3C2AL

Antibody fab fragment 447-52d in complex with ug1033 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
216
Chain Sequence
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVLWYQQFPGTAPKLLIYGNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYFCATWDSGLSADWVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 447-52D light chain
total genus 47
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c2aL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c2aL01
4UDTB 2G9HA 2BOBA 2BNRB 4OCLC 5C0BD 4XHJD 1JPGA 1RIVL 1D5ZA 4P4RB 4PY7A 3FRPG 1J86A 2X4RB 3SO3C 4LBEA 5D70L 3V6FA 1J8HA 1F4XL 3WSQH 1M6OA 3LQZA 2OMBA 1K6QH 3QXDB 1BHGA 3OXRA 3QFJD 1CXEA 3EOAA 1F4HA 1MLBA 43C9B 4Y1AA 1CLZL 1RU9L 4YX2L 4OLZL 3MV8D 1TTGA 5AAWA 5T5NF 3V6BR 1BQHB 5IESL 1S7RB 5CEXB 4R0LC 3G5VA 3LKSA 4XNUH 1FO0H 5BS0E 4OZIB 1GGBL 2N7BA 4G9FE 4S1RL 2GKIA 1G7LA 1ZHLB 1RJLA 5B8CA 2DWEA 4PJDA 5DFVD 1FRGH 3SQOH 5C86A 4PRHB 5C08A 5I17B 2W38A 3VMOA 5IB3A 2IGFL 1L7TH 2Y36H 4OQTH 3ZTJH 4Q9QH 3P4LA 1YMMD 4ZSOB 1HHJA 3MCKB 2EE2A 4AMKL 4JCMA 3D3VB 4ONFH 2AXGA 1BZ7A 3IFLH 5ESVA 4P23A 1NC4B 3RDTC 5MP6L 1KLUA 1YN7B 4ZPTB 2CDGB 4WI7A 4QT5B 1ZTXL 4OIIH 3H9YA 1BM3L 4ZXBC 3KJ6L 5J13C 2JF1A 2MQCA 1AFVL 1IVLA 4ZTOH 4YGVA 1J10A 1T83C 4NRYB 4XP9H 2PO6A 3M1BB 3WKNA 1GSMA 2XNAA 3VXRB 3CDYA 3K3QA 4WHTB 5FHBL 2R2BA 1RZIB 5D6DC 1T4KA 1HDMA 2FEDC 2J6EA 3HG1D 4CN6A 4U3XA 1NL0H 4NGHH 1F4WH 1IQDA 1AGCB 1ZHBB 2EYTA 3CX5K 2AK4D 4YDJA 2CLVA 2C4FT 1Q0XL 3U0PA 3FN0H 4F57H 4Y2DD 4PLOB 4BSVA 5E9DE 4LIQL 5C6WH 2W60B 5I0ZA 3GNML 5F7EL 4YDKL 1T22B 4Y4FA 4JFFE 1A6ZA 5EO0B 1WGOA 1G6RH 3IAGC 1TQBB 1BAFH 2EDKA 4KC3B 5DEZA 1OSZA 4POZC 1XF2A 5D70H 2UY6A 1W0VA 4UDTA 1CDIA 5C0GA 1ACYH 2Z4QA 3DUSB 2X1PA 4R7NA 3RPKA 4I0KA 2GY7B 3KPQB 3RVTD 2K7QA 4KKBC 2EDEA 5LGHH 3BRDA 2HKHH 4WNQB 4JDTH 1X5XA 2V6HA 1DEDA 1IKNC 3DYOA 1DUYA 3EYFA 1YMHB 5IOPA 4HMCA 3OKYA 3SE3C 1FNAA 1SMOA 5IFAH 2AJZA 1BZ9B 3V6ZA 1WCBA 4RGNB 4EIZC 3HZVB 3OKDB 5D1QC 1EMTL 1MAMH 3VRIA 5D71H 1H0DA 1FQ9C 3HE7A 4HWUA 3B5HA 3O2VH 4U1NB 1A3RL 1YPZB 3QIWD 1MVFA 1CICD 3MLZL 4PTUB 4WO4B 3VXNA 3VFRA 1DBJH 1RPQA 3RHWF 2MKLC 2A38A 4POUB 3TT1L 2NR6D 4JKPH 3MUGB 4PJDB 1PY9A 3MRMB 3LZFL 3DUUA 2BX5A 4FQ2H 3CDFA 4N8PA 2CQVA 3X12A 3QWOA 3TPKA 5JO5A 3PWNB 1C5DA 4H8WH 3U9UB 1NH6A 3AS3A 4ZNEE 4UOW1 4Z6AT 1EO7A 3IU4L 2PTTA 5IP4A 4MNQA 1CTOA 2C3VB 1A2YB 1P7KA 3IDXL 4JHAL 2IADA 3MJGX 5T3XL 4OFYA 5BZDB 5EZLA 5F1KC 1GGUA 4HGMA 2FX7L 5CJQH 5D2LB 3KYAA 4QHMA 5I18L 4MS8D 5ALBL 4E5XB 2EIZA 5ADPH 5B39G 3B2UD 5DQJA 2YEZB 1YEJL 2AV7B 1CBVL 1HDMB 1L4IA 2BFVH 5DC0A 4M8VA 1QG3A 4LVHC 3TN0A 3V8CA 5IQ7H 3HA0A 4OZFH 4YDJB 1TZHA 3EDKA 1BREA 3C6LA 1PBYA 4HK0A 5JIKA 4RAHA 5C2BL 5IB2B 1IM9A 4P3CL 2WW8A 1I9EA 4JPKL 1M71B 5DVKA 5IB5B 3NGBC 1UCBL 1LGVA 2AXHA 1F97A 5F88B 5DA0B 3WIFA 5IW1A 5FDYA 3F12B 3L7EB 5KG9A 2VSDA 1U95B 2DDQL 3BKCH 2HLFD 1MCPL 2DN7A 4YXHL 4XPBL 2NXZD 3DTXA 1FIEA 3DYMA 3MRPA 4QRUA 3AVEA 2E7HA 4FFZL 4MNHA 3Q1SH 4LF3A 4M6MH 3V4PL 3WN5B 3OB0K 5KSAD 1P1ZB 5L7XL 1HINH 2A2QT 2IG2H 2YD6A 4F7MA 3KPSE 1TJHH 5HGHA 1U8PB 3OKDA 4H88L 3T2NL 3HE7B 1MFCH 2VE6A 3LRSA 3K2UL 3MUZ1 4PTUA 4YXLL 1KEMH 3I6LD 5ADOL 1AHWB 3BKML 4XBEH 3DXAD 4RMWA 2EE9A 3WJJA 2HFTA 2ICCA 2EKSB 1PSKH 1VFBA 3BEVA 3QT2A 1I7UA 1MJJB 3AGVA 2QSCH 4XC3H 1Q8MA 1NDGA 2OQJB 4JZNB 4MA7H 1FYTD 4ZUSA 3QUYD 1AY1H 3UTSA 4N0CC 3T0XA 1OAKL 2YD3A 2DLGA 3MGAA 4OGZA 3VA6A 3OKLB 2VRAA 4HAFA 3T4YA 2ENYA 4MJ2A 4U1KA 5F9OL 3V6OC 1F3JA 3T2QA 3MRJB 4CVZB 1JNLL 2NY1C 2DQDL 4XZUB 4J3TA 4ODVL 1ZV5A 4WO4D 2YD8A 4ZTPH 4XGZB 3F62A 4X6CE 3ZYIA 5A40E 4NO3B 4OLXH 5DMIL 5JMOC 3O3EA 3R06A 2ZNXA 1MIMH 1V5JA 1KELL 2QQQA 4TPRH 1OW0A 5DZNA 4B50A 4DN3H 3QO1A 1AXIB 5I16B 2A9NL 4BELD 2OL3H 4LGPB 1CLOH 1NUGA 3GJEB 4RGNE 1GIGL 1KENH 3NGBB 1XCTB 2DMKA 5D7JA 1BQSA 1H3PL 4AENA 1H15B 4Z8FH 3RWIB 3WEXB 1LE5B 5D7IB 1JPST 3K2MC 2IAMA 5I75B 4PJGF 1I3UA 3WIFB 3CVHH 4G8EB 4XP1L 1I1AA 1V7ML 1J8HE 1XH3A 3RIFF 5F9WC 1CGSL 1DDHA 3MUY1 4G5ZH 1IBGL 4RGMC 3QWRA 4MAYA 5A2LH 2OZ4A 4KRNA 1FORH 4K23H 1JTOA 4CU8A 3WN5A 4XMKH 3VXUA 4XVUC 3QDME 5GGVH 1S5IH 2JCCE 3ARRA 1EO5A 2GEEA 2VXUL 3MRRB 3EJZD 1J12A 4X9BA 5IFJB 2DQTH 1NL0L 4WWID 1XR8A 1G9NH 2VZ3A 4NIKB 4NKMA 4YHYC 1RZJL 5JW4M 4UIKL 5GGSY 2EC9U 1U8KA 2BMKB 3V5KA 2LAGB 3BKCL 4BUGA 3FRUB 2UYLB 5IB1A 5EWIH 1M6OB 3UTTB 4EXPX 1XGQB 3G6DH 5CD3A 5I19H 3EOAB 2XYCA 5D2LE 3V79C 4G7VH 4OCRL 3GM0A 1QR4A 3ULUE 1NC4D 4JJ5B 2A0LD 2NXYB 3D3VD 4BSWB 4NQUA 1FL6B 3QIUB 4JM2D 3MBEC 1RD6A 1RFDH 5L7XH 4JEGB 3VE0A 3NPSC 2DQDH 3QO0B 5ICYB 3ZHDA 1A64A 1D5BA 3RNKA 1IGYB 3AS0A 3PWJA 1PKOA 2KKQA 1NBVH 4LASL 1UXWB 4QRPA 2IALA 1CD9B 4N8VB 2DIBA 5DD5L 3OJ2C 3ZDXF 3R0NA 2EDBA 1JI2A 3C8DA 4J8RB 4O00A 5F97E 3RX5A 2QQLL 3MZGB 1KXQE 1CGTA 1N64H 2CDGA 4ODHL 4M7KH 2HYMA 4CMHC 3LDBB 4QRRD 3S3JA 1ITBB 1B4JL 1DVFD 5J6HB 4HZLA 1C16B 3MLSH 1ULVA 1F00I 1UWGL 3AM8A 3D1MC 2Y23A 4GUPA 2EDHA 5C0BB 3AY4C 5T5FH 4ZUVA 1ACYL 3BJ91 2ZOLA 3CK0H 4F58H 1C5BL 4Y5XB 3PDOA 2CLVB 5ACZB 4KI5F 2C3WA 2VDLH 3FQTA 3PV7A 3ZYZA 3MREA 2FECI 1HNFA 2D7NA 2W60A 4EN3D 2LE9A 5IVXA 5LXGL 4ODUA 4XXDA 2VDNH 5HPMB 4Y4HC 4OZIE 1FVDA 4F57L 1OSZB 5IFJA 4MAUH 2CUIA 3SDDA 4I1NB 1EAPA 4ZUTA 4QTHB 5E8PB 5CJOL 2MHAA 4GXVH 5C3TA 4YBQC 1FAIL 1NCCH 5F21B 4JB9L 2AERT 3TT1H 4NQXA 5KSVB 3WNKA 2R69L 3EOTH 3MCLH 1LNUA 4QXUL 4UT6L 1R3KA 3BOVA 2AJZB 3DARA 3OX8A 5ERWB 1T5WA 1RUKL 1ZK9A 4L1DA 1EVTC 4N9GA 4C56D 4LPWA 3DURA 5INDB 2IJ0C 4XC3L 1ZEAH 1I1RA 2F54D 2LU4A 5I2IB 4OZHF 2DM4A 4Y19B 4C56A 4M9OA 4OZ4A 2BNQD 4PY7B 4AIXA 4LSUH 4I3SH 1AFVH 3VFWA 2EO1A 4N8VA 1C12B 3ZDZE 1BJMA 3S3SA 3BESR 4K94L 1JYVA 2X09A 3F6LA 1KTLB 2VDKH 1J8HB 3LCYA 1OAUH 5JW4N 2FCBA 1NFDF 1QZ1A 3U9UA 9CGTA 43C9A 4Y1AB 3OPZH 5ANME 1N8ZA 1TMCB 3MJ7A 2GK0B 4M7LT 2G2RA 4NN6C 3FOLB 4JFQB 2IADB 2WBWB 5EO9A 1VFAB 4O02L 4NP4L 4KDVA 1XGYL 3K8MA 3QDMB 3WFEH 1QPPA 5CKAA 4M6NH 3BPOC 3O2VL 2KL6A 4HK3J 4BH7B 1P84J 4J23A 5C71A 3CZFB 3AREB 3RAJH 4OCWL 1NBQA 4IHOA 3DRQB 1OPGH 1P69B 2EZ0C 1AKJB 2VDML 3RJDA 5JXEA 4KVNL 4LSQL 4MNGA 1VA9A 35C8L 4J4PC 4ENED 3RTQB 1I7TB 2NLJA 4YHIB 3QAZB 3BH9A 5E6ZA 3RVXD 1J11A 4MDJB 4CRPA 1HE7A 1BWWA 3SBWC 3ALXA 3PP3K 2UWEF 3MV9D 2NY3D 1KJMA 3OZ9H 4ESKA 2VLME 5A3IC 5KAQF 3VXRA 4LF3B 5F7YC 1AGDA 5IBLC 4P3WA 3FB6A 3L95B 4OKDA 4D9QD 1HCVA 3IAQA 4EI6A 5HYFA 1ZHBA 5AWNL 3MXWL 4NHCH 2APFA 2NY0C 4PJHE 3UYPA 4TTDC 4HCRA 5HGHB 4NSKA 1G9NC 3PGCA 4Z7UE 5DJ8A 2F74B 4FG6C 3W39A 1A1MB 3WL9A 1ZGLA 4FQQB 3ULUC 4WV1B 4KVCL 4NZDA 2IC2A 3RBGA 4R8WL 3Q3GA 3RY6C 4JZOA 1URLA 2ZUYA 3TBSA 4DW2L 4JM2A 2DYPB 3E3QE 3QI9C 3RPIA 5C0JB 4AEHH 1QKZL 1XIWB 4NN7B 4P57A 1A3LL 5TDOA 3VFWB 4K3HA 2PYFB 4RWYL 4O2CB 4ZFZA 4AMKH 1ED3B 3CFCH 4RGOL 3HI5L 5HGBB 3SO3B 4LEXH 2H2SC 4K3DH 5LQBH 3O3AB 4KWUA 1JF6A 2IBZY 3UPCA 3OKLA 3W5MA 2IPKB 1NC2A 3QI9B 3OMZA 5DI8A 1N8ZB 5D2NA 4NQEB 4IDLA 5EUOE 1IGFL 4HH9B 4K7FA 2FJHA 4KI5E 2KBGA 3MRCA 4F3FB 4NKIL 2VTFA 4H88H 1RUPH 2AP2A 3S35L 1MCSA 3CGTA 5E2VH 5DQDL 3VH8G 1B4JH 3RWFA 4JFHD 4NO3A 1CLYH 3MUGA 5JIPA 4JREC 1EEQA 3IETA 1WTLA 4NO0D 3HR5A 2YD5A 2YBRA 1WF5A 1RZFH 4XPFL 3L3KB 4TNVK 2BVUA 2ESVB 4JVUA 1FAIH 1NCCL 3QHFL 2XN9B 3NAAL 2AI0H 4FFZH 4MSWB 1HIMH 1ONQA 3GMOB 5F7EH 2QEJA 1C5DB 2FL5A 4FQIH 1D6VL 4LPUA 5CP7B 3WD5H 4HD9A 1I1AD 5E94B 1CFVL 4ZAKD 2C3VA 2IAMD 3B9KC 1XH3B 4KJWC 5TE7H 5IMLB 4WUUE 1DN0A 4N0UA 5D7JD 1RAMA 2YUXA 2ADIB 4PG2A 5D2LA 4AEIL 5TGBA 4PUBL 2R2CA 1KJMB 4OZIF 4J3SA 3PP4H 1N2RB 1QSEA 5AG8A 1MCBA 1MCHA 1XCQB 2MFNA 4X4XB 4DFIA 4IDJL 4X7SL 1KC5L 3MRLB 3CUPB 2D7TL 2XIDA 3X17A 2FR4A 4F9LA 4Z7UF 4Y8AA 1Z3GH 4U6VL 1ADQL 3QUZD 1P9MA 2ATPA 4HSQA 5DJ8B 1H8OA 3QHTC 1MHHA 3G5XB 3DV4B 2X89D 3L3OA 3GSOA 3MFFA 2VZSA 1MREH 4GAJH 2UYLA 3NA9H 3WIIL 1G9NL 2GHWB 4LPTA 4P59H 5HI5C 3C8KA 2EIBA 5E4IA 4NZTL 3HE7C 4G43A 4M48H 1P1ZA 2NY6C 3ESUF 5DT1H 1EBAA 3DXAA 3PL6B 2AGJH 4HJJH 2EDYA 4F7MB 3TIDA 4FXKB 1I4FA 4HIJA 3GBLA 3NCBB 4Q6IB 1ETZB 1A7OL 5TF0A 1U42A 1KCKA 3QDJB 2IFFH 5IGXH 1G1CA 4KY1H 4AM0A 5KSBF 1NMBH 2QBWA 3FL7A 2EO9A 1CVSC 4Z8FL 5ANMB 2ITCB 3T1FB 4GAGH 5D8JH 5JR1L 4J8RA 4J3XA 1DBKH 3IETB 1FZKB 5LGHL 5I0DA 4F7CA 1FNHA 3ULUF 1SHMA 2HLAA 4Y0GA 3C09C 3L3KA 3VW3H 4Y1AE 5FYLD 2VLJB 5DHVB 1WWWX 1LK2B 3DMMB 4GW4B 2NX5A 1MPAL 2F19H 3TJHC 4LAJH 3B6SB 3JTSB 1A7QH 3VWJD 3GSNB 1U91A 3NIFF 5HGAA 2BVQB 3RUGE 3C6SA 4H25B 1HXMB 1M7DA 3LKRB 1RHHA 2BSRB 5L8KB 1IM9D 1QVOB 4OLYL 3KLHD 3CSYB 5C0AB 3LS5H 3JUYA 3KYKH 4AG4H 5BV7C 1FZOA 1S7VA 3MREB 4LCWE 1F3RB 4XVJH 4X6FA 5DGQA 1XCQA 1NCDH 5MP6H 2UVFA 3ZYOA 1F02I 3HRPA 5IW6B 1S3KH 3PWLA 1A22B 1IGJB 4G80A 2N4IA 5HPMA 3HUJE 3TV3L 3QRGL 4NZUH 4G8GA 3W5NA 3GRWH 2R1WB 4URTB 4XP9L 1EAPB 4ZUTB 4LSTH 4K9EL 4QTHA 2NZ9D 4O9HH 1LE5A 1BLNB 1AKJD 5HHQA 1I1AB 4Z0BH 4PLJD 1SM3L 1YNTA 4O5LH 3G9VA 5FUZH 4C56E 5CLWA 4OFKA 4EDXA 4PPTA 2H41A 1DBJL 2JJSC 1Q9KB 1RZGB 3NIGF 4XBPA 1EIBA 1YZZA 1I9JH 3QXVA 1ZHKB 3ETBF 2E6PA 5B38A 3QHZL 4Y19D 5T3XE 5C09D 4DGIH 3ZL4L 4K71B 3IKCB 1JZ8A 1VKXB 2XZAH 2MQ0A 4FQJH 3HHRB 1YECL 3VXMA 1FN4A 2VAJA 3SEPA 3QIWA 3RZCC 2OLDA 4NKMB 4U6VH 5ISZB 5FYKL 3ALPA 1PKQB 2VXSL 2ZJSH 3GKZA 4LK4A 2PXYB 2CKNA 1GC1L 2GJ6E 1I7RA 2NXYC 4GH7B 4QTIH 3OGCB 3MUHL 4S1SH 3BKJH 3T0BA 4L8SB 4EKXA 1PG7L 3GEWB 3QUXC 5MENB 5FO7B 2VLKD 1SYSA 3FMGL 1P7QA 2G2RB 32C2B 3FOLA 1X5JA 1IGIL 5D2NC 1HILA 5JDSA 1LHZA 4MB5A 3MA9H 4S11A 4OT1H 3QQ4B 4F7EA 1EGJA 5K9KB 3GRWA 4KGJA 2C1OB 1RIHL 3B5GA 4HIHB 2BC4B 4DWHA 4QWWD 2PYEE 2QSVA 3V4VH 2J7LA 1IAIH 1L9MA 3AREA 2IBBA 2GSIB 4FG6D 3ARBC 1RHHB 5IV2B 4PJXF 4DVRH 5HSFA 4JREB 1MFDH 2CRMA 3CSYA 2AK4A 4G9DA 1W8OA 2FWOA 1QSZA 1AO7A 1CFTA 2XA3A 3O3UN 2KH2B 3RAJL 4X4ZA 1DLHA 1OAUL 4NDMB 5HJ3B 4NQDA 4A2MA 3B8SA 1G84A 4OLWL 2ZG1A 4XWOC 5DS8A 5BRZE 1CXHA 1KJ2A 3IKKA 1D5MB 5CEYA 4TNWF 5DRXB 1D5XA 5E4EB 2VUOA 5HHQB 3A6CH 1N6QH 3HFMH 4Q9RL 4EI5B 4PLNC 5E8EA 4H5SA 1NGZA 2HJKA 3EOYG 4EDXB 2WBJC 4HXAH 5KSBB 4H26B 3OB0H 2HH0L 3WFHA 5FO9B 3LZFH 4Z76A 1OY3B 4NSKB 5D9SA 1AQDA 1YECH 4JFXA 3DOSA 1PSKL 3BYYA 3P4MA 2IQAB 1H8NA 5FECA 3MJ9H 4QHNB 1OB1B 1HYSD 1BX2A 3IFNL 2NY2B 1FL5A 4UMGA 3BGAA 3KWWB 3TBSB 4TUOB 1F6AB 2A77L 1EEYA 1AXTH 2DYPA 2MHAB 5J0BA 1TFHA 3KLAB 2Z8VC 3IFOB 1DEEB 3BE1L 2W92A 4XCCH 3CPLB 1KCUH 3U6RA 1GGYA 4DCQB 2D31A 1LNUB 4MQSB 3QUXB 3FO1B 5E2UH 2JK5A 5IBTL 4GBXA 5DLML 5FO7A 1SYSB 3K8KA 4H0GA 1UB5A 3OG6B 4P4KB 3RKDC 3SE9L 3RWJA 5JDSB 1F4YH 4KRMB 5JHDA 5SV4A 1AO7D 1UM4H 3L3IA 4JFPA 5D71L 4YHML 2QQNL 1DL7H 2C1OA 4HIHA 3VA2C 2A6KB 3HB3D 4PJGE 4RA0C 3CFBA 4F7TA 3ARED 4LNRA 1SEBA 4YNYB 3IJHB 3TFKC 1G7QB 3G6AB 3S5LA 4R26L 2FIRT 1OGAD 2K3TA 3ZKMC 3MODL 2FWOB 3KPPB 3BKJL 4KY1L 4ZXBA 2I26N 3PF2A 4TRPH 1KFAH 4PJAA 2VYRE 3WJLC 5C0IA 4JFQA 3GSUB 5E5RB 1TCRA 5CIPB 1PX3A 2ADIA 2CGRL 4WFED 2X4PB 5K33A 2HT2D 4K7PL 5D5MB 3O45A 2BK8A 3CX2A 1RMFH 4APQA 5JIHA 1QSEB 3U7WH 5CJ5A 3MOBL 3RIAF 5E08L 5DMJB 1RI8A 2I27N 1O0VA 1I7ZB 2VLRB 2X70A 4W70A 5CGYC 1YEEH 4YHPB 1U0QA 2BY2A 3MYZA 4XCYB 4XAWL 3DSFL 5A2KH 2L7UA 3FZUC 5DUPH 4Y16C 5DVMA 1ND0B 2D4FA 1V3LA 1PW3A 4JQVC 4X9HA 5FECB 2Y72A 3VFMB 3ZE2F 1EVUA 1EV2E 1Z3GL 4TUOA 1B4RA 4LARL 5JXAH 5C0CA 3VGAB 4OCXL 1E0OB 3H9HA 5AZ2H 5F7KC 4Z0XB 1LQSR 3Q48A 1UH3A 5HDBE 4FQCL 3H42L 1DEEA 4EI5D 1I9IH 1OP3K 1KCRH 1BBJA 4OZHA 5KJRL 2H2PD 3NFSH 1ZLSH 2VDLL 5CBEA 5B3NA 5T1KD 1IAIL 1XT5A 2X4SA 2RJMA 4TSBH 3FO0L 4HUMB 4EUPA 3MLWH 3FHQA 3BO8B 4OV5A 1P6FA 4FXGB 3VGDA 1ZGLB 4HCRL 3IRPX 4FQQA 1AIFB 5FUCC 1IM3A 3CFDB 4KKAC 5K59F 4JFPB 1MEXL 2Z92B 3L5IA 4X6DE 5I1EL 2AI0L 2X44D 4YHLH 3PABA 4ELMA 1UH2A 1V7MH 2L4OA 3QJHB 3HAEB 4JM2B 4TSAH 4MQTB 4JLRA 1OHQA 4F9PA 4AIOA 5C0JA 5CGYD 2B5IB 2X7LB 1OQXA 2DI7A 4F15B 4F7CB 2XTJE 2CKBB 4M5ZH 4HXBL 3VI3E 2R15A 2VXSH 5IB3B 4GAGL 5JR1H 3AS2A 1X5GA 1JWMB 3QCUH 5I1IL 2VAAA 1EH9A 3B6SA 1YYML 1NC2B 4PJAB 2XRAL 2W0PA 4P23B 1JTTA 2SEBB 3STLB 2BVQA 4S1DC 1CT8A 2ZOKA 5MEND 4HS8L 1ZA6B 2XWTA 4M7JH 3SPVA 4HJ0D 2UUDK 3WHE0 2P4AB 4V1DA 3MGTB 2VOTA 4OZFG 1NUDA 1TVBA 2JTDA 4WUUD 2ORBL 3P73A 4MA1B 3KPRB 5FYJD 4P5TB 3C9NB 1QBLL 3PQYA 1JPSH 2KDGA 1D6EB 3B5TA 4ONFL 3MYJA 3KPOB 3HKFA 4RAUB 2X4OA 3S8WA 2VLLA 3QIUD 3U30C 1JFQL 5CZKA 4X5WA 4U7SA 4NP4H 2VDQL 1H3PH 2N56A 5TPWH 1YEKL 3C60A 4JANA 1A6TB 5E24E 5EZJB 4YQXL 3TBVA 4N0UB 4OD1L 3RX7A 4BYHA 2DM3A 4LSRL 3FAWA 4HGWA 2VZVA 2AW2A 4PJBB 2Q8AH 2FRGP 1JHTB 1CDBA 4LFHG 4OLYH 1UADC 5DEGA 1WEJL 2DLFL 4XPAL 5GSRA 1FCCA 4NFDA 4X7DC 1NAMB 5HI4C 3S36H 3VCLB 4HWBH 4PJ9D 4H0IA 1JHKL 5ESAA 5BO1H 3U7AA 4IOIB 1MCOL 4NM8L 4X9IA 4OAWB 5FGRA 4U3HA 1TVDA 1MI5A 1XF4A 1QLRA 3HZKB 4OV5B 4LCUA 1HZHH 2XPGA 4WW1A 3O2DL 1RIVH 3DV4A 1P4LA 5FA4A 4BZ1H 2Z92A 3MTRA 3OWEA 3P9MB 3PL6C 5EU3A 1I7RB 3VG9C 4YDLB 2VC2L 1QLEH 2VERN 5CZVH 5DSCA 3EJZC 1SBSL 5TFSL 5FK9A 4UTBH 3IXTA 2D0GA 3RJQB 3VDCA 3FO9B 2VDPL 4KMQA 4KJPC 4UIMB 1IGCH 1RJYA 4HQQH 3K2UH 4Q9CA 5K9JL 4XNYL 1I4FB 4HIJB 4Q6IA 3MNVB 5I1DB 1IEAB 2BC4A 4M7LL 4P23C 4KQ4H 1CTNA 1UWGH 4FMKA 3H8NA 1FVCA 2DDQH 4RQQB 3TO4A 4FXLA 4BSJA 3QDJA 5HY9B 5KVEH 2X6MA 3QQ3A 4QRTB 2VJXA 5LBSL 4DUVA 2WNGA 1A2YA 2ZUUA 4FTVD 4PTTB 1CWVA 4KDWA 3T1FA 4WJ5B 1IGTA 1CFNB 1T2XA 4D0CA 4NRXB 5GXBB 3C87A 1WZ1L 1QO3A 3V5HB 2YEZA 5KVMC 2P8LA 1WIOA 4MD4A 3IJYB 4NQDB 4Q74A 1W72B 1Q9OA 2ED8A 1IAKA 2HFEB 2CPCA 4U6TA 1LK2A 3R8QA 3T3PE 4XP5H 2VIRA 2C4XA 3Q2CA 3V7AG 3LPGA 2BNRE 4R96A 3OSKA 5DEFB 3VFSB 4K3JL 2G75A 2FD6H 4APQC 4F33B 3F8UB 3C60B 1A6TA 5DO2D 1A4KB 3FQWA 4ZFOB 2GFBA 3L7EA 2EE6A 5KG9B 3K81A 4YEEA 4QHLB 2I07A 1EMTH 1MAML 2HT4C 1K6QL 4LSSH 4WUUA 1MCWW 3IS0X 2W0KA 1Z6JT 4WHYG 2V17H 3EBAA 2E9WA 2VXTH 1U8LB 1KXVC 4G6AC 5HHNB 1NBYB 4IRJB 3CLFL 1FC2D 4LLUA 1EZVY 2JELH 3QUZB 5DRNA 3B43A 3TNNA 4R7DB 4PJDE 2XICA 1FZMA 3HZKA 1B2WH 1YEEL 1KNOB 1U8PA 3F7PC 3L5XH 4XCNB 2R0KL 1KLGA 3G5ZA 1A9EB 1BJ8A 5MEQB 3VXRD 2IF7A 2VE6B 1J8KA 4PUBH 4UQ2B 2OK0L 4ODWB 3MR9A 5GGVL 4JFFA 5DSCB 2ICWA 2R9HD 4NN7C 4JE4B 1F3DJ 4NCC1 4N1CA 1CLCA 4GBXB 3QUKB 1ZHKA 4KQ4L 4P4KA 5IQ9A 5FHAL 2H1PH 4BFIB 5E8OB 4KK8D 1FSKC 4CU7A 4C83B 5I66B 5CILL 3MV8B 4FMFA 3WUWG 3FCTA 3LEVH 2D4DA 1R3LA 5EU7C 2OK0H 1R5WB 3V6OA 5I76A 3QIWB 5KJRH 1T7WA 2B2XH 1KCSL 3OV6A 5J06A 4IS6B 4KAQH 3T3MF 2DWEB 1Q9LA 3GFUA 4TPRL 1MCKA 1P53A 4JO4L 1Q0XH 3SGDI 5HHOD 1GGIH 4GKSB 4L3EB 5F7HA 3T2OA 3CXHK 4D0CB 3HPJA 1T2QH 5GIRA 2YA0A 1KF9B 3N1QC 1OP9A 1CD8A 2DQGH 1IAKB 4OB5H 1A5FL 3ARFC 5D7JC 3UPAA 2QHLA 3QO1B 5DJCB 1X5LA 4L1HA 2VIRB 3CXDL 5DDHB 1F11A 4ELMF 1G0XA 1J88A 3AB0B 1LK3L 4R9HA 4JHWL 5GS0L 1CQKA 2ESVE 3RWIA 3WEXA 5D7IA 3F58H 2BNQA 2IH3A 2FATL 2GFBB 1XEDA 4FQ1H 4P3DA 1WT5C 1FNLA 5IV2A 5GZOD 2FJGA 1ZVSB 1KN4L 2OXHA 4CMHB 4H0HB 3WXWL 1HCFX 1TJIL 1CFTB 1RJCA 2P5WA 4ORGB 1F90H 5EN2B 4OZGE 5E4EC 1FZJA 1DLHB 1XF5A 2DLTA 3BKMH 1JBJA 1H9VA 3MV7A 4J7RA 4JRXE 4DGVL 2ZG2A 4KKNA 1D5MA 3FZUD 3TCXA 3VU2A 4AEEA 1VERA 5IHUH 1D5XB 4MZ2A 4XT1C 3H9HB 3SDXB 2B1HH 1VADB 4G6KH 1T21A 2ZSWB 5DR5L 5SX4I 3BW9B 4KDTA 3JV4B 3MNZA 2W1NA 4Z7VA 1K3IA 2PYEB 5HYSA 5CBEB 3O6FD 2NY3B 4QLRA 1EGJL 1YNKH 2NY2C 4PRHE 4WV1C 4XI5C 2ZCKL 1Y6MR 2DTML 3PHOA 1AQDB 2F5BL 4S1QH 1PAMA 4BJLA 5E7BA 1XF1A 1XGRA 5BRZA 5E8OA 1H0DB 3HNTL 1BX2B 3D39D 1FE8L 2VQ1B 1AJ7H 4UAOB 4LEOB 2PW2A 2R0ZL 4GBXD 1U3YA 5EBLA 3OR6B 2IFGA 2WUBH 5L0QC 1XGUA 5E6IC 4FQCH 2EEAA 4J6RH 3PDDA 5IBUB 4L29A 4JDVA 1B0GB 2DWDA 3F5WA 4JFFD 5IWLA 2YUWA 4G6JH 5F9OH 5CZVL 4EIGB 5FGBA 3OL2A 3L3IB 3T0ED 3BWAB 4IBLT 5A2IH 1XGPB 5IVXE 4XAWH 1QLFA 4Y5VC 3NABL 4V1DB 2BNUB 3QBTB 2LFGA 1FG9C 1YEFL 2A6KA 2ZCHL 3B3IB 3PE9A 5IM7A 1VEOA 2YKLH 3IJHA 2XWJA 5DQDH 1A6PA 1VACB 2AV7A 4PRBB 3C9NA 4LCIH 3PQYB 2DRUA 5I17A 2WMPA 5C0AD 4OUUB 4ZXBB 5SWQA 2AJYH 4JY4A 1NFDA 1IM9B 5C3LD 3D3VA 5EN2A 1QQDA 4BQ8A 1M71A 1X5KA 1XF5B 5C0IB 2Z91A 3OJVC 1EDQA 1ERNA 3GJFK 4G7YL 4NQDD 3BEWA 2DBLL 1FVDB 4LLYA 2BVPA 4MD0A 1YY9D 4YDIL 5E8PA 2VMFA 4OF0A 1C5BH 1T4KB 3JWDL 3VCLA 4OSUL 2NW2B 4G6AD 4B41A 3ZKMD 4UTAL 5GZNC 1IGCL 4MHHG 4HUUA 4LMQE 1F4YL 3DXAE 3RVUD 1T22A 3HMXH 4P49A 5CZXD 4OIAA 1MHPH 3P9MA 2P8MB 4MAYD 2CUHA 5IKCA 5I9QB 2J5LB 2XRAH 2HG5A 4JQIL 2E6JA 1XF2B 1TVHA 4XHJC 1FFNB 2QV2A 2GCYB 2DLEA 2NQCA 5F9JB 4OI7A 1VFBB 3BEVB 3GDBA 5HI4D 4GG6B 2I24N 3DVGB 1MH5A 2FX7H 2DWDB 5EB9A 3F5WB 2X1WL 4EUPB 4JZNA 3WHXB 5KW9H 1EHAA 3ZLQC 2EIEA 4MQ7B 4Y88A 2PXYD 2Q6WB 3EDEA 3UTQB 2QADD 3HZVA 3U7YH 1KBGL 4OCYH 5D7LD 5GRZA 1CZ8L 5EO9B 4RX4D 2BOCB 1A3LH 1SMAA 4KHXH 3S37X 1DLFH 4G7VL 4WO4A 3DYPA 4MDIA 4BZ1L 5FUZL 4WW2A 3MOAH 3BE1H 4U1JB 1BFSA 1FPTL 2CH8A 2AJYL 5ICZB 4BH7A 1QO3B 3N9GH 2XN9D 3OHXB 3V5HA 5EU6E 1W0WA 4NRZB 2GI7A 5JPMA 4Q9RH 5C07D 3UJIL 2M26A 2CMRH 2APBA 3GGWA 3PWVB 5E6ID 1D5IH 3VXSA 1JUFB 3QHZH 3DUUB 5C07B 1O5DT 3T4AA 1RIUH 1AKJA 2FLRT 4XPAH 1NGYB 5D7JB 3L6FB 1T7YA 4R3SB 2SEBA 2Z91B 3STLA 3MV9E 4EN3C 5IUSA 4MA1C 2QKIA 1HHIB 3SPVB 3U0TB 2XKNA 5T5NG 1IE5A 2MSPA 2I07B 3U2SA 4WUUB 1KB5H 2YOCA 4L9LA 3MLXL 4FHBD 1U8MA 3CU7A 2A1WH 3QNYA 4M62L 3OKNA 1UGNA 2F58L 4HKZA 3FT3B 3LKQB 1TZHB 4XPBH 4HUUB 1BQLH 3WNLA 4U2ZA 5KS9F 2P5EA 3S96B 3K4ZA 4RRPG 5C0RL 3DX8A 1KT2B 3OAYK 2VITA 2XA8H 4JO1L 4KDTC 4PJCE 3PIQA 1OCWH 4JZOB 4PR5A 1JGUH 4HIEB 3U0WH 2OTUB 5GRYA 2IQ9L 3QCTL 1FFNA 4KMTL 2A73A 1B9ZA 1XGQA 2NY3C 1ZWIB 3NZHL 4M1CC 1EO8L 5IIEA 3V0VB 4LPCA 4GG6A 5TDOB 1BVLA 4C83A 5I66A 1D9KB 3FO0H 3EO1A 4NC0B 1J05B 3QEHA 5ICYA 3TN0D 2XPGB 2NTFA 2AJVL 3BPNB 1OM3L 4RSVA 5DK3A 1AD9A 2EC9T 3HFML 5AZ2L 4L3AA 2UZIH 3IDIB 1P4IL 4P2QD 4NOFA 2YA2A 1QBLH 1MUJB 2H26B 1IAOA 4YBLC 4D8PA 4JZJB 2ZKHL 3TYFB 5CINH 4MVBC 1RJYB 3ARDB 4YDIH 3DX9A 1NDGB 5GJSL 2CLZA 1TZIB 1FDLH 1HI6A 5J6HA 2EEBA 3S34L 3QA3B 3T4YB 4LRIC 1INQB 1OWRM 4NHCL 3OAZH 2FJFB 4HS8H 4J12A 5FYLH 3T3ME 2XKNB 5C0CE 1X44A 4ZUVB 4XZUA 1GH7A 1HKLL 4NOBA 4WJ5A 1CICA 1QSED 5E99H 1N5YH 1OARL 3AREC 4ONHB 5C0BE 3MOAL 3BDYH 4JFZL 1FZJB 4R8WH 3HMXA 3RGVB 4KHTH 5GHWH 5ICXB 4HXBH 3OKNB 5HDLA 4CKVX 4J3UA 2IPTH 3CFEA 4HV8A 1DTUA 5IJKA 1K4CA 5FKPA 3LY6A 4LSDA 1CLZH 2HRPH 2F8OA 3BN9C 4R96B 5DEFA 4CL7A 1CE1L 3O0RL 4GJTB 3BKYH 3TP4A 5IF0B 1UC6A 4C4KT 1RUML 3L3OB 3GSOB 3MFFB 1CR9H 4R4FH 4ZD3L 2EDLA 4ZS7H 3CFKA 3IJSA 1JF1B 2CO6B 4XNZC 1MCPH 3UJTL 5IT2L 2OTWB 3MMEA 4NZUL 3QSKB 5FV1L 1RK1A 1KYOK 1NBYA 1T5WB 3P0GB 4I5BA 1BVLB 1NSNH 3NTCL 3P0VH 1WSST 3DVFA 3N85H 2UWEB 4XNZB 3QDHA 4RGNC 5KVEL 3CMOH 3GSQB 1BM3H 3RWCA 4XMLH 2X42A 4F37K 5JHDD 4CDHA 5EO1B 4JO3H 5D8JL 3V2AR 3U1SH 4NQED 4RAVB 2NTSP 3SGEH 1X4XA 4CNIB 1X3DA 4GAFB 1U6AL 1C12A 3C2SA 4PB0L 4Q6YA 5IR1B 5DK0A 4PJXA 4F15C 1AR1C 2XQYK 4PJBF 3RBSA 4KJPD 5C8JA 3LB6D 4UTBL 1CU4H 3CLEL 3K1DA 1CE6B 1BPVA 3O4OC 3CDCA 3B2VL 3KNBB 4P5MB 5EOCL 2DTSA 3GSWA 3GB7B 5DHVA 3QEQB 4KPHL 1YMMA 2BNUA 1E4WL 4QXGH 2BDNL 2CRYA 3D48R 1IAII 2XWJB 5DVLA 2GIYA 3EAKA 3QQNA 5JPNB 4PJ7B 4PRBA 3TYGH 1MRCH 1Q9LB 5EZIH 3T0EA 5I8OL 3MV11 5J11B 5IVZB 1HK6A 5HVHC 1FIGL 4NFCA 4OUUA 4ZQKB 5EORH 3VI3F 2MCPH 3AMLA 4IIQC 1BVKA 2YN5A 1FZOB 1S7VB 2BDNH 2JIXD 4OFIA 4FQXB 5D4QA 3WIHL 3EYSH 1HSBA 3RTQA 4X5XA 4WTWA 3WFCH 4G80B 2ZG3A 3PUCA 4U1IB 4ODBD 3MV9B 1F11B 4UI2A 4QWWC 1UKTA 2P49B 2I5YH 2Y7QA 4U6YA 2F15A 4GUPB 3ILPB 1AGDB 5C0BA 1AGFA 2ILLA 4PJDF 4PJ9C 1H3VA 3U4BH 2IPUG 4EBQH 3IJSB 5A3ID 3O6LH 2CR6A 2K7PA 3G9AB 2Q20A 1NCDL 1ADQH 3DGGA 3MMEB 5ACZA 1JNNL 1SBSH 5TFSH 3I75B 4WRLA 4I4WB 1TDQA 4ODTH 5BS0B 1KGCD 4K3EL 4RZCA 3H7LA 1A1MA 3WL9B 3MV7B 4I18C 3O6FA 4K71C 2R2HA 3MSPA 3UJJL 5DMGC 3EDJA 1T66C 4B53A 1DJSA 5I1GH 2YZ1A 3VFNB 2VDOL 1T21B 4GAYB 1ZT7A 4GKNB 3BW9A 5L2KD 1M7IA 4RA3A 3D9AH 2PYEA 2Q1EA 1A8JH 4I48A 2DI8A 5ALBH 3KYMB 3MV7D 5KSVA 3LVEA 1IILE 4HUXA 3V0AC 4R4FL 1I3RA 3V6FB 4ZNEA 2NXZC 5DD6A 1MFCL 2YSSA 1SEQH 4NWTH 2P48B 4JM2C 4JFED 5D2NB 3VH8A 1NMBL 2ZP0T 4P59L 2BOCA 3DURB 2Q7NA 4I3SL 1P5VA 3C5ZA 1B2WL 3WBDA 5TQ0L 4WW2B 5I2IA 1SJHB 3O6ML 1NGPH 3GHBL 4OI8A 4HLJA 5B8CB 4Y19A 3CVHA 4C56B 1GHFL 4Y7MA 2PN5A 4PRHA 5C08B 4K9EH 1MSPA 4PV9A 1NMCB 4FQXD 1HHJB 2XXCB 4Y89A 5LCVL 3THMH 4UOW0 4R4ND 5AYUH 1Z9OA 1GPOH 5DJ6B 1E27B 1HINL 3FOMB 3CLEH 4X5XB 4ZPTA 4KTDL 1HHIA 1J0JA 4X4ME 3ARFB 4OB5L 3WHE1 2HTKD 2ICEB 4GRWE 3LS5L 4HC1H 4XXCA 15C8L 3RU8H 4ZFFA 3GSVA 1OPGL 5IMKA 4BZ2L 4LVHB 5HD8D 4HT1L 2E7LC 2AQ1A 2Z93B 3ME0A 1RZKH 1KTDB 3QPXH 3CJJA 1SJXA 1N4XH 2H9GA 1UM6H 1NGZB 1BOYA 5D2NE 5LGJA 2A9ML 2DTMH 1EXUB 1KPVA 5KSBA 1F5WA 4E9LA 4JY4B 2W59A 2N1KA 4TQEL 3UYRL 5B3JF 5I71C 1DVFA 2B20A 2BSTA 3D5OF 4QTIL 2WIIA 4KTYA 1MY5A 2IQAA 2X1QA 3LIZL 3LKOA 2BHUA 3U82B 2MMXA 2NX5D 4NM4L 4HIEA 4PR5B 5H37H 3EIFA 4I77H 3K80A 2VZTA 1HIML 3GO1L 3KHQA 3C8KB 5DURD 1WQVT 2AS5M 1L0YA 4ZTPL 2WWKT 4MCYB 1OP3H 3UDWA 3U48A 3UYOD 3CPLA 1UZ6E 4G43B 1VEMA 4I0CC 2WAHA 5GRUH 4WNQA 3PL6A 3G04A 3QZWA 1Y0LA 4C58B 2EKJA 3EYFB 2O5XL 2Y5TA 1WJ3A 4ZOAA 1UH4A 5DUBA 4Z7NE 4WI5A 2OL3L 2DMCA 5KVDL 5JXAL 3QUYB 1ZLVH 2J12B 4AEHL 1Q0YL 2P8PB 3WV0A 3VWKD 2EDQA 1GGCL 4CDGC 4NQTA 2AJUH 3IDIA 1E6OL 4DGIL 2FB4H 4NNPL 2C26A 4LVOB 3TNMB 4AZ8A 2NY7H 4H1LA 4PGJA 3STZB 3TO4C 3QCTH 2C3XA 3ILQC 5E6IB 5E56A 5DHXB 2CJUL 2CLZB 3TJEL 5T3ZH 3RGVD 3RY6A 1NGWB 3U1SL 2R0LL 4LSVH 5BZWB 1XF3A 1H5BC 3MA7A 2X4UB 3FT4B 2FGWL 2FX9L 4Y5YA 4QEGA 1F58L 3UTQA 5CKGA 2X89A 2ZUXA 3V95A 1AJ7L 1F42A 1ZKAA 4FTVA 1JNNH 4DQOH 2ADGA 3T0WA 1WZKA 4JKWA 4MDIB 4HMDA 5A2FA 5IMKB 4G8FB 5FAAA 4TVPL 5C0FA 3PWPD 2VDRH 2AJ3A 4KTEL 3ULVC 1BD2E 4PJFB 3ULSA 3IFPB 3OXSA 3VRJB 2GJJA 4P2OC 3QULA 2RR3A 4N5UA 2HKFL 3ZHLA 4MSWA 1BBDL 2P24A 3FN0L 3KAAA 3L6FA 1MAKA 4K94H 3ESVF 5E94A 3RTQC 5JDJA 1LO5B 2C3GA 1U95A 4JG0H 3LKOB 4Y19E 5T3XD 1HQRB 2AABL 1KPRA 1ZVHA 3DTXB 5I75C 1JF1A 5KVFL 3NFNA 3ECBA 1NCAL 5E2WH 4Z78A 1A0QH 4ONOA 5J6GA 4KZEL 4P9MH 3V7AE 2XKSA 3I9GL 4L4VE 1MWAB 5J1SC 4I5BB 4KI5D 4HKZB 4PJ9A 2V17L 4F2MA 4LHUD 1JVKA 2DQEH 4NQEE 4PJ5E 5I1JH 2AXJA 2UWEA 4LU5L 1S7WA 2Y5TB 1DUZA 5CFHA 3LHPL 3GSQA 3U7YL 2P5EB 4OM1H 1PJ9A 3GJFA 2Y6SD 3QUYA 4TTDD 4QHUA 3UTSD 5DJAA 1L0XA 4PLKC 5DYOA 4RAVA 4XPGL 1IFHL 3LRSB 1CIDA 1XR9A 3BJLA 1CDJA 1NDMB 1EHXA 1J18A 1I8LC 5B4MD 4L8SA 4I77L 4WFHD 4UILL 5ID0A 1NGPL 1ZMYA 3STZA 1UA6H 4WHYH 1WBYB 4KUZH 1IGMH 3T0EC 4DK6A 3CD4A 4RFNB 1HILB 4GXUN 3VWKA 1Y6NR 5GGUB 2VZOA 4UB0H 5ALCH 1I1FB 3CXDH 2BXZA 1XF3B 3UTSB 1KN2H 3MA7B 4RGND 5E08H 3HUJF 5K9KA 3VD9A 4FXKA 2VLJD 4Z77A 4M6AA 1NJ9B 3FN9A 4WFFD 3NPZB 4FFWC 3EOBA 2PTUA 2R0WH 4G8GE 2CDFB 3PL6D 1BJ1J 5JOPD 3QISA 5D1XC 4JZJC 5KBNC 5IVZA 1JYXA 1T20B 4HPYH 5EBMB 2AK4B 2ZWLT 3QEGL 4G9DB 4PJ8B 4XVUD 3RU8L 4DAGH 1WZLA 3I85A 4RMQA 4JN2A 2NY5H 3WO3B 1BGXL 4D8PB 3KPRA 4YEFA 1DBML 3IFPA 1UFUA 3VI4F 5DRZA 3MV9A 4JPWH 3GJEA 4CN1A 5GISH 1JCKA 3D18B 3ES6A 4LKCB 3ULVE 3SGKA 3RDTB 3SOBL 2XQBH 4O4YH 4P5TC 4BZYA 5DXWA 3BP5A 5D96B 4NGHL 3K7UA 3NCYP 5JXED 4KMTH 1R5IB 1NKRA 2EICA 4OI9A 1X5AA 1ZE3C 3MLXH 4JFXB 2FGZA 4GMSH 1OD9A 2WANA 3WYRA 1IGJA 4MXQC 4L4VD 3MRRA 4TYUA 3W9DA 1T1ZA 4Y16B 3TFKD 1JGLL 1J87A 1HWHB 4L8CB 1C1EL 1MI5B 3ULUH 4YQXH 1RURH 4WW1B 1MJ7L 4PJAF 5HHXH 5FHBH 2UZIL 4PRHD 3DHJA 1MY7A 3U6RB 1VFUA 3FRUA 1I3RB 1YY9C 3TBTB 3TVMB 1MFBH 4PJIF 4ZODA 5AD0B 1T03L 1KIQB 1YQVH 1RK1B 2UWEE 1T7XA 5F72S 1U8IA 4X6EB 1VESA 3EFDH 1TJHL 3BISA 2Q8BL 3QXAA 3RUGA 4UU9B 1TXKA 4HKXA 1SJHA 3FT2A 1IEAA 4APQD 2JJSA 1H3UA 1LO4H 2Y07H 3RNKB 1HH6A 2YKLL 1JYWA 3BYTA 3UCRA 4PLKD 2BVTA 2APXA 3QNZA 3QQ3B 1G7QA 3MFGB 5FOJA 3G6AA 3S5LB 2NR6C 1UWEH 2WUBL 2XY1A 5EBMA 4L8BB 4NN5C 1RUQH 2W9DL 1IGTB 4HDIB 5DJ6A 3BPCA 4GKOA 1IKFH 1TETL 4KRPD 2CKBL 3T77B 1KBGH 5CBAA 3FTGB 3KNBA 3L9RB 3BPOB 3M17B 3GSUA 5DRZB 4MJIE 4PJEE 3EYUH 3SDDD 1V7NH 4IMLB 3MRFA 4LDLB 3QQ4A 2YMXH 3HN3A 1C16A 4HZLB 3OBAA 4Y5YC 4AY0A 5JW5B 4LVNB 4Y2DA 3R0MA 2EXWD 1HKFA 3WXVL 1CL7L 3WFEL 4XX1G 4AL8L 1JHKH 4U4BA 4PJ7A 3ZDZF 1S7XB 3KPNA 5C0RH 3HG1A 4O51A 2PO6C 3PDOB 2VXQL 3N1FC 3GKWH 1A9BB 1U92A 4KJQD 3HI6H 4ZOBA 1QA9B 4XH2A 1JRHL 1J0YA 4Z7OE 1U8LA 5HHNA 3HMXL 3W0WA 4OZGB 1PKQE 2A6IA 1MRDH 3MLVH 4OUOA 4YZFF 3RTQD 1F4AA 3LS4H 1OAQL 3S98A 2VZUA 1DQML 3QFDB 4GG8B 4MHHI 4I9WD 2B4CC 3HUJB 4QRRA 4NKIH 5CS7A 4Y4HD 4JPIB 3ARYA 4A6YL 4XCNA 3GMLA 3UEZA 4Z5RB 1WAAE 1GGIL 3QCVH 2D0FA 2HJKB 3D39B 4UINH 5C08D 2EYRA 3X14B 1RJZB 4L4VB 5B39A 4ODWA 1OSPL 3T0AA 1MF2H 3UDWC 3WFHB 1JGVH 4I3GA 4XP6L 4X6EA 1RIUL 1I9JL 2EE3A 3BO8A 5HHPB 4PJGA 4LQ1A 5INDA 4Y4KD 3MV8A 3QCVL 2X9YA 1XIWC 1N26A 4Y1AD 5FYLE 1F6AA 1EEYB 3FT2B 1MRFL 3HAEA 5D1QA 4HKJB 1ZT7B 2FATH 2VABB 2RFXB 1J8HD 1JGEA 2BY0A 3KLAA 4PRIE 3IFOA 3C5ZC 5SWSB 4IOFD 4ENEC 1UYWH 4YX2H 1XGTA 1M05B 1K8DA 4HGKC 4OKVB 4L8SC 3EFFB 4L4TB 1U9KA 2JJWA 3P9WB 3R4DA 1BP3B 1T3FB 2LU7A 2BRRL 5F7DB 3S4SA 5GIRB 4OGYL 3UZVB 4XMKL 3A6BL 4LIQE 5GGVY 4NZJA 4YXHH 2D03L 3MA9L 5ILTH 1ZS8B 3V0WH 3NCJH 3GRWL 1IEHA 3LRHA 5C0FB 5FGCB 4M3KB 1SY6A 4DZBA 5F9DC 5FGBC 1AGBB 2AJ3B 1MPAH 1X5ZA 2F19L 2BNQB 3P4NB 3DJ9A 3A67L 4PV9B 3QULB 3WJLA 1KENL 4JVPA 1FNSH 2GQHA 3KPPA 4PRAA 2CSPA 4MNGB 3KJ6H 4Q0XL 3ULUD 3ZT5A 5FXCH 4XTRC 2AJXL 3NCJL 3CVIL 1QA9A 4XH2B 1FE8H 5KS9A 4YPJA 2QHRH 5T1LD 1RULL 4YHIA 2A6IB 2QLVB 1QRND 2FX8L 4XNMA 2P5WE 1OWWA 3SE8H 4TSBL 1KPRB 3HRZA 1AQKH 2IAMC 3KG5A 1F13A 5J3HD 4ZFGL 3ZL4H 2X5PA 4HGWB 2HFGL 3U0WL 1UWXH 1YNKL 2UY7A 3VWJC 2AJSH 1LD9B 1Q94B 4NWUL 1JIBA 1YNLH 3VXMD 4JPIA 5HVWA 1R3IL 1KB5L 1EHNA 1N3NB 5DEGB 1W8NA 3L95A 4Z5RA 2F8VA 4OGAD 4JN1L 1RJZA 4M03A 5C09A 4KGLA 4YHPA 3EGSA 5IBLD 3NZ8A 4IOIA 5C08E 5CCKH 2YRLA 1SM3H 1MRFH 1DVFB 1UWEL 2BP3A 3L3JB 5TE4H 5IFHH 1CXLA 2EDWA 4TTGA 5D7LE 1R3IH 4NUJA 4IRZH 4R90H 3EYQC 1WK0A 2VQ1A 3ALWA 3MJ9L 1TITA 3CZJA 3MNWA 4OLVL 2XWBB 2PW2B 4UDUA 2VH5L 5J57B 5MEOB 2W65A 1DBAL 3KPSB 4GRLA 5I6XC 4R4BB 3BGFB 5CINL 2I9LA 2DD8H 1NKOA 5GGUA 4JHZA 5FO8B 5HGBA 1Y0LB 5B22A 3ABZA 2X4SB 1CL7I 3LQAH 1RU9H 2AQ2A 2XFXB 3PWPB 4LCCA 5EDXA 1T3FA 2B2XL 2ZCLH 4KTEH 5DTFA 5I1KH 2DQJH 4ZPVA 4YHZL 3WS6C 5KANI 1OF2B 3O8XB 1PLGL 3TZVC 4LRNH 1AIFA 2FJHB 2ADFL 4GS7B 4WFGE 3A6OA 2GJZA 4L3CA 1OM3H 3BPNC 2R4RL 1JRHH 4F7PA 4HWBL 2F5AL 2H1PL 4LKXA 3HS0B 3U9PL 3RWFB 4JR9L 1QBAA 5CWSB 1CFNA 3ULVD 1AGBA 5DZLA 3MRQB 3M07A 3ARSA 1YEIL 3O4LD 2V7HB 3DIFA 3JTTA 2F53B 2R4SL 1Z5LA 5CP7A 1NFDB 2QADC 5EC2B 4YIQB 2EDOA 5F1IB 5DD3L 4KKLD 4FTVB 4NM4H 4H1LG 5IB4A 1HHHB 4RCAA 1G0YR 5TDPA 1AE6L 3K46A 4DKFH 2C7UA 3C6LD 1P84K 5E00A 5H35A 15C8H 1TJGH 2P42B 5CD5C 2MQ3A 5CCKL 4X6DB 1TVBB 3PGFH 3O3BB 2AEWA 1ZLUH 1MFNA 3U30B 3VJ6A 3QJFB 1EFXD 3OXSB 2D7MA 3TA3A 3A6CL 1MEXH 3EGSB 5I1EH 3MYJB 4YAQA 4R7DA 3SDAC 1EZVX 2X4OB 5J13B 4YJZL 3FB5A 5MEPB 5BW7C 1G6RA 4EVNA 3SDCD 4L4TE 4M8QA 4K8RL 4JGJA 1KJ2H 1SBBA 2E7CA 5CJQL 1II4E 3BZEA 4JANB 5EZJA 1JGLH 4MWFB 4G6JL 5F44A 2PW1B 2XWBA 4M5ZL 5I74C 1ADQA 2W9EL 4JRXA 3G5YB 4WCYH 1HOCA 5I6XB 3ARGA 4WTZG 1A7NL 1ROWA 1FCGA 2YWYA 5F71A 1JHTA 3WFBL 5MEOA 4A2LA 1LEIA 2GCYA 4POZD 4YHKH 3NABH 1C08A 2DAVA 5HHMB 4MXQD 5AWNH 3DXAB 3U7WL 5HVFB 1UKQA 2VN4A 5J4MA 1MH5B 4UV4L 2OX5A 3KLDA 3KYKL 4AG4L 1K8IA 2OJEB 1PYWB 1S9VA 3UTZA 4OAWA 3WHXA 3BRFA 4ONGL 2CDEB 1U3ZA 1JPTH 3GBMH 5BQ7A 3B9VA 4RFEA 5DD0L 1MVUA 5EFIB 2IANA 5DYOB 3SKNA 3HMWL 4BA8A 1U8HB 3RL1B 4Y5VA 3KJ4B 1P6AB 3AROA 5HGDB 4LLWA 5T1LA 3BUTA 2R1YA 5C70A 4TSAL 3K4DA 5C2BH 3W9EA 1JWSA 4S1SL 1T04B 3RY4A 5IEKB 5CBAB 5FDWB 3FTGA 4NNXA 1UM6L 4K3EH 3TLRA 1P2CB 1I1FA 3W0WE 4BQ6A 4X8JB 5JW5A 3JTSA 3JWDH 2HFFB 3ARBB 5EU4B 4BK5A 5FCUH 1R5VB 1FVCB 4JG0L 5HYJD 2CDFA 5EU5A 1S7XA 1K2DB 5E2JA 5IB4B 3ZKND 4QRTA 5SX5K 5FF6B 1V7NL 1QP1A 3MRKA 1M7DB 2BSRA 3HAEH 1QVOA 4I3RH 3LPFA 2ED7A 4RMTA 3H9SA 1N5AA 1WFTA 4JAMB 2B0SH 5EU7E 4ODTL 2P5WB 4I9WE 4NZRL 3LN9A 4R2GB 1PZ5B 5INCA 3SKMB 2EZ0D 3PWLB 3IJYA 4CJ1A 4Y8DC 3O2DH 5JZ7C 3ZTNH 5B38G 1BWMA 4X7EC 4XC1H 2KZ1B 3RA7L 4QRRE 3WS3A 2KZWA 3LEYH 5I8CB 5CUSL 1EFQA 4GW5B 3QFDA 1VCAA 3CCHA 3GI8L 3WLWD 5MEPA 1KB9J 1TLKA 5L2JB 3DO7B 3QAZC 4XXCC 2F53D 3LQAL 1HHGA 2L7JA 4P23D 4Z7VB 4U6XB 1KT2A 2VITB 4NCC2 5B39B 1R5IA 3DETD 5BXFA 1DSFL 5FYKE 4MA7L 3EJYC 2WBJB 2A74B 2VH5H 4X7SH 5GRXG 3NIDE 4UT6H 1UVQB 4XB7A 1RY7B 1WIUA 1RK0A 2R1XA 2X9XA 3H3KA 4MXVF 1YNLL 1D9KA 4UOJA 1T1ZB 1GRWA 3RVUC 1I8LA 1PYWA 4PGZA 3F6IA 4Z7UB 2F5BH 3VXMB 1MRDL 3EO1B 3TVMC 4L8CA 3WXWH 3BGMB 5IK3A 4EDWL 2ZUWA 2VABA 4R6UA 1MVUB 4YBHA 1JPSL 3MX0A 5EFIA 1YYMH 4PJIE 2O5YL 5EBLB 3KXFD 4YHZH 4YFEA 4JFOA 3RWGB 3RL1A 1A9EA 1RMFL 1BQUA 5MEQA 3MJ9A 3RWHA 3MR9B 4RIRB 1NEZA 2O5ZH 1B0GA 1J5OH 3I9GH 2ICWB 1KIQA 3AUVA 2DL2A 4GG6E 3ARWA 1JWSB 2Z8WC 3UO1H 5I8EB 4W4OA 3UTPD 3KS0H 2MPAL 32C2A 4M1CD 3ZKNC 4J6RL 4JZJA 5DFVC 5F7FA 5KTEH 5D7IE 3ARDA 5A43C 4F7EB 4JFYA 5BRZD 2YPVL 1WC7A 1TZIA 4JO4H 4JGMA 1JPTL 4R97B 5IM7B 3S7GA 4UNVA 4G8IB 1FO0B 1ZTXH 4OIIL 2FJFA 1U3HD 2OS7A 3B9KD 2DLHA 1G7JA 2MWCA 4KJQC 1E4KC 3QWQB 4FP8H 3CFCL 4YGAB 4EZMA 4JPVL 5F1NB 5HHVH 4YC2C 2E7LA 3IYLW 2VLRD 4WUKH 3B83A 1G7PA 1N6VA 4PIRF 1OT1A 1KJ2B 4HV8B 3TH4T 4IMLA 2WLZA 3DETC 4J2XA 4L4JA 5DMKB 1YPZF 4KK8C 4OM0H 5ID1A 3PXHA 4Y2DB 4ZO7A 1HXYB 4OQ1A 8FABA 5IF0A 1OAXH 3E6FA 4PGEB 4H5SB 3MXVL 4S10A 1FG2B 2IH3B 1CD1A 4IDJH 4IJ3C 3MRNA 4HEME 2NW2A 5J9PA 4I3RL 1CU4L 4PP1D 5ENWA 2AJVH 5D9SB 2AK1H 5ESQB 3S4SG 1IT9L 2EH7L 5I1HL 2ZNWA 3VFOA 3P4MB 4D0BA 2NX5E 2CD0A 2XXMB 5K9QI 1JZ5A 2YK1L 2P8MA 2QHRL 3EO9L 2Z0BA 3LIZH 4U1HB 2CXKA 3RWCB 2JCCA 1VADA 5GGQL 4CJ0A 2ZSWA 1EJ6A 3AMKA 2H45A 5GGRA 4OD3H 1WISA 2ARWA 4PP2A 1JYNA 3GMLB 1KPUA 2AJSL 1NLDL 5F9JA 5JW4Q 2EYRB 1X4YA 1TPXC 4L4VA 3IDJB 1NEZB 3ZKXC 4P99A 3X3FH 5HHME 2H6PB 5DK0B 2JK5B 5DTFB 2OM5A 5EG6C 5C8JB 3EDDA 1KIUA 3CFIC 2ATKA 3BP4B 5HHPA 2IH1B 1OF2A 2NY6B 1L6ZA 5FA3A 1BF2A 1Q72H 4M9PA 4OQTA 2OJZH 4I8DA 2IPUK 2UUDH 1IGIH 5DMGD 4P5MA 2B5IC 2GJZB 4L3CB 1ZVYA 4JFDE 5CEXA 1IKNA 2OYPA 1VB9A 1KIPB 2OBGA 5D1QB 4HKJA 2PCPB 5T1MA 3ET9F 2GJ6B 3RZCA 3MO1B 4ELKB 3KJ4C 1SEBB 4YNYA 1FO0A 4N0UE 3ROOB 4EOWL 4OF7A 6FABH 5JPMB 1MCNA 2VXQH 4PJ8C 1FSKB 3GMNB 4UBDD 3IXAB 4WU7A 2OJZL 5I73B 4EQ3A 1JNJA 1INEH 3MUJA 5L8LB 4L29B 4U05A 5DWUH 3GIZL 1V3KA 5TQ2L 5HYSG 4L4TA 1CFBA 1DCLA 5F1NA 1N7MH 3VGEA 4FQXC 3ISWA 2HT3D 1AR1D 1CFQA 1M4KA 4PJCB 5HBBA 1CDUA 1EUUA 5EOTA 5B8CC 4G9FB 1H3XA 5FYLL 2Z8SA 2XTJD 3FFCB 5K93A 1XGPA 2DJUA 4ZFOL 5D5MA 5CUSH 3RVTC 2JB5H 3REVB 5IW3A 1NFIB 4NRYA 8FABB 3B3IA 4NT6B 3PHQB 4L9LB 3W11C 2NZIA 1KCUL 5KZCD 4PGEA 7CGTA 2Z35A 3TF7C 1RZIA 4UILH 5C9JA 2EEDA 4QGYA 1BVZA 4P2CG 3LKQA 4RGMB 2EYTB 4M3JA 1OTTC 4PRAB 5F3HB 5ESQA 5CEZL 3U0PB 2CRIA 5DGRA 1I8KB 5BS0A 4RZCB 4M8QB 4G42B 4Y4FB 4P2OA 4MX7A 2YMXL 3WFDH 2EDRA 1Z0MA 3HRZB 2ED9A 3D2UD 3PIQB 4NYLB 3HPLB 5FKAB 3IDYC 3CNKA 1JL8A 1NLBL 1Q38A 2JLLA 1P4BH 2C1PA 4HWZB 4JRXB 3G5YA 5JLZA 4B7IA 2BVPB 1Q94A 4MD0B 4M5YL 1T5XA 4LSRH 3ULVL 4ELME 1YY8A 5DA4A 1AE6H 3I6KA 1N3NA 4DKFL 4PJEB 5BV7H 1U8JB 5I71B 4MA3A 3BD4A 2HRLA 4L3EE 3ZKXB 5C09B 2F5AH 3SDYL 2UVEA 1MHPL 1ES0A 4XCEA 2ADJA 4HEPG 3QDJD 1KFAL 5DHYA 2A6JB 4M1GL 2OL3A 5BVPL 4F8TA 2H2PC 1J05A 3QEHB 2ATKB 2YSSB 4FXGA 2IANB 5TJWK 4Z7VF 3SKNB 3NCYS 1WCBB 1A7OH 2D7PA 3BGFC 1SQ2N 2RHEA 4POYA 3HI1B 4ONGH 1KIPA 3W2DH 4JY6B 1Z9MA 4JLRB 2GJ6A 3RZCB 4PBVC 2DKMA 1KEGH 3LN4A 3DBXB 3PWPE 3A67H 5IHUL 3HE6A 3CVHB 4N0FB 4OD3L 1MUJA 1RUAH 2H26A 1IAOB 4GS7C 4EDWH 1UACL 1IC7L 1I8MA 1P2CA 1A6AA 3WLWC 3BDXA 4U2YA 4ODVH 1JK8A 3FQRB 5GS0C 1ITCA 2XFXA 3PWPA 4LCCB 1KCVH 4UQ3A 4Z7VE 4WIQA 5IHLB 1WLHA 1EEZA 1U93A 1R5VA 4Q58C 2O5ZL 2COQA 3PV6B 4LLAA 4GRMB 3RWDA 3X13B 2Z31C 4DN3L 3ARFA 3BMVA 4D9RE 2LTQB 3O6MH 4LVNC 4IRJD 2J4WL 5DZOA 1OTSC 2RB8A 5BZDA 5EZLB 5D7LB 2QJDA 1KUMA 2Q7YA 4JRYA 3FRPA 3EYQD 1CK0H 4NT6A 3H0TA 3SKOA 1UXSB 2ZCHH 4RWYH 3P73B 2B8OT 5IJVB 3RGVA 5ICXA 3HAEG 3I3DA 4X98B 2H9GB 3MLUL 2EDTA 4PJ8D 1JRHI 3F7QA 1D6EA 3T04D 3C60D 5ADOH 3VXSB 1K4CB 1LO0L 5JA9A 3EDFA 4ZAKB 2NY4C 4FQ1L 4KRPC 4YXKL 4XHQA 5E1AB 1BQHG 5IHBA 4G42A 4MX7B 1WFUA 4KV5E 3IDYB 3IDGA 4OLZH 1IC4L 4NYLA 5FKAA 5JW4R 1NCUA 1FVEB 2H8PA 3SGKC 3CFKB 4AYFA 5CJXC 1JTPA 2IMNA 2G5RA 1ZHNA 3MRPB 1T5XB 4S2SB 3JWDC 4MGXA 1A6UH 2YPLD 5GSRB 1GJIA 1UVQA 2JB6B 2X10A 5HDBF 3TPUA 4YE4H 4MCYA 3IT8D 5D7SL 3KYNA 3TBWA 4N0CD 5ESAB 3QZWB 1DR9A 2R56H 3FHAA 3MRBA 1OTTD 2OXGA 3MLSL 2AABH 2Z31D 5KVFH 2FBJH 1RHFA 4EVNB 2D7OA 5MHSE 3LKPB 3OKOA 5HYEA 2P8PA 2R23A 4OJFH 4I2XB 4NKDB 5EOCJ 5EU3B 2PW1A 3P4OB 1N59B 2BVOB 1GPOL 1I3GL 5FCUL 1GC1H 2OTUA 4PJXB 2FYYB 2LQRA 3WS6A 3FO2A 3DGCR 4M1DH 3EO9H 4HBCL 5HI3C 1OGTA 2AXFA 1J1PL 4N0FA 5IIEB 5LWYH 1QACA 3V0VA 2ERJC 4L9DA 3SE3A 1BJ1H 4TULH 4UIMA 3BRGC 1OP5H 3SCMD 3GSWB 4MNQE 3FQRA 2OQJA 1S9VB 5EZOL 3CXHJ 4GLRH 3GMMB 4ODSH 5I1DA 3IFNH 3MBXH 1EEZB 1U93B 3TO4B 3LKNA 4NKOB 1KTRL 2CIIA 5GGSB 4ALAL 1A14H 2XKUA 4U1KB 2DQCL 1GOFA 2FZ3A 4Y5VB 3E1F1 3LN5B 3MBEA 3LQAC 3T0EB 4CVZA 1G1YA 1PVHA 1CXIA 2Q3ZA 1E4WH 3CIQA 1DE4A 1YN6A 3DX7B 3QIBC 3SKUD 4G8FA 4NRXA 2DS4A 2EYSA 3ZO0A 3MRGA 1QFUL 2ZCKH 4FQXA 4U6HB 3C08H 2AK1L 1HYRC 4WI4A 2P5EE 2DL9A 2NY0D 4NO0B 5HYIA 1BD2A 4JPVH 1PEZA 1CN4A 4UT9H 4HPOL 3VFSA 3ZT7A 1YEHL 2P24B 2N7AA 4AENB 4DEPC 1ZSDA 4IOSD 5IHZA 3MOBH 5EU5B 3WDHA 2IAMB 2P47B 3B9DA 4UINL 3MRKB 3FB7A 1C7TA 3MRNB 4OM0L 4OD1H 2H8PB 5M95B 3B2VH 3TO2A 2A0LC 4JAMA 3OB8A 1B0RB 3BFOA 1ORSB 5I30L 1BIIA 3NVQA 3SCMA 1NCWH 3DSFH 3AC0A 2AKRB 5IROA 3I75A 4O58H 1KB5B 3GBNL 3AY4A 1PZ5A 4HIXL 5INCB 3SKMA 3U4BL 3KYNB 3VXUB 4QGTA 2R2HB 2DOCA 2PYED 3DVIA 2ZUVA 1QUNA 1L7IL 4DKEL 1I3VA 4QHKJ 1VDGA 1T89C 3X11B 3O11A 3KPMA 5D1ZA 1FYHB 4W4NA 4B7LA 3LKPA 2X05A 3QHFH 4JKLA 4OCWH 1KG0B 1AGEB 2FO4A 3IDJA 1XR9B 4UQ2A 5I9QC 1FAKT 1VGEL 1N59A 2BVOA 3UYRH 3KYMA 1R24B 2R4RH 2QQKL 3KXFE 4HUXB 5DJXA 2H6PA 4Q97A 3O6FC 1ZA3A 5EZOH 2FYYA 1VFMA 1CDGA 4G9FD 5H2BB 5IQ9B 1QSFE 3OGOE 5EPMA 2AEQH 2YPLA 4LLMB 5DLMH 3B4NA 1CBVH 4JFHE 5EIVA 5LAXB 3FCTB 4HFWB 4HUVA 5BV7L 3C5ZB 2CIKB 5CAYB 5JHLH 4Z7UA 1VPOL 4ACPA 4X9FA 4MQXC 3QO0A 1YEGL 1MJUH 5IK3B 3MO1A 2HH0H 1EBPA 4Z77B 1YC8A 2YD9A 3QXWA 3ROOA 4GG6F 4ZYKB 5KOVC 5AUMB 3RWHB 2A9MH 4CMMA 4TUKH 4U7KA 3S97C 4PB9H 4WO4C 1XIWD 3EYVB 3GMQA 2XT1B 1KLFA 2DYPD 3JXAA 5SX5H 2DLFH 1CE6A 3QDGD 4XC1L 5T3ZE 3FOMA 3DX6B 1P5UA 3GB7A 4UUJA 1WC7B 4QF1A 2Y06H 2FHBA 2QSCL 3GSVB 1SJVA 3ARFD 4U31A 1A3RH 1G9MC 4PRPE 4QOKE 4OLVH 1T1WB 4ZSOE 4YC2B 4KKCC 1KTDA 1YJDC 4LU5H 3LAFA 4P3DB 1ZXQA 3KHOA 3D69B 1OGAE 2ZOLB 5ETUB 3I50L 5LGJB 1FJ1B 1PY4A 3BXNB 3I2CL 4I2XE 4ZQKA 2OR9H 4Y2DC 4MAUL 1PGRB 5J89A 1I8KA 5TQ2H 1XFPA 3CX5J 2AJXH 2X4TA 5L6YL 2B4CH 1CL7H 4XAKD 4BQCA 3OTTA 3RKPA 3I84A 4U1IA 5MENE 4M93C 5ID1B 4JJHA 4Y16A 3KR3H 3QRFM 1FL3B 4QNPF 4WEMB 2Y7QB 5BJTB 1KB9K 1YY8B 3I6KB 4KK5C 2PETA 1CICC 2WUCL 2Y1VA 2V7NA 2APWA 3IDMB 3U46B 5SWZD 1NUFA 4OZFA 1RSFA 3LOWA 4YFLI 1Q1JH 1R24A 2D7QA 2R9HC 4LP4A 4DKAA 4WDIA 3BIAX 2ADJB 4ZS7L 3TBTA 2OL3B 4NC2B 3P30L 4OF6A 4LHJB 5KAQG 1W72L 5DUBB 4XBGB 5SX4H 5EPMB 1S9YA 3ORJA 5KTEL 3Q6GH 1PLGH 2VXVL 2VWEE 3MLPA 2X2YA 3O6FB 2ENSA 5D72H 4Z7WF 3AFLA 1KJVA 1KJ3H 4U1HA 2BRQA 2HJLA 1INDH 3GNMH 1R3JB 2APTA 1MF2L 4P2OD 4HS3A 3OR6A 4K3JH 3HC4H 3TNMA 1SEQL 2YZ8A 4H1LB 2IMMA 5EOQL 1I8MB 2E6QA 4JDVB 5HI3D 4I48B 2MJWA 3HNSL 3BVNB 2CK2A 3NACH 1NGWA 5CEZD 3EYVA 5DD6B 1IFHH 4LSSL 5CHNA 5TQ0H 1JNLH 2OZ4H 3BP4A 4HDIA 2IH1A 2I5YL 3OG4B 4LDOB 1S7TA 1D5ZB 4P4RA 2ICWJ 1E6JH 1BEYL 2DB8A 1T6VN 4MMXC 3BWAA 1VFAA 1YYLH 4XWGL 2ADGB 1IL1A 4JRYB 2Q7YB 2PCPA 5T1MB 4AIZB 2EECA 4A6YB 3H0TB 4GQPH 4JHWH 1IMHC 5IJVA 5EBWB 4FZ8L 2XZQL 1WBZA 4X98A 5E70A 3GMNA 2Z8RA 3KPNB 5L88H 3VGFA 5I8OH 4IHOB 2NY1B 3D0VA 4L8DA 4QYOB 3FFCE 1PQZB 1MJ7H 1IC7H 2IBZX 1G7LB 3B9KB 1CFQB 2R4SH 4PJCA 1E27A 4OF8A 4N68A 2XTLA 1LMKA 3FFCA 4OZGA 1LO5A 1VENA 5E9DD 3ZE0F 4UNTA 1MCWM 4J4PD 3DSNA 1GZPA 4EN3B 2YRPA 4Z78B 5J6GB 3DPBA 3HUJA 4QRRB 1E4XI 4TQEH 3SCMC 2O5YH 3L7FB 2Z93A 1QRKA 2VDPH 1CDCA 4PJ9B 5KSAB 4F2MB 4EI6B 4LCWA 1EGJH 2FX8H 1V3MA 3O9WA 4ETQB 2XQBL 4O4YL 3VWJA 1DUZB 1A6WL 2WBJD 2P44B 4U1SA 3OKMA 2JKXA 5D7SH 3PGCB 3BZ4B 2BSTB 3CDGA 1HEZA 1T83A 3GSXA 4YUEL 5D7IF 5DJAB 1DANT 2NCMA 2WBKA 3QEQD 1EJOL 4PJGB 4D9QE 4I2XA 4NKDA 3HNTH 4BH8A 1NSNL 2HG5B 5HYJE 5LVEA 1T03H 2I25N 2Q3AA 1J1XH 4YO0B 4KK5D 3V4UH 3SDXF 3FO2B 5EUKA 3ELAT 3EYUL 1DVFC 2ZSVB 4BM7A 2V9RA 1AP2B 4P57B 4DQOL 1JV5B 5E2UL 4UAOC 2PYFA 4O2CA 4ZFZB 2Q8BH 1QSEE 4P5TD 1Q9WB 1KN4H 4E41B 5HDOA 4X4MA 1GGCH 5DHYB 5F89B 3L1OH 4KJWD 1CGVA 1W0VB 4KRLB 3ZTNL 3DO3A 4FNLL 4UV4H 2IPKA 3QI9A 4R7NB 3MRDA 1N0LA 4NHUA 1R3HA 2GTWB 4K55A 1I8IB 5GGTH 4NQVA 1PG7W 2UZXB 3MBXL 1T20A 5ACLA 3ZE1E 2DQIH 3MRHA 3GMRA 3OHXA 1UZ6F 4U49A 5KN5A 4N8CL 4JN2B 5EWIL 2A83A 1U2HA 4YFLF 1YPZA 4KH2A 5E6IA 2D2OA 1MCJA 4YBQD 4FOMA 5DWUL 5C07A 2IEPA 3T4AB 3SY0A 3ZSTA 2VL5A 5DHVH 2XN9A 4D9LL 3B9KA 5TDNA 4L5FL 3D18A 1U3HA 4XP4L 3TIEB 4JM4L 3I3EA 1FNEB 4R3SA 1N6QL 2OSLA 4HF5L 3RDTA 4DVRL 3D0LA 4XVTH 1FBIH 5JW3H 4IRSD 4NJAH 3TBYA 3OF6A 2PR4L 5I1JL 2FD6L 3U0TA 4WVRA 1I1YA 4PGBA 4NPYB 4NWTL 2F54E 3ARXA 1DN0B 1YJDL 5D7LA 1NMCC 3UROR 3U2SB 5TGBB 3F7YB 1A7PH 2AKRA 4U0QB 3JWNC 1UXSA 2OP4H 3OZ9L 1A21A 3VDAA 1FYTB 2UZYB 5JXEC 4ZD3H 2DLIA 5JTWA 3S35X 4RDQG 4BUHA 3HLAA 1GCFA 1QSFA 4KV5F 1RZ7L 4ZUWA 2NY5C 4ZAKA 2V9QA 4LP5A 3VWJB 2FEDD 3AU1B 5J1AB 4M7KL 5E1AA 3O11B 3KPMB 5D1ZB 1HEZB 1QD0A 3GSXB 2VDMH 1CXKA 3GKWL 3OPZL 1KG0A 3DX8B 5LCVH 3IDGB 1CLOL 4JKKA 4NUJB 4JR9H 4MJ5B 4UNUA 4KROB 3SDAA 1UM5H 3ECBB 4LVEA 5T3ZL 4M61B 2A73B 2VNCA 5MERA 5H2BA 4G6MH 1LO3H 4P9HC 4JKPL 4OF3A 2ZSVA 3P0YH 2QQKH 3UBXA 4O58L 2WQ8A 3RP1A 4C55A 1Q9WA 5DJ2B 4DUWA 2XZQH 4QRUB 3RWEB 3RUGB 4UU9A 4DAGL 5DRWB 3MRDB 3EFDL 1L7IH 4N9OB 3O8XA 1QBBA 2R23B 3LMJH 4M6OL 1TJGL 3KYOB 4AM0B 3VG0H 1CS6A 4WFFE 5C7XH 4F7PB 1NDMA 4JDZB 2VLMD 3QH3A 4J1UB 1MCFA 3HS0A 2ITCA 3E2HB 4KVCH 4UIKH 1F90L 4HJGA 4FFYL 3M45A 5I8KH 5IWLC 4ZFGH 1CI5A 2HLAB 5C9KA 1VSCA 2J6EH 2DQUH 3DIFB 3GMMA 5GRVL 3MRFB 4E41D 5I19L 2HJFA 3FB8B 1F45A 4NKOA 2OSLB 5DD1H 5GGSA 3IDNB 3MQIA 4A6YH 5HYJA 1DFBH 3EOBB 2O5XH 1FLRL 2FZ3B 4H20H 2LAAA 4PGBB 1NGXB 3C5JB 3C6SB 4LQFH 4PJAE 3SGDH 1B90A 5ETUA 1ORQB 1MQKL 3DX7A 4GXVL 2J8OA 1TENA 3LHPH 1N7ML 1VHPA 2ZUQB 1XAUA 1VGEH 2D03H 3D25B 3BP6A 1MCEA 5J1TC 3HLAB 2RCSL 3J7HA 1BD2B 5IROC 1PZUB 1R6VA 2BNRD 2X1XR 3QQ9C 4CAGA 5J1AA 2R1WA 1IAMA 3WFCL 1UT9A 4G6FB 1ZSDB 3R06B 1N64L 4TUJB 2ESVD 3T0VA 4OZFB 3RQ3A 4NQCE 2OCFD 3BP5B 2DMBA 3D39A 4MWFA 3TO2B 4OLWH 4MAYC 1MHEB 3CH1A 3UX9B 1RUPL 3S35H 3MLRH 4I18B 1G9EA 1E6OH 1QRNB 1HOCB 3O9WC 1KB5A 3ARGB 3G08B 3PJSA 1S9YB 2GT9A 3VXQB 4G8EA 1WTGT 3A6BH 4NQSA 1LEIB 2A9NH 1YMME 1C08B 3F7VA 4KROC 1ZLWH 2HN7A 3B9EA 5H8DA 2WIMA 1KJVB 4ZOCA 2CJUH 3W9DB 3RWEA 1TPXB 4NQDE 1HYSC 4G7YH 2CDEA 2DJSA 1MFBL 2Z9TA 4KI1A 1J9CT 3X11A 1U41A 4X9GA 4MJIA 1J0IA 1QR1A 1DQQB 1AXSB 3SDCA 4FFYH 1JGEB 3BUYB 1IQWL 1D3CA 1XGYH 3E0GA 1AGEA 1LEGA 3NBNA 4TNVF 2IANE 4KU1A 1N5YL 5TE4L 1BFVL 5IR1A 2YR3A 3QH3B 1IGFH 3TA3D 3TVMA 2FBOJ 2GUOA 1U8IB 5BMFL 5IVNA 1GAFL 1X5HA 4PRDB 5LAXA 4M4PA 1DQDH 4HPOH 4QXUH 2M8XA 2DQTL 1IL1B 3THML 3QXAB 2OZ4L 1ZS8A 1OSPH 1SYVA 2Y5EA 1RZ7H 3IU3A 3BSZH 4DZBB 4ZYKA 3IB4A 2Y9RT 2FEEL 1FHGA 5D1XB 4IMKA 5IMMB 5DK2B 3QIBB 1QPXA 5FGCE 4LOUC 1D5BB 3QB7C 1N5AB 1BVKB 5GGTL 3C2AL 1A6UL 3EZJB 5HHOA 4TSCL 4QO1A 1KSRA 3ZMRA 1IC5L 3L9RA 1OW0C 4LLVA 4X8XA 3WS3B 5I8CA 4EN3A 4LCWD 4GRWB 2I60L 2J88L 4U1GB 3KPRE 4XPHL 4YLQT 4LSTL 5JOFA 2HT3C 4LRIA 1N6UA 3H9SE 4LCWB 4QHKI 5H94A 3MLVL 3GHBH 1A1OB 4P4KD 1A9BA 1U92B 2MPAH 3ZTJG 2PR4H 5FO9A 1IAIM 2HWZH 4I4WA 4TVPD 2VN7A 1QNZL 3ZHKA 4V2CB 3QDMD 4GRLD 1UYWL 2YC1A 2OMNA 2HN7B 3W0WB 2GY5A 4Y5XA 4KXZH 4DN4H 1A6WH 3U4AA 3U9PH 3FQTB 5HHOE 1OD7A 4GAYA 2XV6B 2XZAL 4FQJL 4GKNA 4MQXD 4MJIB 1QR1B 5I1CH 2V5RA 4J3VA 3WDIA 1AP2A 5DUPL 4ISVB 3WNNA 2EH7H 3IF1B 4XP1H 4OQTL 3DWTA 3IVKB 4AQOA 3SGJA 2I9LB 4WDIB 4OF5A 4RMUA 4QRPD 3O2DA 5IBUG 5HHVL 4TNWK 1FLRH 2HTKC 3QUXA 4PRID 5EA0H 3WKMH 4FTVE 4XBGA 2VR9A 1TTUA 2X4NA 3U83A 2L0DA 3VH8B 5KVGL 1U8OB 5ITFB 1R3HB 4YXKH 4RMRA 2LVCA 3RWJB 5KVDH 3L1OL 3OAYH 3VXRE 4DTGH 3QXUA 5BOZG 2HJLB 4UT9L 3I02B 3D85A 3QUMH 3OX8B 5ERWA 3RGHA 4F7TB 4Q9BA 2WP3T 1W0YT 4TRPL 4EBQL 2A83B 5KSBE 3RI5F 3MRQA 3N9GL 4PJHA 3U36B 3NIFE 4X7TB 1DZBA 3SY0B 2G5BB 3UBXG 1XGTB 1K8DB 3P77B 3JTTB 3LD8C 1WCQA 1AHWC 3RNQA 3FQUB 3NCFB 4ZS6C 2ORBH 4WI9A 4K7PH 4OZ4B 1FNEA 5HHOB 5F7DA 5IESH 4JQIH 1CVRA 5F1IA 2NYYC 4D9RD 1A14L 3WMSA 3LEXA 5CP3H 3PG2A 2FSEA 2AV1B 1D7FA 1BGXH 1A7BA 2C7UB 5E00B 2IQ9H 3L5WB 1CF8H 3O41A 3QWRD 5CILH 4APQB 2RGSA 3ULUL 1WBZB 2DQJL 4LGRB 5D5ME 1LDPH 3VJ6B 3P4NA 1B0WA 1QEWB 1KGCE 3D0VB 3GHEH 1X7QA 4WI3A 4YAQB 4ZNCD 5E5MB 5C0EB 1HH9B 4W6XB 1G6RB 3RHWK 2QQLH 1A4JB 3S34H 5CSGA 3VFMA 5D7KE 4MJ5A 3SBWA 5I1LA 5KSAC 3CVHL 3A0OA 1GAFH 2WINB 5I1KL 4MCZA 1CFVH 1EHLH 2FH6A 3MV7E 1MI5D 4Z0XA 5BVJB 4ZDHB 4C59B 3OJDB 3EYOB 3WE6B 4QXWA 5GGRB 3ARZA 4PP2B 3QXTA 1WFOA 3I50H 2J8UA 3TM6A 1H3GA 3G04B 4PJ7F 2R0KH 3UTZB 5F9AC 4PGDB 2MCPL 1E6JL 2X4NB 5KSUA 4RFEB 3QNXB 3QDGA 1QNZH 1NFDE 4XI5D 4Y4HA 3BHBA 1V05A 4JG1H 4GQ9L 2OR7A 3HC3L 4G6FD 3V5DA 4KQ3L 4PJIB 4NNYB 5HGDA 2EIDA 3MNWB 4HH8A 5C2UB 3D85B 4E41E 4ODXA 4K7PX 5A16A 4TN9A 4FZEH 4ELKA 2W65B 1P4IH 3KPSA 4GRLB 3MV8E 1KACB 1OAQH 4Z95L 1AO7E 3ARPA 1REIA 5ITBH 4NNXB 5GS1C 1OTUD 3IXAA 2R69H 3EOTL 3MCLL 3KPTA 5T33H 4WW2C 3RNQB 1YDPA 3P0VL 3NCCB 3MODH 1GXEA 1UB6A 1OCWL 4I0PD 5GJSH 4XBEL 3W81A 4F9PC 3GMPB 5L6YH 2GTZB 1WV7T 2XWTB 3NH7L 4JVWA 4NQVB 3TH3T 2MCG1 4KROD 4RNRA 1UENA 1T0PB