3C2BA

Crystal structure of tetr transcriptional regulator from agrobacterium tumefaciens
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
203
structure length
200
Chain Sequence
SPRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAMITFQQSKVRTFEKAGDRVSAPQLADHLEVFAHDLLDVLAGDVSLALNRLAIGQASRKLGDLLLERGRRQIDRRARGLIEAGRRSGYLRFDDAEEAYRSFYGLIVSDLHVRMLLGEAPDKDFSARAKKAVVAFLTLYGTEKVHSELGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title X-ray crystal structure of TetR transcriptional regulator from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transcription regulator
total genus 68
structure length 200
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14246 TetR_C_7 AefR-like transcriptional repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3c2bA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3c2bA02
1IJWC 2CQQA 1FJLA 4AF5A 3HBLA 5GPAA 1OCPA 3BRUA 2LLKA 1UI5A 1B72B 2HYJA 3FIWA 3JSJA 3SFIA 4DW6A 1JUSA 3ZOBA 2QOPA 3PO3J 3GTGJ 2L7FP 1BJZA 5M5XJ 1MBEA 4MFEA 3VPRA 1Q1VA 2DA1A 3VVYA 3Q0VA 1VNDA 3LSGA 2NS7A 2F07A 4JX6A 5FGLA 5C3EJ 3NPIA 3NAUA 2XRLA 3GEUA 1HCRA 1FTZA 2EZIA 4GFKA 1RETA 2LTPA 3D1NI 3S2DJ 4FE4A 1GUUA 2OF7A 3Q0WA 1ETOA 1NK2P 2L7ZA 4A3LJ 3EUPA 1LE8B 2HOAA 3NI7A 2IAIA 4AUXA 1W0UA 4C3HJ 1QPIA 1GV2A 1OCTC 5IP6A 3BR0A 5FJ8J 1BW5A 1A5JA 5J1RA 5FMPA 1LFUP 1AKHA 1JTXA 3HM5A 4DZJA 3LSPA 2D6YA 2DA3A 5FKOA 3JRCA 5K58A 5HAWA 2LP0A 1TWFJ 2R5YB 5M5YJ 1JUPA 5C4JJ 3MVPA 1YRNA 1ORKA 4BKXA 1MNMC 5F1JA 5HBUA 2DA5A 1NTCA 2QCOA 3ZQIA 1JJ6C 3HOYJ 3ZQFA 1SANA 4YZEA 2X6OA 2JA7J 3F0CA 1RR7A 2YU9J 2XPVA 4FE7A 4GCLA 1TWHJ 2L7MP 3HB9A 3FK7A 1ETYA 1ETQA 2B63J 1F43A 3VOKA 2XB5A 3E7QA 3AQTA 5FKLA 1AKHB 2W48A 3DEWA 3S15J 2COBA 2VI6A 3G1MA 2M8GX 4A93J 5J1YA 3VVXA 1B8IB 2H8RA 2CQXA 1HF0A 3JRGA 1YRNB 2X9DA 2GFNA 3BCGA 3HTHA 2M2EA 3S1MJ 3LWJA 4FCYA 4LOCA 1I3QJ 2OPTA 1D5YA 1T56A 4BY7J 2I10A 3G56A 1UMQA 2NX4A 1JUMA 3GTOJ 2E2JJ 3FKIJ 3CDLA 4CYCB 3PPBA 4Y52J 3T6NA 5FLMJ 5GP9A 1QVTA 5K7FA 1DU0A 2N8GA 3HOXJ 2Q24A 1ITYA 2YVHA 1MH3A 1UHSA 2QF7A 2YVEA 3BNIA 3UKGA 3HTIA 4L62A 1TWCJ 1U9NA 4MO7A 2E2IJ 5EG0A 2ID6A 3BTCA 3AQSA 2Y30A 2PZ9A 2WGBA 2DA4A 3O60A 5CXIA 1WPKA 3L1PA 2EH3A 4B3AA 4A3IJ 4A3FJ 3IH2A 2EZLA 4GCTA 1VFCA 3BR6A 3BR5A 4RBOA 2ID3A 1JKQC 1GVDA 5EEAA 4W97A 4JL3A 2FBQA 2UXHA 2QTQA 1U9OA 1TWGJ 1X2NA 5F27A 1JT6A 3CCYA 2Y2ZA 3FK6A 1FIPA 3K2AA 3GTLJ 5H9TA 2TCTA 2XPWA 5E3OA 4A3BJ 1ZKGA 2K40A 2JN6A 2XGEA 2MGQA 1OFCX 3QPSA 1JKOC 5EDNA 4AYBN 4IHXA 1WI3A 4RDUA 3PM1A 4XK4A 3HDDA 4GCKA 1IDYA 2EQRA 4IHYA 3I4MJ 5K7ZA 2ZCXA 4J19A 1MBHA 2DG7A 2G7GA 3FRQA 3CQZJ 4M3GA 4GFBA 5E3NA 4XIDA 2ECCA 3C07A 2QKOA 2MSYA 4KWAA 4A3JJ 3MN2A 2FQ4A 3EGQA 1IGNA 2GENA 3LSRA 1XG1A 2ELKA 1H8AC 3A01A 1DU6A 5IYBJ 2RAEA 3SDGA 4EEFG 1JKPC 2DN0A 4M3BA 4BY1J 5F0CA 1IDZA 2OERA 2JA6J 3JR9A 2E2HJ 2RHAA 4A3DJ 3ON4A 4XICA 3ZQCA 3JREA 4X6AJ 1PUFA 2YUSA 2JA8J 2LKXA 3GTQJ 2Y31A 2IEKA 5JLXA 2Y9YA 2HYTA 5EYRA 1JJ8C 1WH7A 2R92J 3BQZA 2DJNA 3S1QJ 5F0HA 4JX4A 1XC5A 3LOCA 2CUFA 4B4CA 3VUQA 1MBJA 2UXUA 2XGDA 5EGOA 3G7RA 2REKA 3W6VA 3HE0A 2JK3A 3WHCA 3NNRA 3VP5A 2XDNA 2DMNA 3IH4A 3B6AA 1OJLA 3V78A 2NP5A 5DTDA 2HOSA 1ZTRA 5F0FA 3TP3A 1HDPA 4ACIA 2DA7A 2HDDA 2OI8A 5C4YA 1GDTA 3HOUJ 3BHQA 1K83J 3BR3A 2M9HA 2PBXA 2RASA 2ZOZA 2O7OA 1IC8A 1ETKA 2R93J 2Y0SN 3GTKJ 2NVTJ 2E19A 3RH2A 3BTLA 2O7TA 5D19A 1S7EA 2EZHA 2R5ZA 3QQAA 2VKVA 4XRMA 5EGOB 3HGYA 5EZHA 1SFOJ 4MXMA 5DAJA 2CJJA 4FTHA 3S2HJ 3H3VK 4G12A 5AQCA 2K9SA 2DG8A 1SGMA 4QSHA 4AC0A 3S1RJ 2LFBA 3ZQLA 4ICHA 1JGGA 1ZGWA 5CW8A 5M3MJ 3QPLA 4D7MA 2K9QA 3ZQHA 2AHQA 5E3MA 2WUIA 2MG4A 1UI6A 1VI0A 2ECBA 3SJMA 2G7SA 1BW6A 2MW8A 5F08A 4DYQA 1H89C 4V2GA 5EFYA 1RKTA 3IV5A 3HTAA 2KT0A 3RQIA 2ZCMA 2EBIA 2L9RA 3KNWA 1F36A 3BQYA 1WCMJ 3K7AJ 3HGGA 4I76A 2R5ZB 3CWRA 4C2MJ 1JKRC 2NP3A 3GBGA 2JWTA 5EF6A 3B81A 3CRJA 2UXPA 2UXIA 2K9NA 1BA5A 3LJLA 4IHWA 3RZDJ 5JLWA 1EF4A 4UUSA 4MK6A 3RD3A 3OSGA 4MLOA 3M3YJ 1IUFA 1ENHA 3JRBA 3MNLA 1ZK8A 2WB1N 4QIWN 3PASA 2XPUA 4M3DA 4QTRA 3HTJA 4M3FA 4L5EA 5IOYA 2DMUA 2HI3A 2DMPA 3DCFA 1P7JA 5E3LA 3BT9A 1ZR4A 2DMQA 2QWTA 1JTYA 2ZB9A 4A3CJ 3TW6A 5C4XJ 3ON2A 2NVYJ 5EG0B 2G3BA 1GT0C 1B72A 1IV6A 4BBSJ 1WGXA 5K7HA 1H88C 4D5FA 3JRDA 2DTZA 2CUEA 5BNGA 3TEDA 3IUVA 2W53A 5DS9A 2AO9A 4HNVA 3LHQA 1R9TJ 3VOXA 3HOZJ 4CGRA 1FTTA 1BL0A 1HDDC 1I6HJ 1Z77A 5IP7J 1Y1WJ 2LVSA 4XRSG 3JRHA 5GPCA 1U78A 9ANTA 4B1RA 3GTJJ 2FJ1A 5J3LA 4I6ZA 2GLOA 4W1UA 5C44J 2E1OA 1G2HA 1QRYA 2NVQJ 1LE8A 3CJDA 3GTMJ 4JNNA 1MSEC 2ME0A 4MIMA 3TP0A 3CMYA 4A3EJ 1O4XA 1JT0A 1X2MA 5HSZA 1AHDP 3ANGA 2G0EA 1W0TA 2NVXJ 5FKNA 1X58A 1ZR2A 2Y9ZA 5IYDJ 1MBFA 4S0HB 1VF9A 2M34A 4M3EA 2R5YA 2JA5J 4Y7NJ 3DPJA 2VUMJ 4JKZA 4JX5A 3S5RA 2YS9A 2G7LA 1IRZA 1A6IA 3NXCA 3S17J 4ME9A 2LY9A 2VKEA 5EZGA 1CQTA 3M4OJ 3RKQA 4X1EA 3ZQGA 3VVZA 1IG7A 3A01B 1E3OC 3TW7A 3Q3SA 2O8KA 2H1KA 3BR1A 2FX0A 3LSJA 2LK2A 3H0GJ 3A02A 3HOWJ 4BBRJ 2XSDC 1P7IA 4GFLA 3VIBA 1FIAA 4BXXJ 5FHPA 3LNQA 4IEJA 3HIMA 1PUFB 4DYRA 4D5CA 1AU7A 3KKCA 4A69C 4NDLA 3BG9A 2CU7A 2WAQN 1B8IA 3A03A 3O8GA 3VW1A 3F1BA 4A3MJ 2DA2A 3KZ9A 3VW0A 2X48A 1MBGA 5F04A 4A3KJ 3HKZN 1RKWA 2HOTA 3Q0UA 3GZIA 3G1OA 3IH3A 2O9LA 2XGCA 3KKDA 2WV1A 5IYCJ 2KDZA 5J1UA 4CYCA 5IOZA 4NELA 5M3FJ 2DMTA 3QBMA 1UG2A 1NK3P 4MFDA 3ANPA 3JRIA 3FISA 2EZKA 2PMZN 1TC3C 1ETXA 3B6CA 2HXOA 4UDSA 2QIBA 5D18A 5FKMA 2LD5A 2FD5A 2JMWA 2M0CA 1T33A 4JP0A 4C3IJ 1HLVA 2LR8A 2D5VA 3BTJA 3COLA 2NOGA 4A3GJ 4IHVA 1POGA 4JYKA 4AC6A 1XS9A 4HKUA 4FISA 2TRTA 3BTIA 1ZQ3P 3O8HA 2IBDA 1Z0XA 1Y1VJ 2V57A 5D1RA 1TWAJ 3BG3A 3G1LA 4D7NA 3NARA 3WHBA 5M5WJ 1APLC 3HOVJ 2XB0X 4M6VA 5IP9J 2ZOYA 3QKXA 3JRAA 2ZCNA 4NN1A 2L0KA 1LFBA 1I50J 3BG5A 1U8BA 3HEFA 1RPWA 3RZOJ 4PXIA 1RESA 1ETWA 4XRSA 3GTPJ 1ETVA 5FKKA 2GBYA 2R0QC 1MSFC 4DZPA 4UUTA 2ME6A 4DYCA 2DA6A 3BJBA 5IPAA 3V6GA 3OIOA 1K61A 5FLVA 2HKUA 2JJ7A 3S16J 3BR2A 1QVUA 2IU5A 2R7ZJ 2CRGA 2HXIA 5HODA 3PO2J 2VPRA 1FEXA 3C2BA 1MBKA 3VW2A 3OSFA 4C3JJ 4UUSB 3JRFA 2GUHA 2NS8A 4ABZA 4V2FA 1MH4A 2UXOA 1WH5A 2HQ5A 2GM4A 5CXGA 3S1NJ 3NRGA 3S14J 1HOMA 3P9TA 2P81A 3OOUA 3MKLA 3I4NJ 3E7LA 1GV5A
chains in the Genus database with same CATH superfamily
5GAGJ 2DPUA 1LDJA 1FJLA 4Q48A 4DJAA 3H9JA 4BH9A 5JHFA 2CQKA 5HNFA 2FOKA 3WGIA 3GFJA 3NRVA 1SVMA 1K4SA 3JSJA 3ZOBA 1MJAA 2IA2A 2LC2A 2L7FP 3DPUA 5L3EA 3EYYA 4HNUA 3G6EI 1GXPA 2DT6A 4L5IA 1BJAA 5JR3A 3SFZA 4I01A 4PJJA 3KP7A 5JVTA 5C3EJ 4RLQA 3NPIA 2DFEA 1B1BA 5FGLA 1HCRA 1P4WA 2BHYA 3N4MA 3JTHA 1D1CA 2L2OA 4FE4A 5CQGA 1FBQA 1P4AA 1NK2P 2JVGA 3IRQA 2B3WA 3GZ6A 4A3LJ 2HOAA 3QU3A 3NI7A 2IAIA 1W0UA 3FMQA 1GV2A 1SD6A 5J4YA 2NNYA 3E3VA 3CTAA 4O6JA 1A5JA 4ESBA 1LFUP 4DZJA 2ZBKA 2R7TA 3KFWX 5CVRA 2BY3A 3LA2A 1R4NB 4HF2A 2XROA 4HF0A 5M5YJ 3MVPA 1WZ2A 4E7HA 4CCLA 2JRTA 1KZHA 1RUOA 3GO5A 1Y8RB 1LJ9A 2M0MA 1OISA 1SANA 3F8MA 1U5TC 2YPRA 1YO5C 1W36C 3A2KA 4MGRA 2XPVA 1LVAA 1OMIA 1MW7A 4ZZLA 2K85A 1F5TA 3FK7A 2DYSH 1F43A 3ZQ7A 2OTJI 4YELA 1A6QA 4EGYA 4ESJA 3ECOA 4XLHA 3VOEA 2W48A 3DEWA 3K6GA 2KJCA 1R5GA 3QRFF 1KU9A 3VVXA 5DUIA 4OOIA 5CVIA 1X1AA 3BCGA 1HSJA 4FCYA 1FP1D 2HFHA 1W5CC 4ZDOA 5LRRA 2IGOA 3G56A 2P7VB 5ICCA 1FYKA 2D45A 1JUMA 2ZJPF 4LG0A 2E2JJ 2ZO4A 2W82A 4RB2C 3FKIJ 2VJJA 1FOKA 3WU2C 2F6CA 5ICFA 5FLMJ 1FBUA 4BS9A 5GP9A 1QVTA 3V7RA 3F3XA 4IQJA 4M9XA 1U5TA 2ZMEA 2EIKH 1L3LA 1YS7A 3CLOA 2OA4A 2OCCH 3K4KA 3NS4A 5LFAA 2IW5A 5BPDA 1R6RA 2QF7A 3CF2A 3I5UA 3CP8A 2HVRA 3V7SA 2GIVA 3O60A 1WPKA 3L1PA 3J80K 1MMDA 3EDPA 1VQ8I 3CUOA 3IH2A 4PJNA 2QA4I 2CUJA 3IKVA 5DUKA 2O5RA 2M8EA 3K10A 3AG4H 5EEAA 3K0LA 2DAOA 3P9IA 2MLKA 4A2UA 3PNVA 2FBQA 4LK1F 4CCOA 1GHCA 2ELJA 1TWGJ 3MCZA 2AXLA 4HSTA 5L3CA 2ZFUA 3VSLA 2Y2ZA 2VIXA 6PAXA 4BQQA 3K2AA 3CC7I 4NC7A 4PGHA 4A3BJ 3PSFA 2JN6A 2XGEA 3HJEA 4IPAA 3SYTA 3BPXA 2MGQA 1OFCX 1O3QA 2KIMA 4O3MA 3I59A 1WI3A 3PM1A 1B9NA 1SFEA 4XK4A 4B48A 3I4MJ 1XDSA 5K7ZA 1FMWA 1T95A 1Z21A 4YFXF 4HAMA 2B0LA 4J01A 2M7AA 4XORA 5JI6A 1CF7A 5DCMA 3E6DA 4GFBA 2XF6A 4IHTA 3C07A 2V1XA 2L9SA 2FBIA 2FQ4A 3ZMUA 1S7AA 1X1DA 3FF5A 4Z6YA 5HS8A 5J6XA 2OERA 2FRHA 2MD0A 3X2QH 3JR9A 3OYEA 2WAQA 3K8PC 3MWMA 2UUZA 4BL0B 2XC7A 4KITB 4XOTA 2ICWG 4PFOA 1V5FA 2CGPA 5LD2C 1JHHA 2LKXA 1C0WA 3GTQJ 2Y31A 2QUFA 2Y9YA 3GUDA 3HKZA 5EYRA 3WGHA 1WH7A 4HG2A 3S1QJ 4IKFA 1YJWI 2M1BA 3VUQA 1O7FA 2CFOA 3QOPA 1R7JA 4A5MA 3W6VA 2HDCA 2JK3A 1Z1DA 3WHCA 1DP7P 5HLTA 4R8HA 5D8KB 5B3SH 4ENJA 4P1WA 1S7OA 2DMNA 2XDNA 4U9LA 2R7RA 3B6AA 5BQTA 2VLAA 3L2VA 2BBYA 4LK0F 5DTDA 5F0FA 3TP3A 2K3PA 1HDPA 4GYIA 3RKXA 4BQOA 5BMZA 5D5UB 4ACIA 2HDDA 2OCEA 1SFXA 3BHQA 1K83J 1USTA 4HF1A 5ICEA 2E5ZA 2E36A 3WTWC 2O7OA 2ZOZA 1ETKA 1VQNI 4CH7A 1T2KA 1ZG3A 2VONA 1NHAA 1XTAA 4HEA2 5EGOB 3HUGB 1X1CA 2KRHA 1EH7A 4ASNA 2CJJA 2WBMA 4F92B 1REPC 3H3VK 3E5XA 2K9SA 3PQKA 1SGMA 4QSHA 3S1RJ 1XGSA 1ZG1A 3RKWA 3ZQLA 1YG2A 4ICHA 2P5KA 4FQGA 4I0AA 2W84A 5CW8A 2VJ4A 5M3MJ 2ZFWA 2LY1A 2ZCWA 3DTEA 2R7UA 4D7MA 4Y17A 3IP4B 2K9QA 2Y48A 4HX4A 2QVOA 3N97A 1IV8A 4CXFA 1D8JA 2AHQA 1QZZA 2FNAA 1TQIA 1VI0A 2WC2A 1Y8QB 3SJMA 2G7SA 1BW6A 3K69A 1DQUA 5F08A 1WRJA 1XCVA 1RKTA 3HTAA 2KT0A 2ZCMA 3RQ4A 4L9VA 3KNWA 1F36A 2X0LA 4EM1A 4E7KA 5CKTA 3B81A 2EPFA 4LJZF 4YEJA 3AG1H 1I5ZA 2HVQA 5CJ9A 1E3PA 2HPIA 1SFUA 3RCOA 3M3YJ 1IUFA 4MNUA 2L54A 1FX7A 4BXFA 3PASA 3SEZA 3K4MA 5DM6F 2M3AA 1DUXC 3HTJA 2CYYA 2IA0A 3ESWB 5IOYA 3S3MA 4ESFA 2HI3A 1YTYA 2BV6A 3DCFA 4ZC3A 2X51A 2DMQA 4GYGA 3TL4X 2ZB9A 3BP8A 5EG0B 4K2EA 4RB3C 3ELKA 4ZH4F 5K7HA 2ZJRF 3JRDA 2O3FA 1IRFA 3MKZA 2PMUA 4JOMA 1VQKI 3WU0A 3VDXA 3HIFA 3RYPA 1PP8F 3CC4I 1A04A 2YVXA 3HOZJ 1FSEA 3J7AY 4A6EA 3AG2H 3E6BA 4G6DA 3QODA 2M4KA 3JRHA 1T6SA 3OL4A 3LAJA 4NQWB 2LBFB 5GPCA 1IRXA 4B1RA 4BHPA 1MMAA 1OCZH 2E1OA 3IWZA 4Y3OA 3W3CA 4JNNA 4MIMA 2VJIA 3ML6A 3PJRA 5LEKA 5HSZA 2V1UA 1MMNA 3ANGA 3V42A 1KU2A 1SVOA 5FKNA 1X58A 3VB2A 1R58A 1YIJI 1J9IA 1R1VA 3BC8A 1YW9A 3TOAA 2HKXA 2E5NA 2D1HA 1TLHB 1ULYA 4B47A 1BM9A 1EKEA 2A6TA 1IRZA 4MTEA 4WK8F 3M8JA 5H6QA 3TO9A 2CG4A 2VKEA 4QLCU 3M4OJ 4XQFA 4X1EA 3ZQGA 4HRIA 2LF8A 3VTIA 3HSRA 1VZ0A 3TW7A 2O8KA 2CH0A 4EJVA 2LK2A 4GGGA 1HW5A 4BXUA 2VJ5A 2XSDC 4GFLA 3IRRA 3T8RA 4DYRA 2MH2A 2A3SA 3HXLA 3WTYC 1I27A 2PG4A 3BG9A 2CU7A 3KP5A 4CICA 1Z67A 4B3XA 2F5CA 5BS6A 3F1BA 5D4SA 4L9TA 5FB2A 2O0YA 2VKDA 4XSXF 1D5VA 3RDIA 2F5FA 3CMMA 3RTRA 1VQ5I 4HX7A 4A6DA 3G1OA 3IH3A 3VYSB 5CVJA 2KIFA 3PNYA 2VB6A 3PL8A 2XAQA 4ZYEA 2KDZA 2LH9A 4E7LA 2FE3A 3VYRB 4NELA 4LMYA 4AWXB 5M3FJ 3QYBA 3ERED 4CHUA 2K7LA 1UG2A 3HSEA 3DPTA 4MFDA 3PFIA 1S29A 3I71A 2P4WA 1TC3C 3QPHA 4OD4A 5FKMA 3HHHA 2VT3A 3WODF 2FD5A 4JP0A 3J80Z 4KICA 5HNHA 4ON0A 3IHUA 1Z6TA 2A61A 2D5VA 4BYYA 3COLA 1XPXA 2NOGA 2DFFA 4WIBA 1EH6A 5FD5A 2NVUB 4HKUA 3L2RA 4FISA 2KIQA 1ZQ3P 4AC6A 3GLLA 3QPTA 1Y1VJ 3CUQB 2V57A 3JCUC 2VODA 3G1LA 4OAZA 1LKXA 2W25A 4XLEA 3K1NA 3DEEA 2WV0A 2QBYA 2X6YA 1MNEA 5IP9J 3IC7A 3JRAA 3QKXA 4EMSA 1YYVA 2L0KA 1IN6A 2JRMA 1HA8A 1RPWA 1IXCA 3O3KA 1ETWA 3GTPJ 1OLTA 4PXIA 3DKYA 1HXDA 1ETVA 2GBYA 3VODA 4GDFA 4KN4X 2K5CA 3F8NA 3TKYA 3PIPF 5IPAA 2KP6A 2HKUA 1TNTA 3BR2A 1QVUA 3CDHA 3D0SA 2IU5A 3KLOA 5HODA 2X1CA 3K2ZA 2PJPA 2CO5A 2RKHA 1MBKA 5DYMA 1TQMA 3S93A 1JHFA 4OAYA 4XL9A 2UXOA 3PUFA 2GM4A 1MGTA 1HOMA 4PJMA 3R6SA 4OINF 2DOFA 2L9VA 2P81A 3W6JB 3FBIB 3MKLA 2R4GA 1RUNA 2UV1A 3W6KB 2DI3A 4U0YA 2L7KA 2QM3A 4R1HA 3EYIA 3ZMDA 2ZC2A 4L0YB 2TDXA 3J81K 4XLFA 4G8XA 5TISC 3BRUA 1YI2I 4ZYHA 3N05A 1IN5A 1R5ID 1UI5A 4X0GA 2Y75A 3HRUA 5E1ZB 2UWMA 3SWHA 4XKWA 3SFIA 1SMTA 1GVJA 2KIUA 2M45A 3DFGA 2CSOA 1J75A 3GTGJ 4RGRA 3ZP5A 1TNSA 1R71A 1MBEA 3RYRA 3LSTA 1Q1VA 2DA1A 2HZDA 3LSHA 2R7SA 3LSGA 2DOEA 3KCCA 2NS7A 4BJTA 4UVBA 2EINH 2IRFG 3OV8A 3GEUA 2ZSHB 1FZPB 2H6CA 2EZIA 1WJDA 2MH9A 1RETA 3S32A 2GA1A 4U0WA 1GUUA 2WADA 2WA0A 3IKTA 3Q0WA 1Q1HA 2FA5A 3EUPA 3I0TA 1QPIA 2RNGA 5H20A 3M9AA 4C3HJ 2F5EA 1KU7A 2E1MB 1OCTC 2X1EA 4V19K 2JUCA 2A5WA 2P5VA 5J1RA 2QSHX 1JTXA 3SZTA 2DA3A 1O7LA 2ADUA 4OIOF 3HUGA 2EIJH 2KMUA 5K58A 5HAWA 4Y13A 1JUPA 4L18B 1MNMC 3KZYA 4HW0A 2EFNA 1LUJB 2JTVA 1NTCA 1SD5A 2QCOA 2DDBA 3H5RA 3ZGKA 3FMSA 3MKWB 1T39A 1WSUA 3F0CA 1QNTA 5LGTA 4GCLA 4EV0A 1R5HA 3HB9A 1D8KA 1ETYA 5DD8A 2LKPA 3GLXA 2B63J 3VOKA 3S3OA 3Q9VA 5E18F 2QQBA 3AQTA 3BOQA 2EV0A 1SC7A 1AKHB 2AXTC 3ONQA 2COBA 1YQAA 3G1MA 1PVEA 4N4NB 1B8IB 2DLLA 1HF0A 3P9KA 3FM5A 3JRGA 3CF5F 1YRNB 4A12A 2M2EA 2GWRA 4CCNA 3S1MJ 1X19A 2ELHA 2K4JA 3BROA 4I02A 4LOCA 2O03A 3ZCOA 4BY7J 2VXDA 2WB1A 1MKMA 4U88A 2VC0A 1R49A 3U2RA 1WKMA 3D5RC 3A0HC 4CYCB 3CJNA 3PPBA 3QU6A 1XSXA 4FASD 4KIFA 2MBFA 4EM2A 1SVLA 2N8GA 3H0DA 1OYWA 3HOXJ 1G8XA 3D5SC 3KZZA 2XRNA 2MC4A 4IJAA 3BNIA 3HTIA 2KFDA 2DO7A 5E20A 2OQGA 3P7NA 1TWCJ 1U9NA 2PFBA 5EG0A 4C2UA 3I53A 4BE1A 1ODDA 4BUPA 2HPMA 1EV7A 2PZ9A 2DA4A 4B3AA 5CLSA 4A3IJ 1VQOI 2DQRA 4A3FJ 4I2OA 2EZLA 1J7KA 5FO5A 4RM3A 1KQ8A 3WE3A 3BR6A 4PFPA 4RBOA 2VBXA 2VQGA 3MEXA 4W97A 2V6EA 3JAMK 2IS6A 4DNCA 1X2NA 5HDGA 2DW4A 1ZH5A 1JT6A 3CCYA 3E5UA 3FK6A 3DLAA 2BHZA 3UR3C 4KYWA 2TCTA 2LBFA 5K5QA 1ZKGA 4GCVA 2L4AA 2AQEA 1S8NA 1AA7A 3JSPA 5ERIA 1JKOC 4RGXA 5L3DA 4AYBN 5K5RA 5HVQC 4RDUA 3GFIA 1S9HA 3BPVA 4GCKA 2EQRA 3U9GA 1IN4A 3DBHB 4J19A 3OYGA 4BDYA 4H0EA 2A05A 4ENNA 2DG7A 1TBXA 2LREA 3CESA 3SZPA 2G7GA 1ZN2A 3DTKA 3FRQA 2HS5A 2GA2A 2HKOA 4PDKA 3ZN1A 3VYUB 1NG7A 2CMPA 4XBFA 4XIDA 2DT7B 4CCKA 2ZSIB 3F23A 1IGNA 1MD0A 1XG1A 1H8AC 2QQ9A 1DU6A 2XKOA 5IYBJ 2RAEA 3SDGA 2DK5A 3HSFA 2DN0A 4M3BA 5IT9K 2MD5A 3FX3A 1IDZA 2E2HJ 1LPQA 2E7XA 2RHAA 2YSRA 2QGUA 2YUSA 5EEGA 1SAUA 2JA8J 3KPHA 1B6AA 4F55A 4PUSA 1ZGJA 5F0HA 2BYVE 3CUQC 5FRNA 2P6TA 3V7CA 4B4CA 3BZCA 1MBJA 1O3SA 2XGDA 3G7RA 1J2XA 1YOVB 2P8TA 2Q2EB 1DPUA 5B5EC 3NNRA 1IXSB 2PMZA 2GOXB 3V78A 2FQ3A 1W1WE 1ZTRA 2HOSA 3KE2A 2XUBA 2I8DA 3MZHA 3WE2A 2JA2A 2LNBA 4IL6C 2BVMA 5C4YA 3C7JA 2J5PA 2E7WA 2EB7A 2FOWA 2M9HA 4G9YA 1T38A 1P92A 4XLAA 2E19A 3RH2A 3BTLA 3CO6C 3QQAA 3H3ZA 4XRMA 5EZHA 5DAJA 4M9ZA 2QSFX 3TOBA 4FTHA 2VL8A 3CUQA 1GXQA 4LIUA 1RC9A 2CW0F 4U9NA 1JGGA 2VBWA 5F64A 3QPLA 2CV0A 4Y33A 1G6NA 1U3EM 1VTNC 2FF4A 1XSDA 3RSNA 4MEXF 4DYQA 1H89C 3C2GA 4V2GA 4BJ6C 1FBSA 1TW3A 3G3ZA 5HS9A 1AOYA 1K6YA 2BY2A 3IV5A 2OZ6A 3FXUA 1G3TA 3V8JA 2ZXHA 1A35A 4GRIA 3KLNA 1BR2A 2R7OA 2R5ZB 4I76A 5LRSA 3B73A 4RGUA 4BU2A 2NP3A 1S6LA 3GBGA 2VQLA 1LNWA 4UXNA 4UVCA 3LJLA 4EATA 4NC8A 1U0JA 4UHTA 5JLWA 1MJBA 2NXNB 3I55I 3QYEA 2D2WA 3FDYA 4ITVA 3E6MA 3WTVC 4QTRA 1SMYF 1UELB 2LY2A 4M3FA 4N4OB 4L5EA 4XMYA 1ZYRF 2DMPA 2E1MC 4GXOA 2V26A 5KAIC 1JTYA 3ON2A 2IGNA 3TW6A 4MTDA 2NVYJ 3PSIA 2G3BA 2X85A 2PLYA 3EUHC 1WGXA 2KQRA 1VQ6I 3W2VA 2IPQX 4S04A 1UB9A 4KT6A 1UAAA 5BNGA 3LSMA 2PEXA 2W53A 2XAUA 2EIMH 1F4KA 2M7BA 2IA1A 2PN6A 5AIQA 1OR7C 3HL2A 3LHQA 3RI4A 4FT8A 3FHZA 2OU2A 2RDPA 4CGRA 3OL3A 1FYLA 4AIHA 1HDDC 3DLLF 3TBIA 1V55H 1KYWA 2KZVA 2X1DA 3AFHA 4XRSG 3J7AO 1VQ4I 2OUMA 9ANTA 2E1CA 1HKQA 3FXMA 1G2HA 1QRYA 2Q1ZB 1UHMA 3DU6A 4LD5A 4EQQA 3GTMJ 4LFUA 3HPGA 1MSEC 3TP0A 1YLFA 2PJRB 2V1DA 1X2MA 1H9TA 1RI7A 5L3BA 1AHDP 2WAFA 2NVXJ 3KP6A 1F9NA 1W0TA 1LFPA 3EUHA 5IYDJ 1MBFA 4S0HB 3CCEI 2M34A 1XN7A 1MDMA 1W4MA 4RA2A 2CQ7A 1YE9A 4OMZA 2YU3A 2V1NA 2YS9A 2KLOA 4KIGA 4RS8A 2G7LA 2DBBA 3GXOA 3ZN0A 4LIVA 1OR7A 1ZHFA 3VSKA 3RKQA 1BIAA 3L9FA 1WJ5A 1IG7A 3A01B 2KHMA 1E3OC 2XDVA 1OPCA 3BR1A 1VQLI 3KEQA 3LSJA 3ZMSA 5HLHA 2OTLI 2IXSA 4BBRJ 1P7IA 1FIAA 5FHPA 2V4JC 1X4PA 4IEJA 3ZMTA 1PUFB 1PJRA 4KFCA 4BEHB 4ZDPA 2HU9A 4F7ZA 3KKCA 3OS2A 2WAQN 1B8IA 4U0VA 3F8BA 2DU9A 4BE2A 1K79A 1VQ9I 3GF2A 3CC2I 2OBPA 3HKZN 2HOTA 2BEOA 3GZIA 1Z7UA 1W7PB 3KKDA 4Y4RA 2O61A 4U87A 1XMAA 3T8TA 5J1UA 4CYCA 5IOZA 3JTGA 4NUBA 3QBMA 2CW7A 3R0JA 3CCSI 2V6CA 3FISA 2EZKA 3H5AA 2LDUA 3B6CA 1KQ0A 4UDSA 5D18A 3REOA 3E0JB 2LD5A 3L2QA 3ISPA 2JMWA 2M0CA 1ERDA 4C3IJ 1HLVA 3DKXA 3U21A 1T0FC 4A0XA 1WJFA 4WXHA 3QOEA 4LG3A 5AIPA 5DEQA 4UUVA 1FOWA 4A3GJ 1POGA 2HZTA 2M30A 3DPLC 1E17A 4WWCA 3H1CA 4F52A 4O5VA 3FXRA 4ZDLA 4F93B 3NARA 5M5WJ 1H9GA 4IRGA 3RKYA 2XB0X 4XKBA 1SFKA 1W7PD 2B9SA 3KP2A 3HEFA 3NEUA 4NHJA 3TO6A 1XD7A 2BW3B 2FBKA 1U6GA 2IGMA 3GEZA 1HSTA 4E7ZA 4G7HF 5KCMA 2R0QC 1UG0A 2EWNA 1E3HA 4C9YA 3V6GA 4BACA 1K61A 5FLVA 2JJ7A 2EA4A 1X3ZB 2HXIA 2W57A 2BOLA 1A31A 1TP4A 3GVAA 1DGWY 3C2BA 3I54A 4UB8C 3VW2A 3OSFA 4C3JJ 1BI3A 2F48A 4UUSB 4E7SA 2NS8A 3K1MA 4ABZA 4V2FA 2IP2A 4B43A 4U7DA 2ESNA 3F21A 5E8GA 2HQ5A 5CXGA 3S1NJ 4ZYAA 4EJOA 2WY8Q 4M9SA 5B1AH 4PJ0C 1Y6IA 1SD7A 2F4MB 4WX9A 3E7LA 1IJWC 4P9FA 5E17F 1RRJA 2PQ8A 1GLNA 4AF5A 5GPAA 1OCPA 1QU3A 2HYJA 2PX9A 5KNLA 2XAGA 4MHGA 4DW6A 1JUSA 3H3UA 2QOPA 5KAFC 2MFZA 3S3NA 4BNCA 3OIPA 3MAJA 4HQEA 1J5YA 3VPRA 2Q2EA 3VVYA 2B7EA 4P5OA 2XASA 2F07A 4JX6A 1IRGA 2VT2A 4RAYA 1SAXA 3NAUA 4XOPA 1DDNA 4GFKA 1VQPI 4ZYDA 2H94A 3D1NI 3S2DJ 5LHIA 3WTUC 2A6EF 4XNFA 1KQ9A 2Y0SA 2YR2A 3VWBA 1ETOA 2H09A 4FX0A 2L7ZA 3ABTA 2XGXA 3F6OA 1LE8B 4FHTA 1D1BA 5IP6A 3BR0A 3Q9SA 3TGNA 5FJ8J 1BW5A 5FMPA 4ZZDA 1E2XA 3H9QA 3HM5A 3DTIA 2JUGA 1Y0UA 3PUBA 4XR6A 2QZ8A 1HBXG 2COMA 2LOOA 3F8CA 1BR4A 1TWFJ 2R5YB 1ORKA 3B02A 2QEXI 5HBUA 2A69F 2DA5A 2H1LA 5KK1A 3K4CA 2K02A 1IZ1A 2X6OA 2JA7J 2FXAA 1PYVA 4FE7A 1IN7A 4PK4A 4EJWA 5B66C 2DODA 5HDKA 2L7MP 2JQ7A 1R23A 2XHKA 1B59A 1YS6A 2K9LA 4JK1X 2XB5A 1XGMA 3L00A 2RQPA 5LLQA 1WQ2A 3K4BA 2VI6A 2M8GX 5J1YA 2H8RA 3FZVA 5E1WA 3KP3A 3P9CA 2X9DA 3KP4A 3LWJA 1UZCA 4C2TA 2VKHA 2JT1A 3WG9A 1ZRDA 1UMQA 2WAEA 3G71I 1MJ9A 1ZAOA 3GTOJ 3MZYA 4I09A 3T0YA 3WG7H 4DGWB 2NRAC 2Z3YA 3QWLA 3V8KA 2Q8KA 1XMXA 4CUGA 4Y52J 3GFLA 5K7FA 3OYMA 1X1PA 2NS0A 1ITYA 4OMYA 5FRMA 4L62A 1G3WA 4XSZF 4A0YA 3UKGA 1WFXA 2ZXIA 3MKYB 4OWRB 2GOMA 2G9WA 3COAC 2WGBA 2MA3A 5CXIA 4PCQA 1G3YA 2K3FA 2K4BA 1R36A 4XKCA 3P5JA 4G7OF 3R0AA 1EJ9A 4GCTA 3BR5A 3OYCA 2ID3A 1JKQC 4XM3A 5A2QK 3K4JA 1BI2A 2FJI1 2UXHA 4DQ2A 1U9OA 4M74A 2AS5F 5F27A 1TT5B 1XGOA 2ZMEB 1BC8C 2ZXWH 3I3LA 1KONA 1YIOA 2VBYA 2L02A 1O57A 3QPSA 2XF7A 2ZKZA 4HYEA 3OYHA 5EDNA 4IHXA 4LITA 2EFQA 2R7DA 3OIQA 2NNNA 2PJRA 4Z2YA 5D8LB 3E5QA 3HRMA 5CQEA 5J47A 4IHYA 1YJ9I 1BI1A 5ILVA 1RNLA 3DBLB 2L9NA 4BHCA 1MBHA 4L9NA 2RV8A 2X6XA 4EJTA 1LDDA 3CZ6A 3CJRB 3F9KA 1CGPA 2VBZA 3DP7A 4IVNA 4DIQA 3MN2A 1HC8A 4WCGA 3LSRA 3OWTA 4Q5SF 3A01A 1OCOH 4BY1J 3M1CA 1JKPC 2W1OA 3OS0A 2GXAA 5F0CA 4HLYA 2R7FA 2JA6J 3I59B 3FXJA 3LMMA 5LHGA 4XICA 5D5VB 3JREA 4F3QA 1PUFA 3A0BC 4X6AJ 2IEKA 1QZEA 1TW2A 1JJ8C 3CCRI 3RIRA 2ZY9A 1XMKA 2DJNA 1K78B 1XC5A 4N9IA 2CUFA 4DOZA 5LHHA 2W7NA 1HKSA 3HRSA 4EGZA 5EGOA 2REKA 4EM0B 3WU1B 1ZARA 1W7PA 2FBHA 3QAHA 1AWCA 1D0ZA 3HE0A 4G6TB 3BLYA 3VP5A 1QGPA 3IH4A 2E35A 1NH3A 3BY6A 1ZLKA 5HOOA 4IZZA 2R7XA 2NP5A 1SD4A 4D1QA 2FNPA 4NNJA 1QQIA 3KYCB 2K86A 1D3YA 1ZG5A 3GFMA 1ON2A 1ZRFA 2OI8A 4KT5C 3HOTA 3AKZA 4KMUX 2NAZA 3BCAA 3BR3A 3I58A 3UNGC 3DQVC 4CDGA 1IC8A 2R93J 3CMEI 5CVVA 3JW4A 3OMYA 4YIRX 3GTKJ 2NVTJ 1K7AA 2EZHA 3HPHA 3DBRB 3KZIC 3ECHA 4OIRF 3SHFA 2FUG2 3WTSC 3HGYA 2MC3A 1TL8A 3K1PA 3DU5A 4E4HA 4G12A 3DXJF 3OY9A 2F2EA 5FD6A 2DG8A 4AC0A 2VE9A 4XONA 4P9UA 2PFVA 2KJBA 4BDZA 2RNJA 3M1EA 1IXRC 1MMSA 3LWFA 5D5XB 1UCRA 5ICGA 2E60A 3ZQHA 4ENKA 2HYGD 3KX2A 3I9V2 2MG4A 5E3MA 3J7ZI 1FYMA 4RAFA 3ZMZA 2BW3A 3LA7A 3LFKA 4WF2A 4C2MA 1JI8A 4IX7A 1G4DA 4AD9A 2QQAA 3BZ6A 4B8XA 3J7YJ 5EFYA 5CPRB 3BJOA 3VEPA 2BZTA 2EBIA 2L4MA 3OYNA 2GIZA 2KZGA 2L9RA 3BQYA 1WCMJ 3K7AJ 3ULQB 4UV9A 1ZELA 1JKRC 3DEUA 2JWTA 5EF6A 1E0EA 3C1DA 2IS2A 4RAZA 2UXIA 4IHWA 3RZDJ 5J4VA 3MMYB 1FPQA 4RB1A 4UUSA 2CUZA 4MK6A 2AQFA 2Z33A 2CFXA 3OSGA 3RD3A 3BZKA 3F6VA 4BJ5C 1R1UA 4OD5A 2EFWA 3MNLA 1ZK8A 2WB1N 4QIWN 3AL0B 2H27A 4L0ZB 5H2FC 3FWEA 4M3DA 3TQNA 4E6KG 1WHUA 4OIQF 4D0PA 3LQQA 1LEAA 2O6GE 4NQWA 1YJNI 2DMUA 3EUAA 4N0BA 3SZGA 3BT9A 2YX7A 4HPQA 5LBQA 2UZKA 3WGGA 4BBSJ 2QQ8A 3CLQA 4NB5A 4D5FA 3EPZA 4B09A 2CUEA 3CCUI 3TEDA 3IUVA 4KISA 1BOAA 2HR3A 4XKVA 1N75A 5E1XA 4BHBA 3KYDB 2HVSA 3DKWA 3GX4X 1B9MA 1FWZA 1FTTA 1FMVA 2EILH 3ERMA 4J00A 3L2UA 4E70A 1Z77A 5IP7J 5J8FA 3M8EA 4AIDA 1Y39A 4IRVA 4CO8A 4OU0A 3GWZA 2WY7Q 2X6WA 1WJEA 5J3LA 1HKTA 2NVQJ 1NG6A 1LE8A 3OYJA 5BPIA 4IQ4A 3CMYA 1BI0A 1O4XA 1JT0A 4QWQA 3OYBA 1BIBA 2XIGA 4IF4A 1HW1A 3HTSB 3QP6A 4YIFA 4M3EA 3DPJA 2R5YA 2JA5J 1FNNA 3OYKA 2OJED 1BOBA 2JZYA 1A6IA 3NXCA 2XAHA 3S17J 3NQOA 3CCLI 2LY9A 1CQTA 5D6FA 5TRDA 1OKRA 1WJBA 3VVZA 2LKSA 2R7QA 1ZGAA 3MQ0A 4GO1A 1LDKB 3HOWJ 2L3DA 2Y69H 4BXXJ 3U1DA 4ENMA 3LFUA 2P7CB 3AAFA 2XKPA 2VQHA 2DJIA 2VOOA 4NDLA 2IS1A 3O8GA 3VW1A 3PFYA 4A3MJ 4IHSA 2DA2A 1U8RA 1Z05A 3FHNA 2X48A 3O2PE 1MBGA 1QZYA 3ASNH 4A3KJ 1ZREA 5B1BH 4BQAA 4RM2A 2XGCA 3JSOA 2O9LA 2WV1A 1VQ7I 2XAJA 2ZMEC 4DBQA 5LGUA 3HZJA 2BXZA 1FC3A 1XX5A 2DMTA 2LYCA 2EJRA 3K9TA 3VYTB 3JRIA 3EQLF 4HZFA 5FGMA 2PMZN 1MZBA 2H8WA 2OZUA 1XCBA 2V7FA 1ETXA 4HX8A 3PIOF 2LF7A 1YITI 2QKLB 2QIBA 1X3UA 2DYRH 3M7GA 1T33A 2W00A 5CYVA 5LGNA 4U7BA 1VQMI 2PI0A 1XB4A 3G73A 3C3WA 2YX4A 3FXLA 5K5OA 1KYZA 1OCCH 3CDIA 3BTJA 4XRFA 4CGZA 4PGGA 2HQRA 2LSOA 4M6XA 1R22A 4XLCA 5A2QZ 3PNTA 4JYKA 2VC1A 2IBDA 1S3JA 1MMGA 1IO2A 1WVRA 4I7HA 4M71A 3GW2A 1TWAJ 3WTXC 3BG3A 4AVZA 3WHBA 2RVCA 1APLC 3HOVJ 4M6VA 2Z99A 2ZOYA 1JE8A 4NN1A 3ABKH 1I50J 3RZOJ 1RESA 4XRSA 3CCVI 1WJCA 1EH8A 4A0ZA 1QPMA 3L2WA 3LSIA 3C2HA 4II2A 3J81Z 4UUTA 2ME6A 2IGKA 2DA6A 4DVYP 1D1AA 1T98A 3MZ8A 4AU7A 3H35A 1KU3A 3ZRGA 1I39A 1DPRA 1HW2A 4XLNF 3OYAA 2CRGA 5J8CA 4N9HA 2NOJB 5E79C 3IWFA 3TDUC 2DTRA 2VPRA 1FEXA 3FBNB 1R1TA 3JRFA 2WWYA 1MIJA 2QBYB 2H6BA 2VXZA 2ISZA 2Z2SB 1JXSA 1S5LC 3L7WA 3NRGA 1P9QC 1W5SA 4BE0A 5F1RA 2HOEA 4Q47A 1IN8A 3S8PA 1R00A 3I4NJ 1F1ZA 3CO7C 2VPLA 3ABMH 4JQFA 3VFZA 1GV5A 2CQQA 1J0RA 4XN0A 5KVRA 3I64A 2A07F 2RC4A 3HBLA 2LLKA 1B72B 2ISYA 5D6EA 2KRFA 2KPMA 3FIWA 2F5DA 1MNDA 2E71A 3PO3J 1K78A 1WWXA 2XF5A 1OQYA 2EV6A 1BJZA 5M5XJ 4MFEA 4I0BA 1ACIA 3IAM2 4LB5A 3Q0VA 1VNDA 5JHUA 4HLXA 3I4PA 2XRLA 1I1GA 3FXOA 1FOXA 2Z1DA 1FTZA 1FT9A 2LTPA 1TT0A 4PSXA 4S05A 2OF7A 1OYIA 4G94A 2Z16A 4AIJA 2EA2A 4AUXA 2GAUA 2VQCA 1AKHA 2BY1A 3LSPA 4TV7A 2STWA 2D6YA 5FKOA 1Z3XA 3BCBA 3GMEA 3JRCA 2PMHA 2LP0A 1FOYA 1LVKA 3RPUD 4RLFA 3OOPA 5C4JJ 1YRNA 4BKXA 5F1JA 1FLIA 3ZQIA 1JJ6C 3AL0C 3G2BA 5J40A 3HOYJ 3ZQFA 2UXXA 4YZEA 3CCJI 1RR7A 2FU4A 2YU9J 3RJPA 1TWHJ 3CP2A 1ETQA 1BBYA 1BN5A 3LAPA 2C6YA 2BVLA 3ZR8X 3E7QA 3QYFA 3OR2C 3OS1A 5LEJA 3E1SA 5FKLA 3LL7A 1FY7A 2ESHA 3ZXSA 3S15J 3BJAA 5D4RA 4A93J 2ETHA 2CQXA 2VASA 2D1VA 1P4XA 1T08B 2VE8A 5HLIA 2GFNA 5GTIC 3KYLA 2EFOA 3HTHA 3TMOA 1ZRCA 1I3QJ 5FLXK 2OPTA 1D5YA 1T56A 1X1BA 2I10A 5AONA 3JAMZ 1BC7C 1A36A 2NX4A 5JFRA 1N78A 1V54H 3C18A 3CJTB 1M1EB 1Y56A 2Y0MA 4QPQA 2ZXJA 2DDAA 3CDLA 1FSHA 3HTUA 3T6NA 1QHHD 3R61A 3KEYA 2JPBA 1DU0A 1PP7U 3LQRA 2Q24A 2DQLA 3TDZC 4L5JA 2YVHA 1Y0NA 1MH3A 1UHSA 4CCMA 2YVEA 2CW8A 5DM7F 4MO7A 2NYXA 2BXYA 4ETSA 5KHDA 1IAWA 4P96A 2E2IJ 2ID6A 3BTCA 3AQSA 2Y30A 3R60A 4KMFA 4ZJZA 2PBIA 1QHGA 2EH3A 5L3GA 1SEUA 1N25A 4HV5A 5TGTA 3E6CC 3HOSA 2JVHA 1VFCA 1T0FA 3M07A 3PQJA 1TZLA 5ILSA 5FFXA 1GVDA 5H6RA 2XSJC 4CA0A 1O3TA 3KIOA 3O6BB 3W2AA 4JL3A 3BJ6A 2QTQA 1K6OA 1G59A 4Y15A 5BOXA 2JPCA 1FIPA 2OQRA 3HG9A 5H9TA 3OYDA 3DV8A 3HC7A 3GTLJ 2ZNYA 5IT9Z 2HQAA 2XPWA 5E3OA 2DFIA 2K40A 3WTZA 2EV5A 2CS3A 2MLGA 1Z7LA 1Z9CA 1QO0D 1YX3A 3HDDA 1XGNA 4D9JA 1IDYA 2ZCXA 1JGSA 1KA8A 2GZWA 4HV6A 2OV7A 3E97A 2RREA 2VN2A 2FEZA 3CQZJ 1PUEE 2OC6A 3ABLH 4EVIA 4AIKA 4M3GA 2MABA 4C30A 3DF8A 5E3NA 2ECCA 4PJLA 1N77A 4BAYA 2QKOA 1USSA 2MSYA 3BDDA 3OR1C 4KWAA 4A3JJ 4DBRA 4FX4A 3EGQA 2GENA 3K70D 1I1SA 2ELKA 2ZNZA 2G7UA 2JSPA 4MQ9F 2DCEA 4EEFG 1D0XA 4QPOA 3GYHX 2I5UA 4LLNA 4A3DJ 3ON4A 4PSWA 3ZQCA 4II3A 1UHWA 4ZTJA 4MEYF 3NWTA 1FP2A 4G6QA 5JLXA 4LLGF 2HYTA 2R92J 3BQZA 1OCRH 2V9PA 1RZ4A 2XAFA 3H36A 2OAZA 4RMNA 4JX4A 3SEQA 1TQPA 3LOCA 4HSRA 3L09A 2KRCA 2UXUA 3F72A 5FROA 3CJQB 4MQVA 3ROUA 2BE5F 3DWLE 2FMYA 2EK5A 2W24A 1J59A 1DP3A 4HBLA 4ZYGA 2LMDA 3V8LA 1YW8A 1OJLA 3NWSA 1H0MA 1RR8C 4IXAA 1D0YA 4IRIA 1TTYA 4XLPF 1XDUA 3OYLA 2DA7A 2F4OB 2DOAA 2P6SA 1GDTA 3HOUJ 3SXYA 2GQQA 3ZMVA 2PBXA 2RASA 4KA4A 2Y0SN 2V9VA 2V9KA 3TO7A 2O7TA 5D19A 4ZTFA 3FMRA 1S7EA 2Z5UA 5FFZA 5K1YA 2R5ZA 2VKVA 2RQQA 3V4GA 1SFOJ 4MXMA 2M4GA 2QLZA 3H92A 5EJCA 3S2HJ 5AQCA 2E1NA 4M73A 2QYOA 4ANJA 2HWVA 2LFBA 2ZJ2A 3IAS2 2VOPA 1UFMA 1ZGWA 4KDPA 4YRVA 3FXQA 4PZJA 2P5LC 3GCMA 2R7VA 5ED4A 4I98B 4NC6A 2KL4A 2WUIA 1UI6A 4RGSA 2ECBA 5D5WB 1V3FA 3A4CA 2MW8A 3EETA 2LG4A 2Z9OA 3T1BA 1J09A 3CCQI 3RQIA 4UB6C 1IW7F 4RAGA 1PDNC 1P6RA 1G3SA 1V5GA 5DCFA 4G7ZF 1LB2A 3HGGA 3I56I 3CWRA 4C2MJ 3IL2A 3CRJA 1B4AA 3W2WA 2UXPA 5GTHC 2A6HF 2K9NA 3ABUA 1WJAA 2K27A 4FETA 4KN7X 3KEOA 2ZJQF 4OIPF 1BA5A 1YHQI 3ASOH 1EF4A 3U1KA 2F4IA 3MD2A 3RPQA 4MLOA 4LG0B 1QA6A 4YFNF 4HDUA 5DD4A 5HLGA 2QSGX 2GXGA 1ENHA 2X4HA 4EJUA 3JRBA 4P55A 1T8IA 5HDNA 2XPUA 2UXNA 4CCJA 1U5TB 1X3WB 2A68F 5GAHJ 2DPDA 4UNOA 5TJJA 5E3LA 1P7JA 1U2WA 1V5EA 1ZR4A 2QWTA 2DK8A 4A3CJ 5DV5A 5C4XJ 1GT0C 1B72A 1IV6A 2A5YB 4LGWA 4UY8I 3A1YA 3GZNB 3HRTA 1X4OA 1H88C 1BR1A 2HNHA 3RPUA 2DTZA 1Z3YA 2WTEA 3F8FA 2DFHA 3BG7A 2KISA 2IJLA 1OYYA 5DS9A 4HDVA 2AO9A 4HNVA 3L2CA 1R9TJ 3VOXA 1YFHA 3BG6A 2STTA 2BY0A 5IY5H 3F22A 2BGCA 3SDBA 1BL0A 1YX5A 2F5VA 5ILUA 1I6HJ 2IS4A 1Y1WJ 1YW7A 2LVSA 4CZZA 2P0WA 2L5QA 1Z91A 1U78A 3CCMI 3GTJJ 2FJ1A 2FMLA 4I6ZA 2GLOA 2JSCA 4W1UA 5F6FA 5C44J 4NBQA 1IUYA 3CJDA 1W36D 3BWGA 1IF1A 2ME0A 4H4KC 4A3EJ 4HOBA 4M6YA 3Q5FA 5E8IA 2A2FX 2G0EA 4BEHA 2B1EA 3CD6I 4KUMA 1ZR2A 4LB6B 4HQMA 2HEOA 1W5TA 2Y9ZA 3G4SI 1VF9A 2E34A 2QWWA 4Y7NJ 2DXIA 1CF7B 2VUMJ 5DCMB 4JKZA 2DT5A 4JX5A 4HNTA 3S5RA 2L01A 3FXKA 3S2WA 3HHGA 5IT3A 3FM3A 4ME9A 5EZGA 4BQNA 3KETA 2RN7A 1L0OC 4IO9F 3FKJA 4AVPA 3Q3SA 5DDGA 2H1KA 2FX0A 2J5OA 3R4KA 3H0GJ 3A02A 5GAEJ 2K9MA 3CMAI 3VIBA 3MFKA 3LNQA 3AG3H 4JBAA 3HIMA 2CV2A 4WXDA 4D5CA 3OYIA 1AU7A 2IT0A 4A69C 2XVCA 3K4NA 5L3FA 4IOAF 3A03A 2W85A 1MDMB 5FLXZ 3GZ5A 4XN3A 1S72I 3KZ9A 1LEBA 3VW0A 2GXBA 5F04A 3K70C 1ONVA 1RKWA 2R3SA 3Q0UA 2R7WA 4M72A 4E7IA 5IYCJ 4KIBA 1O3RA 2KKOA 4RB0A 3LA3A 3OYFA 1ZLJA 4Q4ZF 4KNYA 2LRDA 2XV4S 1V4RA 1EA3A 1NK3P 1UJ8A 2RGVA 2Q0OA 2M87A 3ANPA 3H5NA 1P2FA 2HXOA 1WI9A 1ON1A 4E7JA 3SQNA 2G7HA 2LR8A 3HYIA 2FSWA 4UVAA 1I6XA 2OD5A 3QP5A 2IVMA 4F91B 4IHVA 2O8XA 4A5NA 4YFKF 3T5XA 1XS9A 2TRTA 3BTIA 5GADJ 3O8HA 1XSVA 1Z0XA 3ZQQA 2HQNA 5D1RA 3H9GA 2HTJA 1DGRM 4D7NA 3D5LA 1KGSA 5CVUA 2W4SA 3ZPLA 2CV1A 2ACJA 2V79A 2HDWA 4CSWA 2ZCNA 1LFBA 1U8BA 3BG5A 1STZA 2KDOA 4AYBA 4WXCA 4CZCA 1K4TA 5FKKA 3M8FA 4IOCF 2HYFA 4LLLA 4YIIA 3EUKL 4YG2F 1HQCA 1MSFC 4DZPA 4DYCA 2EFPA 2HTSA 3BJBA 5EEHA 3OIOA 3S16J 1LQ1A 2R7ZJ 3WTTC 4L9JA 2CWEA 4BGDA 1R4MB 3PO2J 4B44A 1RIOH 4AM3A 2GUHA 4HA8A 4IRHA 2M5WA 1MH4A 1I3AA 1WH5A 4I99C 3S14J 4R79A 3LSKA 3P9TA 3IUOA 2HGCA 3OOUA 5HS7A 2CQNA 2MYSA 4CYDA 4UV8A 2QENA 2QKMB 1QBJA 5JVGF 4KJZA 1Z6RA 3K4LA
chains in the Genus database with same CATH topology
1IJWC 2CQQA 1FJLA 4AF5A 3HBLA 5GPAA 1OCPA 3BRUA 2LLKA 1UI5A 1B72B 2HYJA 3FIWA 3JSJA 3SFIA 4DW6A 1JUSA 3ZOBA 2QOPA 3PO3J 3GTGJ 2L7FP 1BJZA 5M5XJ 1MBEA 4MFEA 3VPRA 1Q1VA 2DA1A 3VVYA 3Q0VA 1VNDA 3LSGA 2NS7A 2F07A 4JX6A 5FGLA 5C3EJ 3NPIA 3NAUA 2XRLA 3GEUA 1HCRA 1FTZA 2EZIA 4GFKA 1RETA 2LTPA 3D1NI 3S2DJ 4FE4A 1GUUA 2OF7A 3Q0WA 1ETOA 1NK2P 2L7ZA 4A3LJ 3EUPA 1LE8B 2HOAA 3NI7A 2IAIA 4AUXA 1W0UA 4C3HJ 1QPIA 1GV2A 1OCTC 5IP6A 3BR0A 5FJ8J 1BW5A 1A5JA 5J1RA 5FMPA 1LFUP 1AKHA 1JTXA 3HM5A 4DZJA 3LSPA 2D6YA 2DA3A 5FKOA 3JRCA 5K58A 5HAWA 2LP0A 1TWFJ 2R5YB 5M5YJ 1JUPA 5C4JJ 3MVPA 1YRNA 1ORKA 4BKXA 1MNMC 5F1JA 5HBUA 2DA5A 1NTCA 2QCOA 3ZQIA 1JJ6C 3HOYJ 3ZQFA 1SANA 4YZEA 2X6OA 2JA7J 3F0CA 1RR7A 2YU9J 2XPVA 4FE7A 4GCLA 1TWHJ 2L7MP 3HB9A 3FK7A 1ETYA 1ETQA 2B63J 1F43A 3VOKA 2XB5A 3E7QA 3AQTA 5FKLA 1AKHB 2W48A 3DEWA 3S15J 2COBA 2VI6A 3G1MA 2M8GX 4A93J 5J1YA 3VVXA 1B8IB 2H8RA 2CQXA 1HF0A 3JRGA 1YRNB 2X9DA 2GFNA 3BCGA 3HTHA 2M2EA 3S1MJ 3LWJA 4FCYA 4LOCA 1I3QJ 2OPTA 1D5YA 1T56A 4BY7J 2I10A 3G56A 1UMQA 2NX4A 1JUMA 3GTOJ 2E2JJ 3FKIJ 3CDLA 4CYCB 3PPBA 4Y52J 3T6NA 5FLMJ 5GP9A 1QVTA 5K7FA 1DU0A 2N8GA 3HOXJ 2Q24A 1ITYA 2YVHA 1MH3A 1UHSA 2QF7A 2YVEA 3BNIA 3UKGA 3HTIA 4L62A 1TWCJ 1U9NA 4MO7A 2E2IJ 5EG0A 2ID6A 3BTCA 3AQSA 2Y30A 2PZ9A 2WGBA 2DA4A 3O60A 5CXIA 1WPKA 3L1PA 2EH3A 4B3AA 4A3IJ 4A3FJ 3IH2A 2EZLA 4GCTA 1VFCA 3BR6A 3BR5A 4RBOA 2ID3A 1JKQC 1GVDA 5EEAA 4W97A 4JL3A 2FBQA 2UXHA 2QTQA 1U9OA 1TWGJ 1X2NA 5F27A 1JT6A 3CCYA 2Y2ZA 3FK6A 1FIPA 3K2AA 3GTLJ 5H9TA 2TCTA 2XPWA 5E3OA 4A3BJ 1ZKGA 2K40A 2JN6A 2XGEA 2MGQA 1OFCX 3QPSA 1JKOC 5EDNA 4AYBN 4IHXA 1WI3A 4RDUA 3PM1A 4XK4A 3HDDA 4GCKA 1IDYA 2EQRA 4IHYA 3I4MJ 5K7ZA 2ZCXA 4J19A 1MBHA 2DG7A 2G7GA 3FRQA 3CQZJ 4M3GA 4GFBA 5E3NA 4XIDA 2ECCA 3C07A 2QKOA 2MSYA 4KWAA 4A3JJ 3MN2A 2FQ4A 3EGQA 1IGNA 2GENA 3LSRA 1XG1A 2ELKA 1H8AC 3A01A 1DU6A 5IYBJ 2RAEA 3SDGA 4EEFG 1JKPC 2DN0A 4M3BA 4BY1J 5F0CA 1IDZA 2OERA 2JA6J 3JR9A 2E2HJ 2RHAA 4A3DJ 3ON4A 4XICA 3ZQCA 3JREA 4X6AJ 1PUFA 2YUSA 2JA8J 2LKXA 3GTQJ 2Y31A 2IEKA 5JLXA 2Y9YA 2HYTA 5EYRA 1JJ8C 1WH7A 2R92J 3BQZA 2DJNA 3S1QJ 5F0HA 4JX4A 1XC5A 3LOCA 2CUFA 4B4CA 3VUQA 1MBJA 2UXUA 2XGDA 5EGOA 3G7RA 2REKA 3W6VA 3HE0A 2JK3A 3WHCA 3NNRA 3VP5A 2XDNA 2DMNA 3IH4A 3B6AA 1OJLA 3V78A 2NP5A 5DTDA 2HOSA 1ZTRA 5F0FA 3TP3A 1HDPA 4ACIA 2DA7A 2HDDA 2OI8A 5C4YA 1GDTA 3HOUJ 3BHQA 1K83J 3BR3A 2M9HA 2PBXA 2RASA 2ZOZA 2O7OA 1IC8A 1ETKA 2R93J 2Y0SN 3GTKJ 2NVTJ 2E19A 3RH2A 3BTLA 2O7TA 5D19A 1S7EA 2EZHA 2R5ZA 3QQAA 2VKVA 4XRMA 5EGOB 3HGYA 5EZHA 1SFOJ 4MXMA 5DAJA 2CJJA 4FTHA 3S2HJ 3H3VK 4G12A 5AQCA 2K9SA 2DG8A 1SGMA 4QSHA 4AC0A 3S1RJ 2LFBA 3ZQLA 4ICHA 1JGGA 1ZGWA 5CW8A 5M3MJ 3QPLA 4D7MA 2K9QA 3ZQHA 2AHQA 5E3MA 2WUIA 2MG4A 1UI6A 1VI0A 2ECBA 3SJMA 2G7SA 1BW6A 2MW8A 5F08A 4DYQA 1H89C 4V2GA 5EFYA 1RKTA 3IV5A 3HTAA 2KT0A 3RQIA 2ZCMA 2EBIA 2L9RA 3KNWA 1F36A 3BQYA 1WCMJ 3K7AJ 3HGGA 4I76A 2R5ZB 3CWRA 4C2MJ 1JKRC 2NP3A 3GBGA 2JWTA 5EF6A 3B81A 3CRJA 2UXPA 2UXIA 2K9NA 1BA5A 3LJLA 4IHWA 3RZDJ 5JLWA 1EF4A 4UUSA 4MK6A 3RD3A 3OSGA 4MLOA 3M3YJ 1IUFA 1ENHA 3JRBA 3MNLA 1ZK8A 2WB1N 4QIWN 3PASA 2XPUA 4M3DA 4QTRA 3HTJA 4M3FA 4L5EA 5IOYA 2DMUA 2HI3A 2DMPA 3DCFA 1P7JA 5E3LA 3BT9A 1ZR4A 2DMQA 2QWTA 1JTYA 2ZB9A 4A3CJ 3TW6A 5C4XJ 3ON2A 2NVYJ 5EG0B 2G3BA 1GT0C 1B72A 1IV6A 4BBSJ 1WGXA 5K7HA 1H88C 4D5FA 3JRDA 2DTZA 2CUEA 5BNGA 3TEDA 3IUVA 2W53A 5DS9A 2AO9A 4HNVA 3LHQA 1R9TJ 3VOXA 3HOZJ 4CGRA 1FTTA 1BL0A 1HDDC 1I6HJ 1Z77A 5IP7J 1Y1WJ 2LVSA 4XRSG 3JRHA 5GPCA 1U78A 9ANTA 4B1RA 3GTJJ 2FJ1A 5J3LA 4I6ZA 2GLOA 4W1UA 5C44J 2E1OA 1G2HA 1QRYA 2NVQJ 1LE8A 3CJDA 3GTMJ 4JNNA 1MSEC 2ME0A 4MIMA 3TP0A 3CMYA 4A3EJ 1O4XA 1JT0A 1X2MA 5HSZA 1AHDP 3ANGA 2G0EA 1W0TA 2NVXJ 5FKNA 1X58A 1ZR2A 2Y9ZA 5IYDJ 1MBFA 4S0HB 1VF9A 2M34A 4M3EA 2R5YA 2JA5J 4Y7NJ 3DPJA 2VUMJ 4JKZA 4JX5A 3S5RA 2YS9A 2G7LA 1IRZA 1A6IA 3NXCA 3S17J 4ME9A 2LY9A 2VKEA 5EZGA 1CQTA 3M4OJ 3RKQA 4X1EA 3ZQGA 3VVZA 1IG7A 3A01B 1E3OC 3TW7A 3Q3SA 2O8KA 2H1KA 3BR1A 2FX0A 3LSJA 2LK2A 3H0GJ 3A02A 3HOWJ 4BBRJ 2XSDC 1P7IA 4GFLA 3VIBA 1FIAA 4BXXJ 5FHPA 3LNQA 4IEJA 3HIMA 1PUFB 4DYRA 4D5CA 1AU7A 3KKCA 4A69C 4NDLA 3BG9A 2CU7A 2WAQN 1B8IA 3A03A 3O8GA 3VW1A 3F1BA 4A3MJ 2DA2A 3KZ9A 3VW0A 2X48A 1MBGA 5F04A 4A3KJ 3HKZN 1RKWA 2HOTA 3Q0UA 3GZIA 3G1OA 3IH3A 2O9LA 2XGCA 3KKDA 2WV1A 5IYCJ 2KDZA 5J1UA 4CYCA 5IOZA 4NELA 5M3FJ 2DMTA 3QBMA 1UG2A 1NK3P 4MFDA 3ANPA 3JRIA 3FISA 2EZKA 2PMZN 1TC3C 1ETXA 3B6CA 2HXOA 4UDSA 2QIBA 5D18A 5FKMA 2LD5A 2FD5A 2JMWA 2M0CA 1T33A 4JP0A 4C3IJ 1HLVA 2LR8A 2D5VA 3BTJA 3COLA 2NOGA 4A3GJ 4IHVA 1POGA 4JYKA 4AC6A 1XS9A 4HKUA 4FISA 2TRTA 3BTIA 1ZQ3P 3O8HA 2IBDA 1Z0XA 1Y1VJ 2V57A 5D1RA 1TWAJ 3BG3A 3G1LA 4D7NA 3NARA 3WHBA 5M5WJ 1APLC 3HOVJ 2XB0X 4M6VA 5IP9J 2ZOYA 3QKXA 3JRAA 2ZCNA 4NN1A 2L0KA 1LFBA 1I50J 3BG5A 1U8BA 3HEFA 1RPWA 3RZOJ 4PXIA 1RESA 1ETWA 4XRSA 3GTPJ 1ETVA 5FKKA 2GBYA 2R0QC 1MSFC 4DZPA 4UUTA 2ME6A 4DYCA 2DA6A 3BJBA 5IPAA 3V6GA 3OIOA 1K61A 5FLVA 2HKUA 2JJ7A 3S16J 3BR2A 1QVUA 2IU5A 2R7ZJ 2CRGA 2HXIA 5HODA 3PO2J 2VPRA 1FEXA 3C2BA 1MBKA 3VW2A 3OSFA 4C3JJ 4UUSB 3JRFA 2GUHA 2NS8A 4ABZA 4V2FA 1MH4A 2UXOA 1WH5A 2HQ5A 2GM4A 5CXGA 3S1NJ 3NRGA 3S14J 1HOMA 3P9TA 2P81A 3OOUA 3MKLA 3I4NJ 3E7LA 1GV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJW C;  2CQQ A;  1FJL A;  4AF5 A;  3HBL A;  5GPA A;  1OCP A;  3BRU A;  2LLK A;  1UI5 A;  1B72 B;  2HYJ A;  3FIW A;  3JSJ A;  3SFI A;  4DW6 A;  1JUS A;  3ZOB A;  2QOP A;  3PO3 J;  3GTG J;  2L7F P;  1BJZ A;  5M5X J;  1MBE A;  4MFE A;  3VPR A;  1Q1V A;  2DA1 A;  3VVY A;  3Q0V A;  1VND A;  3LSG A;  2NS7 A;  2F07 A;  4JX6 A;  5FGL A;  5C3E J;  3NPI A;  3NAU A;  2XRL A;  3GEU A;  1HCR A;  1FTZ A;  2EZI A;  4GFK A;  1RET A;  2LTP A;  3D1N I;  3S2D J;  4FE4 A;  1GUU A;  2OF7 A;  3Q0W A;  1ETO A;  1NK2 P;  2L7Z A;  4A3L J;  3EUP A;  1LE8 B;  2HOA A;  3NI7 A;  2IAI A;  4AUX A;  1W0U A;  4C3H J;  1QPI A;  1GV2 A;  1OCT C;  5IP6 A;  3BR0 A;  5FJ8 J;  1BW5 A;  1A5J A;  5J1R A;  5FMP A;  1LFU P;  1AKH A;  1JTX A;  3HM5 A;  4DZJ A;  3LSP A;  2D6Y A;  2DA3 A;  5FKO A;  3JRC A;  5K58 A;  5HAW A;  2LP0 A;  1TWF J;  2R5Y B;  5M5Y J;  1JUP A;  5C4J J;  3MVP A;  1YRN A;  1ORK A;  4BKX A;  1MNM C;  5F1J A;  5HBU A;  2DA5 A;  1NTC A;  2QCO A;  3ZQI A;  1JJ6 C;  3HOY J;  3ZQF A;  1SAN A;  4YZE A;  2X6O A;  2JA7 J;  3F0C A;  1RR7 A;  2YU9 J;  2XPV A;  4FE7 A;  4GCL A;  1TWH J;  2L7M P;  3HB9 A;  3FK7 A;  1ETY A;  1ETQ A;  2B63 J;  1F43 A;  3VOK A;  2XB5 A;  3E7Q A;  3AQT A;  5FKL A;  1AKH B;  2W48 A;  3DEW A;  3S15 J;  2COB A;  2VI6 A;  3G1M A;  2M8G X;  4A93 J;  5J1Y A;  3VVX A;  1B8I B;  2H8R A;  2CQX A;  1HF0 A;  3JRG A;  1YRN B;  2X9D A;  2GFN A;  3BCG A;  3HTH A;  2M2E A;  3S1M J;  3LWJ A;  4FCY A;  4LOC A;  1I3Q J;  2OPT A;  1D5Y A;  1T56 A;  4BY7 J;  2I10 A;  3G56 A;  1UMQ A;  2NX4 A;  1JUM A;  3GTO J;  2E2J J;  3FKI J;  3CDL A;  4CYC B;  3PPB A;  4Y52 J;  3T6N A;  5FLM J;  5GP9 A;  1QVT A;  5K7F A;  1DU0 A;  2N8G A;  3HOX J;  2Q24 A;  1ITY A;  2YVH A;  1MH3 A;  1UHS A;  2QF7 A;  2YVE A;  3BNI A;  3UKG A;  3HTI A;  4L62 A;  1TWC J;  1U9N A;  4MO7 A;  2E2I J;  5EG0 A;  2ID6 A;  3BTC A;  3AQS A;  2Y30 A;  2PZ9 A;  2WGB A;  2DA4 A;  3O60 A;  5CXI A;  1WPK A;  3L1P A;  2EH3 A;  4B3A A;  4A3I J;  4A3F J;  3IH2 A;  2EZL A;  4GCT A;  1VFC A;  3BR6 A;  3BR5 A;  4RBO A;  2ID3 A;  1JKQ C;  1GVD A;  5EEA A;  4W97 A;  4JL3 A;  2FBQ A;  2UXH A;  2QTQ A;  1U9O A;  1TWG J;  1X2N A;  5F27 A;  1JT6 A;  3CCY A;  2Y2Z A;  3FK6 A;  1FIP A;  3K2A A;  3GTL J;  5H9T A;  2TCT A;  2XPW A;  5E3O A;  4A3B J;  1ZKG A;  2K40 A;  2JN6 A;  2XGE A;  2MGQ A;  1OFC X;  3QPS A;  1JKO C;  5EDN A;  4AYB N;  4IHX A;  1WI3 A;  4RDU A;  3PM1 A;  4XK4 A;  3HDD A;  4GCK A;  1IDY A;  2EQR A;  4IHY A;  3I4M J;  5K7Z A;  2ZCX A;  4J19 A;  1MBH A;  2DG7 A;  2G7G A;  3FRQ A;  3CQZ J;  4M3G A;  4GFB A;  5E3N A;  4XID A;  2ECC A;  3C07 A;  2QKO A;  2MSY A;  4KWA A;  4A3J J;  3MN2 A;  2FQ4 A;  3EGQ A;  1IGN A;  2GEN A;  3LSR A;  1XG1 A;  2ELK A;  1H8A C;  3A01 A;  1DU6 A;  5IYB J;  2RAE A;  3SDG A;  4EEF G;  1JKP C;  2DN0 A;  4M3B A;  4BY1 J;  5F0C A;  1IDZ A;  2OER A;  2JA6 J;  3JR9 A;  2E2H J;  2RHA A;  4A3D J;  3ON4 A;  4XIC A;  3ZQC A;  3JRE A;  4X6A J;  1PUF A;  2YUS A;  2JA8 J;  2LKX A;  3GTQ J;  2Y31 A;  2IEK A;  5JLX A;  2Y9Y A;  2HYT A;  5EYR A;  1JJ8 C;  1WH7 A;  2R92 J;  3BQZ A;  2DJN A;  3S1Q J;  5F0H A;  4JX4 A;  1XC5 A;  3LOC A;  2CUF A;  4B4C A;  3VUQ A;  1MBJ A;  2UXU A;  2XGD A;  5EGO A;  3G7R A;  2REK A;  3W6V A;  3HE0 A;  2JK3 A;  3WHC A;  3NNR A;  3VP5 A;  2XDN A;  2DMN A;  3IH4 A;  3B6A A;  1OJL A;  3V78 A;  2NP5 A;  5DTD A;  2HOS A;  1ZTR A;  5F0F A;  3TP3 A;  1HDP A;  4ACI A;  2DA7 A;  2HDD A;  2OI8 A;  5C4Y A;  1GDT A;  3HOU J;  3BHQ A;  1K83 J;  3BR3 A;  2M9H A;  2PBX A;  2RAS A;  2ZOZ A;  2O7O A;  1IC8 A;  1ETK A;  2R93 J;  2Y0S N;  3GTK J;  2NVT J;  2E19 A;  3RH2 A;  3BTL A;  2O7T A;  5D19 A;  1S7E A;  2EZH A;  2R5Z A;  3QQA A;  2VKV A;  4XRM A;  5EGO B;  3HGY A;  5EZH A;  1SFO J;  4MXM A;  5DAJ A;  2CJJ A;  4FTH A;  3S2H J;  3H3V K;  4G12 A;  5AQC A;  2K9S A;  2DG8 A;  1SGM A;  4QSH A;  4AC0 A;  3S1R J;  2LFB A;  3ZQL A;  4ICH A;  1JGG A;  1ZGW A;  5CW8 A;  5M3M J;  3QPL A;  4D7M A;  2K9Q A;  3ZQH A;  2AHQ A;  5E3M A;  2WUI A;  2MG4 A;  1UI6 A;  1VI0 A;  2ECB A;  3SJM A;  2G7S A;  1BW6 A;  2MW8 A;  5F08 A;  4DYQ A;  1H89 C;  4V2G A;  5EFY A;  1RKT A;  3IV5 A;  3HTA A;  2KT0 A;  3RQI A;  2ZCM A;  2EBI A;  2L9R A;  3KNW A;  1F36 A;  3BQY A;  1WCM J;  3K7A J;  3HGG A;  4I76 A;  2R5Z B;  3CWR A;  4C2M J;  1JKR C;  2NP3 A;  3GBG A;  2JWT A;  5EF6 A;  3B81 A;  3CRJ A;  2UXP A;  2UXI A;  2K9N A;  1BA5 A;  3LJL A;  4IHW A;  3RZD J;  5JLW A;  1EF4 A;  4UUS A;  4MK6 A;  3RD3 A;  3OSG A;  4MLO A;  3M3Y J;  1IUF A;  1ENH A;  3JRB A;  3MNL A;  1ZK8 A;  2WB1 N;  4QIW N;  3PAS A;  2XPU A;  4M3D A;  4QTR A;  3HTJ A;  4M3F A;  4L5E A;  5IOY A;  2DMU A;  2HI3 A;  2DMP A;  3DCF A;  1P7J A;  5E3L A;  3BT9 A;  1ZR4 A;  2DMQ A;  2QWT A;  1JTY A;  2ZB9 A;  4A3C J;  3TW6 A;  5C4X J;  3ON2 A;  2NVY J;  5EG0 B;  2G3B A;  1GT0 C;  1B72 A;  1IV6 A;  4BBS J;  1WGX A;  5K7H A;  1H88 C;  4D5F A;  3JRD A;  2DTZ A;  2CUE A;  5BNG A;  3TED A;  3IUV A;  2W53 A;  5DS9 A;  2AO9 A;  4HNV A;  3LHQ A;  1R9T J;  3VOX A;  3HOZ J;  4CGR A;  1FTT A;  1BL0 A;  1HDD C;  1I6H J;  1Z77 A;  5IP7 J;  1Y1W J;  2LVS A;  4XRS G;  3JRH A;  5GPC A;  1U78 A;  9ANT A;  4B1R A;  3GTJ J;  2FJ1 A;  5J3L A;  4I6Z A;  2GLO A;  4W1U A;  5C44 J;  2E1O A;  1G2H A;  1QRY A;  2NVQ J;  1LE8 A;  3CJD A;  3GTM J;  4JNN A;  1MSE C;  2ME0 A;  4MIM A;  3TP0 A;  3CMY A;  4A3E J;  1O4X A;  1JT0 A;  1X2M A;  5HSZ A;  1AHD P;  3ANG A;  2G0E A;  1W0T A;  2NVX J;  5FKN A;  1X58 A;  1ZR2 A;  2Y9Z A;  5IYD J;  1MBF A;  4S0H B;  1VF9 A;  2M34 A;  4M3E A;  2R5Y A;  2JA5 J;  4Y7N J;  3DPJ A;  2VUM J;  4JKZ A;  4JX5 A;  3S5R A;  2YS9 A;  2G7L A;  1IRZ A;  1A6I A;  3NXC A;  3S17 J;  4ME9 A;  2LY9 A;  2VKE A;  5EZG A;  1CQT A;  3M4O J;  3RKQ A;  4X1E A;  3ZQG A;  3VVZ A;  1IG7 A;  3A01 B;  1E3O C;  3TW7 A;  3Q3S A;  2O8K A;  2H1K A;  3BR1 A;  2FX0 A;  3LSJ A;  2LK2 A;  3H0G J;  3A02 A;  3HOW J;  4BBR J;  2XSD C;  1P7I A;  4GFL A;  3VIB A;  1FIA A;  4BXX J;  5FHP A;  3LNQ A;  4IEJ A;  3HIM A;  1PUF B;  4DYR A;  4D5C A;  1AU7 A;  3KKC A;  4A69 C;  4NDL A;  3BG9 A;  2CU7 A;  2WAQ N;  1B8I A;  3A03 A;  3O8G A;  3VW1 A;  3F1B A;  4A3M J;  2DA2 A;  3KZ9 A;  3VW0 A;  2X48 A;  1MBG A;  5F04 A;  4A3K J;  3HKZ N;  1RKW A;  2HOT A;  3Q0U A;  3GZI A;  3G1O A;  3IH3 A;  2O9L A;  2XGC A;  3KKD A;  2WV1 A;  5IYC J;  2KDZ A;  5J1U A;  4CYC A;  5IOZ A;  4NEL A;  5M3F J;  2DMT A;  3QBM A;  1UG2 A;  1NK3 P;  4MFD A;  3ANP A;  3JRI A;  3FIS A;  2EZK A;  2PMZ N;  1TC3 C;  1ETX A;  3B6C A;  2HXO A;  4UDS A;  2QIB A;  5D18 A;  5FKM A;  2LD5 A;  2FD5 A;  2JMW A;  2M0C A;  1T33 A;  4JP0 A;  4C3I J;  1HLV A;  2LR8 A;  2D5V A;  3BTJ A;  3COL A;  2NOG A;  4A3G J;  4IHV A;  1POG A;  4JYK A;  4AC6 A;  1XS9 A;  4HKU A;  4FIS A;  2TRT A;  3BTI A;  1ZQ3 P;  3O8H A;  2IBD A;  1Z0X A;  1Y1V J;  2V57 A;  5D1R A;  1TWA J;  3BG3 A;  3G1L A;  4D7N A;  3NAR A;  3WHB A;  5M5W J;  1APL C;  3HOV J;  2XB0 X;  4M6V A;  5IP9 J;  2ZOY A;  3QKX A;  3JRA A;  2ZCN A;  4NN1 A;  2L0K A;  1LFB A;  1I50 J;  3BG5 A;  1U8B A;  3HEF A;  1RPW A;  3RZO J;  4PXI A;  1RES A;  1ETW A;  4XRS A;  3GTP J;  1ETV A;  5FKK A;  2GBY A;  2R0Q C;  1MSF C;  4DZP A;  4UUT A;  2ME6 A;  4DYC A;  2DA6 A;  3BJB A;  5IPA A;  3V6G A;  3OIO A;  1K61 A;  5FLV A;  2HKU A;  2JJ7 A;  3S16 J;  3BR2 A;  1QVU A;  2IU5 A;  2R7Z J;  2CRG A;  2HXI A;  5HOD A;  3PO2 J;  2VPR A;  1FEX A;  3C2B A;  1MBK A;  3VW2 A;  3OSF A;  4C3J J;  4UUS B;  3JRF A;  2GUH A;  2NS8 A;  4ABZ A;  4V2F A;  1MH4 A;  2UXO A;  1WH5 A;  2HQ5 A;  2GM4 A;  5CXG A;  3S1N J;  3NRG A;  3S14 J;  1HOM A;  3P9T A;  2P81 A;  3OOU A;  3MKL A;  3I4N J;  3E7L A;  1GV5 A; 
#chains in the Genus database with same CATH topology
 5GAG J;  2DPU A;  1LDJ A;  1FJL A;  4Q48 A;  4DJA A;  3H9J A;  4BH9 A;  5JHF A;  2CQK A;  5HNF A;  2FOK A;  3WGI A;  3GFJ A;  3NRV A;  1SVM A;  1K4S A;  3JSJ A;  3ZOB A;  1MJA A;  2IA2 A;  2LC2 A;  2L7F P;  3DPU A;  5L3E A;  3EYY A;  4HNU A;  3G6E I;  1GXP A;  2DT6 A;  4L5I A;  1BJA A;  5JR3 A;  3SFZ A;  4I01 A;  4PJJ A;  3KP7 A;  5JVT A;  5C3E J;  4RLQ A;  3NPI A;  2DFE A;  1B1B A;  5FGL A;  1HCR A;  1P4W A;  2BHY A;  3N4M A;  3JTH A;  1D1C A;  2L2O A;  4FE4 A;  5CQG A;  1FBQ A;  1P4A A;  1NK2 P;  2JVG A;  3IRQ A;  2B3W A;  3GZ6 A;  4A3L J;  2HOA A;  3QU3 A;  3NI7 A;  2IAI A;  1W0U A;  3FMQ A;  1GV2 A;  1SD6 A;  5J4Y A;  2NNY A;  3E3V A;  3CTA A;  4O6J A;  1A5J A;  4ESB A;  1LFU P;  4DZJ A;  2ZBK A;  2R7T A;  3KFW X;  5CVR A;  2BY3 A;  3LA2 A;  1R4N B;  4HF2 A;  2XRO A;  4HF0 A;  5M5Y J;  3MVP A;  1WZ2 A;  4E7H A;  4CCL A;  2JRT A;  1KZH A;  1RUO A;  3GO5 A;  1Y8R B;  1LJ9 A;  2M0M A;  1OIS A;  1SAN A;  3F8M A;  1U5T C;  2YPR A;  1YO5 C;  1W36 C;  3A2K A;  4MGR A;  2XPV A;  1LVA A;  1OMI A;  1MW7 A;  4ZZL A;  2K85 A;  1F5T A;  3FK7 A;  2DYS H;  1F43 A;  3ZQ7 A;  2OTJ I;  4YEL A;  1A6Q A;  4EGY A;  4ESJ A;  3ECO A;  4XLH A;  3VOE A;  2W48 A;  3DEW A;  3K6G A;  2KJC A;  1R5G A;  3QRF F;  1KU9 A;  3VVX A;  5DUI A;  4OOI A;  5CVI A;  1X1A A;  3BCG A;  1HSJ A;  4FCY A;  1FP1 D;  2HFH A;  1W5C C;  4ZDO A;  5LRR A;  2IGO A;  3G56 A;  2P7V B;  5ICC A;  1FYK A;  2D45 A;  1JUM A;  2ZJP F;  4LG0 A;  2E2J J;  2ZO4 A;  2W82 A;  4RB2 C;  3FKI J;  2VJJ A;  1FOK A;  3WU2 C;  2F6C A;  5ICF A;  5FLM J;  1FBU A;  4BS9 A;  5GP9 A;  1QVT A;  3V7R A;  3F3X A;  4IQJ A;  4M9X A;  1U5T A;  2ZME A;  2EIK H;  1L3L A;  1YS7 A;  3CLO A;  2OA4 A;  2OCC H;  3K4K A;  3NS4 A;  5LFA A;  2IW5 A;  5BPD A;  1R6R A;  2QF7 A;  3CF2 A;  3I5U A;  3CP8 A;  2HVR A;  3V7S A;  2GIV A;  3O60 A;  1WPK A;  3L1P A;  3J80 K;  1MMD A;  3EDP A;  1VQ8 I;  3CUO A;  3IH2 A;  4PJN A;  2QA4 I;  2CUJ A;  3IKV A;  5DUK A;  2O5R A;  2M8E A;  3K10 A;  3AG4 H;  5EEA A;  3K0L A;  2DAO A;  3P9I A;  2MLK A;  4A2U A;  3PNV A;  2FBQ A;  4LK1 F;  4CCO A;  1GHC A;  2ELJ A;  1TWG J;  3MCZ A;  2AXL A;  4HST A;  5L3C A;  2ZFU A;  3VSL A;  2Y2Z A;  2VIX A;  6PAX A;  4BQQ A;  3K2A A;  3CC7 I;  4NC7 A;  4PGH A;  4A3B J;  3PSF A;  2JN6 A;  2XGE A;  3HJE A;  4IPA A;  3SYT A;  3BPX A;  2MGQ A;  1OFC X;  1O3Q A;  2KIM A;  4O3M A;  3I59 A;  1WI3 A;  3PM1 A;  1B9N A;  1SFE A;  4XK4 A;  4B48 A;  3I4M J;  1XDS A;  5K7Z A;  1FMW A;  1T95 A;  1Z21 A;  4YFX F;  4HAM A;  2B0L A;  4J01 A;  2M7A A;  4XOR A;  5JI6 A;  1CF7 A;  5DCM A;  3E6D A;  4GFB A;  2XF6 A;  4IHT A;  3C07 A;  2V1X A;  2L9S A;  2FBI A;  2FQ4 A;  3ZMU A;  1S7A A;  1X1D A;  3FF5 A;  4Z6Y A;  5HS8 A;  5J6X A;  2OER A;  2FRH A;  2MD0 A;  3X2Q H;  3JR9 A;  3OYE A;  2WAQ A;  3K8P C;  3MWM A;  2UUZ A;  4BL0 B;  2XC7 A;  4KIT B;  4XOT A;  2ICW G;  4PFO A;  1V5F A;  2CGP A;  5LD2 C;  1JHH A;  2LKX A;  1C0W A;  3GTQ J;  2Y31 A;  2QUF A;  2Y9Y A;  3GUD A;  3HKZ A;  5EYR A;  3WGH A;  1WH7 A;  4HG2 A;  3S1Q J;  4IKF A;  1YJW I;  2M1B A;  3VUQ A;  1O7F A;  2CFO A;  3QOP A;  1R7J A;  4A5M A;  3W6V A;  2HDC A;  2JK3 A;  1Z1D A;  3WHC A;  1DP7 P;  5HLT A;  4R8H A;  5D8K B;  5B3S H;  4ENJ A;  4P1W A;  1S7O A;  2DMN A;  2XDN A;  4U9L A;  2R7R A;  3B6A A;  5BQT A;  2VLA A;  3L2V A;  2BBY A;  4LK0 F;  5DTD A;  5F0F A;  3TP3 A;  2K3P A;  1HDP A;  4GYI A;  3RKX A;  4BQO A;  5BMZ A;  5D5U B;  4ACI A;  2HDD A;  2OCE A;  1SFX A;  3BHQ A;  1K83 J;  1UST A;  4HF1 A;  5ICE A;  2E5Z A;  2E36 A;  3WTW C;  2O7O A;  2ZOZ A;  1ETK A;  1VQN I;  4CH7 A;  1T2K A;  1ZG3 A;  2VON A;  1NHA A;  1XTA A;  4HEA 2;  5EGO B;  3HUG B;  1X1C A;  2KRH A;  1EH7 A;  4ASN A;  2CJJ A;  2WBM A;  4F92 B;  1REP C;  3H3V K;  3E5X A;  2K9S A;  3PQK A;  1SGM A;  4QSH A;  3S1R J;  1XGS A;  1ZG1 A;  3RKW A;  3ZQL A;  1YG2 A;  4ICH A;  2P5K A;  4FQG A;  4I0A A;  2W84 A;  5CW8 A;  2VJ4 A;  5M3M J;  2ZFW A;  2LY1 A;  2ZCW A;  3DTE A;  2R7U A;  4D7M A;  4Y17 A;  3IP4 B;  2K9Q A;  2Y48 A;  4HX4 A;  2QVO A;  3N97 A;  1IV8 A;  4CXF A;  1D8J A;  2AHQ A;  1QZZ A;  2FNA A;  1TQI A;  1VI0 A;  2WC2 A;  1Y8Q B;  3SJM A;  2G7S A;  1BW6 A;  3K69 A;  1DQU A;  5F08 A;  1WRJ A;  1XCV A;  1RKT A;  3HTA A;  2KT0 A;  2ZCM A;  3RQ4 A;  4L9V A;  3KNW A;  1F36 A;  2X0L A;  4EM1 A;  4E7K A;  5CKT A;  3B81 A;  2EPF A;  4LJZ F;  4YEJ A;  3AG1 H;  1I5Z A;  2HVQ A;  5CJ9 A;  1E3P A;  2HPI A;  1SFU A;  3RCO A;  3M3Y J;  1IUF A;  4MNU A;  2L54 A;  1FX7 A;  4BXF A;  3PAS A;  3SEZ A;  3K4M A;  5DM6 F;  2M3A A;  1DUX C;  3HTJ A;  2CYY A;  2IA0 A;  3ESW B;  5IOY A;  3S3M A;  4ESF A;  2HI3 A;  1YTY A;  2BV6 A;  3DCF A;  4ZC3 A;  2X51 A;  2DMQ A;  4GYG A;  3TL4 X;  2ZB9 A;  3BP8 A;  5EG0 B;  4K2E A;  4RB3 C;  3ELK A;  4ZH4 F;  5K7H A;  2ZJR F;  3JRD A;  2O3F A;  1IRF A;  3MKZ A;  2PMU A;  4JOM A;  1VQK I;  3WU0 A;  3VDX A;  3HIF A;  3RYP A;  1PP8 F;  3CC4 I;  1A04 A;  2YVX A;  3HOZ J;  1FSE A;  3J7A Y;  4A6E A;  3AG2 H;  3E6B A;  4G6D A;  3QOD A;  2M4K A;  3JRH A;  1T6S A;  3OL4 A;  3LAJ A;  4NQW B;  2LBF B;  5GPC A;  1IRX A;  4B1R A;  4BHP A;  1MMA A;  1OCZ H;  2E1O A;  3IWZ A;  4Y3O A;  3W3C A;  4JNN A;  4MIM A;  2VJI A;  3ML6 A;  3PJR A;  5LEK A;  5HSZ A;  2V1U A;  1MMN A;  3ANG A;  3V42 A;  1KU2 A;  1SVO A;  5FKN A;  1X58 A;  3VB2 A;  1R58 A;  1YIJ I;  1J9I A;  1R1V A;  3BC8 A;  1YW9 A;  3TOA A;  2HKX A;  2E5N A;  2D1H A;  1TLH B;  1ULY A;  4B47 A;  1BM9 A;  1EKE A;  2A6T A;  1IRZ A;  4MTE A;  4WK8 F;  3M8J A;  5H6Q A;  3TO9 A;  2CG4 A;  2VKE A;  4QLC U;  3M4O J;  4XQF A;  4X1E A;  3ZQG A;  4HRI A;  2LF8 A;  3VTI A;  3HSR A;  1VZ0 A;  3TW7 A;  2O8K A;  2CH0 A;  4EJV A;  2LK2 A;  4GGG A;  1HW5 A;  4BXU A;  2VJ5 A;  2XSD C;  4GFL A;  3IRR A;  3T8R A;  4DYR A;  2MH2 A;  2A3S A;  3HXL A;  3WTY C;  1I27 A;  2PG4 A;  3BG9 A;  2CU7 A;  3KP5 A;  4CIC A;  1Z67 A;  4B3X A;  2F5C A;  5BS6 A;  3F1B A;  5D4S A;  4L9T A;  5FB2 A;  2O0Y A;  2VKD A;  4XSX F;  1D5V A;  3RDI A;  2F5F A;  3CMM A;  3RTR A;  1VQ5 I;  4HX7 A;  4A6D A;  3G1O A;  3IH3 A;  3VYS B;  5CVJ A;  2KIF A;  3PNY A;  2VB6 A;  3PL8 A;  2XAQ A;  4ZYE A;  2KDZ A;  2LH9 A;  4E7L A;  2FE3 A;  3VYR B;  4NEL A;  4LMY A;  4AWX B;  5M3F J;  3QYB A;  3ERE D;  4CHU A;  2K7L A;  1UG2 A;  3HSE A;  3DPT A;  4MFD A;  3PFI A;  1S29 A;  3I71 A;  2P4W A;  1TC3 C;  3QPH A;  4OD4 A;  5FKM A;  3HHH A;  2VT3 A;  3WOD F;  2FD5 A;  4JP0 A;  3J80 Z;  4KIC A;  5HNH A;  4ON0 A;  3IHU A;  1Z6T A;  2A61 A;  2D5V A;  4BYY A;  3COL A;  1XPX A;  2NOG A;  2DFF A;  4WIB A;  1EH6 A;  5FD5 A;  2NVU B;  4HKU A;  3L2R A;  4FIS A;  2KIQ A;  1ZQ3 P;  4AC6 A;  3GLL A;  3QPT A;  1Y1V J;  3CUQ B;  2V57 A;  3JCU C;  2VOD A;  3G1L A;  4OAZ A;  1LKX A;  2W25 A;  4XLE A;  3K1N A;  3DEE A;  2WV0 A;  2QBY A;  2X6Y A;  1MNE A;  5IP9 J;  3IC7 A;  3JRA A;  3QKX A;  4EMS A;  1YYV A;  2L0K A;  1IN6 A;  2JRM A;  1HA8 A;  1RPW A;  1IXC A;  3O3K A;  1ETW A;  3GTP J;  1OLT A;  4PXI A;  3DKY A;  1HXD A;  1ETV A;  2GBY A;  3VOD A;  4GDF A;  4KN4 X;  2K5C A;  3F8N A;  3TKY A;  3PIP F;  5IPA A;  2KP6 A;  2HKU A;  1TNT A;  3BR2 A;  1QVU A;  3CDH A;  3D0S A;  2IU5 A;  3KLO A;  5HOD A;  2X1C A;  3K2Z A;  2PJP A;  2CO5 A;  2RKH A;  1MBK A;  5DYM A;  1TQM A;  3S93 A;  1JHF A;  4OAY A;  4XL9 A;  2UXO A;  3PUF A;  2GM4 A;  1MGT A;  1HOM A;  4PJM A;  3R6S A;  4OIN F;  2DOF A;  2L9V A;  2P81 A;  3W6J B;  3FBI B;  3MKL A;  2R4G A;  1RUN A;  2UV1 A;  3W6K B;  2DI3 A;  4U0Y A;  2L7K A;  2QM3 A;  4R1H A;  3EYI A;  3ZMD A;  2ZC2 A;  4L0Y B;  2TDX A;  3J81 K;  4XLF A;  4G8X A;  5TIS C;  3BRU A;  1YI2 I;  4ZYH A;  3N05 A;  1IN5 A;  1R5I D;  1UI5 A;  4X0G A;  2Y75 A;  3HRU A;  5E1Z B;  2UWM A;  3SWH A;  4XKW A;  3SFI A;  1SMT A;  1GVJ A;  2KIU A;  2M45 A;  3DFG A;  2CSO A;  1J75 A;  3GTG J;  4RGR A;  3ZP5 A;  1TNS A;  1R71 A;  1MBE A;  3RYR A;  3LST A;  1Q1V A;  2DA1 A;  2HZD A;  3LSH A;  2R7S A;  3LSG A;  2DOE A;  3KCC A;  2NS7 A;  4BJT A;  4UVB A;  2EIN H;  2IRF G;  3OV8 A;  3GEU A;  2ZSH B;  1FZP B;  2H6C A;  2EZI A;  1WJD A;  2MH9 A;  1RET A;  3S32 A;  2GA1 A;  4U0W A;  1GUU A;  2WAD A;  2WA0 A;  3IKT A;  3Q0W A;  1Q1H A;  2FA5 A;  3EUP A;  3I0T A;  1QPI A;  2RNG A;  5H20 A;  3M9A A;  4C3H J;  2F5E A;  1KU7 A;  2E1M B;  1OCT C;  2X1E A;  4V19 K;  2JUC A;  2A5W A;  2P5V A;  5J1R A;  2QSH X;  1JTX A;  3SZT A;  2DA3 A;  1O7L A;  2ADU A;  4OIO F;  3HUG A;  2EIJ H;  2KMU A;  5K58 A;  5HAW A;  4Y13 A;  1JUP A;  4L18 B;  1MNM C;  3KZY A;  4HW0 A;  2EFN A;  1LUJ B;  2JTV A;  1NTC A;  1SD5 A;  2QCO A;  2DDB A;  3H5R A;  3ZGK A;  3FMS A;  3MKW B;  1T39 A;  1WSU A;  3F0C A;  1QNT A;  5LGT A;  4GCL A;  4EV0 A;  1R5H A;  3HB9 A;  1D8K A;  1ETY A;  5DD8 A;  2LKP A;  3GLX A;  2B63 J;  3VOK A;  3S3O A;  3Q9V A;  5E18 F;  2QQB A;  3AQT A;  3BOQ A;  2EV0 A;  1SC7 A;  1AKH B;  2AXT C;  3ONQ A;  2COB A;  1YQA A;  3G1M A;  1PVE A;  4N4N B;  1B8I B;  2DLL A;  1HF0 A;  3P9K A;  3FM5 A;  3JRG A;  3CF5 F;  1YRN B;  4A12 A;  2M2E A;  2GWR A;  4CCN A;  3S1M J;  1X19 A;  2ELH A;  2K4J A;  3BRO A;  4I02 A;  4LOC A;  2O03 A;  3ZCO A;  4BY7 J;  2VXD A;  2WB1 A;  1MKM A;  4U88 A;  2VC0 A;  1R49 A;  3U2R A;  1WKM A;  3D5R C;  3A0H C;  4CYC B;  3CJN A;  3PPB A;  3QU6 A;  1XSX A;  4FAS D;  4KIF A;  2MBF A;  4EM2 A;  1SVL A;  2N8G A;  3H0D A;  1OYW A;  3HOX J;  1G8X A;  3D5S C;  3KZZ A;  2XRN A;  2MC4 A;  4IJA A;  3BNI A;  3HTI A;  2KFD A;  2DO7 A;  5E20 A;  2OQG A;  3P7N A;  1TWC J;  1U9N A;  2PFB A;  5EG0 A;  4C2U A;  3I53 A;  4BE1 A;  1ODD A;  4BUP A;  2HPM A;  1EV7 A;  2PZ9 A;  2DA4 A;  4B3A A;  5CLS A;  4A3I J;  1VQO I;  2DQR A;  4A3F J;  4I2O A;  2EZL A;  1J7K A;  5FO5 A;  4RM3 A;  1KQ8 A;  3WE3 A;  3BR6 A;  4PFP A;  4RBO A;  2VBX A;  2VQG A;  3MEX A;  4W97 A;  2V6E A;  3JAM K;  2IS6 A;  4DNC A;  1X2N A;  5HDG A;  2DW4 A;  1ZH5 A;  1JT6 A;  3CCY A;  3E5U A;  3FK6 A;  3DLA A;  2BHZ A;  3UR3 C;  4KYW A;  2TCT A;  2LBF A;  5K5Q A;  1ZKG A;  4GCV A;  2L4A A;  2AQE A;  1S8N A;  1AA7 A;  3JSP A;  5ERI A;  1JKO C;  4RGX A;  5L3D A;  4AYB N;  5K5R A;  5HVQ C;  4RDU A;  3GFI A;  1S9H A;  3BPV A;  4GCK A;  2EQR A;  3U9G A;  1IN4 A;  3DBH B;  4J19 A;  3OYG A;  4BDY A;  4H0E A;  2A05 A;  4ENN A;  2DG7 A;  1TBX A;  2LRE A;  3CES A;  3SZP A;  2G7G A;  1ZN2 A;  3DTK A;  3FRQ A;  2HS5 A;  2GA2 A;  2HKO A;  4PDK A;  3ZN1 A;  3VYU B;  1NG7 A;  2CMP A;  4XBF A;  4XID A;  2DT7 B;  4CCK A;  2ZSI B;  3F23 A;  1IGN A;  1MD0 A;  1XG1 A;  1H8A C;  2QQ9 A;  1DU6 A;  2XKO A;  5IYB J;  2RAE A;  3SDG A;  2DK5 A;  3HSF A;  2DN0 A;  4M3B A;  5IT9 K;  2MD5 A;  3FX3 A;  1IDZ A;  2E2H J;  1LPQ A;  2E7X A;  2RHA A;  2YSR A;  2QGU A;  2YUS A;  5EEG A;  1SAU A;  2JA8 J;  3KPH A;  1B6A A;  4F55 A;  4PUS A;  1ZGJ A;  5F0H A;  2BYV E;  3CUQ C;  5FRN A;  2P6T A;  3V7C A;  4B4C A;  3BZC A;  1MBJ A;  1O3S A;  2XGD A;  3G7R A;  1J2X A;  1YOV B;  2P8T A;  2Q2E B;  1DPU A;  5B5E C;  3NNR A;  1IXS B;  2PMZ A;  2GOX B;  3V78 A;  2FQ3 A;  1W1W E;  1ZTR A;  2HOS A;  3KE2 A;  2XUB A;  2I8D A;  3MZH A;  3WE2 A;  2JA2 A;  2LNB A;  4IL6 C;  2BVM A;  5C4Y A;  3C7J A;  2J5P A;  2E7W A;  2EB7 A;  2FOW A;  2M9H A;  4G9Y A;  1T38 A;  1P92 A;  4XLA A;  2E19 A;  3RH2 A;  3BTL A;  3CO6 C;  3QQA A;  3H3Z A;  4XRM A;  5EZH A;  5DAJ A;  4M9Z A;  2QSF X;  3TOB A;  4FTH A;  2VL8 A;  3CUQ A;  1GXQ A;  4LIU A;  1RC9 A;  2CW0 F;  4U9N A;  1JGG A;  2VBW A;  5F64 A;  3QPL A;  2CV0 A;  4Y33 A;  1G6N A;  1U3E M;  1VTN C;  2FF4 A;  1XSD A;  3RSN A;  4MEX F;  4DYQ A;  1H89 C;  3C2G A;  4V2G A;  4BJ6 C;  1FBS A;  1TW3 A;  3G3Z A;  5HS9 A;  1AOY A;  1K6Y A;  2BY2 A;  3IV5 A;  2OZ6 A;  3FXU A;  1G3T A;  3V8J A;  2ZXH A;  1A35 A;  4GRI A;  3KLN A;  1BR2 A;  2R7O A;  2R5Z B;  4I76 A;  5LRS A;  3B73 A;  4RGU A;  4BU2 A;  2NP3 A;  1S6L A;  3GBG A;  2VQL A;  1LNW A;  4UXN A;  4UVC A;  3LJL A;  4EAT A;  4NC8 A;  1U0J A;  4UHT A;  5JLW A;  1MJB A;  2NXN B;  3I55 I;  3QYE A;  2D2W A;  3FDY A;  4ITV A;  3E6M A;  3WTV C;  4QTR A;  1SMY F;  1UEL B;  2LY2 A;  4M3F A;  4N4O B;  4L5E A;  4XMY A;  1ZYR F;  2DMP A;  2E1M C;  4GXO A;  2V26 A;  5KAI C;  1JTY A;  3ON2 A;  2IGN A;  3TW6 A;  4MTD A;  2NVY J;  3PSI A;  2G3B A;  2X85 A;  2PLY A;  3EUH C;  1WGX A;  2KQR A;  1VQ6 I;  3W2V A;  2IPQ X;  4S04 A;  1UB9 A;  4KT6 A;  1UAA A;  5BNG A;  3LSM A;  2PEX A;  2W53 A;  2XAU A;  2EIM H;  1F4K A;  2M7B A;  2IA1 A;  2PN6 A;  5AIQ A;  1OR7 C;  3HL2 A;  3LHQ A;  3RI4 A;  4FT8 A;  3FHZ A;  2OU2 A;  2RDP A;  4CGR A;  3OL3 A;  1FYL A;  4AIH A;  1HDD C;  3DLL F;  3TBI A;  1V55 H;  1KYW A;  2KZV A;  2X1D A;  3AFH A;  4XRS G;  3J7A O;  1VQ4 I;  2OUM A;  9ANT A;  2E1C A;  1HKQ A;  3FXM A;  1G2H A;  1QRY A;  2Q1Z B;  1UHM A;  3DU6 A;  4LD5 A;  4EQQ A;  3GTM J;  4LFU A;  3HPG A;  1MSE C;  3TP0 A;  1YLF A;  2PJR B;  2V1D A;  1X2M A;  1H9T A;  1RI7 A;  5L3B A;  1AHD P;  2WAF A;  2NVX J;  3KP6 A;  1F9N A;  1W0T A;  1LFP A;  3EUH A;  5IYD J;  1MBF A;  4S0H B;  3CCE I;  2M34 A;  1XN7 A;  1MDM A;  1W4M A;  4RA2 A;  2CQ7 A;  1YE9 A;  4OMZ A;  2YU3 A;  2V1N A;  2YS9 A;  2KLO A;  4KIG A;  4RS8 A;  2G7L A;  2DBB A;  3GXO A;  3ZN0 A;  4LIV A;  1OR7 A;  1ZHF A;  3VSK A;  3RKQ A;  1BIA A;  3L9F A;  1WJ5 A;  1IG7 A;  3A01 B;  2KHM A;  1E3O C;  2XDV A;  1OPC A;  3BR1 A;  1VQL I;  3KEQ A;  3LSJ A;  3ZMS A;  5HLH A;  2OTL I;  2IXS A;  4BBR J;  1P7I A;  1FIA A;  5FHP A;  2V4J C;  1X4P A;  4IEJ A;  3ZMT A;  1PUF B;  1PJR A;  4KFC A;  4BEH B;  4ZDP A;  2HU9 A;  4F7Z A;  3KKC A;  3OS2 A;  2WAQ N;  1B8I A;  4U0V A;  3F8B A;  2DU9 A;  4BE2 A;  1K79 A;  1VQ9 I;  3GF2 A;  3CC2 I;  2OBP A;  3HKZ N;  2HOT A;  2BEO A;  3GZI A;  1Z7U A;  1W7P B;  3KKD A;  4Y4R A;  2O61 A;  4U87 A;  1XMA A;  3T8T A;  5J1U A;  4CYC A;  5IOZ A;  3JTG A;  4NUB A;  3QBM A;  2CW7 A;  3R0J A;  3CCS I;  2V6C A;  3FIS A;  2EZK A;  3H5A A;  2LDU A;  3B6C A;  1KQ0 A;  4UDS A;  5D18 A;  3REO A;  3E0J B;  2LD5 A;  3L2Q A;  3ISP A;  2JMW A;  2M0C A;  1ERD A;  4C3I J;  1HLV A;  3DKX A;  3U21 A;  1T0F C;  4A0X A;  1WJF A;  4WXH A;  3QOE A;  4LG3 A;  5AIP A;  5DEQ A;  4UUV A;  1FOW A;  4A3G J;  1POG A;  2HZT A;  2M30 A;  3DPL C;  1E17 A;  4WWC A;  3H1C A;  4F52 A;  4O5V A;  3FXR A;  4ZDL A;  4F93 B;  3NAR A;  5M5W J;  1H9G A;  4IRG A;  3RKY A;  2XB0 X;  4XKB A;  1SFK A;  1W7P D;  2B9S A;  3KP2 A;  3HEF A;  3NEU A;  4NHJ A;  3TO6 A;  1XD7 A;  2BW3 B;  2FBK A;  1U6G A;  2IGM A;  3GEZ A;  1HST A;  4E7Z A;  4G7H F;  5KCM A;  2R0Q C;  1UG0 A;  2EWN A;  1E3H A;  4C9Y A;  3V6G A;  4BAC A;  1K61 A;  5FLV A;  2JJ7 A;  2EA4 A;  1X3Z B;  2HXI A;  2W57 A;  2BOL A;  1A31 A;  1TP4 A;  3GVA A;  1DGW Y;  3C2B A;  3I54 A;  4UB8 C;  3VW2 A;  3OSF A;  4C3J J;  1BI3 A;  2F48 A;  4UUS B;  4E7S A;  2NS8 A;  3K1M A;  4ABZ A;  4V2F A;  2IP2 A;  4B43 A;  4U7D A;  2ESN A;  3F21 A;  5E8G A;  2HQ5 A;  5CXG A;  3S1N J;  4ZYA A;  4EJO A;  2WY8 Q;  4M9S A;  5B1A H;  4PJ0 C;  1Y6I A;  1SD7 A;  2F4M B;  4WX9 A;  3E7L A;  1IJW C;  4P9F A;  5E17 F;  1RRJ A;  2PQ8 A;  1GLN A;  4AF5 A;  5GPA A;  1OCP A;  1QU3 A;  2HYJ A;  2PX9 A;  5KNL A;  2XAG A;  4MHG A;  4DW6 A;  1JUS A;  3H3U A;  2QOP A;  5KAF C;  2MFZ A;  3S3N A;  4BNC A;  3OIP A;  3MAJ A;  4HQE A;  1J5Y A;  3VPR A;  2Q2E A;  3VVY A;  2B7E A;  4P5O A;  2XAS A;  2F07 A;  4JX6 A;  1IRG A;  2VT2 A;  4RAY A;  1SAX A;  3NAU A;  4XOP A;  1DDN A;  4GFK A;  1VQP I;  4ZYD A;  2H94 A;  3D1N I;  3S2D J;  5LHI A;  3WTU C;  2A6E F;  4XNF A;  1KQ9 A;  2Y0S A;  2YR2 A;  3VWB A;  1ETO A;  2H09 A;  4FX0 A;  2L7Z A;  3ABT A;  2XGX A;  3F6O A;  1LE8 B;  4FHT A;  1D1B A;  5IP6 A;  3BR0 A;  3Q9S A;  3TGN A;  5FJ8 J;  1BW5 A;  5FMP A;  4ZZD A;  1E2X A;  3H9Q A;  3HM5 A;  3DTI A;  2JUG A;  1Y0U A;  3PUB A;  4XR6 A;  2QZ8 A;  1HBX G;  2COM A;  2LOO A;  3F8C A;  1BR4 A;  1TWF J;  2R5Y B;  1ORK A;  3B02 A;  2QEX I;  5HBU A;  2A69 F;  2DA5 A;  2H1L A;  5KK1 A;  3K4C A;  2K02 A;  1IZ1 A;  2X6O A;  2JA7 J;  2FXA A;  1PYV A;  4FE7 A;  1IN7 A;  4PK4 A;  4EJW A;  5B66 C;  2DOD A;  5HDK A;  2L7M P;  2JQ7 A;  1R23 A;  2XHK A;  1B59 A;  1YS6 A;  2K9L A;  4JK1 X;  2XB5 A;  1XGM A;  3L00 A;  2RQP A;  5LLQ A;  1WQ2 A;  3K4B A;  2VI6 A;  2M8G X;  5J1Y A;  2H8R A;  3FZV A;  5E1W A;  3KP3 A;  3P9C A;  2X9D A;  3KP4 A;  3LWJ A;  1UZC A;  4C2T A;  2VKH A;  2JT1 A;  3WG9 A;  1ZRD A;  1UMQ A;  2WAE A;  3G71 I;  1MJ9 A;  1ZAO A;  3GTO J;  3MZY A;  4I09 A;  3T0Y A;  3WG7 H;  4DGW B;  2NRA C;  2Z3Y A;  3QWL A;  3V8K A;  2Q8K A;  1XMX A;  4CUG A;  4Y52 J;  3GFL A;  5K7F A;  3OYM A;  1X1P A;  2NS0 A;  1ITY A;  4OMY A;  5FRM A;  4L62 A;  1G3W A;  4XSZ F;  4A0Y A;  3UKG A;  1WFX A;  2ZXI A;  3MKY B;  4OWR B;  2GOM A;  2G9W A;  3COA C;  2WGB A;  2MA3 A;  5CXI A;  4PCQ A;  1G3Y A;  2K3F A;  2K4B A;  1R36 A;  4XKC A;  3P5J A;  4G7O F;  3R0A A;  1EJ9 A;  4GCT A;  3BR5 A;  3OYC A;  2ID3 A;  1JKQ C;  4XM3 A;  5A2Q K;  3K4J A;  1BI2 A;  2FJI 1;  2UXH A;  4DQ2 A;  1U9O A;  4M74 A;  2AS5 F;  5F27 A;  1TT5 B;  1XGO A;  2ZME B;  1BC8 C;  2ZXW H;  3I3L A;  1KON A;  1YIO A;  2VBY A;  2L02 A;  1O57 A;  3QPS A;  2XF7 A;  2ZKZ A;  4HYE A;  3OYH A;  5EDN A;  4IHX A;  4LIT A;  2EFQ A;  2R7D A;  3OIQ A;  2NNN A;  2PJR A;  4Z2Y A;  5D8L B;  3E5Q A;  3HRM A;  5CQE A;  5J47 A;  4IHY A;  1YJ9 I;  1BI1 A;  5ILV A;  1RNL A;  3DBL B;  2L9N A;  4BHC A;  1MBH A;  4L9N A;  2RV8 A;  2X6X A;  4EJT A;  1LDD A;  3CZ6 A;  3CJR B;  3F9K A;  1CGP A;  2VBZ A;  3DP7 A;  4IVN A;  4DIQ A;  3MN2 A;  1HC8 A;  4WCG A;  3LSR A;  3OWT A;  4Q5S F;  3A01 A;  1OCO H;  4BY1 J;  3M1C A;  1JKP C;  2W1O A;  3OS0 A;  2GXA A;  5F0C A;  4HLY A;  2R7F A;  2JA6 J;  3I59 B;  3FXJ A;  3LMM A;  5LHG A;  4XIC A;  5D5V B;  3JRE A;  4F3Q A;  1PUF A;  3A0B C;  4X6A J;  2IEK A;  1QZE A;  1TW2 A;  1JJ8 C;  3CCR I;  3RIR A;  2ZY9 A;  1XMK A;  2DJN A;  1K78 B;  1XC5 A;  4N9I A;  2CUF A;  4DOZ A;  5LHH A;  2W7N A;  1HKS A;  3HRS A;  4EGZ A;  5EGO A;  2REK A;  4EM0 B;  3WU1 B;  1ZAR A;  1W7P A;  2FBH A;  3QAH A;  1AWC A;  1D0Z A;  3HE0 A;  4G6T B;  3BLY A;  3VP5 A;  1QGP A;  3IH4 A;  2E35 A;  1NH3 A;  3BY6 A;  1ZLK A;  5HOO A;  4IZZ A;  2R7X A;  2NP5 A;  1SD4 A;  4D1Q A;  2FNP A;  4NNJ A;  1QQI A;  3KYC B;  2K86 A;  1D3Y A;  1ZG5 A;  3GFM A;  1ON2 A;  1ZRF A;  2OI8 A;  4KT5 C;  3HOT A;  3AKZ A;  4KMU X;  2NAZ A;  3BCA A;  3BR3 A;  3I58 A;  3UNG C;  3DQV C;  4CDG A;  1IC8 A;  2R93 J;  3CME I;  5CVV A;  3JW4 A;  3OMY A;  4YIR X;  3GTK J;  2NVT J;  1K7A A;  2EZH A;  3HPH A;  3DBR B;  3KZI C;  3ECH A;  4OIR F;  3SHF A;  2FUG 2;  3WTS C;  3HGY A;  2MC3 A;  1TL8 A;  3K1P A;  3DU5 A;  4E4H A;  4G12 A;  3DXJ F;  3OY9 A;  2F2E A;  5FD6 A;  2DG8 A;  4AC0 A;  2VE9 A;  4XON A;  4P9U A;  2PFV A;  2KJB A;  4BDZ A;  2RNJ A;  3M1E A;  1IXR C;  1MMS A;  3LWF A;  5D5X B;  1UCR A;  5ICG A;  2E60 A;  3ZQH A;  4ENK A;  2HYG D;  3KX2 A;  3I9V 2;  2MG4 A;  5E3M A;  3J7Z I;  1FYM A;  4RAF A;  3ZMZ A;  2BW3 A;  3LA7 A;  3LFK A;  4WF2 A;  4C2M A;  1JI8 A;  4IX7 A;  1G4D A;  4AD9 A;  2QQA A;  3BZ6 A;  4B8X A;  3J7Y J;  5EFY A;  5CPR B;  3BJO A;  3VEP A;  2BZT A;  2EBI A;  2L4M A;  3OYN A;  2GIZ A;  2KZG A;  2L9R A;  3BQY A;  1WCM J;  3K7A J;  3ULQ B;  4UV9 A;  1ZEL A;  1JKR C;  3DEU A;  2JWT A;  5EF6 A;  1E0E A;  3C1D A;  2IS2 A;  4RAZ A;  2UXI A;  4IHW A;  3RZD J;  5J4V A;  3MMY B;  1FPQ A;  4RB1 A;  4UUS A;  2CUZ A;  4MK6 A;  2AQF A;  2Z33 A;  2CFX A;  3OSG A;  3RD3 A;  3BZK A;  3F6V A;  4BJ5 C;  1R1U A;  4OD5 A;  2EFW A;  3MNL A;  1ZK8 A;  2WB1 N;  4QIW N;  3AL0 B;  2H27 A;  4L0Z B;  5H2F C;  3FWE A;  4M3D A;  3TQN A;  4E6K G;  1WHU A;  4OIQ F;  4D0P A;  3LQQ A;  1LEA A;  2O6G E;  4NQW A;  1YJN I;  2DMU A;  3EUA A;  4N0B A;  3SZG A;  3BT9 A;  2YX7 A;  4HPQ A;  5LBQ A;  2UZK A;  3WGG A;  4BBS J;  2QQ8 A;  3CLQ A;  4NB5 A;  4D5F A;  3EPZ A;  4B09 A;  2CUE A;  3CCU I;  3TED A;  3IUV A;  4KIS A;  1BOA A;  2HR3 A;  4XKV A;  1N75 A;  5E1X A;  4BHB A;  3KYD B;  2HVS A;  3DKW A;  3GX4 X;  1B9M A;  1FWZ A;  1FTT A;  1FMV A;  2EIL H;  3ERM A;  4J00 A;  3L2U A;  4E70 A;  1Z77 A;  5IP7 J;  5J8F A;  3M8E A;  4AID A;  1Y39 A;  4IRV A;  4CO8 A;  4OU0 A;  3GWZ A;  2WY7 Q;  2X6W A;  1WJE A;  5J3L A;  1HKT A;  2NVQ J;  1NG6 A;  1LE8 A;  3OYJ A;  5BPI A;  4IQ4 A;  3CMY A;  1BI0 A;  1O4X A;  1JT0 A;  4QWQ A;  3OYB A;  1BIB A;  2XIG A;  4IF4 A;  1HW1 A;  3HTS B;  3QP6 A;  4YIF A;  4M3E A;  3DPJ A;  2R5Y A;  2JA5 J;  1FNN A;  3OYK A;  2OJE D;  1BOB A;  2JZY A;  1A6I A;  3NXC A;  2XAH A;  3S17 J;  3NQO A;  3CCL I;  2LY9 A;  1CQT A;  5D6F A;  5TRD A;  1OKR A;  1WJB A;  3VVZ A;  2LKS A;  2R7Q A;  1ZGA A;  3MQ0 A;  4GO1 A;  1LDK B;  3HOW J;  2L3D A;  2Y69 H;  4BXX J;  3U1D A;  4ENM A;  3LFU A;  2P7C B;  3AAF A;  2XKP A;  2VQH A;  2DJI A;  2VOO A;  4NDL A;  2IS1 A;  3O8G A;  3VW1 A;  3PFY A;  4A3M J;  4IHS A;  2DA2 A;  1U8R A;  1Z05 A;  3FHN A;  2X48 A;  3O2P E;  1MBG A;  1QZY A;  3ASN H;  4A3K J;  1ZRE A;  5B1B H;  4BQA A;  4RM2 A;  2XGC A;  3JSO A;  2O9L A;  2WV1 A;  1VQ7 I;  2XAJ A;  2ZME C;  4DBQ A;  5LGU A;  3HZJ A;  2BXZ A;  1FC3 A;  1XX5 A;  2DMT A;  2LYC A;  2EJR A;  3K9T A;  3VYT B;  3JRI A;  3EQL F;  4HZF A;  5FGM A;  2PMZ N;  1MZB A;  2H8W A;  2OZU A;  1XCB A;  2V7F A;  1ETX A;  4HX8 A;  3PIO F;  2LF7 A;  1YIT I;  2QKL B;  2QIB A;  1X3U A;  2DYR H;  3M7G A;  1T33 A;  2W00 A;  5CYV A;  5LGN A;  4U7B A;  1VQM I;  2PI0 A;  1XB4 A;  3G73 A;  3C3W A;  2YX4 A;  3FXL A;  5K5O A;  1KYZ A;  1OCC H;  3CDI A;  3BTJ A;  4XRF A;  4CGZ A;  4PGG A;  2HQR A;  2LSO A;  4M6X A;  1R22 A;  4XLC A;  5A2Q Z;  3PNT A;  4JYK A;  2VC1 A;  2IBD A;  1S3J A;  1MMG A;  1IO2 A;  1WVR A;  4I7H A;  4M71 A;  3GW2 A;  1TWA J;  3WTX C;  3BG3 A;  4AVZ A;  3WHB A;  2RVC A;  1APL C;  3HOV J;  4M6V A;  2Z99 A;  2ZOY A;  1JE8 A;  4NN1 A;  3ABK H;  1I50 J;  3RZO J;  1RES A;  4XRS A;  3CCV I;  1WJC A;  1EH8 A;  4A0Z A;  1QPM A;  3L2W A;  3LSI A;  3C2H A;  4II2 A;  3J81 Z;  4UUT A;  2ME6 A;  2IGK A;  2DA6 A;  4DVY P;  1D1A A;  1T98 A;  3MZ8 A;  4AU7 A;  3H35 A;  1KU3 A;  3ZRG A;  1I39 A;  1DPR A;  1HW2 A;  4XLN F;  3OYA A;  2CRG A;  5J8C A;  4N9H A;  2NOJ B;  5E79 C;  3IWF A;  3TDU C;  2DTR A;  2VPR A;  1FEX A;  3FBN B;  1R1T A;  3JRF A;  2WWY A;  1MIJ A;  2QBY B;  2H6B A;  2VXZ A;  2ISZ A;  2Z2S B;  1JXS A;  1S5L C;  3L7W A;  3NRG A;  1P9Q C;  1W5S A;  4BE0 A;  5F1R A;  2HOE A;  4Q47 A;  1IN8 A;  3S8P A;  1R00 A;  3I4N J;  1F1Z A;  3CO7 C;  2VPL A;  3ABM H;  4JQF A;  3VFZ A;  1GV5 A;  2CQQ A;  1J0R A;  4XN0 A;  5KVR A;  3I64 A;  2A07 F;  2RC4 A;  3HBL A;  2LLK A;  1B72 B;  2ISY A;  5D6E A;  2KRF A;  2KPM A;  3FIW A;  2F5D A;  1MND A;  2E71 A;  3PO3 J;  1K78 A;  1WWX A;  2XF5 A;  1OQY A;  2EV6 A;  1BJZ A;  5M5X J;  4MFE A;  4I0B A;  1ACI A;  3IAM 2;  4LB5 A;  3Q0V A;  1VND A;  5JHU A;  4HLX A;  3I4P A;  2XRL A;  1I1G A;  3FXO A;  1FOX A;  2Z1D A;  1FTZ A;  1FT9 A;  2LTP A;  1TT0 A;  4PSX A;  4S05 A;  2OF7 A;  1OYI A;  4G94 A;  2Z16 A;  4AIJ A;  2EA2 A;  4AUX A;  2GAU A;  2VQC A;  1AKH A;  2BY1 A;  3LSP A;  4TV7 A;  2STW A;  2D6Y A;  5FKO A;  1Z3X A;  3BCB A;  3GME A;  3JRC A;  2PMH A;  2LP0 A;  1FOY A;  1LVK A;  3RPU D;  4RLF A;  3OOP A;  5C4J J;  1YRN A;  4BKX A;  5F1J A;  1FLI A;  3ZQI A;  1JJ6 C;  3AL0 C;  3G2B A;  5J40 A;  3HOY J;  3ZQF A;  2UXX A;  4YZE A;  3CCJ I;  1RR7 A;  2FU4 A;  2YU9 J;  3RJP A;  1TWH J;  3CP2 A;  1ETQ A;  1BBY A;  1BN5 A;  3LAP A;  2C6Y A;  2BVL A;  3ZR8 X;  3E7Q A;  3QYF A;  3OR2 C;  3OS1 A;  5LEJ A;  3E1S A;  5FKL A;  3LL7 A;  1FY7 A;  2ESH A;  3ZXS A;  3S15 J;  3BJA A;  5D4R A;  4A93 J;  2ETH A;  2CQX A;  2VAS A;  2D1V A;  1P4X A;  1T08 B;  2VE8 A;  5HLI A;  2GFN A;  5GTI C;  3KYL A;  2EFO A;  3HTH A;  3TMO A;  1ZRC A;  1I3Q J;  5FLX K;  2OPT A;  1D5Y A;  1T56 A;  1X1B A;  2I10 A;  5AON A;  3JAM Z;  1BC7 C;  1A36 A;  2NX4 A;  5JFR A;  1N78 A;  1V54 H;  3C18 A;  3CJT B;  1M1E B;  1Y56 A;  2Y0M A;  4QPQ A;  2ZXJ A;  2DDA A;  3CDL A;  1FSH A;  3HTU A;  3T6N A;  1QHH D;  3R61 A;  3KEY A;  2JPB A;  1DU0 A;  1PP7 U;  3LQR A;  2Q24 A;  2DQL A;  3TDZ C;  4L5J A;  2YVH A;  1Y0N A;  1MH3 A;  1UHS A;  4CCM A;  2YVE A;  2CW8 A;  5DM7 F;  4MO7 A;  2NYX A;  2BXY A;  4ETS A;  5KHD A;  1IAW A;  4P96 A;  2E2I J;  2ID6 A;  3BTC A;  3AQS A;  2Y30 A;  3R60 A;  4KMF A;  4ZJZ A;  2PBI A;  1QHG A;  2EH3 A;  5L3G A;  1SEU A;  1N25 A;  4HV5 A;  5TGT A;  3E6C C;  3HOS A;  2JVH A;  1VFC A;  1T0F A;  3M07 A;  3PQJ A;  1TZL A;  5ILS A;  5FFX A;  1GVD A;  5H6R A;  2XSJ C;  4CA0 A;  1O3T A;  3KIO A;  3O6B B;  3W2A A;  4JL3 A;  3BJ6 A;  2QTQ A;  1K6O A;  1G59 A;  4Y15 A;  5BOX A;  2JPC A;  1FIP A;  2OQR A;  3HG9 A;  5H9T A;  3OYD A;  3DV8 A;  3HC7 A;  3GTL J;  2ZNY A;  5IT9 Z;  2HQA A;  2XPW A;  5E3O A;  2DFI A;  2K40 A;  3WTZ A;  2EV5 A;  2CS3 A;  2MLG A;  1Z7L A;  1Z9C A;  1QO0 D;  1YX3 A;  3HDD A;  1XGN A;  4D9J A;  1IDY A;  2ZCX A;  1JGS A;  1KA8 A;  2GZW A;  4HV6 A;  2OV7 A;  3E97 A;  2RRE A;  2VN2 A;  2FEZ A;  3CQZ J;  1PUE E;  2OC6 A;  3ABL H;  4EVI A;  4AIK A;  4M3G A;  2MAB A;  4C30 A;  3DF8 A;  5E3N A;  2ECC A;  4PJL A;  1N77 A;  4BAY A;  2QKO A;  1USS A;  2MSY A;  3BDD A;  3OR1 C;  4KWA A;  4A3J J;  4DBR A;  4FX4 A;  3EGQ A;  2GEN A;  3K70 D;  1I1S A;  2ELK A;  2ZNZ A;  2G7U A;  2JSP A;  4MQ9 F;  2DCE A;  4EEF G;  1D0X A;  4QPO A;  3GYH X;  2I5U A;  4LLN A;  4A3D J;  3ON4 A;  4PSW A;  3ZQC A;  4II3 A;  1UHW A;  4ZTJ A;  4MEY F;  3NWT A;  1FP2 A;  4G6Q A;  5JLX A;  4LLG F;  2HYT A;  2R92 J;  3BQZ A;  1OCR H;  2V9P A;  1RZ4 A;  2XAF A;  3H36 A;  2OAZ A;  4RMN A;  4JX4 A;  3SEQ A;  1TQP A;  3LOC A;  4HSR A;  3L09 A;  2KRC A;  2UXU A;  3F72 A;  5FRO A;  3CJQ B;  4MQV A;  3ROU A;  2BE5 F;  3DWL E;  2FMY A;  2EK5 A;  2W24 A;  1J59 A;  1DP3 A;  4HBL A;  4ZYG A;  2LMD A;  3V8L A;  1YW8 A;  1OJL A;  3NWS A;  1H0M A;  1RR8 C;  4IXA A;  1D0Y A;  4IRI A;  1TTY A;  4XLP F;  1XDU A;  3OYL A;  2DA7 A;  2F4O B;  2DOA A;  2P6S A;  1GDT A;  3HOU J;  3SXY A;  2GQQ A;  3ZMV A;  2PBX A;  2RAS A;  4KA4 A;  2Y0S N;  2V9V A;  2V9K A;  3TO7 A;  2O7T A;  5D19 A;  4ZTF A;  3FMR A;  1S7E A;  2Z5U A;  5FFZ A;  5K1Y A;  2R5Z A;  2VKV A;  2RQQ A;  3V4G A;  1SFO J;  4MXM A;  2M4G A;  2QLZ A;  3H92 A;  5EJC A;  3S2H J;  5AQC A;  2E1N A;  4M73 A;  2QYO A;  4ANJ A;  2HWV A;  2LFB A;  2ZJ2 A;  3IAS 2;  2VOP A;  1UFM A;  1ZGW A;  4KDP A;  4YRV A;  3FXQ A;  4PZJ A;  2P5L C;  3GCM A;  2R7V A;  5ED4 A;  4I98 B;  4NC6 A;  2KL4 A;  2WUI A;  1UI6 A;  4RGS A;  2ECB A;  5D5W B;  1V3F A;  3A4C A;  2MW8 A;  3EET A;  2LG4 A;  2Z9O A;  3T1B A;  1J09 A;  3CCQ I;  3RQI A;  4UB6 C;  1IW7 F;  4RAG A;  1PDN C;  1P6R A;  1G3S A;  1V5G A;  5DCF A;  4G7Z F;  1LB2 A;  3HGG A;  3I56 I;  3CWR A;  4C2M J;  3IL2 A;  3CRJ A;  1B4A A;  3W2W A;  2UXP A;  5GTH C;  2A6H F;  2K9N A;  3ABU A;  1WJA A;  2K27 A;  4FET A;  4KN7 X;  3KEO A;  2ZJQ F;  4OIP F;  1BA5 A;  1YHQ I;  3ASO H;  1EF4 A;  3U1K A;  2F4I A;  3MD2 A;  3RPQ A;  4MLO A;  4LG0 B;  1QA6 A;  4YFN F;  4HDU A;  5DD4 A;  5HLG A;  2QSG X;  2GXG A;  1ENH A;  2X4H A;  4EJU A;  3JRB A;  4P55 A;  1T8I A;  5HDN A;  2XPU A;  2UXN A;  4CCJ A;  1U5T B;  1X3W B;  2A68 F;  5GAH J;  2DPD A;  4UNO A;  5TJJ A;  5E3L A;  1P7J A;  1U2W A;  1V5E A;  1ZR4 A;  2QWT A;  2DK8 A;  4A3C J;  5DV5 A;  5C4X J;  1GT0 C;  1B72 A;  1IV6 A;  2A5Y B;  4LGW A;  4UY8 I;  3A1Y A;  3GZN B;  3HRT A;  1X4O A;  1H88 C;  1BR1 A;  2HNH A;  3RPU A;  2DTZ A;  1Z3Y A;  2WTE A;  3F8F A;  2DFH A;  3BG7 A;  2KIS A;  2IJL A;  1OYY A;  5DS9 A;  4HDV A;  2AO9 A;  4HNV A;  3L2C A;  1R9T J;  3VOX A;  1YFH A;  3BG6 A;  2STT A;  2BY0 A;  5IY5 H;  3F22 A;  2BGC A;  3SDB A;  1BL0 A;  1YX5 A;  2F5V A;  5ILU A;  1I6H J;  2IS4 A;  1Y1W J;  1YW7 A;  2LVS A;  4CZZ A;  2P0W A;  2L5Q A;  1Z91 A;  1U78 A;  3CCM I;  3GTJ J;  2FJ1 A;  2FML A;  4I6Z A;  2GLO A;  2JSC A;  4W1U A;  5F6F A;  5C44 J;  4NBQ A;  1IUY A;  3CJD A;  1W36 D;  3BWG A;  1IF1 A;  2ME0 A;  4H4K C;  4A3E J;  4HOB A;  4M6Y A;  3Q5F A;  5E8I A;  2A2F X;  2G0E A;  4BEH A;  2B1E A;  3CD6 I;  4KUM A;  1ZR2 A;  4LB6 B;  4HQM A;  2HEO A;  1W5T A;  2Y9Z A;  3G4S I;  1VF9 A;  2E34 A;  2QWW A;  4Y7N J;  2DXI A;  1CF7 B;  2VUM J;  5DCM B;  4JKZ A;  2DT5 A;  4JX5 A;  4HNT A;  3S5R A;  2L01 A;  3FXK A;  3S2W A;  3HHG A;  5IT3 A;  3FM3 A;  4ME9 A;  5EZG A;  4BQN A;  3KET A;  2RN7 A;  1L0O C;  4IO9 F;  3FKJ A;  4AVP A;  3Q3S A;  5DDG A;  2H1K A;  2FX0 A;  2J5O A;  3R4K A;  3H0G J;  3A02 A;  5GAE J;  2K9M A;  3CMA I;  3VIB A;  3MFK A;  3LNQ A;  3AG3 H;  4JBA A;  3HIM A;  2CV2 A;  4WXD A;  4D5C A;  3OYI A;  1AU7 A;  2IT0 A;  4A69 C;  2XVC A;  3K4N A;  5L3F A;  4IOA F;  3A03 A;  2W85 A;  1MDM B;  5FLX Z;  3GZ5 A;  4XN3 A;  1S72 I;  3KZ9 A;  1LEB A;  3VW0 A;  2GXB A;  5F04 A;  3K70 C;  1ONV A;  1RKW A;  2R3S A;  3Q0U A;  2R7W A;  4M72 A;  4E7I A;  5IYC J;  4KIB A;  1O3R A;  2KKO A;  4RB0 A;  3LA3 A;  3OYF A;  1ZLJ A;  4Q4Z F;  4KNY A;  2LRD A;  2XV4 S;  1V4R A;  1EA3 A;  1NK3 P;  1UJ8 A;  2RGV A;  2Q0O A;  2M87 A;  3ANP A;  3H5N A;  1P2F A;  2HXO A;  1WI9 A;  1ON1 A;  4E7J A;  3SQN A;  2G7H A;  2LR8 A;  3HYI A;  2FSW A;  4UVA A;  1I6X A;  2OD5 A;  3QP5 A;  2IVM A;  4F91 B;  4IHV A;  2O8X A;  4A5N A;  4YFK F;  3T5X A;  1XS9 A;  2TRT A;  3BTI A;  5GAD J;  3O8H A;  1XSV A;  1Z0X A;  3ZQQ A;  2HQN A;  5D1R A;  3H9G A;  2HTJ A;  1DGR M;  4D7N A;  3D5L A;  1KGS A;  5CVU A;  2W4S A;  3ZPL A;  2CV1 A;  2ACJ A;  2V79 A;  2HDW A;  4CSW A;  2ZCN A;  1LFB A;  1U8B A;  3BG5 A;  1STZ A;  2KDO A;  4AYB A;  4WXC A;  4CZC A;  1K4T A;  5FKK A;  3M8F A;  4IOC F;  2HYF A;  4LLL A;  4YII A;  3EUK L;  4YG2 F;  1HQC A;  1MSF C;  4DZP A;  4DYC A;  2EFP A;  2HTS A;  3BJB A;  5EEH A;  3OIO A;  3S16 J;  1LQ1 A;  2R7Z J;  3WTT C;  4L9J A;  2CWE A;  4BGD A;  1R4M B;  3PO2 J;  4B44 A;  1RIO H;  4AM3 A;  2GUH A;  4HA8 A;  4IRH A;  2M5W A;  1MH4 A;  1I3A A;  1WH5 A;  4I99 C;  3S14 J;  4R79 A;  3LSK A;  3P9T A;  3IUO A;  2HGC A;  3OOU A;  5HS7 A;  2CQN A;  2MYS A;  4CYD A;  4UV8 A;  2QEN A;  2QKM B;  1QBJ A;  5JVG F;  4KJZ A;  1Z6R A;  3K4L A; 
#chains in the Genus database with same CATH homology
 1IJW C;  2CQQ A;  1FJL A;  4AF5 A;  3HBL A;  5GPA A;  1OCP A;  3BRU A;  2LLK A;  1UI5 A;  1B72 B;  2HYJ A;  3FIW A;  3JSJ A;  3SFI A;  4DW6 A;  1JUS A;  3ZOB A;  2QOP A;  3PO3 J;  3GTG J;  2L7F P;  1BJZ A;  5M5X J;  1MBE A;  4MFE A;  3VPR A;  1Q1V A;  2DA1 A;  3VVY A;  3Q0V A;  1VND A;  3LSG A;  2NS7 A;  2F07 A;  4JX6 A;  5FGL A;  5C3E J;  3NPI A;  3NAU A;  2XRL A;  3GEU A;  1HCR A;  1FTZ A;  2EZI A;  4GFK A;  1RET A;  2LTP A;  3D1N I;  3S2D J;  4FE4 A;  1GUU A;  2OF7 A;  3Q0W A;  1ETO A;  1NK2 P;  2L7Z A;  4A3L J;  3EUP A;  1LE8 B;  2HOA A;  3NI7 A;  2IAI A;  4AUX A;  1W0U A;  4C3H J;  1QPI A;  1GV2 A;  1OCT C;  5IP6 A;  3BR0 A;  5FJ8 J;  1BW5 A;  1A5J A;  5J1R A;  5FMP A;  1LFU P;  1AKH A;  1JTX A;  3HM5 A;  4DZJ A;  3LSP A;  2D6Y A;  2DA3 A;  5FKO A;  3JRC A;  5K58 A;  5HAW A;  2LP0 A;  1TWF J;  2R5Y B;  5M5Y J;  1JUP A;  5C4J J;  3MVP A;  1YRN A;  1ORK A;  4BKX A;  1MNM C;  5F1J A;  5HBU A;  2DA5 A;  1NTC A;  2QCO A;  3ZQI A;  1JJ6 C;  3HOY J;  3ZQF A;  1SAN A;  4YZE A;  2X6O A;  2JA7 J;  3F0C A;  1RR7 A;  2YU9 J;  2XPV A;  4FE7 A;  4GCL A;  1TWH J;  2L7M P;  3HB9 A;  3FK7 A;  1ETY A;  1ETQ A;  2B63 J;  1F43 A;  3VOK A;  2XB5 A;  3E7Q A;  3AQT A;  5FKL A;  1AKH B;  2W48 A;  3DEW A;  3S15 J;  2COB A;  2VI6 A;  3G1M A;  2M8G X;  4A93 J;  5J1Y A;  3VVX A;  1B8I B;  2H8R A;  2CQX A;  1HF0 A;  3JRG A;  1YRN B;  2X9D A;  2GFN A;  3BCG A;  3HTH A;  2M2E A;  3S1M J;  3LWJ A;  4FCY A;  4LOC A;  1I3Q J;  2OPT A;  1D5Y A;  1T56 A;  4BY7 J;  2I10 A;  3G56 A;  1UMQ A;  2NX4 A;  1JUM A;  3GTO J;  2E2J J;  3FKI J;  3CDL A;  4CYC B;  3PPB A;  4Y52 J;  3T6N A;  5FLM J;  5GP9 A;  1QVT A;  5K7F A;  1DU0 A;  2N8G A;  3HOX J;  2Q24 A;  1ITY A;  2YVH A;  1MH3 A;  1UHS A;  2QF7 A;  2YVE A;  3BNI A;  3UKG A;  3HTI A;  4L62 A;  1TWC J;  1U9N A;  4MO7 A;  2E2I J;  5EG0 A;  2ID6 A;  3BTC A;  3AQS A;  2Y30 A;  2PZ9 A;  2WGB A;  2DA4 A;  3O60 A;  5CXI A;  1WPK A;  3L1P A;  2EH3 A;  4B3A A;  4A3I J;  4A3F J;  3IH2 A;  2EZL A;  4GCT A;  1VFC A;  3BR6 A;  3BR5 A;  4RBO A;  2ID3 A;  1JKQ C;  1GVD A;  5EEA A;  4W97 A;  4JL3 A;  2FBQ A;  2UXH A;  2QTQ A;  1U9O A;  1TWG J;  1X2N A;  5F27 A;  1JT6 A;  3CCY A;  2Y2Z A;  3FK6 A;  1FIP A;  3K2A A;  3GTL J;  5H9T A;  2TCT A;  2XPW A;  5E3O A;  4A3B J;  1ZKG A;  2K40 A;  2JN6 A;  2XGE A;  2MGQ A;  1OFC X;  3QPS A;  1JKO C;  5EDN A;  4AYB N;  4IHX A;  1WI3 A;  4RDU A;  3PM1 A;  4XK4 A;  3HDD A;  4GCK A;  1IDY A;  2EQR A;  4IHY A;  3I4M J;  5K7Z A;  2ZCX A;  4J19 A;  1MBH A;  2DG7 A;  2G7G A;  3FRQ A;  3CQZ J;  4M3G A;  4GFB A;  5E3N A;  4XID A;  2ECC A;  3C07 A;  2QKO A;  2MSY A;  4KWA A;  4A3J J;  3MN2 A;  2FQ4 A;  3EGQ A;  1IGN A;  2GEN A;  3LSR A;  1XG1 A;  2ELK A;  1H8A C;  3A01 A;  1DU6 A;  5IYB J;  2RAE A;  3SDG A;  4EEF G;  1JKP C;  2DN0 A;  4M3B A;  4BY1 J;  5F0C A;  1IDZ A;  2OER A;  2JA6 J;  3JR9 A;  2E2H J;  2RHA A;  4A3D J;  3ON4 A;  4XIC A;  3ZQC A;  3JRE A;  4X6A J;  1PUF A;  2YUS A;  2JA8 J;  2LKX A;  3GTQ J;  2Y31 A;  2IEK A;  5JLX A;  2Y9Y A;  2HYT A;  5EYR A;  1JJ8 C;  1WH7 A;  2R92 J;  3BQZ A;  2DJN A;  3S1Q J;  5F0H A;  4JX4 A;  1XC5 A;  3LOC A;  2CUF A;  4B4C A;  3VUQ A;  1MBJ A;  2UXU A;  2XGD A;  5EGO A;  3G7R A;  2REK A;  3W6V A;  3HE0 A;  2JK3 A;  3WHC A;  3NNR A;  3VP5 A;  2XDN A;  2DMN A;  3IH4 A;  3B6A A;  1OJL A;  3V78 A;  2NP5 A;  5DTD A;  2HOS A;  1ZTR A;  5F0F A;  3TP3 A;  1HDP A;  4ACI A;  2DA7 A;  2HDD A;  2OI8 A;  5C4Y A;  1GDT A;  3HOU J;  3BHQ A;  1K83 J;  3BR3 A;  2M9H A;  2PBX A;  2RAS A;  2ZOZ A;  2O7O A;  1IC8 A;  1ETK A;  2R93 J;  2Y0S N;  3GTK J;  2NVT J;  2E19 A;  3RH2 A;  3BTL A;  2O7T A;  5D19 A;  1S7E A;  2EZH A;  2R5Z A;  3QQA A;  2VKV A;  4XRM A;  5EGO B;  3HGY A;  5EZH A;  1SFO J;  4MXM A;  5DAJ A;  2CJJ A;  4FTH A;  3S2H J;  3H3V K;  4G12 A;  5AQC A;  2K9S A;  2DG8 A;  1SGM A;  4QSH A;  4AC0 A;  3S1R J;  2LFB A;  3ZQL A;  4ICH A;  1JGG A;  1ZGW A;  5CW8 A;  5M3M J;  3QPL A;  4D7M A;  2K9Q A;  3ZQH A;  2AHQ A;  5E3M A;  2WUI A;  2MG4 A;  1UI6 A;  1VI0 A;  2ECB A;  3SJM A;  2G7S A;  1BW6 A;  2MW8 A;  5F08 A;  4DYQ A;  1H89 C;  4V2G A;  5EFY A;  1RKT A;  3IV5 A;  3HTA A;  2KT0 A;  3RQI A;  2ZCM A;  2EBI A;  2L9R A;  3KNW A;  1F36 A;  3BQY A;  1WCM J;  3K7A J;  3HGG A;  4I76 A;  2R5Z B;  3CWR A;  4C2M J;  1JKR C;  2NP3 A;  3GBG A;  2JWT A;  5EF6 A;  3B81 A;  3CRJ A;  2UXP A;  2UXI A;  2K9N A;  1BA5 A;  3LJL A;  4IHW A;  3RZD J;  5JLW A;  1EF4 A;  4UUS A;  4MK6 A;  3RD3 A;  3OSG A;  4MLO A;  3M3Y J;  1IUF A;  1ENH A;  3JRB A;  3MNL A;  1ZK8 A;  2WB1 N;  4QIW N;  3PAS A;  2XPU A;  4M3D A;  4QTR A;  3HTJ A;  4M3F A;  4L5E A;  5IOY A;  2DMU A;  2HI3 A;  2DMP A;  3DCF A;  1P7J A;  5E3L A;  3BT9 A;  1ZR4 A;  2DMQ A;  2QWT A;  1JTY A;  2ZB9 A;  4A3C J;  3TW6 A;  5C4X J;  3ON2 A;  2NVY J;  5EG0 B;  2G3B A;  1GT0 C;  1B72 A;  1IV6 A;  4BBS J;  1WGX A;  5K7H A;  1H88 C;  4D5F A;  3JRD A;  2DTZ A;  2CUE A;  5BNG A;  3TED A;  3IUV A;  2W53 A;  5DS9 A;  2AO9 A;  4HNV A;  3LHQ A;  1R9T J;  3VOX A;  3HOZ J;  4CGR A;  1FTT A;  1BL0 A;  1HDD C;  1I6H J;  1Z77 A;  5IP7 J;  1Y1W J;  2LVS A;  4XRS G;  3JRH A;  5GPC A;  1U78 A;  9ANT A;  4B1R A;  3GTJ J;  2FJ1 A;  5J3L A;  4I6Z A;  2GLO A;  4W1U A;  5C44 J;  2E1O A;  1G2H A;  1QRY A;  2NVQ J;  1LE8 A;  3CJD A;  3GTM J;  4JNN A;  1MSE C;  2ME0 A;  4MIM A;  3TP0 A;  3CMY A;  4A3E J;  1O4X A;  1JT0 A;  1X2M A;  5HSZ A;  1AHD P;  3ANG A;  2G0E A;  1W0T A;  2NVX J;  5FKN A;  1X58 A;  1ZR2 A;  2Y9Z A;  5IYD J;  1MBF A;  4S0H B;  1VF9 A;  2M34 A;  4M3E A;  2R5Y A;  2JA5 J;  4Y7N J;  3DPJ A;  2VUM J;  4JKZ A;  4JX5 A;  3S5R A;  2YS9 A;  2G7L A;  1IRZ A;  1A6I A;  3NXC A;  3S17 J;  4ME9 A;  2LY9 A;  2VKE A;  5EZG A;  1CQT A;  3M4O J;  3RKQ A;  4X1E A;  3ZQG A;  3VVZ A;  1IG7 A;  3A01 B;  1E3O C;  3TW7 A;  3Q3S A;  2O8K A;  2H1K A;  3BR1 A;  2FX0 A;  3LSJ A;  2LK2 A;  3H0G J;  3A02 A;  3HOW J;  4BBR J;  2XSD C;  1P7I A;  4GFL A;  3VIB A;  1FIA A;  4BXX J;  5FHP A;  3LNQ A;  4IEJ A;  3HIM A;  1PUF B;  4DYR A;  4D5C A;  1AU7 A;  3KKC A;  4A69 C;  4NDL A;  3BG9 A;  2CU7 A;  2WAQ N;  1B8I A;  3A03 A;  3O8G A;  3VW1 A;  3F1B A;  4A3M J;  2DA2 A;  3KZ9 A;  3VW0 A;  2X48 A;  1MBG A;  5F04 A;  4A3K J;  3HKZ N;  1RKW A;  2HOT A;  3Q0U A;  3GZI A;  3G1O A;  3IH3 A;  2O9L A;  2XGC A;  3KKD A;  2WV1 A;  5IYC J;  2KDZ A;  5J1U A;  4CYC A;  5IOZ A;  4NEL A;  5M3F J;  2DMT A;  3QBM A;  1UG2 A;  1NK3 P;  4MFD A;  3ANP A;  3JRI A;  3FIS A;  2EZK A;  2PMZ N;  1TC3 C;  1ETX A;  3B6C A;  2HXO A;  4UDS A;  2QIB A;  5D18 A;  5FKM A;  2LD5 A;  2FD5 A;  2JMW A;  2M0C A;  1T33 A;  4JP0 A;  4C3I J;  1HLV A;  2LR8 A;  2D5V A;  3BTJ A;  3COL A;  2NOG A;  4A3G J;  4IHV A;  1POG A;  4JYK A;  4AC6 A;  1XS9 A;  4HKU A;  4FIS A;  2TRT A;  3BTI A;  1ZQ3 P;  3O8H A;  2IBD A;  1Z0X A;  1Y1V J;  2V57 A;  5D1R A;  1TWA J;  3BG3 A;  3G1L A;  4D7N A;  3NAR A;  3WHB A;  5M5W J;  1APL C;  3HOV J;  2XB0 X;  4M6V A;  5IP9 J;  2ZOY A;  3QKX A;  3JRA A;  2ZCN A;  4NN1 A;  2L0K A;  1LFB A;  1I50 J;  3BG5 A;  1U8B A;  3HEF A;  1RPW A;  3RZO J;  4PXI A;  1RES A;  1ETW A;  4XRS A;  3GTP J;  1ETV A;  5FKK A;  2GBY A;  2R0Q C;  1MSF C;  4DZP A;  4UUT A;  2ME6 A;  4DYC A;  2DA6 A;  3BJB A;  5IPA A;  3V6G A;  3OIO A;  1K61 A;  5FLV A;  2HKU A;  2JJ7 A;  3S16 J;  3BR2 A;  1QVU A;  2IU5 A;  2R7Z J;  2CRG A;  2HXI A;  5HOD A;  3PO2 J;  2VPR A;  1FEX A;  3C2B A;  1MBK A;  3VW2 A;  3OSF A;  4C3J J;  4UUS B;  3JRF A;  2GUH A;  2NS8 A;  4ABZ A;  4V2F A;  1MH4 A;  2UXO A;  1WH5 A;  2HQ5 A;  2GM4 A;  5CXG A;  3S1N J;  3NRG A;  3S14 J;  1HOM A;  3P9T A;  2P81 A;  3OOU A;  3MKL A;  3I4N J;  3E7L A;  1GV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...