNLA 3GRZA 3MJFA 4IMIB 3VUEA 5KYKA 3A1NA 2E2WA 3RVJA 4BLVA 3EMKA 1ZRNA 2KWIA 2O8BB 1KOFA 3ET5A 4QFBA 3CTMA 5CYPA 4QDJA 2BBOA 1IN4A 2TYSB 4P5EA 3WRXA 1BFDA 3U3DA 1HRDA 1R1DA 2HMTA 4GLBA 4LNUA 4CM9A 1IHPA 1XDGA 2YQ5A 1OA0A 5TDHA 3ZCTA 1UM9B 2AQKA 3FMOB 3AO0B 1NBAA 1BVYF 3VM6A 3ORRA 4YDQA 3B48A 5IVPA 1L4BA 1XZAA 3GLFE 2IZ7A 3DPUA 4AF8A 5AJHA 1S02A 6ABPA 1H2XA 1KS9A 4O2AF 4PLVA 1V1MA 1X94A 1UKZA 3IEXA 5IT4A 3FSGD 3IIMA 3MT9A 3O26A 3AM4A 3INTA 3FKSA 1Z2CA 3FAZA 2C57A 1W4LA 3P0FA 3T3OA 1A5AB 2V03A 4A0GA 1WU7A 4OL0A 2H4WA 4L8VA 3M82A 1XZEA 4R16A 1N6OA 1BX3A 1TMOA 3IQGX 1A9RA 1E9EA 2WHRA 4EOGA 2HV8A 1MMFB 1PEAA 3KVOA 3PEFA 4EKDA 2IZ1A 2PMCA 3ES9A 2WHQA 3GFFA 3LXXA 5EMMA 4DXDA 3AF4A 4LOHA 3VSAA 4B4WA 4DVGA 4EDFA 4O59O 2E5FA 2P2NA 2OCLA 3AESB 1E1RD 3CSDA 2W48A 2DR3A 4YWHA 3U4AA 1Y34E 2GK6A 3BCRA 5DGDA 2W4IA 2FHPA 2BY4A 3GDOA 1DTWA 3QWHA 4S1PA 4U1RA 5DXAA 4XVCA 4D26A 1AKWA 2B4YA 1Q6ZA 5BSGA 1KI2A 2C04A 2DT8A 1GSOA 1S01A 2HAEA 1LDGA 2BGJA 2JBAA 1NJ5A 1T4CA 2PQ0A 1A9YA 1SHZA 3BWYA 3VZRA 2E21A 3KZCA 1H9AA 3WWPA 2ZUFA 3WLHA 3FCEA 1UJMA 3EEBA 2OZEA 5HCNA 3SJUA 4JCCA 5F4BA 3RROA 1M7HA 1RQ7A 4ZU3A 3H5AA 3QFTA 3UFXB 2FWNA 1FUKA 1DT5A 2IYQA 3NX4A 5HE9A 3ESCA 1QO7A 3F0TA 4QXQA 3I1IA 2O2HA 5MFZA 1SCKA 3CH7A 4FFLA 4XLLA 1O5OA 1IDOA 1IVSA 1QR6A 1Q0LA 1RW4A 3A6HA 2OFWA 3EN0A 4GMFA 2WDZA 3LBFA 3HWRA 4XQCA 1JIJA 1T4BA 5EZQA 3WTBA 4S04A 2Y2UA 3W8NA 4MUJA 2PFGA 4MLCA 4JBYA 1KK0A 4MZXA 1TGYA 1HK7A 1S9HA 2OGSA 2V8BA 4YXWA 1O6FA 1KE1A 4EUSA 5AVUA 4NZYA 2ZYIA 3BUSA 1S8FA 4ACAA 1OX4A 5TPWA 4EUNA 2CHUA 4WLUA 1Z12A 4RA6A 4YV0A 1XQVA 1GL7A 3H8WA 1WXEA 4R8SA 2IXTA 4KRFA 4RV9A 4N5MA 5F9MA 4ZEMA 4FS3A 2H07A 4WHMA 3IP6A 2Y9PB 2CNKA 3EXFA 2GSDA 1KR2A 1GO2A 1N4AA 4QBKA 5AICA 5I8PA 1EX9A 2GVNA 1V1MB 2IFTA 3D6TB 4Z49A 4JI4B 4YK7A 2G09A 3BM5A 4I9GA 4B3HA 3PL1A 5LDDC 2YW9A 4K2AA 4D02A 4EJ6A 3HN2A 4UBJA 3ACDA 1R8SA 5ILOA 3C4QA 2ZIXA 1GAWA 1T1EA 3GX1A 3VR3D 4Y2XA 2GF9A 1U02A 4CCWA 1Y48E 1L3CA 4Y0VA 1DAGA 2IUEA 2WHXA 3MJCA 1GKKA 1LQTA 2I54A 5CU7A 2RAFA 3ZE9A 3BYZA 2YWCA 5BQ5A 1E9VA 1N3BA 1FDUA 1PSDA 1P1BA 5AW4A 3ERCA 4BNNA 2QDXA 4B82A 4MKFA 3NHSA 2IUYA 4L76A 4MV5A 1SAYA 4GX5A 3TOCA 2BMAA 4J7AA 4LZAA 4NBUA 2RHWA 3AKEA 3GFRA 2QZ9A 1EGMB 4KLRA 1C3JA 1GQYA 5KYNA 1WZ2A 1DTWB 1T10A 3GNQA 3JQAA 3NIFB 4R8RA 3UAGA 3MLAA 1Q83A 4FN4A 1X39A 1T25A 1VBKA 3PLRA 4WEOA 2NUBA 4XVRA 1PVDA 4KN8A 4MV6A 5AKLA 3QEMA 4BMVA 2JBAB 1T4CB 2ZYWX 2BGGA 3WQQA 1U2QA 1VL1A 4HNAA 1GU1A 4RNDB 1X87A 4R31A 2VK1A 4J1NA 2DGDA 3S44A 3R5SA 2QW8A 2G8NA 3OSZA 4RK6A 5DBEX 3TIXB 3LLSA 3BFXA 5ED0A 1JBKA 3ZHVA 3EGDA 1IWBB 3P71T 4XWGA 4QLBA 2HXYA 4AUNA 3TMAA 1H22A 4RKFA 4D3ZA 1HFJA 3R8CA 2M32A 1LDEA 1WMSA 3EGCA 4XDZA 4Y1EA 5E8RA 3C5CA 4D5GA 4BO0A 1K7SN 2ZKLA 4Y6SA 3TEJA 3ZE1B 2IBTA 4MRSA 4LXTA 2XZLA 3CLHA 4HPJB 1JQ5A 4ARUA 5F9HA 3DBRA 3CFYA 2AFVA 1V3UA 1H3NA 3PXCX 2ANBA 2EJUA 3R5HA 4ONEA 2JGAA 1V9SA 3HE3A 4V38A 3BXZA 2NXEA 4Q1AA 2Z56A 5TPWB 3TPFA 1RXCA 5HOQA 1T4GA 1D9ZA 4GU5A 1EHIA 2ACVA 4BKOA 10MHA 2GM3A 1Z63A 3IIJA 2PAFA 1J20A 2QM8A 3IBGA 1DOZA 4FYWA 2C5HA 1KEUA 1R6VA 1X7GA 4HAUA 4M87A 1A2QA 4A2WA 4ENUA 3RF7A 1EFHA 1E89A 2J4CA 3O1HB 1Z7WA 4BJHB 4GC9A 4GUDA 3HTXA 1T36B 1QQ5A 3ZD7A 4EMSA 4ZO6A 3TIGA 5HJEA 3L84A 2GQ0A 3HKBA 4PG4A