3C2BA

Crystal structure of tetr transcriptional regulator from agrobacterium tumefaciens
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
203
structure length
200
Chain Sequence
SPRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAMITFQQSKVRTFEKAGDRVSAPQLADHLEVFAHDLLDVLAGDVSLALNRLAIGQASRKLGDLLLERGRRQIDRRARGLIEAGRRSGYLRFDDAEEAYRSFYGLIVSDLHVRMLLGEAPDKDFSARAKKAVVAFLTLYGTEKVHSELGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of TetR transcriptional regulator from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
total genus 68
structure length 200
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14246 TetR_C_7 AefR-like transcriptional repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3c2bA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3c2bA02
4Y7NJ 3BCGA 3COLA 3JRHA 4UUSB 5D19A 2W53A 1MBEA 5EF6A 4CYCA 2L9RA 3BT9A 3V78A 2R5YB 2VUMJ 3S1NJ 3BRUA 2HOTA 4CGRA 5M3FJ 5K7HA 3GTQJ 2EZIA 3HBLA 4XRMA 4QTRA 4NN1A 3LSPA 2M34A 3HTIA 5FKOA 3OSGA 2XGEA 1JKRC 1SGMA 2ECCA 3C2BA 3HM5A 2EBIA 4W1UA 1UI5A 2O9LA 3DEWA 1WGXA 4M3BA 4ME9A 2G7SA 5H9TA 2YU9J 5FKNA 3IH3A 3PM1A 3TP3A 5F0CA 4A3KJ 4A3IJ 3GTOJ 4MFEA 1ETOA 1NK2P 1ETQA 2JWTA 1K83J 3GTKJ 3PASA 2HYJA 1GUUA 2XPVA 2QIBA 4RDUA 3LSGA 2E1OA 5E3NA 4JL3A 3HTJA 3VUQA 3Q0WA 1UHSA 2X6OA 3FK7A 2NS7A 4CYCB 4IHVA 2X48A 5FLMJ 5D1RA 4X6AJ 1QPIA 2FBQA 3S15J 2UXIA 2P81A 1HOMA 1JJ6C 2B63J 1QRYA 2HXOA 2MSYA 1YRNB 3E7QA 5GPCA 3GBGA 5E3LA 3CDLA 3HE0A 3LOCA 2R5ZB 1D5YA 3RZDJ 4M3GA 5F08A 4B3AA 3JRIA 3RQIA 2HDDA 5CXGA 3UKGA 5M3MJ 5EZGA 1W0UA 2QWTA 3LHQA 4A3DJ 2GFNA 3ZQLA 2E2HJ 2K9NA 2QKOA 5F0HA 3ANPA 5FHPA 2UXPA 4MO7A 4B4CA 2TCTA 1U9NA 3VW0A 4A3FJ 2O7OA 4UDSA 3JREA 5C4YA 2NOGA 4V2FA 5CXIA 3BR0A 3RKQA 3GTGJ 3GZIA 2LLKA 1HLVA 1ETWA 2DJNA 2E2IJ 2JA5J 2HXIA 3JRCA 2G7LA 2OF7A 3H3VK 2VKEA 1FTZA 2DG7A 2QOPA 2WAQN 3HKZN 3O8HA 1BA5A 3FKIJ 2NS8A 4AUXA 1IRZA 1GV2A 5HBUA 2COBA 4GFBA 4GCKA 3F1BA 3IH2A 3HOUJ 1TWAJ 2CRGA 2EZLA 2ME0A 1PUFB 1YRNA 3VOKA 1WCMJ 1TC3C 3KKDA 1JT0A 1LE8A 4D5FA 4AF5A 3V6GA 3IH4A 1X2MA 2NVYJ 2H1KA 2GBYA 1OCPA 5HSZA 2ECBA 1BJZA 1XG1A 4FCYA 4S0HB 5FKKA 2LKXA 1VNDA 1MBHA 4EEFG 2E19A 3K2AA 5IPAA 3KKCA 1Q1VA 2JN6A 1UG2A 2MG4A 3HB9A 2WUIA 3AQTA 2ELKA 2QF7A 2WV1A 3A01A 4UUSA 2PZ9A 1NK3P 4MK6A 5K7FA 3L1PA 3S5RA 3VVXA 1H88C 1MSFC 1ORKA 3BR6A 3VOXA 5EGOA 2R5YA 3G1MA 1U9OA 4MIMA 3IV5A 2CUEA 2GENA 2DTZA 1FIAA 1NTCA 1RPWA 4BBSJ 4YZEA 2DA6A 1RKTA 2ZCNA 2CUFA 1GV5A 5J1UA 1WI3A 4BBRJ 2YUSA 4A93J 2JJ7A 1QVUA 1P7IA 3RZOJ 1ZTRA 3DCFA 4BY7J 1S7EA 3B6CA 3ZQGA 1HDPA 2RAEA 5DAJA 4MFDA 3GTMJ 2N8GA 4D7MA 3CJDA 2G7GA 2LFBA 5IOZA 3S1QJ 1TWFJ 4GFKA 2OERA 2VPRA 2ZB9A 3B6AA 3HGYA 5M5WJ 2DG8A 1ETYA 2DA1A 1JTXA 2DA7A 4FTHA 3F0CA 2LY9A 2ID6A 3Q3SA 2NP5A 4DYRA 4ACIA 2F07A 2Y31A 3TEDA 3MVPA 3A02A 4I6ZA 3FRQA 1W0TA 2KDZA 4XK4A 3JR9A 1VF9A 1ZR4A 1F36A 1ZKGA 3BTCA 1ENHA 2VI6A 3QPLA 4QIWN 4MLOA 1XC5A 5EGOB 2AHQA 3DPJA 2TRTA 5J1RA 2VKVA 3FK6A 4GFLA 3RH2A 1RETA 1E3OC 5HODA 2MW8A 1OCTC 1GDTA 3WHBA 3ON4A 1TWGJ 4DW6A 1B72B 2DN0A 2ID3A 4FISA 4M3EA 1BL0A 2IEKA 2EZHA 1HCRA 2K9SA 2M9HA 3BG5A 3KZ9A 1VI0A 2ZOYA 2LK2A 2M2EA 3HTAA 1P7JA 2G3BA 3CCYA 2H8RA 3Q0UA 2DA4A 2NP3A 3G7RA 1TWCJ 4G12A 1MNMC 4FE7A 2DMTA 2IBDA 4A69C 3EGQA 3ON2A 1ZGWA 3CMYA 3KNWA 2Q24A 3BR3A 2R7ZJ 3NRGA 2XDNA 5K7ZA 3ZQCA 2UXOA 2XPWA 2YS9A 1TWHJ 1I6HJ 2DA2A 1T33A 2DMPA 3HOYJ 2FQ4A 4A3CJ 2M8GX 3G1OA 3TW7A 5E3MA 2X9DA 2L7FP 3O8GA 3TP0A 3GTPJ 5FKLA 4RBOA 1IUFA 1HF0A 1DU6A 3IUVA 4A3EJ 1AU7A 3HEFA 1FJLA 3BQYA 2L0KA 1IGNA 2XB5A 1Z0XA 1F43A 1BW6A 3MNLA 5C4XJ 3RD3A 3VW2A 3BG9A 1JTYA 4A3BJ 3CRJA 3S1MJ 3I4NJ 2Y9YA 3SJMA 1FEXA 2QCOA 1I50J 3NXCA 1MBFA 2HQ5A 4DYQA 5IP6A 5IP7J 5M5YJ 4L62A 1MBGA 9ANTA 1JUMA 1JKQC 3QBMA 3OIOA 5EG0A 3FIWA 2CU7A 3JRDA 5J3LA 3S16J 1JUSA 1SANA 5F0FA 3JSJA 4M6VA 4A3MJ 1ZQ3P 3A01B 4Y52J 5FMPA 2UXHA 1EF4A 3JRGA 2Y30A 2LTPA 3BNIA 3SDGA 1FIPA 5CW8A 5EZHA 2FJ1A 5EEAA 1FTTA 3CWRA 5DTDA 2DA3A 1GVDA 1JT6A 3W6VA 1B8IA 1T56A 1IC8A 3JRAA 2FX0A 2EQRA 3BG3A 2ME6A 1VFCA 2R0QC 2D5VA 4X1EA 1O4XA 1I3QJ 1RKWA 3ANGA 1ITYA 1OJLA 3BR1A 5F1JA 4PXIA 3PPBA 3Q0VA 4XICA 3VW1A 1A6IA 3AQSA 2O8KA 4XRSA 1MH3A 5HAWA 2EH3A 2XPUA 2PMZN 5IP9J 2HOSA 4L5EA 2MGQA 3HGGA 1X2NA 5EG0B 4M3DA 3BQZA 2RHAA 3VIBA 4JKZA 3BTLA 1MBJA 3NPIA 2Y2ZA 2XRLA 4AYBN 2NVTJ 5FGLA 3QPSA 3EUPA 3TW6A 2ZCXA 1JJ8C 5E3OA 3HOZJ 3GEUA 2CJJA 2Y0SN 1Y1VJ 3BTIA 4DYCA 5DS9A 4IHWA 3S14J 1R9TJ 2LR8A 3HOXJ 4JYKA 1JGGA 5D18A 1IG7A 1B72A 4C2MJ 2XGDA 5M5XJ 2ZCMA 4W97A 3JRBA 3HOWJ 2K9QA 2R92J 1IDZA 1RR7A 1ETVA 4V2GA 1IDYA 3SFIA 4C3JJ 4GCTA 4NELA 3VVZA 1MH4A 2E2JJ 1SFOJ 3WHCA 5C4JJ 3GTLJ 3E7LA 5J1YA 5BNGA 1WH5A 1WH7A 2R93J 2K40A 4JNNA 2JA7J 3BR2A 2HKUA 1Z77A 3P9TA 3HTHA 3CQZJ 2XB0X 3M3YJ 3MN2A 3NAUA 4B1RA 3VVYA 4DZPA 3HIMA 2RASA 4AC6A 4HNVA 2W48A 4J19A 1H8AC 3ZQIA 3BHQA 3FISA 2KT0A 3K7AJ 4LOCA 4AC0A 1Y1WJ 3LWJA 4JX4A 5K58A 2JA8J 1POGA 2QTQA 4BY1J 2XGCA 3S2HJ 2YVEA 1LFBA 2REKA 3I4MJ 1IJWC 5AQCA 3S17J 1H89C 2IAIA 1JKPC 1BW5A 4KWAA 4FE4A 4QSHA 3JRFA 1WPKA 2O7TA 4IEJA 2JMWA 4BKXA 5FJ8J 3QQAA 3LSJA 3LJLA 2M0CA 3S1RJ 4ICHA 2FD5A 2WB1N 1APLC 4NDLA 1AHDP 2V57A 3MKLA 2HOAA 3ZOBA 5IOYA 5JLWA 3D1NI 4A3JJ 1CQTA 2I10A 1U78A 2JA6J 1GT0C 3M4OJ 5F27A 1ETKA 4D7NA 3NNRA 5F04A 2OPTA 5IYBJ 4D5CA 2R5ZA 2PBXA 1A5JA 2NVXJ 4IHYA 4XIDA 1AKHA 5GPAA 1HDDC 4JX6A 2ZOZA 3HDDA 1MSEC 4C3IJ 4GCLA 3G1LA 4I76A 5EFYA 2HI3A 1OFCX 4UUTA 2GM4A 3VPRA 3A03A 2D6YA 1X58A 2GLOA 1B8IB 1ZR2A 2WGBA 3BJBA 2HYTA 2CQXA 3PO2J 2LD5A 5C44J 2LVSA 2JK3A 1JKOC 3O60A 5EDNA 3OSFA 3LNQA 1ETXA 4M3FA 2GUHA 2EZKA 2XSDC 3BR5A 2L7MP 2DA5A 1K61A 2NVQJ 2L7ZA 4MXMA 1U8BA 4A3GJ 1UMQA 4BXXJ 2YVHA 4JX5A 4A3LJ 2IU5A 3B81A 2Y9ZA 3GTJJ 3BTJA 5IYDJ 4JP0A 1PUFA 4DZJA 3G56A 5C3EJ 3NARA 2LP0A 4XRSG 1LE8B 3H0GJ 5FLVA 3PO3J 4HKUA 1AKHB 1XS9A 2NX4A 3T6NA 4C3HJ 3LSRA 2CQQA 2DMUA 2DMQA 1IV6A 2DMNA 2UXUA 5EYRA 1JUPA 1LFUP 3S2DJ 1RESA 5FKMA 4IHXA 1UI6A 3C07A 1DU0A 1G2HA 3ZQFA 3QKXA 3VP5A 3HOVJ 3ZQHA 2G0EA 1MBKA 1QVTA 5IYCJ 3NI7A 2AO9A 5GP9A 2OI8A 5JLXA 4ABZA 3OOUA 1ZK8A
chains in the Genus database with same CATH superfamily
3BCGA 4LIVA 2KHMA 1R58A 1H0MA 1N78A 4CYCA 1ZG3A 3BT9A 2VC1A 2DFEA 4MQ9F 1PVEA 2HOTA 1ZRFA 3TQNA 3HBLA 2QQAA 4QTRA 2DODA 3SZTA 4AD9A 4BJ5C 2P5VA 2XGEA 3C2BA 3HM5A 3DEWA 1TL8A 4ME9A 4M3BA 2GA2A 4PGGA 3ZPLA 2O5RA 3VYTB 4Y33A 1K78A 3L2RA 1TQMA 3ZN1A 2H27A 3DLLF 1S9HA 2JWTA 2LF8A 2RREA 4L9VA 1Q1HA 2FBHA 2HYJA 2XPVA 4JBAA 4GYGA 4XLHA 4G7ZF 2QIBA 3KLOA 3DTEA 2VJJA 4C2MA 2CSOA 3CCSI 3QAHA 3QOEA 4EM2A 4IHTA 3HPHA 4KMUX 2HKXA 5CQEA 3SQNA 4EJWA 3F9KA 4LIUA 2ZMEB 3R6SA 3Q0WA 2JSPA 2MA3A 4BEHB 1YIOA 2DK5A 4N4NB 2X1CA 2NS7A 2A05A 4CZZA 1B59A 4CYCB 2Q0OA 2GOMA 2VB6A 1VQ9I 1DP7P 3F22A 3S15J 2UXIA 3ECHA 1HOMA 4DNCA 5DCMA 4JK1X 1Z7LA 2R7TA 5GPCA 3V42A 3CDLA 1X4PA 3HE0A 2R5ZB 2M7AA 3RZDJ 2ZC2A 2LOOA 3KYDB 2VC0A 2MLKA 3JRIA 2KRCA 1P6RA 3RQIA 2HDDA 5M3MJ 5EZGA 1W0UA 3LHQA 3C1DA 2QKOA 4RB2C 2A5YB 5F0HA 5FHPA 3WTZA 2BXYA 5J8FA 2Z2SB 2CMPA 2AQEA 4A3FJ 4KUMA 3F3XA 2LRDA 1MJ9A 3QYBA 1HLVA 4MEXF 1ETWA 2LMDA 4RGUA 3JSOA 2E2IJ 1UHWA 5F1RA 2KZGA 2ADUA 2HXIA 3N05A 4RS8A 5F6FA 3H3VK 4CICA 2CGPA 3HKZN 4Y13A 2DXIA 4XMYA 3WGHA 3H5AA 4BH9A 1ERDA 3EUHA 2HTJA 2COBA 4GFBA 1SFXA 3SZPA 3F1BA 4GXOA 2JUCA 2IS1A 3RPUA 1TWAJ 4RGRA 5JHFA 2CRGA 2EZLA 4IRGA 1YRNA 3RTRA 3VOKA 4Y15A 1TC3C 3DWLE 1D8JA 4RAGA 1LE8A 1G4DA 5EEGA 2H1KA 1U2WA 3IUOA 3JAMK 4YFNF 2VKDA 2X1DA 4C2TA 1MMDA 2PFVA 2HVRA 1FBUA 3DXJF 2LBFB 4ZZLA 5AIQA 1WI9A 4HLYA 2EJRA 2KRHA 2WV1A 5L3GA 3A01A 4RLFA 2PMUA 3ABKH 1TTYA 3L1PA 5A2QZ 1H88C 1MSFC 1IAWA 1ZREA 3KE2A 3VOXA 2R5YA 2MD0A 2O0YA 3BCAA 1FZPB 1FIAA 2DT7B 4FX0A 1Y8RB 5B1AH 4YZEA 1O3QA 2BHYA 4PZJA 4KT6A 3LFUA 4L0YB 1P7IA 3GF2A 1TQIA 3M9AA 5FO5A 4O3MA 4DIQA 2LKPA 3TGNA 1XX5A 4MFDA 2MC3A 4PJLA 2K85A 4D7MA 1G3TA 3LWFA 2X6WA 5IOZA 2VQHA 1SD7A 1QNTA 1TWFJ 2OERA 2NXNB 3GVAA 3KP3A 4HV5A 1ODDA 4C9YA 1JTXA 2PBIA 2YX7A 2LY9A 1WJBA 2NYXA 3Q3SA 5H2FC 4X0GA 3WTYC 1NH3A 2V26A 5BPIA 1LEAA 3A0BC 1W0TA 1ZR4A 2X6XA 5H6QA 3BTCA 3WG7H 5FGMA 2VI6A 2F5FA 1QO0D 4QIWN 3ZN0A 4WCGA 1XC5A 3KEOA 5H20A 4RA2A 3CTAA 1YIJI 1WJAA 5L3EA 5DCMB 5HODA 1OCTC 1O7LA 3ON4A 2L01A 3I58A 2ID3A 4FISA 4M3EA 4NNJA 1BL0A 2IEKA 2R7SA 1X1BA 1B9NA 2DPDA 2M9HA 2DAOA 4YELA 3FHZA 2M2EA 4ESJA 4XN0A 1E2XA 1YJNI 3CCYA 2H8RA 4HW0A 3T0YA 3Q0UA 5KK1A 1RIOH 3SWHA 2ZJPF 3G7RA 4G12A 3GEZA 4ITVA 4ZJZA 1XMKA 1IV8A 4FE7A 1YI2I 3D5LA 1LQ1A 3CMYA 2A07F 1WVRA 2Q24A 3I59B 3OYEA 3BR3A 3BY6A 1X3ZB 3I0TA 2R7ZJ 5B1BH 5K7ZA 1YTYA 2L7KA 3HRMA 4CA0A 2OQRA 1B6AA 1TWHJ 1P4AA 2BY0A 2CYYA 2DMPA 5J8CA 3HOYJ 1J0RA 3TW7A 5E3MA 3CC2I 3WG9A 2HFHA 2V1UA 1J59A 4KICA 1MMGA 3U21A 2XSJC 3KP2A 4B09A 1FYKA 3GW2A 1LDJA 2FE3A 1W36C 2H8WA 4ETSA 4IO9F 3BG9A 1JTYA 2BGCA 2EILH 3M8EA 2Y9YA 2BY1A 3GFJA 3PUBA 4TV7A 1QHHD 4L62A 9ANTA 1JUMA 5E1WA 1ZLJA 3WU0A 5EG0A 4E6KG 3CLOA 3HC7A 3JRDA 2DOEA 2LSOA 5J3LA 5HDNA 2XAFA 2V6EA 3GZNB 1UG0A 4XN3A 1SANA 2O03A 4Q4ZF 4M6VA 3A01B 5FMPA 1ZGAA 1XB4A 3ZMTA 3JRGA 3L2QA 5CVIA 2IS2A 4LLNA 1P92A 3SDGA 3WTUC 3RI4A 5EZHA 3TL4X 4G7OF 1S8NA 3KP5A 5DTDA 4IZZA 1JE8A 3CWRA 1GVDA 3KLNA 1HW5A 3OOPA 3CC4I 4U88A 3ROUA 3HUGA 4LK1F 3JRAA 1IC8A 4OIOF 2OBPA 1BR1A 4B47A 4X1EA 2H6BA 1I3QJ 1RKWA 3HOSA 4A12A 2VQCA 5F1JA 2ZJQF 2MH9A 3VW1A 4A5NA 2EPFA 3GZ5A 4XRSA 2XPUA 1HKSA 2HOSA 2JVGA 2YX4A 2XRNA 5GAGJ 5L3DA 2IPQX 4L5EA 1O3TA 3OS1A 2F2EA 1MMSA 1X2NA 5B5EC 1Z6TA 1IXSB 3BQZA 2RHAA 2BVMA 3R0AA 3GFIA 3HRUA 3QPSA 3G4SI 1V5EA 5E3OA 4HYEA 3GEUA 3C18A 4DYCA 4A0ZA 4G9YA 2ZFWA 4RAZA 5FLXK 3G2BA 3P7NA 4IVNA 2PMZA 1VQ6I 3I5UA 2A69F 3L7WA 4DOZA 4EJUA 3ABLH 5BPDA 1B72A 4XOTA 5M5XJ 2HOEA 4W97A 3S93A 4LITA 3H9QA 2K9QA 5JI6A 1RR7A 1IDYA 3SFIA 4KNYA 4ZYDA 4GCTA 1TNSA 3BPVA 4WIBA 1IN4A 1DPRA 2ICWG 3BWGA 3E7LA 2QWWA 3RYRA 4C2UA 3O2PE 4J00A 1WH7A 3K2ZA 2K40A 4JNNA 1HBXG 1X1PA 4M73A 4AU7A 3ZMZA 3CCJI 3ZQ7A 3O3KA 3FF5A 1U0JA 1H8AC 2L5QA 3FISA 3SYTA 2PLYA 5K58A 3HKZA 3M1EA 5DDGA 3BG7A 2J5OA 3EUHC 2G7HA 2QTQA 1U5TA 4E7HA 3S2HJ 2X4HA 2ZSHB 1LFBA 1HW1A 2BV6A 3NQOA 5J6XA 2BE5F 1XN7A 1BW5A 4FE4A 2ZMEA 4XLFA 3REOA 4BKXA 2BW3B 3R0JA 3SHFA 2HVSA 4ICHA 2FD5A 3MAJA 2QEXI 3GUDA 2AXTC 3G3ZA 1AHDP 3DBLB 1CQTA 4LG0A 1LB2A 4AIKA 2JA6J 4WXCA 2W1OA 2XHKA 4D7NA 4G6TB 2OPTA 3CMMA 3F72A 5IYBJ 4D5CA 3HJEA 2GIVA 3H92A 4XNFA 4IHYA 2R7WA 3DPTA 1EA3A 3DKXA 3HDDA 3CCQI 4Q47A 1FOKA 1WFXA 2IVMA 4P1WA 3G1LA 4YG2F 4OOIA 2HI3A 3IAM2 2GM4A 3K4LA 2VN2A 2X1EA 3A03A 3WGGA 2F5CA 4MHGA 1ZYRF 5B3SH 1B8IB 3BJBA 2K9MA 4XKCA 3K1PA 2HPMA 2LD5A 1DUXC 5EDNA 3OSFA 3FDYA 1QZYA 1UELB 2D1HA 1ETXA 3JTHA 1K6OA 2HKOA 3FBNB 2VQLA 4HRIA 2OTJI 2F4OB 2DTRA 2DA5A 4M9XA 3GO5A 2YVHA 3T1BA 1YW8A 1T0FA 4A3LJ 4XLPF 4CCOA 4XONA 5IYDJ 3VYUB 1XGMA 1TW3A 3G56A 1PP7U 4KJZA 4XRSG 1LE8B 3H0GJ 3PNYA 4HKUA 1AKHB 1D1BA 1XS9A 1B9MA 2IRFG 2CQQA 2W4SA 2QBYB 1ONVA 2DMNA 2PJPA 3DPLC 3G71I 1JUPA 4KISA 1RESA 4PCQA 5FKMA 2R7UA 3C07A 1DU0A 3ZQFA 4ZH4F 4ZYHA 2EA4A 1V54H 2G0EA 4PSXA 1MBKA 2ZJ2A 3E6DA 5IYCJ 3NI7A 5K5RA 3KP7A 3HHHA 1ZK8A 4A0XA 2ZJRF 4MTEA 2IP2A 3JRHA 4UUSB 1W1WE 5ICFA 1BC8C 4DJAA 2Q2EB 2L9RA 4I02A 1NHAA 1YJ9I 2R5YB 3BRUA 2E1NA 4CZCA 3QYFA 2V6CA 5M3FJ 5AONA 3OV8A 2E7XA 3MQ0A 3LSPA 3HTIA 1IO2A 2NOJB 3A0HC 2FMYA 3MZ8A 4MEYF 3ERMA 1JKRC 4F55A 1GXPA 2HYGD 2O9LA 1FBSA 1FY7A 1SD5A 3MZYA 2RV8A 4L9JA 3U1KA 1MJAA 3MZHA 5J4VA 4E7ZA 3TP3A 4BNCA 1C0WA 4YFXF 2Z9OA 4MFEA 4AVPA 1FYLA 1ETQA 1OYWA 1K83J 3RKWA 2QSHX 3PASA 2P6TA 4RDUA 3E5QA 1QU3A 1FMVA 1USTA 3EUKL 3JCUC 3BOQA 2VE8A 3WE3A 3VUQA 1UHSA 2X6OA 1SAXA 1G59A 3EQLF 2RQQA 4KIFA 2D1VA 2DQLA 1VQOI 1UB9A 5D1RA 2QSGX 2FBQA 4KT5C 3AG4H 2Z1DA 3FHNA 1HKTA 2B63J 1QPMA 1QRYA 1WJEA 2E60A 2HXOA 2XIGA 3GBGA 2E1MC 2XROA 1KQ8A 4IRIA 5F08A 2LH9A 4WXDA 1FP1D 1H9TA 1GLNA 4A3DJ 3DF8A 3ZQLA 2E2HJ 5BMZA 2ESHA 1J09A 3HSEA 3KIOA 2LREA 4LJZF 4MO7A 4B4CA 2CFOA 1U9NA 3VW0A 1R7JA 3JREA 3SFZA 4V2FA 5CXIA 1OKRA 1IRFA 2G9WA 3L9FA 3GZIA 2LLKA 3F8CA 2WWYA 2DJNA 3H9GA 2FOKA 1XMAA 4NC8A 3CMEI 2FBKA 3VOEA 2OF7A 2G7LA 2VKEA 5D6EA 2DG7A 4FT8A 2WAQN 4EGZA 1D0ZA 2W82A 5ICCA 3L2UA 1BA5A 2L02A 3FKIJ 1P9QC 4RAYA 5BS6A 4HDUA 2KDOA 2ME0A 2KFDA 3DBHB 5GAEJ 1HSTA 1KA8A 3LSMA 4AF5A 3V6GA 5TJJA 2QYOA 2E36A 3AKZA 4KA4A 1FOWA 4IRVA 1TT0A 1T08B 2HDCA 5D5XB 1Z3XA 1OCPA 5LLQA 5HSZA 5KAIC 2OQGA 2B9SA 4HBLA 4I2OA 1MBHA 2E19A 1WHUA 5GADJ 3ZXSA 2FXAA 2WAQA 4UY8I 3BZ6A 3CJNA 2WAFA 2ELKA 2QF7A 1E3PA 2EB7A 4UUSA 1ZRDA 1NK3P 5JFRA 2FUG2 4BJTA 4A2UA 1OCZH 3BR6A 2WADA 3G1MA 1U9OA 4GDFA 1MZBA 3EPZA 4MIMA 2GENA 1NTCA 2QLZA 3I3LA 3IP4B 4HX8A 3P5JA 4M6XA 1RKTA 3KFWX 3BJ6A 4XLEA 4BBSJ 1GV5A 4E70A 1R71A 2ZO4A 1RC9A 1R6RA 5J1UA 2LF7A 3RJPA 3C2HA 4BBRJ 2OTLI 1QVUA 2DYSH 4BQQA 3FZVA 4AIDA 2Y75A 1G6NA 3OYGA 1YE9A 5DAJA 2COMA 4EATA 4OD4A 3BROA 1W5CC 4GFKA 2VPRA 2ZKZA 3HGYA 5M5WJ 2DG8A 4AIJA 2DA7A 1JXSA 1A35A 2ID6A 3OS0A 4Y4RA 5K5QA 1SVMA 1F5TA 1VQMI 4ACIA 1MDMA 2XKOA 2Y31A 3TEDA 2W57A 3FRQA 4BQAA 2KDZA 1A04A 2DPUA 1VF9A 2EA2A 4BE0A 3N97A 1BI3A 1PJRA 1F36A 1ZKGA 1E17A 2H94A 5DEQA 3CMAI 2AHQA 4OIPF 2LKSA 2TRTA 4FETA 2FF4A 1LDDA 2FSWA 1RETA 4ENMA 2A61A 4XSZF 2ZXJA 4HF1A 2VBYA 2PEXA 4DW6A 2DN0A 4YIIA 4UUVA 2EZHA 1HCRA 5HNHA 1BJAA 3BG5A 1RZ4A 1VI0A 3KEYA 4O5VA 2ZOYA 1R5GA 1XGOA 2V9VA 4LMYA 3BLYA 3TOBA 2W84A 4BHCA 5LD2C 2G3BA 3QPHA 3RCOA 1S7AA 2IJLA 1R22A 2QSFX 3KX2A 2OJED 2M87A 2DFIA 1GHCA 1J9IA 1ZGWA 4U0YA 5D4RA 1EH6A 1RI7A 1OMIA 2ZXIA 3E5XA 3TBIA 3OYFA 2UZKA 4CGZA 3KNWA 3TDZC 2XF5A 3ZQCA 4RLQA 1MDMB 1VQ5I 4N9HA 2YS9A 3DLAA 3OL3A 2EWNA 5DM6F 4HEA2 4II2A 1KQ9A 1QZZA 1T33A 2DA2A 5J40A 1HKQA 2ZY9A 2R7RA 2XAHA 1IN6A 1U8RA 1OLTA 2X9DA 3O8GA 4IQ4A 3TP0A 5ED4A 1HF0A 1IUFA 3WODF 3W2AA 3K4KA 2GXAA 3HEFA 5HOOA 2NNNA 4IOCF 3S8PA 3BQYA 2L0KA 4KIBA 1KZHA 4BE2A 1IGNA 1XGSA 4KDPA 1RR8C 1Z0XA 4RB1A 1F43A 1EH8A 4E7LA 1AWCA 3T8RA 2M45A 2KKOA 2FEZA 2QM3A 5C4XJ 3FM5A 3MD2A 4CCMA 4A3BJ 5DD4A 1BR4A 3SJMA 2OAZA 1PUEE 1I50J 1FEXA 2A6TA 2P5KA 2UWMA 1MBGA 4ON0A 2UXNA 1JKQC 3QBMA 1Z67A 2UXXA 5TGTA 3OIOA 4IRHA 4KN4X 5IT3A 3QP5A 3V8JA 4N4OB 2CU7A 1EJ9A 3S16J 5E8GA 1J5YA 4CSWA 3JSJA 5F0FA 4PSWA 2ISZA 4IF4A 4ZYAA 4L0ZB 4I01A 2UXHA 3S32A 4M74A 2ZXWH 3GMEA 1FIPA 2NAZA 4OU0A 4CCNA 1XDUA 4F52A 3ZMSA 1F9NA 2DO7A 2DA3A 1JT6A 2BYVE 2P7VB 1U5TC 2ZSIB 2BY2A 2XDVA 2OCCH 4V19K 4IXAA 1I5ZA 2BZTA 4UB6C 3EYYA 2PI0A 1O57A 1D1AA 2R0QC 1UFMA 2LC2A 5L3FA 3PIOF 5E79C 1OQYA 3ANGA 2VQGA 1ITYA 4A6EA 2K4JA 2XF6A 2E7WA 5HAWA 1S72I 2V1XA 5E18F 1DGWY 2KLOA 3EUAA 4FX4A 3I9V2 1KYZA 3HGGA 2NS0A 5EG0B 4M9ZA 4M3DA 1TBXA 3FMQA 1VQNI 2BXZA 1Y0NA 2M3AA 1MBJA 1T98A 3ML6A 3CCLI 3NPIA 3K9TA 2XRLA 3O6BB 3FXLA 3HOZJ 1U5TB 2CJJA 4HSRA 1Y1VJ 3DTIA 2RQPA 3OR2C 5DS9A 4IHWA 2V9PA 3HSFA 2W7NA 5BQTA 3E6BA 1J7KA 3MMYB 3IRQA 1T0FC 1HXDA 1STZA 1LVAA 1IF1A 1FMWA 2WTEA 2XGDA 4B43A 3DTKA 2PN6A 1FNNA 1OYIA 4S05A 2WA0A 2K02A 4WWCA 3OYNA 3P9KA 1ETVA 4XLCA 4XBFA 4C3JJ 4NELA 2JRTA 3GTLJ 1I1GA 5L3BA 5DV5A 4HNTA 4HG2A 1I3AA 1LJ9A 1R1VA 3IWZA 1JHHA 1R1TA 2HKUA 3SZGA 3OMYA 2B7EA 3CQZJ 4A6DA 3VSKA 3MN2A 3PJRA 3HTHA 1IRXA 3NAUA 1XGNA 3HPGA 4B1RA 1GVJA 4DZPA 4AC6A 1PYVA 3QYEA 2W48A 4L9NA 4J19A 2LYCA 4PK4A 1V5FA 2W24A 4LLLA 1FSHA 1Y1WJ 5FB2A 2BBYA 1ULYA 3E0JB 4JX4A 4BS9A 3OY9A 3GYHX 4I0BA 2JA8J 3C2GA 4R8HA 4D0PA 1ZAOA 4BY1J 1I6XA 2XGCA 1FP2A 4FQGA 4Z2YA 2QQ9A 4HLXA 5LHGA 4G6QA 1R4NB 1I27A 2IAIA 1IJWC 2JPCA 3E1SA 4KWAA 2YPRA 4QSHA 1I39A 3ZMDA 2MABA 2QQ8A 1ON2A 2XC7A 2JMWA 3C3WA 1T6SA 3QQAA 2L9SA 3VODA 2CV2A 3LSJA 2V4JC 3HZJA 2W85A 2HZTA 3LAJA 2VBZA 1FX7A 2WB1N 5K1YA 3RYPA 1SVOA 3MKLA 3VYSB 3ZOBA 4EQQA 4BL0B 5JR3A 2I10A 1U78A 2HWVA 3M07A 1ETKA 3NNRA 5D8LB 1AA7A 2R5ZA 2ELHA 2WC2A 2NVXJ 5GPAA 2XAGA 1HDDC 2CV0A 2RNGA 3BG6A 2ZCWA 2F4IA 1OCCH 3F8NA 5LRSA 2XAUA 3NEUA 2ESNA 3R60A 3CF2A 3QPTA 3VPRA 2D6YA 2OCEA 4BXUA 2FNPA 1X58A 3WTSC 2RC4A 2GLOA 2YU3A 1ZR2A 1X3UA 2HYTA 1G3SA 2M0MA 2LG4A 5E1XA 2JK3A 3V4GA 1LNWA 2Q2EA 2X85A 1DPUA 2IXSA 2GUHA 1HSJA 2M8EA 3PL8A 4L5IA 2XSDC 3BR5A 1R1UA 1K61A 1K4SA 1YS7A 2Z33A 2NVQJ 4A3GJ 4MXMA 4B44A 3JSPA 2IU5A 2FQ3A 2AQFA 4EMSA 4LB5A 3OYMA 4LG3A 4DBRA 5C3EJ 4IPAA 3IRRA 4N9IA 3PNTA 3KZZA 5FLVA 5HLGA 3PUFA 3AFHA 2E1CA 2Z16A 4CCLA 2ETHA 2EINH 2KISA 4K2EA 4C3HJ 3LSRA 1K78B 3WU2C 1VQ4I 2VXDA 5EYRA 1CGPA 3S2DJ 2HYFA 3KETA 3NS4A 5JHUA 3QKXA 3VP5A 2VBWA 3HOVJ 1TT5B 3ZQHA 4U9NA 1LPQA 2DQRA 2EV0A 3OR1C 5GP9A 4E4HA 2OI8A 4XLNF 1TZLA 3K6GA 4ABZA 4OWRB 4Y7NJ 5TRDA 1QGPA 3COLA 2F5VA 1ZLKA 5D19A 2V1DA 4AM3A 2W53A 3L2VA 2B1EA 1EKEA 4LGWA 3CDIA 3KP6A 5E20A 3V78A 4CH7A 3OYIA 5LBQA 3LFKA 5K7HA 2EZIA 4XRMA 4NN1A 2L4MA 2M34A 1T38A 2OU2A 4IJAA 5FKOA 5IT9Z 4PXIA 1S3JA 1MJBA 3HXLA 3COAC 2EBIA 4W1UA 4XM3A 2MH2A 3FM3A 2PFBA 2ISYA 4M9SA 1Z1DA 5FKNA 3SEZA 1JI8A 5ERIA 1T8IA 1XDSA 2P4WA 5DYMA 3WTVC 2XAJA 3IAS2 1VQPI 4A3KJ 5D5VB 3GTOJ 2A68F 1NK2P 4IOAF 1MKMA 3GTKJ 1GUUA 1Y6IA 3VEPA 2KRFA 1Z7UA 3CJQB 2DYRH 4R79A 2JA2A 3J80Z 1F4KA 1D0YA 4CDGA 3HTJA 4UXNA 4PJMA 2VJ5A 1TP4A 5H6RA 2BW3A 1Y8QB 1FYMA 2DBBA 4XSXF 2CFXA 1UHMA 2VKHA 5FD5A 4IHVA 3U9GA 2RNJA 5FLMJ 1QPIA 1XTAA 1FSEA 1HC8A 4BDYA 3S3NA 4R1HA 4JOMA 1JJ6C 2MSYA 2H09A 2GIZA 5E3LA 3MKWB 3CUQB 1D5YA 4MGRA 3DU5A 2ZFUA 4M3GA 2F48A 2L2OA 2V79A 2DT6A 3UKGA 3F8MA 2E1MB 2EV6A 3OYBA 3OYLA 4KN7X 3DKYA 2GFNA 1Z91A 3ANPA 1SFKA 2BVLA 1XMXA 1ON1A 3CO7C 5C4YA 5D6FA 2PG4A 3R4KA 3RSNA 3BR0A 3RKQA 3OYDA 3GTGJ 5HDKA 1VQKI 4LB6B 5ICGA 3M7GA 3HSRA 3V8LA 4WK8F 3FXUA 5IY5H 4FHTA 1FTZA 3W3CA 1R4MB 3L2WA 1ACIA 3PNVA 4EM0B 2MD5A 3HTSB 3O8HA 1OCRH 2CWEA 1IRZA 5HBUA 1GV2A 3LA3A 4F92B 4F3QA 3PFYA 2IT0A 4ASNA 3CDHA 4BHPA 1JHFA 2O3FA 3IH2A 3HOUJ 3D5RC 4I7HA 1PUFB 3ECOA 1WCMJ 3SDBA 5CVVA 4AWXB 1S29A 1EV7A 4MQVA 2I8DA 4D5FA 5GTHC 4KMFA 3GFLA 3VDXA 2VE9A 3IH4A 1X2MA 2WB1A 3EYIA 2GBYA 1ZG5A 3DQVC 3OYCA 2ECBA 1XG1A 4Y3OA 3B73A 2HGCA 2ZXHA 5LEKA 2LKXA 1DQUA 2VPLA 1VNDA 2QGUA 2P8TA 3HTUA 1KU2A 4U0VA 4HX7A 5CQGA 3H1CA 3I71A 1Q1VA 2K5CA 3FXMA 2MG4A 3HB9A 2WUIA 3AQTA 1KU9A 3TOAA 3NRVA 4MTDA 4F91B 3S5RA 4XQFA 3VVXA 2R7FA 1ORKA 2Y69H 4HF0A 3TKYA 1X1DA 1HQCA 3RQ4A 5EGOA 2RKHA 3ZGKA 3PIPF 1D5VA 2NNYA 3IV5A 2CUEA 1WSUA 3JAMZ 3DFGA 2O8XA 1P2FA 2DA6A 2PMHA 4WX9A 2ZCNA 3VSLA 2CUFA 3V8KA 6PAXA 2B0LA 2MYSA 3HUGB 4L5JA 4RB0A 3WU1B 1HA8A 1ZHFA 2YUSA 4A93J 1LEBA 2XKPA 3F8FA 5HS9A 2L4AA 2FBIA 4BY7J 3ZQGA 1S7EA 3QOPA 2JPBA 5KAFC 2F4MB 2QKMB 3GTMJ 1Z6RA 2L3DA 3JW4A 3CJDA 3RIRA 3S1QJ 3VB2A 2ZB9A 5FLXZ 2H6CA 3OYHA 3E6MA 4FTHA 3I59A 5FROA 4I99C 2VOPA 2CO5A 1N25A 2VOOA 3BPXA 4DYRA 2F07A 3MVPA 1QHGA 3A02A 4I6ZA 4M72A 1QA6A 4XK4A 4DGWB 3JR9A 4PUSA 2WAEA 1ENHA 1UAAA 1KU3A 3BCBA 3QPLA 3MKZA 1PP8F 1R5ID 4OD5A 4LLGF 2KMUA 2R7QA 4UVBA 3LMMA 5J1RA 3QRFF 3SEQA 1Z3YA 3J7AY 3L2CA 4GFLA 1MMNA 2MW8A 2P0WA 1GDTA 5LGNA 3MFKA 1B72B 1YLFA 3BJAA 1LUJB 2KQRA 3K4CA 4B3XA 1MGTA 1YHQI 3FXQA 3KYCB 2LK2A 5CVUA 3HTAA 2JSCA 1P7JA 3U1DA 2NP3A 1TWCJ 2WY8Q 4G94A 4CCJA 1MNMC 2DMTA 2IBDA 3ON2A 4OIQF 3K70C 3B02A 2L54A 3ULQB 3P9CA 3VTIA 5LGTA 1YS6A 2UXOA 1XCVA 2XPWA 4U87A 1I6HJ 3GLXA 2YVXA 4ZTJA 1OCOH 1ZELA 2FQ4A 1SD6A 4A3CJ 2M8GX 3G1OA 5TISC 3GTPJ 4KIGA 3FWEA 1BR2A 5FKLA 1UCRA 4RBOA 3IWFA 2FNAA 3LL7A 3ZQQA 4XKWA 2Q8KA 1FJLA 2D45A 1BN5A 1OYYA 4NC7A 5D5UB 2EIJH 1VQ8I 2HQRA 4CO8A 3ERED 3FMRA 1REPC 3MNLA 3CC7I 3VW2A 2HVQA 3IKTA 1A31A 3CRJA 3S1MJ 4XR6A 4II3A 4NUBA 1MBFA 2HQ5A 4DYQA 5IP6A 5IP7J 3K10A 4BXFA 4RB3C 2A6HF 2R7VA 1X4OA 1X19A 2LBFA 3A2KA 2PX9A 1JUSA 4G6DA 4HZFA 2VJIA 4OAZA 1ZQ3P 5A2QK 2IGMA 1EF4A 1ZH5A 3RKYA 2Y30A 2LTPA 3BNIA 3DKWA 3H3ZA 3OYJA 2VLAA 3OIQA 4J01A 2FJ1A 4M71A 1KGSA 4HA8A 4Q5SF 1WRJA 1OPCA 1BM9A 2EK5A 2M5WA 4NB5A 2GAUA 1TNTA 2EQRA 2P6SA 2HS5A 2OZ6A 2V1NA 2ME6A 3CCUI 1KQ0A 1IZ1A 4B8XA 5E1ZB 2FU4A 3Q0VA 1A6IA 1CF7A 3AQSA 4IKFA 1MMAA 2HPIA 5IP9J 3L09A 5FFXA 2MGQA 3JTGA 3FXRA 1FPQA 2A3SA 3VIBA 4KFCA 4JKZA 3BTLA 3DV8A 4ZDPA 4LK0F 3QODA 3VYRB 2Y48A 3MCZA 4AYBN 1P4WA 5CLSA 2NVTJ 5FGLA 2CH0A 2YSRA 4HPQA 2XVCA 5D4SA 2ZCXA 2M4GA 4MNUA 4OINF 2VXZA 5LHIA 3ELKA 4F93B 4D1QA 1YO5C 5CVJA 3BTIA 1SD4A 2R4GA 3D0SA 4HV6A 2ELJA 1WZ2A 2JUGA 3DEEA 1QZEA 2VASA 1G3YA 1XSXA 4PFPA 3I56I 2LR8A 2TDXA 1JGGA 4HX4A 2RDPA 3LSKA 3OIPA 1BOBA 4N0BA 5LHHA 5D18A 3F21A 4C2MJ 3JRBA 1ZN2A 4ANJA 3SXYA 2E5ZA 3HOWJ 3MEXA 2R92J 3BP8A 2QA4I 3TO6A 1IDZA 2LY1A 1S7OA 5D5WB 2HNHA 4ZTFA 3VVZA 1MH4A 3BZKA 2DFFA 2E2JJ 3WHCA 5J1YA 5BNGA 1R23A 1N77A 5DUIA 3CLQA 2R93J 1V4RA 4RGXA 3K4NA 2JA7J 2BHZA 3BR2A 1Z77A 2K3PA 3E6CC 3A4CA 1W7PA 4Y17A 2XGXA 2VL8A 4CUGA 2DCEA 3CJTB 3HOTA 3Q9VA 2CUJA 2Q1ZB 5HVQC 2STTA 3ZQIA 5LEJA 4LOCA 2KT0A 3LWJA 4GYIA 3K4MA 2IA1A 1IN8A 1BIAA 5KVRA 4XKVA 2LDUA 1POGA 2Z3YA 3KZYA 2L9NA 1BI1A 3BZCA 2VT3A 2Y0SA 3S17J 1H89C 5E8IA 1JKPC 1VQLI 3GXOA 3ONQA 3CUOA 2O7TA 1MNDA 1WJ5A 4IEJA 4CXFA 3KP4A 2IGKA 4JQFA 4HNUA 4IX7A 4BQOA 1BI2A 3BJOA 3FXOA 3UNGC 1RUNA 5KCMA 1JGSA 2M0CA 3F6OA 3S2WA 4IQJA 2AS5F 4GO1A 3RPUD 4NDLA 5KHDA 2EIMH 3K4BA 2HOAA 4UVCA 5DD8A 4A5MA 5JLWA 4U7BA 5CKTA 1GT0C 3OWTA 2VBXA 4XLAA 3IC7A 2PBXA 3CUQA 2VONA 4EV0A 3W6KB 2MC4A 3EDPA 4PJ0C 4ENNA 2DU9A 2ZOZA 4CYDA 1MSEC 3CP8A 4C3IJ 4GCLA 3HRSA 2K9LA 4I76A 1I1SA 5EFYA 2DJIA 2CQKA 4YFKF 1GXQA 3IKVA 4EGYA 2ACJA 2IS4A 3I55I 1BOAA 2WGBA 2CQXA 2EFQA 2M1BA 4ESBA 1ZRCA 2RVCA 4AYBA 2LVSA 3K4JA 1WKMA 3O60A 1IUYA 4QLCU 3G73A 2R3SA 4UB8C 1OISA 3BC8A 1Z05A 2WBMA 1IN7A 3F23A 4LFUA 2XAQA 2L7MP 3VFZA 5J47A 2L7ZA 1U8BA 4A0YA 1U3EM 4JX5A 2RGVA 3H5NA 2B3WA 2Y9ZA 1W36D 3GTJJ 3BTJA 1AOYA 1P4XA 1PUFA 4DZJA 1VQ7I 1D3YA 1YW9A 4RM3A 1XPXA 4UV9A 2PJRB 2NX4A 1B1BA 2DMUA 2DMQA 4HOBA 4U0WA 3TMOA 2UXUA 4PJJA 1LFUP 2A5WA 2A6EF 3NWSA 1IRGA 2WY7Q 1G2HA 1UI6A 2JQ7A 3I53A 4EVIA 4B48A 3U2RA 3I4PA 2AO9A 3KYLA 1S6LA 2F5EA 2KJCA 3H35A 3HRTA 3CUQC 5HLHA 3D1NI 4HQMA 2E34A 2GZWA 2HR3A 1MBEA 2OV7A 5EF6A 3UR3C 1USSA 2VUMJ 1ZGJA 1FT9A 3S1NJ 5FRNA 4P96A 4CGRA 4ESFA 1D1CA 4XRFA 1QQIA 3GTQJ 3LA7A 3OS2A 4PJNA 2QENA 2CQNA 4EM1A 3OSGA 1SGMA 1EH7A 1OR7C 2ECCA 3M8FA 1UI5A 4WF2A 3TO7A 2K27A 1WGXA 2G7SA 5H9TA 2YU9J 3IH3A 4PDKA 2QVOA 2I5UA 1X3WB 5CJ9A 3PM1A 5BOXA 2PJRA 4D9JA 5F0CA 2H1LA 4DQ2A 4A3IJ 1ETOA 2GXBA 4RM2A 1FC3A 2JRMA 2E71A 3T5XA 1MW7A 2ZBKA 2EFNA 2FJI1 3LSGA 1Z9CA 2E1OA 2CW7A 5E3NA 4PGHA 4JL3A 2KPMA 1K4TA 4ZDOA 3AAFA 1ZARA 1YJWI 3FK7A 2M30A 3FKJA 1FOYA 1R36A 1O3RA 3K1NA 5CYVA 2X48A 4P55A 5HS7A 1SAUA 1UJ8A 3K69A 3QU3A 2O6GE 4UV8A 2P81A 1YX5A 4LG0B 1YRNB 3E7QA 2KJBA 2IGNA 2OA4A 3LOCA 3GX4X 2FOWA 3RKXA 4B3AA 3CZ6A 5CXGA 2DDBA 1O7FA 2QWTA 3ASOH 3QWLA 1Y39A 2K9NA 2PQ8A 5DUKA 3KCCA 2UXPA 4ENJA 2TCTA 4H4KC 3ASNH 3WTTC 1V3FA 4E7KA 4EJTA 4L18B 2O7OA 4UDSA 2NOGA 1DP3A 2GA1A 2VIXA 3PSFA 1XSDA 2VODA 4U9LA 1SVLA 3HHGA 1E0EA 3ISPA 2OUMA 3QU6A 4P9FA 2JA5J 2LY2A 1R00A 3JRCA 2XV4S 5LFAA 2QOPA 4F7ZA 3V7CA 2L9VA 1TW2A 4XOPA 2JT1A 4BE1A 1SC7A 2HTSA 3ABMH 3PSIA 2NS8A 4AUXA 3F8BA 2IA2A 4CCKA 3AG2H 4GCKA 2EFWA 2HZDA 2K86A 1PDNC 1HW2A 2KL4A 1MD0A 2JZYA 3ESWB 5DM7F 3J81Z 1XSVA 5HLIA 1A36A 1JT0A 3KKDA 4GCVA 3WGIA 3ABUA 2ZNZA 4LD5A 3X2QH 1KONA 3MKYB 2NVYJ 4GRIA 3WE2A 4H0EA 4NQWA 2R7DA 3A1YA 1KYWA 1TQPA 1BJZA 4FCYA 5EEHA 4S0HB 5FKKA 3E5UA 2STWA 4HQEA 3ABTA 2BY3A 4I98B 3GWZA 4EEFG 3H3UA 3W2VA 3H5RA 2A2FX 1D0XA 3K2AA 5IPAA 2E35A 2JN6A 4YIRX 3KKCA 3VWBA 1UG2A 5FFZA 4WXHA 5FRMA 2LNBA 2CW8A 1YYVA 2PZ9A 4OIRF 2OD5A 4MK6A 1LVKA 4BYYA 5K7FA 1UZCA 3P9IA 2KIUA 5DCFA 4IL6C 2DW4A 5GAHJ 3RDIA 3GLLA 2MLGA 3V7RA 1RRJA 5FD6A 2DTZA 1N75A 1RPWA 2Z99A 4XKBA 1YX3A 1XCBA 3AL0B 4OAYA 4CHUA 3HL2A 1WI3A 5IT9K 2JJ7A 2HQAA 3RZOJ 1YOVB 1R49A 3FBIB 1ZTRA 3DCFA 3B6CA 1BI0A 1RNLA 5CPRB 4EJVA 3F6VA 1Z21A 3J7AO 1HDPA 2UV1A 2RAEA 1T2KA 2ZMEC 1CF7B 2N8GA 3OL4A 2G7GA 2LFBA 3LSIA 4BHBA 5ILUA 3B6AA 2M4KA 3KZIC 1IW7F 1ETYA 2IW5A 2DA1A 1SEUA 3F0CA 1FOXA 1MIJA 2NP5A 2GOXB 2EIKH 1Y0UA 3V7SA 4HF2A 4BEHA 4KYWA 3HIFA 1SMYF 1V5GA 1YFHA 4ZZDA 2UUZA 4MLOA 3ZMVA 5EGOB 5EJCA 3DPJA 2VKVA 3FK6A 3RH2A 2KZVA 1E3OC 2QUFA 5L3CA 3S3OA 1LKXA 2DI3A 3KEQA 2OZUA 2QZ8A 3WHBA 2HEOA 2P5LC 1TWGJ 2EV5A 3W2WA 1TLHB 1D8KA 1WJDA 1J2XA 2K9SA 2MFZA 3KZ9A 2BOLA 1XD7A 2GQQA 1K79A 2DA4A 4L9TA 4XL9A 3ZCOA 1L0OC 3K70D 2CS3A 4QPOA 3MWMA 4FASD 4A69C 3EGQA 1IXCA 1BIBA 1Y56A 2R7XA 1SMTA 1FWZA 1R5HA 4QPQA 4NC6A 5ILVA 3NRGA 3AL0C 2XDNA 2M7BA 3CESA 2MBFA 2J5PA 2EFOA 1WWXA 4YIFA 3ZR8X 1T39A 4HAMA 2QQBA 2KIMA 3DPUA 4S04A 2L7FP 2P7CB 3DU6A 3BDDA 3LQQA 3M8JA 2X51A 1DU6A 5F64A 3IUVA 5JVTA 2DFHA 4YRVA 4A3EJ 1AU7A 4AVZA 4BGDA 2XB5A 2WV0A 1W7PD 3WTWC 1IN5A 3OYKA 3W6JB 2ZNYA 3HG9A 1BW6A 4BU2A 3AG1H 2W00A 4BACA 2KIFA 4G8XA 3C7JA 3RD3A 2O61A 2HQNA 2F5DA 3LSTA 3I4NJ 3NXCA 2QCOA 1WJCA 3R61A 5M5YJ 4E7SA 3ZP5A 4ZDLA 2X6YA 5D8KB 3FIWA 3S3MA 1QBJA 2DOAA 4QWQA 1M1EB 1NG7A 3J7ZI 3IHUA 4A3MJ 4E7IA 4Y52J 4P5OA 3CF5F 2DK8A 1DGRM 5CW8A 3M1CA 3Q5FA 3CD6I 3FXKA 5GTIC 5EEAA 1KU7A 1FTTA 2AXLA 1OR7A 2D2WA 4HSTA 1L3LA 1E3HA 3W6VA 4DVYP 5HDGA 4BDZA 1B8IA 1T56A 3H36A 2FX0A 3CP2A 3BG3A 2VT2A 1VFCA 3G6EI 4AIHA 2D5VA 2CUZA 1O4XA 5HNFA 4PFOA 1SFEA 4RAFA 2NRAC 1OJLA 3BR1A 5E17F 3PPBA 1W5TA 3FMSA 4XICA 4C30A 3DP7A 2Z5UA 4I09A 1J75A 2CG4A 4M6YA 5LRRA 2O8KA 1MH3A 1DDNA 2EH3A 4HDVA 2PMZN 1T95A 1ZG1A 4I0AA 5HLTA 1VZ0A 1S5LC 4ZYEA 1W7PB 4UNOA 4ZYGA 1SFUA 4BQNA 3GCMA 1K6YA 1LDKB 2FA5A 2Y2ZA 3E3VA 5KNLA 4O6JA 3TW6A 2QBYA 3QP6A 3EETA 1JJ8C 3EUPA 1X1AA 2R7OA 2C6YA 5J4YA 3ZMUA 2F6CA 3I64A 2Y0SN 3ZRGA 3S14J 2E5NA 3T8TA 1R9TJ 3L00A 3J7YJ 5ILSA 4OMYA 3GFMA 3AG3H 1K7AA 4BJ6C 4BUPA 2KIQA 4JYKA 3PQKA 3HOXJ 3CCMI 1IG7A 5LGUA 2HU9A 2K7LA 3LAPA 2ZCMA 2FRHA 5JVGF 3TDUC 3LSHA 2JVHA 4V2GA 2GWRA 1BC7C 4Q48A 2CQ7A 1SFOJ 5C4JJ 4XORA 5HS8A 1WH5A 3FXJA 2G7UA 3N4MA 2OC6A 3RPQA 1W4MA 1WQ2A 3P9TA 2XB0X 3M3YJ 1G3WA 2JTVA 1V55H 3VVYA 3HIMA 2RASA 4HNVA 2V9KA 5ICEA 2NVUB 3CCEI 1IXRC 3BHQA 3K7AJ 4AC0A 3HYIA 1YW7A 3K1MA 2GXGA 1H9GA 4Z6YA 4IHSA 4DBQA 2HDWA 4OMZA 2YVEA 2REKA 3I4MJ 5AQCA 3Q9SA 3J81K 3KPHA 3JRFA 1WPKA 2YR2A 2IGOA 2K3FA 4EJOA 1FBQA 4BAYA 5FJ8J 2Y0MA 2DOFA 2CV1A 5B66C 3PFIA 3LJLA 1YQAA 3S1RJ 3H0DA 3GZ6A 4NHJA 1APLC 1MNEA 2DLLA 2V57A 5IOYA 2IS6A 2W25A 4A3JJ 2X0LA 1YG2A 4RMNA 3OYAA 5F27A 3M4OJ 3CJRB 2VJ4A 5F04A 2KP6A 1A5JA 1B4AA 4G7HF 1U6GA 4XIDA 3K0LA 2BEOA 1AKHA 1X1CA 4JX6A 5AIPA 5CVRA 3H9JA 3CCVI 2QKLB 4YEJA 2CW0F 3CCRI 3DEUA 1OFCX 4UUTA 1NG6A 4KITB 3J80K 4GGGA 3K8PC 1F1ZA 2EFPA 2XUBA 4P9UA 3WTXC 1FLIA 3PO2J 1G8XA 3CO6C 3NWTA 5C44J 2IA0A 1JKOC 1RUOA 1O3SA 3PQJA 3LNQA 2DT5A 2RN7A 4UHTA 4M3FA 2DDAA 2EZKA 4UVAA 1YITI 4ENKA 1UMQA 1BBYA 1W5SA 4BXXJ 3B81A 1LFPA 3IL2A 4E7JA 3E97A 3LQRA 3I54A 4JP0A 3D5SC 1WJFA 3FX3A 1VTNC 3NARA 2LP0A 4NBQA 3PO3J 3TO9A 2XASA 2FMLA 4RGSA 4U7DA 1IV6A 3T6NA 3LA2A 4NQWB 3DBRB 4ZC3A 2XF7A 2K4BA 4IHXA 1A6QA 5K5OA 2V7FA 1QVTA 5JLXA 3OOUA 4X6AJ
chains in the Genus database with same CATH topology
4Y7NJ 3BCGA 3COLA 3JRHA 4UUSB 5D19A 2W53A 1MBEA 5EF6A 4CYCA 2L9RA 3BT9A 3V78A 2R5YB 2VUMJ 3S1NJ 3BRUA 2HOTA 4CGRA 5M3FJ 5K7HA 3GTQJ 2EZIA 3HBLA 4XRMA 4QTRA 4NN1A 3LSPA 2M34A 3HTIA 5FKOA 3OSGA 2XGEA 1JKRC 1SGMA 2ECCA 3C2BA 3HM5A 2EBIA 4W1UA 1UI5A 2O9LA 3DEWA 1WGXA 4M3BA 4ME9A 2G7SA 5H9TA 2YU9J 5FKNA 3IH3A 3PM1A 3TP3A 5F0CA 4A3KJ 4A3IJ 3GTOJ 4MFEA 1ETOA 1NK2P 1ETQA 2JWTA 1K83J 3GTKJ 3PASA 2HYJA 1GUUA 2XPVA 2QIBA 4RDUA 3LSGA 2E1OA 5E3NA 4JL3A 3HTJA 3VUQA 3Q0WA 1UHSA 2X6OA 3FK7A 2NS7A 4CYCB 4IHVA 2X48A 5FLMJ 5D1RA 4X6AJ 1QPIA 2FBQA 3S15J 2UXIA 2P81A 1HOMA 1JJ6C 2B63J 1QRYA 2HXOA 2MSYA 1YRNB 3E7QA 5GPCA 3GBGA 5E3LA 3CDLA 3HE0A 3LOCA 2R5ZB 1D5YA 3RZDJ 4M3GA 5F08A 4B3AA 3JRIA 3RQIA 2HDDA 5CXGA 3UKGA 5M3MJ 5EZGA 1W0UA 2QWTA 3LHQA 4A3DJ 2GFNA 3ZQLA 2E2HJ 2K9NA 2QKOA 5F0HA 3ANPA 5FHPA 2UXPA 4MO7A 4B4CA 2TCTA 1U9NA 3VW0A 4A3FJ 2O7OA 4UDSA 3JREA 5C4YA 2NOGA 4V2FA 5CXIA 3BR0A 3RKQA 3GTGJ 3GZIA 2LLKA 1HLVA 1ETWA 2DJNA 2E2IJ 2JA5J 2HXIA 3JRCA 2G7LA 2OF7A 3H3VK 2VKEA 1FTZA 2DG7A 2QOPA 2WAQN 3HKZN 3O8HA 1BA5A 3FKIJ 2NS8A 4AUXA 1IRZA 1GV2A 5HBUA 2COBA 4GFBA 4GCKA 3F1BA 3IH2A 3HOUJ 1TWAJ 2CRGA 2EZLA 2ME0A 1PUFB 1YRNA 3VOKA 1WCMJ 1TC3C 3KKDA 1JT0A 1LE8A 4D5FA 4AF5A 3V6GA 3IH4A 1X2MA 2NVYJ 2H1KA 2GBYA 1OCPA 5HSZA 2ECBA 1BJZA 1XG1A 4FCYA 4S0HB 5FKKA 2LKXA 1VNDA 1MBHA 4EEFG 2E19A 3K2AA 5IPAA 3KKCA 1Q1VA 2JN6A 1UG2A 2MG4A 3HB9A 2WUIA 3AQTA 2ELKA 2QF7A 2WV1A 3A01A 4UUSA 2PZ9A 1NK3P 4MK6A 5K7FA 3L1PA 3S5RA 3VVXA 1H88C 1MSFC 1ORKA 3BR6A 3VOXA 5EGOA 2R5YA 3G1MA 1U9OA 4MIMA 3IV5A 2CUEA 2GENA 2DTZA 1FIAA 1NTCA 1RPWA 4BBSJ 4YZEA 2DA6A 1RKTA 2ZCNA 2CUFA 1GV5A 5J1UA 1WI3A 4BBRJ 2YUSA 4A93J 2JJ7A 1QVUA 1P7IA 3RZOJ 1ZTRA 3DCFA 4BY7J 1S7EA 3B6CA 3ZQGA 1HDPA 2RAEA 5DAJA 4MFDA 3GTMJ 2N8GA 4D7MA 3CJDA 2G7GA 2LFBA 5IOZA 3S1QJ 1TWFJ 4GFKA 2OERA 2VPRA 2ZB9A 3B6AA 3HGYA 5M5WJ 2DG8A 1ETYA 2DA1A 1JTXA 2DA7A 4FTHA 3F0CA 2LY9A 2ID6A 3Q3SA 2NP5A 4DYRA 4ACIA 2F07A 2Y31A 3TEDA 3MVPA 3A02A 4I6ZA 3FRQA 1W0TA 2KDZA 4XK4A 3JR9A 1VF9A 1ZR4A 1F36A 1ZKGA 3BTCA 1ENHA 2VI6A 3QPLA 4QIWN 4MLOA 1XC5A 5EGOB 2AHQA 3DPJA 2TRTA 5J1RA 2VKVA 3FK6A 4GFLA 3RH2A 1RETA 1E3OC 5HODA 2MW8A 1OCTC 1GDTA 3WHBA 3ON4A 1TWGJ 4DW6A 1B72B 2DN0A 2ID3A 4FISA 4M3EA 1BL0A 2IEKA 2EZHA 1HCRA 2K9SA 2M9HA 3BG5A 3KZ9A 1VI0A 2ZOYA 2LK2A 2M2EA 3HTAA 1P7JA 2G3BA 3CCYA 2H8RA 3Q0UA 2DA4A 2NP3A 3G7RA 1TWCJ 4G12A 1MNMC 4FE7A 2DMTA 2IBDA 4A69C 3EGQA 3ON2A 1ZGWA 3CMYA 3KNWA 2Q24A 3BR3A 2R7ZJ 3NRGA 2XDNA 5K7ZA 3ZQCA 2UXOA 2XPWA 2YS9A 1TWHJ 1I6HJ 2DA2A 1T33A 2DMPA 3HOYJ 2FQ4A 4A3CJ 2M8GX 3G1OA 3TW7A 5E3MA 2X9DA 2L7FP 3O8GA 3TP0A 3GTPJ 5FKLA 4RBOA 1IUFA 1HF0A 1DU6A 3IUVA 4A3EJ 1AU7A 3HEFA 1FJLA 3BQYA 2L0KA 1IGNA 2XB5A 1Z0XA 1F43A 1BW6A 3MNLA 5C4XJ 3RD3A 3VW2A 3BG9A 1JTYA 4A3BJ 3CRJA 3S1MJ 3I4NJ 2Y9YA 3SJMA 1FEXA 2QCOA 1I50J 3NXCA 1MBFA 2HQ5A 4DYQA 5IP6A 5IP7J 5M5YJ 4L62A 1MBGA 9ANTA 1JUMA 1JKQC 3QBMA 3OIOA 5EG0A 3FIWA 2CU7A 3JRDA 5J3LA 3S16J 1JUSA 1SANA 5F0FA 3JSJA 4M6VA 4A3MJ 1ZQ3P 3A01B 4Y52J 5FMPA 2UXHA 1EF4A 3JRGA 2Y30A 2LTPA 3BNIA 3SDGA 1FIPA 5CW8A 5EZHA 2FJ1A 5EEAA 1FTTA 3CWRA 5DTDA 2DA3A 1GVDA 1JT6A 3W6VA 1B8IA 1T56A 1IC8A 3JRAA 2FX0A 2EQRA 3BG3A 2ME6A 1VFCA 2R0QC 2D5VA 4X1EA 1O4XA 1I3QJ 1RKWA 3ANGA 1ITYA 1OJLA 3BR1A 5F1JA 4PXIA 3PPBA 3Q0VA 4XICA 3VW1A 1A6IA 3AQSA 2O8KA 4XRSA 1MH3A 5HAWA 2EH3A 2XPUA 2PMZN 5IP9J 2HOSA 4L5EA 2MGQA 3HGGA 1X2NA 5EG0B 4M3DA 3BQZA 2RHAA 3VIBA 4JKZA 3BTLA 1MBJA 3NPIA 2Y2ZA 2XRLA 4AYBN 2NVTJ 5FGLA 3QPSA 3EUPA 3TW6A 2ZCXA 1JJ8C 5E3OA 3HOZJ 3GEUA 2CJJA 2Y0SN 1Y1VJ 3BTIA 4DYCA 5DS9A 4IHWA 3S14J 1R9TJ 2LR8A 3HOXJ 4JYKA 1JGGA 5D18A 1IG7A 1B72A 4C2MJ 2XGDA 5M5XJ 2ZCMA 4W97A 3JRBA 3HOWJ 2K9QA 2R92J 1IDZA 1RR7A 1ETVA 4V2GA 1IDYA 3SFIA 4C3JJ 4GCTA 4NELA 3VVZA 1MH4A 2E2JJ 1SFOJ 3WHCA 5C4JJ 3GTLJ 3E7LA 5J1YA 5BNGA 1WH5A 1WH7A 2R93J 2K40A 4JNNA 2JA7J 3BR2A 2HKUA 1Z77A 3P9TA 3HTHA 3CQZJ 2XB0X 3M3YJ 3MN2A 3NAUA 4B1RA 3VVYA 4DZPA 3HIMA 2RASA 4AC6A 4HNVA 2W48A 4J19A 1H8AC 3ZQIA 3BHQA 3FISA 2KT0A 3K7AJ 4LOCA 4AC0A 1Y1WJ 3LWJA 4JX4A 5K58A 2JA8J 1POGA 2QTQA 4BY1J 2XGCA 3S2HJ 2YVEA 1LFBA 2REKA 3I4MJ 1IJWC 5AQCA 3S17J 1H89C 2IAIA 1JKPC 1BW5A 4KWAA 4FE4A 4QSHA 3JRFA 1WPKA 2O7TA 4IEJA 2JMWA 4BKXA 5FJ8J 3QQAA 3LSJA 3LJLA 2M0CA 3S1RJ 4ICHA 2FD5A 2WB1N 1APLC 4NDLA 1AHDP 2V57A 3MKLA 2HOAA 3ZOBA 5IOYA 5JLWA 3D1NI 4A3JJ 1CQTA 2I10A 1U78A 2JA6J 1GT0C 3M4OJ 5F27A 1ETKA 4D7NA 3NNRA 5F04A 2OPTA 5IYBJ 4D5CA 2R5ZA 2PBXA 1A5JA 2NVXJ 4IHYA 4XIDA 1AKHA 5GPAA 1HDDC 4JX6A 2ZOZA 3HDDA 1MSEC 4C3IJ 4GCLA 3G1LA 4I76A 5EFYA 2HI3A 1OFCX 4UUTA 2GM4A 3VPRA 3A03A 2D6YA 1X58A 2GLOA 1B8IB 1ZR2A 2WGBA 3BJBA 2HYTA 2CQXA 3PO2J 2LD5A 5C44J 2LVSA 2JK3A 1JKOC 3O60A 5EDNA 3OSFA 3LNQA 1ETXA 4M3FA 2GUHA 2EZKA 2XSDC 3BR5A 2L7MP 2DA5A 1K61A 2NVQJ 2L7ZA 4MXMA 1U8BA 4A3GJ 1UMQA 4BXXJ 2YVHA 4JX5A 4A3LJ 2IU5A 3B81A 2Y9ZA 3GTJJ 3BTJA 5IYDJ 4JP0A 1PUFA 4DZJA 3G56A 5C3EJ 3NARA 2LP0A 4XRSG 1LE8B 3H0GJ 5FLVA 3PO3J 4HKUA 1AKHB 1XS9A 2NX4A 3T6NA 4C3HJ 3LSRA 2CQQA 2DMUA 2DMQA 1IV6A 2DMNA 2UXUA 5EYRA 1JUPA 1LFUP 3S2DJ 1RESA 5FKMA 4IHXA 1UI6A 3C07A 1DU0A 1G2HA 3ZQFA 3QKXA 3VP5A 3HOVJ 3ZQHA 2G0EA 1MBKA 1QVTA 5IYCJ 3NI7A 2AO9A 5GP9A 2OI8A 5JLXA 4ABZA 3OOUA 1ZK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N J;  3BCG A;  3COL A;  3JRH A;  4UUS B;  5D19 A;  2W53 A;  1MBE A;  5EF6 A;  4CYC A;  2L9R A;  3BT9 A;  3V78 A;  2R5Y B;  2VUM J;  3S1N J;  3BRU A;  2HOT A;  4CGR A;  5M3F J;  5K7H A;  3GTQ J;  2EZI A;  3HBL A;  4XRM A;  4QTR A;  4NN1 A;  3LSP A;  2M34 A;  3HTI A;  5FKO A;  3OSG A;  2XGE A;  1JKR C;  1SGM A;  2ECC A;  3C2B A;  3HM5 A;  2EBI A;  4W1U A;  1UI5 A;  2O9L A;  3DEW A;  1WGX A;  4M3B A;  4ME9 A;  2G7S A;  5H9T A;  2YU9 J;  5FKN A;  3IH3 A;  3PM1 A;  3TP3 A;  5F0C A;  4A3K J;  4A3I J;  3GTO J;  4MFE A;  1ETO A;  1NK2 P;  1ETQ A;  2JWT A;  1K83 J;  3GTK J;  3PAS A;  2HYJ A;  1GUU A;  2XPV A;  2QIB A;  4RDU A;  3LSG A;  2E1O A;  5E3N A;  4JL3 A;  3HTJ A;  3VUQ A;  3Q0W A;  1UHS A;  2X6O A;  3FK7 A;  2NS7 A;  4CYC B;  4IHV A;  2X48 A;  5FLM J;  5D1R A;  4X6A J;  1QPI A;  2FBQ A;  3S15 J;  2UXI A;  2P81 A;  1HOM A;  1JJ6 C;  2B63 J;  1QRY A;  2HXO A;  2MSY A;  1YRN B;  3E7Q A;  5GPC A;  3GBG A;  5E3L A;  3CDL A;  3HE0 A;  3LOC A;  2R5Z B;  1D5Y A;  3RZD J;  4M3G A;  5F08 A;  4B3A A;  3JRI A;  3RQI A;  2HDD A;  5CXG A;  3UKG A;  5M3M J;  5EZG A;  1W0U A;  2QWT A;  3LHQ A;  4A3D J;  2GFN A;  3ZQL A;  2E2H J;  2K9N A;  2QKO A;  5F0H A;  3ANP A;  5FHP A;  2UXP A;  4MO7 A;  4B4C A;  2TCT A;  1U9N A;  3VW0 A;  4A3F J;  2O7O A;  4UDS A;  3JRE A;  5C4Y A;  2NOG A;  4V2F A;  5CXI A;  3BR0 A;  3RKQ A;  3GTG J;  3GZI A;  2LLK A;  1HLV A;  1ETW A;  2DJN A;  2E2I J;  2JA5 J;  2HXI A;  3JRC A;  2G7L A;  2OF7 A;  3H3V K;  2VKE A;  1FTZ A;  2DG7 A;  2QOP A;  2WAQ N;  3HKZ N;  3O8H A;  1BA5 A;  3FKI J;  2NS8 A;  4AUX A;  1IRZ A;  1GV2 A;  5HBU A;  2COB A;  4GFB A;  4GCK A;  3F1B A;  3IH2 A;  3HOU J;  1TWA J;  2CRG A;  2EZL A;  2ME0 A;  1PUF B;  1YRN A;  3VOK A;  1WCM J;  1TC3 C;  3KKD A;  1JT0 A;  1LE8 A;  4D5F A;  4AF5 A;  3V6G A;  3IH4 A;  1X2M A;  2NVY J;  2H1K A;  2GBY A;  1OCP A;  5HSZ A;  2ECB A;  1BJZ A;  1XG1 A;  4FCY A;  4S0H B;  5FKK A;  2LKX A;  1VND A;  1MBH A;  4EEF G;  2E19 A;  3K2A A;  5IPA A;  3KKC A;  1Q1V A;  2JN6 A;  1UG2 A;  2MG4 A;  3HB9 A;  2WUI A;  3AQT A;  2ELK A;  2QF7 A;  2WV1 A;  3A01 A;  4UUS A;  2PZ9 A;  1NK3 P;  4MK6 A;  5K7F A;  3L1P A;  3S5R A;  3VVX A;  1H88 C;  1MSF C;  1ORK A;  3BR6 A;  3VOX A;  5EGO A;  2R5Y A;  3G1M A;  1U9O A;  4MIM A;  3IV5 A;  2CUE A;  2GEN A;  2DTZ A;  1FIA A;  1NTC A;  1RPW A;  4BBS J;  4YZE A;  2DA6 A;  1RKT A;  2ZCN A;  2CUF A;  1GV5 A;  5J1U A;  1WI3 A;  4BBR J;  2YUS A;  4A93 J;  2JJ7 A;  1QVU A;  1P7I A;  3RZO J;  1ZTR A;  3DCF A;  4BY7 J;  1S7E A;  3B6C A;  3ZQG A;  1HDP A;  2RAE A;  5DAJ A;  4MFD A;  3GTM J;  2N8G A;  4D7M A;  3CJD A;  2G7G A;  2LFB A;  5IOZ A;  3S1Q J;  1TWF J;  4GFK A;  2OER A;  2VPR A;  2ZB9 A;  3B6A A;  3HGY A;  5M5W J;  2DG8 A;  1ETY A;  2DA1 A;  1JTX A;  2DA7 A;  4FTH A;  3F0C A;  2LY9 A;  2ID6 A;  3Q3S A;  2NP5 A;  4DYR A;  4ACI A;  2F07 A;  2Y31 A;  3TED A;  3MVP A;  3A02 A;  4I6Z A;  3FRQ A;  1W0T A;  2KDZ A;  4XK4 A;  3JR9 A;  1VF9 A;  1ZR4 A;  1F36 A;  1ZKG A;  3BTC A;  1ENH A;  2VI6 A;  3QPL A;  4QIW N;  4MLO A;  1XC5 A;  5EGO B;  2AHQ A;  3DPJ A;  2TRT A;  5J1R A;  2VKV A;  3FK6 A;  4GFL A;  3RH2 A;  1RET A;  1E3O C;  5HOD A;  2MW8 A;  1OCT C;  1GDT A;  3WHB A;  3ON4 A;  1TWG J;  4DW6 A;  1B72 B;  2DN0 A;  2ID3 A;  4FIS A;  4M3E A;  1BL0 A;  2IEK A;  2EZH A;  1HCR A;  2K9S A;  2M9H A;  3BG5 A;  3KZ9 A;  1VI0 A;  2ZOY A;  2LK2 A;  2M2E A;  3HTA A;  1P7J A;  2G3B A;  3CCY A;  2H8R A;  3Q0U A;  2DA4 A;  2NP3 A;  3G7R A;  1TWC J;  4G12 A;  1MNM C;  4FE7 A;  2DMT A;  2IBD A;  4A69 C;  3EGQ A;  3ON2 A;  1ZGW A;  3CMY A;  3KNW A;  2Q24 A;  3BR3 A;  2R7Z J;  3NRG A;  2XDN A;  5K7Z A;  3ZQC A;  2UXO A;  2XPW A;  2YS9 A;  1TWH J;  1I6H J;  2DA2 A;  1T33 A;  2DMP A;  3HOY J;  2FQ4 A;  4A3C J;  2M8G X;  3G1O A;  3TW7 A;  5E3M A;  2X9D A;  2L7F P;  3O8G A;  3TP0 A;  3GTP J;  5FKL A;  4RBO A;  1IUF A;  1HF0 A;  1DU6 A;  3IUV A;  4A3E J;  1AU7 A;  3HEF A;  1FJL A;  3BQY A;  2L0K A;  1IGN A;  2XB5 A;  1Z0X A;  1F43 A;  1BW6 A;  3MNL A;  5C4X J;  3RD3 A;  3VW2 A;  3BG9 A;  1JTY A;  4A3B J;  3CRJ A;  3S1M J;  3I4N J;  2Y9Y A;  3SJM A;  1FEX A;  2QCO A;  1I50 J;  3NXC A;  1MBF A;  2HQ5 A;  4DYQ A;  5IP6 A;  5IP7 J;  5M5Y J;  4L62 A;  1MBG A;  9ANT A;  1JUM A;  1JKQ C;  3QBM A;  3OIO A;  5EG0 A;  3FIW A;  2CU7 A;  3JRD A;  5J3L A;  3S16 J;  1JUS A;  1SAN A;  5F0F A;  3JSJ A;  4M6V A;  4A3M J;  1ZQ3 P;  3A01 B;  4Y52 J;  5FMP A;  2UXH A;  1EF4 A;  3JRG A;  2Y30 A;  2LTP A;  3BNI A;  3SDG A;  1FIP A;  5CW8 A;  5EZH A;  2FJ1 A;  5EEA A;  1FTT A;  3CWR A;  5DTD A;  2DA3 A;  1GVD A;  1JT6 A;  3W6V A;  1B8I A;  1T56 A;  1IC8 A;  3JRA A;  2FX0 A;  2EQR A;  3BG3 A;  2ME6 A;  1VFC A;  2R0Q C;  2D5V A;  4X1E A;  1O4X A;  1I3Q J;  1RKW A;  3ANG A;  1ITY A;  1OJL A;  3BR1 A;  5F1J A;  4PXI A;  3PPB A;  3Q0V A;  4XIC A;  3VW1 A;  1A6I A;  3AQS A;  2O8K A;  4XRS A;  1MH3 A;  5HAW A;  2EH3 A;  2XPU A;  2PMZ N;  5IP9 J;  2HOS A;  4L5E A;  2MGQ A;  3HGG A;  1X2N A;  5EG0 B;  4M3D A;  3BQZ A;  2RHA A;  3VIB A;  4JKZ A;  3BTL A;  1MBJ A;  3NPI A;  2Y2Z A;  2XRL A;  4AYB N;  2NVT J;  5FGL A;  3QPS A;  3EUP A;  3TW6 A;  2ZCX A;  1JJ8 C;  5E3O A;  3HOZ J;  3GEU A;  2CJJ A;  2Y0S N;  1Y1V J;  3BTI A;  4DYC A;  5DS9 A;  4IHW A;  3S14 J;  1R9T J;  2LR8 A;  3HOX J;  4JYK A;  1JGG A;  5D18 A;  1IG7 A;  1B72 A;  4C2M J;  2XGD A;  5M5X J;  2ZCM A;  4W97 A;  3JRB A;  3HOW J;  2K9Q A;  2R92 J;  1IDZ A;  1RR7 A;  1ETV A;  4V2G A;  1IDY A;  3SFI A;  4C3J J;  4GCT A;  4NEL A;  3VVZ A;  1MH4 A;  2E2J J;  1SFO J;  3WHC A;  5C4J J;  3GTL J;  3E7L A;  5J1Y A;  5BNG A;  1WH5 A;  1WH7 A;  2R93 J;  2K40 A;  4JNN A;  2JA7 J;  3BR2 A;  2HKU A;  1Z77 A;  3P9T A;  3HTH A;  3CQZ J;  2XB0 X;  3M3Y J;  3MN2 A;  3NAU A;  4B1R A;  3VVY A;  4DZP A;  3HIM A;  2RAS A;  4AC6 A;  4HNV A;  2W48 A;  4J19 A;  1H8A C;  3ZQI A;  3BHQ A;  3FIS A;  2KT0 A;  3K7A J;  4LOC A;  4AC0 A;  1Y1W J;  3LWJ A;  4JX4 A;  5K58 A;  2JA8 J;  1POG A;  2QTQ A;  4BY1 J;  2XGC A;  3S2H J;  2YVE A;  1LFB A;  2REK A;  3I4M J;  1IJW C;  5AQC A;  3S17 J;  1H89 C;  2IAI A;  1JKP C;  1BW5 A;  4KWA A;  4FE4 A;  4QSH A;  3JRF A;  1WPK A;  2O7T A;  4IEJ A;  2JMW A;  4BKX A;  5FJ8 J;  3QQA A;  3LSJ A;  3LJL A;  2M0C A;  3S1R J;  4ICH A;  2FD5 A;  2WB1 N;  1APL C;  4NDL A;  1AHD P;  2V57 A;  3MKL A;  2HOA A;  3ZOB A;  5IOY A;  5JLW A;  3D1N I;  4A3J J;  1CQT A;  2I10 A;  1U78 A;  2JA6 J;  1GT0 C;  3M4O J;  5F27 A;  1ETK A;  4D7N A;  3NNR A;  5F04 A;  2OPT A;  5IYB J;  4D5C A;  2R5Z A;  2PBX A;  1A5J A;  2NVX J;  4IHY A;  4XID A;  1AKH A;  5GPA A;  1HDD C;  4JX6 A;  2ZOZ A;  3HDD A;  1MSE C;  4C3I J;  4GCL A;  3G1L A;  4I76 A;  5EFY A;  2HI3 A;  1OFC X;  4UUT A;  2GM4 A;  3VPR A;  3A03 A;  2D6Y A;  1X58 A;  2GLO A;  1B8I B;  1ZR2 A;  2WGB A;  3BJB A;  2HYT A;  2CQX A;  3PO2 J;  2LD5 A;  5C44 J;  2LVS A;  2JK3 A;  1JKO C;  3O60 A;  5EDN A;  3OSF A;  3LNQ A;  1ETX A;  4M3F A;  2GUH A;  2EZK A;  2XSD C;  3BR5 A;  2L7M P;  2DA5 A;  1K61 A;  2NVQ J;  2L7Z A;  4MXM A;  1U8B A;  4A3G J;  1UMQ A;  4BXX J;  2YVH A;  4JX5 A;  4A3L J;  2IU5 A;  3B81 A;  2Y9Z A;  3GTJ J;  3BTJ A;  5IYD J;  4JP0 A;  1PUF A;  4DZJ A;  3G56 A;  5C3E J;  3NAR A;  2LP0 A;  4XRS G;  1LE8 B;  3H0G J;  5FLV A;  3PO3 J;  4HKU A;  1AKH B;  1XS9 A;  2NX4 A;  3T6N A;  4C3H J;  3LSR A;  2CQQ A;  2DMU A;  2DMQ A;  1IV6 A;  2DMN A;  2UXU A;  5EYR A;  1JUP A;  1LFU P;  3S2D J;  1RES A;  5FKM A;  4IHX A;  1UI6 A;  3C07 A;  1DU0 A;  1G2H A;  3ZQF A;  3QKX A;  3VP5 A;  3HOV J;  3ZQH A;  2G0E A;  1MBK A;  1QVT A;  5IYC J;  3NI7 A;  2AO9 A;  5GP9 A;  2OI8 A;  5JLX A;  4ABZ A;  3OOU A;  1ZK8 A; 
#chains in the Genus database with same CATH topology
 3BCG A;  4LIV A;  2KHM A;  1R58 A;  1H0M A;  1N78 A;  4CYC A;  1ZG3 A;  3BT9 A;  2VC1 A;  2DFE A;  4MQ9 F;  1PVE A;  2HOT A;  1ZRF A;  3TQN A;  3HBL A;  2QQA A;  4QTR A;  2DOD A;  3SZT A;  4AD9 A;  4BJ5 C;  2P5V A;  2XGE A;  3C2B A;  3HM5 A;  3DEW A;  1TL8 A;  4ME9 A;  4M3B A;  2GA2 A;  4PGG A;  3ZPL A;  2O5R A;  3VYT B;  4Y33 A;  1K78 A;  3L2R A;  1TQM A;  3ZN1 A;  2H27 A;  3DLL F;  1S9H A;  2JWT A;  2LF8 A;  2RRE A;  4L9V A;  1Q1H A;  2FBH A;  2HYJ A;  2XPV A;  4JBA A;  4GYG A;  4XLH A;  4G7Z F;  2QIB A;  3KLO A;  3DTE A;  2VJJ A;  4C2M A;  2CSO A;  3CCS I;  3QAH A;  3QOE A;  4EM2 A;  4IHT A;  3HPH A;  4KMU X;  2HKX A;  5CQE A;  3SQN A;  4EJW A;  3F9K A;  4LIU A;  2ZME B;  3R6S A;  3Q0W A;  2JSP A;  2MA3 A;  4BEH B;  1YIO A;  2DK5 A;  4N4N B;  2X1C A;  2NS7 A;  2A05 A;  4CZZ A;  1B59 A;  4CYC B;  2Q0O A;  2GOM A;  2VB6 A;  1VQ9 I;  1DP7 P;  3F22 A;  3S15 J;  2UXI A;  3ECH A;  1HOM A;  4DNC A;  5DCM A;  4JK1 X;  1Z7L A;  2R7T A;  5GPC A;  3V42 A;  3CDL A;  1X4P A;  3HE0 A;  2R5Z B;  2M7A A;  3RZD J;  2ZC2 A;  2LOO A;  3KYD B;  2VC0 A;  2MLK A;  3JRI A;  2KRC A;  1P6R A;  3RQI A;  2HDD A;  5M3M J;  5EZG A;  1W0U A;  3LHQ A;  3C1D A;  2QKO A;  4RB2 C;  2A5Y B;  5F0H A;  5FHP A;  3WTZ A;  2BXY A;  5J8F A;  2Z2S B;  2CMP A;  2AQE A;  4A3F J;  4KUM A;  3F3X A;  2LRD A;  1MJ9 A;  3QYB A;  1HLV A;  4MEX F;  1ETW A;  2LMD A;  4RGU A;  3JSO A;  2E2I J;  1UHW A;  5F1R A;  2KZG A;  2ADU A;  2HXI A;  3N05 A;  4RS8 A;  5F6F A;  3H3V K;  4CIC A;  2CGP A;  3HKZ N;  4Y13 A;  2DXI A;  4XMY A;  3WGH A;  3H5A A;  4BH9 A;  1ERD A;  3EUH A;  2HTJ A;  2COB A;  4GFB A;  1SFX A;  3SZP A;  3F1B A;  4GXO A;  2JUC A;  2IS1 A;  3RPU A;  1TWA J;  4RGR A;  5JHF A;  2CRG A;  2EZL A;  4IRG A;  1YRN A;  3RTR A;  3VOK A;  4Y15 A;  1TC3 C;  3DWL E;  1D8J A;  4RAG A;  1LE8 A;  1G4D A;  5EEG A;  2H1K A;  1U2W A;  3IUO A;  3JAM K;  4YFN F;  2VKD A;  2X1D A;  4C2T A;  1MMD A;  2PFV A;  2HVR A;  1FBU A;  3DXJ F;  2LBF B;  4ZZL A;  5AIQ A;  1WI9 A;  4HLY A;  2EJR A;  2KRH A;  2WV1 A;  5L3G A;  3A01 A;  4RLF A;  2PMU A;  3ABK H;  1TTY A;  3L1P A;  5A2Q Z;  1H88 C;  1MSF C;  1IAW A;  1ZRE A;  3KE2 A;  3VOX A;  2R5Y A;  2MD0 A;  2O0Y A;  3BCA A;  1FZP B;  1FIA A;  2DT7 B;  4FX0 A;  1Y8R B;  5B1A H;  4YZE A;  1O3Q A;  2BHY A;  4PZJ A;  4KT6 A;  3LFU A;  4L0Y B;  1P7I A;  3GF2 A;  1TQI A;  3M9A A;  5FO5 A;  4O3M A;  4DIQ A;  2LKP A;  3TGN A;  1XX5 A;  4MFD A;  2MC3 A;  4PJL A;  2K85 A;  4D7M A;  1G3T A;  3LWF A;  2X6W A;  5IOZ A;  2VQH A;  1SD7 A;  1QNT A;  1TWF J;  2OER A;  2NXN B;  3GVA A;  3KP3 A;  4HV5 A;  1ODD A;  4C9Y A;  1JTX A;  2PBI A;  2YX7 A;  2LY9 A;  1WJB A;  2NYX A;  3Q3S A;  5H2F C;  4X0G A;  3WTY C;  1NH3 A;  2V26 A;  5BPI A;  1LEA A;  3A0B C;  1W0T A;  1ZR4 A;  2X6X A;  5H6Q A;  3BTC A;  3WG7 H;  5FGM A;  2VI6 A;  2F5F A;  1QO0 D;  4QIW N;  3ZN0 A;  4WCG A;  1XC5 A;  3KEO A;  5H20 A;  4RA2 A;  3CTA A;  1YIJ I;  1WJA A;  5L3E A;  5DCM B;  5HOD A;  1OCT C;  1O7L A;  3ON4 A;  2L01 A;  3I58 A;  2ID3 A;  4FIS A;  4M3E A;  4NNJ A;  1BL0 A;  2IEK A;  2R7S A;  1X1B A;  1B9N A;  2DPD A;  2M9H A;  2DAO A;  4YEL A;  3FHZ A;  2M2E A;  4ESJ A;  4XN0 A;  1E2X A;  1YJN I;  3CCY A;  2H8R A;  4HW0 A;  3T0Y A;  3Q0U A;  5KK1 A;  1RIO H;  3SWH A;  2ZJP F;  3G7R A;  4G12 A;  3GEZ A;  4ITV A;  4ZJZ A;  1XMK A;  1IV8 A;  4FE7 A;  1YI2 I;  3D5L A;  1LQ1 A;  3CMY A;  2A07 F;  1WVR A;  2Q24 A;  3I59 B;  3OYE A;  3BR3 A;  3BY6 A;  1X3Z B;  3I0T A;  2R7Z J;  5B1B H;  5K7Z A;  1YTY A;  2L7K A;  3HRM A;  4CA0 A;  2OQR A;  1B6A A;  1TWH J;  1P4A A;  2BY0 A;  2CYY A;  2DMP A;  5J8C A;  3HOY J;  1J0R A;  3TW7 A;  5E3M A;  3CC2 I;  3WG9 A;  2HFH A;  2V1U A;  1J59 A;  4KIC A;  1MMG A;  3U21 A;  2XSJ C;  3KP2 A;  4B09 A;  1FYK A;  3GW2 A;  1LDJ A;  2FE3 A;  1W36 C;  2H8W A;  4ETS A;  4IO9 F;  3BG9 A;  1JTY A;  2BGC A;  2EIL H;  3M8E A;  2Y9Y A;  2BY1 A;  3GFJ A;  3PUB A;  4TV7 A;  1QHH D;  4L62 A;  9ANT A;  1JUM A;  5E1W A;  1ZLJ A;  3WU0 A;  5EG0 A;  4E6K G;  3CLO A;  3HC7 A;  3JRD A;  2DOE A;  2LSO A;  5J3L A;  5HDN A;  2XAF A;  2V6E A;  3GZN B;  1UG0 A;  4XN3 A;  1SAN A;  2O03 A;  4Q4Z F;  4M6V A;  3A01 B;  5FMP A;  1ZGA A;  1XB4 A;  3ZMT A;  3JRG A;  3L2Q A;  5CVI A;  2IS2 A;  4LLN A;  1P92 A;  3SDG A;  3WTU C;  3RI4 A;  5EZH A;  3TL4 X;  4G7O F;  1S8N A;  3KP5 A;  5DTD A;  4IZZ A;  1JE8 A;  3CWR A;  1GVD A;  3KLN A;  1HW5 A;  3OOP A;  3CC4 I;  4U88 A;  3ROU A;  3HUG A;  4LK1 F;  3JRA A;  1IC8 A;  4OIO F;  2OBP A;  1BR1 A;  4B47 A;  4X1E A;  2H6B A;  1I3Q J;  1RKW A;  3HOS A;  4A12 A;  2VQC A;  5F1J A;  2ZJQ F;  2MH9 A;  3VW1 A;  4A5N A;  2EPF A;  3GZ5 A;  4XRS A;  2XPU A;  1HKS A;  2HOS A;  2JVG A;  2YX4 A;  2XRN A;  5GAG J;  5L3D A;  2IPQ X;  4L5E A;  1O3T A;  3OS1 A;  2F2E A;  1MMS A;  1X2N A;  5B5E C;  1Z6T A;  1IXS B;  3BQZ A;  2RHA A;  2BVM A;  3R0A A;  3GFI A;  3HRU A;  3QPS A;  3G4S I;  1V5E A;  5E3O A;  4HYE A;  3GEU A;  3C18 A;  4DYC A;  4A0Z A;  4G9Y A;  2ZFW A;  4RAZ A;  5FLX K;  3G2B A;  3P7N A;  4IVN A;  2PMZ A;  1VQ6 I;  3I5U A;  2A69 F;  3L7W A;  4DOZ A;  4EJU A;  3ABL H;  5BPD A;  1B72 A;  4XOT A;  5M5X J;  2HOE A;  4W97 A;  3S93 A;  4LIT A;  3H9Q A;  2K9Q A;  5JI6 A;  1RR7 A;  1IDY A;  3SFI A;  4KNY A;  4ZYD A;  4GCT A;  1TNS A;  3BPV A;  4WIB A;  1IN4 A;  1DPR A;  2ICW G;  3BWG A;  3E7L A;  2QWW A;  3RYR A;  4C2U A;  3O2P E;  4J00 A;  1WH7 A;  3K2Z A;  2K40 A;  4JNN A;  1HBX G;  1X1P A;  4M73 A;  4AU7 A;  3ZMZ A;  3CCJ I;  3ZQ7 A;  3O3K A;  3FF5 A;  1U0J A;  1H8A C;  2L5Q A;  3FIS A;  3SYT A;  2PLY A;  5K58 A;  3HKZ A;  3M1E A;  5DDG A;  3BG7 A;  2J5O A;  3EUH C;  2G7H A;  2QTQ A;  1U5T A;  4E7H A;  3S2H J;  2X4H A;  2ZSH B;  1LFB A;  1HW1 A;  2BV6 A;  3NQO A;  5J6X A;  2BE5 F;  1XN7 A;  1BW5 A;  4FE4 A;  2ZME A;  4XLF A;  3REO A;  4BKX A;  2BW3 B;  3R0J A;  3SHF A;  2HVS A;  4ICH A;  2FD5 A;  3MAJ A;  2QEX I;  3GUD A;  2AXT C;  3G3Z A;  1AHD P;  3DBL B;  1CQT A;  4LG0 A;  1LB2 A;  4AIK A;  2JA6 J;  4WXC A;  2W1O A;  2XHK A;  4D7N A;  4G6T B;  2OPT A;  3CMM A;  3F72 A;  5IYB J;  4D5C A;  3HJE A;  2GIV A;  3H92 A;  4XNF A;  4IHY A;  2R7W A;  3DPT A;  1EA3 A;  3DKX A;  3HDD A;  3CCQ I;  4Q47 A;  1FOK A;  1WFX A;  2IVM A;  4P1W A;  3G1L A;  4YG2 F;  4OOI A;  2HI3 A;  3IAM 2;  2GM4 A;  3K4L A;  2VN2 A;  2X1E A;  3A03 A;  3WGG A;  2F5C A;  4MHG A;  1ZYR F;  5B3S H;  1B8I B;  3BJB A;  2K9M A;  4XKC A;  3K1P A;  2HPM A;  2LD5 A;  1DUX C;  5EDN A;  3OSF A;  3FDY A;  1QZY A;  1UEL B;  2D1H A;  1ETX A;  3JTH A;  1K6O A;  2HKO A;  3FBN B;  2VQL A;  4HRI A;  2OTJ I;  2F4O B;  2DTR A;  2DA5 A;  4M9X A;  3GO5 A;  2YVH A;  3T1B A;  1YW8 A;  1T0F A;  4A3L J;  4XLP F;  4CCO A;  4XON A;  5IYD J;  3VYU B;  1XGM A;  1TW3 A;  3G56 A;  1PP7 U;  4KJZ A;  4XRS G;  1LE8 B;  3H0G J;  3PNY A;  4HKU A;  1AKH B;  1D1B A;  1XS9 A;  1B9M A;  2IRF G;  2CQQ A;  2W4S A;  2QBY B;  1ONV A;  2DMN A;  2PJP A;  3DPL C;  3G71 I;  1JUP A;  4KIS A;  1RES A;  4PCQ A;  5FKM A;  2R7U A;  3C07 A;  1DU0 A;  3ZQF A;  4ZH4 F;  4ZYH A;  2EA4 A;  1V54 H;  2G0E A;  4PSX A;  1MBK A;  2ZJ2 A;  3E6D A;  5IYC J;  3NI7 A;  5K5R A;  3KP7 A;  3HHH A;  1ZK8 A;  4A0X A;  2ZJR F;  4MTE A;  2IP2 A;  3JRH A;  4UUS B;  1W1W E;  5ICF A;  1BC8 C;  4DJA A;  2Q2E B;  2L9R A;  4I02 A;  1NHA A;  1YJ9 I;  2R5Y B;  3BRU A;  2E1N A;  4CZC A;  3QYF A;  2V6C A;  5M3F J;  5AON A;  3OV8 A;  2E7X A;  3MQ0 A;  3LSP A;  3HTI A;  1IO2 A;  2NOJ B;  3A0H C;  2FMY A;  3MZ8 A;  4MEY F;  3ERM A;  1JKR C;  4F55 A;  1GXP A;  2HYG D;  2O9L A;  1FBS A;  1FY7 A;  1SD5 A;  3MZY A;  2RV8 A;  4L9J A;  3U1K A;  1MJA A;  3MZH A;  5J4V A;  4E7Z A;  3TP3 A;  4BNC A;  1C0W A;  4YFX F;  2Z9O A;  4MFE A;  4AVP A;  1FYL A;  1ETQ A;  1OYW A;  1K83 J;  3RKW A;  2QSH X;  3PAS A;  2P6T A;  4RDU A;  3E5Q A;  1QU3 A;  1FMV A;  1UST A;  3EUK L;  3JCU C;  3BOQ A;  2VE8 A;  3WE3 A;  3VUQ A;  1UHS A;  2X6O A;  1SAX A;  1G59 A;  3EQL F;  2RQQ A;  4KIF A;  2D1V A;  2DQL A;  1VQO I;  1UB9 A;  5D1R A;  2QSG X;  2FBQ A;  4KT5 C;  3AG4 H;  2Z1D A;  3FHN A;  1HKT A;  2B63 J;  1QPM A;  1QRY A;  1WJE A;  2E60 A;  2HXO A;  2XIG A;  3GBG A;  2E1M C;  2XRO A;  1KQ8 A;  4IRI A;  5F08 A;  2LH9 A;  4WXD A;  1FP1 D;  1H9T A;  1GLN A;  4A3D J;  3DF8 A;  3ZQL A;  2E2H J;  5BMZ A;  2ESH A;  1J09 A;  3HSE A;  3KIO A;  2LRE A;  4LJZ F;  4MO7 A;  4B4C A;  2CFO A;  1U9N A;  3VW0 A;  1R7J A;  3JRE A;  3SFZ A;  4V2F A;  5CXI A;  1OKR A;  1IRF A;  2G9W A;  3L9F A;  3GZI A;  2LLK A;  3F8C A;  2WWY A;  2DJN A;  3H9G A;  2FOK A;  1XMA A;  4NC8 A;  3CME I;  2FBK A;  3VOE A;  2OF7 A;  2G7L A;  2VKE A;  5D6E A;  2DG7 A;  4FT8 A;  2WAQ N;  4EGZ A;  1D0Z A;  2W82 A;  5ICC A;  3L2U A;  1BA5 A;  2L02 A;  3FKI J;  1P9Q C;  4RAY A;  5BS6 A;  4HDU A;  2KDO A;  2ME0 A;  2KFD A;  3DBH B;  5GAE J;  1HST A;  1KA8 A;  3LSM A;  4AF5 A;  3V6G A;  5TJJ A;  2QYO A;  2E36 A;  3AKZ A;  4KA4 A;  1FOW A;  4IRV A;  1TT0 A;  1T08 B;  2HDC A;  5D5X B;  1Z3X A;  1OCP A;  5LLQ A;  5HSZ A;  5KAI C;  2OQG A;  2B9S A;  4HBL A;  4I2O A;  1MBH A;  2E19 A;  1WHU A;  5GAD J;  3ZXS A;  2FXA A;  2WAQ A;  4UY8 I;  3BZ6 A;  3CJN A;  2WAF A;  2ELK A;  2QF7 A;  1E3P A;  2EB7 A;  4UUS A;  1ZRD A;  1NK3 P;  5JFR A;  2FUG 2;  4BJT A;  4A2U A;  1OCZ H;  3BR6 A;  2WAD A;  3G1M A;  1U9O A;  4GDF A;  1MZB A;  3EPZ A;  4MIM A;  2GEN A;  1NTC A;  2QLZ A;  3I3L A;  3IP4 B;  4HX8 A;  3P5J A;  4M6X A;  1RKT A;  3KFW X;  3BJ6 A;  4XLE A;  4BBS J;  1GV5 A;  4E70 A;  1R71 A;  2ZO4 A;  1RC9 A;  1R6R A;  5J1U A;  2LF7 A;  3RJP A;  3C2H A;  4BBR J;  2OTL I;  1QVU A;  2DYS H;  4BQQ A;  3FZV A;  4AID A;  2Y75 A;  1G6N A;  3OYG A;  1YE9 A;  5DAJ A;  2COM A;  4EAT A;  4OD4 A;  3BRO A;  1W5C C;  4GFK A;  2VPR A;  2ZKZ A;  3HGY A;  5M5W J;  2DG8 A;  4AIJ A;  2DA7 A;  1JXS A;  1A35 A;  2ID6 A;  3OS0 A;  4Y4R A;  5K5Q A;  1SVM A;  1F5T A;  1VQM I;  4ACI A;  1MDM A;  2XKO A;  2Y31 A;  3TED A;  2W57 A;  3FRQ A;  4BQA A;  2KDZ A;  1A04 A;  2DPU A;  1VF9 A;  2EA2 A;  4BE0 A;  3N97 A;  1BI3 A;  1PJR A;  1F36 A;  1ZKG A;  1E17 A;  2H94 A;  5DEQ A;  3CMA I;  2AHQ A;  4OIP F;  2LKS A;  2TRT A;  4FET A;  2FF4 A;  1LDD A;  2FSW A;  1RET A;  4ENM A;  2A61 A;  4XSZ F;  2ZXJ A;  4HF1 A;  2VBY A;  2PEX A;  4DW6 A;  2DN0 A;  4YII A;  4UUV A;  2EZH A;  1HCR A;  5HNH A;  1BJA A;  3BG5 A;  1RZ4 A;  1VI0 A;  3KEY A;  4O5V A;  2ZOY A;  1R5G A;  1XGO A;  2V9V A;  4LMY A;  3BLY A;  3TOB A;  2W84 A;  4BHC A;  5LD2 C;  2G3B A;  3QPH A;  3RCO A;  1S7A A;  2IJL A;  1R22 A;  2QSF X;  3KX2 A;  2OJE D;  2M87 A;  2DFI A;  1GHC A;  1J9I A;  1ZGW A;  4U0Y A;  5D4R A;  1EH6 A;  1RI7 A;  1OMI A;  2ZXI A;  3E5X A;  3TBI A;  3OYF A;  2UZK A;  4CGZ A;  3KNW A;  3TDZ C;  2XF5 A;  3ZQC A;  4RLQ A;  1MDM B;  1VQ5 I;  4N9H A;  2YS9 A;  3DLA A;  3OL3 A;  2EWN A;  5DM6 F;  4HEA 2;  4II2 A;  1KQ9 A;  1QZZ A;  1T33 A;  2DA2 A;  5J40 A;  1HKQ A;  2ZY9 A;  2R7R A;  2XAH A;  1IN6 A;  1U8R A;  1OLT A;  2X9D A;  3O8G A;  4IQ4 A;  3TP0 A;  5ED4 A;  1HF0 A;  1IUF A;  3WOD F;  3W2A A;  3K4K A;  2GXA A;  3HEF A;  5HOO A;  2NNN A;  4IOC F;  3S8P A;  3BQY A;  2L0K A;  4KIB A;  1KZH A;  4BE2 A;  1IGN A;  1XGS A;  4KDP A;  1RR8 C;  1Z0X A;  4RB1 A;  1F43 A;  1EH8 A;  4E7L A;  1AWC A;  3T8R A;  2M45 A;  2KKO A;  2FEZ A;  2QM3 A;  5C4X J;  3FM5 A;  3MD2 A;  4CCM A;  4A3B J;  5DD4 A;  1BR4 A;  3SJM A;  2OAZ A;  1PUE E;  1I50 J;  1FEX A;  2A6T A;  2P5K A;  2UWM A;  1MBG A;  4ON0 A;  2UXN A;  1JKQ C;  3QBM A;  1Z67 A;  2UXX A;  5TGT A;  3OIO A;  4IRH A;  4KN4 X;  5IT3 A;  3QP5 A;  3V8J A;  4N4O B;  2CU7 A;  1EJ9 A;  3S16 J;  5E8G A;  1J5Y A;  4CSW A;  3JSJ A;  5F0F A;  4PSW A;  2ISZ A;  4IF4 A;  4ZYA A;  4L0Z B;  4I01 A;  2UXH A;  3S32 A;  4M74 A;  2ZXW H;  3GME A;  1FIP A;  2NAZ A;  4OU0 A;  4CCN A;  1XDU A;  4F52 A;  3ZMS A;  1F9N A;  2DO7 A;  2DA3 A;  1JT6 A;  2BYV E;  2P7V B;  1U5T C;  2ZSI B;  2BY2 A;  2XDV A;  2OCC H;  4V19 K;  4IXA A;  1I5Z A;  2BZT A;  4UB6 C;  3EYY A;  2PI0 A;  1O57 A;  1D1A A;  2R0Q C;  1UFM A;  2LC2 A;  5L3F A;  3PIO F;  5E79 C;  1OQY A;  3ANG A;  2VQG A;  1ITY A;  4A6E A;  2K4J A;  2XF6 A;  2E7W A;  5HAW A;  1S72 I;  2V1X A;  5E18 F;  1DGW Y;  2KLO A;  3EUA A;  4FX4 A;  3I9V 2;  1KYZ A;  3HGG A;  2NS0 A;  5EG0 B;  4M9Z A;  4M3D A;  1TBX A;  3FMQ A;  1VQN I;  2BXZ A;  1Y0N A;  2M3A A;  1MBJ A;  1T98 A;  3ML6 A;  3CCL I;  3NPI A;  3K9T A;  2XRL A;  3O6B B;  3FXL A;  3HOZ J;  1U5T B;  2CJJ A;  4HSR A;  1Y1V J;  3DTI A;  2RQP A;  3OR2 C;  5DS9 A;  4IHW A;  2V9P A;  3HSF A;  2W7N A;  5BQT A;  3E6B A;  1J7K A;  3MMY B;  3IRQ A;  1T0F C;  1HXD A;  1STZ A;  1LVA A;  1IF1 A;  1FMW A;  2WTE A;  2XGD A;  4B43 A;  3DTK A;  2PN6 A;  1FNN A;  1OYI A;  4S05 A;  2WA0 A;  2K02 A;  4WWC A;  3OYN A;  3P9K A;  1ETV A;  4XLC A;  4XBF A;  4C3J J;  4NEL A;  2JRT A;  3GTL J;  1I1G A;  5L3B A;  5DV5 A;  4HNT A;  4HG2 A;  1I3A A;  1LJ9 A;  1R1V A;  3IWZ A;  1JHH A;  1R1T A;  2HKU A;  3SZG A;  3OMY A;  2B7E A;  3CQZ J;  4A6D A;  3VSK A;  3MN2 A;  3PJR A;  3HTH A;  1IRX A;  3NAU A;  1XGN A;  3HPG A;  4B1R A;  1GVJ A;  4DZP A;  4AC6 A;  1PYV A;  3QYE A;  2W48 A;  4L9N A;  4J19 A;  2LYC A;  4PK4 A;  1V5F A;  2W24 A;  4LLL A;  1FSH A;  1Y1W J;  5FB2 A;  2BBY A;  1ULY A;  3E0J B;  4JX4 A;  4BS9 A;  3OY9 A;  3GYH X;  4I0B A;  2JA8 J;  3C2G A;  4R8H A;  4D0P A;  1ZAO A;  4BY1 J;  1I6X A;  2XGC A;  1FP2 A;  4FQG A;  4Z2Y A;  2QQ9 A;  4HLX A;  5LHG A;  4G6Q A;  1R4N B;  1I27 A;  2IAI A;  1IJW C;  2JPC A;  3E1S A;  4KWA A;  2YPR A;  4QSH A;  1I39 A;  3ZMD A;  2MAB A;  2QQ8 A;  1ON2 A;  2XC7 A;  2JMW A;  3C3W A;  1T6S A;  3QQA A;  2L9S A;  3VOD A;  2CV2 A;  3LSJ A;  2V4J C;  3HZJ A;  2W85 A;  2HZT A;  3LAJ A;  2VBZ A;  1FX7 A;  2WB1 N;  5K1Y A;  3RYP A;  1SVO A;  3MKL A;  3VYS B;  3ZOB A;  4EQQ A;  4BL0 B;  5JR3 A;  2I10 A;  1U78 A;  2HWV A;  3M07 A;  1ETK A;  3NNR A;  5D8L B;  1AA7 A;  2R5Z A;  2ELH A;  2WC2 A;  2NVX J;  5GPA A;  2XAG A;  1HDD C;  2CV0 A;  2RNG A;  3BG6 A;  2ZCW A;  2F4I A;  1OCC H;  3F8N A;  5LRS A;  2XAU A;  3NEU A;  2ESN A;  3R60 A;  3CF2 A;  3QPT A;  3VPR A;  2D6Y A;  2OCE A;  4BXU A;  2FNP A;  1X58 A;  3WTS C;  2RC4 A;  2GLO A;  2YU3 A;  1ZR2 A;  1X3U A;  2HYT A;  1G3S A;  2M0M A;  2LG4 A;  5E1X A;  2JK3 A;  3V4G A;  1LNW A;  2Q2E A;  2X85 A;  1DPU A;  2IXS A;  2GUH A;  1HSJ A;  2M8E A;  3PL8 A;  4L5I A;  2XSD C;  3BR5 A;  1R1U A;  1K61 A;  1K4S A;  1YS7 A;  2Z33 A;  2NVQ J;  4A3G J;  4MXM A;  4B44 A;  3JSP A;  2IU5 A;  2FQ3 A;  2AQF A;  4EMS A;  4LB5 A;  3OYM A;  4LG3 A;  4DBR A;  5C3E J;  4IPA A;  3IRR A;  4N9I A;  3PNT A;  3KZZ A;  5FLV A;  5HLG A;  3PUF A;  3AFH A;  2E1C A;  2Z16 A;  4CCL A;  2ETH A;  2EIN H;  2KIS A;  4K2E A;  4C3H J;  3LSR A;  1K78 B;  3WU2 C;  1VQ4 I;  2VXD A;  5EYR A;  1CGP A;  3S2D J;  2HYF A;  3KET A;  3NS4 A;  5JHU A;  3QKX A;  3VP5 A;  2VBW A;  3HOV J;  1TT5 B;  3ZQH A;  4U9N A;  1LPQ A;  2DQR A;  2EV0 A;  3OR1 C;  5GP9 A;  4E4H A;  2OI8 A;  4XLN F;  1TZL A;  3K6G A;  4ABZ A;  4OWR B;  4Y7N J;  5TRD A;  1QGP A;  3COL A;  2F5V A;  1ZLK A;  5D19 A;  2V1D A;  4AM3 A;  2W53 A;  3L2V A;  2B1E A;  1EKE A;  4LGW A;  3CDI A;  3KP6 A;  5E20 A;  3V78 A;  4CH7 A;  3OYI A;  5LBQ A;  3LFK A;  5K7H A;  2EZI A;  4XRM A;  4NN1 A;  2L4M A;  2M34 A;  1T38 A;  2OU2 A;  4IJA A;  5FKO A;  5IT9 Z;  4PXI A;  1S3J A;  1MJB A;  3HXL A;  3COA C;  2EBI A;  4W1U A;  4XM3 A;  2MH2 A;  3FM3 A;  2PFB A;  2ISY A;  4M9S A;  1Z1D A;  5FKN A;  3SEZ A;  1JI8 A;  5ERI A;  1T8I A;  1XDS A;  2P4W A;  5DYM A;  3WTV C;  2XAJ A;  3IAS 2;  1VQP I;  4A3K J;  5D5V B;  3GTO J;  2A68 F;  1NK2 P;  4IOA F;  1MKM A;  3GTK J;  1GUU A;  1Y6I A;  3VEP A;  2KRF A;  1Z7U A;  3CJQ B;  2DYR H;  4R79 A;  2JA2 A;  3J80 Z;  1F4K A;  1D0Y A;  4CDG A;  3HTJ A;  4UXN A;  4PJM A;  2VJ5 A;  1TP4 A;  5H6R A;  2BW3 A;  1Y8Q B;  1FYM A;  2DBB A;  4XSX F;  2CFX A;  1UHM A;  2VKH A;  5FD5 A;  4IHV A;  3U9G A;  2RNJ A;  5FLM J;  1QPI A;  1XTA A;  1FSE A;  1HC8 A;  4BDY A;  3S3N A;  4R1H A;  4JOM A;  1JJ6 C;  2MSY A;  2H09 A;  2GIZ A;  5E3L A;  3MKW B;  3CUQ B;  1D5Y A;  4MGR A;  3DU5 A;  2ZFU A;  4M3G A;  2F48 A;  2L2O A;  2V79 A;  2DT6 A;  3UKG A;  3F8M A;  2E1M B;  2EV6 A;  3OYB A;  3OYL A;  4KN7 X;  3DKY A;  2GFN A;  1Z91 A;  3ANP A;  1SFK A;  2BVL A;  1XMX A;  1ON1 A;  3CO7 C;  5C4Y A;  5D6F A;  2PG4 A;  3R4K A;  3RSN A;  3BR0 A;  3RKQ A;  3OYD A;  3GTG J;  5HDK A;  1VQK I;  4LB6 B;  5ICG A;  3M7G A;  3HSR A;  3V8L A;  4WK8 F;  3FXU A;  5IY5 H;  4FHT A;  1FTZ A;  3W3C A;  1R4M B;  3L2W A;  1ACI A;  3PNV A;  4EM0 B;  2MD5 A;  3HTS B;  3O8H A;  1OCR H;  2CWE A;  1IRZ A;  5HBU A;  1GV2 A;  3LA3 A;  4F92 B;  4F3Q A;  3PFY A;  2IT0 A;  4ASN A;  3CDH A;  4BHP A;  1JHF A;  2O3F A;  3IH2 A;  3HOU J;  3D5R C;  4I7H A;  1PUF B;  3ECO A;  1WCM J;  3SDB A;  5CVV A;  4AWX B;  1S29 A;  1EV7 A;  4MQV A;  2I8D A;  4D5F A;  5GTH C;  4KMF A;  3GFL A;  3VDX A;  2VE9 A;  3IH4 A;  1X2M A;  2WB1 A;  3EYI A;  2GBY A;  1ZG5 A;  3DQV C;  3OYC A;  2ECB A;  1XG1 A;  4Y3O A;  3B73 A;  2HGC A;  2ZXH A;  5LEK A;  2LKX A;  1DQU A;  2VPL A;  1VND A;  2QGU A;  2P8T A;  3HTU A;  1KU2 A;  4U0V A;  4HX7 A;  5CQG A;  3H1C A;  3I71 A;  1Q1V A;  2K5C A;  3FXM A;  2MG4 A;  3HB9 A;  2WUI A;  3AQT A;  1KU9 A;  3TOA A;  3NRV A;  4MTD A;  4F91 B;  3S5R A;  4XQF A;  3VVX A;  2R7F A;  1ORK A;  2Y69 H;  4HF0 A;  3TKY A;  1X1D A;  1HQC A;  3RQ4 A;  5EGO A;  2RKH A;  3ZGK A;  3PIP F;  1D5V A;  2NNY A;  3IV5 A;  2CUE A;  1WSU A;  3JAM Z;  3DFG A;  2O8X A;  1P2F A;  2DA6 A;  2PMH A;  4WX9 A;  2ZCN A;  3VSL A;  2CUF A;  3V8K A;  6PAX A;  2B0L A;  2MYS A;  3HUG B;  4L5J A;  4RB0 A;  3WU1 B;  1HA8 A;  1ZHF A;  2YUS A;  4A93 J;  1LEB A;  2XKP A;  3F8F A;  5HS9 A;  2L4A A;  2FBI A;  4BY7 J;  3ZQG A;  1S7E A;  3QOP A;  2JPB A;  5KAF C;  2F4M B;  2QKM B;  3GTM J;  1Z6R A;  2L3D A;  3JW4 A;  3CJD A;  3RIR A;  3S1Q J;  3VB2 A;  2ZB9 A;  5FLX Z;  2H6C A;  3OYH A;  3E6M A;  4FTH A;  3I59 A;  5FRO A;  4I99 C;  2VOP A;  2CO5 A;  1N25 A;  2VOO A;  3BPX A;  4DYR A;  2F07 A;  3MVP A;  1QHG A;  3A02 A;  4I6Z A;  4M72 A;  1QA6 A;  4XK4 A;  4DGW B;  3JR9 A;  4PUS A;  2WAE A;  1ENH A;  1UAA A;  1KU3 A;  3BCB A;  3QPL A;  3MKZ A;  1PP8 F;  1R5I D;  4OD5 A;  4LLG F;  2KMU A;  2R7Q A;  4UVB A;  3LMM A;  5J1R A;  3QRF F;  3SEQ A;  1Z3Y A;  3J7A Y;  3L2C A;  4GFL A;  1MMN A;  2MW8 A;  2P0W A;  1GDT A;  5LGN A;  3MFK A;  1B72 B;  1YLF A;  3BJA A;  1LUJ B;  2KQR A;  3K4C A;  4B3X A;  1MGT A;  1YHQ I;  3FXQ A;  3KYC B;  2LK2 A;  5CVU A;  3HTA A;  2JSC A;  1P7J A;  3U1D A;  2NP3 A;  1TWC J;  2WY8 Q;  4G94 A;  4CCJ A;  1MNM C;  2DMT A;  2IBD A;  3ON2 A;  4OIQ F;  3K70 C;  3B02 A;  2L54 A;  3ULQ B;  3P9C A;  3VTI A;  5LGT A;  1YS6 A;  2UXO A;  1XCV A;  2XPW A;  4U87 A;  1I6H J;  3GLX A;  2YVX A;  4ZTJ A;  1OCO H;  1ZEL A;  2FQ4 A;  1SD6 A;  4A3C J;  2M8G X;  3G1O A;  5TIS C;  3GTP J;  4KIG A;  3FWE A;  1BR2 A;  5FKL A;  1UCR A;  4RBO A;  3IWF A;  2FNA A;  3LL7 A;  3ZQQ A;  4XKW A;  2Q8K A;  1FJL A;  2D45 A;  1BN5 A;  1OYY A;  4NC7 A;  5D5U B;  2EIJ H;  1VQ8 I;  2HQR A;  4CO8 A;  3ERE D;  3FMR A;  1REP C;  3MNL A;  3CC7 I;  3VW2 A;  2HVQ A;  3IKT A;  1A31 A;  3CRJ A;  3S1M J;  4XR6 A;  4II3 A;  4NUB A;  1MBF A;  2HQ5 A;  4DYQ A;  5IP6 A;  5IP7 J;  3K10 A;  4BXF A;  4RB3 C;  2A6H F;  2R7V A;  1X4O A;  1X19 A;  2LBF A;  3A2K A;  2PX9 A;  1JUS A;  4G6D A;  4HZF A;  2VJI A;  4OAZ A;  1ZQ3 P;  5A2Q K;  2IGM A;  1EF4 A;  1ZH5 A;  3RKY A;  2Y30 A;  2LTP A;  3BNI A;  3DKW A;  3H3Z A;  3OYJ A;  2VLA A;  3OIQ A;  4J01 A;  2FJ1 A;  4M71 A;  1KGS A;  4HA8 A;  4Q5S F;  1WRJ A;  1OPC A;  1BM9 A;  2EK5 A;  2M5W A;  4NB5 A;  2GAU A;  1TNT A;  2EQR A;  2P6S A;  2HS5 A;  2OZ6 A;  2V1N A;  2ME6 A;  3CCU I;  1KQ0 A;  1IZ1 A;  4B8X A;  5E1Z B;  2FU4 A;  3Q0V A;  1A6I A;  1CF7 A;  3AQS A;  4IKF A;  1MMA A;  2HPI A;  5IP9 J;  3L09 A;  5FFX A;  2MGQ A;  3JTG A;  3FXR A;  1FPQ A;  2A3S A;  3VIB A;  4KFC A;  4JKZ A;  3BTL A;  3DV8 A;  4ZDP A;  4LK0 F;  3QOD A;  3VYR B;  2Y48 A;  3MCZ A;  4AYB N;  1P4W A;  5CLS A;  2NVT J;  5FGL A;  2CH0 A;  2YSR A;  4HPQ A;  2XVC A;  5D4S A;  2ZCX A;  2M4G A;  4MNU A;  4OIN F;  2VXZ A;  5LHI A;  3ELK A;  4F93 B;  4D1Q A;  1YO5 C;  5CVJ A;  3BTI A;  1SD4 A;  2R4G A;  3D0S A;  4HV6 A;  2ELJ A;  1WZ2 A;  2JUG A;  3DEE A;  1QZE A;  2VAS A;  1G3Y A;  1XSX A;  4PFP A;  3I56 I;  2LR8 A;  2TDX A;  1JGG A;  4HX4 A;  2RDP A;  3LSK A;  3OIP A;  1BOB A;  4N0B A;  5LHH A;  5D18 A;  3F21 A;  4C2M J;  3JRB A;  1ZN2 A;  4ANJ A;  3SXY A;  2E5Z A;  3HOW J;  3MEX A;  2R92 J;  3BP8 A;  2QA4 I;  3TO6 A;  1IDZ A;  2LY1 A;  1S7O A;  5D5W B;  2HNH A;  4ZTF A;  3VVZ A;  1MH4 A;  3BZK A;  2DFF A;  2E2J J;  3WHC A;  5J1Y A;  5BNG A;  1R23 A;  1N77 A;  5DUI A;  3CLQ A;  2R93 J;  1V4R A;  4RGX A;  3K4N A;  2JA7 J;  2BHZ A;  3BR2 A;  1Z77 A;  2K3P A;  3E6C C;  3A4C A;  1W7P A;  4Y17 A;  2XGX A;  2VL8 A;  4CUG A;  2DCE A;  3CJT B;  3HOT A;  3Q9V A;  2CUJ A;  2Q1Z B;  5HVQ C;  2STT A;  3ZQI A;  5LEJ A;  4LOC A;  2KT0 A;  3LWJ A;  4GYI A;  3K4M A;  2IA1 A;  1IN8 A;  1BIA A;  5KVR A;  4XKV A;  2LDU A;  1POG A;  2Z3Y A;  3KZY A;  2L9N A;  1BI1 A;  3BZC A;  2VT3 A;  2Y0S A;  3S17 J;  1H89 C;  5E8I A;  1JKP C;  1VQL I;  3GXO A;  3ONQ A;  3CUO A;  2O7T A;  1MND A;  1WJ5 A;  4IEJ A;  4CXF A;  3KP4 A;  2IGK A;  4JQF A;  4HNU A;  4IX7 A;  4BQO A;  1BI2 A;  3BJO A;  3FXO A;  3UNG C;  1RUN A;  5KCM A;  1JGS A;  2M0C A;  3F6O A;  3S2W A;  4IQJ A;  2AS5 F;  4GO1 A;  3RPU D;  4NDL A;  5KHD A;  2EIM H;  3K4B A;  2HOA A;  4UVC A;  5DD8 A;  4A5M A;  5JLW A;  4U7B A;  5CKT A;  1GT0 C;  3OWT A;  2VBX A;  4XLA A;  3IC7 A;  2PBX A;  3CUQ A;  2VON A;  4EV0 A;  3W6K B;  2MC4 A;  3EDP A;  4PJ0 C;  4ENN A;  2DU9 A;  2ZOZ A;  4CYD A;  1MSE C;  3CP8 A;  4C3I J;  4GCL A;  3HRS A;  2K9L A;  4I76 A;  1I1S A;  5EFY A;  2DJI A;  2CQK A;  4YFK F;  1GXQ A;  3IKV A;  4EGY A;  2ACJ A;  2IS4 A;  3I55 I;  1BOA A;  2WGB A;  2CQX A;  2EFQ A;  2M1B A;  4ESB A;  1ZRC A;  2RVC A;  4AYB A;  2LVS A;  3K4J A;  1WKM A;  3O60 A;  1IUY A;  4QLC U;  3G73 A;  2R3S A;  4UB8 C;  1OIS A;  3BC8 A;  1Z05 A;  2WBM A;  1IN7 A;  3F23 A;  4LFU A;  2XAQ A;  2L7M P;  3VFZ A;  5J47 A;  2L7Z A;  1U8B A;  4A0Y A;  1U3E M;  4JX5 A;  2RGV A;  3H5N A;  2B3W A;  2Y9Z A;  1W36 D;  3GTJ J;  3BTJ A;  1AOY A;  1P4X A;  1PUF A;  4DZJ A;  1VQ7 I;  1D3Y A;  1YW9 A;  4RM3 A;  1XPX A;  4UV9 A;  2PJR B;  2NX4 A;  1B1B A;  2DMU A;  2DMQ A;  4HOB A;  4U0W A;  3TMO A;  2UXU A;  4PJJ A;  1LFU P;  2A5W A;  2A6E F;  3NWS A;  1IRG A;  2WY7 Q;  1G2H A;  1UI6 A;  2JQ7 A;  3I53 A;  4EVI A;  4B48 A;  3U2R A;  3I4P A;  2AO9 A;  3KYL A;  1S6L A;  2F5E A;  2KJC A;  3H35 A;  3HRT A;  3CUQ C;  5HLH A;  3D1N I;  4HQM A;  2E34 A;  2GZW A;  2HR3 A;  1MBE A;  2OV7 A;  5EF6 A;  3UR3 C;  1USS A;  2VUM J;  1ZGJ A;  1FT9 A;  3S1N J;  5FRN A;  4P96 A;  4CGR A;  4ESF A;  1D1C A;  4XRF A;  1QQI A;  3GTQ J;  3LA7 A;  3OS2 A;  4PJN A;  2QEN A;  2CQN A;  4EM1 A;  3OSG A;  1SGM A;  1EH7 A;  1OR7 C;  2ECC A;  3M8F A;  1UI5 A;  4WF2 A;  3TO7 A;  2K27 A;  1WGX A;  2G7S A;  5H9T A;  2YU9 J;  3IH3 A;  4PDK A;  2QVO A;  2I5U A;  1X3W B;  5CJ9 A;  3PM1 A;  5BOX A;  2PJR A;  4D9J A;  5F0C A;  2H1L A;  4DQ2 A;  4A3I J;  1ETO A;  2GXB A;  4RM2 A;  1FC3 A;  2JRM A;  2E71 A;  3T5X A;  1MW7 A;  2ZBK A;  2EFN A;  2FJI 1;  3LSG A;  1Z9C A;  2E1O A;  2CW7 A;  5E3N A;  4PGH A;  4JL3 A;  2KPM A;  1K4T A;  4ZDO A;  3AAF A;  1ZAR A;  1YJW I;  3FK7 A;  2M30 A;  3FKJ A;  1FOY A;  1R36 A;  1O3R A;  3K1N A;  5CYV A;  2X48 A;  4P55 A;  5HS7 A;  1SAU A;  1UJ8 A;  3K69 A;  3QU3 A;  2O6G E;  4UV8 A;  2P81 A;  1YX5 A;  4LG0 B;  1YRN B;  3E7Q A;  2KJB A;  2IGN A;  2OA4 A;  3LOC A;  3GX4 X;  2FOW A;  3RKX A;  4B3A A;  3CZ6 A;  5CXG A;  2DDB A;  1O7F A;  2QWT A;  3ASO H;  3QWL A;  1Y39 A;  2K9N A;  2PQ8 A;  5DUK A;  3KCC A;  2UXP A;  4ENJ A;  2TCT A;  4H4K C;  3ASN H;  3WTT C;  1V3F A;  4E7K A;  4EJT A;  4L18 B;  2O7O A;  4UDS A;  2NOG A;  1DP3 A;  2GA1 A;  2VIX A;  3PSF A;  1XSD A;  2VOD A;  4U9L A;  1SVL A;  3HHG A;  1E0E A;  3ISP A;  2OUM A;  3QU6 A;  4P9F A;  2JA5 J;  2LY2 A;  1R00 A;  3JRC A;  2XV4 S;  5LFA A;  2QOP A;  4F7Z A;  3V7C A;  2L9V A;  1TW2 A;  4XOP A;  2JT1 A;  4BE1 A;  1SC7 A;  2HTS A;  3ABM H;  3PSI A;  2NS8 A;  4AUX A;  3F8B A;  2IA2 A;  4CCK A;  3AG2 H;  4GCK A;  2EFW A;  2HZD A;  2K86 A;  1PDN C;  1HW2 A;  2KL4 A;  1MD0 A;  2JZY A;  3ESW B;  5DM7 F;  3J81 Z;  1XSV A;  5HLI A;  1A36 A;  1JT0 A;  3KKD A;  4GCV A;  3WGI A;  3ABU A;  2ZNZ A;  4LD5 A;  3X2Q H;  1KON A;  3MKY B;  2NVY J;  4GRI A;  3WE2 A;  4H0E A;  4NQW A;  2R7D A;  3A1Y A;  1KYW A;  1TQP A;  1BJZ A;  4FCY A;  5EEH A;  4S0H B;  5FKK A;  3E5U A;  2STW A;  4HQE A;  3ABT A;  2BY3 A;  4I98 B;  3GWZ A;  4EEF G;  3H3U A;  3W2V A;  3H5R A;  2A2F X;  1D0X A;  3K2A A;  5IPA A;  2E35 A;  2JN6 A;  4YIR X;  3KKC A;  3VWB A;  1UG2 A;  5FFZ A;  4WXH A;  5FRM A;  2LNB A;  2CW8 A;  1YYV A;  2PZ9 A;  4OIR F;  2OD5 A;  4MK6 A;  1LVK A;  4BYY A;  5K7F A;  1UZC A;  3P9I A;  2KIU A;  5DCF A;  4IL6 C;  2DW4 A;  5GAH J;  3RDI A;  3GLL A;  2MLG A;  3V7R A;  1RRJ A;  5FD6 A;  2DTZ A;  1N75 A;  1RPW A;  2Z99 A;  4XKB A;  1YX3 A;  1XCB A;  3AL0 B;  4OAY A;  4CHU A;  3HL2 A;  1WI3 A;  5IT9 K;  2JJ7 A;  2HQA A;  3RZO J;  1YOV B;  1R49 A;  3FBI B;  1ZTR A;  3DCF A;  3B6C A;  1BI0 A;  1RNL A;  5CPR B;  4EJV A;  3F6V A;  1Z21 A;  3J7A O;  1HDP A;  2UV1 A;  2RAE A;  1T2K A;  2ZME C;  1CF7 B;  2N8G A;  3OL4 A;  2G7G A;  2LFB A;  3LSI A;  4BHB A;  5ILU A;  3B6A A;  2M4K A;  3KZI C;  1IW7 F;  1ETY A;  2IW5 A;  2DA1 A;  1SEU A;  3F0C A;  1FOX A;  1MIJ A;  2NP5 A;  2GOX B;  2EIK H;  1Y0U A;  3V7S A;  4HF2 A;  4BEH A;  4KYW A;  3HIF A;  1SMY F;  1V5G A;  1YFH A;  4ZZD A;  2UUZ A;  4MLO A;  3ZMV A;  5EGO B;  5EJC A;  3DPJ A;  2VKV A;  3FK6 A;  3RH2 A;  2KZV A;  1E3O C;  2QUF A;  5L3C A;  3S3O A;  1LKX A;  2DI3 A;  3KEQ A;  2OZU A;  2QZ8 A;  3WHB A;  2HEO A;  2P5L C;  1TWG J;  2EV5 A;  3W2W A;  1TLH B;  1D8K A;  1WJD A;  1J2X A;  2K9S A;  2MFZ A;  3KZ9 A;  2BOL A;  1XD7 A;  2GQQ A;  1K79 A;  2DA4 A;  4L9T A;  4XL9 A;  3ZCO A;  1L0O C;  3K70 D;  2CS3 A;  4QPO A;  3MWM A;  4FAS D;  4A69 C;  3EGQ A;  1IXC A;  1BIB A;  1Y56 A;  2R7X A;  1SMT A;  1FWZ A;  1R5H A;  4QPQ A;  4NC6 A;  5ILV A;  3NRG A;  3AL0 C;  2XDN A;  2M7B A;  3CES A;  2MBF A;  2J5P A;  2EFO A;  1WWX A;  4YIF A;  3ZR8 X;  1T39 A;  4HAM A;  2QQB A;  2KIM A;  3DPU A;  4S04 A;  2L7F P;  2P7C B;  3DU6 A;  3BDD A;  3LQQ A;  3M8J A;  2X51 A;  1DU6 A;  5F64 A;  3IUV A;  5JVT A;  2DFH A;  4YRV A;  4A3E J;  1AU7 A;  4AVZ A;  4BGD A;  2XB5 A;  2WV0 A;  1W7P D;  3WTW C;  1IN5 A;  3OYK A;  3W6J B;  2ZNY A;  3HG9 A;  1BW6 A;  4BU2 A;  3AG1 H;  2W00 A;  4BAC A;  2KIF A;  4G8X A;  3C7J A;  3RD3 A;  2O61 A;  2HQN A;  2F5D A;  3LST A;  3I4N J;  3NXC A;  2QCO A;  1WJC A;  3R61 A;  5M5Y J;  4E7S A;  3ZP5 A;  4ZDL A;  2X6Y A;  5D8K B;  3FIW A;  3S3M A;  1QBJ A;  2DOA A;  4QWQ A;  1M1E B;  1NG7 A;  3J7Z I;  3IHU A;  4A3M J;  4E7I A;  4Y52 J;  4P5O A;  3CF5 F;  2DK8 A;  1DGR M;  5CW8 A;  3M1C A;  3Q5F A;  3CD6 I;  3FXK A;  5GTI C;  5EEA A;  1KU7 A;  1FTT A;  2AXL A;  1OR7 A;  2D2W A;  4HST A;  1L3L A;  1E3H A;  3W6V A;  4DVY P;  5HDG A;  4BDZ A;  1B8I A;  1T56 A;  3H36 A;  2FX0 A;  3CP2 A;  3BG3 A;  2VT2 A;  1VFC A;  3G6E I;  4AIH A;  2D5V A;  2CUZ A;  1O4X A;  5HNF A;  4PFO A;  1SFE A;  4RAF A;  2NRA C;  1OJL A;  3BR1 A;  5E17 F;  3PPB A;  1W5T A;  3FMS A;  4XIC A;  4C30 A;  3DP7 A;  2Z5U A;  4I09 A;  1J75 A;  2CG4 A;  4M6Y A;  5LRR A;  2O8K A;  1MH3 A;  1DDN A;  2EH3 A;  4HDV A;  2PMZ N;  1T95 A;  1ZG1 A;  4I0A A;  5HLT A;  1VZ0 A;  1S5L C;  4ZYE A;  1W7P B;  4UNO A;  4ZYG A;  1SFU A;  4BQN A;  3GCM A;  1K6Y A;  1LDK B;  2FA5 A;  2Y2Z A;  3E3V A;  5KNL A;  4O6J A;  3TW6 A;  2QBY A;  3QP6 A;  3EET A;  1JJ8 C;  3EUP A;  1X1A A;  2R7O A;  2C6Y A;  5J4Y A;  3ZMU A;  2F6C A;  3I64 A;  2Y0S N;  3ZRG A;  3S14 J;  2E5N A;  3T8T A;  1R9T J;  3L00 A;  3J7Y J;  5ILS A;  4OMY A;  3GFM A;  3AG3 H;  1K7A A;  4BJ6 C;  4BUP A;  2KIQ A;  4JYK A;  3PQK A;  3HOX J;  3CCM I;  1IG7 A;  5LGU A;  2HU9 A;  2K7L A;  3LAP A;  2ZCM A;  2FRH A;  5JVG F;  3TDU C;  3LSH A;  2JVH A;  4V2G A;  2GWR A;  1BC7 C;  4Q48 A;  2CQ7 A;  1SFO J;  5C4J J;  4XOR A;  5HS8 A;  1WH5 A;  3FXJ A;  2G7U A;  3N4M A;  2OC6 A;  3RPQ A;  1W4M A;  1WQ2 A;  3P9T A;  2XB0 X;  3M3Y J;  1G3W A;  2JTV A;  1V55 H;  3VVY A;  3HIM A;  2RAS A;  4HNV A;  2V9K A;  5ICE A;  2NVU B;  3CCE I;  1IXR C;  3BHQ A;  3K7A J;  4AC0 A;  3HYI A;  1YW7 A;  3K1M A;  2GXG A;  1H9G A;  4Z6Y A;  4IHS A;  4DBQ A;  2HDW A;  4OMZ A;  2YVE A;  2REK A;  3I4M J;  5AQC A;  3Q9S A;  3J81 K;  3KPH A;  3JRF A;  1WPK A;  2YR2 A;  2IGO A;  2K3F A;  4EJO A;  1FBQ A;  4BAY A;  5FJ8 J;  2Y0M A;  2DOF A;  2CV1 A;  5B66 C;  3PFI A;  3LJL A;  1YQA A;  3S1R J;  3H0D A;  3GZ6 A;  4NHJ A;  1APL C;  1MNE A;  2DLL A;  2V57 A;  5IOY A;  2IS6 A;  2W25 A;  4A3J J;  2X0L A;  1YG2 A;  4RMN A;  3OYA A;  5F27 A;  3M4O J;  3CJR B;  2VJ4 A;  5F04 A;  2KP6 A;  1A5J A;  1B4A A;  4G7H F;  1U6G A;  4XID A;  3K0L A;  2BEO A;  1AKH A;  1X1C A;  4JX6 A;  5AIP A;  5CVR A;  3H9J A;  3CCV I;  2QKL B;  4YEJ A;  2CW0 F;  3CCR I;  3DEU A;  1OFC X;  4UUT A;  1NG6 A;  4KIT B;  3J80 K;  4GGG A;  3K8P C;  1F1Z A;  2EFP A;  2XUB A;  4P9U A;  3WTX C;  1FLI A;  3PO2 J;  1G8X A;  3CO6 C;  3NWT A;  5C44 J;  2IA0 A;  1JKO C;  1RUO A;  1O3S A;  3PQJ A;  3LNQ A;  2DT5 A;  2RN7 A;  4UHT A;  4M3F A;  2DDA A;  2EZK A;  4UVA A;  1YIT I;  4ENK A;  1UMQ A;  1BBY A;  1W5S A;  4BXX J;  3B81 A;  1LFP A;  3IL2 A;  4E7J A;  3E97 A;  3LQR A;  3I54 A;  4JP0 A;  3D5S C;  1WJF A;  3FX3 A;  1VTN C;  3NAR A;  2LP0 A;  4NBQ A;  3PO3 J;  3TO9 A;  2XAS A;  2FML A;  4RGS A;  4U7D A;  1IV6 A;  3T6N A;  3LA2 A;  4NQW B;  3DBR B;  4ZC3 A;  2XF7 A;  2K4B A;  4IHX A;  1A6Q A;  5K5O A;  2V7F A;  1QVT A;  5JLX A;  3OOU A;  4X6A J; 
#chains in the Genus database with same CATH homology
 4Y7N J;  3BCG A;  3COL A;  3JRH A;  4UUS B;  5D19 A;  2W53 A;  1MBE A;  5EF6 A;  4CYC A;  2L9R A;  3BT9 A;  3V78 A;  2R5Y B;  2VUM J;  3S1N J;  3BRU A;  2HOT A;  4CGR A;  5M3F J;  5K7H A;  3GTQ J;  2EZI A;  3HBL A;  4XRM A;  4QTR A;  4NN1 A;  3LSP A;  2M34 A;  3HTI A;  5FKO A;  3OSG A;  2XGE A;  1JKR C;  1SGM A;  2ECC A;  3C2B A;  3HM5 A;  2EBI A;  4W1U A;  1UI5 A;  2O9L A;  3DEW A;  1WGX A;  4M3B A;  4ME9 A;  2G7S A;  5H9T A;  2YU9 J;  5FKN A;  3IH3 A;  3PM1 A;  3TP3 A;  5F0C A;  4A3K J;  4A3I J;  3GTO J;  4MFE A;  1ETO A;  1NK2 P;  1ETQ A;  2JWT A;  1K83 J;  3GTK J;  3PAS A;  2HYJ A;  1GUU A;  2XPV A;  2QIB A;  4RDU A;  3LSG A;  2E1O A;  5E3N A;  4JL3 A;  3HTJ A;  3VUQ A;  3Q0W A;  1UHS A;  2X6O A;  3FK7 A;  2NS7 A;  4CYC B;  4IHV A;  2X48 A;  5FLM J;  5D1R A;  4X6A J;  1QPI A;  2FBQ A;  3S15 J;  2UXI A;  2P81 A;  1HOM A;  1JJ6 C;  2B63 J;  1QRY A;  2HXO A;  2MSY A;  1YRN B;  3E7Q A;  5GPC A;  3GBG A;  5E3L A;  3CDL A;  3HE0 A;  3LOC A;  2R5Z B;  1D5Y A;  3RZD J;  4M3G A;  5F08 A;  4B3A A;  3JRI A;  3RQI A;  2HDD A;  5CXG A;  3UKG A;  5M3M J;  5EZG A;  1W0U A;  2QWT A;  3LHQ A;  4A3D J;  2GFN A;  3ZQL A;  2E2H J;  2K9N A;  2QKO A;  5F0H A;  3ANP A;  5FHP A;  2UXP A;  4MO7 A;  4B4C A;  2TCT A;  1U9N A;  3VW0 A;  4A3F J;  2O7O A;  4UDS A;  3JRE A;  5C4Y A;  2NOG A;  4V2F A;  5CXI A;  3BR0 A;  3RKQ A;  3GTG J;  3GZI A;  2LLK A;  1HLV A;  1ETW A;  2DJN A;  2E2I J;  2JA5 J;  2HXI A;  3JRC A;  2G7L A;  2OF7 A;  3H3V K;  2VKE A;  1FTZ A;  2DG7 A;  2QOP A;  2WAQ N;  3HKZ N;  3O8H A;  1BA5 A;  3FKI J;  2NS8 A;  4AUX A;  1IRZ A;  1GV2 A;  5HBU A;  2COB A;  4GFB A;  4GCK A;  3F1B A;  3IH2 A;  3HOU J;  1TWA J;  2CRG A;  2EZL A;  2ME0 A;  1PUF B;  1YRN A;  3VOK A;  1WCM J;  1TC3 C;  3KKD A;  1JT0 A;  1LE8 A;  4D5F A;  4AF5 A;  3V6G A;  3IH4 A;  1X2M A;  2NVY J;  2H1K A;  2GBY A;  1OCP A;  5HSZ A;  2ECB A;  1BJZ A;  1XG1 A;  4FCY A;  4S0H B;  5FKK A;  2LKX A;  1VND A;  1MBH A;  4EEF G;  2E19 A;  3K2A A;  5IPA A;  3KKC A;  1Q1V A;  2JN6 A;  1UG2 A;  2MG4 A;  3HB9 A;  2WUI A;  3AQT A;  2ELK A;  2QF7 A;  2WV1 A;  3A01 A;  4UUS A;  2PZ9 A;  1NK3 P;  4MK6 A;  5K7F A;  3L1P A;  3S5R A;  3VVX A;  1H88 C;  1MSF C;  1ORK A;  3BR6 A;  3VOX A;  5EGO A;  2R5Y A;  3G1M A;  1U9O A;  4MIM A;  3IV5 A;  2CUE A;  2GEN A;  2DTZ A;  1FIA A;  1NTC A;  1RPW A;  4BBS J;  4YZE A;  2DA6 A;  1RKT A;  2ZCN A;  2CUF A;  1GV5 A;  5J1U A;  1WI3 A;  4BBR J;  2YUS A;  4A93 J;  2JJ7 A;  1QVU A;  1P7I A;  3RZO J;  1ZTR A;  3DCF A;  4BY7 J;  1S7E A;  3B6C A;  3ZQG A;  1HDP A;  2RAE A;  5DAJ A;  4MFD A;  3GTM J;  2N8G A;  4D7M A;  3CJD A;  2G7G A;  2LFB A;  5IOZ A;  3S1Q J;  1TWF J;  4GFK A;  2OER A;  2VPR A;  2ZB9 A;  3B6A A;  3HGY A;  5M5W J;  2DG8 A;  1ETY A;  2DA1 A;  1JTX A;  2DA7 A;  4FTH A;  3F0C A;  2LY9 A;  2ID6 A;  3Q3S A;  2NP5 A;  4DYR A;  4ACI A;  2F07 A;  2Y31 A;  3TED A;  3MVP A;  3A02 A;  4I6Z A;  3FRQ A;  1W0T A;  2KDZ A;  4XK4 A;  3JR9 A;  1VF9 A;  1ZR4 A;  1F36 A;  1ZKG A;  3BTC A;  1ENH A;  2VI6 A;  3QPL A;  4QIW N;  4MLO A;  1XC5 A;  5EGO B;  2AHQ A;  3DPJ A;  2TRT A;  5J1R A;  2VKV A;  3FK6 A;  4GFL A;  3RH2 A;  1RET A;  1E3O C;  5HOD A;  2MW8 A;  1OCT C;  1GDT A;  3WHB A;  3ON4 A;  1TWG J;  4DW6 A;  1B72 B;  2DN0 A;  2ID3 A;  4FIS A;  4M3E A;  1BL0 A;  2IEK A;  2EZH A;  1HCR A;  2K9S A;  2M9H A;  3BG5 A;  3KZ9 A;  1VI0 A;  2ZOY A;  2LK2 A;  2M2E A;  3HTA A;  1P7J A;  2G3B A;  3CCY A;  2H8R A;  3Q0U A;  2DA4 A;  2NP3 A;  3G7R A;  1TWC J;  4G12 A;  1MNM C;  4FE7 A;  2DMT A;  2IBD A;  4A69 C;  3EGQ A;  3ON2 A;  1ZGW A;  3CMY A;  3KNW A;  2Q24 A;  3BR3 A;  2R7Z J;  3NRG A;  2XDN A;  5K7Z A;  3ZQC A;  2UXO A;  2XPW A;  2YS9 A;  1TWH J;  1I6H J;  2DA2 A;  1T33 A;  2DMP A;  3HOY J;  2FQ4 A;  4A3C J;  2M8G X;  3G1O A;  3TW7 A;  5E3M A;  2X9D A;  2L7F P;  3O8G A;  3TP0 A;  3GTP J;  5FKL A;  4RBO A;  1IUF A;  1HF0 A;  1DU6 A;  3IUV A;  4A3E J;  1AU7 A;  3HEF A;  1FJL A;  3BQY A;  2L0K A;  1IGN A;  2XB5 A;  1Z0X A;  1F43 A;  1BW6 A;  3MNL A;  5C4X J;  3RD3 A;  3VW2 A;  3BG9 A;  1JTY A;  4A3B J;  3CRJ A;  3S1M J;  3I4N J;  2Y9Y A;  3SJM A;  1FEX A;  2QCO A;  1I50 J;  3NXC A;  1MBF A;  2HQ5 A;  4DYQ A;  5IP6 A;  5IP7 J;  5M5Y J;  4L62 A;  1MBG A;  9ANT A;  1JUM A;  1JKQ C;  3QBM A;  3OIO A;  5EG0 A;  3FIW A;  2CU7 A;  3JRD A;  5J3L A;  3S16 J;  1JUS A;  1SAN A;  5F0F A;  3JSJ A;  4M6V A;  4A3M J;  1ZQ3 P;  3A01 B;  4Y52 J;  5FMP A;  2UXH A;  1EF4 A;  3JRG A;  2Y30 A;  2LTP A;  3BNI A;  3SDG A;  1FIP A;  5CW8 A;  5EZH A;  2FJ1 A;  5EEA A;  1FTT A;  3CWR A;  5DTD A;  2DA3 A;  1GVD A;  1JT6 A;  3W6V A;  1B8I A;  1T56 A;  1IC8 A;  3JRA A;  2FX0 A;  2EQR A;  3BG3 A;  2ME6 A;  1VFC A;  2R0Q C;  2D5V A;  4X1E A;  1O4X A;  1I3Q J;  1RKW A;  3ANG A;  1ITY A;  1OJL A;  3BR1 A;  5F1J A;  4PXI A;  3PPB A;  3Q0V A;  4XIC A;  3VW1 A;  1A6I A;  3AQS A;  2O8K A;  4XRS A;  1MH3 A;  5HAW A;  2EH3 A;  2XPU A;  2PMZ N;  5IP9 J;  2HOS A;  4L5E A;  2MGQ A;  3HGG A;  1X2N A;  5EG0 B;  4M3D A;  3BQZ A;  2RHA A;  3VIB A;  4JKZ A;  3BTL A;  1MBJ A;  3NPI A;  2Y2Z A;  2XRL A;  4AYB N;  2NVT J;  5FGL A;  3QPS A;  3EUP A;  3TW6 A;  2ZCX A;  1JJ8 C;  5E3O A;  3HOZ J;  3GEU A;  2CJJ A;  2Y0S N;  1Y1V J;  3BTI A;  4DYC A;  5DS9 A;  4IHW A;  3S14 J;  1R9T J;  2LR8 A;  3HOX J;  4JYK A;  1JGG A;  5D18 A;  1IG7 A;  1B72 A;  4C2M J;  2XGD A;  5M5X J;  2ZCM A;  4W97 A;  3JRB A;  3HOW J;  2K9Q A;  2R92 J;  1IDZ A;  1RR7 A;  1ETV A;  4V2G A;  1IDY A;  3SFI A;  4C3J J;  4GCT A;  4NEL A;  3VVZ A;  1MH4 A;  2E2J J;  1SFO J;  3WHC A;  5C4J J;  3GTL J;  3E7L A;  5J1Y A;  5BNG A;  1WH5 A;  1WH7 A;  2R93 J;  2K40 A;  4JNN A;  2JA7 J;  3BR2 A;  2HKU A;  1Z77 A;  3P9T A;  3HTH A;  3CQZ J;  2XB0 X;  3M3Y J;  3MN2 A;  3NAU A;  4B1R A;  3VVY A;  4DZP A;  3HIM A;  2RAS A;  4AC6 A;  4HNV A;  2W48 A;  4J19 A;  1H8A C;  3ZQI A;  3BHQ A;  3FIS A;  2KT0 A;  3K7A J;  4LOC A;  4AC0 A;  1Y1W J;  3LWJ A;  4JX4 A;  5K58 A;  2JA8 J;  1POG A;  2QTQ A;  4BY1 J;  2XGC A;  3S2H J;  2YVE A;  1LFB A;  2REK A;  3I4M J;  1IJW C;  5AQC A;  3S17 J;  1H89 C;  2IAI A;  1JKP C;  1BW5 A;  4KWA A;  4FE4 A;  4QSH A;  3JRF A;  1WPK A;  2O7T A;  4IEJ A;  2JMW A;  4BKX A;  5FJ8 J;  3QQA A;  3LSJ A;  3LJL A;  2M0C A;  3S1R J;  4ICH A;  2FD5 A;  2WB1 N;  1APL C;  4NDL A;  1AHD P;  2V57 A;  3MKL A;  2HOA A;  3ZOB A;  5IOY A;  5JLW A;  3D1N I;  4A3J J;  1CQT A;  2I10 A;  1U78 A;  2JA6 J;  1GT0 C;  3M4O J;  5F27 A;  1ETK A;  4D7N A;  3NNR A;  5F04 A;  2OPT A;  5IYB J;  4D5C A;  2R5Z A;  2PBX A;  1A5J A;  2NVX J;  4IHY A;  4XID A;  1AKH A;  5GPA A;  1HDD C;  4JX6 A;  2ZOZ A;  3HDD A;  1MSE C;  4C3I J;  4GCL A;  3G1L A;  4I76 A;  5EFY A;  2HI3 A;  1OFC X;  4UUT A;  2GM4 A;  3VPR A;  3A03 A;  2D6Y A;  1X58 A;  2GLO A;  1B8I B;  1ZR2 A;  2WGB A;  3BJB A;  2HYT A;  2CQX A;  3PO2 J;  2LD5 A;  5C44 J;  2LVS A;  2JK3 A;  1JKO C;  3O60 A;  5EDN A;  3OSF A;  3LNQ A;  1ETX A;  4M3F A;  2GUH A;  2EZK A;  2XSD C;  3BR5 A;  2L7M P;  2DA5 A;  1K61 A;  2NVQ J;  2L7Z A;  4MXM A;  1U8B A;  4A3G J;  1UMQ A;  4BXX J;  2YVH A;  4JX5 A;  4A3L J;  2IU5 A;  3B81 A;  2Y9Z A;  3GTJ J;  3BTJ A;  5IYD J;  4JP0 A;  1PUF A;  4DZJ A;  3G56 A;  5C3E J;  3NAR A;  2LP0 A;  4XRS G;  1LE8 B;  3H0G J;  5FLV A;  3PO3 J;  4HKU A;  1AKH B;  1XS9 A;  2NX4 A;  3T6N A;  4C3H J;  3LSR A;  2CQQ A;  2DMU A;  2DMQ A;  1IV6 A;  2DMN A;  2UXU A;  5EYR A;  1JUP A;  1LFU P;  3S2D J;  1RES A;  5FKM A;  4IHX A;  1UI6 A;  3C07 A;  1DU0 A;  1G2H A;  3ZQF A;  3QKX A;  3VP5 A;  3HOV J;  3ZQH A;  2G0E A;  1MBK A;  1QVT A;  5IYC J;  3NI7 A;  2AO9 A;  5GP9 A;  2OI8 A;  5JLX A;  4ABZ A;  3OOU A;  1ZK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...