3C2AL

Antibody fab fragment 447-52d in complex with ug1033 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
216
Chain Sequence
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVLWYQQFPGTAPKLLIYGNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYFCATWDSGLSADWVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 447-52D light chain
publication title Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 216
sequence length 216
chains with identical sequence M
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c2aL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c2aL01
2E9IA 3QUZB 3NGBC 4JFFA 1T66D 1XAUA 3D18B 4WFGD 4Q6YA 3ARDA 2ICWJ 2IADB 3GMMB 3NGBB 3V52L 4U1JB 4C59B 3U4BL 1P5UA 3KPRA 5TPWL 4F7PB 4QXWA 6CGTA 2FX8H 2Z31A 4AL8H 1A6ZA 4DJMA 4NZJA 5E8OA 2DTML 3HNVH 4F3FB 3KPSD 1ZT1B 3DX9A 2ZUWA 4ZAKD 4G80A 2C7UB 3I02A 4XBEL 2W65A 4R4FL 1ZA3B 4MLIA 4XPHL 4JDZA 4WTXA 3TO4A 2FL5B 3OB8A 2VABA 1HI6B 2UYLB 3OKLB 2BOCA 3QDAA 4PGEB 5D1ZA 1MHPH 3MLWL 3VFWA 4HS6A 3MV9E 1TPXC 1DQTA 3WFCL 4AENB 1RK0B 4OGAD 2O5ZH 2IBGA 2VO5A 1TPXB 4K8RC 3OF6D 4F9LC 4D9LH 4FQJH 5EBMB 4KXZI 3GMLB 3NZHL 1EV2E 4ZODA 3O2DL 4Z78B 1CZ8L 1CVSC 4Z7WF 2NMSA 4MQXD 4Z0BL 3G6JA 5EUKA 3HN3A 4KJWD 1U3YA 1WAAF 3SKOA 3JWDL 1OVZA 5KSBE 1QR1A 4O2EA 3WDHA 5HGBA 3ZSSA 3ZZ1A 4DWHA 1FZOA 1NCBH 4Y1AD 2ZUUA 4LPXA 2P8PA 5TE6L 4A6YH 3ET9F 3GGWB 5B4MD 3MNWA 3JTSB 3I6GA 3MRIA 3SDXA 4RDQG 4KK8D 2N4IA 3VXTA 3ARFA 3IFPA 1FYTB 4ZDHA 1YA5A 4HH8A 3T08A 3TIDA 4OZIF 3PNWA 1JMXA 1PYWB 1N8ZB 5I1JH 3HNSH 4IRJA 3U4EB 2OZ4H 5J89A 4WO4D 1QZ1A 4Q0XH 4Y4HC 5CINH 3VMNA 5DD1L 2GK2A 1YMHA 1FO0H 4Y4HB 3G6AB 4OLVL 4Q9RH 4ZUVB 4I0KA 2EZ0D 4YLQT 3IDIA 1QHOA 3PWJB 4NN5C 1NBQA 2CDGB 3VI3F 3ZE0F 5BW7C 2VLLB 2CUMA 3NN8A 4WTZG 4YC2B 4NN5B 1GGBH 2OR9H 4U3HA 4ZPVB 1W0VB 3BT2L 3VXQB 1U8MA 5E1AB 2E9JA 4OKVA 4YFEA 3SN6N 5GIRA 2ITCA 3RWHB 3P0VH 4FQ2L 4W4OC 3I6KB 4JM4H 4NUGL 4U0RC 4HZLB 3BH8A 3EO0A 1Z0MA 2HFFB 3ALWA 4P3DB 3EHBC 4CVXA 4U0RB 4O2FB 4M43H 3Q5OA 2VAAB 5I17B 5B3NA 1ZT4A 5J6HA 2ARJA 1FVCB 2A6KA 2EDWA 4WI7A 4LCWD 5BCAA 3GZKA 4G9FA 5IBLC 5F71A 3RL1B 3ZTJH 3F12A 4FTVA 1R3HA 2W92A 1DJSA 4LGSB 2X4RA 1K4DB 4EOWH 2G9HB 3JWOH 5EN2A 5CP7B 3ULVC 4MAYD 4ORGB 3LOWA 5EUOB 5DVOA 4MLSA 2LAAA 2C3WA 4HKZA 4UBDC 4LHUG 5EZIL 2A9ML 1P7KA 4BQBA 3MV8B 3W39B 2BC4B 3G5VB 4OFDA 3VXSD 4HXBH 4DVBA 3I3BA 4K3JL 2ZCKH 5C7XL 2A6IB 5EU6A 4DVRH 2YPVL 3H9YA 5ICXA 4QT5B 5IHBA 3L3IB 3HE7A 3QNXA 2R1YA 4PB9L 4A2MA 4ERSL 5GGQH 1JMZA 3BFOA 3MGTA 5T1MB 1FJ1B 3QUXC 3W0WB 1MPAL 3UYRH 5HD8C 2AV1B 4A2LA 2B4CH 3P4LA 4W70A 3QUXB 4R4ND 1RY7B 5FUCC 5I1EL 5HHNA 5FO9B 2D2OA 4DGVL 1NCCL 3T3MF 2BVUA 4EUPB 5HHQB 5IJKA 2NXYD 4M9OA 5IB1B 1IEAA 1MJUL 1UVQB 3UTSB 7CGTA 3V2AR 2XNAA 3BZEA 4HBCL 1W72A 2FBJH 3DV6A 3GSVA 1SYSA 3E8UH 4LCWE 4G6FD 2F5BL 4U7KA 3F7YA 5ENWB 2ZWLT 4PTTA 4NKIL 2KQNA 5JOEA 5GSRB 2OP4L 1SEQH 1RZIA 1B4JL 3O8XA 3QYCA 5MHSD 4PS4L 2EKSB 2AEQH 4WTZA 1VGEL 3RWJA 4E0RA 5C6TL 4MCYA 4OCYL 3VXSE 5LCVL 4ZSOB 1RU9H 4RGMC 1NGXA 3TBVB 3FN3A 1KIRA 3AMKA 2YS4A 4WHCA 4RGMB 4Z5RB 3JTTB 5EPMA 2X1WL 3D6GA 2UWEF 4PRAA 4YO0A 1T6VN 4XBPB 3UBXB 2YKLL 5I76A 2Q87A 1IRAY 2YWYA 3MXWH 1FN4B 4H26B 2CKBB 1K4CB 2DQIL 1C16B 1NAML 1LE5A 5JW3L 3KLHC 5FUZH 4D0DA 4F58H 4XXDB 1HILA 3GBMH 1X5XA 5IJVB 2DMKA 1B2WH 1FFRA 3FN9A 1T2QH 5JPNA 5JZ7D 4NZTH 2DLHA 1JHLL 3CLFL 4N9GB 1OP3H 3P4OB 1WBXB 2OTWA 1NMCB 1KG0A 4LHUA 4NC2B 3TGXA 2V5TA 4JY5L 3I3EA 4Z0XB 2X05A 3MFFB 4LQFH 5JPMB 1PY4A 2W9EH 5TGBA 1ZEAH 4MD0B 5J6GB 2G2RA 3F7RA 4KDTA 2EDXA 4IHOB 4IJ3C 5HHVH 1MHHA 1YJDC 5F9JB 1MCSA 4H20H 4IJ3B 3D39B 1QVOA 4RWHA 3O45B 5BVPL 3C08L 4LSSL 3O3AB 3K4DA 2BSED 2EH7L 3RVUC 4BFIB 5I8KL 4GAYA 1HSBA 1R0AL 3VGHA 3BP7A 4I9WD 3BP4B 4JGUA 4JR9L 3UJIL 1K6QH 1UJ3A 4M62H 4Y16C 2QEJA 3A6CL 3KVQA 4B7IA 2I9TA 4XPFH 1AGFB 1NC2B 3ULUC 2XZAH 5LQBL 4Y16B 4P5TC 2A0LC 2DBJA 3ALPA 1X9QA 3O6LH 4QXUL 2X40A 4NRZA 4XCNA 5EBLA 4P5TB 1MCNA 3T4AB 4OLXH 2OK0L 3MZTA 4HG4J 3KLSA 2BNUB 1Q9KB 4C54A 3SE4A 1KBGH 4GUPB 4X7TB 4UDUB 1T0MB 3L5WA 4TSCL 3LZFH 5AZ2H 1FDLL 1A4JA 5FO8A 3QH3B 1TZGH 1S9WA 2BSRB 2GITA 4LFHG 4RMRA 5JR1L 3P3YA 1JNLL 4MD4B 5H37H 4G8IB 2AKRA 2OMBA 5LAXA 3QI9C 3F5WA 4NKMA 5HGAA 4ZOBA 4WW2B 1KJ2L 2PO6A 3BW9B 1G0YR 5E8EB 1HQRB 3LKOB 3QI9B 3R0NA 4KK5D 2RFXA 3EJZC 4L8CB 1T1WB 4JKKA 1QSZA 4JCLA 1A3LL 3O6FD 4X0KA 4K94L 3QDMB 2F5AL 4X6CF 1FLRH 3VGGA 2BFVH 3HPJA 2EC9T 2FGZA 4PGBB 1G6RH 5I30L 4BH7B 5ICYA 4KPHH 5CEXB 3NIFE 1CDYA 1QKZH 5IF0A 3MSPA 5ACLA 4WHTA 3QNZB 3DLQR 5DJYA 1P69B 3T3PE 1OOAA 5F7NC 3IDUA 4MA7H 2I27N 3MRPA 4XVSH 5FOJA 3IU3A 2P46B 1QBLL 1T5WA 2EDYA 4P23C 3NFPB 5CD3B 4N8PA 2FJGB 4HIXH 5DEZA 1GZPA 3ZDYF 3CMOH 3OR7A 1YN6A 1IT9L 3MRLB 2NY3D 1Z3GL 3VWJA 4IRSA 4EI5A 1SYVB 5HHOB 1I1FA 2YMXL 1AKJD 5T5NG 1WBZA 3U83A 1CICC 2EDNA 3ARTA 3FQXB 3QWRD 1SY6H 1CICB 1JWUB 2B5IC 4U2ZA 4WFFE 1I7TA 3AXLB 1KLGB 4RAVA 3RWEB 5C92A 3FKUS 1ZLVK 4CRPA 1HNGA 2B5IB 5EBWA 2D7TH 4UQ2B 3MRRB 3VG0H 4NQEA 3MOQA 4MGXA 2Y36L 1S3KH 1AGCB 1G7PA 1RZ8B 4R7NA 1U8JB 3PWUB 3WNMA 1VGKB 1F3RB 2M26A 3HMXL 1A47A 2NR6C 3SE8L 5D2NE 3BHBA 5ILTH 1NLBL 1JWMB 4KV5F 4K2UH 3MR9B 3HS0B 3FONA 2DM3A 2J5LB 4XRCB 4RWYL 1TTGA 3TJEL 4WI3A 4W6YB 5B3JF 4WU7A 1CK0L 2D7NA 5IFAH 4A6YL 5D1XA 4L5FH 4Z18A 4ALAH 4ZFOA 3MBEC 3OB0K 3VH8B 3SDAD 3EDKA 1ORSA 1XF5B 2Q1EA 3MBEB 1E4XI 5I8CB 1MF2H 2IBZX 5LGKA 4GRLC 1JK8B 3K0WA 5DD3H 2OZ4L 3GMNA 4GRLB 3B9KD 5CINL 2ATPA 5DMYA 1G7QA 5ID1A 2BNQD 4I18A 4Z77A 2VL5A 2YD9A 3L5XH 1Q9OA 1SVZA 3SO5A 4ZOEA 4BFBD 1R3LB 2CMRH 3KYAA 5H8DA 5EOTA 4WUKH 5C0AA 3LIZH 3RUGE 5IHUL 4OLUH 1KNOA 2OR9L 2G5BA 4PJIB 2P45B 2HG5A 4G7VH 2D3VA 5C0GA 3C5ZB 3RWIA 3STLA 2VDPH 4R7DA 3BIKA 1KCKA 2ZUQC 1F8TH 3M17B 3OJVC 4NQDD 3HE6C 1UGNA 4FQHB 4S1DC 1GGIL 1NFDF 4M43L 3HNTH 3W5MA 3HE6B 4LOUD 5C08A 3HUJA 1CDUA 1YEKL 2VOTA 1AJ7H 1A1MB 1JHTA 3CAFA 3KXFB 4OGYH 4RFEB 4E42A 3MV7E 1E27B 1YY9D 4YDJB 3O3DB 5LXGL 4NKDA 1QBAA 2VSDA 5F93C 1HE7A 4MNQD 4N0UA 2A6JB 3GSOA 2MCPL 3P9MB 4PUBH 3UJJH 3P4NB 4PY8I 4BFGA 1IKFH 2QL1A 2W0LA 2YHGA 1BVLA 4QRQB 1EPFA 2LU4A 3DGCR 4ENEC 5MENA 2BNQE 3BIBX 4MX7A 5M7QA 4OFYD 2R56H 3CNKA 3BESR 4GBXD 5I73C 1CFBA 1IC4H 3MLVH 2WUBH 5FOBA 1A2YA 2VITB 1MFBL 3I75B 3GUTB 2IH3B 5GGQL 5MEOA 3UYRL 2VQ1A 3ARDC 1RUQL 4JPWH 5C2BL 2B4CL 3FFCA 4JFFB 3N50A 3K4AA 1MWAH 3ARDB 4RGNC 3F58H 4PJGE 3AS3A 5EOQL 2YA1A 3KPRB 3AMLA 3OQ3B 3OL2A 1UQSA 3EYVA 2Z31C 3BKYL 4C4KT 1KB9J 2FZ3A 4YHOH 3HZKA 2Z31B 1R5WB 1A6ZB 5E8OB 3TT1L 3VWKA 3GIZH 1JNHA 2GUOA 4GFTB 2NZIA 3WIHL 3DX9B 4Q2ZA 4G80B 3X3FH 2WQRA 2APTA 3QHZH 1CDJA 3I02B 3P9LB 2W65B 4JDZB 4AH2A 1SEQL 3TO4B 4MNQE 2VABB 4XT1C 3GSNA 4LCIH 2BOCB 2C3XA 4ZNEE 5HGHA 3VFWB 3WYRA 2XQYK 4HS6B 5FM4A 4FFZL 3ZYIA 1HINL 1EAJA 2AI0L 4HGMA 4NSKA 2XY1A 1T1YB 1MJ8H 4YHMH 1RVFH 2EXWC 5EWIL 2VQUA 2AP2A 2VC2H 1U36A 4GG6F 2I07A 3OR6A 2P48B 3G6JB 4KH2A 4Y5VA 5EUKB 3LQAH 4NP4L 4XPBL 4F7MA 2X89A 3SKOB 2GAZA 3UEZA 1CG9A 3QCUH 4R3SA 3RVWD 5JXEA 2PKDA 4O2EB 5FUZL 5HGBB 3N0PB 1U3ZA 2R69H 4LHJB 4O2CA 1FZOB 5SX5H 2P8PB 5I1LA 1F2XK 3ZYJA 2ZG3A 4U33A 5FAAA 5IW6A 3MRIB 2IFFH 4QNPF 3SDXB 4X4YA 3VXTB 5IP4A 4LPWA 3ZDXF 1SHMA 4JPVL 3TIDB 3GO1H 1JGLH 3PNWB 4LQFL 4IRJC 5F7FA 1YDPA 4IRJB 4LCUB 3T4YA 3E3QC 3GBNL 4FABH 2WNGA 3ZE2E 2A74A 4DUWA 4K3EL 1YMHB 1G7JA 1Q0XL 4JREC 4NQCD 2V17L 3ZHDA 4HEPG 3IDIB 3QEQE 3JBG7 4XTRD 3FL7A 4JREB 4YHZL 2VWEC 4OLWL 3SQBA 4M62L 3NN8B 2X44D 1HN1A 5KSAC 2J8UE 3SGJA 2J4WH 1AQDA 5FXCH 5KSAB 4OKVB 3NFSH 3QQ3A 5I1GL 5E8PA 3DBXA 5GIRB 2C9AA 2ITCB 3QG7L 2XZZA 4GH7B 3JUYA 1UXSA 2V9TA 3BH8B 1YEGH 3EO0B 1AC0A 2VIRA 3BE1L 3VFNA 4U1SB 4CVXB 4LSQL 2BRQA 5FA3B 1I85A 1ZT4B 5J6HB 2E8ZA 2ARJB 2A6KB 5AAMA 4D0CA 4KKLC 3D85A 3T09A 4BZ1H 4G9FB 1KUMA 2W0FA 3F12B 5ANME 4FTVB 1R3HB 2AW2A 2X7LA 1INEH 2X4RB 4FFWD 4LEXH 4Y2DD 5FKPA 5B8CA 5I66A 5LBSH 4CW1A 5EN2B 3TLRA 4NCDA 1X5YA 4XHJD 3ARGA 2AABH 1F58H 1JZ6A 1P7KB 4YXHH 4UIKH 3BJ91 1FLRL 1NGWA 4YDKL 3DX8A 2BFVL 3V0AC 5FV2A 3D3VB 2HTLC 3BPOC 4DVBB 3PWVA 3IAGC 1CGSH 2X41A 3OG6B 3HE7C 4KPHL 4NQCE 4YIQA 5EU6B 5ICXB 3U0PA 3BPOB 2AXJA 4JO2L 5B21A 5JW4N 2D0HA 3HE7B 3QNXB 2IGFH 2R1YB 3AUVA 3QULA 2E7BA 4NUJA 4JRXE 1AGDB 5CILH 3MGTB 4PJXE 4M7LH 2WP3T 2OLDA 2FWOA 3RVTD 1MHCB 5HHNB 1N4XH 5CEZH 1KLUA 1OW0A 5K59F 4KU1A 3U2SA 5IJKC 1VHPA 1RHHA 3CMOL 5DWUL 3O3UN 1NC4D 1QYGH 3DNKA 1RUKH 1IEAB 4WY7H 3O2WH 1T7YA 2XNAB 3V6FA 1W72B 4R0LA 3DV6B 3GSVB 4XX1E 1SYSB 3GIVA 1A5FH 1IEBB 3R4DA 3F7YB 3IFLL 3IFNH 4OFVA 4ZYKB 5D9SA 3HRZA 3EYSL 4PTTB 1EA9C 4LU5H 4QGTA 5D96C 1HH6A 1RZIB 4UT7L 2HKFL 5D96B 5EIIA 5FGCE 2D7TL 3UTTD 1PZ5A 3T0EA 3VMPA 4HCRA 3FRPG 4M1CC 5DJ8A 3VXMD 3SDDD 4XPGL 1S3KL 1NKRA 4E0RB 4MCYB 4LLAA 3WL9B 1A1OA 1S78C 1ULVA 4TTGA 1NGXB 3TIEA 1KIRB 3BEVA 5AYUH 4HS8H 4MQTB 5ILTL 3A67H 3CLEL 3P11H 5EPMB 4K2UL 1PSKL 4X8XA 3FO2A 3DRTA 3ESUF 2ZG2A 4PRIA 4PRAB 4YO0B 3IVKB 2I60H 5TH2A 5EU4A 5D72H 4OV5A 3L95A 2VLJA 5H2BA 1UM6L 3DSFH 2AXGB 1NGQH 5KBNC 1MAKA 4OZHF 4M1GH 1BLNA 4D0DB 5C8JA 4OZ4A 4TSAL 1BHGA 4AQOA 1HILB 1OHQA 1MF2L 1OM3H 5JPNB 5KZCD 1BFOA 5DD3L 1QFWM 3PP3K 2OTWB 4GQPH 1KG0B 3L1OL 2IC2A 1HK6A 3BWUC 3EOAA 4TTDC 3WFBL 5EBGA 2DIBA 3L5XL 4LMQI 5TGBB 3TN0A 4LVEA 2G2RB 4ZS7L 5DT1L 4JAMB 5JHDA 5DFVC 1MHHB 1JZ7A 5HI5C 2VXQH 3WNLA 1QVOB 3VXME 2RJMA 4Z9KB 2VSCA 5FB8A 1UCTA 3TYFA 4HFWA 2DQUH 4GAYB 4N8VA 1HSBB 1UADC 3BP7B 4IRZH 1WWCA 2XTJD 2F58H 1UJ3B 1UKSA 2HLFC 2VLMD 5ABDE 2I9TB 1F8TL 3MPCA 4U1GB 3QFJA 3LD8C 3L3OA 2EKJA 1DLFL 4MWFA 4NRZB 4XCNB 5EBLB 2JELH 5FYLE 5LWYH 3LD8B 4M5YL 3SE4C 1NUFA 4BSVA 3RJQB 4XPTH 1MY7A 5F1IA 3L5WB 3SGDI 3JZ7A 4NO0A 1S9WB 2GITB 3KDMA 1MCBA 2AK1H 4TYUA 4HWZA 4NN7C 4YWGH 2FECI 4JM2D 2AKRB 3VD3A 5LAXB 2V5YA 4P9ML 4NKMB 2PTVA 5HGAB 3FRPA 5D7JA 2YEZA 2PO6B 4NN7B 3FTGA 4EN3C 3Q48A 2RFXB 2P5WB 3K3QA 3GDBA 4EN3B 3MCKB 2HA1A 2QQKL 4X0KB 3MLVL 1ERNA 4NZRH 4KI5F 4U7MA 2DLFH 4DKAA 1F2QA 4ZFGH 2MWCA 3HPJB 2WWMC 4JZOA 4ODVH 4I2XA 1EIBA 1RI8A 4CU8A 5ICYB 1BPVA 2FO4A 5CEZD 1JZ8A 5IKCA 4P9HH 1CBVH 3HMWL 3H9HA 5IF0B 2VLRA 4CMHC 1MI5D 1GSMA 2BHZA 4WHTB 4HFUH 2AERT 4J3OC 5DJYB 4CMHB 4YDVA 4YPJA 2GCYA 2ADJA 3MRPB 3IU3B 1LO4H 1T5WB 1BF8A 1E4KA 4HUNB 1GZPB 1KGCD 4PJAE 3OR7B 3VWJC 4IRSC 4EI5C 2KPNA 5GRYA 5HPOA 2XRAL 3BAEH 4JJHA 5CCKL 1U3JA 1JF6A 1PKQA 3QUML 3VWJB 4IRSB 3X3FL 4EI5B 5C6PB 1WLHA 1I1FB 2IAMA 1KV3A 4G8GA 4HXAH 4MXQC 2IQAA 1FIEA 3BP6A 5H94A 4OTXH 4JFXA 4RAVB 4BQ8A 1SMOA 3V95A 3QUYA 5EBWB 3TP4A 3VXUA 5T1KA 3L3DA 4NQEB 5IG7A 1RMFH 4AEHH 2KZ1B 3CXDH 1HHHA 3O6KH 2IPTH 4I1NB 1BOYA 1QFOA 2DMBA 4K3DL 1OSPH 1G7PB 1U58B 2DQTL 4R7NB 2IQ9L 5BRZD 1CWVA 2D9QB 5KVGH 2VC2L 5MERA 3WHE0 3WO4C 3WD5L 1BFSA 3CZFA 4XAKE 1JZ5A 3DWTA 5C0DA 2JJWA 3WO4B 5CEZE 3BHBB 4PJ7A 5IBLD 1CDIA 4UI2A 2ITDA 3UJTH 4X6EA 1FYTE 3Q3GB 3FONB 1BFVH 1JPFA 5EA0L 5DJDA 1ORQA 1R3JA 5FYLL 4YHLL 4WU7B 3OAUH 3MV8D 2HVKA 1MOEA 3MLSH 5D1XB 4D94A 1KGCE 1I9IH 4ZFOB 3WN5A 3DETD 2J6EA 1FIGH 1PW3A 1ORSB 2XFXA 5LGHL 1LP9A 4IDJH 5J1SC 2OI9C 1CL7H 2H2PD 4NZUH 3OAYH 2MQ0A 2X4QA 2J12B 4I18C 2OI9B 1RULL 3GMNB 2HJKA 4KAQL 2X70A 2ATPB 1G7QB 4N0YH 4I18B 3LEVL 1EERB 2RCSL 1CLZL 2W59A 5KSVB 1JPTL 4Z77B 4PJ8D 2X2YA 3SDYL 1AQKH 1Q9OB 1N5AA 1F00I 1ADQL 5I1KH 1MELA 1YY8A 35C8H 4I3SH 5EOTB 5DUBB 4QTHB 4Z7WE 3FRUA 2YUZA 5C0AB 1S7UB 4GKZA 2MJWA 4PJCF 1WAAE 4JFOA 2VISA 1KNOB 1X4YA 2EC8A 4KRPB 4RA3A 2G5BB 3IDGA 2HG5B 4Z7QF 1A6WH 3TYGH 5C0GB 1WIUA 3BJLA 3RWIB 3STLB 4R7DB 5DHVA 5TQ2L 1WUNT 3S5LG 5TQ0H 2AXFA 1EUUA 4KGLA 5CUSL 1V7NH 5HDQL 5JMOC 2UUDH 5C08B 3LEXA 4L9DA 2XTLA 3HUJB 4DK3A 1KIUA 3IDXH 1J5OL 3ULVE 3A6BL 4E42B 4ZUSA 4OCSH 1OAKH 4DGIH 3MV8E 5JOPD 3DYMA 5DQDL 4NKDB 1INEL 4OT1H 3O41A 5LBSL 2JIXA 1VFMA 3K2MC 4JO1L 2DI8A 4M00A 4N0UB 1FFPA 3GSOB 3BYTA 3MRQA 2AABL 3TC9A 3OKDA 1BVLB 2EIEA 1WWBX 1GGTA 4UIKL 4D9QE 3TT3H 5MENB 2FEEI 1DBBH 2X4SA 4U6XA 4MX7B 5C3TA 4XP5L 3CCHA 4PP1C 3CPLA 5F6HI 4NKOA 2GSIA 5FUCE 1S9VA 2PF6A 5FOBB 1A2YB 1JL8A 5FYJU 1EO7A 3WKNA 2JCCF 3UTSE 5D6DC 3OJMB 1OCWH 5EUOF 3S4SG 3KLHD 2VQ1B 4XCYA 1RZ7L 3CH1A 4MJ6A 4OI8A 3FFCB 4LGRB 4L8SA 4ETYA 4ZD3H 3S3PA 5CEZL 3NH7H 4MZ3A 4Y8DC 3PXHA 1KN2L 2X9WA 5T1DL 1UQSB 4RFNC 1QNZL 1KB5H 3QEGL 2XA3A 3EYVB 2DYPA 1Z6JT 1YPZF 4XNUL 5AYQA 1EJ6A 1I1AD 1B90A 4RFNB 2UZYB 2ZKHL 3HZKB 5GHWH 5E8DH 5CKGA 1JNHB 2GUOB 5JOPE 4OD1H 3RWDA 3MLRH 1CCZA 3KYMA 4ZSOE 4F57H 3OGOE 4YXLL 2FEDC 1IZJA 4AH2B 4ZFFA 1B9ZA 4G6MH 3CSYA 3H0TA 3GSNB 1MFNA 3L3JB 3RX7A 3L7EB 5HGHB 3DURA 5D71H 1GHFH 3O4OC 1ZLUK 3SY0A 3F7PC 1L0XA 4LLMB 1QP1A 4ODBD 5AUMA 3RA7L 3P9WB 3O4OB 1HQ4A 4NSKB 4HJJH 3S5LA 5AYUL 1V3MA 3W82A 3SGEH 1BBDH 3T3ME 3REWA 4Y0GA 4Y5VC 3SKMB 1G7LA 4BKLA 4JG1L 2I07B 4LKCB 2GYSA 5BO1L 3OR6B 4Y5VB 2G60L 1OY3B 5JXEC 1OT2A 4F7MB 3DSFL 2GAZB 1N7MH 1CG9B 1NGQL 2YWZA 3VJ6A 2IG2H 2COQA 4R3SB 2AJ3B 4Z7UF 2HJFA 1F6LL 4GO6B 5DZOA 1FE8H 2PTUA 4K55A 3IU4L 1D5ZA 1NCNA 4CNIA 5ELIA 1KACB 4O2CB 4D0BA 1UH2A 4WTWA 4ODHL 3ULVL 1OM3L 5I1LB 3RNQA 5KSBA 3D39E 4EIGB 2VDKL 5IW6B 4JB9L 4X4YB 3G04B 3PHQA 4RMWA 3TH2T 2C1OB 1OAYL 1KJ3L 5DR5H 2F19L 2IH1A 1GAFH 1A7PH 3F7VB 1CXHA 4QF1A 5GRVL 3T4YB 3KPSA 5IT2L 1CU4L 2VXQL 4ZAKA 2DQFA 4NYLA 2A74B 4AEFA 3ULUE 2BXZA 1G7JB 4PJDB 2AVGA 4XXCA 3SGJC 4M4RA 2WAHA 4P23D 2F58L 3KYNA 5IM7A 2Y06L 2IWGA 4GMSH 3H7LA 2DBLL 4PV9A 3SBWA 2ILLA 3RPKA 1TVHA 3QQ3B 4P3CH 5E8PB 3DBXB 2JELL 2ICEA 3OF6A 4TPRL 3HI6L 1UXSB 2X4OA 1I85C 1KIQB 1U6AH 4RRPG 2VIRB 3VFNB 2C1PA 4X9BA 1X6NA 3ARSA 2ADFH 3D0VA 3D2UD 4D0CB 3D85B 3QDME 3WS6A 2VDOH 1ZANH 4WWID 1NAMA 1G9NC 3X14A 1SJVA 4YWGL 3V79C 2W0FB 3RNKA 3BEWA 3HZYB 1SQ2N 2X7LB 5B8CB 2LVCA 2AJYH 5FKPB 2I5YL 4OLYH 3ARGC 5I66B 3LSOA 4QYOA 4CW1B 5ETUA 2W0PA 1KPUA 4HD9A 4QRSA 4Y1AA 4NDMA 4OGXH 3QIBC 4Q58C 3ARGB 3OKEA 2OYPA 1REIA 3MCLH 3O0RH 5FGBC 2VLKD 1NGWB 3DX8B 1S7SB 1G7MA 4YQXL 4F80A 3PWVB 2H2SD 3PIQA 4U7SA 4YIQB 4I3RH 3U0PB 2GK0A 3IT8D 2CKBL 4QXGL 4WO4A 4WW2F 3HHRB 1DCLA 4PB0L 3FHAA 4XP1H 5INDA 1NL0L 1U8IA 2W9DL 3QULB 4NUJB 3BQUC 3PWPD 3PF2A 1IVLA 2W60A 3MBED 3PP4H 4ZTPH 3BQUB 1OW0C 3O2VL 1OPGL 1ZHKA 3LEYH 3MJ6A 5GGRA 1KLUB 3U2SB 1TFHA 1FGVH 1RHHB 3OXSA 5BMFL 2EE3A 4I0PD 1S7QB 4OUUA 1UWGL 4R0LC 2VQTA 1FRGH 1NSNH 2W1NA 3JV5A 1BM3L 3SGKC 5F3BA 1J11A 3V6FB 3LKQB 1JBJA 1U8PA 3ZHLA 4R0LB 1KULA 2GY5A 3S88L 3GIVB 1C5CH 2ZCHL 1INDH 4TUKH 1YJDL 4FN0A 4X7SL 1TTUA 5D9SB 3HRZB 3U6RA 2VDRH 1KXTB 4OTXL 3IF1A 4LCWA 1OTTC 3T0EC 1HH6B 4NM4L 1BX2A 4UTAL 1PZ5B 3T0EB 1KJ2A 4RSVA 1PX4A 5DJ8B 2D7PA 2VLKE 5DURD 2YBRA 1OSPL 4S1QH 4MQ7A 4U6VH 4S1DD 4MAYA 4QWWC 2HWZH 3MJ9H 2C4FU 2DWEA 4NBXB 5DEGA 3TIEB 1DVFC 3CUPA 5DRNA 5I8OL 3BEVB 1CFSA 2Y07H 4NT6A 4XMLH 2QQNH 2IJ0C 1VKXA 1CFQB 1EDQA 3ZDYE 3VXSA 3DRTB 3FO2B 4RRPA 2OCFD 4PRIB 1BFVL 2FHCA 1LE9A 5TH2B 3LMJL 5EU4B 4OV5B 3L95B 3INUH 5H2BB 4E9LA 4MJ2A 4WFHD 2ED9A 3OAUL 1S5IL 4BQ6A 3MLSL 1DN2A 1I9IL 4PYGA 1BLNB 4KDVA 5C8JB 2AJUL 5HHXH 1TJGH 4JRYD 3ETBF 4OZ4B 2OR8A 1YEFL 2XA8L 1I9JH 4OF7A 3RU8L 1BZQK 1LO2H 1BFOB 2PETA 5KAQG 2R2EA 4N0YL 2ARJQ 4QKXB 3EOAB 1ZTXH 1AQKL 5DC0A 4KMTL 3ZTJG 2YD5A 3LKRB 5JHDB 3MO1A 35C8L 4I3SL 2H1PL 3OJDA 4RGND 3W5NA 1ZAGA 1YEDA 1ND0B 4RMUA 4OLEA 5FB8B 3TYFB 4HFWB 4KV5E 5CGTA 1KCRH 5CGYD 3TYGL 2GFBA 2EDBA 5I1CH 3GI8L 5IMKA 4KTYA 3QFJB 3L3OB 5C07D 3IJHA 4MWFB 1QSED 5EU3A 1C08A 4TOYL 4H25A 4WFHE 2A9NH 4OCSL 3DTXA 3ARWA 3HG1D 2CLZA 4BSVB 4X7CC 4N8CH 2ATKA 4PJIF 4Y2OA 5F1IB 3G5XA 5CD5C 3B2UC 2O5XL 3IS0X 1F4AA 3EAKA 1AXSA 4NO0B 2C3GA 1UACL 1IAIH 3KDMB 4HMEA 2V9RA 4A6YA 4NIKB 4HWZB 4XNYL 4J3XA 3VGAC 3VG9C 1DLHA 3RZCA 4M6OL 2M1KA 3KPMA 3M45A 5D7JB 4LLDB 2YEZB 5E5MB 3VGAB 3VG9B 3TT3L 3FTGB 2EXWD 4N5ED 1ITCA 3VFMA 2ENYA 1MSPA 2EXYC 2H32B 1K85A 3DJ9A 3WIFA 2F54D 1AI1L 2OZ4A 1Y0LA 5F1NA 1RZJC 4NKQB 4RGNE 2Y72A 1JYXA 1VFAA 1KCVH 2YXMA 4JZOB 5CSBA 4UNVA 2NXZD 4I2XB 2FJHA 4O4YL 3ESVF 2KQMA 1EBAA 3LCYA 2FO4B 2R0KH 3H42H 4LPTA 1CS6A 5IKCB 1TTFA 5F7WC 3H9HB 5DYOA 1JFQL 2VLRB 5SWZD 1N5YH 4RNRA 3G08A 1J8HB 2FLBT 2HMID 4YDVB 1U2HA 1KB5L 4QRPD 5EU7E 1E4KC 4FS0A 4N1EA 5C07E 2ADJB 1QSEE 3IXAA 4JHWH 2DQCH 5GHWL 5E8DL 3QRGH 1MH5A 4QHNA 2B0SH 3WUZA 4F9PA 3MLRL 2IAMC 4DKEH 1PKQB 4HWNA 4TVPH 5F96H 3C87A 4XPAH 5HJ3A 2IAMB 4G8GB 3S37H 4CUCA 1TMCB 4YX2H 3GI9L 1AGEA 2IQAB 3BP6B 2Y5EA 3PUCA 5H94B 1DBJL 4M02A 3QUYC 5D71L 4JFXB 1I3GH 4UT6H 4H0GA 5ICZA 1FNSL 4OV6F 2DF3A 3G6JE 3QUYB 2F54E 3V4PL 4YK4C 3VXUB 3MYZA 5T1KB 4WENB 3L3DB 3VFSA 1R3IH 5IG7B 1JCKA 1HHHB 3GJFB 3TNNA 2CIIB 3CVHH 4YK4B 3HAEH 4S2SA 5T3XH 5MERB 2JJSA 3FB5A 3O6FA 2R1WA 1HH9A 4AEIH 4F7TA 5C0DB 3E0GA 4HV8A 1RUML 1U8OA 3SDXE 4D9RD 5SWZE 2ITDB 4X6EB 2PYED 4V2BA 2E7MA 1CQYA 1J18A 2CUIA 1VSCA 1JPFB 4OQTL 1FE8L 1NCWH 4KVCL 2BHYA 5DJDB 4TSBL 1FCGA 1ORQB 1R3JB 3RAJH 5D2NA 1VDGA 4KKBD 2HVKB 4X4XA 1IE5A 4QHUA 3WN5B 3DMMD 5EH1A 2DD8H 3E3QE 3QO0A 4XMKH 2NPLX 5KSUA 2HTLD 5DR5L 1LP9B 4AQ1B 2X4QB 4U1NB 2DWDB 2AS5M 3B43A 3WIIL 2HJKB 2VWEE 2X70B 3V4VH 1XCTA 1HXMA 2DRUA 5BZDA 1N5AB 1AKJA 3W9DA 5FHAL 5H37G 1R6VA 1XF4A 1YY8B 3BOVA 5JIHA 3T0VA 1VERA 3QWRA 4GJTB 3I50L 4JFOB 2VISB 2QQLH 2XQBL 1NAKH 5DO2C 2NY6C 4XCCH 1J88A 5TE4H 3N1PC 3UPCA 4JFDD 3FO1A 4FTVE 2NY6B 4I77H 1LO3L 4EVNA 1AXTH 2AXFB 1OAXH 2DLGA 4D9RE 4G5ZH 1U6AL 2PYEE 1GIGL 3PGDA 4PREA 3JWDC 2V5SA 2FH6A 2EH8H 3C2AH 3LEXB 3ZDXE 5C70A 1WITA 2ADFL 4BM7A 3BDYH 5EOCL 3JVGA 2RIKA 3QHTC 3D3VE 1FPTH 4POZD 3KLDA 5DDHA 2AJYL 1AY1L 4JKLA 3O41B 4YHNA 2JIXB 5EU6E 2EECA 2VZUA 5FYKD 3MV7A 1FFPB 3ARRA 3DOSA 3MOAH 3MCLL 3MRQB 3O0RL 4PJEA 3OKDB 5DK3A 3SDAA 1B88A 3S8WA 3IXTA 1BOGA 3ES6A 4X83A 4ZS6D 2X4SB 4NHCH 4U6XB 3BKCH 3CCHB 3CPLB 4NKOB 1C12B 2GSIB 5A2JH 3B9KA 1NMBL 4XP1L 4PJBF 2BNQA 1CTNA 5GRJL 4NPYA 4L8SC 5E2TH 2APXA 4XCYB 3CH1B 4MJ6B 4L8SB 4KRNA 1GC1H 1G9MH 1OGAD 3N1GC 4JFDE 3AY4A 4HULB 5A40E 4CJ1A 5DUPH 1XGTA 3PGFH 4F7CA 2X10A 4P5KA 2DYPB 1FRGL 3FCTA 1WZMA 4TVPD 3I6LD 5ID0A 4PJGA 2HVJA 3WFDL 1C5CL 4NQDA 2XYCA 4TUKL 1JUFA 3IKCA 3RWDB 1VESA 4P0DA 3BGFB 4F15C 3KYMB 3NCFB 1FAKT 3B83A 4HWBH 1KXQE 3EBAA 4F15B 1KJMA 5FYKE 4ZFFB 3G5YA 3CSYB 2KL6A 3H0TB 4X99A 1NBZA 2IAND 3LN9A 2ZJSH 5KVDH 1LD9A 3DURB 1AE6H 5CP3H 4U6VL 4MNQA 1IAOA 2MSPA 3GHEH 2CDEA 1HHGA 2R4RL 3O9WA 5JIIA 2HWZL 5AUMB 1EFQA 2P7TA 4R4BA 2GKIA 1HQ4B 3C5JA 2NW3A 3S5LB 2QQNL 3QXDA 5K59E 2YZ1A 1K5NA 4PJFF 1MNUL 3REWB 3TM6A 1G7LB 4OFYA 4BKLB 1PEWA 1ZGLP 2R4SH 1LVEA 4GBXA 3RWCA 3INUL 1X4ZA 4OM1H 5DMGC 5FFLA 3J7HA 5C0RH 1J8KA 1OGAE 3VJ6B 5FM5M 2XOTA 1T66C 2P5WD 2HJFB 5HGGS 5C1MB 1LHZA 4QOKD 4G6AD 4EN3D 5HHXL 4F2MA 5I71C 1D5ZB 3ZKND 1JYNA 2GSGB 4TVPE 4CNIB 2CJUL 4MS8D 5E2VH 3I6LE 4D0BB 5CWSA 3NAAH 3C6LD 5I71B 3RDTC 3RNQB 5KSBB 3ZSTA 4HWEL 3PHQB 3LKNA 2WWMD 4NC1C 5F88A 1P4BL 1ZTXL 2IH1B 5K9OA 2HTKD 2GQHA 4QF1B 5DJAA 3KPSB 3OG4B 3IETA 2DQFB 4NYLB 4RFOH 4XXCC 4O58H 4XX1G 3KYKH 3EO1A 3W11C 2CGRL 3S4SB 3OTTA 3FT4A 3BKJH 2ESVD 2NX5D 4I5BA 8CGTA 5ITFB 2XWJA 4FP8H 5B38G 2VDQL 3KYNB 4OGAC 1EFXB 4PV9B 4EKXA 5C9JA 3BMVA 3UX9B 1TVHB 4FXKB 32C2A 2ICEB 1EEUA 1MQ8A 2A9NL 1FVDA 1RD6A 2X4OB 4G3YL 4XP4L 4YHKH 2P5WE 3HZVA 4R9HA 4PJHB 2C1PB 2LE9A 1A3QA 2VDLH 2EDQA 2XG4A 1RIVL 3D0VB 3EYUH 1I7RA 1NAMB 3GK8H 3X14B 5IEKA 3BEWB 4KI5D 1JTOA 3L5IA 1PQZA 4DAGH 4U05A 5ETUB 1KPUB 1RIHH 4JFQA 5B4MC 1X44A 4WI2A 4Y1AB 4NDMB 4HPOL 4AJ0A 3OKEB 4KK8C 4LAQH 5FYKL 1UKQA 3L6FA 1WV7T 3QIUD 3QQ9D 5CEYA 4UQ3A 4K7PL 2WZPD 5AEAA 3KAAA 5CJQH 3ZDZE 1LDPH 4PR5A 5DS8A 1CE6A 1G7MB 3VDCA 2DM4A 4ZXBD 4OBRA 5CJOH 9CGTA 4WO4C 3PIQB 3ZE1E 3MRFA 4UUJA 2WIIA 4X4ZA 2GK0B 3KHOA 5HTSA 4XAWH 2R0KL 4WO4B 4LSUL 3VFVA 3KR3L 2ESVE 3QO1A 1U8IB 2OL3H 1N5YL 2EZ0C 3MV11 1DBAH 2W60B 1LNUA 4NQCA 1HOCA 3QRFM 2VXVH 4I48A 5GGRB 5DJXA 3HZMA 4JHWL 1CXEA 6FABL 3QRGL 3OXSB 4PJXA 4G42B 4ODSH 3KPLA 3BUYA 3CSBA 1U92A 4OUUB 1EEZA 3IB4A 5IW1B 3WKML 3BKML 2BVQA 5F3BB 4TVPL 3VI4F 5AWNL 1U8PB 3S37L 3FQWA 4XBGA 4OF6A 5J11C 2FD6H 2IALA 3RKDD 1XH3A 4URTB 4PBWD 5J11B 3U6RB 3BWAA 1D6VL 1I3GL 3IF1B 4LCWB 1BX2B 3NABH 5F7YC 1EX0A 3WFZA 4Y2DA 1UB6A 4MAYC 5B38A 3QG6A 3CVHL 2YBRB 2A77L 3BZ4A 4MQ7B 4B53A 4MAYB 1CGWA 4NQSA 4B5EA 2DWEB 4ZTOL 5DEGB 3CUPB 1CT8A 1I3VA 2JLLA 5DRNB 3GBLA 2KKQA 1CFSB 4NT6B 1F45A 1Z9SA 1WWAX 4X80H 2NY2D 1VKXB 2CO7B 3VXSB 5EO9A 1P1ZA 1AGBA 3MTRA 1QACA 2V7NA 3MJGX 1LE9B 4Z8FH 4PP2A 4WI5A 4YDIH 1MWAA 1L7IH 3KPTA 2DDQH 1PVHA 3OJ2C 3MRHA 4R4NC 1ZLVH 2H3NA 2K9UA 1S7VA 3F6LA 3UTZA 4POUB 1OTSD 4HMCA 5DD0H 4PP1D 4MXVF 2NXYC 1PLGL 2R2EB 4HUKB 1F90L 1HSAA 3NACL 4XP6H 1NC4A 2NXYB 3QR2A 3QUMA 4GRWF 3V4VL 1DUZA 4Y89A 5I2IB 3H9ZA 4G6FB 1UEYA 3V7MA 2P49B 2QSVA 3MO1B 1NUDA 4X98A 2DJSA 4HK0A 5E2WH 2O61A 1YEDB 5IFJA 1BEYL 3LS5L 3CX5K 5C08E 2QQLL 4K23H 1NAKL 2DQGL 5LG1A 3UTTA 4N0FA 2GFBB 5TE4L 3TPUA 1CLOL 3OB0H 1H3UA 3VXMA 2R0WH 3NFNA 3SDDA 1I75A 5A43C 3D0LA 1KFAH 3QPQD 2PW1B 5GJTL 5A2IH 5IMKB 4LSTL 1NCDL 1T4KB 1U8HA 1UG9A 1L7TH 1E4XH 1A7BA 2FEDD 5EU3B 3P40A 5AZEL 4JFPA 4H25B 3DTXB 5M95B 2CLZB 5ACMA 1UWEH 2ATKB 5MEQA 3G5XB 1FPTL 3KWWA 2XZQL 2FB4L 4AMKH 3EFDL 2EDTA 3RVXC 1AXSB 2I24N 1OARH 4GSDL 2VL4A 4A6YB 4APQA 4GW4A 1CVRA 3OX8A 2ZUYA 3IGAA 1DLHB 3TH3T 1HCFX 1EHLL 4KVNH 3AAZA 5ISZD 1A6TA 1J9CT 5J12B 4JDVA 4PJCE 3G9VA 3VFMB 3FFCE 4P46D 1I3UA 3BKCL 4AIOA 3WIFB 1AFVH 1F4WL 3VXOB 4Z7QE 1D5MA 1Y0LB 3QJHA 5F1NB 1RZGA 2EDDA 1BFTA 2R8SH 1BZ7A 1VFAB 4J3SA 4KWUA 2FJHB 3NCCB 4LRIA 1ADQA 5AD0A 12E8L 1MCQA 3RX8A 2X4NA 5BS0D 5DYOB 3DI3B 4G6JH 4ZFOL 1DQMH 3GSWA 4LSVL 1ZGLM 1HZHH 3G08B 5DI8B 4EXKA 3EOTL 1PDKA 3O6MH 3BN3B 4XNQB 1NLDH 5L6YL 3IXAB 4F9PC 1MH5B 1A7QH 5CFHA 5GS2H 3L3HB 5KOMC 4QHNB 2VZ1A 5DRZA 1ZA3A 4NOFA 1UWXH 4DUXA 4O51A 2AGJL 2A2QT 4WEBL 5D2LF 1PG7L 3DUUB 5HJ3B 5I15L 4PJAA 4WVRA 2YPLD 3JWOC 1XZ0A 1NUNB 5D93C 1AGEB 4P5MA 4AENA 4MA8H 1AE6L 2L7UA 5M94B 3V4UH 5GZOD 2R0LL 5ICZB 4Q9QL 3WFEL 4F8TA 1ZGLA 5F7MC 4JM2A 1MCLA 4KK5C 4LSPH 3SKJH 3VFSB 4F9LA 4EBQH 3TNNB 5I19H 1NANI 1N6QL 1MEXH 5J1AA 5GGRY 3FO0H 2VZVA 4S2SB 4LCYA 4XWGL 1P4LA 4K9EH 3OPZH 5JLZA 2R4SL 2R1WB 1VACB 1HH9B 1KPRB 4F7TB 1TETH 4HV8B 1J0ZA 1U8OB 2B4CC 2NY7H 4ZO7A 4KJPD 2UV3A 3GKWL 5D2NC 3T2PA 2BP3A 2P5ED 4WDIA 1H8OA 2X1XR 2A38A 2BK8A 3NCJL 4OF5A 3GGWA 4PRDA 5E2UH 5IESH 5D2NB 3VA2C 4U6TA 2GTZA 4EUPG 3QIBD 1MI5A 1T6WA 2W0KA 5IVOA 4UINH 1V3LA 4X4XB 4QHUB 2HH0H 4GAFB 2R0ZL 4NOBA 5KSUB 3Q6FA 3S36X 3ROLA 1SM3L 4PJDE 3U4EA 4HSQA 1DQDL 3FOMA 2NY3C 1H0DB 5E0QA 1MY5A 4XVTL 2YPLE 2NY3B 4MQSB 1XCTB 3BQUD 4OF0A 2NY0D 1D5XA 1HXMB 4U1MA 4PLNC 1VFOA 5BZDB 1YNTA 3KYKL 2BVEA 3PG2A 1AKJB 3W9DB 3QAZC 4JY4A 3MROB 1XF4B 4PRBA 5F70A 2AXHA 4OCWH 3QAZB 2FX7H 3HI5L 1QBMH 4S1SL 3P0YH 4GS7B 4Z7UE 4X4ME 4KK9D 3FB7A 3I6KA 4PGDA 4Z7WA 1KCSH 4M48L 3S35X 3QPXL 2ZUXA 4P2OD 4W4OA 1IMHC 4JZNA 3FO1B 3TBYA 3ZL4L 1WAAA 5ALBH 1S7RA 4EVNB 1PG7W 2VNCA 3UBXG 5BRZA 3PGDB 1WJ3A 4PREB 1H8SA 1XFPA 5E8NA 2P5EE 2UVEA 3RL1A 4D3CL 3JVGC 3EYUL 5IMLA 4BUHA 3UROR 1MCHA 3VXRD 3ZKSD 5FF6A 5IB3A 1FORH 5CP7A 1CFVL 5DDHB 4NJAH 4DAGL 4YHNB 2YUWA 1RIHL 5F8QC 5KN5A 1H3VA 3MV8A 5CIPA 4ZPTA 3S36H 3SDAC 4LAQL 2HRLA 4PJEB 1DVFD 3SDAB 1OQXA 3IXTB 2A6IA 4X5LA 1FQ9C 3TWCL 1BOGB 3ES6B 5I6XC 4QT5A 2YN3A 2OSLA 4FZ8L 3B9KC 4LVHC 5I6XB 1T04B 1GXEA 4XAWL 3B9KB 2DI7A 1SVCP 4PG2A 2BNQB 2OL3L 5FCUH 2AV1A 4HIHA 1DBAL 4PJ8A 5DUML 4GW5A 4NPYB 1JGUL 5A2FA 4B7LA 4J6RH 5DLMH 2JB5H 4XP9L 2VXVL 5IBTH 1GCFA 4EUPA 4IMKC 5GS2D 3S35H 3NTCL 4PLKC 1XGTB 2Q7YA 2P1YA 4F7CB 5JW4Q 3N85L 2W38A 3P30H 4P5KB 4P2QD 2P47B 5ID0B 4JEGB 5ENWA 4GKOA 4PJGB 4NO2B 3WE6A 2HVJB 3T0EE 3SQOH 4NQDB 3M1BA 4LOUC 3ZTNH 3UYOD 1JUFB 3IKCB 3HC3L 2HFGH 1XEDA 3S97C 3UCRA 2VDMH 2B1AH 2C4XA 4KHXH 5MI0C 4Y4KC 1KJMB 4EQ2A 4OI7A 5MI0B 4Y4KB 1FLTX 1NBZB 3HLAB 3VGFA 3WO3B 1ZWIA 5E4EC 5HDBE 4PRIE 1LD9B 2HRPH 3C5SA 5MP6H 3TBVA 4N90D 5IQ7L 1UM5L 2VXUH 5E4EB 4MNQB 1IAOB 4LBEA 1HHKA 2CDEB 1HHGB 2FBOJ 2P7TB 4R4BB 2NW3B 3C5JB 3QXDB 4MJ5A 3UBXA 4GBXC 3U0WH 1FC1A 1K5NB 4L3ED 5KS9E 1FN4A 3N9GH 4GBXB 3RWCB 5KOVC 1L7IL 1QLFA 1S8DA 3IDMA 1WBYB 4PJ9D 4DN4H 4TNVK 1G9NL 3M8OL 5IB4A 4HPYH 5CJ5A 1ONQA 3RIAK 1WBXA 5DD0L 4DEPB 2AQ1A 1QRKA 5IEHA 4Z0XA 3MFFA 1PGRB 3NA9H 4MXWL 4NNPL 3LKNB 2GT9A 4G8EB 4OCXL 5BV7H 5F88B 1I1AA 5K9OB 2R29H 4CN1A 3O45A 5DJAB 3O3AA 1NDMA 4GMTH 1J8HD 3HFMH 3IETB 1JNNL 4DQOL 1BGXH 3QFJE 3QA3A 1BQLH 2HFEB 2NZ9D 3EO1B 4K23L 4N90E 1RZFH 3FT4B 4EXPX 4P3WA 5AAWA 3CIQA 4I5BB 5IQ9B 4MB5A 2XZCH 2XWJB 5FK9A 1IGMH 2R0WL 5T5FH 3D9AH 3QWQB 3KPOB 4UV7L 4F33A 2UWEA 5C9JB 4JJ5A 3MMEB 2FYYA 4AG4L 4JG0H 5K9QG 4QLRA 4L3EE 2BNUA 32C2B 1L7TL 3PP3H 3MLZH 5TJWK 4OJFH 4WIQA 4M7JH 5D5MF 4HC1H 1FVDB 2QQQA 5GQBA 1UWEL 1LO0H 5F9OL 3HZVB 1CD8A 1ED3A 4AMKL 1XF2A 2DTSA 3TJHD 1JGVH 4Y5XC 5GRWA 3RP1A 1I7RB 1RUPH 4Y5XB 2CPCA 4UV4H 4KVNL 3ZKMD 5DMKA 1PQZB 1T1WA 1TENA 1TJHH 1F4HA 3ABZA 4JFQB 1WIPA 2BOBA 3HPLB 1YC7A 5BZWA 3L6FB 2EYTB 2XKUA 1QFUL 4UQ3B 5CEYB 3SE3A 3MJ8A 1J8HE 4XI5D 4PR5B 5DS8B 1CE6B 5D7SH 3MXVH 3X12A 5JHLL 3MRFB 2WIIB 1KYOK 1C7SA 1N64H 5BOPA 3MRMA 3VFVB 4YEFA 1NBYA 1B0RB 1T80A 4QHLA 4WV1A 5B39G 1CXIA 1HZHL 4XTRC 4OIIH 4JPIA 1LNUB 4NQCB 5KJRH 3SGDH 5CD3A 1G0XA 2APVA 2DIAA 1A64A 4G8GE 1HOCB 2MQCA 1EGJH 3MA9H 3PGCB 4X5WA 4K7PX 4P23A 4ZNCD 1YNLL 3THMH 5DJXB 3HZMB 4WGWB 4JO3L 4RMVA 1A7QL 4PJXB 5TDPA 3H9SB 3EW3B 3BUYB 1U92B 2ERJC 1WZ1H 1UA6L 4EDWL 1A8JH 2BVQB 3JSSA 4HW6A 3VXUE 1N0XL 4XBGB 3KPQB 2IALB 3LPGA 3PXJA 4JGMA 3E1F1 3RWEA 3LHPH 1F13A 3CZJA 3BWAB 4GAJL 4KKNA 3T1WA 3D2UA 4KROD 2MKWA 3V4UL 5A1AA 4FFWC 4Y2DC 1WZLA 4Y7MA 3CU1A 3SKJL 3MLYH 4LSPL 5D1ZD 3NIGF 4X6CA 1U8JA 4EBQL 3PWUA 4ONHA 3WDJA 4Y2DB 1UB6B 5B38B 4XHJC 5I19L 3QG6B 4D8PA 1MRDL 2X1QA 3BZ4B 1I8LA 4O9HH 1J0HA 1QFWL 5JUEL 4U1KA 5FGCB 4K9EL 3OPZL 2AJXH 2AEIT 2ICWA 1AO7D 4HHAA 1M05A 2VLKA 1CT8B 4P2YA 2YK1L 4CJ0A 4HQQL 2NY7L 1QLRA 4FOMA 5EO9B 3OKMA 1P1ZB 3SO3B 3D48R 3SDCD 1AGBB 3FQRA 2V7NB 2V7HA 2YN5A 4ODTL 3QJFA 2X4PA 4UILH 2UZXB 4PP2B 5E2UL 1MWAB 2OM5A 4KY1H 1T7XA 5T3ZE 1OAQL 1BWMA 3PWPA 3K74B 3MRHB 4UINL 4HMDA 2DB8A 3MBEA 2HH0L 4XMPL 2H3NB 1KB5A 3RVTC 4YZFF 2DKUA 1S7VB 1A9BA 2Y25A 4OM0H 4TNWK 3EFFA 3UTZB 3VFPA 2OMNA 5IFHH 4MHHG 4PJ7F 2OR7A 4H8WH 4V1DD 3HC4H 4DZBA 1MAMH 2ICCA 4I0PA 1HSAB 1NC4B 3QUMB 2BY1A 4JN2A 2QV2A 1MFCH 1R3LA 1DUZB 2AJSH 3ZT6A 5GXBB 4X98B 1IGFH 4HK0B 5C0JB 4NRXA 5B39A 5IFJB 1QBML 3B5HA 1FZKA 1LP9F 1E6JL 5GGSY 1J86A 3K8MA 4KZDL 4Q7DA 4XC3L 3UTTB 1KCSL 4N0FB 3TPUB 3EIFA 1AO7E 1T1XA 4X6DE 3VDBA 3VXMB 3NFNB 5ALBL 1T03L 3D0LB 5IVXE 4FFYL 5C0ND 3LQAC 3LN5A 5CLWA 1BAFH 3SKNB 1U8HB 3KS0H 1F4XH 1JIBA 1T89C 4U6HA 2N1KA 1A9EA 1WTGT 4JFPB 3QBTB 4KGJA 2Q8AH 1RFDH 4N0CD 4OQTA 1FORL 3KWWB 4NJAL 2A6JA 4WRLA 3DUSA 3TVMD 3P9MA 3B2VH 4GW4B 3OX8B 1XT5A 5GGVL 3IGAB 4V1DE 1L4IA 4ONGH 3AAZB 3AM8C 1YQVH 1A6TB 4GKSA 4JRYA 5D8JL 3CSPA 3QCVH 1TITA 1RIUH 4JDVB 1YECH 4MA3B 2B2XH 1KT2B 3GUTA 5KZCB 1MCOL 5JORA 1GPOH 2IH3A 2EIZA 3VFRA 1D5MB 5DMGD 3QJHB 1RZGB 4JFYA 4LRIC 5KVFH 5FCUL 2HKHL 1BZ7B 3RPIB 4JFZH 2E9WA 1S5HA 2CK0H 5AD0B 1IGIL 2JB5L 2X4NB 4PTUA 3SHSA 1DL7L 3GSWB 1S9YA 4NGHH 3RDTD 2J6EL 1KEMH 5EZOL 1FBIH 2XTJC 1NFDA 1R5WA 2XTJB 2KH2B 4WI4A 5T3ZL 3MC0A 2VJXA 2E6JA 3ZTNL 3P9LA 5ALCL 5DRZB 2CUHA 4MA1C 5C07A 2DJUA 4O51B 4TULH 3V6BR 2B1AL 1QSEA 3W11D 3IKKA 4R90L 2IMNA 4PJAB 2BXYA 1ZKAA 3P77A 3HG1A 1MREH 1EFXD 1XZ0B 4HH9A 1TVBA 4P5MB 4ZUUA 3FFDA 2EICA 3V5KB 5MP6L 4JM2C 2HP4A 5GGUA 1KN4L 4HS3B 5TFSH 4M8QA 1ZGLB 1T1YA 4JM2B 4PD4K 3ECBA 4N68A 3B9DA 2UVFA 2Q8BL 5J1AB 2QTEA 3U0WL 4LCYB 4WFGE 1P4LB 2F54A 3MACH 5JLZB 3N9GL 4L4VD 2N56A 1QA9A 5CSZA 1B3JA 3RGHA 5A3ID 4W68A 5EC1A 5CZVH 3MRKB 2CR3A 1J0KA 1VADA 4WDIB 5I8EA 3T2NH 1I9RL 4PRDB 4ODWA 4NC1E 2GTZB 3STZB 4ZO6A 5SWZA 1ITBB 1MI5B 3KPSE 4P48A 5L9DH 1MHEA 1JP5A 5DD5H 4QRPA 3Q6FB 1ZLUH 2VZOA 4GRWH 3ROLB 3ALXA 1R3KB 4LCUA 4L1DA 1NCUA 3U36B 3FOMB 3CDGA 1BD2D 4GMTL 4X6FA 3HFML 3SE9H 1D5XB 4U1MB 5E56A 1YNTB 5KW9L 2A1WH 5KSBF 1UZ6E 2KZWA 4G6KH 4PJFE 4JY4B 4PRBB 1RQ5A 5DRXA 2RGSA 1JYVA 1NUGA 4CDHA 4O5LL 3STBA 5KSAA 1IGML 3D9AL 4UU9A 5TF0A 4PJHE 3OV6A 5DQJA 2NYYC 3FB7B 4GG6A 4PGDB 4Z7WB 3HCVA 4L4VE 1NCAH 1LDSA 3MFGB 4JZNB 2YRZA 4OCRH 3TBYB 4U1SA 4HC1L 1S7RB 1CE1H 4DFIA 5FA3A 3RRQA 3TCXA 4HLJA 5BRZB 2G5RA 1LMKA 5E8NB 4Y1AE 4FQQB 5E95B 4GXVL 5IMLB 5DMIH 4IDLA 1MAJA 2PYEA 1H5BA 4DGYH 3OKNA 5FF6B 5IB3B 4OZGE 4L8DB 3UTOA 4FQLL 1TJHL 4P4KD 2ORBH 4YHPA 4FZEH 5EOCJ 1FAIL 1UT9A 5KN5B 2X6MA 3ZKQD 4Z7NE 3DETC 5CIPB 1A3RL 4ZPTB 4LPVA 4Z7VE 3D3VA 3DMMA 3Q2CA 1U2CA 2MPAL 2BRRH 1BD2E 3MODH 1TJIL 2H2PC 5I1HH 3MXVL 4KHTH 4QXTA 1Z9MA 4HDIB 2OSLB 4E5XA 4DKFH 3UAJD 4NC0B 4AM0A 5DF0A 4YUEL 4PG2C 1AGDA 1I1RA 1IAIM 4PJ8C 1A14H 4KTEL 2Z8RA 4M3KB 4E41D 1YC8A 4HIHB 4PJ8B 4YE4H 4GW5B 1MHCA 5KJRL 2XT1B 3PDOA 1J05A 3F7QA 3MJ7A 3MA9L 4O02L 5F7EH 3EDDA 3THML 2BERA 4JZJC 3HAEG 1SEBA 2Q7YB 1FZJA 1EO8L 4Z95L 1IEBA 5IR1A 2UZIH 4OUOA 5H35A 4JFDA 1ZSDA 3WE6B 4ZYKA 3FQNA 1PKOA 2OTUA 1OAZH 3M1BB 1SJHA 1IAMA 1M6OA 3X13A 4KQ3H 3DO7A 3FN0H 1HYSC 2ZSVB 3C9NA 1MCKA 5SX4I 1I7ZA 1IQDB 3WL9A 4QCIA 3MLXH 1ZWIB 1CXLA 4G8FB 3C5SB 5F6IC 1XR9A 1D3CA 4Q6IC 3L3KA 2FDBP 4O9HL 3U7YH 4LBEB 1HHKB 3I9GL 5F6IB 2BY0A 3X3GH 5I1AA 1DBKH 3RWGA 3IVKA 4MJ5B 3LQZA 1HKLH 4E41E 4P9HC 3MUZ1 4ORZC 3TBWB 2AXGA 3RVXD 4UILL 3VXNA 1DSFL 4MMZC 3DPBA 3VI4E 1QLFB 1S8DB 3IDMB 2XXMB 1MCPH 4FQXD 2ZCLH 1YEHH 4OD2A 5IB4B 1MFAH 5IFHL 3V0WL 1TXKA 1ONQB 3OKKA 4KUZH 1OGAA 3SPVA 4C4KO 3HC4L 4V2CB 5IEHB 2H6PA 1I1AC 4WWKD 4JAMA 1A7RH 1MFCL 2GT9B 3U1SH 1I1AB 3ARYA 4U49A 5MHSE 1UM4L 25C8H 3SJVD 1J1PL 1ZXQA 2VN7A 2J7LA 1NDMB 3TZVD 4PLJC 4XNXH 1IGFL 3FOLA 1U95A 1RURL 1Q1JH 5SWQA 3QA3B 2GIYA 2IFGA 4HF5H 3SOBL 4HT1H 4MAUH 2AEPL 3CSGA 3U4AA 1A6VH 2IANA 4ONFH 5FK9B 3CVHA 3BYYA 3HAEA 5DA4A 1EJOL 4F33B 3UTPD 2UWEB 4JJ5B 1Z0NA 2FYYB 4YFDB 5DVLA 1BAFL 5BVJA 4P4RA 4LKXA 3TESA 4ODUA 1DR9A 4U1HA 1BF2A 1DBMH 3UC0H 1ED3B 1XF2B 1DQLL 1WFOA 1FNAA 2APBA 4BZ2L 3VD5A 2G75B 1I1CA 5FYJH 5GRVK 3V5HA 4K71C 1N2RA 4EQ3A 1V7MH 3GHBL 1OLLA 2P5WA 3GNML 1KXVC 5DMKB 4K71B 1YYML 4QOKA 3MRBA 3MCKA 5DMJB 4EN3A 8FABA 1DDHA 3QCVL 5IROA 3TV3H 3C6LA 3SE3C 2EDHA 2BOBB 4ZMAT 5BZWB 4N0RA 4WI6A 1GPOL 1R5VB 5CMAA 5HVHC 2CRIA 3MJ8B 4R2GD 5KVFL 4DFHA 4I9WE 5HVHB 3X12B 4WV1C 1E4JA 3MRMB 4PIRF 1NBYB 4QHLB 4WV1B 1YEEH 1ZVSA 3CH8A 4JPIB 1P7QD 2FX8L 1HDMA 3JV6B 5AG8A 1DANT 4WNQA 3LKSA 4KJYA 4AL8L 1WSST 5J9PA 3RTQC 1INQA 3HNVL 2ESVA 2NX5A 4X5WB 1U0QA 4P23B 1A0QH 5FA4A 4UOW0 5TDPB 1K9TA 1OP9A 1ES0B 1QSVA 3PV7A 4LLQA 3FZUD 1YQ2A 4TULL 3MX0A 5HI3D 4OFPA 1P84K 3FQUA 4JQVA 1MHPL 1QD0A 3CFJA 3CXHK 3UBXI 3NIFF 1ZMYA 3GRWH 5ITBH 2WQ8A 2O5ZL 1OL0A 5DD6A 3D2UB 4X9GA 5TFSL 2ZSWA 4D9LL 4FQJL 1SMAA 5GISH 1U58A 4X6CB 4FQ1H 4ODXA 4ONHB 1I8LC 3Q6GH 5GGTH 3RGVD 4D8PB 2F8OA 5HHPA 1JF5A 5C2UB 1U8NA 1I8IA 1F4YH 4U1KB 3TBSA 3MACL 3S7GA 5KTEH 2ICWB 2LQRA 4HHAB 3QIUA 1M05B 2ADGA 2LAGB 2VLKB 3Q3GA 7FABH 5EB9A 2H2SC 4X8JA 4NCC2 2RR3A 5CZVL 1QLRB 2PR4H 3LH2H 3OKMB 1PBYA 1NCBL 3BIAX 3FQRB 2V7HB 4OB5H 5L7XH 4Y4FC 3QJFB 3T2NL 2X4PB 5I1IH 2JE8A 2OXHA 5D2LE 2Y7QA 2WP3O 3LB6D 3PWPB 3MLTA 5ERWB 4R6UA 1YNKH 2X4TB 1KB5B 3VGBA 4MDIA 5DD5L 5I1JL 4GKNB 1MIMH 1A9BB 3HNSL 3VFPB 3EFFB 4N5UA 3LV3A 3ARVA 3RBSA 1A21A 4I0PC 1EEQA 4Q0XL 4J4PD 3BSZH 4DZBB 5KSVA 1W0WA 2FJFA 4I0PB 1FO0L 3WXVH 4Q9RL 1TCRB 5DJ6A 3BP5A 3REVA 3SE9L 4JN2B 4LIQH 1NGYB 3MNZA 3C09C 5DUBA 4QTHA 1S7UA 3ARED 3QQNA 5DRWA 4G6KL 3C09B 1GGBL 1NBVH 4KQ4H 4J3UA 1FP5A 5HYJD 1J12A 4LK4A 4P57A 4NRXB 3PDDA 5B39B 3C60D 1FZKB 3X17A 3O4LD 4HBQA 4PLKD 1NPUA 3B8SA 4TNVF 1VEMA 1ZA6A 3IFOA 3P0VL 4LLUB 4ZOAA 4LGPB 4JM4L 2N7AA 3UDWC 2IMMA 5D7IF 3DRQA 1T1XB 5IVNA 2ZUQB 5DURB 1E28A 3RIAF 4NQXA 3MA7A 3LN5B 5JQ6H 3EYQC 4B50A 1OQOA 4U6HB 4Y4KD 1LEGB 1A9EB 1ZHNA 4JKPH 1QOKA 5FYJD 2FCBA 4PJEE 5DMIL 3DVFA 1JZ3A 4TQEH 4EOWL 4DGYL 3CK0H 3JWOL 1UKTA 3WNNA 5IMMA 4L1HA 3RUGF 3DUSB 5E08H 4CKVX 3EO9H 2BZDA 4FZEL 2ADIB 1PJ9A 5EO0A 3TA3D 1FNEA 4PRPD 2WM0A 4HXBL 3HR5A 2XV6B 1X5GA 4GKSB 2ZCKL 1UWXK 2WLZA 4ONOA 4JRYB 3W2DH 4DVRL 4KHTL 5EFIA 1EH9A 2F74A 5JORB 5I73B 1IGCH 2EIZB 3VFRB 1A14L 2YPKB 1VENA 5D70H 5CGMA 1RZKH 4JFYB 4PJCA 5D6DA 1S5HB 2RBLA 5SWSD 4MD5A 5FGRA 2ED7A 4PTUB 4NQDE 4RGNB 1S9YB 5CGYC 3GMQA 3H3PH 1T0NA 2YXFA 4KUCF 4QHMA 2FBJL 1NFDB 3E8UL 5EORH 5IHZB 1CLYH 2UZIL 3DGGA 5EU7C 3X11A 1KTLA 4LNRA 1F3DH 5C07B 3VD9A 4HLZG 5K9QI 1NMAH 2ICWI 1QSEB 2NLJA 3ZO0A 3AFLA 4NBZB 3S34H 3L3JA 3VRJA 2FR4A 2AEQL 3L7EA 3P77B 3HG1B 3RFZC 2OQJA 4C57C 3VDAA 4HH9B 3WLWD 3MRDB 1TVBB 1ZVYA 1I9EA 3MLXL 4ZUUB 2Y6SD 4NJ9H 3FFDB 1RU9L 3MBXH 2MTPA 3LKPB 4PJGF 4LLMA 1T7VA 5GGUB 5C0FA 3IYLW 4M8QB 3OZ9H 3GSRA 2QHRH 4N5EC 1URLA 3PQYD 5ISZA 3NBNA 2VUYA 4WW1A 3ECBB 3SKMA 3AS2A 5FDWA 2JCCA 4LKCA 4AIZA 4NWUH 3K1KC 2F54B 1II4E 3D87B 3MXWL 4CADA 4LDLB 4M5ZH 3LRHA 4LLWA 2AJ3A 2ZUTA 4TRPH 1QA9B 2NXZC 2OL3A 5CSZB 1JJUA 5EC1B 2YD3A 4F58L 2NXZB 1IBGH 2K7QA 2ZCLL 3GBML 5JOFA 1VADB 3DSNA 3L3GA 5I8EB 1B2WL 1T2QL 3C8HA 2VLJD 1YPZA 5IK3B 1MFAL 4NZTL 5SV3A 4F8QA 4ODWB 3JV4A 2VR4A 3G04A 2HMIC 5SWZB 5ADOH 1MHEB 2C1OA 1AH1A 2R2HA 2F53D 2W9EL 1ZEAL 1AHWA 4QRPB 3F7VA 1Y6NR 5HHVL 3HA0A 5FYKU 3V52H 4H20L 3U4BH 3CDGB 5TPWH 3QQ4B 1DZBA 4HIJA 4YBLC 4X6FB 4XNXL 3OBAA 1BBJA 4R8WH 4PJDA 4ELMF 1Q1JL 3B9VA 4YBLB 1F3JA 1K6QL 2DTMH 4IOFD 1JGDA 2YPLA 4XPFL 5DRXB 1GZQA 1DEEA 2XZAL 1OSZA 3H9SD 1MCRA 4MB3A 3O6LL 4UU9B 4XBEH 4XPHH 5JO5A 4OLXL 4FQIH 3BVNB 5DQJB 1M71A 4GG6B 5B22A 3HCVB 1V3JA 1KBGL 1KIQA 3MLWH 4TNWF 5DHYA 5MEPA 1T21A 3LZFL 1FNLA 4HJ0D 5CZXD 5AZ2L 4Z7UA 3GEWB 1X5FA 4X4MA 1TZGL 2YD1A 1WCBA 5DHVH 1H5BC 3ZE2F 3HZYA 43C9A 3NZHH 4JANA 2PYEB 1H5BB 2O26U 1V7ML 3O2DH 3OKNB 3ME0A 2P5EA 4KKBC 1UENA 1JF1A 1HNFA 2F53E 1KIPA 4YHPB 2J8UF 3DMMC 3QIBA 4HUUA 4PG9A 1QFPA 1S7SA 4Y19D 5FGBA 3DMMB 5C0EA 3ZHKA 1G6RL 2VH5H 4FFVC 3WEXA 1DQJA 4QXTB 5TE6H 4E5XB 1ZS8A 1QKZL 1ZT7A 4AM0B 1KPVA 1MQKH 4XVUC 1EUTA 1XIWD 3BQUA 3H9SE 2YA2A 4MA7L 1JPGB 4XVSL 4LDOB 4N1HB 3PDOB 1J05B 4HIXL 3MJ7B 1K8IA 5HHMD 4UT9H 5DD1H 1S7QA 1A0QL 3LN4B 4XVJH 2GEEA 4OLVH 1SEBB 2WWKT 3LKQA 1FZJB 4ESKA 3UZEA 1XGQA 3SGKA 4HIIA 5IR1B 5I74C 4P2OA 5H35B 1MIEH 4JFDB 1ZSDB 1SY6L 1RJYA 3FQNB 1Q72H 2OTUB 5I74B 3BT2H 3WNPA 1SJHB 5GZND 3GRWL 5IMOA 3TNMA 1M6OB 2BJMH 5C0CD 3MUHL 3X13B 4FQ2H 3DO7B 3VG0L 1BIHA 4NUGH 3C9NB 1KENH 2XQYG 4POZC 4PJXF 3MOBH 5GISL 3VXRA 1I7ZB 2BY3A 4TUOA 4QRRD 4QCIB 4PRHD 5GGTL 1ZOXA 2CXGA 4X9FA 5CS7A 1XR9B 3L3KB 2EEBA 1VCAA 4DCQA 1JNJA 4M8VA 1CFQA 1DVFA 1E6OH 4ZS6C 2FIKA 5J3HC 3RWGB 5I1AB 5ACZA 3ARXA 2XIDA 1D5IH 4WI8A 1L9MA 3LQZB 3VA6A 2PR4L 3LH2L 1MFDH 4JO4H 5DEFA 1RJZA 1WICA 4OB5L 4H0HB 5IFAL 3VXNB 5EZIH 2A9MH 5I1IL 4L5FL 4ALAL 1EZVY 4U1LA 1IAKA 4OZFH 5KS9A 5C7XH 1P84J 4BSJA 2WUCH 1YNKL 2NY5H 5E99H 2YPVH 2D0GA 4OD2B 4OAWA 1GJIA 3CFEA 5D6CA 3V0VA 3OKKB 2WBJD 5IB5A 1OGAB 1RJCA 3GSQA 1CDGA 3SPVB 3BSZL 2PXYD 2H6PB 3WXVL 3NIGE 1CYGA 1T20B 5I1EH 4P2QA 3LKRA 2CMRL 5C0CE 4WUKL 4DGVH 1FSKC 3UTTE 3R0MA 1G6VK 3LIZL 1HWGB 4OLUL 2A73A 1CF8H 1ND0A 3DV4A 1FSKB 4JKMA 3BN9D 4QRRE 3UZVB 3FOLB 1U95B 2VZSA 3HKFA 4G7VL 4HBCH 1DFBH 5SWQB 4C56D 4PRHE 3VU2A 2VDPL 3BGAA 1MLBA 2VR5A 3JV0A 1HIMH 3GSXA 1DN0A 2F5BH 3DXAD 5BOZG 5DJCA 3RY5A 2IANB 4C58B 2FLRT 4NKIH 3CVHB 2FO1A 3L9RA 3HAEB 1A6PA 5TF1H 3HNTL 3SCMD 2DAVA 1B4JH 3EDEA 1AJ7L 5C0BD 1MCWM 5E6ID 1FNFA 5HYSG 4L29A 4BH8A 4OGYL 5BVJB 3WHXB 4P4RB 4LKXB 1L9NA 1VGEH 5C6TH 4H0IA 2PYFA 4OCYH 4ODUB 4TQEL 4YBQC 4U1HB 5LCVH 4KKAC 4L3EA 1IC5H 1M1SA 5E08L 1ZHBA 3ULSA 4PUBL 3EO9L 3UJJL 1IKFL 4LLDA 5E5MA 4PJ9A 2VE6A 3V5HB 1N2RB 4G6AC 5C9KA 3ZKNC 4MS8C 5IROC 2H32A 3ARQA 1E4WH 4QOKB 1FNGA 3C6LC 3MRBB 3EYOA 4OCNC 1DDHB 2R56L 8FABB 1IC4L 2WUBL 3VFGH 3C6LB 1NAMH 1I3RB 1XR8A 2EEDA 4HG4K 5CMAB 5JW3H 2Z92B 3BD5A 5D70L 4JPWL 2HTKC 2R2BA 4GLRI 1IM9B 4C56E 2XTJE 5CZKA 1MWAL 1JHLH 3CLFH 4QO1A 3F58L 3DXAE 3OHXA 5HGDA 2VLME 1J8HA 4JY5H 1PY9A 3GMOA 3OXRB 4WHYG 1CGXA 1ZVSB 1HDMB 4YHOL 5L8JB 2P4AB 3WHE1 5HVFB 4WNQB 3LKSB 4KJYB 2GJ6D 4PJ5D 5J9PB 3WLBA 1INQB 2ESVB 2NX5B 3GIZL 4JFHD 1JPSH 5FA4B 4LSSH 2EH7H 4CMMA 3DUHA 3QHZL 3O3BA 4RGOH 1R0AH 4LLQB 4P2CG 2HT4C 2YZ8A 4JQVC 4JR9H 3UJIH 2EDRA 3TEUA 5FHBH 1NFIB 4LCIL 3FQUB 3G6DH 3S34L 1IEHA 5LQBH 3CFJB 3VGDA 3IAPA 4QXUH 4NJ9L 4JQIH 3MBXL 3KYOB 2OK0H 4LL9A 5DD6B 1FC2D 2YUXA 2NYYD 4KI5C 3AROA 2ZSWB 3GJFA 2CIIA 2WV3A 1MJ8L 4YHML 1RVFL 2QHRL 1FV1A 1U3HD 4TSCH 5E1HB 4ODXB 4LRNH 5T1LB 1EHAA 3KLAA 5HHPB 4X6BA 1U8NB 1JNLH 1I8IB 3QIUC 3QQ9C 3LQAL 3TBSB 5HYSA 2Y1VA 3CFKA 1MI5E 1QRND 3QCUL 1KJ2H 3QIUB 4ZXBC 4Z7OF 2ADGB 4TRPL 5IHLB 3K46A 3MV9D 5A2LH 2HAZA 3ARBC 4ZO9A 3ZYZA 4X8JB 1EXUA 2VKWA 4ZXBB 4X9IA 1IBGL 1G9MC 2R69L 3ARBB 3D69A 4OBSA 5IB2A 1P2CA 1XCQB 2CXKA 3BXNA 4K94H 4YHIB 2CLVA 5L2KD 4ELKA 4NO5B 5I18H 2GJ6E 4PJ5E 5K9JH 5DGRA 1IZKA 1GOFA 2BSTA 2IFFL 4JFHE 2Y7QB 3QUZC 5ADOL 3AU1A 5I30H 3MLTB 2QJDA 3GO1L 1JGLL 4YNYA 4MDIB 2NY4D 3RL2A 5HYIA 3HB3D 3LV3B 1DE4A 4DW2H 4U1NA 2DWDA 4L3CA 2C4FT 3L7FA 3W9EA 4FABL 1W0WB 2FJFB 4LDEB 1NANH 1CD1A 5DJ6B 3BP5B 3REVB 4R8WL 1QBLH 3MNZB 4K7PY 4GG8A 1C5BH 3MRNA 2ZOLA 1AP2A 1T0PB 3RKDC 5DRWB 5HI4D 1FYHB 1IT9H 2J4WL 3U30C 1Z3GH 1B0GB 4P57B 5BRZE 2YMXH 3NFSL 3U30B 5DK0A 2L7JA 2BVPA 4FQIL 1ZA6B 3IFOB 1LWRA 2MNUA 3MLPA 3H2WA 3TH4T 1YEGL 3DRQB 1QRNE 3DX6A 4MNGE 3N1QC 2YSSA 1E28B 1P4IH 3BX7C 4HGWA 1T2JA 2GY7B 3MREA 5HDOA 3FQTA 4NQXB 3MA7B 4OZIE 43CAA 5A16B 1FG9C 4BZ1L 3V6OE 5LGJA 5L2KE 5LJYH 1AO7A 2NY2C 4X6DA 1HYSD 2Y36H 1ZHNB 3GMPA 5IVXA 3AB0C 4LEXL 3I85A 4Z76B 2NY2B 1A4KA 1GYAA 2CKNA 1FZMA 3SDCA 3AB0B 3RBGA 5IMMB 3NCMA 3HMXH 1UC6A 3SE8H 1J87A 1F58L 1NLBH 1SJEA 3VI3E 4YXHL 3ZE0E 5EO0B 5I16A 1FNEB 4JQXA 4RWYH 1OTSC 3HR5B 3TJEH 2VH5L 2DQDH 5DSCA 1CGSL 5EG6C 1T7ZA 1C12A 5GRXG 2YA0A 1CK0H 3NVQA 2CIKA 2HT3D 3AC0A 5EFIB 4V1DA 2F74B 2IGFL 5CILL 1CI5A 1MQKL 3CDFA 4M7LL 2Y5TA 1BQUA 4PJCB 3ULVF 4PPTA 4PBVC 1N4XL 1V05A 1MRFH 4NM8H 3VMOA 5F1SA 2QADD 1HCVA 4UT9L 4MD5B 2DLTA 1A02N 4XVJL 1QYGL 5SV4A 1RUKL 4WY7L 3C2SA 3GMQB 4FHBD 1T0NB 3O2WL 1HHIA 2YC1B 4QHMB 4YC2C 2DICA 5DC4B 1A5FL 4H1LG 5J0BA 5IHUH 3QPQC 1FGNH 4M1DH 3FB8A 1J10A 1MIEL 3IFNL 4HC1A 3DGGB 3X11B 1Q72L 1JZ2A 1KTLB 4LU5L 4PLJD 3T77A 4NQUA 4LNRB 4OFKA 3VE0A 5DGQA 5JTWA 2BJML 2NLJB 4LVOC 3VRJB 2FR4B 4WJ5A 1KENL 4K7FA 3T0WA 1TQCC 3MOBL 4LVOB 2OQJB 4I0CC 1KSRA 1GGIH 1T83A 1TQCB 1YEKH 3TVMA 2RAMA 1GGUA 5C0FB 5EU5A 1KB9K 4HS8L 3GSRB 5LXGH 3A67L 3P11L 5ISZB 1E6OL 4WW1B 4P46C 4PJBA 5DJ0A 2I60L 1D5IL 5FDWB 2JCCB 1NCTA 3D25A 3QDGD 5D72L 1I8KA 1MFDL 2MCPH 4JO4L 4M7LT 4P46B 4AIZB 2ZNWA 4CADB 2A83A 2KUTA 1KTKE 4LLWB 4S1RH 2EYSA 1U91A 2OL3B 1WCQA 1QQDB 1W8NA 4M1GL 3K1DA 3Q5YA 2GSGA 5JOFB 2WUCL 2ID5A 2NY5L 5E99L 3VFUA 3L3GB 1EGJA 1YPZB 1WK0A 3JV4B 1MFBH 5BS0B 3M07A 3RDTA 5CJBA 1AHWC 2R2HB 5C2BH 1RUQH 1S9KC 2AK4B 1DP0A 1AHWB 3ZKXC 5I9QC 1HHJA 1BVKA 5E94A 4LVNC 4JY6A 4W4NA 3ZKXB 5EOQH 5I9QB 2VERN 1CF8L 1Z9OA 4LVNB 4XB8A 4UNUA 4HIJB 2YD7A 5HYQA 4CN6A 2DQUL 3BKYH 2IPKA 4J7RA 3S4SA 1BBJB 1FG2A 2UWEE 1Y6MR 4IRZL 5F7DA 1DFBL 3QDHA 1LO5A 2D7MA 3A0OA 1F3JB 1HIML 4OIAA 5DQ9A 3TT1H 2LU7A 3PDGA 5ITFA 1JGDB 5DJ2A 3RTQD 2YPLB 1GZQB 1DEEB 1EFXA 3WIHH 5FUOH 1ZVHA 1OSZB 2ZUSA 2D31A 5GZOC 4IIQC 1JVKA 4FXKA 5DJZA 5TF1L 3QCTH 3BZDA 5JO5B 5L8KB 3QDGE 5LWYL 4PJFA 4IIQB 1M71B 4K3HA 4H1LA 4L8BA 1JTTA 1P53A 3HC0A 4B0MM 4XPTL 2GI7A 2DLIA 4FFZH 1HINH 4PJHA 1T21B 3BO8A 5DHYB 5MEPB 5J06A 4Z7UB 2DM7A 2AI0H 1IC5L 2AK1L 2JJUA 4L4VA 1WCBB 2BCKA 43C9B 4KJPC 4KK6D 3T8XA 3ULUF 2VMFA 4M6NH 4XZUB 5EWIH 4JANB 3SKUD 2P5EB 4QTIH 1JF1B 1KIPB 1E4WL 2NTSP 3BPNC 4NP4H 4XPBH 1CD9B 4NZRL 3QIBB 3VFGL 4HUUB 2DLFL 1N6VA 4PG9B 3RZCD 4U2YA 3BPNB 4YPGA 4ZFGL 4OZGA 2GTWA 5C0EB 4ODVL 4IBLT 1CGYA 3WEXB 3MNVA 5INCA 1IARB 1DQJB 1NMCC 2VB5A 1ZS8B 4P9HL 4JFED 1CBVL 1ZT7B 1EHXA 4Y4FD 4Z7VA 3S96A 5E24E 1KPVB 3FT2A 5DFTA 1EMTH 2NY0C 1BD2A 4HFUL 2Z8WC 5C0IA 4JPVH 2NY0B 1O7SA 4GQ9H 2PTTA 1LO4L 4LSRH 4TUJA 2Q76A 1K8IB 1BZ9B 3GBNH 4PGCA 3WJJA 1PZUB 4P49A 4G42A 1JPSL 1QG3A 3LAFA 3BAEL 5HVGB 4KK9C 4K3EH 1Q0XH 5IW1A 1EBPA 2V17H 1U8QA 4RGOL 5HY9A 3EUUA 4P2OC 4YHZH 1XGQB 4OLWH 4HIIB 4G7YH 4HXAL 4P2OB 5FHBL 3G6DL 1V8HA 1E0OB 1RJYB 4X6CE 4RBPK 4R96A 1T3FA 1YMMB 2EDLA 5IMOB 1X5JA 4NNXA 1QTYT 3TNMB 5I1GH 4JQIL 3QG7H 1QUNA 3IRZA 3U9UA 3EOYG 3NCYS 4MDJA 1RMFL 1VFUA 4AEHL 3O6KL 3CXDL 3VXPA 1BJMA 2IPTL 3VXRB 2NNAA 3BE1H 4TUOB 1R5IA 4LSQH 1XGRA 5JMRA 3H8NA 4LRNL 5KVGL 1ETZA 4P2RD 4P4KA 1MCDA 4CBPA 1JV5A 3T0BA 4WW2C 5ECJE 2EDKA 2BVOA 4NFDA 3UYPA 4MSWA 4JFEE 4NWTH 3EDJA 2EEAA 3EYQD 4R26H 4DCQB 3B6SA 3UJTL 2DL2A 4OIBA 1DVFB 3RI5K 3PWPE 2WLYA 2FIKB 4WFFD 5J13C 3H7BA 5ACZB 2ZPKH 5DEFB 5J13B 1RJZB 3TCLA 4HUXA 1CFNB 5I18L 2DIJA 4ZUTA 4KC3B 5K9JL 4YDKH 1FIGL 1UCBH 1IAKB 4U1LB 1JPST 3NCEB 4E41A 4NO3A 4KTDH 5KS9B 1OAUH 4MNHA 4IDJL 1CL7L 4NZUL 4OAWB 4JO2H 3CFEB 2FNBA 5D6CB 4DW2L 2E7LA 2EO9A 3V0VB 4KRLB 5IB5B 3GSQB 1M7DA 1D9KD 1YEJH 3ZMRA 1D6EA 5I2IA 3DIFA 4P2QB 3EJJX 3GFUA 5I1KL 1WGOA 1C5BL 4EIZC 5FIEA 1EHNA 5DWUH 2A73B 5J57B 3DV4B 1IM3A 3H6JA 4UMGA 1UB5A 1QHPA 3QXTA 1A6WL 5CJXA 4P2RE 3OMZA 1MLBB 3GSXB 1DN0B 3IFLH 5B3JE 5TQ0L 2ARWA 1IGYA 5D1QD 1K2DA 1T2XA 2PW1A 5DJCB 3EYSH 1V7NL 4K9EC 4RCAA 3L9RB 1P4IL 1T4KA 4L4JA 4UT7H 2HKFH 3IDXL 2V2XA 4L29B 4BH8B 3B9AA 1OAKL 3MGOA 3MRCA 4DGIL 2YD2A 4XPGH 5FO7B 3JWNC 1G7IB 4ZOCA 2PYFB 4QRTA 4OT1L 1MRCH 5GS0H 3KS0J 2B39A 4JRYE 4L3EB 1UXWA 4PJ9C 1X6LA 1NKOA 1ZHBB 3ULSB 4YR6B 2J5LC