3C2BA

Crystal structure of tetr transcriptional regulator from agrobacterium tumefaciens
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
203
structure length
200
Chain Sequence
SPRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAMITFQQSKVRTFEKAGDRVSAPQLADHLEVFAHDLLDVLAGDVSLALNRLAIGQASRKLGDLLLERGRRQIDRRARGLIEAGRRSGYLRFDDAEEAYRSFYGLIVSDLHVRMLLGEAPDKDFSARAKKAVVAFLTLYGTEKVHSELGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of TetR transcriptional regulator from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
total genus 68
structure length 200
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14246 TetR_C_7 AefR-like transcriptional repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3c2bA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3c2bA02
3NRGA 1LFUP 1TWFJ 1GV5A 3JRBA 1JTYA 2CRGA 2DA7A 3BCGA 3JRFA 1ETXA 1DU6A 1JT0A 2W53A 1IC8A 2ME0A 2V57A 5J3LA 3IV5A 4BBSJ 1Z77A 2O7OA 1QRYA 3KKDA 2R93J 3IH3A 4CGRA 3JRIA 5M5YJ 3VW0A 2GENA 5FKOA 4X1EA 5CW8A 1OJLA 1Y1VJ 3QPLA 5EGOA 2QIBA 2WAQN 3A01B 1IG7A 4I76A 4M3GA 1T56A 2ID6A 4G12A 4KWAA 4FTHA 3BR0A 4FE7A 2DA4A 3ANPA 4ICHA 3QPSA 1NK2P 4C3IJ 5HAWA 5DAJA 4M3FA 3HDDA 3T6NA 3HGYA 5M3MJ 1JKRC 4Y7NJ 2OERA 3HOXJ 3GZIA 1AU7A 5EZHA 3Q0WA 3COLA 5F04A 2DMPA 1IRZA 1JT6A 3GTOJ 2QF7A 3HKZN 3BTLA 1HDPA 1P7IA 1ZGWA 3HOUJ 2LD5A 1AHDP 1VFCA 3WHCA 4JX6A 2DJNA 5C4JJ 1ETQA 3QBMA 1IUFA 1JUMA 3ZQCA 3K7AJ 1IDYA 3LJLA 1RESA 4A3LJ 3JREA 1K61A 2MSYA 4S0HB 2GM4A 1VI0A 3ON2A 1GDTA 1OCTC 3OOUA 3CDLA 4XK4A 3S17J 4M3EA 2DA3A 1AKHA 1S7EA 2X9DA 3O8HA 3S2DJ 2QTQA 3PPBA 2K40A 3FKIJ 3IUVA 5EG0B 3HE0A 5EFYA 2XGEA 2OI8A 2JWTA 4L62A 2MW8A 4GCLA 4IHYA 2H1KA 2VKEA 2NS8A 3JRHA 5IOYA 2M34A 3RZOJ 2CUEA 3RZDJ 2G7LA 3BQZA 4NDLA 3LSRA 4YZEA 3VW2A 5F08A 1GUUA 3ZQIA 4JL3A 3TP3A 3O60A 3CRJA 5F0CA 2RHAA 1OFCX 2QWTA 1IV6A 3FIWA 2HOAA 3E7QA 1B8IB 1WGXA 2Y9ZA 2HQ5A 3E7LA 2ELKA 5FGLA 4D5CA 1ZTRA 2JA6J 4Y52J 1U9NA 2Y0SN 4AF5A 4DYQA 2UXPA 3TW7A 9ANTA 3MVPA 2MGQA 1B72B 3WHBA 3F1BA 2RASA 1MBEA 5IP9J 3B81A 3NI7A 1RETA 5E3LA 2FD5A 1ZR4A 3CJDA 2LTPA 3ANGA 3BG9A 4C3JJ 4MK6A 1CQTA 3QQAA 1A6IA 2FQ4A 5GPAA 2L0KA 3S1NJ 2UXOA 4JNNA 3CCYA 2ME6A 2XGDA 1Q1VA 2WV1A 1TWGJ 2R5YA 3ZOBA 1O4XA 5FHPA 3VVZA 3S2HJ 5D1RA 1QPIA 3NNRA 2VI6A 4A3MJ 1A5JA 2ZOYA 4D5FA 3HM5A 1SANA 4D7MA 1IJWC 3BR6A 2TRTA 2DMNA 1MBHA 1UMQA 4QSHA 5F0HA 4A3DJ 2YU9J 4MFDA 2JA5J 3PASA 3BG5A 5C4YA 2CQQA 3Q3SA 1FJLA 4XRMA 4DYCA 1B8IA 4A3FJ 4V2FA 2IU5A 1JUPA 3MN2A 2PZ9A 2DTZA 3HOYJ 4XIDA 3BTJA 1MSFC 2DMQA 4NELA 2EZIA 2XDNA 2WUIA 4A93J 3V6GA 1XG1A 4L5EA 3JRAA 1LFBA 3LHQA 2K9QA 2HKUA 2YVHA 3GBGA 2UXUA 3KZ9A 1IGNA 2Y30A 5EZGA 2IBDA 1IDZA 2R92J 2GUHA 4IHVA 3P9TA 2UXHA 1QVUA 2DA2A 2Y2ZA 1X2MA 1BJZA 2I10A 3HIMA 3HTIA 2LP0A 5JLXA 2NP5A 1P7JA 3JR9A 4DYRA 1ZR2A 1AKHB 2MG4A 1PUFB 3DPJA 1HOMA 1BW5A 3EGQA 2VPRA 3VIBA 5EF6A 3GTPJ 2ZCNA 1JUSA 2NP3A 2ECBA 4BBRJ 2AHQA 3A02A 1Y1WJ 3PO2J 3NARA 1MBJA 3ON4A 3TEDA 3G56A 3OSGA 3OIOA 5EG0A 3BR1A 2FBQA 4M3BA 5FKNA 5F27A 4DZPA 1SFOJ 1H89C 2GBYA 1LE8A 1POGA 4A3CJ 2EQRA 3VP5A 3VOXA 4GFKA 5FLVA 3O8GA 3GTLJ 4MFEA 2ZOZA 3FK6A 3S1RJ 2D6YA 4GFBA 2LK2A 5E3MA 5K7HA 3C07A 2E1OA 3GTKJ 2DA1A 3BRUA 1RKTA 1JJ6C 3KKCA 1GV2A 3TP0A 2EH3A 3SJMA 2LY9A 2X48A 2RAEA 1MNMC 2DA6A 2CQXA 2E2IJ 2Q24A 1I3QJ 3HTAA 2JMWA 5K7ZA 2TCTA 4FE4A 1NTCA 2HXOA 2G3BA 2QCOA 5DTDA 4BY1J 2VUMJ 3SFIA 4C3HJ 1ORKA 4JX4A 4JX5A 1VNDA 3BR3A 2ZCXA 2YUSA 3JRCA 3MKLA 1TWCJ 1FTZA 3BT9A 1X58A 4MIMA 1HDDC 1H8AC 3VW1A 1XC5A 2YVEA 1SGMA 4DW6A 5F0FA 2ECCA 5JLWA 2XB0X 3PM1A 2COBA 1JKOC 3QKXA 2FJ1A 2W48A 3G1MA 4A3IJ 3S1MJ 1FIPA 1UI5A 1FIAA 1E3OC 4ME9A 2NX4A 1BL0A 2E2HJ 2HI3A 2K9SA 5F1JA 2N8GA 3S16J 4ACIA 3HOVJ 2H8RA 4IEJA 5J1RA 4BKXA 1H88C 2JK3A 4FCYA 5K7FA 3ZQFA 2YS9A 1U9OA 3AQTA 4D7NA 1HLVA 3PO3J 2O9LA 4A3JJ 2D5VA 5CXIA 3S1QJ 4I6ZA 4RDUA 3B6CA 5E3NA 3LWJA 2CUFA 4ABZA 2OPTA 1MBGA 5J1YA 3RKQA 1ETYA 2KT0A 1FTTA 1UI6A 1Z0XA 5C44J 5BNGA 2HOTA 2NVTJ 2R5ZA 3BHQA 1LE8B 4UUSB 1MBFA 1ZQ3P 1BA5A 5M3FJ 1MH4A 2DG8A 3VPRA 4V2GA 4M6VA 1W0UA 5M5WJ 5HBUA 3HBLA 1WH5A 5HODA 3DCFA 4J19A 4X6AJ 3V78A 4RBOA 4W97A 3IH4A 1X2NA 1WI3A 3HB9A 5E3OA 2G7GA 1TC3C 1ITYA 3GEUA 4AUXA 1ZK8A 4B4CA 2DMUA 5C3EJ 3ZQLA 3G7RA 3HTJA 2K9NA 3FRQA 2L7ZA 3EUPA 2ZCMA 1F36A 4AC6A 1WH7A 3LOCA 2REKA 3FISA 2LR8A 3BNIA 5EDNA 3GTGJ 3HGGA 2IAIA 1APLC 3JRDA 4C2MJ 4HNVA 4GCKA 1TWHJ 4CYCA 5IP6A 3HTHA 4IHWA 5AQCA 3DEWA 2ID3A 3F0CA 1XS9A 1R9TJ 4HKUA 4UUSA 3I4MJ 1PUFA 2JN6A 1K83J 2NVYJ 2XGCA 4DZJA 4GFLA 4A3GJ 4FISA 2PBXA 3G1LA 5K58A 5J1UA 4QIWN 4AC0A 2UXIA 5FLMJ 2G0EA 4A3KJ 3SDGA 5C4XJ 2E19A 5DS9A 2QOPA 3RD3A 3D1NI 1ZKGA 4UUTA 3HOWJ 4W1UA 1JKPC 3NPIA 2LKXA 3G1OA 4JYKA 3GTJJ 3A01A 1YRNB 4M3DA 2L7FP 4JKZA 1I50J 3W6VA 3GTMJ 1MH3A 1MSEC 5EGOB 3B6AA 5D18A 2WB1N 4XRSG 1UHSA 3NAUA 5IYBJ 4XRSA 3LSJA 5EEAA 2XPVA 3BG3A 2HYTA 2R5YB 2EZKA 1U78A 3UKGA 1RKWA 2LVSA 1GVDA 4XICA 3BR5A 3S14J 3CWRA 4PXIA 3S5RA 2CJJA 2LFBA 5IOZA 1F43A 3VVXA 3IH2A 1YRNA 1WPKA 4QTRA 2OF7A 1RPWA 3BR2A 1D5YA 4A3EJ 4B1RA 2Y9YA 2EZLA 1W0TA 4GCTA 2NOGA 2PMZN 1TWAJ 3H0GJ 4BY7J 1HCRA 2GFNA 2QKOA 2E2JJ 4NN1A 3Q0VA 5IYCJ 2LLKA 3M3YJ 2WGBA 1UG2A 5H9TA 2HXIA 2XPWA 2R7ZJ 2AO9A 5M5XJ 4LOCA 3HEFA 1BW6A 1EF4A 5FMPA 2JA7J 2L7MP 1B72A 2DMTA 5FKMA 1JGGA 1RR7A 2M2EA 2XSDC 4A3BJ 3LSGA 3A03A 1I6HJ 3AQSA 2P81A 2XB5A 3BTCA 2IEKA 1U8BA 2XPUA 2X6OA 1DU0A 3CMYA 5IPAA 2FX0A 2GLOA 4MLOA 1JTXA 1OCPA 2JA8J 3C2BA 2KDZA 1ETOA 1ETWA 3M4OJ 4IHXA 3ZQHA 3VVYA 2EBIA 2M8GX 2F07A 4AYBN 5CXGA 3H3VK 3GTQJ 2L9RA 4A69C 5IP7J 1HF0A 2O7TA 5IYDJ 4CYCB 3HOZJ 2NVQJ 3ZQGA 3VUQA 1NK3P 3VOKA 4UDSA 3BTIA 4MXMA 3LNQA 2O8KA 3JSJA 1ETVA 4JP0A 1T33A 1QVTA 2R0QC 5FKKA 3L1PA 5FKLA 1GT0C 1VF9A 3S15J 5D19A 3MNLA 2M9HA 2R5ZB 3K2AA 3FK7A 2G7SA 5EYRA 3NXCA 3Q0UA 1JKQC 3RQIA 3LSPA 2HOSA 3I4NJ 5GP9A 4EEFG 5HSZA 2DN0A 2JJ7A 4B3AA 2B63J 3BJBA 2M0CA 2Y31A 2CU7A 3CQZJ 2DG7A 3KNWA 2NVXJ 2XRLA 5FJ8J 2VKVA 3BQYA 3JRGA 1WCMJ 5GPCA 2DA5A 3OSFA 1FEXA 2NS7A 1JJ8C 4BXXJ 1MBKA 2ZB9A 3RH2A 1ETKA 2EZHA 1G2HA 3TW6A 1ENHA 4MO7A 2HDDA 2HYJA
chains in the Genus database with same CATH superfamily
4PFPA 2PLYA 5LGNA 1TWFJ 2Q2EA 5J4VA 3L2VA 3CCVI 4AIKA 2CRGA 2DA7A 2PBIA 3JRFA 1U8RA 4WXDA 4UVBA 4I09A 1P4WA 3RQ4A 1JT0A 2ME0A 2V57A 3OYCA 2IA0A 1JE8A 2R93J 5M5YJ 4HF2A 4OOIA 5FKOA 2E5NA 3W2AA 1TNTA 1P6RA 1Y1VJ 2FBKA 2XUBA 4HX8A 3SZTA 3QPLA 2UUZA 4H4KC 2EB7A 5K5RA 2WAQN 3H9QA 3HJEA 4DQ2A 2HEOA 3VWBA 4G12A 4KWAA 4XN3A 3BR0A 5BPIA 2DA4A 4O6JA 3GWZA 4ZDLA 2ISZA 3QPSA 1YLFA 3BZ6A 4E7IA 5TRDA 5HAWA 2BE5F 5E8IA 5DAJA 3ZMDA 1MNDA 2EINH 2BXYA 3L00A 4B09A 2G7UA 3HOXJ 3GZIA 2ZMEA 1KYZA 3COLA 4CCOA 1NG7A 4IKFA 2BY3A 3GTOJ 2QF7A 3BTLA 3L2RA 2XKOA 1ZGWA 4HDUA 2PQ8A 3FXRA 1BR4A 3PNTA 3T8TA 2K9LA 5J8FA 1EH6A 1V54H 1EA3A 4Z6YA 3I56I 2DK8A 1S6LA 3K7AJ 4FQGA 3WU1B 4EGYA 4E7KA 1U5TC 1FP1D 2KRCA 4FHTA 3CUQC 1QPMA 4RA2A 1DPRA 1P2FA 3EYIA 3QU3A 5HNFA 5FROA 2VKHA 2X9DA 5CKTA 3IKTA 3S2DJ 3OMYA 3P9KA 3IUVA 2XRNA 4MHGA 5BMZA 3HE0A 2EWNA 2XGEA 1XDSA 3MQ0A 5HLHA 2NS8A 2M34A 4PDKA 2CUEA 5FFZA 2GIVA 3ZMVA 2V1NA 1BIAA 4L0ZB 1LB2A 4HV5A 1FYLA 1GUUA 1SD7A 3G4SI 1R4MB 4IVNA 1RC9A 1Z91A 3MMYB 4XL9A 3O60A 2LYCA 1Y39A 1I6XA 4LG3A 4M72A 2P6TA 4XMYA 1UZCA 4NC7A 2X51A 3BJAA 1QQIA 4HLYA 3WODF 5CVVA 3HZJA 2VJ4A 1R4NB 2IGKA 1RI7A 1B8IB 2ZBKA 3KE2A 2HQ5A 1VQ4I 3F72A 3K4MA 4D5CA 5J4YA 3CC4I 5FGLA 1ZTRA 5LHHA 1SD5A 2UXPA 1D1BA 3AL0C 9ANTA 2GOMA 3MVPA 1FSHA 4I99C 3F1BA 3PQJA 4RLFA 1ACIA 3NI7A 3B81A 1RETA 5E3LA 2R7DA 2FD5A 4UY8I 4D9JA 2LTPA 5B3SH 3SZPA 4C3JJ 3L2CA 4MK6A 3KEOA 4JNNA 4HEA2 4EM0B 1ZLKA 3GEZA 3V8LA 2FJI1 2ME6A 4CSWA 3ZOBA 2LH9A 1A5JA 3TL4X 3HM5A 3J80Z 2IPQX 2OZUA 1OCRH 1X1DA 3SQNA 2JA5J 1ZRCA 3DBRB 4N4OB 3KP7A 4IJAA 2DT5A 1EH7A 4CA0A 4DYCA 1AWCA 2WAQA 3MN2A 5BPDA 2DTZA 2ZCWA 3G71I 4NELA 3ABMH 1SFKA 1U2WA 2EZIA 2XDNA 3K6GA 2WUIA 3V6GA 2VBWA 1EH8A 2RQQA 3LHQA 3KP4A 3LMMA 1X1AA 1HW2A 1T98A 3LFKA 1IDZA 2IT0A 4XLNF 5D8KB 5LRSA 2R92J 4AVZA 1X2MA 3HIMA 2NP5A 3EYYA 2XAHA 5GAGJ 4EJVA 2JPCA 2MG4A 1LNWA 2W85A 1BW5A 1Z6TA 5EF6A 4U9LA 2VPLA 1K7AA 3PSFA 2NP3A 2ZCNA 2HZDA 1JHFA 2V6CA 4DGWB 2AHQA 4XNFA 3VYUB 2KIUA 1BI0A 3K4KA 4RAZA 2Q1ZB 2K7LA 2ZJ2A 4M9SA 1ZRFA 4YELA 3PUFA 3DF8A 4HSTA 2IW5A 2JRTA 4M3BA 1H89C 1SFOJ 1IXRC 3VODA 4RLQA 4YFNF 1WZ2A 2E35A 2CH0A 3VYRB 4GFKA 3GTLJ 2M45A 3CTAA 3FZVA 1ONVA 2R7FA 4MFEA 1S29A 3VYTB 3S1RJ 2GXBA 1X1BA 3BZCA 4LK0F 4GFBA 2LK2A 4FX0A 2Z1DA 2E1OA 2JVHA 3QU6A 1JJ6C 2P0WA 1ZH5A 4HG2A 3KKCA 1GV2A 3HRMA 3SEQA 4O5VA 3SEZA 2XAQA 1MNMC 2MBFA 4NC6A 1VZ0A 4C2UA 4EVIA 3MKYB 3M7GA 5CYVA 1DPUA 3TMOA 1ZN2A 4C3HJ 2XSJC 2VB6A 4JX4A 2K4JA 3KZZA 2HQRA 1TWCJ 3ZGKA 2L02A 2DPDA 3WGIA 1HDDC 3RIRA 1XC5A 4X0GA 2M0MA 2R7QA 1SGMA 2GA1A 1YTYA 4BS9A 5F0FA 2ECCA 1R5ID 1O3RA 2M30A 3LSTA 2FU4A 1JKOC 1W36C 4BEHA 2BEOA 2HI3A 5HDGA 1IRGA 1AOYA 2N8GA 5JHFA 2A69F 4JBAA 3LSHA 5LLQA 3J7AY 1XPXA 1H88C 2KISA 1HQCA 2EFPA 1HLVA 3PO3J 2D5VA 1TZLA 2QSGX 2KZVA 4EATA 3B6CA 2CUFA 1MBGA 3RKQA 2FQ3A 1ETYA 1K78A 4ZH4F 1WJAA 1Z0XA 2FBHA 5BNGA 1FTTA 1UI6A 3CCJI 4P1WA 2YVXA 1LE8B 1MBFA 5KNLA 1ZQ3P 3ONQA 2DG8A 3RSNA 4LLNA 1WRJA 1XMAA 5HBUA 5HODA 2ZJQF 3BZKA 5B5EC 4G7ZF 1F1ZA 4RBOA 4W97A 2STTA 4CDGA 4LG0A 5E3OA 3Q9SA 1IXSB 1ZG5A 4B4CA 2IGOA 1TQMA 3ZQLA 4BYYA 1VQPI 2RDPA 4Y3OA 3FRQA 3EUPA 3DPLC 3K4JA 3FXOA 4O3MA 5LHIA 5EDNA 1APLC 1D1AA 2XAFA 1CF7B 3ISPA 2JUCA 3SHFA 1DQUA 2LMDA 4GCKA 1KZHA 5IP6A 3PJRA 3K0LA 2RC4A 1H9GA 5CVUA 2F48A 2DI3A 3CP2A 3I4MJ 4R8HA 3K8PC 1WJDA 4GFLA 1L0OC 3F8CA 1JXSA 4UB6C 4FISA 2M3AA 2PBXA 4KMUX 3E5XA 2M1BA 1YJNI 2QSFX 1SC7A 4NNJA 2UXIA 3TOBA 4ZZDA 1IRFA 1T8IA 1YX3A 5DS9A 3RD3A 4BNCA 5IY5H 2D1HA 1ZKGA 4UUTA 1V4RA 1NHAA 4AYBA 3NPIA 3Q5FA 5AIPA 2ZFWA 2HOEA 3G1OA 4JYKA 2XC7A 1YRNB 3W6VA 5EGOB 4KIFA 5D18A 4BHBA 4XRSG 3BOQA 2BOLA 4BJ6C 2F5FA 3I9V2 2HYTA 2CG4A 3ABLH 4B48A 2EZKA 2CW8A 3L2WA 2LY2A 3GCMA 2FOKA 3CJTB 2L7KA 1YS7A 2F5DA 2CJJA 3U9GA 5IOZA 2IP2A 1XTAA 1YRNA 1WPKA 2H1LA 5CQGA 1RPWA 2FNPA 2XKPA 1ZREA 4OINF 4XLAA 4A3EJ 1W5CC 4GCTA 3VSLA 3HG9A 2F4MB 2UV1A 3Q0VA 5CJ9A 1K4SA 4F92B 3E1SA 2R7ZJ 4ENNA 3HEFA 3OYFA 1BW6A 3CF2A 4RGRA 2FMLA 1MMAA 2WADA 2NNYA 4MGRA 1MDMA 2JA7J 2VOPA 2QKLB 3OYHA 2DMTA 4BDYA 1JGGA 1RR7A 1MNEA 3LSGA 3A03A 2O03A 5IT9Z 2V1UA 2XV4S 3HSEA 2FEZA 4ENKA 2X6OA 2HZTA 1OISA 5FB2A 1FOWA 1X19A 1GXQA 2QVOA 3E6DA 3CJRB 1ZLJA 1W1WE 2BXZA 2P7VB 4MQ9F 1S7AA 3WTVC 3GW2A 4LB6B 4KISA 4L5IA 3VDXA 4OIOF 4IL6C 3CD6I 3K4NA 1TNSA 2YPRA 2M8GX 4CCNA 2F07A 4AYBN 3IRQA 3JTHA 5CXGA 3AAFA 3D0SA 4HQEA 2O7TA 1HF0A 4XKVA 2JT1A 5FO5A 3VUQA 2ZXJA 1YG2A 3BTIA 4KT5C 2ZO4A 5HDNA 1ETVA 5E20A 1SVMA 4ZDPA 2R0QC 2OV7A 3OR2C 2KL4A 2M8EA 4XOPA 5FKLA 1GT0C 1YE9A 2IVMA 5D19A 3MNLA 5E79C 2MFZA 3QPHA 1VQ5I 5EYRA 3Q0UA 2RREA 2DBBA 3VOEA 2DT7B 1USTA 3KP6A 5CVRA 1IAWA 2CFOA 2V4JC 4XR6A 5GP9A 2DN0A 1E3PA 2JJ7A 1W7PA 1SD6A 1VQLI 2CU7A 3CQZJ 4CCJA 3OS1A 2KRFA 5FJ8J 3JRGA 2A61A 4RB1A 5D5WB 1SFUA 1WSUA 1STZA 2UXNA 2DA5A 1FEXA 3DBHB 4MTEA 4LD5A 1MBKA 3K1NA 1K6OA 3K2ZA 2EZHA 3OYIA 1A31A 4Q47A 2ZJPF 1O7LA 3LQQA 5KVRA 4A0YA 4BJ5C 1FPQA 1PJRA 1WQ2A 3HRTA 5A2QZ 2L54A 4FX4A 1Y8QB 3KIOA 5ICCA 2MLKA 1OR7A 2PX9A 2P5VA 1JTYA 2OTJI 2BZTA 4DJAA 3OYKA 1ETXA 2WTEA 3KZIC 5L3FA 3ELKA 3EUKL 1DU6A 1QO0D 5EEGA 4AIJA 4M74A 3WTZA 1Z7LA 4BBSJ 1Z77A 3M9AA 1BI3A 3CLOA 4RM2A 2L2OA 4CGRA 3VW0A 3SXYA 2X6YA 3N4MA 2GENA 2M4KA 5CW8A 1OJLA 5H6QA 2Y69H 2EA4A 5HLGA 3A01B 1BJAA 1IG7A 4J01A 3ZP5A 1AA7A 3L7WA 4L9NA 3WGHA 1QBJA 1BC8C 4ICHA 4CZZA 2KFDA 3OYJA 4KA4A 1NK2P 3CC2I 4M3FA 4YIFA 1SMYF 3T6NA 3WGGA 2D1VA 4Y7NJ 2OERA 3HL2A 4BHCA 1AU7A 2PMUA 5DD8A 2VL8A 3HKZN 1P7IA 2H09A 2E60A 3SFZA 3FKJA 3LAPA 3CMAI 4JX6A 4HV6A 4ZTFA 2Q8KA 2MC4A 4C9YA 1PVEA 1JUMA 2H6CA 2KP6A 2NXNB 4NC8A 4FASD 3MKWB 4PCQA 1TW3A 1RESA 2MD5A 4A3LJ 3KCCA 4FETA 5LHGA 3JREA 2QA4I 3E6BA 1O57A 1X3ZB 1OCTC 3CDLA 4XK4A 4M3EA 1HA8A 1AKHA 1S7EA 3O8HA 3G2BA 4U7DA 5JR3A 1QHHD 3FKIJ 4PJLA 5EFYA 2A5YB 4PJNA 2H6BA 1LJ9A 4A5MA 2CV2A 3PUBA 4GCLA 3BPXA 1WI9A 2VKEA 1D8JA 3FXLA 2FNAA 3RZOJ 1FOKA 3RZDJ 3IAM2 4G7OF 3IL2A 3B73A 2WA0A 4YZEA 3VW2A 5F08A 1Y0NA 1SAXA 3TP3A 2NAZA 3CCEI 3CRJA 5F0CA 1MD0A 3F8NA 1XGOA 2LG4A 1OFCX 2O8XA 3K9TA 1KYWA 3I71A 1XDUA 5GAHJ 3DP7A 4LITA 2E36A 4AF5A 2GAUA 1XGNA 3R4KA 3RPUA 3TW7A 2HKOA 2MGQA 3E5UA 1B72B 1YIOA 2LRDA 3IUOA 3P5JA 2BY2A 2V7FA 4M73A 1ZR4A 4AU7A 2A3SA 1YJWI 4Y15A 3WG7H 1FBSA 1UFMA 1FZPB 3CUQA 1A6IA 3DEUA 3QQAA 2GXGA 4LJZF 5GPAA 3OYDA 4AM3A 1FBUA 4F55A 2A6HF 2XGDA 4P55A 1O4XA 3VVZA 3CJNA 3JAMK 4L5JA 3S2HJ 1QPIA 3NNRA 2VI6A 2A6EF 2ZOYA 1TW2A 1HSJA 4JOMA 1SANA 4D7MA 2FOWA 2TRTA 2RKHA 3CCLI 3BG5A 4J00A 2E1MC 3GXOA 4BUPA 4XRMA 3DU6A 1GLNA 1YIJI 4V2FA 1J59A 3JAMZ 4RAFA 3EDPA 1FY7A 1HKSA 5K1YA 2DMQA 1R1UA 1MGTA 2W24A 4L18B 3DXJF 2BW3B 4LLLA 1TTYA 3SDBA 3CC7I 4L5EA 3U2RA 4M9XA 4BE0A 1W7PD 1OLTA 2QGUA 3AG1H 2DT6A 1SAUA 1LFBA 2K9QA 2ACJA 2KQRA 3ECOA 3KZ9A 1G3YA 2A05A 3UNGC 3JSPA 1XMKA 5EZGA 2KJBA 2GUHA 2JZYA 4HNTA 3GLLA 3P9TA 1FLIA 1Z67A 2DA2A 2R3SA 4HYEA 2W82A 5HDKA 1P7JA 1XGSA 2K5CA 2YX4A 1PUFB 2EFNA 3DPJA 1SFXA 1RNLA 1HOMA 2VT3A 2EFQA 3WE3A 2K27A 1T95A 2E1NA 3QP6A 3PO2J 2J5OA 3ON4A 4IOAF 4CO8A 1Z7UA 1YFHA 3G56A 5LD2C 5E8GA 1VQ8I 4RGSA 2MYSA 3E0JB 2GBYA 3FHZA 4PK4A 1POGA 2HNHA 3NWTA 2DTRA 4AIHA 5FLVA 3PNVA 3DPTA 3O8GA 4KJZA 4Q5SF 2IS2A 4BHPA 1ULYA 2ZOZA 3DLLF 2ZKZA 3DFGA 3QP5A 4L9VA 5L3EA 3C07A 3VEPA 3GTKJ 1KQ8A 4EM2A 5K5QA 3TP0A 1V5FA 1FT9A 4BAYA 2RGVA 4HPQA 4WCGA 4AIDA 3C2GA 3K4CA 1I3QJ 1YQAA 2XVCA 2GWRA 3DPUA 1FYMA 2G3BA 2QCOA 1S72I 2K3PA 5KCMA 2HYFA 4BY1J 3H5RA 2EV6A 2XROA 3E6CC 2VUMJ 4EGZA 3FM5A 2XF5A 4M71A 1W5TA 1VNDA 3BR3A 2RVCA 2ZCXA 1O3SA 3ERED 5IT9K 2MABA 3BT9A 4XM3A 4IO9F 3ML6A 1HW1A 3RI4A 2Y0MA 2E34A 4G6TB 4IPAA 4G6DA 4I7HA 2H94A 2XB0X 3HTSB 2COBA 2HQNA 2X4HA 3FBIB 2FJ1A 1UI5A 4A3IJ 1FIPA 2XAGA 1W4MA 1MJBA 4HAMA 4EJWA 1K6YA 2M87A 2NX4A 2E2HJ 2K9SA 4RGUA 1J5YA 1UB9A 5DM6F 4ACIA 3S16J 4HF0A 3H3UA 1X3WB 4EMSA 5J1RA 3BJOA 3A4CA 3HHHA 4P9FA 3RJPA 3KEYA 4DNCA 3DTKA 5K7FA 5B1BH 3V8KA 3DKYA 3MZHA 2XIGA 4D7NA 4U0YA 2EIKH 1OR7C 1BOBA 4A3JJ 4BE1A 5D4SA 4I6ZA 1UHWA 2HDCA 5E3NA 2MH9A 1A6QA 1R71A 3P9CA 3PL8A 4E70A 1OYIA 4PUSA 4A5NA 4WX9A 1IV8A 1WJ5A 5C44J 2HOTA 3BG7A 2FBIA 2R5ZA 3T8RA 4KT6A 2QYOA 1BBYA 1YW7A 2WB1A 5L3DA 1MH4A 4M6VA 5M5WJ 1A04A 2WBMA 1R5GA 1E17A 1M1EB 5JI6A 2NRAC 3D5LA 4HA8A 2ZJRF 4X6AJ 5L3CA 2C6YA 3TBIA 2V1XA 1OYYA 1XSVA 2ZSHB 4ESBA 2L01A 3H9JA 2BGCA 2G7GA 1ITYA 4AUXA 2IJLA 4BL0B 2DMUA 1G6NA 4ZYEA 4YG2F 3Q9VA 4C30A 5C3EJ 3CCQI 3G7RA 3HTJA 3H0DA 1F36A 1WH7A 4F91B 1ON2A 2K02A 2REKA 3R0JA 1YS6A 2LR8A 3DTEA 3JRDA 1G3TA 2ZC2A 1MJ9A 2HTSA 4C2MJ 3GVAA 1TWHJ 1B9MA 3BP8A 3BG6A 2DQRA 5KHDA 1YI2I 4II3A 4IHWA 1IN7A 3DEWA 4RM3A 2ID3A 2VC0A 5DCFA 5DYMA 3RKWA 1RIOH 1R9TJ 4HKUA 4UUSA 4LIUA 1YYVA 3LFUA 2DQLA 2BW3A 1ZAOA 2DFIA 1D8KA 1WWXA 2EFOA 4F7ZA 1T38A 4DZJA 4QLCU 1FOYA 2E7WA 4DVYP 2DO7A 2DJIA 2GQQA 5K58A 5J1UA 2J5PA 4BDZA 4QIWN 4ZZLA 1RZ4A 5LFAA 1T2KA 2G0EA 1MJAA 2Y48A 2E71A 3D1NI 2WWYA 3FMSA 3RYRA 3ZN0A 5FLXZ 1WJFA 3QOPA 3J80K 5JVTA 2K9MA 2DXIA 3KZYA 1U5TB 3IC7A 4M3DA 2L7FP 3FM3A 1I50J 2DU9A 4JKZA 2OAZA 2WB1N 4OWRB 5IYBJ 3NAUA 4XRSA 2QSHX 1A36A 3R6SA 2CYYA 5ICGA 3CF5F 3UKGA 1YHQI 4LLGF 4XICA 3OYLA 1H0MA 3K1PA 2DFFA 3BLYA 3OIQA 2OCEA 4ZDOA 3S5RA 3CUOA 3FX3A 2LFBA 1F43A 3C7JA 5ILSA 2LF8A 3IH2A 3VVXA 2EV5A 4HZFA 2OF7A 3W6KB 3PIOF 1REPC 1ERDA 3BR2A 2R7SA 4OIPF 4B1RA 1J7KA 1B9NA 2EZLA 2Y9YA 1XSXA 2Z99A 2PMZN 4LFUA 4EJUA 1HSTA 1SVLA 2EIJH 1FYKA 4NB5A 3NS4A 3C1DA 4DIQA 2LLKA 3ABTA 1UG2A 2HXIA 2XPWA 1J9IA 1WVRA 4AWXB 3FBNB 3ZMSA 4XKBA 2O61A 2VE8A 4KDPA 1JI8A 2M2EA 2XSDC 1G4DA 4A3BJ 2MC3A 1DP3A 3CJQB 3HOTA 4K2EA 3F22A 2OQRA 1DU0A 4IRGA 3FXQA 3CMYA 2VQGA 4MLOA 2KDZA 4HSRA 1I39A 4KUMA 3RKXA 1ETWA 5LGUA 3EUHC 3HXLA 2QWWA 3A2KA 4D1QA 2QM3A 3CZ6A 5GAEJ 1FOXA 1E2XA 1IN8A 4RB3C 3GTQJ 1QU3A 4QWQA 1TQPA 3KEQA 4A69C 3I64A 4YEJA 3U21A 4CYCB 2EFWA 2NVQJ 3ZQGA 1EJ9A 4RAGA 4WXCA 1X1CA 4MXMA 4AD9A 2QBYB 3LNQA 2B0LA 4NQWB 2AXLA 1T33A 1U3EM 2DYSH 5FKKA 2HR3A 1FP2A 3IWFA 3M8JA 2QQ8A 2P6SA 3HKZA 2M9HA 3K2AA 3W6JB 3L2UA 1A35A 3NXCA 2BVMA 2BHZA 3JTGA 1VQNI 4XBFA 1JKQC 1ZG1A 3GO5A 5EJCA 2HOSA 2QENA 4UNOA 4ENJA 2OBPA 1Z3YA 2Y31A 3KNWA 3QRFF 2ZXWH 4H0EA 2A07F 1K4TA 5D5UB 2V9VA 4KN4X 1IO2A 2JUGA 3SYTA 3VB2A 5GPCA 4F3QA 4G8XA 3TO9A 1FBQA 5LEJA 3K4LA 1R7JA 4LB5A 3E6MA 4G7HF 4OU0A 1Z3XA 3V7SA 4BE2A 3DV8A 4XLEA 4Y17A 2ZB9A 1UAAA 2QEXI 1S3JA 2Z5UA 4G94A 2DAOA 2RV8A 3TO7A 3F9KA 1LFUP 3NRGA 3KP2A 5HLIA 4KNYA 4PSXA 1N78A 1OQYA 3JRBA 3IWZA 4LIVA 3LL7A 2ADUA 4U0VA 4IRHA 2STWA 1Z05A 2IGNA 1P9QC 3OS0A 5J3LA 2R4GA 3ASNH 1O3TA 2O7OA 3A1YA 2PMZA 2CS3A 4S04A 2VC1A 4DOZA 1IF1A 2QIBA 2GIZA 5AONA 4M3GA 2ID6A 3TOAA 2HDWA 3AFHA 2W1OA 4IRVA 3BROA 4IQJA 5JVGF 3RDIA 2Q2EB 5ILVA 2YR2A 3QODA 1J0RA 5HS7A 2QLZA 2X6WA 3HDDA 4B8XA 3HGYA 1JKRC 1VQMI 2K4BA 1S8NA 2A2FX 3Q0WA 2NOJB 4BGDA 2D2WA 1HDPA 2ESHA 2VQLA 3GFIA 1VQ7I 2AQFA 2XDVA 2LD5A 2OD5A 2PMHA 1I3AA 1CGPA 3UR3C 3WHCA 1MMSA 1ETQA 3QBMA 3JW4A 2XGXA 3ZQCA 4XLCA 3ZR8X 1IDYA 3TQNA 2HVRA 2P4WA 3WU0A 2GM4A 3K69A 2FF4A 3AG3H 3S17J 1R1VA 3EPZA 1PP7U 1HBXG 4KFCA 3PPBA 2K40A 1B59A 4HF1A 4LG0B 2IGMA 1UCRA 2JWTA 4IHYA 5BQTA 3JRHA 2WV0A 5IOYA 1BN5A 2G7LA 3GZ5A 4NDLA 2EK5A 3K10A 2W84A 2WAEA 3CMMA 2DFHA 1R49A 2GXAA 3ZQIA 2V6EA 5DM7F 1Z1DA 2RHAA 1I27A 3LSKA 2Y75A 3FXJA 5AIQA 2L3DA 5IT3A 2QWTA 1IV6A 2ZMEC 1KONA 3OY9A 1OPCA 3CMEI 2E1CA 2F5VA 4Y33A 2KLOA 2JA6J 1U9NA 2Y0SN 2VOOA 4DYQA 1PP8F 2VN2A 1DGRM 2VE9A 2AS5F 2RASA 2OC6A 2CW0F 3MD2A 3CJDA 4WF2A 2KDOA 3FMRA 3ZQQA 2ZY9A 3QYFA 3BG9A 3ANGA 3F23A 1CQTA 2FQ4A 3F3XA 3S1NJ 3CCYA 4MTDA 1ZGAA 5J40A 2DODA 3H35A 1Q1VA 2WV1A 1TWGJ 2R5YA 1LDJA 1IN6A 3J7ZI 5D1RA 4A3MJ 4D5FA 1T08B 2M5WA 4RS8A 3K70C 1VQ9I 2DMNA 4ITVA 3BDDA 2IS6A 1R22A 5F0HA 1F5TA 2YU9J 3PASA 3WTWC 5CQEA 1V5GA 3OOPA 1C0WA 2CQQA 3KYCB 2CFXA 2HTJA 1IXCA 2ELHA 4CCMA 4A3FJ 5F6FA 2CGPA 4DBQA 2PJRA 1JUPA 5E17F 2IU5A 2PZ9A 3HOYJ 5J47A 4XIDA 3MFKA 3ZXSA 4UUVA 2CSOA 1XG1A 2PI0A 2ZFUA 3JRAA 2LOOA 1IRXA 2QKMB 1R00A 2JRMA 3WE2A 2HKUA 1XD7A 2Y0SA 2UXUA 2YVHA 3GMEA 4FT8A 2EILH 4GDFA 3O2PE 2Y30A 2F5CA 4IHSA 2IBDA 3OR1C 4IHVA 4XQFA 2DCEA 2CUJA 3NQOA 4MNUA 1QVUA 1BJZA 2I10A 1SD4A 3HTIA 2LP0A 5E18F 3KP3A 2UZKA 3N05A 3JR9A 4DYRA 5LEKA 2ELJA 4CHUA 4CUGA 4M9ZA 1GXPA 3S3OA 3CDHA 3VIBA 1DP7P 3DQVC 2A5WA 4YFXF 1RUOA 3F8BA 1IW7F 2DDBA 1O3QA 2ECBA 4BQNA 2QBYA 1DGWY 2VJ5A 2HVSA 1UJ8A 2QZ8A 3DWLE 1MBJA 2B7EA 3V7CA 3OSGA 4IQ4A 2NS0A 3O6BB 2JSCA 2WY7Q 3BR1A 3GFMA 3ROUA 4DZPA 5F27A 1G8XA 1LE8A 4A3CJ 2EQRA 3O3KA 5L3BA 4BQOA 4A2UA 2VT2A 1IN5A 2K3FA 3FDYA 4EV0A 5DDGA 2IS1A 5DEQA 2PJRB 3HIFA 2H27A 2D6YA 4XRFA 4JQFA 5GTIC 1T0FA 5K7HA 3OYNA 3J7AO 2JQ7A 3U1DA 3HSRA 3F21A 4ENMA 3S3MA 3I58A 2EH3A 2X48A 2RAEA 3BPVA 2DA6A 2CQXA 2E2IJ 2Q24A 3FF5A 3FMQA 4U87A 3HTAA 2JMWA 3BC8A 5K7ZA 3MAJA 1D0YA 2E5ZA 4TV7A 5DTDA 1HXDA 2F6CA 4CZCA 2PG4A 3I53A 1ORKA 3OL3A 2NVUB 2KMUA 2QUFA 5KAFC 3JRCA 4HOBA 4XN0A 2BYVE 3C3WA 2NNNA 1X58A 2MLGA 3MWMA 5BOXA 2DOFA 4DBRA 3WTXC 1H8AC 1G3SA 4M6XA 4DW6A 1BM9A 3E5QA 3PM1A 3R60A 2V1DA 4GRIA 1D3YA 4M6YA 5FD6A 3QKXA 2FXAA 2KZGA 2W48A 1RRJA 5F1RA 3S1MJ 4XKWA 3ABKH 1FIAA 2R7WA 1BL0A 2OJED 2Z3YA 3BCBA 4C2MA 5K5OA 4A0XA 4BU2A 1X1PA 4GYGA 3HOVJ 1UHMA 4IEJA 4NUBA 3VTIA 1LQ1A 3CCSI 5ILUA 1BR1A 3HPGA 4F93B 1Y0UA 1IN4A 4L0YB 3KP5A 3ZQFA 2DLLA 2YS9A 3IKVA 3GLXA 1SVOA 3S2WA 2O9LA 2AQEA 2VLAA 3S1QJ 3KPHA 4XONA 2YSRA 3ASOH 3LWJA 1W36D 2OPTA 4ZC3A 2KIMA 3QYBA 5BS6A 2NVTJ 4GYIA 3L09A 4MQVA 4UUSB 4OMZA 5M3FJ 4U9NA 3I0TA 3VPRA 5HNHA 1W0UA 2A68F 1HW5A 1LDDA 3HBLA 4HNUA 3D5SC 4AVPA 3RYPA 2ZXIA 4J19A 1T6SA 5HS9A 3V78A 1P92A 3VYSB 3CO7C 2QQ9A 2P5LC 1OKRA 4EJTA 1WI3A 1XN7A 2LBFA 1TC3C 4A0ZA 2OTLI 3GEUA 3PFYA 2CV1A 2JTVA 1ZK8A 1WFXA 4II2A 4WWCA 2VQCA 3ESWB 1U0JA 2L7ZA 2O5RA 3I59A 4BH9A 1YW9A 2OU2A 4YFKF 1SEUA 3LOCA 2DFEA 4E7JA 1QZEA 3LA3A 3OYAA 4OIQF 3WTUC 4KITB 5H20A 3OYGA 1ZARA 3IRRA 4CYCA 2RQPA 2W7NA 3HTHA 3LAJA 3K1MA 2H8WA 4XSZF 4HDVA 4C2TA 4I0BA 3GYHX 2RNJA 3HPHA 1XS9A 2I5UA 2HQAA 2W4SA 4A6EA 3AKZA 2XF7A 4ESFA 2Z16A 2XGCA 3K70D 1P4XA 4U0WA 4A3GJ 1Q1HA 2VONA 3G1LA 1MMNA 3OL4A 1VQOI 1MMGA 5B66C 3LWFA 3TDZC 4AC0A 3CO6C 3F8FA 1TBXA 2QOPA 3HRUA 3ULQB 2KRHA 4W1UA 2HFHA 1YITI 2LKXA 1VQ6I 3GTJJ 3OYBA 1BR2A 1MSEC 2KHMA 1YW8A 1YJ9I 1UHSA 4ANJA 4CH7A 1PYVA 2XPVA 5EEAA 2LREA 2R5YB 1HKQA 1GVDA 3BR5A 3S14J 2V9KA 1D5VA 3CWRA 2PFVA 4PXIA 1NH3A 2LDUA 4MEXF 2ZSIB 1USSA 2ESNA 1R58A 2KIQA 1GVJA 4KIBA 4UXNA 4OMYA 2YX7A 3LA2A 1W7PB 4E6KG 3H0GJ 4HBLA 4BY7J 1HCRA 2GFNA 2E2JJ 1I1GA 5HLTA 4E7ZA 2VIXA 4NN1A 4LK1F 2WGBA 5H9TA 4GXOA 3KETA 2AO9A 3NEUA 3H5AA 3CESA 1EF4A 2IXSA 4IF4A 1F9NA 2K85A 2L7MP 1I1SA 3AQSA 2P81A 3DLAA 1L3LA 2HPMA 3ZMUA 3HYIA 2Z33A 1KGSA 2IRFG 1CF7A 4ZTJA 2GLOA 2LSOA 1JTXA 3C2BA 3V4GA 5DD4A 1ETOA 5DCMA 4CGZA 2HPIA 2X85A 4OD5A 4IHXA 2V79A 3VVYA 2LF7A 1B4AA 4N4NB 5GADJ 1X4PA 4Y13A 2XAUA 3B02A 3A0HC 3TGNA 2XF6A 4U88A 4RAYA 1NK3P 4UDSA 3ABUA 4BJTA 3RKYA 1PDNC 4IZZA 3E3VA 3JSJA 4JP0A 6PAXA 1QVTA 1V3FA 1OCCH 3OYMA 2BY1A 4CYDA 5D6FA 3U1KA 1LVKA 2R5ZB 4EQQA 3M8FA 2G7SA 2JPBA 2ZMEB 1KQ0A 1ZRDA 4HW0A 3RQIA 3LSPA 3R0AA 1VTNC 5HSZA 4G6QA 3H9GA 3L9FA 3GUDA 3PQKA 2ZNYA 2M0CA 2DG7A 1KA8A 2CQ7A 2NVXJ 3F8MA 1QGPA 3BQYA 2FMYA 3H36A 2V26A 3CLQA 5HVQC 3FHNA 2P8TA 3OSFA 5EEHA 4S05A 2NS7A 1JJ8C 3ZMZA 4I2OA 5DUKA 4BXXJ 2ICWG 2X6XA 4ETSA 3RH2A 1ETKA 3TW6A 1UG0A 2AXTC 3PSIA 3EUHA 1ZELA 2HYJA 1WJBA 1FMWA 1BIBA 2CW7A 3ZPLA 4BEHB 1GV5A 2PFBA 3BCGA 3L2QA 2ZXHA 4B47A 1TL8A 5HOOA 2W53A 2LKPA 4PSWA 3QOEA 1IC8A 4GO1A 4NBQA 2CQNA 1XSDA 3IV5A 1B1BA 1QRYA 3WTSC 3KKDA 2FSWA 4PJ0C 2X1DA 3CCUI 3IH3A 2HYGD 3H3ZA 3ZMTA 3JRIA 2IS4A 2DOAA 3H5NA 3IP4B 2OCCH 4YIRX 1FMVA 4X1EA 2KJCA 3LQRA 4XLPF 5EGOA 4UVAA 4I76A 1T56A 1IZ1A 4FTHA 3G3ZA 4OAYA 3ZRGA 4FE7A 3ANPA 2OA4A 4IOCF 4C3IJ 2P5KA 2RNGA 2VBYA 1ZG3A 2EV0A 5M3MJ 4BACA 2VJJA 3S3NA 2MA3A 5EZHA 2CQKA 5F04A 2DMPA 1IRZA 1JT6A 4CXFA 5CVIA 2HWVA 3VSKA 2VBXA 2EPFA 4ASNA 5FFXA 3HOUJ 5CPRB 3MCZA 1AHDP 3V42A 1VFCA 3DKWA 3A0BC 2DJNA 3HRSA 5C4JJ 1IUFA 1NG6A 3E97A 3LJLA 3WU2C 1K61A 2MSYA 3J81K 4S0HB 3T5XA 1VI0A 2K86A 3ON2A 1GDTA 1MZBA 2FE3A 3OOUA 1PUEE 4KN7X 2DA3A 3CCMI 2QTQA 4ESJA 1K78B 3WTTC 1KQ9A 2CO5A 4ZYHA 5EG0B 1EV7A 2LBFB 3T1BA 2OI8A 5B1AH 4L62A 2MW8A 3ECHA 3OWTA 5CVJA 2H1KA 4HQMA 1V5EA 2G7HA 2WC2A 3BQZA 3IAS2 3W2WA 4CCKA 3LSRA 4Y4RA 2O3FA 4JL3A 4WIBA 3HC7A 1QA6A 2CWEA 5TISC 5H2FC 1T39A 1YOVB 3DEEA 4PGHA 5GTHC 1WJEA 4OD4A 1LKXA 1DUXC 3CCRI 4ZJZA 2E7XA 2HOAA 1TT0A 3FIWA 3E7QA 1WGXA 2Y9ZA 2MD0A 3E7LA 4BQQA 2ELKA 2W57A 3RTRA 2HS5A 4XSXF 2L4AA 4Y52J 2L9NA 2X1EA 5TGTA 1N25A 1WJCA 3GF2A 5J8CA 3WHBA 3S93A 3F6OA 1MBEA 5IP9J 2HKXA 1OCZH 2KPMA 3V8JA 2HU9A 3QPTA 3MKZA 4B43A 4I02A 2UXOA 2L0KA 1YX5A 1SMTA 5J6XA 5ED4A 2F4IA 3COAC 4A6DA 5FHPA 3IHUA 5JHUA 4Q48A 3RPQA 2QQAA 3H92A 1IJWC 3BR6A 3PFIA 2M7AA 1MBHA 1UMQA 3KX2A 4QSHA 3REOA 3KLOA 4A3DJ 4MFDA 4ON0A 3KFWX 1LEAA 1J75A 2B1EA 5C4YA 4Q4ZF 4I0AA 4RB0A 3Q3SA 5LRRA 3G6EI 5E1XA 1FJLA 1FSEA 3C2HA 4D0PA 4HX4A 3GZ6A 1B8IA 3T0YA 3CUQB 1ZGJA 2OQGA 2Z2SB 3BTJA 1SFEA 1F4KA 1MSFC 5FLXK 4I98B 4BXUA 1LDKB 4A93J 5ICFA 5TJJA 1R23A 3TO6A 3OIPA 3GBGA 4KYWA 4UB8C 4NQWA 2WAFA 5CLSA 5FGMA 1IGNA 4F52A 1OMIA 2CUZA 3ZCOA 2EA2A 2UXHA 2COMA 4E7HA 2FA5A 2Y2ZA 1Z21A 5JLXA 3W2VA 4E4HA 1D0ZA 1AKHB 1ZR2A 3AG4H 2GOXB 2OUMA 3HUGB 1P4AA 3EGQA 3OV8A 5FRNA 2BBYA 2VPRA 1HC8A 3I4PA 2B9SA 3GTPJ 1JUSA 1KU9A 5DV5A 1D0XA 3HTUA 5F64A 4BBRJ 3A02A 1Y1WJ 2R7OA 3NARA 2RN7A 1N75A 3TEDA 1RUNA 3OIOA 5EG0A 2M4GA 2FBQA 1B6AA 5FKNA 3S32A 4V19K 3HUGA 3VP5A 4N9IA 3VOXA 1MKMA 1OCOH 2QQBA 3DBLB 2LNBA 3LA7A 3OS2A 3FK6A 2W25A 2M7BA 1Z6RA 4PJMA 4E7SA 5E3MA 2Q0OA 2DA1A 2VXDA 3RCOA 1RKTA 3BRUA 5KAIC 1K79A 2BHYA 2CMPA 4EM1A 1JGSA 3SJMA 2LY9A 2L5QA 4CCLA 4BQAA 1KU3A 2VBZA 3MEXA 2UWMA 1X3UA 2TCTA 4FE4A 1NTCA 1ON1A 2HXOA 4IRIA 2A6TA 4HLXA 5KK1A 5E1ZB 3SFIA 1Z9CA 3JSOA 3G73A 1KU7A 4JX5A 3I3LA 3DU5A 4LGWA 2YUSA 4B44A 3MKLA 5DUIA 1FTZA 2BVLA 2HVQA 1LPQA 4MIMA 1QZZA 2PJPA 2O0YA 3VW1A 2YVEA 4HX7A 4JK1X 4QPQA 2ETHA 2F2EA 4N9HA 3ZN1A 4WXHA 2XASA 5JLWA 3QWLA 4OAZA 3G1MA 2R7VA 3EETA 1Y56A 1VQKI 1TP4A 3BCAA 1S9HA 4L9JA 1E3OC 4ME9A 1R1TA 2DK5A 1XMXA 3BJ6A 5A2QK 2KKOA 3ZQ7A 3P7NA 5F1JA 1LEBA 2H8RA 5D6EA 2DPUA 4BKXA 3I5UA 1U5TA 3CDIA 2JK3A 1W5SA 4FCYA 3GFLA 4U7BA 1U9OA 1XCBA 1T0FC 2UXXA 1MIJA 3AQTA 4UHTA 3HHGA 5L3GA 5CXIA 1QHGA 4RDUA 4XORA 4UV9A 4ABZA 1BI1A 5ERIA 4KMFA 5J1YA 3K4BA 3JCUC 3W3CA 3NRVA 4P5OA 2WY8Q 2KT0A 4IHTA 3M8EA 4LMYA 2TDXA 3GFJA 4GCVA 4BXFA 1U6GA 3F6VA 3BHQA 4UV8A 4ZYAA 5LGTA 1J09A 1BA5A 2R7TA 4V2GA 3FXKA 3VFZA 1KU2A 1WH5A 3J7YJ 3DCFA 2BV6A 1N77A 2VJIA 4N0BA 2O6GE 1I5ZA 3SWHA 1TT5B 3IH4A 1X2NA 3HB9A 3V7RA 4ZYGA 1O7FA 3AL0B 3I59B 2K9NA 5LBQA 2CV0A 2ZCMA 4AC6A 1XX5A 3KYDB 1FX7A 2X1CA 2P7CB 2R7UA 3FISA 2EJRA 3BNIA 3GTGJ 4KICA 4P9UA 3HGGA 1MW7A 2JA2A 2IAIA 2JSPA 3ERMA 3X2QH 1HKTA 3D5RC 2GZWA 4HNVA 1LVAA 2XHKA 1R5HA 3HSFA 1ZHFA 2LC2A 4XLHA 5AQCA 2MH2A 4OIRF 3F0CA 2EIMH 2JVGA 3I55I 1XB4A 1PUFA 2JN6A 1K83J 4PGGA 2NVYJ 5D5XB 1BC7C 2HGCA 4ZYDA 1QZYA 3FXUA 1YO5C 3S8PA 3M1EA 4CICA 3FWEA 3BWGA 5FLMJ 4QPOA 2B3WA 2YU3A 1WHUA 4MEYF 3SDGA 4A3KJ 5C4XJ 2E19A 4R1HA 4HRIA 5HS8A 1BOAA 1X4OA 1Y8RB 2VKDA 3KLNA 3HOWJ 1JKPC 1WKMA 3WG9A 3LSMA 2R7RA 3N97A 1OYWA 3DKXA 3A01A 1TQIA 3BY6A 3FXMA 1Y6IA 2L9SA 2ISYA 1MH3A 3CP8A 3GZNB 3B6AA 2Z9OA 3QAHA 4P96A 3GTMJ 3MZYA 3LSJA 2F4OB 3BG3A 2VXZA 5D5VB 1U78A 1RKWA 2LVSA 1S5LC 1ZYRF 3WTYC 2LY1A 5JFRA 2L4MA 4IXAA 2DDAA 4QTRA 3H1CA 4NHJA 1FWZA 5FRMA 2PN6A 4XOTA 2KIFA 1D5YA 1G3WA 3LSIA 1RR8C 1S7OA 3TKYA 1W0TA 3R61A 4RMNA 2NOGA 1QNTA 1TWAJ 1FNNA 1FC3A 4RB2C 2QKOA 2I8DA 3SZGA 2X0LA 5FD5A 5IYCJ 3M3YJ 3KYLA 2DOEA 2VQHA 4PFOA 5M5XJ 1UELB 4LOCA 2PEXA 5FMPA 4PZJA 2IA2A 1B72A 5FKMA 3GX4X 4L9TA 1I6HJ 2ZNZA 2XB5A 2E1MB 2IEKA 3BTCA 5D8LB 2F5EA 2XPUA 1U8BA 4UVCA 4YIIA 3NWSA 3PNYA 5IPAA 2FX0A 1OCPA 4XKCA 4WK8F 2JA8J 3OYEA 3RPUD 1D1CA 2FUG2 3M4OJ 1LFPA 3M1CA 3ZQHA 2EBIA 3DTIA 3EQLF 3H3VK 4Z2YA 1MMDA 3EUAA 3MZ8A 2GA2A 2L9RA 5IP7J 1GHCA 5IYDJ 4GGGA 3HOZJ 1DDNA 4I01A 2R7XA 2DYRH 3VOKA 2V9PA 1BI2A 4E7LA 1G59A 2O8KA 4R79A 1LUJB 4KIGA 1E3HA 2L9VA 2D45A 4PJJA 2W00A 1EKEA 3AG2H 3L1PA 2NYXA 1VF9A 3C18A 2IA1A 3S15J 1MDMB 1E0EA 3FK7A 4RGXA 5DCMB 3QYEA 1JHHA 3I54A 1XGMA 4XLFA 1TLHB 5H6RA 4B3XA 4YRVA 2DW4A 2XAJA 3I4NJ 4EEFG 2LKSA 3PIPF 4B3AA 2G9WA 4A12A 2B63J 3BJBA 2XRLA 1R36A 5E1WA 2VODA 1IUYA 4G9YA 2VKVA 1R6RA 3P9IA 1WCMJ 5D4RA 3TDUC 2BY0A 4EJOA 3HOSA 1H9TA 2HDDA 3J81Z 1ODDA 1G2HA 1J2XA 2FRHA 1ENHA 5ICEA 4MO7A 3M07A 2VASA 1V55H 2OZ6A 4IX7A 1XCVA
chains in the Genus database with same CATH topology
3NRGA 1LFUP 1TWFJ 1GV5A 3JRBA 1JTYA 2CRGA 2DA7A 3BCGA 3JRFA 1ETXA 1DU6A 1JT0A 2W53A 1IC8A 2ME0A 2V57A 5J3LA 3IV5A 4BBSJ 1Z77A 2O7OA 1QRYA 3KKDA 2R93J 3IH3A 4CGRA 3JRIA 5M5YJ 3VW0A 2GENA 5FKOA 4X1EA 5CW8A 1OJLA 1Y1VJ 3QPLA 5EGOA 2QIBA 2WAQN 3A01B 1IG7A 4I76A 4M3GA 1T56A 2ID6A 4G12A 4KWAA 4FTHA 3BR0A 4FE7A 2DA4A 3ANPA 4ICHA 3QPSA 1NK2P 4C3IJ 5HAWA 5DAJA 4M3FA 3HDDA 3T6NA 3HGYA 5M3MJ 1JKRC 4Y7NJ 2OERA 3HOXJ 3GZIA 1AU7A 5EZHA 3Q0WA 3COLA 5F04A 2DMPA 1IRZA 1JT6A 3GTOJ 2QF7A 3HKZN 3BTLA 1HDPA 1P7IA 1ZGWA 3HOUJ 2LD5A 1AHDP 1VFCA 3WHCA 4JX6A 2DJNA 5C4JJ 1ETQA 3QBMA 1IUFA 1JUMA 3ZQCA 3K7AJ 1IDYA 3LJLA 1RESA 4A3LJ 3JREA 1K61A 2MSYA 4S0HB 2GM4A 1VI0A 3ON2A 1GDTA 1OCTC 3OOUA 3CDLA 4XK4A 3S17J 4M3EA 2DA3A 1AKHA 1S7EA 2X9DA 3O8HA 3S2DJ 2QTQA 3PPBA 2K40A 3FKIJ 3IUVA 5EG0B 3HE0A 5EFYA 2XGEA 2OI8A 2JWTA 4L62A 2MW8A 4GCLA 4IHYA 2H1KA 2VKEA 2NS8A 3JRHA 5IOYA 2M34A 3RZOJ 2CUEA 3RZDJ 2G7LA 3BQZA 4NDLA 3LSRA 4YZEA 3VW2A 5F08A 1GUUA 3ZQIA 4JL3A 3TP3A 3O60A 3CRJA 5F0CA 2RHAA 1OFCX 2QWTA 1IV6A 3FIWA 2HOAA 3E7QA 1B8IB 1WGXA 2Y9ZA 2HQ5A 3E7LA 2ELKA 5FGLA 4D5CA 1ZTRA 2JA6J 4Y52J 1U9NA 2Y0SN 4AF5A 4DYQA 2UXPA 3TW7A 9ANTA 3MVPA 2MGQA 1B72B 3WHBA 3F1BA 2RASA 1MBEA 5IP9J 3B81A 3NI7A 1RETA 5E3LA 2FD5A 1ZR4A 3CJDA 2LTPA 3ANGA 3BG9A 4C3JJ 4MK6A 1CQTA 3QQAA 1A6IA 2FQ4A 5GPAA 2L0KA 3S1NJ 2UXOA 4JNNA 3CCYA 2ME6A 2XGDA 1Q1VA 2WV1A 1TWGJ 2R5YA 3ZOBA 1O4XA 5FHPA 3VVZA 3S2HJ 5D1RA 1QPIA 3NNRA 2VI6A 4A3MJ 1A5JA 2ZOYA 4D5FA 3HM5A 1SANA 4D7MA 1IJWC 3BR6A 2TRTA 2DMNA 1MBHA 1UMQA 4QSHA 5F0HA 4A3DJ 2YU9J 4MFDA 2JA5J 3PASA 3BG5A 5C4YA 2CQQA 3Q3SA 1FJLA 4XRMA 4DYCA 1B8IA 4A3FJ 4V2FA 2IU5A 1JUPA 3MN2A 2PZ9A 2DTZA 3HOYJ 4XIDA 3BTJA 1MSFC 2DMQA 4NELA 2EZIA 2XDNA 2WUIA 4A93J 3V6GA 1XG1A 4L5EA 3JRAA 1LFBA 3LHQA 2K9QA 2HKUA 2YVHA 3GBGA 2UXUA 3KZ9A 1IGNA 2Y30A 5EZGA 2IBDA 1IDZA 2R92J 2GUHA 4IHVA 3P9TA 2UXHA 1QVUA 2DA2A 2Y2ZA 1X2MA 1BJZA 2I10A 3HIMA 3HTIA 2LP0A 5JLXA 2NP5A 1P7JA 3JR9A 4DYRA 1ZR2A 1AKHB 2MG4A 1PUFB 3DPJA 1HOMA 1BW5A 3EGQA 2VPRA 3VIBA 5EF6A 3GTPJ 2ZCNA 1JUSA 2NP3A 2ECBA 4BBRJ 2AHQA 3A02A 1Y1WJ 3PO2J 3NARA 1MBJA 3ON4A 3TEDA 3G56A 3OSGA 3OIOA 5EG0A 3BR1A 2FBQA 4M3BA 5FKNA 5F27A 4DZPA 1SFOJ 1H89C 2GBYA 1LE8A 1POGA 4A3CJ 2EQRA 3VP5A 3VOXA 4GFKA 5FLVA 3O8GA 3GTLJ 4MFEA 2ZOZA 3FK6A 3S1RJ 2D6YA 4GFBA 2LK2A 5E3MA 5K7HA 3C07A 2E1OA 3GTKJ 2DA1A 3BRUA 1RKTA 1JJ6C 3KKCA 1GV2A 3TP0A 2EH3A 3SJMA 2LY9A 2X48A 2RAEA 1MNMC 2DA6A 2CQXA 2E2IJ 2Q24A 1I3QJ 3HTAA 2JMWA 5K7ZA 2TCTA 4FE4A 1NTCA 2HXOA 2G3BA 2QCOA 5DTDA 4BY1J 2VUMJ 3SFIA 4C3HJ 1ORKA 4JX4A 4JX5A 1VNDA 3BR3A 2ZCXA 2YUSA 3JRCA 3MKLA 1TWCJ 1FTZA 3BT9A 1X58A 4MIMA 1HDDC 1H8AC 3VW1A 1XC5A 2YVEA 1SGMA 4DW6A 5F0FA 2ECCA 5JLWA 2XB0X 3PM1A 2COBA 1JKOC 3QKXA 2FJ1A 2W48A 3G1MA 4A3IJ 3S1MJ 1FIPA 1UI5A 1FIAA 1E3OC 4ME9A 2NX4A 1BL0A 2E2HJ 2HI3A 2K9SA 5F1JA 2N8GA 3S16J 4ACIA 3HOVJ 2H8RA 4IEJA 5J1RA 4BKXA 1H88C 2JK3A 4FCYA 5K7FA 3ZQFA 2YS9A 1U9OA 3AQTA 4D7NA 1HLVA 3PO3J 2O9LA 4A3JJ 2D5VA 5CXIA 3S1QJ 4I6ZA 4RDUA 3B6CA 5E3NA 3LWJA 2CUFA 4ABZA 2OPTA 1MBGA 5J1YA 3RKQA 1ETYA 2KT0A 1FTTA 1UI6A 1Z0XA 5C44J 5BNGA 2HOTA 2NVTJ 2R5ZA 3BHQA 1LE8B 4UUSB 1MBFA 1ZQ3P 1BA5A 5M3FJ 1MH4A 2DG8A 3VPRA 4V2GA 4M6VA 1W0UA 5M5WJ 5HBUA 3HBLA 1WH5A 5HODA 3DCFA 4J19A 4X6AJ 3V78A 4RBOA 4W97A 3IH4A 1X2NA 1WI3A 3HB9A 5E3OA 2G7GA 1TC3C 1ITYA 3GEUA 4AUXA 1ZK8A 4B4CA 2DMUA 5C3EJ 3ZQLA 3G7RA 3HTJA 2K9NA 3FRQA 2L7ZA 3EUPA 2ZCMA 1F36A 4AC6A 1WH7A 3LOCA 2REKA 3FISA 2LR8A 3BNIA 5EDNA 3GTGJ 3HGGA 2IAIA 1APLC 3JRDA 4C2MJ 4HNVA 4GCKA 1TWHJ 4CYCA 5IP6A 3HTHA 4IHWA 5AQCA 3DEWA 2ID3A 3F0CA 1XS9A 1R9TJ 4HKUA 4UUSA 3I4MJ 1PUFA 2JN6A 1K83J 2NVYJ 2XGCA 4DZJA 4GFLA 4A3GJ 4FISA 2PBXA 3G1LA 5K58A 5J1UA 4QIWN 4AC0A 2UXIA 5FLMJ 2G0EA 4A3KJ 3SDGA 5C4XJ 2E19A 5DS9A 2QOPA 3RD3A 3D1NI 1ZKGA 4UUTA 3HOWJ 4W1UA 1JKPC 3NPIA 2LKXA 3G1OA 4JYKA 3GTJJ 3A01A 1YRNB 4M3DA 2L7FP 4JKZA 1I50J 3W6VA 3GTMJ 1MH3A 1MSEC 5EGOB 3B6AA 5D18A 2WB1N 4XRSG 1UHSA 3NAUA 5IYBJ 4XRSA 3LSJA 5EEAA 2XPVA 3BG3A 2HYTA 2R5YB 2EZKA 1U78A 3UKGA 1RKWA 2LVSA 1GVDA 4XICA 3BR5A 3S14J 3CWRA 4PXIA 3S5RA 2CJJA 2LFBA 5IOZA 1F43A 3VVXA 3IH2A 1YRNA 1WPKA 4QTRA 2OF7A 1RPWA 3BR2A 1D5YA 4A3EJ 4B1RA 2Y9YA 2EZLA 1W0TA 4GCTA 2NOGA 2PMZN 1TWAJ 3H0GJ 4BY7J 1HCRA 2GFNA 2QKOA 2E2JJ 4NN1A 3Q0VA 5IYCJ 2LLKA 3M3YJ 2WGBA 1UG2A 5H9TA 2HXIA 2XPWA 2R7ZJ 2AO9A 5M5XJ 4LOCA 3HEFA 1BW6A 1EF4A 5FMPA 2JA7J 2L7MP 1B72A 2DMTA 5FKMA 1JGGA 1RR7A 2M2EA 2XSDC 4A3BJ 3LSGA 3A03A 1I6HJ 3AQSA 2P81A 2XB5A 3BTCA 2IEKA 1U8BA 2XPUA 2X6OA 1DU0A 3CMYA 5IPAA 2FX0A 2GLOA 4MLOA 1JTXA 1OCPA 2JA8J 3C2BA 2KDZA 1ETOA 1ETWA 3M4OJ 4IHXA 3ZQHA 3VVYA 2EBIA 2M8GX 2F07A 4AYBN 5CXGA 3H3VK 3GTQJ 2L9RA 4A69C 5IP7J 1HF0A 2O7TA 5IYDJ 4CYCB 3HOZJ 2NVQJ 3ZQGA 3VUQA 1NK3P 3VOKA 4UDSA 3BTIA 4MXMA 3LNQA 2O8KA 3JSJA 1ETVA 4JP0A 1T33A 1QVTA 2R0QC 5FKKA 3L1PA 5FKLA 1GT0C 1VF9A 3S15J 5D19A 3MNLA 2M9HA 2R5ZB 3K2AA 3FK7A 2G7SA 5EYRA 3NXCA 3Q0UA 1JKQC 3RQIA 3LSPA 2HOSA 3I4NJ 5GP9A 4EEFG 5HSZA 2DN0A 2JJ7A 4B3AA 2B63J 3BJBA 2M0CA 2Y31A 2CU7A 3CQZJ 2DG7A 3KNWA 2NVXJ 2XRLA 5FJ8J 2VKVA 3BQYA 3JRGA 1WCMJ 5GPCA 2DA5A 3OSFA 1FEXA 2NS7A 1JJ8C 4BXXJ 1MBKA 2ZB9A 3RH2A 1ETKA 2EZHA 1G2HA 3TW6A 1ENHA 4MO7A 2HDDA 2HYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRG A;  1LFU P;  1TWF J;  1GV5 A;  3JRB A;  1JTY A;  2CRG A;  2DA7 A;  3BCG A;  3JRF A;  1ETX A;  1DU6 A;  1JT0 A;  2W53 A;  1IC8 A;  2ME0 A;  2V57 A;  5J3L A;  3IV5 A;  4BBS J;  1Z77 A;  2O7O A;  1QRY A;  3KKD A;  2R93 J;  3IH3 A;  4CGR A;  3JRI A;  5M5Y J;  3VW0 A;  2GEN A;  5FKO A;  4X1E A;  5CW8 A;  1OJL A;  1Y1V J;  3QPL A;  5EGO A;  2QIB A;  2WAQ N;  3A01 B;  1IG7 A;  4I76 A;  4M3G A;  1T56 A;  2ID6 A;  4G12 A;  4KWA A;  4FTH A;  3BR0 A;  4FE7 A;  2DA4 A;  3ANP A;  4ICH A;  3QPS A;  1NK2 P;  4C3I J;  5HAW A;  5DAJ A;  4M3F A;  3HDD A;  3T6N A;  3HGY A;  5M3M J;  1JKR C;  4Y7N J;  2OER A;  3HOX J;  3GZI A;  1AU7 A;  5EZH A;  3Q0W A;  3COL A;  5F04 A;  2DMP A;  1IRZ A;  1JT6 A;  3GTO J;  2QF7 A;  3HKZ N;  3BTL A;  1HDP A;  1P7I A;  1ZGW A;  3HOU J;  2LD5 A;  1AHD P;  1VFC A;  3WHC A;  4JX6 A;  2DJN A;  5C4J J;  1ETQ A;  3QBM A;  1IUF A;  1JUM A;  3ZQC A;  3K7A J;  1IDY A;  3LJL A;  1RES A;  4A3L J;  3JRE A;  1K61 A;  2MSY A;  4S0H B;  2GM4 A;  1VI0 A;  3ON2 A;  1GDT A;  1OCT C;  3OOU A;  3CDL A;  4XK4 A;  3S17 J;  4M3E A;  2DA3 A;  1AKH A;  1S7E A;  2X9D A;  3O8H A;  3S2D J;  2QTQ A;  3PPB A;  2K40 A;  3FKI J;  3IUV A;  5EG0 B;  3HE0 A;  5EFY A;  2XGE A;  2OI8 A;  2JWT A;  4L62 A;  2MW8 A;  4GCL A;  4IHY A;  2H1K A;  2VKE A;  2NS8 A;  3JRH A;  5IOY A;  2M34 A;  3RZO J;  2CUE A;  3RZD J;  2G7L A;  3BQZ A;  4NDL A;  3LSR A;  4YZE A;  3VW2 A;  5F08 A;  1GUU A;  3ZQI A;  4JL3 A;  3TP3 A;  3O60 A;  3CRJ A;  5F0C A;  2RHA A;  1OFC X;  2QWT A;  1IV6 A;  3FIW A;  2HOA A;  3E7Q A;  1B8I B;  1WGX A;  2Y9Z A;  2HQ5 A;  3E7L A;  2ELK A;  5FGL A;  4D5C A;  1ZTR A;  2JA6 J;  4Y52 J;  1U9N A;  2Y0S N;  4AF5 A;  4DYQ A;  2UXP A;  3TW7 A;  9ANT A;  3MVP A;  2MGQ A;  1B72 B;  3WHB A;  3F1B A;  2RAS A;  1MBE A;  5IP9 J;  3B81 A;  3NI7 A;  1RET A;  5E3L A;  2FD5 A;  1ZR4 A;  3CJD A;  2LTP A;  3ANG A;  3BG9 A;  4C3J J;  4MK6 A;  1CQT A;  3QQA A;  1A6I A;  2FQ4 A;  5GPA A;  2L0K A;  3S1N J;  2UXO A;  4JNN A;  3CCY A;  2ME6 A;  2XGD A;  1Q1V A;  2WV1 A;  1TWG J;  2R5Y A;  3ZOB A;  1O4X A;  5FHP A;  3VVZ A;  3S2H J;  5D1R A;  1QPI A;  3NNR A;  2VI6 A;  4A3M J;  1A5J A;  2ZOY A;  4D5F A;  3HM5 A;  1SAN A;  4D7M A;  1IJW C;  3BR6 A;  2TRT A;  2DMN A;  1MBH A;  1UMQ A;  4QSH A;  5F0H A;  4A3D J;  2YU9 J;  4MFD A;  2JA5 J;  3PAS A;  3BG5 A;  5C4Y A;  2CQQ A;  3Q3S A;  1FJL A;  4XRM A;  4DYC A;  1B8I A;  4A3F J;  4V2F A;  2IU5 A;  1JUP A;  3MN2 A;  2PZ9 A;  2DTZ A;  3HOY J;  4XID A;  3BTJ A;  1MSF C;  2DMQ A;  4NEL A;  2EZI A;  2XDN A;  2WUI A;  4A93 J;  3V6G A;  1XG1 A;  4L5E A;  3JRA A;  1LFB A;  3LHQ A;  2K9Q A;  2HKU A;  2YVH A;  3GBG A;  2UXU A;  3KZ9 A;  1IGN A;  2Y30 A;  5EZG A;  2IBD A;  1IDZ A;  2R92 J;  2GUH A;  4IHV A;  3P9T A;  2UXH A;  1QVU A;  2DA2 A;  2Y2Z A;  1X2M A;  1BJZ A;  2I10 A;  3HIM A;  3HTI A;  2LP0 A;  5JLX A;  2NP5 A;  1P7J A;  3JR9 A;  4DYR A;  1ZR2 A;  1AKH B;  2MG4 A;  1PUF B;  3DPJ A;  1HOM A;  1BW5 A;  3EGQ A;  2VPR A;  3VIB A;  5EF6 A;  3GTP J;  2ZCN A;  1JUS A;  2NP3 A;  2ECB A;  4BBR J;  2AHQ A;  3A02 A;  1Y1W J;  3PO2 J;  3NAR A;  1MBJ A;  3ON4 A;  3TED A;  3G56 A;  3OSG A;  3OIO A;  5EG0 A;  3BR1 A;  2FBQ A;  4M3B A;  5FKN A;  5F27 A;  4DZP A;  1SFO J;  1H89 C;  2GBY A;  1LE8 A;  1POG A;  4A3C J;  2EQR A;  3VP5 A;  3VOX A;  4GFK A;  5FLV A;  3O8G A;  3GTL J;  4MFE A;  2ZOZ A;  3FK6 A;  3S1R J;  2D6Y A;  4GFB A;  2LK2 A;  5E3M A;  5K7H A;  3C07 A;  2E1O A;  3GTK J;  2DA1 A;  3BRU A;  1RKT A;  1JJ6 C;  3KKC A;  1GV2 A;  3TP0 A;  2EH3 A;  3SJM A;  2LY9 A;  2X48 A;  2RAE A;  1MNM C;  2DA6 A;  2CQX A;  2E2I J;  2Q24 A;  1I3Q J;  3HTA A;  2JMW A;  5K7Z A;  2TCT A;  4FE4 A;  1NTC A;  2HXO A;  2G3B A;  2QCO A;  5DTD A;  4BY1 J;  2VUM J;  3SFI A;  4C3H J;  1ORK A;  4JX4 A;  4JX5 A;  1VND A;  3BR3 A;  2ZCX A;  2YUS A;  3JRC A;  3MKL A;  1TWC J;  1FTZ A;  3BT9 A;  1X58 A;  4MIM A;  1HDD C;  1H8A C;  3VW1 A;  1XC5 A;  2YVE A;  1SGM A;  4DW6 A;  5F0F A;  2ECC A;  5JLW A;  2XB0 X;  3PM1 A;  2COB A;  1JKO C;  3QKX A;  2FJ1 A;  2W48 A;  3G1M A;  4A3I J;  3S1M J;  1FIP A;  1UI5 A;  1FIA A;  1E3O C;  4ME9 A;  2NX4 A;  1BL0 A;  2E2H J;  2HI3 A;  2K9S A;  5F1J A;  2N8G A;  3S16 J;  4ACI A;  3HOV J;  2H8R A;  4IEJ A;  5J1R A;  4BKX A;  1H88 C;  2JK3 A;  4FCY A;  5K7F A;  3ZQF A;  2YS9 A;  1U9O A;  3AQT A;  4D7N A;  1HLV A;  3PO3 J;  2O9L A;  4A3J J;  2D5V A;  5CXI A;  3S1Q J;  4I6Z A;  4RDU A;  3B6C A;  5E3N A;  3LWJ A;  2CUF A;  4ABZ A;  2OPT A;  1MBG A;  5J1Y A;  3RKQ A;  1ETY A;  2KT0 A;  1FTT A;  1UI6 A;  1Z0X A;  5C44 J;  5BNG A;  2HOT A;  2NVT J;  2R5Z A;  3BHQ A;  1LE8 B;  4UUS B;  1MBF A;  1ZQ3 P;  1BA5 A;  5M3F J;  1MH4 A;  2DG8 A;  3VPR A;  4V2G A;  4M6V A;  1W0U A;  5M5W J;  5HBU A;  3HBL A;  1WH5 A;  5HOD A;  3DCF A;  4J19 A;  4X6A J;  3V78 A;  4RBO A;  4W97 A;  3IH4 A;  1X2N A;  1WI3 A;  3HB9 A;  5E3O A;  2G7G A;  1TC3 C;  1ITY A;  3GEU A;  4AUX A;  1ZK8 A;  4B4C A;  2DMU A;  5C3E J;  3ZQL A;  3G7R A;  3HTJ A;  2K9N A;  3FRQ A;  2L7Z A;  3EUP A;  2ZCM A;  1F36 A;  4AC6 A;  1WH7 A;  3LOC A;  2REK A;  3FIS A;  2LR8 A;  3BNI A;  5EDN A;  3GTG J;  3HGG A;  2IAI A;  1APL C;  3JRD A;  4C2M J;  4HNV A;  4GCK A;  1TWH J;  4CYC A;  5IP6 A;  3HTH A;  4IHW A;  5AQC A;  3DEW A;  2ID3 A;  3F0C A;  1XS9 A;  1R9T J;  4HKU A;  4UUS A;  3I4M J;  1PUF A;  2JN6 A;  1K83 J;  2NVY J;  2XGC A;  4DZJ A;  4GFL A;  4A3G J;  4FIS A;  2PBX A;  3G1L A;  5K58 A;  5J1U A;  4QIW N;  4AC0 A;  2UXI A;  5FLM J;  2G0E A;  4A3K J;  3SDG A;  5C4X J;  2E19 A;  5DS9 A;  2QOP A;  3RD3 A;  3D1N I;  1ZKG A;  4UUT A;  3HOW J;  4W1U A;  1JKP C;  3NPI A;  2LKX A;  3G1O A;  4JYK A;  3GTJ J;  3A01 A;  1YRN B;  4M3D A;  2L7F P;  4JKZ A;  1I50 J;  3W6V A;  3GTM J;  1MH3 A;  1MSE C;  5EGO B;  3B6A A;  5D18 A;  2WB1 N;  4XRS G;  1UHS A;  3NAU A;  5IYB J;  4XRS A;  3LSJ A;  5EEA A;  2XPV A;  3BG3 A;  2HYT A;  2R5Y B;  2EZK A;  1U78 A;  3UKG A;  1RKW A;  2LVS A;  1GVD A;  4XIC A;  3BR5 A;  3S14 J;  3CWR A;  4PXI A;  3S5R A;  2CJJ A;  2LFB A;  5IOZ A;  1F43 A;  3VVX A;  3IH2 A;  1YRN A;  1WPK A;  4QTR A;  2OF7 A;  1RPW A;  3BR2 A;  1D5Y A;  4A3E J;  4B1R A;  2Y9Y A;  2EZL A;  1W0T A;  4GCT A;  2NOG A;  2PMZ N;  1TWA J;  3H0G J;  4BY7 J;  1HCR A;  2GFN A;  2QKO A;  2E2J J;  4NN1 A;  3Q0V A;  5IYC J;  2LLK A;  3M3Y J;  2WGB A;  1UG2 A;  5H9T A;  2HXI A;  2XPW A;  2R7Z J;  2AO9 A;  5M5X J;  4LOC A;  3HEF A;  1BW6 A;  1EF4 A;  5FMP A;  2JA7 J;  2L7M P;  1B72 A;  2DMT A;  5FKM A;  1JGG A;  1RR7 A;  2M2E A;  2XSD C;  4A3B J;  3LSG A;  3A03 A;  1I6H J;  3AQS A;  2P81 A;  2XB5 A;  3BTC A;  2IEK A;  1U8B A;  2XPU A;  2X6O A;  1DU0 A;  3CMY A;  5IPA A;  2FX0 A;  2GLO A;  4MLO A;  1JTX A;  1OCP A;  2JA8 J;  3C2B A;  2KDZ A;  1ETO A;  1ETW A;  3M4O J;  4IHX A;  3ZQH A;  3VVY A;  2EBI A;  2M8G X;  2F07 A;  4AYB N;  5CXG A;  3H3V K;  3GTQ J;  2L9R A;  4A69 C;  5IP7 J;  1HF0 A;  2O7T A;  5IYD J;  4CYC B;  3HOZ J;  2NVQ J;  3ZQG A;  3VUQ A;  1NK3 P;  3VOK A;  4UDS A;  3BTI A;  4MXM A;  3LNQ A;  2O8K A;  3JSJ A;  1ETV A;  4JP0 A;  1T33 A;  1QVT A;  2R0Q C;  5FKK A;  3L1P A;  5FKL A;  1GT0 C;  1VF9 A;  3S15 J;  5D19 A;  3MNL A;  2M9H A;  2R5Z B;  3K2A A;  3FK7 A;  2G7S A;  5EYR A;  3NXC A;  3Q0U A;  1JKQ C;  3RQI A;  3LSP A;  2HOS A;  3I4N J;  5GP9 A;  4EEF G;  5HSZ A;  2DN0 A;  2JJ7 A;  4B3A A;  2B63 J;  3BJB A;  2M0C A;  2Y31 A;  2CU7 A;  3CQZ J;  2DG7 A;  3KNW A;  2NVX J;  2XRL A;  5FJ8 J;  2VKV A;  3BQY A;  3JRG A;  1WCM J;  5GPC A;  2DA5 A;  3OSF A;  1FEX A;  2NS7 A;  1JJ8 C;  4BXX J;  1MBK A;  2ZB9 A;  3RH2 A;  1ETK A;  2EZH A;  1G2H A;  3TW6 A;  1ENH A;  4MO7 A;  2HDD A;  2HYJ A; 
#chains in the Genus database with same CATH topology
 4PFP A;  2PLY A;  5LGN A;  1TWF J;  2Q2E A;  5J4V A;  3L2V A;  3CCV I;  4AIK A;  2CRG A;  2DA7 A;  2PBI A;  3JRF A;  1U8R A;  4WXD A;  4UVB A;  4I09 A;  1P4W A;  3RQ4 A;  1JT0 A;  2ME0 A;  2V57 A;  3OYC A;  2IA0 A;  1JE8 A;  2R93 J;  5M5Y J;  4HF2 A;  4OOI A;  5FKO A;  2E5N A;  3W2A A;  1TNT A;  1P6R A;  1Y1V J;  2FBK A;  2XUB A;  4HX8 A;  3SZT A;  3QPL A;  2UUZ A;  4H4K C;  2EB7 A;  5K5R A;  2WAQ N;  3H9Q A;  3HJE A;  4DQ2 A;  2HEO A;  3VWB A;  4G12 A;  4KWA A;  4XN3 A;  3BR0 A;  5BPI A;  2DA4 A;  4O6J A;  3GWZ A;  4ZDL A;  2ISZ A;  3QPS A;  1YLF A;  3BZ6 A;  4E7I A;  5TRD A;  5HAW A;  2BE5 F;  5E8I A;  5DAJ A;  3ZMD A;  1MND A;  2EIN H;  2BXY A;  3L00 A;  4B09 A;  2G7U A;  3HOX J;  3GZI A;  2ZME A;  1KYZ A;  3COL A;  4CCO A;  1NG7 A;  4IKF A;  2BY3 A;  3GTO J;  2QF7 A;  3BTL A;  3L2R A;  2XKO A;  1ZGW A;  4HDU A;  2PQ8 A;  3FXR A;  1BR4 A;  3PNT A;  3T8T A;  2K9L A;  5J8F A;  1EH6 A;  1V54 H;  1EA3 A;  4Z6Y A;  3I56 I;  2DK8 A;  1S6L A;  3K7A J;  4FQG A;  3WU1 B;  4EGY A;  4E7K A;  1U5T C;  1FP1 D;  2KRC A;  4FHT A;  3CUQ C;  1QPM A;  4RA2 A;  1DPR A;  1P2F A;  3EYI A;  3QU3 A;  5HNF A;  5FRO A;  2VKH A;  2X9D A;  5CKT A;  3IKT A;  3S2D J;  3OMY A;  3P9K A;  3IUV A;  2XRN A;  4MHG A;  5BMZ A;  3HE0 A;  2EWN A;  2XGE A;  1XDS A;  3MQ0 A;  5HLH A;  2NS8 A;  2M34 A;  4PDK A;  2CUE A;  5FFZ A;  2GIV A;  3ZMV A;  2V1N A;  1BIA A;  4L0Z B;  1LB2 A;  4HV5 A;  1FYL A;  1GUU A;  1SD7 A;  3G4S I;  1R4M B;  4IVN A;  1RC9 A;  1Z91 A;  3MMY B;  4XL9 A;  3O60 A;  2LYC A;  1Y39 A;  1I6X A;  4LG3 A;  4M72 A;  2P6T A;  4XMY A;  1UZC A;  4NC7 A;  2X51 A;  3BJA A;  1QQI A;  4HLY A;  3WOD F;  5CVV A;  3HZJ A;  2VJ4 A;  1R4N B;  2IGK A;  1RI7 A;  1B8I B;  2ZBK A;  3KE2 A;  2HQ5 A;  1VQ4 I;  3F72 A;  3K4M A;  4D5C A;  5J4Y A;  3CC4 I;  5FGL A;  1ZTR A;  5LHH A;  1SD5 A;  2UXP A;  1D1B A;  3AL0 C;  9ANT A;  2GOM A;  3MVP A;  1FSH A;  4I99 C;  3F1B A;  3PQJ A;  4RLF A;  1ACI A;  3NI7 A;  3B81 A;  1RET A;  5E3L A;  2R7D A;  2FD5 A;  4UY8 I;  4D9J A;  2LTP A;  5B3S H;  3SZP A;  4C3J J;  3L2C A;  4MK6 A;  3KEO A;  4JNN A;  4HEA 2;  4EM0 B;  1ZLK A;  3GEZ A;  3V8L A;  2FJI 1;  2ME6 A;  4CSW A;  3ZOB A;  2LH9 A;  1A5J A;  3TL4 X;  3HM5 A;  3J80 Z;  2IPQ X;  2OZU A;  1OCR H;  1X1D A;  3SQN A;  2JA5 J;  1ZRC A;  3DBR B;  4N4O B;  3KP7 A;  4IJA A;  2DT5 A;  1EH7 A;  4CA0 A;  4DYC A;  1AWC A;  2WAQ A;  3MN2 A;  5BPD A;  2DTZ A;  2ZCW A;  3G71 I;  4NEL A;  3ABM H;  1SFK A;  1U2W A;  2EZI A;  2XDN A;  3K6G A;  2WUI A;  3V6G A;  2VBW A;  1EH8 A;  2RQQ A;  3LHQ A;  3KP4 A;  3LMM A;  1X1A A;  1HW2 A;  1T98 A;  3LFK A;  1IDZ A;  2IT0 A;  4XLN F;  5D8K B;  5LRS A;  2R92 J;  4AVZ A;  1X2M A;  3HIM A;  2NP5 A;  3EYY A;  2XAH A;  5GAG J;  4EJV A;  2JPC A;  2MG4 A;  1LNW A;  2W85 A;  1BW5 A;  1Z6T A;  5EF6 A;  4U9L A;  2VPL A;  1K7A A;  3PSF A;  2NP3 A;  2ZCN A;  2HZD A;  1JHF A;  2V6C A;  4DGW B;  2AHQ A;  4XNF A;  3VYU B;  2KIU A;  1BI0 A;  3K4K A;  4RAZ A;  2Q1Z B;  2K7L A;  2ZJ2 A;  4M9S A;  1ZRF A;  4YEL A;  3PUF A;  3DF8 A;  4HST A;  2IW5 A;  2JRT A;  4M3B A;  1H89 C;  1SFO J;  1IXR C;  3VOD A;  4RLQ A;  4YFN F;  1WZ2 A;  2E35 A;  2CH0 A;  3VYR B;  4GFK A;  3GTL J;  2M45 A;  3CTA A;  3FZV A;  1ONV A;  2R7F A;  4MFE A;  1S29 A;  3VYT B;  3S1R J;  2GXB A;  1X1B A;  3BZC A;  4LK0 F;  4GFB A;  2LK2 A;  4FX0 A;  2Z1D A;  2E1O A;  2JVH A;  3QU6 A;  1JJ6 C;  2P0W A;  1ZH5 A;  4HG2 A;  3KKC A;  1GV2 A;  3HRM A;  3SEQ A;  4O5V A;  3SEZ A;  2XAQ A;  1MNM C;  2MBF A;  4NC6 A;  1VZ0 A;  4C2U A;  4EVI A;  3MKY B;  3M7G A;  5CYV A;  1DPU A;  3TMO A;  1ZN2 A;  4C3H J;  2XSJ C;  2VB6 A;  4JX4 A;  2K4J A;  3KZZ A;  2HQR A;  1TWC J;  3ZGK A;  2L02 A;  2DPD A;  3WGI A;  1HDD C;  3RIR A;  1XC5 A;  4X0G A;  2M0M A;  2R7Q A;  1SGM A;  2GA1 A;  1YTY A;  4BS9 A;  5F0F A;  2ECC A;  1R5I D;  1O3R A;  2M30 A;  3LST A;  2FU4 A;  1JKO C;  1W36 C;  4BEH A;  2BEO A;  2HI3 A;  5HDG A;  1IRG A;  1AOY A;  2N8G A;  5JHF A;  2A69 F;  4JBA A;  3LSH A;  5LLQ A;  3J7A Y;  1XPX A;  1H88 C;  2KIS A;  1HQC A;  2EFP A;  1HLV A;  3PO3 J;  2D5V A;  1TZL A;  2QSG X;  2KZV A;  4EAT A;  3B6C A;  2CUF A;  1MBG A;  3RKQ A;  2FQ3 A;  1ETY A;  1K78 A;  4ZH4 F;  1WJA A;  1Z0X A;  2FBH A;  5BNG A;  1FTT A;  1UI6 A;  3CCJ I;  4P1W A;  2YVX A;  1LE8 B;  1MBF A;  5KNL A;  1ZQ3 P;  3ONQ A;  2DG8 A;  3RSN A;  4LLN A;  1WRJ A;  1XMA A;  5HBU A;  5HOD A;  2ZJQ F;  3BZK A;  5B5E C;  4G7Z F;  1F1Z A;  4RBO A;  4W97 A;  2STT A;  4CDG A;  4LG0 A;  5E3O A;  3Q9S A;  1IXS B;  1ZG5 A;  4B4C A;  2IGO A;  1TQM A;  3ZQL A;  4BYY A;  1VQP I;  2RDP A;  4Y3O A;  3FRQ A;  3EUP A;  3DPL C;  3K4J A;  3FXO A;  4O3M A;  5LHI A;  5EDN A;  1APL C;  1D1A A;  2XAF A;  1CF7 B;  3ISP A;  2JUC A;  3SHF A;  1DQU A;  2LMD A;  4GCK A;  1KZH A;  5IP6 A;  3PJR A;  3K0L A;  2RC4 A;  1H9G A;  5CVU A;  2F48 A;  2DI3 A;  3CP2 A;  3I4M J;  4R8H A;  3K8P C;  1WJD A;  4GFL A;  1L0O C;  3F8C A;  1JXS A;  4UB6 C;  4FIS A;  2M3A A;  2PBX A;  4KMU X;  3E5X A;  2M1B A;  1YJN I;  2QSF X;  1SC7 A;  4NNJ A;  2UXI A;  3TOB A;  4ZZD A;  1IRF A;  1T8I A;  1YX3 A;  5DS9 A;  3RD3 A;  4BNC A;  5IY5 H;  2D1H A;  1ZKG A;  4UUT A;  1V4R A;  1NHA A;  4AYB A;  3NPI A;  3Q5F A;  5AIP A;  2ZFW A;  2HOE A;  3G1O A;  4JYK A;  2XC7 A;  1YRN B;  3W6V A;  5EGO B;  4KIF A;  5D18 A;  4BHB A;  4XRS G;  3BOQ A;  2BOL A;  4BJ6 C;  2F5F A;  3I9V 2;  2HYT A;  2CG4 A;  3ABL H;  4B48 A;  2EZK A;  2CW8 A;  3L2W A;  2LY2 A;  3GCM A;  2FOK A;  3CJT B;  2L7K A;  1YS7 A;  2F5D A;  2CJJ A;  3U9G A;  5IOZ A;  2IP2 A;  1XTA A;  1YRN A;  1WPK A;  2H1L A;  5CQG A;  1RPW A;  2FNP A;  2XKP A;  1ZRE A;  4OIN F;  4XLA A;  4A3E J;  1W5C C;  4GCT A;  3VSL A;  3HG9 A;  2F4M B;  2UV1 A;  3Q0V A;  5CJ9 A;  1K4S A;  4F92 B;  3E1S A;  2R7Z J;  4ENN A;  3HEF A;  3OYF A;  1BW6 A;  3CF2 A;  4RGR A;  2FML A;  1MMA A;  2WAD A;  2NNY A;  4MGR A;  1MDM A;  2JA7 J;  2VOP A;  2QKL B;  3OYH A;  2DMT A;  4BDY A;  1JGG A;  1RR7 A;  1MNE A;  3LSG A;  3A03 A;  2O03 A;  5IT9 Z;  2V1U A;  2XV4 S;  3HSE A;  2FEZ A;  4ENK A;  2X6O A;  2HZT A;  1OIS A;  5FB2 A;  1FOW A;  1X19 A;  1GXQ A;  2QVO A;  3E6D A;  3CJR B;  1ZLJ A;  1W1W E;  2BXZ A;  2P7V B;  4MQ9 F;  1S7A A;  3WTV C;  3GW2 A;  4LB6 B;  4KIS A;  4L5I A;  3VDX A;  4OIO F;  4IL6 C;  3CD6 I;  3K4N A;  1TNS A;  2YPR A;  2M8G X;  4CCN A;  2F07 A;  4AYB N;  3IRQ A;  3JTH A;  5CXG A;  3AAF A;  3D0S A;  4HQE A;  2O7T A;  1HF0 A;  4XKV A;  2JT1 A;  5FO5 A;  3VUQ A;  2ZXJ A;  1YG2 A;  3BTI A;  4KT5 C;  2ZO4 A;  5HDN A;  1ETV A;  5E20 A;  1SVM A;  4ZDP A;  2R0Q C;  2OV7 A;  3OR2 C;  2KL4 A;  2M8E A;  4XOP A;  5FKL A;  1GT0 C;  1YE9 A;  2IVM A;  5D19 A;  3MNL A;  5E79 C;  2MFZ A;  3QPH A;  1VQ5 I;  5EYR A;  3Q0U A;  2RRE A;  2DBB A;  3VOE A;  2DT7 B;  1UST A;  3KP6 A;  5CVR A;  1IAW A;  2CFO A;  2V4J C;  4XR6 A;  5GP9 A;  2DN0 A;  1E3P A;  2JJ7 A;  1W7P A;  1SD6 A;  1VQL I;  2CU7 A;  3CQZ J;  4CCJ A;  3OS1 A;  2KRF A;  5FJ8 J;  3JRG A;  2A61 A;  4RB1 A;  5D5W B;  1SFU A;  1WSU A;  1STZ A;  2UXN A;  2DA5 A;  1FEX A;  3DBH B;  4MTE A;  4LD5 A;  1MBK A;  3K1N A;  1K6O A;  3K2Z A;  2EZH A;  3OYI A;  1A31 A;  4Q47 A;  2ZJP F;  1O7L A;  3LQQ A;  5KVR A;  4A0Y A;  4BJ5 C;  1FPQ A;  1PJR A;  1WQ2 A;  3HRT A;  5A2Q Z;  2L54 A;  4FX4 A;  1Y8Q B;  3KIO A;  5ICC A;  2MLK A;  1OR7 A;  2PX9 A;  2P5V A;  1JTY A;  2OTJ I;  2BZT A;  4DJA A;  3OYK A;  1ETX A;  2WTE A;  3KZI C;  5L3F A;  3ELK A;  3EUK L;  1DU6 A;  1QO0 D;  5EEG A;  4AIJ A;  4M74 A;  3WTZ A;  1Z7L A;  4BBS J;  1Z77 A;  3M9A A;  1BI3 A;  3CLO A;  4RM2 A;  2L2O A;  4CGR A;  3VW0 A;  3SXY A;  2X6Y A;  3N4M A;  2GEN A;  2M4K A;  5CW8 A;  1OJL A;  5H6Q A;  2Y69 H;  2EA4 A;  5HLG A;  3A01 B;  1BJA A;  1IG7 A;  4J01 A;  3ZP5 A;  1AA7 A;  3L7W A;  4L9N A;  3WGH A;  1QBJ A;  1BC8 C;  4ICH A;  4CZZ A;  2KFD A;  3OYJ A;  4KA4 A;  1NK2 P;  3CC2 I;  4M3F A;  4YIF A;  1SMY F;  3T6N A;  3WGG A;  2D1V A;  4Y7N J;  2OER A;  3HL2 A;  4BHC A;  1AU7 A;  2PMU A;  5DD8 A;  2VL8 A;  3HKZ N;  1P7I A;  2H09 A;  2E60 A;  3SFZ A;  3FKJ A;  3LAP A;  3CMA I;  4JX6 A;  4HV6 A;  4ZTF A;  2Q8K A;  2MC4 A;  4C9Y A;  1PVE A;  1JUM A;  2H6C A;  2KP6 A;  2NXN B;  4NC8 A;  4FAS D;  3MKW B;  4PCQ A;  1TW3 A;  1RES A;  2MD5 A;  4A3L J;  3KCC A;  4FET A;  5LHG A;  3JRE A;  2QA4 I;  3E6B A;  1O57 A;  1X3Z B;  1OCT C;  3CDL A;  4XK4 A;  4M3E A;  1HA8 A;  1AKH A;  1S7E A;  3O8H A;  3G2B A;  4U7D A;  5JR3 A;  1QHH D;  3FKI J;  4PJL A;  5EFY A;  2A5Y B;  4PJN A;  2H6B A;  1LJ9 A;  4A5M A;  2CV2 A;  3PUB A;  4GCL A;  3BPX A;  1WI9 A;  2VKE A;  1D8J A;  3FXL A;  2FNA A;  3RZO J;  1FOK A;  3RZD J;  3IAM 2;  4G7O F;  3IL2 A;  3B73 A;  2WA0 A;  4YZE A;  3VW2 A;  5F08 A;  1Y0N A;  1SAX A;  3TP3 A;  2NAZ A;  3CCE I;  3CRJ A;  5F0C A;  1MD0 A;  3F8N A;  1XGO A;  2LG4 A;  1OFC X;  2O8X A;  3K9T A;  1KYW A;  3I71 A;  1XDU A;  5GAH J;  3DP7 A;  4LIT A;  2E36 A;  4AF5 A;  2GAU A;  1XGN A;  3R4K A;  3RPU A;  3TW7 A;  2HKO A;  2MGQ A;  3E5U A;  1B72 B;  1YIO A;  2LRD A;  3IUO A;  3P5J A;  2BY2 A;  2V7F A;  4M73 A;  1ZR4 A;  4AU7 A;  2A3S A;  1YJW I;  4Y15 A;  3WG7 H;  1FBS A;  1UFM A;  1FZP B;  3CUQ A;  1A6I A;  3DEU A;  3QQA A;  2GXG A;  4LJZ F;  5GPA A;  3OYD A;  4AM3 A;  1FBU A;  4F55 A;  2A6H F;  2XGD A;  4P55 A;  1O4X A;  3VVZ A;  3CJN A;  3JAM K;  4L5J A;  3S2H J;  1QPI A;  3NNR A;  2VI6 A;  2A6E F;  2ZOY A;  1TW2 A;  1HSJ A;  4JOM A;  1SAN A;  4D7M A;  2FOW A;  2TRT A;  2RKH A;  3CCL I;  3BG5 A;  4J00 A;  2E1M C;  3GXO A;  4BUP A;  4XRM A;  3DU6 A;  1GLN A;  1YIJ I;  4V2F A;  1J59 A;  3JAM Z;  4RAF A;  3EDP A;  1FY7 A;  1HKS A;  5K1Y A;  2DMQ A;  1R1U A;  1MGT A;  2W24 A;  4L18 B;  3DXJ F;  2BW3 B;  4LLL A;  1TTY A;  3SDB A;  3CC7 I;  4L5E A;  3U2R A;  4M9X A;  4BE0 A;  1W7P D;  1OLT A;  2QGU A;  3AG1 H;  2DT6 A;  1SAU A;  1LFB A;  2K9Q A;  2ACJ A;  2KQR A;  3ECO A;  3KZ9 A;  1G3Y A;  2A05 A;  3UNG C;  3JSP A;  1XMK A;  5EZG A;  2KJB A;  2GUH A;  2JZY A;  4HNT A;  3GLL A;  3P9T A;  1FLI A;  1Z67 A;  2DA2 A;  2R3S A;  4HYE A;  2W82 A;  5HDK A;  1P7J A;  1XGS A;  2K5C A;  2YX4 A;  1PUF B;  2EFN A;  3DPJ A;  1SFX A;  1RNL A;  1HOM A;  2VT3 A;  2EFQ A;  3WE3 A;  2K27 A;  1T95 A;  2E1N A;  3QP6 A;  3PO2 J;  2J5O A;  3ON4 A;  4IOA F;  4CO8 A;  1Z7U A;  1YFH A;  3G56 A;  5LD2 C;  5E8G A;  1VQ8 I;  4RGS A;  2MYS A;  3E0J B;  2GBY A;  3FHZ A;  4PK4 A;  1POG A;  2HNH A;  3NWT A;  2DTR A;  4AIH A;  5FLV A;  3PNV A;  3DPT A;  3O8G A;  4KJZ A;  4Q5S F;  2IS2 A;  4BHP A;  1ULY A;  2ZOZ A;  3DLL F;  2ZKZ A;  3DFG A;  3QP5 A;  4L9V A;  5L3E A;  3C07 A;  3VEP A;  3GTK J;  1KQ8 A;  4EM2 A;  5K5Q A;  3TP0 A;  1V5F A;  1FT9 A;  4BAY A;  2RGV A;  4HPQ A;  4WCG A;  4AID A;  3C2G A;  3K4C A;  1I3Q J;  1YQA A;  2XVC A;  2GWR A;  3DPU A;  1FYM A;  2G3B A;  2QCO A;  1S72 I;  2K3P A;  5KCM A;  2HYF A;  4BY1 J;  3H5R A;  2EV6 A;  2XRO A;  3E6C C;  2VUM J;  4EGZ A;  3FM5 A;  2XF5 A;  4M71 A;  1W5T A;  1VND A;  3BR3 A;  2RVC A;  2ZCX A;  1O3S A;  3ERE D;  5IT9 K;  2MAB A;  3BT9 A;  4XM3 A;  4IO9 F;  3ML6 A;  1HW1 A;  3RI4 A;  2Y0M A;  2E34 A;  4G6T B;  4IPA A;  4G6D A;  4I7H A;  2H94 A;  2XB0 X;  3HTS B;  2COB A;  2HQN A;  2X4H A;  3FBI B;  2FJ1 A;  1UI5 A;  4A3I J;  1FIP A;  2XAG A;  1W4M A;  1MJB A;  4HAM A;  4EJW A;  1K6Y A;  2M87 A;  2NX4 A;  2E2H J;  2K9S A;  4RGU A;  1J5Y A;  1UB9 A;  5DM6 F;  4ACI A;  3S16 J;  4HF0 A;  3H3U A;  1X3W B;  4EMS A;  5J1R A;  3BJO A;  3A4C A;  3HHH A;  4P9F A;  3RJP A;  3KEY A;  4DNC A;  3DTK A;  5K7F A;  5B1B H;  3V8K A;  3DKY A;  3MZH A;  2XIG A;  4D7N A;  4U0Y A;  2EIK H;  1OR7 C;  1BOB A;  4A3J J;  4BE1 A;  5D4S A;  4I6Z A;  1UHW A;  2HDC A;  5E3N A;  2MH9 A;  1A6Q A;  1R71 A;  3P9C A;  3PL8 A;  4E70 A;  1OYI A;  4PUS A;  4A5N A;  4WX9 A;  1IV8 A;  1WJ5 A;  5C44 J;  2HOT A;  3BG7 A;  2FBI A;  2R5Z A;  3T8R A;  4KT6 A;  2QYO A;  1BBY A;  1YW7 A;  2WB1 A;  5L3D A;  1MH4 A;  4M6V A;  5M5W J;  1A04 A;  2WBM A;  1R5G A;  1E17 A;  1M1E B;  5JI6 A;  2NRA C;  3D5L A;  4HA8 A;  2ZJR F;  4X6A J;  5L3C A;  2C6Y A;  3TBI A;  2V1X A;  1OYY A;  1XSV A;  2ZSH B;  4ESB A;  2L01 A;  3H9J A;  2BGC A;  2G7G A;  1ITY A;  4AUX A;  2IJL A;  4BL0 B;  2DMU A;  1G6N A;  4ZYE A;  4YG2 F;  3Q9V A;  4C30 A;  5C3E J;  3CCQ I;  3G7R A;  3HTJ A;  3H0D A;  1F36 A;  1WH7 A;  4F91 B;  1ON2 A;  2K02 A;  2REK A;  3R0J A;  1YS6 A;  2LR8 A;  3DTE A;  3JRD A;  1G3T A;  2ZC2 A;  1MJ9 A;  2HTS A;  4C2M J;  3GVA A;  1TWH J;  1B9M A;  3BP8 A;  3BG6 A;  2DQR A;  5KHD A;  1YI2 I;  4II3 A;  4IHW A;  1IN7 A;  3DEW A;  4RM3 A;  2ID3 A;  2VC0 A;  5DCF A;  5DYM A;  3RKW A;  1RIO H;  1R9T J;  4HKU A;  4UUS A;  4LIU A;  1YYV A;  3LFU A;  2DQL A;  2BW3 A;  1ZAO A;  2DFI A;  1D8K A;  1WWX A;  2EFO A;  4F7Z A;  1T38 A;  4DZJ A;  4QLC U;  1FOY A;  2E7W A;  4DVY P;  2DO7 A;  2DJI A;  2GQQ A;  5K58 A;  5J1U A;  2J5P A;  4BDZ A;  4QIW N;  4ZZL A;  1RZ4 A;  5LFA A;  1T2K A;  2G0E A;  1MJA A;  2Y48 A;  2E71 A;  3D1N I;  2WWY A;  3FMS A;  3RYR A;  3ZN0 A;  5FLX Z;  1WJF A;  3QOP A;  3J80 K;  5JVT A;  2K9M A;  2DXI A;  3KZY A;  1U5T B;  3IC7 A;  4M3D A;  2L7F P;  3FM3 A;  1I50 J;  2DU9 A;  4JKZ A;  2OAZ A;  2WB1 N;  4OWR B;  5IYB J;  3NAU A;  4XRS A;  2QSH X;  1A36 A;  3R6S A;  2CYY A;  5ICG A;  3CF5 F;  3UKG A;  1YHQ I;  4LLG F;  4XIC A;  3OYL A;  1H0M A;  3K1P A;  2DFF A;  3BLY A;  3OIQ A;  2OCE A;  4ZDO A;  3S5R A;  3CUO A;  3FX3 A;  2LFB A;  1F43 A;  3C7J A;  5ILS A;  2LF8 A;  3IH2 A;  3VVX A;  2EV5 A;  4HZF A;  2OF7 A;  3W6K B;  3PIO F;  1REP C;  1ERD A;  3BR2 A;  2R7S A;  4OIP F;  4B1R A;  1J7K A;  1B9N A;  2EZL A;  2Y9Y A;  1XSX A;  2Z99 A;  2PMZ N;  4LFU A;  4EJU A;  1HST A;  1SVL A;  2EIJ H;  1FYK A;  4NB5 A;  3NS4 A;  3C1D A;  4DIQ A;  2LLK A;  3ABT A;  1UG2 A;  2HXI A;  2XPW A;  1J9I A;  1WVR A;  4AWX B;  3FBN B;  3ZMS A;  4XKB A;  2O61 A;  2VE8 A;  4KDP A;  1JI8 A;  2M2E A;  2XSD C;  1G4D A;  4A3B J;  2MC3 A;  1DP3 A;  3CJQ B;  3HOT A;  4K2E A;  3F22 A;  2OQR A;  1DU0 A;  4IRG A;  3FXQ A;  3CMY A;  2VQG A;  4MLO A;  2KDZ A;  4HSR A;  1I39 A;  4KUM A;  3RKX A;  1ETW A;  5LGU A;  3EUH C;  3HXL A;  2QWW A;  3A2K A;  4D1Q A;  2QM3 A;  3CZ6 A;  5GAE J;  1FOX A;  1E2X A;  1IN8 A;  4RB3 C;  3GTQ J;  1QU3 A;  4QWQ A;  1TQP A;  3KEQ A;  4A69 C;  3I64 A;  4YEJ A;  3U21 A;  4CYC B;  2EFW A;  2NVQ J;  3ZQG A;  1EJ9 A;  4RAG A;  4WXC A;  1X1C A;  4MXM A;  4AD9 A;  2QBY B;  3LNQ A;  2B0L A;  4NQW B;  2AXL A;  1T33 A;  1U3E M;  2DYS H;  5FKK A;  2HR3 A;  1FP2 A;  3IWF A;  3M8J A;  2QQ8 A;  2P6S A;  3HKZ A;  2M9H A;  3K2A A;  3W6J B;  3L2U A;  1A35 A;  3NXC A;  2BVM A;  2BHZ A;  3JTG A;  1VQN I;  4XBF A;  1JKQ C;  1ZG1 A;  3GO5 A;  5EJC A;  2HOS A;  2QEN A;  4UNO A;  4ENJ A;  2OBP A;  1Z3Y A;  2Y31 A;  3KNW A;  3QRF F;  2ZXW H;  4H0E A;  2A07 F;  1K4T A;  5D5U B;  2V9V A;  4KN4 X;  1IO2 A;  2JUG A;  3SYT A;  3VB2 A;  5GPC A;  4F3Q A;  4G8X A;  3TO9 A;  1FBQ A;  5LEJ A;  3K4L A;  1R7J A;  4LB5 A;  3E6M A;  4G7H F;  4OU0 A;  1Z3X A;  3V7S A;  4BE2 A;  3DV8 A;  4XLE A;  4Y17 A;  2ZB9 A;  1UAA A;  2QEX I;  1S3J A;  2Z5U A;  4G94 A;  2DAO A;  2RV8 A;  3TO7 A;  3F9K A;  1LFU P;  3NRG A;  3KP2 A;  5HLI A;  4KNY A;  4PSX A;  1N78 A;  1OQY A;  3JRB A;  3IWZ A;  4LIV A;  3LL7 A;  2ADU A;  4U0V A;  4IRH A;  2STW A;  1Z05 A;  2IGN A;  1P9Q C;  3OS0 A;  5J3L A;  2R4G A;  3ASN H;  1O3T A;  2O7O A;  3A1Y A;  2PMZ A;  2CS3 A;  4S04 A;  2VC1 A;  4DOZ A;  1IF1 A;  2QIB A;  2GIZ A;  5AON A;  4M3G A;  2ID6 A;  3TOA A;  2HDW A;  3AFH A;  2W1O A;  4IRV A;  3BRO A;  4IQJ A;  5JVG F;  3RDI A;  2Q2E B;  5ILV A;  2YR2 A;  3QOD A;  1J0R A;  5HS7 A;  2QLZ A;  2X6W A;  3HDD A;  4B8X A;  3HGY A;  1JKR C;  1VQM I;  2K4B A;  1S8N A;  2A2F X;  3Q0W A;  2NOJ B;  4BGD A;  2D2W A;  1HDP A;  2ESH A;  2VQL A;  3GFI A;  1VQ7 I;  2AQF A;  2XDV A;  2LD5 A;  2OD5 A;  2PMH A;  1I3A A;  1CGP A;  3UR3 C;  3WHC A;  1MMS A;  1ETQ A;  3QBM A;  3JW4 A;  2XGX A;  3ZQC A;  4XLC A;  3ZR8 X;  1IDY A;  3TQN A;  2HVR A;  2P4W A;  3WU0 A;  2GM4 A;  3K69 A;  2FF4 A;  3AG3 H;  3S17 J;  1R1V A;  3EPZ A;  1PP7 U;  1HBX G;  4KFC A;  3PPB A;  2K40 A;  1B59 A;  4HF1 A;  4LG0 B;  2IGM A;  1UCR A;  2JWT A;  4IHY A;  5BQT A;  3JRH A;  2WV0 A;  5IOY A;  1BN5 A;  2G7L A;  3GZ5 A;  4NDL A;  2EK5 A;  3K10 A;  2W84 A;  2WAE A;  3CMM A;  2DFH A;  1R49 A;  2GXA A;  3ZQI A;  2V6E A;  5DM7 F;  1Z1D A;  2RHA A;  1I27 A;  3LSK A;  2Y75 A;  3FXJ A;  5AIQ A;  2L3D A;  5IT3 A;  2QWT A;  1IV6 A;  2ZME C;  1KON A;  3OY9 A;  1OPC A;  3CME I;  2E1C A;  2F5V A;  4Y33 A;  2KLO A;  2JA6 J;  1U9N A;  2Y0S N;  2VOO A;  4DYQ A;  1PP8 F;  2VN2 A;  1DGR M;  2VE9 A;  2AS5 F;  2RAS A;  2OC6 A;  2CW0 F;  3MD2 A;  3CJD A;  4WF2 A;  2KDO A;  3FMR A;  3ZQQ A;  2ZY9 A;  3QYF A;  3BG9 A;  3ANG A;  3F23 A;  1CQT A;  2FQ4 A;  3F3X A;  3S1N J;  3CCY A;  4MTD A;  1ZGA A;  5J40 A;  2DOD A;  3H35 A;  1Q1V A;  2WV1 A;  1TWG J;  2R5Y A;  1LDJ A;  1IN6 A;  3J7Z I;  5D1R A;  4A3M J;  4D5F A;  1T08 B;  2M5W A;  4RS8 A;  3K70 C;  1VQ9 I;  2DMN A;  4ITV A;  3BDD A;  2IS6 A;  1R22 A;  5F0H A;  1F5T A;  2YU9 J;  3PAS A;  3WTW C;  5CQE A;  1V5G A;  3OOP A;  1C0W A;  2CQQ A;  3KYC B;  2CFX A;  2HTJ A;  1IXC A;  2ELH A;  4CCM A;  4A3F J;  5F6F A;  2CGP A;  4DBQ A;  2PJR A;  1JUP A;  5E17 F;  2IU5 A;  2PZ9 A;  3HOY J;  5J47 A;  4XID A;  3MFK A;  3ZXS A;  4UUV A;  2CSO A;  1XG1 A;  2PI0 A;  2ZFU A;  3JRA A;  2LOO A;  1IRX A;  2QKM B;  1R00 A;  2JRM A;  3WE2 A;  2HKU A;  1XD7 A;  2Y0S A;  2UXU A;  2YVH A;  3GME A;  4FT8 A;  2EIL H;  4GDF A;  3O2P E;  2Y30 A;  2F5C A;  4IHS A;  2IBD A;  3OR1 C;  4IHV A;  4XQF A;  2DCE A;  2CUJ A;  3NQO A;  4MNU A;  1QVU A;  1BJZ A;  2I10 A;  1SD4 A;  3HTI A;  2LP0 A;  5E18 F;  3KP3 A;  2UZK A;  3N05 A;  3JR9 A;  4DYR A;  5LEK A;  2ELJ A;  4CHU A;  4CUG A;  4M9Z A;  1GXP A;  3S3O A;  3CDH A;  3VIB A;  1DP7 P;  3DQV C;  2A5W A;  4YFX F;  1RUO A;  3F8B A;  1IW7 F;  2DDB A;  1O3Q A;  2ECB A;  4BQN A;  2QBY A;  1DGW Y;  2VJ5 A;  2HVS A;  1UJ8 A;  2QZ8 A;  3DWL E;  1MBJ A;  2B7E A;  3V7C A;  3OSG A;  4IQ4 A;  2NS0 A;  3O6B B;  2JSC A;  2WY7 Q;  3BR1 A;  3GFM A;  3ROU A;  4DZP A;  5F27 A;  1G8X A;  1LE8 A;  4A3C J;  2EQR A;  3O3K A;  5L3B A;  4BQO A;  4A2U A;  2VT2 A;  1IN5 A;  2K3F A;  3FDY A;  4EV0 A;  5DDG A;  2IS1 A;  5DEQ A;  2PJR B;  3HIF A;  2H27 A;  2D6Y A;  4XRF A;  4JQF A;  5GTI C;  1T0F A;  5K7H A;  3OYN A;  3J7A O;  2JQ7 A;  3U1D A;  3HSR A;  3F21 A;  4ENM A;  3S3M A;  3I58 A;  2EH3 A;  2X48 A;  2RAE A;  3BPV A;  2DA6 A;  2CQX A;  2E2I J;  2Q24 A;  3FF5 A;  3FMQ A;  4U87 A;  3HTA A;  2JMW A;  3BC8 A;  5K7Z A;  3MAJ A;  1D0Y A;  2E5Z A;  4TV7 A;  5DTD A;  1HXD A;  2F6C A;  4CZC A;  2PG4 A;  3I53 A;  1ORK A;  3OL3 A;  2NVU B;  2KMU A;  2QUF A;  5KAF C;  3JRC A;  4HOB A;  4XN0 A;  2BYV E;  3C3W A;  2NNN A;  1X58 A;  2MLG A;  3MWM A;  5BOX A;  2DOF A;  4DBR A;  3WTX C;  1H8A C;  1G3S A;  4M6X A;  4DW6 A;  1BM9 A;  3E5Q A;  3PM1 A;  3R60 A;  2V1D A;  4GRI A;  1D3Y A;  4M6Y A;  5FD6 A;  3QKX A;  2FXA A;  2KZG A;  2W48 A;  1RRJ A;  5F1R A;  3S1M J;  4XKW A;  3ABK H;  1FIA A;  2R7W A;  1BL0 A;  2OJE D;  2Z3Y A;  3BCB A;  4C2M A;  5K5O A;  4A0X A;  4BU2 A;  1X1P A;  4GYG A;  3HOV J;  1UHM A;  4IEJ A;  4NUB A;  3VTI A;  1LQ1 A;  3CCS I;  5ILU A;  1BR1 A;  3HPG A;  4F93 B;  1Y0U A;  1IN4 A;  4L0Y B;  3KP5 A;  3ZQF A;  2DLL A;  2YS9 A;  3IKV A;  3GLX A;  1SVO A;  3S2W A;  2O9L A;  2AQE A;  2VLA A;  3S1Q J;  3KPH A;  4XON A;  2YSR A;  3ASO H;  3LWJ A;  1W36 D;  2OPT A;  4ZC3 A;  2KIM A;  3QYB A;  5BS6 A;  2NVT J;  4GYI A;  3L09 A;  4MQV A;  4UUS B;  4OMZ A;  5M3F J;  4U9N A;  3I0T A;  3VPR A;  5HNH A;  1W0U A;  2A68 F;  1HW5 A;  1LDD A;  3HBL A;  4HNU A;  3D5S C;  4AVP A;  3RYP A;  2ZXI A;  4J19 A;  1T6S A;  5HS9 A;  3V78 A;  1P92 A;  3VYS B;  3CO7 C;  2QQ9 A;  2P5L C;  1OKR A;  4EJT A;  1WI3 A;  1XN7 A;  2LBF A;  1TC3 C;  4A0Z A;  2OTL I;  3GEU A;  3PFY A;  2CV1 A;  2JTV A;  1ZK8 A;  1WFX A;  4II2 A;  4WWC A;  2VQC A;  3ESW B;  1U0J A;  2L7Z A;  2O5R A;  3I59 A;  4BH9 A;  1YW9 A;  2OU2 A;  4YFK F;  1SEU A;  3LOC A;  2DFE A;  4E7J A;  1QZE A;  3LA3 A;  3OYA A;  4OIQ F;  3WTU C;  4KIT B;  5H20 A;  3OYG A;  1ZAR A;  3IRR A;  4CYC A;  2RQP A;  2W7N A;  3HTH A;  3LAJ A;  3K1M A;  2H8W A;  4XSZ F;  4HDV A;  4C2T A;  4I0B A;  3GYH X;  2RNJ A;  3HPH A;  1XS9 A;  2I5U A;  2HQA A;  2W4S A;  4A6E A;  3AKZ A;  2XF7 A;  4ESF A;  2Z16 A;  2XGC A;  3K70 D;  1P4X A;  4U0W A;  4A3G J;  1Q1H A;  2VON A;  3G1L A;  1MMN A;  3OL4 A;  1VQO I;  1MMG A;  5B66 C;  3LWF A;  3TDZ C;  4AC0 A;  3CO6 C;  3F8F A;  1TBX A;  2QOP A;  3HRU A;  3ULQ B;  2KRH A;  4W1U A;  2HFH A;  1YIT I;  2LKX A;  1VQ6 I;  3GTJ J;  3OYB A;  1BR2 A;  1MSE C;  2KHM A;  1YW8 A;  1YJ9 I;  1UHS A;  4ANJ A;  4CH7 A;  1PYV A;  2XPV A;  5EEA A;  2LRE A;  2R5Y B;  1HKQ A;  1GVD A;  3BR5 A;  3S14 J;  2V9K A;  1D5V A;  3CWR A;  2PFV A;  4PXI A;  1NH3 A;  2LDU A;  4MEX F;  2ZSI B;  1USS A;  2ESN A;  1R58 A;  2KIQ A;  1GVJ A;  4KIB A;  4UXN A;  4OMY A;  2YX7 A;  3LA2 A;  1W7P B;  4E6K G;  3H0G J;  4HBL A;  4BY7 J;  1HCR A;  2GFN A;  2E2J J;  1I1G A;  5HLT A;  4E7Z A;  2VIX A;  4NN1 A;  4LK1 F;  2WGB A;  5H9T A;  4GXO A;  3KET A;  2AO9 A;  3NEU A;  3H5A A;  3CES A;  1EF4 A;  2IXS A;  4IF4 A;  1F9N A;  2K85 A;  2L7M P;  1I1S A;  3AQS A;  2P81 A;  3DLA A;  1L3L A;  2HPM A;  3ZMU A;  3HYI A;  2Z33 A;  1KGS A;  2IRF G;  1CF7 A;  4ZTJ A;  2GLO A;  2LSO A;  1JTX A;  3C2B A;  3V4G A;  5DD4 A;  1ETO A;  5DCM A;  4CGZ A;  2HPI A;  2X85 A;  4OD5 A;  4IHX A;  2V79 A;  3VVY A;  2LF7 A;  1B4A A;  4N4N B;  5GAD J;  1X4P A;  4Y13 A;  2XAU A;  3B02 A;  3A0H C;  3TGN A;  2XF6 A;  4U88 A;  4RAY A;  1NK3 P;  4UDS A;  3ABU A;  4BJT A;  3RKY A;  1PDN C;  4IZZ A;  3E3V A;  3JSJ A;  4JP0 A;  6PAX A;  1QVT A;  1V3F A;  1OCC H;  3OYM A;  2BY1 A;  4CYD A;  5D6F A;  3U1K A;  1LVK A;  2R5Z B;  4EQQ A;  3M8F A;  2G7S A;  2JPB A;  2ZME B;  1KQ0 A;  1ZRD A;  4HW0 A;  3RQI A;  3LSP A;  3R0A A;  1VTN C;  5HSZ A;  4G6Q A;  3H9G A;  3L9F A;  3GUD A;  3PQK A;  2ZNY A;  2M0C A;  2DG7 A;  1KA8 A;  2CQ7 A;  2NVX J;  3F8M A;  1QGP A;  3BQY A;  2FMY A;  3H36 A;  2V26 A;  3CLQ A;  5HVQ C;  3FHN A;  2P8T A;  3OSF A;  5EEH A;  4S05 A;  2NS7 A;  1JJ8 C;  3ZMZ A;  4I2O A;  5DUK A;  4BXX J;  2ICW G;  2X6X A;  4ETS A;  3RH2 A;  1ETK A;  3TW6 A;  1UG0 A;  2AXT C;  3PSI A;  3EUH A;  1ZEL A;  2HYJ A;  1WJB A;  1FMW A;  1BIB A;  2CW7 A;  3ZPL A;  4BEH B;  1GV5 A;  2PFB A;  3BCG A;  3L2Q A;  2ZXH A;  4B47 A;  1TL8 A;  5HOO A;  2W53 A;  2LKP A;  4PSW A;  3QOE A;  1IC8 A;  4GO1 A;  4NBQ A;  2CQN A;  1XSD A;  3IV5 A;  1B1B A;  1QRY A;  3WTS C;  3KKD A;  2FSW A;  4PJ0 C;  2X1D A;  3CCU I;  3IH3 A;  2HYG D;  3H3Z A;  3ZMT A;  3JRI A;  2IS4 A;  2DOA A;  3H5N A;  3IP4 B;  2OCC H;  4YIR X;  1FMV A;  4X1E A;  2KJC A;  3LQR A;  4XLP F;  5EGO A;  4UVA A;  4I76 A;  1T56 A;  1IZ1 A;  4FTH A;  3G3Z A;  4OAY A;  3ZRG A;  4FE7 A;  3ANP A;  2OA4 A;  4IOC F;  4C3I J;  2P5K A;  2RNG A;  2VBY A;  1ZG3 A;  2EV0 A;  5M3M J;  4BAC A;  2VJJ A;  3S3N A;  2MA3 A;  5EZH A;  2CQK A;  5F04 A;  2DMP A;  1IRZ A;  1JT6 A;  4CXF A;  5CVI A;  2HWV A;  3VSK A;  2VBX A;  2EPF A;  4ASN A;  5FFX A;  3HOU J;  5CPR B;  3MCZ A;  1AHD P;  3V42 A;  1VFC A;  3DKW A;  3A0B C;  2DJN A;  3HRS A;  5C4J J;  1IUF A;  1NG6 A;  3E97 A;  3LJL A;  3WU2 C;  1K61 A;  2MSY A;  3J81 K;  4S0H B;  3T5X A;  1VI0 A;  2K86 A;  3ON2 A;  1GDT A;  1MZB A;  2FE3 A;  3OOU A;  1PUE E;  4KN7 X;  2DA3 A;  3CCM I;  2QTQ A;  4ESJ A;  1K78 B;  3WTT C;  1KQ9 A;  2CO5 A;  4ZYH A;  5EG0 B;  1EV7 A;  2LBF B;  3T1B A;  2OI8 A;  5B1A H;  4L62 A;  2MW8 A;  3ECH A;  3OWT A;  5CVJ A;  2H1K A;  4HQM A;  1V5E A;  2G7H A;  2WC2 A;  3BQZ A;  3IAS 2;  3W2W A;  4CCK A;  3LSR A;  4Y4R A;  2O3F A;  4JL3 A;  4WIB A;  3HC7 A;  1QA6 A;  2CWE A;  5TIS C;  5H2F C;  1T39 A;  1YOV B;  3DEE A;  4PGH A;  5GTH C;  1WJE A;  4OD4 A;  1LKX A;  1DUX C;  3CCR I;  4ZJZ A;  2E7X A;  2HOA A;  1TT0 A;  3FIW A;  3E7Q A;  1WGX A;  2Y9Z A;  2MD0 A;  3E7L A;  4BQQ A;  2ELK A;  2W57 A;  3RTR A;  2HS5 A;  4XSX F;  2L4A A;  4Y52 J;  2L9N A;  2X1E A;  5TGT A;  1N25 A;  1WJC A;  3GF2 A;  5J8C A;  3WHB A;  3S93 A;  3F6O A;  1MBE A;  5IP9 J;  2HKX A;  1OCZ H;  2KPM A;  3V8J A;  2HU9 A;  3QPT A;  3MKZ A;  4B43 A;  4I02 A;  2UXO A;  2L0K A;  1YX5 A;  1SMT A;  5J6X A;  5ED4 A;  2F4I A;  3COA C;  4A6D A;  5FHP A;  3IHU A;  5JHU A;  4Q48 A;  3RPQ A;  2QQA A;  3H92 A;  1IJW C;  3BR6 A;  3PFI A;  2M7A A;  1MBH A;  1UMQ A;  3KX2 A;  4QSH A;  3REO A;  3KLO A;  4A3D J;  4MFD A;  4ON0 A;  3KFW X;  1LEA A;  1J75 A;  2B1E A;  5C4Y A;  4Q4Z F;  4I0A A;  4RB0 A;  3Q3S A;  5LRR A;  3G6E I;  5E1X A;  1FJL A;  1FSE A;  3C2H A;  4D0P A;  4HX4 A;  3GZ6 A;  1B8I A;  3T0Y A;  3CUQ B;  1ZGJ A;  2OQG A;  2Z2S B;  3BTJ A;  1SFE A;  1F4K A;  1MSF C;  5FLX K;  4I98 B;  4BXU A;  1LDK B;  4A93 J;  5ICF A;  5TJJ A;  1R23 A;  3TO6 A;  3OIP A;  3GBG A;  4KYW A;  4UB8 C;  4NQW A;  2WAF A;  5CLS A;  5FGM A;  1IGN A;  4F52 A;  1OMI A;  2CUZ A;  3ZCO A;  2EA2 A;  2UXH A;  2COM A;  4E7H A;  2FA5 A;  2Y2Z A;  1Z21 A;  5JLX A;  3W2V A;  4E4H A;  1D0Z A;  1AKH B;  1ZR2 A;  3AG4 H;  2GOX B;  2OUM A;  3HUG B;  1P4A A;  3EGQ A;  3OV8 A;  5FRN A;  2BBY A;  2VPR A;  1HC8 A;  3I4P A;  2B9S A;  3GTP J;  1JUS A;  1KU9 A;  5DV5 A;  1D0X A;  3HTU A;  5F64 A;  4BBR J;  3A02 A;  1Y1W J;  2R7O A;  3NAR A;  2RN7 A;  1N75 A;  3TED A;  1RUN A;  3OIO A;  5EG0 A;  2M4G A;  2FBQ A;  1B6A A;  5FKN A;  3S32 A;  4V19 K;  3HUG A;  3VP5 A;  4N9I A;  3VOX A;  1MKM A;  1OCO H;  2QQB A;  3DBL B;  2LNB A;  3LA7 A;  3OS2 A;  3FK6 A;  2W25 A;  2M7B A;  1Z6R A;  4PJM A;  4E7S A;  5E3M A;  2Q0O A;  2DA1 A;  2VXD A;  3RCO A;  1RKT A;  3BRU A;  5KAI C;  1K79 A;  2BHY A;  2CMP A;  4EM1 A;  1JGS A;  3SJM A;  2LY9 A;  2L5Q A;  4CCL A;  4BQA A;  1KU3 A;  2VBZ A;  3MEX A;  2UWM A;  1X3U A;  2TCT A;  4FE4 A;  1NTC A;  1ON1 A;  2HXO A;  4IRI A;  2A6T A;  4HLX A;  5KK1 A;  5E1Z B;  3SFI A;  1Z9C A;  3JSO A;  3G73 A;  1KU7 A;  4JX5 A;  3I3L A;  3DU5 A;  4LGW A;  2YUS A;  4B44 A;  3MKL A;  5DUI A;  1FTZ A;  2BVL A;  2HVQ A;  1LPQ A;  4MIM A;  1QZZ A;  2PJP A;  2O0Y A;  3VW1 A;  2YVE A;  4HX7 A;  4JK1 X;  4QPQ A;  2ETH A;  2F2E A;  4N9H A;  3ZN1 A;  4WXH A;  2XAS A;  5JLW A;  3QWL A;  4OAZ A;  3G1M A;  2R7V A;  3EET A;  1Y56 A;  1VQK I;  1TP4 A;  3BCA A;  1S9H A;  4L9J A;  1E3O C;  4ME9 A;  1R1T A;  2DK5 A;  1XMX A;  3BJ6 A;  5A2Q K;  2KKO A;  3ZQ7 A;  3P7N A;  5F1J A;  1LEB A;  2H8R A;  5D6E A;  2DPU A;  4BKX A;  3I5U A;  1U5T A;  3CDI A;  2JK3 A;  1W5S A;  4FCY A;  3GFL A;  4U7B A;  1U9O A;  1XCB A;  1T0F C;  2UXX A;  1MIJ A;  3AQT A;  4UHT A;  3HHG A;  5L3G A;  5CXI A;  1QHG A;  4RDU A;  4XOR A;  4UV9 A;  4ABZ A;  1BI1 A;  5ERI A;  4KMF A;  5J1Y A;  3K4B A;  3JCU C;  3W3C A;  3NRV A;  4P5O A;  2WY8 Q;  2KT0 A;  4IHT A;  3M8E A;  4LMY A;  2TDX A;  3GFJ A;  4GCV A;  4BXF A;  1U6G A;  3F6V A;  3BHQ A;  4UV8 A;  4ZYA A;  5LGT A;  1J09 A;  1BA5 A;  2R7T A;  4V2G A;  3FXK A;  3VFZ A;  1KU2 A;  1WH5 A;  3J7Y J;  3DCF A;  2BV6 A;  1N77 A;  2VJI A;  4N0B A;  2O6G E;  1I5Z A;  3SWH A;  1TT5 B;  3IH4 A;  1X2N A;  3HB9 A;  3V7R A;  4ZYG A;  1O7F A;  3AL0 B;  3I59 B;  2K9N A;  5LBQ A;  2CV0 A;  2ZCM A;  4AC6 A;  1XX5 A;  3KYD B;  1FX7 A;  2X1C A;  2P7C B;  2R7U A;  3FIS A;  2EJR A;  3BNI A;  3GTG J;  4KIC A;  4P9U A;  3HGG A;  1MW7 A;  2JA2 A;  2IAI A;  2JSP A;  3ERM A;  3X2Q H;  1HKT A;  3D5R C;  2GZW A;  4HNV A;  1LVA A;  2XHK A;  1R5H A;  3HSF A;  1ZHF A;  2LC2 A;  4XLH A;  5AQC A;  2MH2 A;  4OIR F;  3F0C A;  2EIM H;  2JVG A;  3I55 I;  1XB4 A;  1PUF A;  2JN6 A;  1K83 J;  4PGG A;  2NVY J;  5D5X B;  1BC7 C;  2HGC A;  4ZYD A;  1QZY A;  3FXU A;  1YO5 C;  3S8P A;  3M1E A;  4CIC A;  3FWE A;  3BWG A;  5FLM J;  4QPO A;  2B3W A;  2YU3 A;  1WHU A;  4MEY F;  3SDG A;  4A3K J;  5C4X J;  2E19 A;  4R1H A;  4HRI A;  5HS8 A;  1BOA A;  1X4O A;  1Y8R B;  2VKD A;  3KLN A;  3HOW J;  1JKP C;  1WKM A;  3WG9 A;  3LSM A;  2R7R A;  3N97 A;  1OYW A;  3DKX A;  3A01 A;  1TQI A;  3BY6 A;  3FXM A;  1Y6I A;  2L9S A;  2ISY A;  1MH3 A;  3CP8 A;  3GZN B;  3B6A A;  2Z9O A;  3QAH A;  4P96 A;  3GTM J;  3MZY A;  3LSJ A;  2F4O B;  3BG3 A;  2VXZ A;  5D5V B;  1U78 A;  1RKW A;  2LVS A;  1S5L C;  1ZYR F;  3WTY C;  2LY1 A;  5JFR A;  2L4M A;  4IXA A;  2DDA A;  4QTR A;  3H1C A;  4NHJ A;  1FWZ A;  5FRM A;  2PN6 A;  4XOT A;  2KIF A;  1D5Y A;  1G3W A;  3LSI A;  1RR8 C;  1S7O A;  3TKY A;  1W0T A;  3R61 A;  4RMN A;  2NOG A;  1QNT A;  1TWA J;  1FNN A;  1FC3 A;  4RB2 C;  2QKO A;  2I8D A;  3SZG A;  2X0L A;  5FD5 A;  5IYC J;  3M3Y J;  3KYL A;  2DOE A;  2VQH A;  4PFO A;  5M5X J;  1UEL B;  4LOC A;  2PEX A;  5FMP A;  4PZJ A;  2IA2 A;  1B72 A;  5FKM A;  3GX4 X;  4L9T A;  1I6H J;  2ZNZ A;  2XB5 A;  2E1M B;  2IEK A;  3BTC A;  5D8L B;  2F5E A;  2XPU A;  1U8B A;  4UVC A;  4YII A;  3NWS A;  3PNY A;  5IPA A;  2FX0 A;  1OCP A;  4XKC A;  4WK8 F;  2JA8 J;  3OYE A;  3RPU D;  1D1C A;  2FUG 2;  3M4O J;  1LFP A;  3M1C A;  3ZQH A;  2EBI A;  3DTI A;  3EQL F;  3H3V K;  4Z2Y A;  1MMD A;  3EUA A;  3MZ8 A;  2GA2 A;  2L9R A;  5IP7 J;  1GHC A;  5IYD J;  4GGG A;  3HOZ J;  1DDN A;  4I01 A;  2R7X A;  2DYR H;  3VOK A;  2V9P A;  1BI2 A;  4E7L A;  1G59 A;  2O8K A;  4R79 A;  1LUJ B;  4KIG A;  1E3H A;  2L9V A;  2D45 A;  4PJJ A;  2W00 A;  1EKE A;  3AG2 H;  3L1P A;  2NYX A;  1VF9 A;  3C18 A;  2IA1 A;  3S15 J;  1MDM B;  1E0E A;  3FK7 A;  4RGX A;  5DCM B;  3QYE A;  1JHH A;  3I54 A;  1XGM A;  4XLF A;  1TLH B;  5H6R A;  4B3X A;  4YRV A;  2DW4 A;  2XAJ A;  3I4N J;  4EEF G;  2LKS A;  3PIP F;  4B3A A;  2G9W A;  4A12 A;  2B63 J;  3BJB A;  2XRL A;  1R36 A;  5E1W A;  2VOD A;  1IUY A;  4G9Y A;  2VKV A;  1R6R A;  3P9I A;  1WCM J;  5D4R A;  3TDU C;  2BY0 A;  4EJO A;  3HOS A;  1H9T A;  2HDD A;  3J81 Z;  1ODD A;  1G2H A;  1J2X A;  2FRH A;  1ENH A;  5ICE A;  4MO7 A;  3M07 A;  2VAS A;  1V55 H;  2OZ6 A;  4IX7 A;  1XCV A; 
#chains in the Genus database with same CATH homology
 3NRG A;  1LFU P;  1TWF J;  1GV5 A;  3JRB A;  1JTY A;  2CRG A;  2DA7 A;  3BCG A;  3JRF A;  1ETX A;  1DU6 A;  1JT0 A;  2W53 A;  1IC8 A;  2ME0 A;  2V57 A;  5J3L A;  3IV5 A;  4BBS J;  1Z77 A;  2O7O A;  1QRY A;  3KKD A;  2R93 J;  3IH3 A;  4CGR A;  3JRI A;  5M5Y J;  3VW0 A;  2GEN A;  5FKO A;  4X1E A;  5CW8 A;  1OJL A;  1Y1V J;  3QPL A;  5EGO A;  2QIB A;  2WAQ N;  3A01 B;  1IG7 A;  4I76 A;  4M3G A;  1T56 A;  2ID6 A;  4G12 A;  4KWA A;  4FTH A;  3BR0 A;  4FE7 A;  2DA4 A;  3ANP A;  4ICH A;  3QPS A;  1NK2 P;  4C3I J;  5HAW A;  5DAJ A;  4M3F A;  3HDD A;  3T6N A;  3HGY A;  5M3M J;  1JKR C;  4Y7N J;  2OER A;  3HOX J;  3GZI A;  1AU7 A;  5EZH A;  3Q0W A;  3COL A;  5F04 A;  2DMP A;  1IRZ A;  1JT6 A;  3GTO J;  2QF7 A;  3HKZ N;  3BTL A;  1HDP A;  1P7I A;  1ZGW A;  3HOU J;  2LD5 A;  1AHD P;  1VFC A;  3WHC A;  4JX6 A;  2DJN A;  5C4J J;  1ETQ A;  3QBM A;  1IUF A;  1JUM A;  3ZQC A;  3K7A J;  1IDY A;  3LJL A;  1RES A;  4A3L J;  3JRE A;  1K61 A;  2MSY A;  4S0H B;  2GM4 A;  1VI0 A;  3ON2 A;  1GDT A;  1OCT C;  3OOU A;  3CDL A;  4XK4 A;  3S17 J;  4M3E A;  2DA3 A;  1AKH A;  1S7E A;  2X9D A;  3O8H A;  3S2D J;  2QTQ A;  3PPB A;  2K40 A;  3FKI J;  3IUV A;  5EG0 B;  3HE0 A;  5EFY A;  2XGE A;  2OI8 A;  2JWT A;  4L62 A;  2MW8 A;  4GCL A;  4IHY A;  2H1K A;  2VKE A;  2NS8 A;  3JRH A;  5IOY A;  2M34 A;  3RZO J;  2CUE A;  3RZD J;  2G7L A;  3BQZ A;  4NDL A;  3LSR A;  4YZE A;  3VW2 A;  5F08 A;  1GUU A;  3ZQI A;  4JL3 A;  3TP3 A;  3O60 A;  3CRJ A;  5F0C A;  2RHA A;  1OFC X;  2QWT A;  1IV6 A;  3FIW A;  2HOA A;  3E7Q A;  1B8I B;  1WGX A;  2Y9Z A;  2HQ5 A;  3E7L A;  2ELK A;  5FGL A;  4D5C A;  1ZTR A;  2JA6 J;  4Y52 J;  1U9N A;  2Y0S N;  4AF5 A;  4DYQ A;  2UXP A;  3TW7 A;  9ANT A;  3MVP A;  2MGQ A;  1B72 B;  3WHB A;  3F1B A;  2RAS A;  1MBE A;  5IP9 J;  3B81 A;  3NI7 A;  1RET A;  5E3L A;  2FD5 A;  1ZR4 A;  3CJD A;  2LTP A;  3ANG A;  3BG9 A;  4C3J J;  4MK6 A;  1CQT A;  3QQA A;  1A6I A;  2FQ4 A;  5GPA A;  2L0K A;  3S1N J;  2UXO A;  4JNN A;  3CCY A;  2ME6 A;  2XGD A;  1Q1V A;  2WV1 A;  1TWG J;  2R5Y A;  3ZOB A;  1O4X A;  5FHP A;  3VVZ A;  3S2H J;  5D1R A;  1QPI A;  3NNR A;  2VI6 A;  4A3M J;  1A5J A;  2ZOY A;  4D5F A;  3HM5 A;  1SAN A;  4D7M A;  1IJW C;  3BR6 A;  2TRT A;  2DMN A;  1MBH A;  1UMQ A;  4QSH A;  5F0H A;  4A3D J;  2YU9 J;  4MFD A;  2JA5 J;  3PAS A;  3BG5 A;  5C4Y A;  2CQQ A;  3Q3S A;  1FJL A;  4XRM A;  4DYC A;  1B8I A;  4A3F J;  4V2F A;  2IU5 A;  1JUP A;  3MN2 A;  2PZ9 A;  2DTZ A;  3HOY J;  4XID A;  3BTJ A;  1MSF C;  2DMQ A;  4NEL A;  2EZI A;  2XDN A;  2WUI A;  4A93 J;  3V6G A;  1XG1 A;  4L5E A;  3JRA A;  1LFB A;  3LHQ A;  2K9Q A;  2HKU A;  2YVH A;  3GBG A;  2UXU A;  3KZ9 A;  1IGN A;  2Y30 A;  5EZG A;  2IBD A;  1IDZ A;  2R92 J;  2GUH A;  4IHV A;  3P9T A;  2UXH A;  1QVU A;  2DA2 A;  2Y2Z A;  1X2M A;  1BJZ A;  2I10 A;  3HIM A;  3HTI A;  2LP0 A;  5JLX A;  2NP5 A;  1P7J A;  3JR9 A;  4DYR A;  1ZR2 A;  1AKH B;  2MG4 A;  1PUF B;  3DPJ A;  1HOM A;  1BW5 A;  3EGQ A;  2VPR A;  3VIB A;  5EF6 A;  3GTP J;  2ZCN A;  1JUS A;  2NP3 A;  2ECB A;  4BBR J;  2AHQ A;  3A02 A;  1Y1W J;  3PO2 J;  3NAR A;  1MBJ A;  3ON4 A;  3TED A;  3G56 A;  3OSG A;  3OIO A;  5EG0 A;  3BR1 A;  2FBQ A;  4M3B A;  5FKN A;  5F27 A;  4DZP A;  1SFO J;  1H89 C;  2GBY A;  1LE8 A;  1POG A;  4A3C J;  2EQR A;  3VP5 A;  3VOX A;  4GFK A;  5FLV A;  3O8G A;  3GTL J;  4MFE A;  2ZOZ A;  3FK6 A;  3S1R J;  2D6Y A;  4GFB A;  2LK2 A;  5E3M A;  5K7H A;  3C07 A;  2E1O A;  3GTK J;  2DA1 A;  3BRU A;  1RKT A;  1JJ6 C;  3KKC A;  1GV2 A;  3TP0 A;  2EH3 A;  3SJM A;  2LY9 A;  2X48 A;  2RAE A;  1MNM C;  2DA6 A;  2CQX A;  2E2I J;  2Q24 A;  1I3Q J;  3HTA A;  2JMW A;  5K7Z A;  2TCT A;  4FE4 A;  1NTC A;  2HXO A;  2G3B A;  2QCO A;  5DTD A;  4BY1 J;  2VUM J;  3SFI A;  4C3H J;  1ORK A;  4JX4 A;  4JX5 A;  1VND A;  3BR3 A;  2ZCX A;  2YUS A;  3JRC A;  3MKL A;  1TWC J;  1FTZ A;  3BT9 A;  1X58 A;  4MIM A;  1HDD C;  1H8A C;  3VW1 A;  1XC5 A;  2YVE A;  1SGM A;  4DW6 A;  5F0F A;  2ECC A;  5JLW A;  2XB0 X;  3PM1 A;  2COB A;  1JKO C;  3QKX A;  2FJ1 A;  2W48 A;  3G1M A;  4A3I J;  3S1M J;  1FIP A;  1UI5 A;  1FIA A;  1E3O C;  4ME9 A;  2NX4 A;  1BL0 A;  2E2H J;  2HI3 A;  2K9S A;  5F1J A;  2N8G A;  3S16 J;  4ACI A;  3HOV J;  2H8R A;  4IEJ A;  5J1R A;  4BKX A;  1H88 C;  2JK3 A;  4FCY A;  5K7F A;  3ZQF A;  2YS9 A;  1U9O A;  3AQT A;  4D7N A;  1HLV A;  3PO3 J;  2O9L A;  4A3J J;  2D5V A;  5CXI A;  3S1Q J;  4I6Z A;  4RDU A;  3B6C A;  5E3N A;  3LWJ A;  2CUF A;  4ABZ A;  2OPT A;  1MBG A;  5J1Y A;  3RKQ A;  1ETY A;  2KT0 A;  1FTT A;  1UI6 A;  1Z0X A;  5C44 J;  5BNG A;  2HOT A;  2NVT J;  2R5Z A;  3BHQ A;  1LE8 B;  4UUS B;  1MBF A;  1ZQ3 P;  1BA5 A;  5M3F J;  1MH4 A;  2DG8 A;  3VPR A;  4V2G A;  4M6V A;  1W0U A;  5M5W J;  5HBU A;  3HBL A;  1WH5 A;  5HOD A;  3DCF A;  4J19 A;  4X6A J;  3V78 A;  4RBO A;  4W97 A;  3IH4 A;  1X2N A;  1WI3 A;  3HB9 A;  5E3O A;  2G7G A;  1TC3 C;  1ITY A;  3GEU A;  4AUX A;  1ZK8 A;  4B4C A;  2DMU A;  5C3E J;  3ZQL A;  3G7R A;  3HTJ A;  2K9N A;  3FRQ A;  2L7Z A;  3EUP A;  2ZCM A;  1F36 A;  4AC6 A;  1WH7 A;  3LOC A;  2REK A;  3FIS A;  2LR8 A;  3BNI A;  5EDN A;  3GTG J;  3HGG A;  2IAI A;  1APL C;  3JRD A;  4C2M J;  4HNV A;  4GCK A;  1TWH J;  4CYC A;  5IP6 A;  3HTH A;  4IHW A;  5AQC A;  3DEW A;  2ID3 A;  3F0C A;  1XS9 A;  1R9T J;  4HKU A;  4UUS A;  3I4M J;  1PUF A;  2JN6 A;  1K83 J;  2NVY J;  2XGC A;  4DZJ A;  4GFL A;  4A3G J;  4FIS A;  2PBX A;  3G1L A;  5K58 A;  5J1U A;  4QIW N;  4AC0 A;  2UXI A;  5FLM J;  2G0E A;  4A3K J;  3SDG A;  5C4X J;  2E19 A;  5DS9 A;  2QOP A;  3RD3 A;  3D1N I;  1ZKG A;  4UUT A;  3HOW J;  4W1U A;  1JKP C;  3NPI A;  2LKX A;  3G1O A;  4JYK A;  3GTJ J;  3A01 A;  1YRN B;  4M3D A;  2L7F P;  4JKZ A;  1I50 J;  3W6V A;  3GTM J;  1MH3 A;  1MSE C;  5EGO B;  3B6A A;  5D18 A;  2WB1 N;  4XRS G;  1UHS A;  3NAU A;  5IYB J;  4XRS A;  3LSJ A;  5EEA A;  2XPV A;  3BG3 A;  2HYT A;  2R5Y B;  2EZK A;  1U78 A;  3UKG A;  1RKW A;  2LVS A;  1GVD A;  4XIC A;  3BR5 A;  3S14 J;  3CWR A;  4PXI A;  3S5R A;  2CJJ A;  2LFB A;  5IOZ A;  1F43 A;  3VVX A;  3IH2 A;  1YRN A;  1WPK A;  4QTR A;  2OF7 A;  1RPW A;  3BR2 A;  1D5Y A;  4A3E J;  4B1R A;  2Y9Y A;  2EZL A;  1W0T A;  4GCT A;  2NOG A;  2PMZ N;  1TWA J;  3H0G J;  4BY7 J;  1HCR A;  2GFN A;  2QKO A;  2E2J J;  4NN1 A;  3Q0V A;  5IYC J;  2LLK A;  3M3Y J;  2WGB A;  1UG2 A;  5H9T A;  2HXI A;  2XPW A;  2R7Z J;  2AO9 A;  5M5X J;  4LOC A;  3HEF A;  1BW6 A;  1EF4 A;  5FMP A;  2JA7 J;  2L7M P;  1B72 A;  2DMT A;  5FKM A;  1JGG A;  1RR7 A;  2M2E A;  2XSD C;  4A3B J;  3LSG A;  3A03 A;  1I6H J;  3AQS A;  2P81 A;  2XB5 A;  3BTC A;  2IEK A;  1U8B A;  2XPU A;  2X6O A;  1DU0 A;  3CMY A;  5IPA A;  2FX0 A;  2GLO A;  4MLO A;  1JTX A;  1OCP A;  2JA8 J;  3C2B A;  2KDZ A;  1ETO A;  1ETW A;  3M4O J;  4IHX A;  3ZQH A;  3VVY A;  2EBI A;  2M8G X;  2F07 A;  4AYB N;  5CXG A;  3H3V K;  3GTQ J;  2L9R A;  4A69 C;  5IP7 J;  1HF0 A;  2O7T A;  5IYD J;  4CYC B;  3HOZ J;  2NVQ J;  3ZQG A;  3VUQ A;  1NK3 P;  3VOK A;  4UDS A;  3BTI A;  4MXM A;  3LNQ A;  2O8K A;  3JSJ A;  1ETV A;  4JP0 A;  1T33 A;  1QVT A;  2R0Q C;  5FKK A;  3L1P A;  5FKL A;  1GT0 C;  1VF9 A;  3S15 J;  5D19 A;  3MNL A;  2M9H A;  2R5Z B;  3K2A A;  3FK7 A;  2G7S A;  5EYR A;  3NXC A;  3Q0U A;  1JKQ C;  3RQI A;  3LSP A;  2HOS A;  3I4N J;  5GP9 A;  4EEF G;  5HSZ A;  2DN0 A;  2JJ7 A;  4B3A A;  2B63 J;  3BJB A;  2M0C A;  2Y31 A;  2CU7 A;  3CQZ J;  2DG7 A;  3KNW A;  2NVX J;  2XRL A;  5FJ8 J;  2VKV A;  3BQY A;  3JRG A;  1WCM J;  5GPC A;  2DA5 A;  3OSF A;  1FEX A;  2NS7 A;  1JJ8 C;  4BXX J;  1MBK A;  2ZB9 A;  3RH2 A;  1ETK A;  2EZH A;  1G2H A;  3TW6 A;  1ENH A;  4MO7 A;  2HDD A;  2HYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...