3C2BA

Crystal structure of tetr transcriptional regulator from agrobacterium tumefaciens
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
203
structure length
200
Chain Sequence
b'SPRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAMITFQQSKVRTFEKAGDRVSAPQLADHLEVFAHDLLDVLAGDVSLALNRLAIGQASRKLGDLLLERGRRQIDRRARGLIEAGRRSGYLRFDDAEEAYRSFYGLIVSDLHVRMLLGEAPDKDFSARAKKAVVAFLTLYGTEKVHSELGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title X-ray crystal structure of TetR transcriptional regulator from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transcription regulator
total genus 68
structure length 200
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14246 TetR_C_7 AefR-like transcriptional repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3c2bA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3c2bA02
2HOAA 1APLC 2Y9YA 5DS9A 3S1MJ 2IBDA 2CQXA 2HI3A 3GTJJ 4W1UA 4XIDA 3BCGA 3H0GJ 2NX4A 5FJ8J 3W6VA 1BL0A 1JUPA 4C3JJ 2JMWA 2UXOA 1BW5A 3GEUA 3HGYA 5GPAA 2E1OA 1PUFA 5CXGA 4IHWA 3L1PA 2YVHA 1EF4A 3JRCA 1JUSA 4JX5A 5M3MJ 2PMZN 1IUFA 1X58A 2OPTA 5C44J 2XGCA 3QKXA 5FMPA 2EZLA 3TP0A 2L0KA 1RETA 2DMTA 1ITYA 2QOPA 4BXXJ 3VVYA 2XRLA 3MKLA 1ZR2A 3HOYJ 2DN0A 1BA5A 1RR7A 1H8AC 3GTKJ 3KKDA 1IV6A 1UI5A 2YU9J 2M2EA 2K9QA 2AO9A 1A5JA 1WH5A 2VUMJ 4XRMA 5EZHA 2Y2ZA 2DMQA 3QQAA 3ZQCA 1MBEA 2CQQA 2D6YA 1UHSA 3JRHA 3G7RA 3VW0A 5EGOB 2N8GA 2VI6A 5F27A 4B1RA 2LD5A 5EG0B 2WGBA 4MIMA 4MFEA 3NI7A 3NARA 2EZIA 4RDUA 2IAIA 4D5CA 3BQYA 1B8IA 1MH4A 2CU7A 4CYCB 3ANGA 1JT6A 1G2HA 1WI3A 3T6NA 3G1MA 1MBJA 3HBLA 2X9DA 1VF9A 1TWGJ 1GUUA 2G3BA 4DW6A 1GT0C 3NAUA 3G56A 1NTCA 2KDZA 2REKA 1I6HJ 5F0CA 4BBSJ 3BR1A 1U9OA 3PPBA 1S7EA 3DPJA 1QRYA 3Q0UA 2W53A 4M3GA 5C4JJ 4JKZA 4A69C 3BRUA 2NVTJ 3LJLA 2P81A 3BTCA 5E3LA 4GCLA 2JA5J 2XPUA 1ZTRA 1ZR4A 4M3DA 1LFBA 3RZOJ 1FTZA 2L9RA 4QIWN 5FKOA 1ENHA 3GTOJ 1RESA 2Y30A 3BR2A 5K58A 2ZCMA 5J1RA 3CJDA 3O8GA 2F07A 2DMNA 3BR5A 4A93J 3HTJA 4C3IJ 3ZOBA 5EF6A 5M5WJ 1JTYA 2CUFA 4B3AA 3PO2J 5M5YJ 3M4OJ 2QWTA 1ETQA 2XB0X 3V6GA 1K83J 1RKTA 3PO3J 4DYCA 1ZQ3P 2QCOA 3JREA 3AQSA 3LNQA 1LFUP 4JL3A 2PBXA 4D5FA 3FKIJ 4CGRA 1WCMJ 4S0HB 3EGQA 2DA6A 4M3FA 4V2FA 2WV1A 4FE4A 4BY1J 2YS9A 3WHBA 2L7ZA 3BT9A 2ME0A 4NDLA 2K40A 2DG8A 5EZGA 3ZQHA 3CWRA 1YRNB 3A01B 5D1RA 4A3BJ 3AQTA 1TWAJ 3HTAA 3CRJA 1QVTA 2DA2A 2NVYJ 5EFYA 3OOUA 1B72B 3BTJA 3IH3A 3FISA 3P9TA 3QPLA 3VVXA 3VPRA 2XPVA 4A3CJ 5EYRA 5J3LA 1ZGWA 2ME6A 2VPRA 2ECCA 2DG7A 5D18A 1VI0A 1XG1A 3BR0A 2B63J 2L7MP 1TWCJ 2Y31A 3SJMA 1ZK8A 2ZOYA 3ZQFA 3RKQA 3HTHA 5FLVA 3ON4A 3JSJA 2ZCXA 4XRSG 3IH4A 1AKHB 4PXIA 1Q1VA 2MGQA 1Y1WJ 4GFBA 3S17J 3E7LA 3MN2A 5IPAA 2ID6A 1JJ6C 1JKOC 3GTPJ 5EGOA 4BKXA 1GDTA 2RASA 3BG3A 3GBGA 5EG0A 3DEWA 2W48A 4MK6A 3CQZJ 3JRIA 5IYBJ 4MXMA 2JWTA 5FHPA 2FX0A 3S5RA 1DU6A 1MH3A 1JKPC 1POGA 1WPKA 1JUMA 4CYCA 3JRAA 5M5XJ 4IHYA 4UUSB 2OERA 1TWFJ 1D5YA 5C4YA 3HOZJ 2LTPA 5E3MA 1E3OC 4D7MA 1HOMA 1F43A 2RHAA 4I76A 2LFBA 2M9HA 1UMQA 5BNGA 3KKCA 2UXHA 2JA7J 3BG5A 3RZDJ 2K9SA 1MSFC 2AHQA 2WAQN 5E3OA 3F0CA 5C4XJ 3GTMJ 2LKXA 4A3FJ 3HDDA 1FIPA 3ZQIA 2Y9ZA 2GM4A 3S1NJ 3TW7A 2R7ZJ 2WB1N 1WH7A 4M3EA 2HKUA 3VOXA 1NK3P 3LOCA 1ETKA 3O8HA 2JA8J 3FK7A 2LVSA 4JYKA 1W0TA 3JRDA 2R5YB 3M3YJ 2OI8A 4A3GJ 2K9NA 2L7FP 1Y1VJ 2YUSA 4HKUA 4J19A 2EZKA 4IEJA 3LWJA 2FD5A 4JNNA 1HDPA 2G0EA 1DU0A 1ETYA 5HBUA 1WGXA 2FJ1A 4RBOA 4I6ZA 3C07A 5D19A 4MLOA 2YVEA 1U8BA 3OIOA 1MBHA 4A3IJ 1IG7A 3FIWA 2EH3A 3BG9A 1SGMA 3S15J 2XGDA 1TC3C 4DZPA 3QBMA 1OCPA 5H9TA 2DA7A 3HIMA 4GFLA 3Q0VA 5GP9A 2V57A 1SFOJ 1YRNA 3A01A 5IYCJ 3EUPA 1B72A 3HOVJ 2I10A 1MBKA 5IYDJ 3FRQA 1ZKGA 3CDLA 4A3JJ 2XDNA 3VOKA 1SANA 3LSJA 1JKRC 2CUEA 4A3DJ 2NS7A 2GUHA 3HKZN 2PZ9A 3VIBA 3VW1A 2GFNA 4ABZA 3C2BA 4JP0A 1A6IA 1IRZA 2E19A 1CQTA 4FISA 3VW2A 4AC6A 1AKHA 2EZHA 4GFKA 2O9LA 5FKLA 1XS9A 2M34A 3SDGA 4XRSA 4Y7NJ 4AC0A 3SFIA 2WUIA 3WHCA 1JT0A 2GLOA 5GPCA 2VKVA 3K2AA 2XPWA 2ELKA 2R92J 3Q3SA 5EDNA 3HM5A 4ME9A 3QPSA 2LY9A 4HNVA 1X2MA 2R5ZB 1FJLA 5JLXA 2HYJA 1HF0A 4A3KJ 2R93J 1Z77A 3B81A 1MNMC 1FEXA 4C3HJ 4UUSA 3B6AA 2ZB9A 4L5EA 5K7ZA 1XC5A 1QVUA 3A02A 3BTLA 3BNIA 3CMYA 1AU7A 3V78A 1I3QJ 1MSEC 4NELA 2MSYA 2H8RA 1W0UA 3S1RJ 5DAJA 2NP3A 1U9NA 1RKWA 2COBA 1UG2A 2LK2A 4A3EJ 3E7QA 3VP5A 3BQZA 2Q24A 4X6AJ 2D5VA 2HXOA 3TW6A 1HCRA 3H3VK 2GBYA 3RH2A 5FKMA 4JX4A 2UXIA 3BTIA 1HLVA 2QIBA 2KT0A 2NS8A 2R5YA 3MVPA 5IOZA 5FLMJ 3HOXJ 1GV2A 1T56A 3GZIA 2JK3A 1IC8A 1FTTA 1ETOA 5HSZA 2FQ4A 2DA3A 4G12A 3JRGA 1QPIA 4JX6A 2HYTA 2M0CA 4A3MJ 2R0QC 2CJJA 1AHDP 1TWHJ 4IHVA 3LSPA 3BHQA 3NNRA 1IJWC 4YZEA 1IDYA 4MFDA 5IP6A 5F0HA 2NVXJ 4W97A 2NOGA 2UXUA 4DYQA 2ZCNA 4LOCA 2LR8A 4DZJA 1K61A 3ZQGA 3JRFA 3LHQA 3Q0WA 4XK4A 3D1NI 4GCKA 3IH2A 1ETVA 2G7SA 3HOUJ 2HQ5A 4X1EA 2DA5A 2M8GX 1OCTC 3ON2A 2JJ7A 1OFCX 1ETWA 1GVDA 2MG4A 2DTZA 1LE8B 1F36A 1JGGA 9ANTA 2CRGA 4NN1A 4DYRA 3A03A 2HXIA 4FTHA 3HOWJ 3LSRA 4B4CA 1MBFA 3VVZA 3HB9A 2ZOZA 3PASA 1NK2P 4L62A 2GENA 2UXPA 3NRGA 1JTXA 3OSFA 3UKGA 2Y0SN 2HOSA 2X48A 4FE7A 3S2HJ 1VNDA 3GTGJ 3GTLJ 4ACIA 4EEFG 4A3LJ 1HDDC 3O60A 2HOTA 1PUFB 3HGGA 2XGEA 5CXIA 4ICHA 3HTIA 2VKEA 4C2MJ 3S16J 2QKOA 4AYBN 1IGNA 5IOYA 4QSHA 3PM1A 3KZ9A 2RAEA 5F0FA 2NVQJ 1JJ8C 4KWAA 3TEDA 1U78A 2ECBA 5E3NA 3HEFA 1O4XA 2R5ZA 4BBRJ 3TP3A 3JR9A 5F1JA 1RPWA 1I50J 3FK6A 1T33A 2DA4A 2DJNA 4MO7A 4UUTA 3ZQLA 3BR6A 2E2JJ 3G1OA 4UDSA 1JKQC 1X2NA 4FCYA 3I4NJ 2EQRA 2E2IJ 3LSGA 5J1YA 5FGLA 4XICA 3OSGA 1R9TJ 4M6VA 2H1KA 1OJLA 5IP7J 5C3EJ 4Y52J 5IP9J 5EEAA 4AF5A 3COLA 2G7LA 2EBIA 4M3BA 5HODA 1B8IB 1VFCA 1ETXA 2XB5A 1GV5A 2O7OA 3DCFA 3K7AJ 4BY7J 3RQIA 3HE0A 5HAWA 2HDDA 2IEKA 3NPIA 3I4MJ 3BJBA 1BJZA 2X6OA 5DTDA 5AQCA 2QTQA 1Z0XA 5F08A 2O8KA 3CCYA 3BR3A 3GTQJ 4D7NA 1H89C 2LLKA 3F1BA 2MW8A 2DMUA 2DMPA 3ANPA 5J1UA 3S2DJ 5FKKA 2IU5A 1FIAA 3IUVA 5JLWA 2XSDC 5K7FA 5CW8A 3VUQA 3RD3A 1ORKA 3G1LA 3IV5A 2G7GA 1P7JA 5FKNA 3S1QJ 2NP5A 3NXCA 1IDZA 4AUXA 2JN6A 1UI6A 2OF7A 4IHXA 5K7HA 1MBGA 2DA1A 5M3FJ 2E2HJ 3B6CA 3KNWA 3MNLA 2TCTA 3JRBA 2O7TA 2FBQA 1H88C 4V2GA 2ID3A 4QTRA 1P7IA 2LP0A 5F04A 1LE8A 4GCTA 1BW6A 3S14J 2TRTA 2QF7A 2JA6J
chains in the Genus database with same CATH superfamily
2HOAA 2WY7Q 1FMWA 3H9QA 4W1UA 4XIDA 3L2RA 1BM9A 5FJ8J 1MMGA 3MAJA 2FOWA 1BL0A 2JMWA 2XHKA 4LG0B 3BOQA 2ZMEC 1PUFA 1R22A 2YVHA 2OC6A 4RAFA 4L5JA 3BZKA 5M3MJ 1IUFA 2OPTA 5C44J 3BPXA 4Y17A 3TP0A 3VOEA 3W2WA 2DMTA 1ITYA 1R4MB 2PJPA 5LFAA 3PUFA 3ECHA 1JE8A 1BA5A 4GRIA 3GTKJ 4P1WA 3LA3A 3KKDA 1IV6A 1UI5A 2W57A 1GVJA 2DDBA 2XIGA 3FBNB 1YHQI 3E5QA 2VUMJ 1I1SA 3KZYA 3ROUA 1UHSA 2L3DA 3JRHA 3VW0A 2P5LC 2Y48A 5EGOB 1P9QC 2LD5A 3K8PC 4MFEA 1SMYF 4CZCA 4QLCU 1STZA 3L09A 4XSZF 4D5CA 4XLPF 4A2UA 2WC2A 3BQYA 1VQMI 3U9GA 4BHPA 3WTWC 2V4JC 3V8JA 4Q4ZF 1DP3A 4ANJA 3R0AA 1TBXA 5LD2C 1MBJA 2XKPA 5J6XA 3PNVA 2G3BA 1WJAA 4F7ZA 5LEJA 2OU2A 4DW6A 2HQRA 2X4HA 3BC8A 3NAUA 1NTCA 3SHFA 4BJ5C 5F0CA 2MYSA 3ZMVA 4AVZA 3PPBA 1S7EA 3EYIA 1FLIA 3DPJA 2DK8A 3CCEI 3L2VA 2CW7A 1H0MA 4J00A 3QODA 4IQJA 2EFOA 1LFBA 1Y8RB 4C2UA 1REPC 5D6EA 1QQIA 2QSFX 5K58A 1U6GA 2ZMEA 3IAM2 1RZ4A 3O8GA 3FXRA 5K5OA 2LOOA 2DMNA 1OQYA 2DO7A 1T8IA 3OYNA 3HTJA 4C3IJ 5EF6A 5H6RA 2CUFA 3TBIA 4B3AA 5EEHA 2HPMA 5DD8A 2QWTA 2Q2EA 1MMDA 3BROA 3VWBA 3GZNB 2K86A 1RKTA 2E5ZA 2ZBKA 4XMYA 2FU4A 5FFZA 4XQFA 1X1BA 1SFXA 1Z9CA 2W4SA 4V2FA 4FE4A 2W7NA 2BY1A 1WI9A 2F4OB 4YEJA 3WHBA 1ERDA 4I01A 1YG2A 1RR8C 5HS7A 2EV0A 2ZJPF 1FWZA 3TOAA 3KP7A 3A01B 5D1RA 2OQRA 2OZUA 1TWAJ 4EJTA 3M1CA 1RC9A 4A0XA 5E1WA 2R7XA 3FISA 3QOEA 5GAHJ 5HOOA 2XPVA 1R5ID 5EYRA 5J3LA 1ZGWA 2ZJQF 2VPRA 6PAXA 4RB2C 2ECCA 2RV8A 3V7CA 1VI0A 1XG1A 1R1VA 2L7MP 1ZK8A 2ZOYA 2D1VA 2RVCA 4M74A 2DT5A 2STTA 2FXAA 4XKBA 5HNHA 1AKHB 1Q1VA 4WXDA 2MGQA 3WTYC 3LAPA 2KZVA 3WODF 4KMUX 1JKOC 4DQ2A 4BHBA 1G8XA 3LFKA 3IUOA 5L3CA 2G7UA 1XGNA 3GZ5A 1TTYA 4P5OA 3DBLB 3KP3A 4MK6A 5HS8A 3CQZJ 4N9HA 2VC1A 1FYKA 2FX0A 3VSLA 3S5RA 5ICFA 2XASA 1P2FA 1I39A 4ZH4F 2YX4A 1JKPC 3AL0C 5M5XJ 2QZ8A 5D5XB 1RUNA 4IHYA 4UUSB 2M30A 5C4YA 2E60A 4GXOA 1FBSA 2L9VA 3OIQA 4CZZA 1S7OA 2W82A 2M9HA 5DCMB 2H09A 4L0YB 2J5PA 1HKQA 3BG5A 3KZZA 2K9SA 3LWFA 3ZMUA 3CUQC 3F0CA 4NQWB 3BCBA 1OMIA 4HV5A 3L2UA 3HPHA 1G3YA 3Q9VA 3HDDA 2KFDA 1FIPA 1YW7A 4HF0A 1SD4A 3TW7A 2HGCA 3PJRA 2HKUA 2LC2A 3LOCA 2JA8J 4RA2A 4KIBA 3DV8A 2LVSA 3J80Z 2VBYA 4Z2YA 2R5YB 2DW4A 3SZPA 1K79A 2K9NA 1F1ZA 2YUSA 2H1LA 3KZIC 1D0ZA 2EZKA 3LWJA 2KP6A 4BQQA 2L9NA 3GLXA 1ETYA 1WGXA 1IUYA 2IW5A 3TO6A 1VQOI 2ETHA 3RQ4A 4ZYAA 3C07A 1W36C 4L9NA 4CYDA 3OIOA 4A3IJ 3IWZA 1IG7A 2DLLA 3BG9A 1SGMA 2O5RA 5CVVA 2XGDA 1BR2A 5L3FA 1ZYRF 2ISZA 1FYMA 2EIMH 2X1DA 1XDUA 1ZELA 5H9TA 3GO5A 2O61A 3HIMA 4KDPA 1TQPA 3Q0VA 1MD0A 3E6BA 3PNYA 3F6VA 1YRNA 3L7WA 3CDHA 1V54H 3EUPA 2P5VA 4CUGA 3J81K 1SFKA 2XROA 4HBLA 2Y69H 5ILVA 4HX4A 2B7EA 3VOKA 2M87A 1D1BA 2GUHA 3VIBA 2PZ9A 4PCQA 4JP0A 4CCJA 3Q5FA 1A6IA 3K1MA 2CFOA 4E7ZA 2V6EA 3CUQA 3DLAA 4LB5A 4MHGA 1T95A 2HVQA 2MD5A 4QPOA 2DXIA 4XOPA 2DCEA 1OR7A 3SDBA 3HHGA 2RKHA 4BQOA 4F3QA 3AG3H 1O7LA 4AC0A 1FBQA 1X1PA 3LSMA 2WUIA 4XR6A 1YX3A 2FNAA 2VKVA 3K2AA 2XPWA 5HS9A 3TO9A 2OTLI 1CGPA 3AAFA 1FJLA 2X6YA 4U0YA 1ODDA 2R93J 3CLQA 1FEXA 1E17A 1TW2A 2ZB9A 1MJAA 4AD9A 2W25A 4L5EA 5D5WB 1IRXA 3F9KA 3BTLA 1W5TA 4HX8A 3BNIA 2BV6A 3I59A 3K4JA 1YJNI 2OUMA 5E1ZB 2WAFA 2MSYA 2NP3A 3OYMA 3ABUA 3QAHA 4A3EJ 2QBYA 3VP5A 3BQZA 2VQGA 3ZMSA 5DCFA 2DPUA 4OD4A 2KPMA 3H3VK 5FKMA 1BN5A 2ELJA 3ZQQA 3SYTA 1K6OA 4L0ZB 4DJAA 4FX0A 1KQ0A 2P4WA 4UB8C 3I5UA 3HOXJ 3FMSA 1GXQA 1GV2A 1T56A 3GZIA 1J7KA 2JK3A 3J80K 4RS8A 2PI0A 1T6SA 2Z5UA 4DOZA 4XRFA 1YITI 5B1BH 1W5SA 3JRGA 4IJAA 2WV0A 3OYJA 4JX6A 2A6HF 4U87A 2BY3A 1XGSA 3MKZA 2CJJA 2ZC2A 3FM3A 2R0QC 3NNRA 1R7JA 4KMFA 3EETA 5D8LB 4I0AA 1IDYA 1MDMB 2HFHA 2YR2A 5H20A 2NOGA 3VYTB 4DYQA 4HNUA 3K4MA 3K4KA 1SC7A 4LOCA 1HW5A 2LR8A 1K61A 4AVPA 4IKFA 1OCZH 2BHZA 1YFHA 3HTSB 4BH9A 3FXLA 2CS3A 4X1EA 2HPIA 1BI3A 2MG4A 1F36A 2NS0A 3HRSA 3G71I 3OY9A 2CRGA 2R4GA 2HXIA 4FTHA 3QYBA 3LSRA 4KIGA 1MBFA 3CCSI 4IVNA 3VVZA 1O3QA 2H6BA 2F48A 2HU9A 4HDVA 2E35A 1JTXA 4BL0B 4G6TB 2KHMA 1LUJB 2X48A 1XCBA 3EQLF 4WXCA 4ACIA 3O60A 1PUFB 1L0OC 1OISA 3FZVA 3HGGA 2GXGA 3M9AA 3CP2A 3HTIA 4AYBA 1WVRA 3HC7A 4EM1A 4RM2A 1IGNA 1QHGA 5IOYA 3BP8A 4QSHA 4EJUA 3PM1A 2HEOA 3ZN1A 2NYXA 2XUBA 3ASOH 3H1CA 3TDUC 2QLZA 2WWYA 3H3ZA 1UFMA 4U9LA 2BBYA 2RN7A 2KRCA 5TGTA 1I3AA 1ZG1A 3QWLA 2HS5A 3DKYA 3GEZA 3PL8A 1U3EM 3CLOA 4G94A 1YTYA 2DA4A 3AFHA 4G7ZF 3A4CA 4UUTA 3GW2A 2DAOA 3BR6A 2MD0A 3DBRB 3VODA 5HNFA 4BHCA 1CF7A 5DUIA 2VXDA 4I09A 2H1KA 4HZFA 5IP7J 3DTIA 3GLLA 3R4KA 5EEAA 1ACIA 1T0FC 5J47A 3HRMA 4L9JA 2EBIA 4YELA 4BDYA 2EK5A 4HEA2 2F2EA 2DT6A 3BCAA 3KCCA 2F4MB 1VFCA 1ETXA 1V5GA 2X1CA 3DP7A 5FLXZ 3F23A 2E36A 2X6OA 5AIPA 2F4IA 2XF6A 2PMUA 4F91B 2QTQA 2IS6A 3H0DA 1B4AA 4DIQA 2O8KA 4O5VA 2WAEA 3BWGA 4I99C 1FBUA 2DMUA 4U0VA 3EUHA 5BOXA 1LDJA 1MNEA 2EA4A 3S2DJ 1R36A 1Y56A 1UAAA 3C7JA 5JLWA 2IGKA 4IQ4A 4B8XA 5CW8A 2IRFG 3OWTA 3IV5A 2ZMEB 1P7JA 3H3UA 1KZHA 5J4VA 4O6JA 3OYBA 3S1QJ 1IV8A 4IHXA 1TZLA 2V9KA 3KNWA 3B6CA 1WJDA 2W1OA 2FBQA 2Q2EB 4V2GA 4KT5C 3KX2A 4GGGA 4QTRA 2PQ8A 1P7IA 3GZ6A 5F04A 1SD6A 1BW6A 5E8IA 3OS1A 2P6TA 3MQ0A 3CD6I 1OYIA 2DTRA 4DNCA 3G73A 3WGIA 2JA6J 1BI1A 2Y9YA 3JSPA 1GLNA 3ZMTA 3E6CC 3RSNA 2CQXA 3W2AA 3S3NA 2E1MC 2DODA 2WTEA 4RM3A 5CVIA 1JUPA 4C3JJ 2UXOA 1BW5A 3GEUA 1X4PA 3GFMA 5GPAA 3H36A 1R5GA 4WXHA 4IHWA 1E3HA 2PMZA 1EF4A 1JUSA 4JX5A 3K0LA 3CF2A 5FD6A 3GFIA 4HPQA 2X6XA 5J8FA 2Y75A 2KL4A 4ENNA 2KIMA 2DFIA 3MKLA 4J01A 1ZR2A 5E17F 3E0JB 4A0ZA 2IP2A 2YU9J 2M2EA 4HF1A 1X1DA 3AKZA 2K9QA 4E70A 3HZJA 3G3ZA 1ZAOA 1G3WA 4WIBA 4JOMA 1DQUA 1MBEA 4L9VA 1YYVA 2D6YA 3J7ZI 3ERED 1VQLI 2E5NA 2N8GA 2VI6A 4LLNA 4ZTJA 2MC4A 3DFGA 4XN3A 1VQ4I 3NI7A 1SFEA 2EZIA 1U5TC 2RNGA 2IAIA 1MNDA 1IN4A 1B8IA 1MH4A 3ANGA 5L3GA 1JT6A 1DGRM 4CA0A 1K4SA 4Q48A 3HBLA 2Q1ZB 1XGMA 1D3YA 1R1UA 1Z21A 2W85A 3H35A 3MMYB 1PP8F 3HSFA 2Z33A 2HOEA 2XAQA 2LY1A 1GT0C 3PUBA 5IT3A 1HBXG 2B1EA 5FLXK 4TV7A 2REKA 4E6KG 5DDGA 3RKWA 2ZSHB 2W53A 5C4JJ 4AM3A 4RGXA 4K2EA 3QP6A 2P81A 2JA5J 1ZTRA 3QOPA 4M3DA 3OYFA 5CLSA 2QYOA 5LRSA 3RKXA 3GTOJ 1RESA 2Y30A 2EIKH 3BR2A 3TO7A 2F5EA 4BXUA 1QU3A 4OINF 2F07A 4A93J 4OIQF 1YO5C 2EV5A 3VFZA 1X1CA 4OOIA 4OU0A 2I5UA 3KP4A 2DOAA 4G7HF 2MH9A 2QWWA 1USTA 2LKPA 1WSUA 1JHFA 2QQ9A 1K83J 1N77A 2FBKA 4HOBA 1R4NB 3ZRGA 3JREA 3AQSA 1LFUP 4JL3A 2D45A 3WTTC 3GMEA 1W5CC 4S0HB 4I0BA 2DA6A 5L3BA 1HA8A 2WV1A 4H4KC 4BY1J 2YS9A 1LPQA 2L7ZA 1QZYA 4NDLA 2JRMA 4C30A 3CWRA 2K3PA 1YRNB 3EPZA 4A3BJ 5EFYA 2DA2A 4IRGA 4YFKF 3MKWB 4IOAF 1U5TA 3P9TA 4E7KA 3QPLA 3VVXA 2L02A 2IVMA 3AL0B 1VQ6I 4A3CJ 3L2QA 2Q8KA 3A0HC 3TQNA 5D18A 4HDUA 3RKQA 4EVIA 5FLVA 3JSJA 4IPAA 3CUQB 4ZZLA 4XRSG 3IH4A 3V7SA 4PXIA 3TKYA 3EYYA 1Y1WJ 4HQEA 3CCRI 2A6EF 2FE3A 2ID6A 1JJ6C 3P9KA 3NEUA 4PFOA 2DOEA 2KIFA 4BKXA 4F55A 1NH3A 4EV0A 2M7BA 3GBGA 4HG2A 4NBQA 1H9GA 2LDUA 4AIKA 2QSGX 3RTRA 4MXMA 4HLXA 2RC4A 3DPTA 1K7AA 3WTZA 1DU6A 4B3XA 3JAMZ 1DP7P 1JUMA 3FM5A 4CXFA 4CYCA 1VQ8I 2VJIA 2V26A 2GIVA 1XSXA 3D5LA 4KFCA 4M6XA 1V55H 1E3OC 1HOMA 3E5UA 2RHAA 4LITA 2QQAA 3I59B 1WQ2A 2VL8A 3RZDJ 2IA1A 2MABA 2WAQA 1MSFC 2VE9A 2AHQA 5E3OA 2NXNB 3OYHA 4B44A 4ESJA 3E5XA 2QBYB 5C4XJ 2CUJA 2K4BA 3VYRB 4A3FJ 2Z2SB 3ZQIA 2CFXA 1KONA 2WB1A 4AU7A 3I64A 3S1NJ 1LEBA 2IT0A 1WH7A 4WF2A 3IRQA 1P92A 2B0LA 1VQ5I 3ML6A 1YIOA 3CJNA 1W0TA 3JRDA 4EGZA 2ACJA 3FKJA 3BY6A 2FRHA 3T5XA 2LREA 2XC7A 3GX4X 1XTAA 4PDKA 3PFYA 3FXMA 4HKUA 3KEOA 1Z1DA 1I6XA 2FD5A 5CVUA 2EPFA 4I02A 2BW3A 3CMEI 2OTJI 5HBUA 3NWSA 1NG7A 5LHIA 3CUOA 2MH2A 4I6ZA 3M1EA 5D4RA 3M07A 2JUGA 1VQPI 1YS7A 3K70C 4MLOA 2YVEA 4EM0B 3WTXC 2R7WA 5EEGA 1T2KA 2QEXI 3UR3C 2ICWG 1SAXA 1UELB 4GFLA 1LFPA 4IZZA 2HNHA 3ZPLA 2JQ7A 4B48A 1B72A 2HVSA 2XDVA 3FWEA 3HOVJ 1MBKA 5ICCA 3WTSC 3MFKA 4CHUA 3COAC 1X4OA 1W36D 1NG6A 1SANA 2A6TA 4Y15A 3H5RA 2CUEA 1WHUA 3JSOA 2HR3A 4IRIA 1ZGJA 2E19A 1S7AA 4I2OA 3D5RC 4AC6A 3PQJA 3F8NA 2MC3A 2EZHA 3KE2A 1OCOH 2O9LA 2H27A 3ZMZA 1XS9A 2VKDA 1B6AA 2E1NA 2M34A 3V7RA 4V19K 4YIFA 1S5LC 2GZWA 3WHCA 3TOBA 2VODA 4CCLA 3HOTA 5GPCA 2IS4A 4FASD 4L18B 3RPQA 3Q3SA 4A6DA 1YIJI 4ME9A 2QGUA 4ASNA 2VPLA 1X2MA 4FHTA 5FGMA 1ZLKA 1QZZA 1R00A 5JLXA 3HL2A 1V5FA 3M8JA 1HF0A 2FA5A 1WJBA 4FX4A 3QP5A 3B81A 4GYIA 4S04A 3SQNA 4C3HJ 4YIIA 5FB2A 1UHMA 1XC5A 2JT1A 4EM2A 1EH6A 2LMDA 3V78A 1HSTA 1CF7B 3DWLE 2A5WA 2JPCA 4UVAA 2EINH 4NELA 4AF5A 1U2WA 1BR4A 3EUKL 2H8RA 5D6FA 4MNUA 2G9WA 1U9NA 2COBA 3I54A 3E7QA 4RAZA 3KPHA 2Q24A 4UV8A 3TW6A 1HCRA 3FXQA 2GBYA 3RH2A 1C0WA 3ABTA 2P7VB 3ONQA 2CH0A 2UXIA 2AXLA 2VJJA 5AONA 2W24A 2M7AA 3BG6A 3TMOA 3MVPA 3SZTA 1XMKA 2OV7A 5IOZA 5FLMJ 4WK8F 3E1SA 1B9MA 4LLGF 2M4KA 3DQVC 5ICEA 3OYDA 5FRNA 3OS2A 3OOPA 3R6SA 3F21A 2V79A 5LLQA 1Z7UA 3CC4I 5J4YA 2A3SA 5BMZA 2V1UA 1AHDP 3DU5A 1SVMA 4X0GA 3LSPA 1FSHA 3BHQA 1YOVB 1LJ9A 2P6SA 4YZEA 4G6QA 1SAUA 4W97A 3DBHB 2UXUA 2ZCNA 5JFRA 1JXSA 1QHHD 1ULYA 4RMNA 3Q0WA 5DV5A 4XBFA 4BACA 4GCKA 2J5OA 5KNLA 3IC7A 2HQ5A 3I56I 3REOA 2M8GX 1KA8A 2A61A 2FBHA 3F8FA 4PK4A 3WTVC 1OFCX 4PJLA 3V4GA 1UHWA 1T39A 9ANTA 2O3FA 5CKTA 4DYRA 3A03A 4I7HA 2ZJ2A 4IL6C 3GUDA 2AS5F 3HB9A 1LVKA 1NK2P 4IHTA 3VSKA 4R79A 2GOMA 5TJJA 4BGDA 3UKGA 4QPQA 1EJ9A 4FE7A 5ED4A 2L4MA 5DEQA 2VOOA 2HQAA 2P5KA 1D5VA 3JW4A 4EEFG 4A3LJ 1IXRC 1TLHB 1YJ9I 2XGEA 4DGWB 2KLOA 1WJCA 3HHHA 5HDGA 1J0RA 3O3KA 2KISA 4C2MJ 2QKOA 1TW3A 4AYBN 3L2WA 1EH7A 4XLNF 4PJ0C 4NC7A 1UCRA 1A04A 1UZCA 2JPBA 1TT5B 4ON0A 1U78A 5E3NA 3HEFA 1O4XA 1VQ7I 4BBRJ 5TRDA 1IN7A 4AIDA 2HWVA 1JI8A 4DBRA 2RGVA 1QNTA 1KQ8A 1ZRDA 1R71A 2VN2A 3ULQB 3SZGA 1X2NA 1X1AA 3I4NJ 2E2IJ 3CCVI 5J1YA 4A5NA 4XICA 3OYGA 4Y52J 2JSPA 4IOCF 1E0EA 3KYLA 2X0LA 3I0TA 2G7LA 2EWNA 2ZXHA 4XONA 3MZYA 1B8IB 2WA0A 2XB5A 2O7OA 3F8MA 1ONVA 4BY7J 2PBIA 3DKWA 5L3DA 5BQTA 5HAWA 2HDDA 3KYDB 4YIRX 3KETA 3NPIA 4ZDLA 3I4MJ 3BJBA 1BJZA 1P6RA 5F08A 4B43A 4PGHA 3R60A 4ZJZA 3B02A 4ENKA 4CCOA 4PJMA 4D7NA 2I8DA 5F1RA 3F1BA 3IWFA 3LA2A 1FSEA 2DMPA 3UNGC 3RCOA 1FNNA 2V9VA 1PVEA 3FHNA 2XSDC 2MLKA 3V8LA 4Q5SF 2HDWA 3VUQA 3RD3A 3E6MA 4ZDOA 3G1LA 2L54A 3PSIA 2G7GA 2FOKA 2A07F 1IDZA 2EV6A 2UXXA 3QYEA 4AUXA 2JN6A 4LMYA 1UI6A 2OF7A 2E2HJ 2MFZA 2TCTA 3JRBA 3DTKA 4NC8A 2XKOA 4PZJA 5J40A 2F5CA 2FMLA 2ID3A 2HKXA 2R7VA 3GF2A 1T08B 2LP0A 3LQRA 4PJJA 3S14J 5JHUA 2TRTA 1U8RA 2QF7A 2QQBA 2GIZA 1BBYA 2ME6A 1APLC 2M45A 2HQNA 3S1MJ 2IBDA 4P96A 1VQNI 2BY0A 1ZH5A 3BCGA 3H0GJ 5GAEJ 4XLHA 5FRMA 2R7QA 3HSEA 3DXJF 4B09A 1BIBA 2E1OA 2LNBA 5CXGA 2L4AA 2CW0F 1U5TB 4XORA 2PMZN 3H5AA 4XKWA 5FMPA 1LNWA 2EZLA 3KP5A 4D9JA 1RETA 2K27A 4BQNA 4BXXJ 2XRLA 1FY7A 1Z05A 1Z6TA 3FXUA 3HOYJ 4BE1A 1RR7A 1H8AC 2ZNYA 2QM3A 1RIOH 1DPRA 2JZYA 3GFJA 1HQCA 1OYWA 2PFBA 3ISPA 5EZHA 1KYWA 2DMQA 2Y2ZA 1DGWY 3IAS2 3SXYA 3BZCA 1N25A 3E3VA 2JUCA 2WY8Q 3CCMI 4B1RA 3RI4A 4MIMA 3WU1B 1T98A 5E8GA 3H92A 3WE3A 3WGGA 5B3SH 1J59A 3FBIB 3DLLF 2W84A 2CQ7A 2OD5A 4CSWA 3OV8A 3F6OA 4E7HA 2CU7A 4CYCB 1A36A 1IXCA 3MCZA 3VDXA 3CF5F 1SEUA 2H6CA 4GYGA 1ZARA 3M8EA 1EKEA 1R58A 4A12A 3OYKA 2VJ4A 2PEXA 3GYHX 2IS1A 3G56A 3ASNH 1XDSA 3I3LA 1AA7A 1U9OA 3GWZA 3E97A 3FMQA 1OYYA 3VEPA 5B1AH 1BR1A 5LRRA 3MZ8A 3K1NA 2TDXA 2FMYA 4JKZA 2EJRA 2IGMA 4OIOF 1R6RA 3LJLA 4GCLA 1V3FA 3RZOJ 2CSOA 4HSTA 1FTZA 2L9RA 2NOJB 4QIWN 4PSXA 5FKOA 1ENHA 2ZCMA 2M1BA 3O6BB 1ZLJA 2HTJA 3NRVA 5EJCA 2CG4A 4BQAA 1EA3A 2STWA 4BE0A 1JTYA 3C1DA 3L00A 1R23A 3P9IA 3VYUB 4F92B 1Y6IA 3IKTA 3CO6C 3PO2J 2BW3B 2YU3A 5M5YJ 3M4OJ 3VB2A 4UXNA 3J7AY 1S8NA 1KU3A 1ZQ3P 2K4JA 2QCOA 3LAJA 2R7SA 1O3SA 3I55I 3LNQA 1D1AA 2CGPA 2BZTA 3HJEA 1W1WE 4D5FA 3FKIJ 4E4HA 1LQ1A 2WBMA 3EGQA 4M3FA 4CCNA 3OIPA 1VQKI 4LK1F 3IRRA 2ME0A 1D8KA 2DFHA 4M9XA 4BDZA 2DG8A 4YFXF 5LHHA 4CGZA 4P9UA 3AQTA 1B59A 2QVOA 3CRJA 3OOUA 1B72B 1TT0A 3IH3A 2VBXA 4ZYDA 5JVTA 3E6DA 3N4MA 3S3MA 5CJ9A 1O7FA 2HDCA 3A1YA 3V8KA 3JTGA 4Y3OA 1MJBA 5HLHA 3OYAA 2DG7A 4RAYA 3BR0A 3WG9A 5IT9Z 1IW7F 1TWCJ 2Y31A 4L9TA 3HTHA 3HIFA 2R3SA 1U0JA 4RLQA 5KVRA 2A05A 3H9JA 4GFBA 1Y0UA 3ABMH 2XAGA 5KAIC 2E34A 1GDTA 3I58A 4BEHA 2BEOA 5HLGA 5EG0A 2W48A 2L2OA 3ZN0A 3CJRB 5IYBJ 3WU2C 1T0FA 1IAWA 1FOXA 2AQFA 1POGA 3ZXSA 3IHUA 2PMHA 2OJED 3BLYA 2K9LA 4GCVA 2EFNA 4ZC3A 1D5YA 3BJOA 2KQRA 2LTPA 2VT3A 2LRDA 4D7MA 1F43A 2LFBA 1W7PD 3KKCA 4KYWA 2JA7J 1YE9A 2ZO4A 2CQNA 2WAQN 4LLLA 3C2HA 3LA7A 3F8BA 2V9PA 3GTMJ 2LKXA 2JVGA 2H94A 2FSWA 1PUEE 4IRHA 1SVOA 2R7ZJ 2WB1N 4M3EA 4Y13A 3VOXA 2O0YA 2F5VA 3KFWX 4U0WA 1ETKA 3O8HA 3KYCB 2EFWA 4Q47A 4KNYA 2L5QA 4N9IA 1AOYA 1D0XA 2NAZA 2Z1DA 1IF1A 2OI8A 3QU3A 3R61A 1Y1VJ 2MA3A 4IEJA 1HDPA 4ESBA 1W4MA 1X19A 2FJ1A 2M4GA 4WX9A 2DFFA 4HX7A 3X2QH 4MEXF 2Z99A 5D19A 3RIRA 3K2ZA 1XB4A 3FIWA 1YW8A 2EH3A 1P4WA 2XF5A 4KISA 2QA4I 4XN0A 1MZBA 5HLTA 5LGNA 4DZPA 2IS2A 1OCPA 2IJLA 4E7SA 4UV9A 3FF5A 3HPGA 3CCLI 2V57A 4EATA 1SFOJ 1N78A 3CDIA 2GXAA 2ZSIB 2HZTA 3BDDA 1G3SA 2R7OA 5IYCJ 2NRAC 1IRGA 4AIJA 2HTSA 4N4OB 1A6QA 2I10A 5BPIA 5IYDJ 2OA4A 1XD7A 2V1DA 1WRJA 4MEYF 5LGUA 2LKSA 3CDLA 2X51A 3LL7A 3K70D 3OR2C 2QQ8A 1ON2A 3LSJA 2RQPA 1QZEA 3PFIA 1OLTA 4A3DJ 2NS7A 3HKZN 3HRTA 2VASA 3VW1A 5DYMA 2PG4A 2CWEA 1SD7A 1CQTA 2VQCA 4FISA 3VW2A 4A5MA 1JHHA 5IT9K 3N05A 2YPRA 3P5JA 3DTEA 2PFVA 1S9HA 5FKLA 1K4TA 2ZXJA 2QKMB 3EDPA 3K4LA 4G7OF 5H2FC 2FNPA 4XRSA 4Y7NJ 3P7NA 2CV2A 4BJ6C 4UB6C 5ICGA 1JT0A 1D8JA 1USSA 4PGGA 2R92J 5EDNA 3CMAI 3HM5A 3M7GA 1ZG3A 3RPUD 4IHSA 3CZ6A 2LY9A 4HNVA 1LB2A 3ZP5A 2HYJA 2R7TA 4XM3A 2VT2A 4QWQA 1LKXA 1OCCH 1Z7LA 4B47A 5K7ZA 1BOAA 4BU2A 2VXZA 5J8CA 5D4SA 5B66C 1Q1HA 1AU7A 2P7CB 1I1GA 4XLEA 1RNLA 2GXBA 5DAJA 3T8RA 4X6AJ 1S29A 2D5VA 1HXDA 3IP4B 2EB7A 2JSCA 4F52A 1MW7A 4JX4A 1HC8A 4UY8I 4PSWA 3BTIA 2RQQA 2QIBA 2KT0A 1ZHFA 2DYRH 2RREA 3HSRA 4G8XA 4YG2F 2OCCH 3G6EI 1IC8A 1FTTA 1ETOA 2UXNA 3WTUC 3K4BA 2FQ4A 2G7HA 3HTUA 2DA3A 4G12A 2BVLA 3K69A 4OWRB 4ZZDA 1YI2I 1QPIA 4PJNA 4RB1A 2DK5A 4OMYA 4OIRF 3G2BA 5FD5A 3K9TA 1TWHJ 2BXYA 2BYVE 1BIAA 3PQKA 4ESFA 2PJRA 5CQEA 4MFDA 1KU7A 5IP6A 5F0HA 2NVXJ 5KHDA 3FX3A 1J5YA 2OZ6A 4XLAA 5CVJA 4DZJA 3ZQGA 3JRFA 4PUSA 4LB6B 2A2FX 3IH2A 1ETVA 2G7SA 2A69F 1HW2A 4ZYEA 2DA5A 2K7LA 3HUGA 2IA2A 4KN7X 1OCTC 3ON2A 2JJ7A 1ETWA 1GVDA 1JGGA 4KN4X 4NN1A 2MLGA 1LDDA 3HOWJ 2B9SA 1TNTA 2XF7A 1OCRH 4XOTA 4L62A 4HYEA 2UXPA 4D1QA 2Y0SA 1BC7C 4M9ZA 2BY2A 1FT9A 2LBFA 4RGUA 2CO5A 2F6CA 3ELKA 3CJQB 1LDKB 2DQLA 5FO5A 4II2A 3GTGJ 3S2HJ 4CDGA 2ESNA 5L3EA 1A35A 3GTLJ 1HDDC 2JRTA 4CICA 2HOTA 4H0EA 5CXIA 4ICHA 1ZGAA 4YFNF 3S16J 1W7PA 4L5IA 3BZ6A 3KZ9A 4XL9A 4U7DA 3H9GA 4EJOA 5F0FA 1UB9A 3I4PA 4LIVA 4C2TA 2DDAA 1WJEA 4MGRA 5BS6A 1R5HA 1JJ8C 4KWAA 3TEDA 5LBQA 1O3RA 1MMNA 2R5ZA 3PSFA 3JR9A 2A68F 3HOSA 2XSJC 2Z9OA 2MBFA 1YX5A 5F1JA 1GHCA 2XAHA 3FK6A 1I50J 4UNOA 2DJNA 3HKZA 4P9FA 3K10A 2FJI1 4FETA 3FXOA 1YS6A 5DUKA 1TL8A 3G1OA 2OBPA 2EQRA 2ESHA 1WFXA 5K5QA 1R9TJ 4M6VA 1OJLA 5C3EJ 5HLIA 3V42A 4ITVA 4BYYA 1G6NA 3J7AO 3F22A 3MZHA 2UV1A 3U1KA 3VTIA 1GV5A 3DCFA 3RQIA 4RAGA 3HE0A 2IEKA 2D1HA 4YRVA 4BJTA 1HKTA 1K78A 1Z0XA 3FHZA 1DDNA 4CCMA 4DVYP 3BR3A 4OIPF 3BPVA 4I98B 3CMMA 3GTQJ 1IZ1A 1H89C 2LLKA 1JGSA 3ZR8X 1R1TA 2KIQA 4NB5A 2MW8A 3JAMK 4P55A 5J1UA 1PDNC 3J81Z 3JCUC 2P8TA 4MQ9F 4BS9A 2CW8A 3PIPF 5K7FA 3LFUA 5TISC 3S8PA 3KLOA 1SFUA 1ORKA 5JVGF 1QBJA 2K02A 3JTHA 2NP5A 5A2QZ 3QRFF 4CH7A 3K6GA 2PLYA 2R7DA 5M3FJ 3MNLA 4E7LA 5BPDA 3LMMA 2O7TA 3ZCOA 1H88C 2NNNA 1FOYA 1LE8A 2JVHA 2BOLA 3QPHA 3I9V2 4WWCA 4UVBA 5JR3A 3OYCA 3DEEA 2DPDA 5DS9A 3OL4A 4UHTA 2PN6A 4HAMA 2HI3A 3RPUA 3GTJJ 3M8FA 1HW1A 2Q0OA 2NX4A 3W6VA 3FMRA 4M71A 2L7KA 1PJRA 1Z6RA 1XPXA 3HGYA 1BC8C 3WG7H 3L1PA 2UUZA 3JRCA 4OAZA 5HDNA 4EJVA 1X58A 1MGTA 2XGCA 3QKXA 1H9TA 1D0YA 2K85A 2L0KA 4KUMA 2DT7B 1PP7U 2QOPA 3RYRA 1B9NA 2PX9A 5D5VB 1S3JA 3VVYA 5D8KB 2BVMA 2GWRA 2DN0A 2HYFA 2LF8A 2OQGA 4PFPA 1FPQA 2COMA 4C2MA 3MEXA 1GXPA 1F4KA 2AO9A 1A5JA 1WH5A 1KQ9A 3U1DA 4M9SA 1OR7C 4XRMA 5DM6F 3ZQCA 2A5YB 3QQAA 2CQQA 2YSRA 2ZY9A 2W00A 3GVAA 2HKOA 2YVXA 3G7RA 4HLYA 1VQ9I 1DPUA 5F27A 4BEHB 5EG0B 2WGBA 4ETSA 2M8EA 3DKXA 1FX7A 3L9FA 3NARA 4RDUA 2Y0MA 2VBWA 1T38A 3W2VA 2IGOA 1TP4A 4D0PA 3ESWB 4NHJA 3MWMA 1G2HA 1WI3A 3T6NA 2BE5F 4XSXF 1RUOA 3G1MA 4KIFA 2X9DA 1QPMA 1VF9A 3QPTA 3ZMDA 1IRFA 1TWGJ 2ZXIA 1GUUA 2KRFA 3OR1C 2DOFA 4HA8A 4BAYA 2CMPA 3FDYA 4XKVA 2KDZA 2E7XA 3FXKA 4BBSJ 1I27A 3BR1A 2JTVA 1I6HJ 2FQ3A 2XAUA 1QRYA 3Q0UA 5JI6A 4IX7A 3RJPA 4M3GA 5HDKA 4ZYGA 4O3MA 4ZTFA 4A69C 3HRUA 2E7WA 3BRUA 2NVTJ 3BTCA 5E3LA 2RNJA 4KJZA 2XPUA 1ZR4A 3KEYA 3MD2A 1ZREA 3C3WA 3NWTA 5CYVA 4LFUA 5J1RA 4U7BA 3WE2A 3CJDA 2DJIA 4LIUA 1XCVA 2V1NA 1B1BA 3BR5A 1O3TA 2XAJA 2C6YA 3ZOBA 5M5WJ 5E1XA 1FYLA 3TDZC 2OCEA 1FOKA 5A2QK 1ETQA 1KU2A 2XB0X 1EH8A 3V6GA 3KIOA 3PO3J 4DYCA 1J75A 3L2CA 3BG7A 3OMYA 3W6KB 5GTIC 3OYIA 3WGHA 1G59A 2XGXA 2KIUA 2UZKA 2PBXA 4HNTA 1G4DA 3KP2A 5B5EC 1VZ0A 4CGRA 1WCMJ 1X3ZB 1MIJA 1OKRA 3D5SC 1Z67A 3BT9A 1UG0A 1YQAA 2E1MB 2K40A 5EZGA 3ZQHA 2EA2A 4LG0A 4IRVA 3HTAA 1QVTA 2VLAA 2KJBA 2NVYJ 3BTJA 4Y4RA 4NUBA 4KITB 4M73A 3VPRA 4E7JA 2XAFA 2VJ5A 1I5ZA 1KU9A 2DFEA 1FOWA 5DD4A 4N0BA 1S6LA 4G9YA 1HKSA 3HXLA 2B63J 2P0WA 4EGYA 2HVRA 3SJMA 4U88A 3ZQFA 4LGWA 3HG9A 1VTNC 2FUG2 2OAZA 3ON4A 2L01A 2CUZA 3I53A 3F8CA 2ZCXA 3DF8A 1WKMA 1SVLA 5CVRA 1IN5A 3DPLC 2ZFWA 3E7LA 3RYPA 3MN2A 5IPAA 5ILUA 3S17J 2KRHA 3KEQA 2V7FA 1XSVA 3GTPJ 3LSIA 3CCUI 5EGOA 4HSRA 1ZG5A 1X3UA 2RASA 3BG3A 3T0YA 2M0MA 2ZFUA 2X85A 3DEWA 3JRIA 2LH9A 2QUFA 3K1PA 2JWTA 2VC0A 5FHPA 1FZPB 2O6GE 1E2XA 1MH3A 3F72A 1WPKA 3JRAA 3OYEA 4N4NB 2NNYA 2OERA 1TWFJ 2ELHA 2VONA 3HOZJ 5E3MA 3CCQI 2VB6A 3W6JB 2Z3YA 4Z6YA 1FMVA 1O57A 2JA2A 1UMQA 4I76A 1QO0D 5BNGA 5KAFC 2UXHA 5KCMA 5GTHC 4FQGA 1X3WB 3CC7I 5FFXA 2GA2A 4KICA 1IO2A 1SMTA 1J2XA 5ILSA 4LJZF 2DBBA 3RKYA 2VIXA 2Y9ZA 3J7YJ 2GM4A 1TQIA 5ERIA 2Z16A 1DUXC 1NK3P 1Y8QB 3FK7A 4EJWA 2CYYA 2X6WA 1P4AA 4JYKA 2K5CA 2AQEA 1OPCA 3M3YJ 3K4NA 3A0BC 4A3GJ 4ENJA 2BGCA 2R7FA 3U21A 1A31A 2L7FP 3LSTA 4ENMA 4J19A 2LF7A 5F6FA 4JNNA 3EUHC 2G0EA 1DU0A 1SD5A 1HSJA 4RBOA 1QGPA 2H8WA 2LYCA 5F64A 3OS0A 5D5UB 1ZRFA 1U8BA 1MBHA 2FF4A 2GQQA 2PJRB 3IKVA 3S15J 2KJCA 1TC3C 3QBMA 3B73A 4M72A 1N75A 1EV7A 2DA7A 2ZKZA 2M5WA 2EFPA 4G6DA 1XX5A 5GP9A 1Y39A 3RDIA 4RLFA 2XV4S 3ECOA 5CPRB 3A01A 1F9NA 3HUGB 4ZDPA 4A6EA 1J9IA 3OYLA 2ADUA 3FRQA 1D1CA 1L3LA 1BOBA 1XMXA 2BXZA 1ZKGA 1V4RA 5HVQC 4A3JJ 4A0YA 3CCJI 2F5DA 4JK1X 1R49A 2XDNA 1JKRC 2EILH 2IPQX 3VYSB 2LBFB 2GFNA 4ABZA 3C2BA 2RDPA 2R7RA 3W3CA 1MMSA 1IRZA 1RRJA 4LK0F 1V5EA 4CCKA 1ZRCA 3C2GA 2VBZA 3CTAA 1ZN2A 2ISYA 1AKHA 2K9MA 4GFKA 4XLCA 5LEKA 3SDGA 1W7PB 2GA1A 4NNJA 2DU9A 1IN6A 4KT6A 3SFIA 2D2WA 3CP8A 2DQRA 2GLOA 4XKCA 2R7UA 2ELKA 3ZQ7A 1Z91A 4R1HA 3QPSA 1FP1D 2X1EA 4OD5A 4MQVA 2R5ZB 5GADJ 2ZJRF 1IN8A 5KK1A 4JBAA 3ZGKA 3AG2H 1XGOA 4A3KJ 1Z77A 3D0SA 2KZGA 4UUSA 3B6AA 2DYSH 2WADA 1QVUA 3A02A 1WJFA 2QSHX 5DCMA 4AIHA 3CMYA 2KDOA 3ABLH 3LSHA 1TQMA 1I3QJ 1AWCA 1MSEC 1J09A 2VOPA 2O03A 4DBQA 4NQWA 1W0UA 1Z3XA 3S1RJ 3QU6A 3SWHA 1RKWA 2BHYA 1UG2A 2KMUA 2LK2A 3DPUA 2FEZA 3ERMA 4KA4A 3K4CA 5AIQA 2HXOA 3T1BA 3SEQA 3TGNA 1F5TA 3GXOA 5CQGA 4LD5A 2IGNA 2VQLA 3R0JA 4AWXB 1HLVA 2NS8A 1K78B 5FROA 2R5YA 4RB0A 3AG1H 1NHAA 2GOXB 3IL2A 1IXSB 1YJWI 1ON1A 3FXJA 2UWMA 5HSZA 2O8XA 4XLFA 3TL4X 3C18A 1LVAA 1KYZA 2E71A 4HRIA 2HYTA 2M0CA 4A3MJ 4RB3C 4IHVA 1YW9A 4OAYA 2EFQA 1IJWC 4MTDA 4UUVA 2B3WA 1MJ9A 1Z3YA 3ABKH 3LSKA 3LHQA 4IXAA 4IO9F 2IXSA 1E3PA 4HV6A 4XK4A 3D1NI 3A2KA 4HF2A 3HOUJ 3KLNA 1BJAA 2XRNA 4GO1A 2F5FA 5JHFA 2DTZA 1LE8B 4M6YA 5LHGA 3DU6A 2ZXWH 3T8TA 1MMAA 4B4CA 4EMSA 2E1CA 2LY2A 2ZOZA 1BI2A 1Y0NA 3PASA 2GENA 2ZCWA 3NRGA 3OSFA 2Y0SN 3CO7C 2HOSA 5K5RA 1VNDA 4HQMA 1KGSA 5K1YA 3Q9SA 4R8HA 3G4SI 2L9SA 4ZYHA 1PYVA 2FBIA 2DI3A 2VKEA 5H6QA 2YX7A 3F3XA 2LG4A 2RAEA 2LSOA 3SEZA 2NVQJ 5E79C 1XSDA 3NQOA 4UVCA 2CQKA 2QENA 4E7IA 5E18F 3BJ6A 4OMZA 2ECBA 1FP2A 2QKLB 3TP3A 4MTEA 2NVUB 4RGRA 2K3FA 3PIOF 1RPWA 1T33A 4MO7A 1LEAA 3ZQLA 2ZNZA 5IY5H 2E2JJ 4UDSA 1JKQC 4FCYA 2HZDA 3DEUA 4Y33A 3BJAA 3HYIA 3LSGA 3CJTB 3GCMA 3S32A 3OSGA 5FGLA 4BXFA 4II3A 5IP9J 2KKOA 1WZ2A 4GDFA 3WU0A 3COLA 2V1XA 3PNTA 2V6CA 1FC3A 4M3BA 1XN7A 3H5NA 5HODA 1MKMA 4F93B 4S05A 3OL3A 3K7AJ 2CV0A 2VKHA 1P4XA 4WCGA 1YLFA 2IA0A 5DTDA 5AQCA 3I71A 1G3TA 4HW0A 3S3OA 2GAUA 3KP6A 3GFLA 1WWXA 3CCYA 1M1EB 4BNCA 1RI7A 5LGTA 4EQQA 2VE8A 3S93A 4BUPA 1XMAA 4CO8A 5GAGJ 3O2PE 3ANPA 4U9NA 5FKKA 2IU5A 3NS4A 1FIAA 3IUVA 4FT8A 3QYFA 1K6YA 3CESA 1TNSA 3LQQA 1S72I 3AG4H 4RGSA 1MDMA 5FKNA 3S2WA 3NXCA 3U2RA 4C9YA 2HYGD 2AXTC 2EIJH 5K7HA 1MBGA 2DA1A 4IF4A 3EUAA 4NC6A 4LG3A 1QA6A 3N97A 2VQHA 4BE2A 1WJ5A 1UJ8A 2XVCA 5E20A 3SFZA 2CV1A 3MKYB 4GCTA 3P9CA 4XNFA 3CC2I 2M3AA 5DM7F 1MNMC 4JQFA 1BI0A
chains in the Genus database with same CATH topology
2HOAA 1APLC 2Y9YA 5DS9A 3S1MJ 2IBDA 2CQXA 2HI3A 3GTJJ 4W1UA 4XIDA 3BCGA 3H0GJ 2NX4A 5FJ8J 3W6VA 1BL0A 1JUPA 4C3JJ 2JMWA 2UXOA 1BW5A 3GEUA 3HGYA 5GPAA 2E1OA 1PUFA 5CXGA 4IHWA 3L1PA 2YVHA 1EF4A 3JRCA 1JUSA 4JX5A 5M3MJ 2PMZN 1IUFA 1X58A 2OPTA 5C44J 2XGCA 3QKXA 5FMPA 2EZLA 3TP0A 2L0KA 1RETA 2DMTA 1ITYA 2QOPA 4BXXJ 3VVYA 2XRLA 3MKLA 1ZR2A 3HOYJ 2DN0A 1BA5A 1RR7A 1H8AC 3GTKJ 3KKDA 1IV6A 1UI5A 2YU9J 2M2EA 2K9QA 2AO9A 1A5JA 1WH5A 2VUMJ 4XRMA 5EZHA 2Y2ZA 2DMQA 3QQAA 3ZQCA 1MBEA 2CQQA 2D6YA 1UHSA 3JRHA 3G7RA 3VW0A 5EGOB 2N8GA 2VI6A 5F27A 4B1RA 2LD5A 5EG0B 2WGBA 4MIMA 4MFEA 3NI7A 3NARA 2EZIA 4RDUA 2IAIA 4D5CA 3BQYA 1B8IA 1MH4A 2CU7A 4CYCB 3ANGA 1JT6A 1G2HA 1WI3A 3T6NA 3G1MA 1MBJA 3HBLA 2X9DA 1VF9A 1TWGJ 1GUUA 2G3BA 4DW6A 1GT0C 3NAUA 3G56A 1NTCA 2KDZA 2REKA 1I6HJ 5F0CA 4BBSJ 3BR1A 1U9OA 3PPBA 1S7EA 3DPJA 1QRYA 3Q0UA 2W53A 4M3GA 5C4JJ 4JKZA 4A69C 3BRUA 2NVTJ 3LJLA 2P81A 3BTCA 5E3LA 4GCLA 2JA5J 2XPUA 1ZTRA 1ZR4A 4M3DA 1LFBA 3RZOJ 1FTZA 2L9RA 4QIWN 5FKOA 1ENHA 3GTOJ 1RESA 2Y30A 3BR2A 5K58A 2ZCMA 5J1RA 3CJDA 3O8GA 2F07A 2DMNA 3BR5A 4A93J 3HTJA 4C3IJ 3ZOBA 5EF6A 5M5WJ 1JTYA 2CUFA 4B3AA 3PO2J 5M5YJ 3M4OJ 2QWTA 1ETQA 2XB0X 3V6GA 1K83J 1RKTA 3PO3J 4DYCA 1ZQ3P 2QCOA 3JREA 3AQSA 3LNQA 1LFUP 4JL3A 2PBXA 4D5FA 3FKIJ 4CGRA 1WCMJ 4S0HB 3EGQA 2DA6A 4M3FA 4V2FA 2WV1A 4FE4A 4BY1J 2YS9A 3WHBA 2L7ZA 3BT9A 2ME0A 4NDLA 2K40A 2DG8A 5EZGA 3ZQHA 3CWRA 1YRNB 3A01B 5D1RA 4A3BJ 3AQTA 1TWAJ 3HTAA 3CRJA 1QVTA 2DA2A 2NVYJ 5EFYA 3OOUA 1B72B 3BTJA 3IH3A 3FISA 3P9TA 3QPLA 3VVXA 3VPRA 2XPVA 4A3CJ 5EYRA 5J3LA 1ZGWA 2ME6A 2VPRA 2ECCA 2DG7A 5D18A 1VI0A 1XG1A 3BR0A 2B63J 2L7MP 1TWCJ 2Y31A 3SJMA 1ZK8A 2ZOYA 3ZQFA 3RKQA 3HTHA 5FLVA 3ON4A 3JSJA 2ZCXA 4XRSG 3IH4A 1AKHB 4PXIA 1Q1VA 2MGQA 1Y1WJ 4GFBA 3S17J 3E7LA 3MN2A 5IPAA 2ID6A 1JJ6C 1JKOC 3GTPJ 5EGOA 4BKXA 1GDTA 2RASA 3BG3A 3GBGA 5EG0A 3DEWA 2W48A 4MK6A 3CQZJ 3JRIA 5IYBJ 4MXMA 2JWTA 5FHPA 2FX0A 3S5RA 1DU6A 1MH3A 1JKPC 1POGA 1WPKA 1JUMA 4CYCA 3JRAA 5M5XJ 4IHYA 4UUSB 2OERA 1TWFJ 1D5YA 5C4YA 3HOZJ 2LTPA 5E3MA 1E3OC 4D7MA 1HOMA 1F43A 2RHAA 4I76A 2LFBA 2M9HA 1UMQA 5BNGA 3KKCA 2UXHA 2JA7J 3BG5A 3RZDJ 2K9SA 1MSFC 2AHQA 2WAQN 5E3OA 3F0CA 5C4XJ 3GTMJ 2LKXA 4A3FJ 3HDDA 1FIPA 3ZQIA 2Y9ZA 2GM4A 3S1NJ 3TW7A 2R7ZJ 2WB1N 1WH7A 4M3EA 2HKUA 3VOXA 1NK3P 3LOCA 1ETKA 3O8HA 2JA8J 3FK7A 2LVSA 4JYKA 1W0TA 3JRDA 2R5YB 3M3YJ 2OI8A 4A3GJ 2K9NA 2L7FP 1Y1VJ 2YUSA 4HKUA 4J19A 2EZKA 4IEJA 3LWJA 2FD5A 4JNNA 1HDPA 2G0EA 1DU0A 1ETYA 5HBUA 1WGXA 2FJ1A 4RBOA 4I6ZA 3C07A 5D19A 4MLOA 2YVEA 1U8BA 3OIOA 1MBHA 4A3IJ 1IG7A 3FIWA 2EH3A 3BG9A 1SGMA 3S15J 2XGDA 1TC3C 4DZPA 3QBMA 1OCPA 5H9TA 2DA7A 3HIMA 4GFLA 3Q0VA 5GP9A 2V57A 1SFOJ 1YRNA 3A01A 5IYCJ 3EUPA 1B72A 3HOVJ 2I10A 1MBKA 5IYDJ 3FRQA 1ZKGA 3CDLA 4A3JJ 2XDNA 3VOKA 1SANA 3LSJA 1JKRC 2CUEA 4A3DJ 2NS7A 2GUHA 3HKZN 2PZ9A 3VIBA 3VW1A 2GFNA 4ABZA 3C2BA 4JP0A 1A6IA 1IRZA 2E19A 1CQTA 4FISA 3VW2A 4AC6A 1AKHA 2EZHA 4GFKA 2O9LA 5FKLA 1XS9A 2M34A 3SDGA 4XRSA 4Y7NJ 4AC0A 3SFIA 2WUIA 3WHCA 1JT0A 2GLOA 5GPCA 2VKVA 3K2AA 2XPWA 2ELKA 2R92J 3Q3SA 5EDNA 3HM5A 4ME9A 3QPSA 2LY9A 4HNVA 1X2MA 2R5ZB 1FJLA 5JLXA 2HYJA 1HF0A 4A3KJ 2R93J 1Z77A 3B81A 1MNMC 1FEXA 4C3HJ 4UUSA 3B6AA 2ZB9A 4L5EA 5K7ZA 1XC5A 1QVUA 3A02A 3BTLA 3BNIA 3CMYA 1AU7A 3V78A 1I3QJ 1MSEC 4NELA 2MSYA 2H8RA 1W0UA 3S1RJ 5DAJA 2NP3A 1U9NA 1RKWA 2COBA 1UG2A 2LK2A 4A3EJ 3E7QA 3VP5A 3BQZA 2Q24A 4X6AJ 2D5VA 2HXOA 3TW6A 1HCRA 3H3VK 2GBYA 3RH2A 5FKMA 4JX4A 2UXIA 3BTIA 1HLVA 2QIBA 2KT0A 2NS8A 2R5YA 3MVPA 5IOZA 5FLMJ 3HOXJ 1GV2A 1T56A 3GZIA 2JK3A 1IC8A 1FTTA 1ETOA 5HSZA 2FQ4A 2DA3A 4G12A 3JRGA 1QPIA 4JX6A 2HYTA 2M0CA 4A3MJ 2R0QC 2CJJA 1AHDP 1TWHJ 4IHVA 3LSPA 3BHQA 3NNRA 1IJWC 4YZEA 1IDYA 4MFDA 5IP6A 5F0HA 2NVXJ 4W97A 2NOGA 2UXUA 4DYQA 2ZCNA 4LOCA 2LR8A 4DZJA 1K61A 3ZQGA 3JRFA 3LHQA 3Q0WA 4XK4A 3D1NI 4GCKA 3IH2A 1ETVA 2G7SA 3HOUJ 2HQ5A 4X1EA 2DA5A 2M8GX 1OCTC 3ON2A 2JJ7A 1OFCX 1ETWA 1GVDA 2MG4A 2DTZA 1LE8B 1F36A 1JGGA 9ANTA 2CRGA 4NN1A 4DYRA 3A03A 2HXIA 4FTHA 3HOWJ 3LSRA 4B4CA 1MBFA 3VVZA 3HB9A 2ZOZA 3PASA 1NK2P 4L62A 2GENA 2UXPA 3NRGA 1JTXA 3OSFA 3UKGA 2Y0SN 2HOSA 2X48A 4FE7A 3S2HJ 1VNDA 3GTGJ 3GTLJ 4ACIA 4EEFG 4A3LJ 1HDDC 3O60A 2HOTA 1PUFB 3HGGA 2XGEA 5CXIA 4ICHA 3HTIA 2VKEA 4C2MJ 3S16J 2QKOA 4AYBN 1IGNA 5IOYA 4QSHA 3PM1A 3KZ9A 2RAEA 5F0FA 2NVQJ 1JJ8C 4KWAA 3TEDA 1U78A 2ECBA 5E3NA 3HEFA 1O4XA 2R5ZA 4BBRJ 3TP3A 3JR9A 5F1JA 1RPWA 1I50J 3FK6A 1T33A 2DA4A 2DJNA 4MO7A 4UUTA 3ZQLA 3BR6A 2E2JJ 3G1OA 4UDSA 1JKQC 1X2NA 4FCYA 3I4NJ 2EQRA 2E2IJ 3LSGA 5J1YA 5FGLA 4XICA 3OSGA 1R9TJ 4M6VA 2H1KA 1OJLA 5IP7J 5C3EJ 4Y52J 5IP9J 5EEAA 4AF5A 3COLA 2G7LA 2EBIA 4M3BA 5HODA 1B8IB 1VFCA 1ETXA 2XB5A 1GV5A 2O7OA 3DCFA 3K7AJ 4BY7J 3RQIA 3HE0A 5HAWA 2HDDA 2IEKA 3NPIA 3I4MJ 3BJBA 1BJZA 2X6OA 5DTDA 5AQCA 2QTQA 1Z0XA 5F08A 2O8KA 3CCYA 3BR3A 3GTQJ 4D7NA 1H89C 2LLKA 3F1BA 2MW8A 2DMUA 2DMPA 3ANPA 5J1UA 3S2DJ 5FKKA 2IU5A 1FIAA 3IUVA 5JLWA 2XSDC 5K7FA 5CW8A 3VUQA 3RD3A 1ORKA 3G1LA 3IV5A 2G7GA 1P7JA 5FKNA 3S1QJ 2NP5A 3NXCA 1IDZA 4AUXA 2JN6A 1UI6A 2OF7A 4IHXA 5K7HA 1MBGA 2DA1A 5M3FJ 2E2HJ 3B6CA 3KNWA 3MNLA 2TCTA 3JRBA 2O7TA 2FBQA 1H88C 4V2GA 2ID3A 4QTRA 1P7IA 2LP0A 5F04A 1LE8A 4GCTA 1BW6A 3S14J 2TRTA 2QF7A 2JA6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOA A;  1APL C;  2Y9Y A;  5DS9 A;  3S1M J;  2IBD A;  2CQX A;  2HI3 A;  3GTJ J;  4W1U A;  4XID A;  3BCG A;  3H0G J;  2NX4 A;  5FJ8 J;  3W6V A;  1BL0 A;  1JUP A;  4C3J J;  2JMW A;  2UXO A;  1BW5 A;  3GEU A;  3HGY A;  5GPA A;  2E1O A;  1PUF A;  5CXG A;  4IHW A;  3L1P A;  2YVH A;  1EF4 A;  3JRC A;  1JUS A;  4JX5 A;  5M3M J;  2PMZ N;  1IUF A;  1X58 A;  2OPT A;  5C44 J;  2XGC A;  3QKX A;  5FMP A;  2EZL A;  3TP0 A;  2L0K A;  1RET A;  2DMT A;  1ITY A;  2QOP A;  4BXX J;  3VVY A;  2XRL A;  3MKL A;  1ZR2 A;  3HOY J;  2DN0 A;  1BA5 A;  1RR7 A;  1H8A C;  3GTK J;  3KKD A;  1IV6 A;  1UI5 A;  2YU9 J;  2M2E A;  2K9Q A;  2AO9 A;  1A5J A;  1WH5 A;  2VUM J;  4XRM A;  5EZH A;  2Y2Z A;  2DMQ A;  3QQA A;  3ZQC A;  1MBE A;  2CQQ A;  2D6Y A;  1UHS A;  3JRH A;  3G7R A;  3VW0 A;  5EGO B;  2N8G A;  2VI6 A;  5F27 A;  4B1R A;  2LD5 A;  5EG0 B;  2WGB A;  4MIM A;  4MFE A;  3NI7 A;  3NAR A;  2EZI A;  4RDU A;  2IAI A;  4D5C A;  3BQY A;  1B8I A;  1MH4 A;  2CU7 A;  4CYC B;  3ANG A;  1JT6 A;  1G2H A;  1WI3 A;  3T6N A;  3G1M A;  1MBJ A;  3HBL A;  2X9D A;  1VF9 A;  1TWG J;  1GUU A;  2G3B A;  4DW6 A;  1GT0 C;  3NAU A;  3G56 A;  1NTC A;  2KDZ A;  2REK A;  1I6H J;  5F0C A;  4BBS J;  3BR1 A;  1U9O A;  3PPB A;  1S7E A;  3DPJ A;  1QRY A;  3Q0U A;  2W53 A;  4M3G A;  5C4J J;  4JKZ A;  4A69 C;  3BRU A;  2NVT J;  3LJL A;  2P81 A;  3BTC A;  5E3L A;  4GCL A;  2JA5 J;  2XPU A;  1ZTR A;  1ZR4 A;  4M3D A;  1LFB A;  3RZO J;  1FTZ A;  2L9R A;  4QIW N;  5FKO A;  1ENH A;  3GTO J;  1RES A;  2Y30 A;  3BR2 A;  5K58 A;  2ZCM A;  5J1R A;  3CJD A;  3O8G A;  2F07 A;  2DMN A;  3BR5 A;  4A93 J;  3HTJ A;  4C3I J;  3ZOB A;  5EF6 A;  5M5W J;  1JTY A;  2CUF A;  4B3A A;  3PO2 J;  5M5Y J;  3M4O J;  2QWT A;  1ETQ A;  2XB0 X;  3V6G A;  1K83 J;  1RKT A;  3PO3 J;  4DYC A;  1ZQ3 P;  2QCO A;  3JRE A;  3AQS A;  3LNQ A;  1LFU P;  4JL3 A;  2PBX A;  4D5F A;  3FKI J;  4CGR A;  1WCM J;  4S0H B;  3EGQ A;  2DA6 A;  4M3F A;  4V2F A;  2WV1 A;  4FE4 A;  4BY1 J;  2YS9 A;  3WHB A;  2L7Z A;  3BT9 A;  2ME0 A;  4NDL A;  2K40 A;  2DG8 A;  5EZG A;  3ZQH A;  3CWR A;  1YRN B;  3A01 B;  5D1R A;  4A3B J;  3AQT A;  1TWA J;  3HTA A;  3CRJ A;  1QVT A;  2DA2 A;  2NVY J;  5EFY A;  3OOU A;  1B72 B;  3BTJ A;  3IH3 A;  3FIS A;  3P9T A;  3QPL A;  3VVX A;  3VPR A;  2XPV A;  4A3C J;  5EYR A;  5J3L A;  1ZGW A;  2ME6 A;  2VPR A;  2ECC A;  2DG7 A;  5D18 A;  1VI0 A;  1XG1 A;  3BR0 A;  2B63 J;  2L7M P;  1TWC J;  2Y31 A;  3SJM A;  1ZK8 A;  2ZOY A;  3ZQF A;  3RKQ A;  3HTH A;  5FLV A;  3ON4 A;  3JSJ A;  2ZCX A;  4XRS G;  3IH4 A;  1AKH B;  4PXI A;  1Q1V A;  2MGQ A;  1Y1W J;  4GFB A;  3S17 J;  3E7L A;  3MN2 A;  5IPA A;  2ID6 A;  1JJ6 C;  1JKO C;  3GTP J;  5EGO A;  4BKX A;  1GDT A;  2RAS A;  3BG3 A;  3GBG A;  5EG0 A;  3DEW A;  2W48 A;  4MK6 A;  3CQZ J;  3JRI A;  5IYB J;  4MXM A;  2JWT A;  5FHP A;  2FX0 A;  3S5R A;  1DU6 A;  1MH3 A;  1JKP C;  1POG A;  1WPK A;  1JUM A;  4CYC A;  3JRA A;  5M5X J;  4IHY A;  4UUS B;  2OER A;  1TWF J;  1D5Y A;  5C4Y A;  3HOZ J;  2LTP A;  5E3M A;  1E3O C;  4D7M A;  1HOM A;  1F43 A;  2RHA A;  4I76 A;  2LFB A;  2M9H A;  1UMQ A;  5BNG A;  3KKC A;  2UXH A;  2JA7 J;  3BG5 A;  3RZD J;  2K9S A;  1MSF C;  2AHQ A;  2WAQ N;  5E3O A;  3F0C A;  5C4X J;  3GTM J;  2LKX A;  4A3F J;  3HDD A;  1FIP A;  3ZQI A;  2Y9Z A;  2GM4 A;  3S1N J;  3TW7 A;  2R7Z J;  2WB1 N;  1WH7 A;  4M3E A;  2HKU A;  3VOX A;  1NK3 P;  3LOC A;  1ETK A;  3O8H A;  2JA8 J;  3FK7 A;  2LVS A;  4JYK A;  1W0T A;  3JRD A;  2R5Y B;  3M3Y J;  2OI8 A;  4A3G J;  2K9N A;  2L7F P;  1Y1V J;  2YUS A;  4HKU A;  4J19 A;  2EZK A;  4IEJ A;  3LWJ A;  2FD5 A;  4JNN A;  1HDP A;  2G0E A;  1DU0 A;  1ETY A;  5HBU A;  1WGX A;  2FJ1 A;  4RBO A;  4I6Z A;  3C07 A;  5D19 A;  4MLO A;  2YVE A;  1U8B A;  3OIO A;  1MBH A;  4A3I J;  1IG7 A;  3FIW A;  2EH3 A;  3BG9 A;  1SGM A;  3S15 J;  2XGD A;  1TC3 C;  4DZP A;  3QBM A;  1OCP A;  5H9T A;  2DA7 A;  3HIM A;  4GFL A;  3Q0V A;  5GP9 A;  2V57 A;  1SFO J;  1YRN A;  3A01 A;  5IYC J;  3EUP A;  1B72 A;  3HOV J;  2I10 A;  1MBK A;  5IYD J;  3FRQ A;  1ZKG A;  3CDL A;  4A3J J;  2XDN A;  3VOK A;  1SAN A;  3LSJ A;  1JKR C;  2CUE A;  4A3D J;  2NS7 A;  2GUH A;  3HKZ N;  2PZ9 A;  3VIB A;  3VW1 A;  2GFN A;  4ABZ A;  3C2B A;  4JP0 A;  1A6I A;  1IRZ A;  2E19 A;  1CQT A;  4FIS A;  3VW2 A;  4AC6 A;  1AKH A;  2EZH A;  4GFK A;  2O9L A;  5FKL A;  1XS9 A;  2M34 A;  3SDG A;  4XRS A;  4Y7N J;  4AC0 A;  3SFI A;  2WUI A;  3WHC A;  1JT0 A;  2GLO A;  5GPC A;  2VKV A;  3K2A A;  2XPW A;  2ELK A;  2R92 J;  3Q3S A;  5EDN A;  3HM5 A;  4ME9 A;  3QPS A;  2LY9 A;  4HNV A;  1X2M A;  2R5Z B;  1FJL A;  5JLX A;  2HYJ A;  1HF0 A;  4A3K J;  2R93 J;  1Z77 A;  3B81 A;  1MNM C;  1FEX A;  4C3H J;  4UUS A;  3B6A A;  2ZB9 A;  4L5E A;  5K7Z A;  1XC5 A;  1QVU A;  3A02 A;  3BTL A;  3BNI A;  3CMY A;  1AU7 A;  3V78 A;  1I3Q J;  1MSE C;  4NEL A;  2MSY A;  2H8R A;  1W0U A;  3S1R J;  5DAJ A;  2NP3 A;  1U9N A;  1RKW A;  2COB A;  1UG2 A;  2LK2 A;  4A3E J;  3E7Q A;  3VP5 A;  3BQZ A;  2Q24 A;  4X6A J;  2D5V A;  2HXO A;  3TW6 A;  1HCR A;  3H3V K;  2GBY A;  3RH2 A;  5FKM A;  4JX4 A;  2UXI A;  3BTI A;  1HLV A;  2QIB A;  2KT0 A;  2NS8 A;  2R5Y A;  3MVP A;  5IOZ A;  5FLM J;  3HOX J;  1GV2 A;  1T56 A;  3GZI A;  2JK3 A;  1IC8 A;  1FTT A;  1ETO A;  5HSZ A;  2FQ4 A;  2DA3 A;  4G12 A;  3JRG A;  1QPI A;  4JX6 A;  2HYT A;  2M0C A;  4A3M J;  2R0Q C;  2CJJ A;  1AHD P;  1TWH J;  4IHV A;  3LSP A;  3BHQ A;  3NNR A;  1IJW C;  4YZE A;  1IDY A;  4MFD A;  5IP6 A;  5F0H A;  2NVX J;  4W97 A;  2NOG A;  2UXU A;  4DYQ A;  2ZCN A;  4LOC A;  2LR8 A;  4DZJ A;  1K61 A;  3ZQG A;  3JRF A;  3LHQ A;  3Q0W A;  4XK4 A;  3D1N I;  4GCK A;  3IH2 A;  1ETV A;  2G7S A;  3HOU J;  2HQ5 A;  4X1E A;  2DA5 A;  2M8G X;  1OCT C;  3ON2 A;  2JJ7 A;  1OFC X;  1ETW A;  1GVD A;  2MG4 A;  2DTZ A;  1LE8 B;  1F36 A;  1JGG A;  9ANT A;  2CRG A;  4NN1 A;  4DYR A;  3A03 A;  2HXI A;  4FTH A;  3HOW J;  3LSR A;  4B4C A;  1MBF A;  3VVZ A;  3HB9 A;  2ZOZ A;  3PAS A;  1NK2 P;  4L62 A;  2GEN A;  2UXP A;  3NRG A;  1JTX A;  3OSF A;  3UKG A;  2Y0S N;  2HOS A;  2X48 A;  4FE7 A;  3S2H J;  1VND A;  3GTG J;  3GTL J;  4ACI A;  4EEF G;  4A3L J;  1HDD C;  3O60 A;  2HOT A;  1PUF B;  3HGG A;  2XGE A;  5CXI A;  4ICH A;  3HTI A;  2VKE A;  4C2M J;  3S16 J;  2QKO A;  4AYB N;  1IGN A;  5IOY A;  4QSH A;  3PM1 A;  3KZ9 A;  2RAE A;  5F0F A;  2NVQ J;  1JJ8 C;  4KWA A;  3TED A;  1U78 A;  2ECB A;  5E3N A;  3HEF A;  1O4X A;  2R5Z A;  4BBR J;  3TP3 A;  3JR9 A;  5F1J A;  1RPW A;  1I50 J;  3FK6 A;  1T33 A;  2DA4 A;  2DJN A;  4MO7 A;  4UUT A;  3ZQL A;  3BR6 A;  2E2J J;  3G1O A;  4UDS A;  1JKQ C;  1X2N A;  4FCY A;  3I4N J;  2EQR A;  2E2I J;  3LSG A;  5J1Y A;  5FGL A;  4XIC A;  3OSG A;  1R9T J;  4M6V A;  2H1K A;  1OJL A;  5IP7 J;  5C3E J;  4Y52 J;  5IP9 J;  5EEA A;  4AF5 A;  3COL A;  2G7L A;  2EBI A;  4M3B A;  5HOD A;  1B8I B;  1VFC A;  1ETX A;  2XB5 A;  1GV5 A;  2O7O A;  3DCF A;  3K7A J;  4BY7 J;  3RQI A;  3HE0 A;  5HAW A;  2HDD A;  2IEK A;  3NPI A;  3I4M J;  3BJB A;  1BJZ A;  2X6O A;  5DTD A;  5AQC A;  2QTQ A;  1Z0X A;  5F08 A;  2O8K A;  3CCY A;  3BR3 A;  3GTQ J;  4D7N A;  1H89 C;  2LLK A;  3F1B A;  2MW8 A;  2DMU A;  2DMP A;  3ANP A;  5J1U A;  3S2D J;  5FKK A;  2IU5 A;  1FIA A;  3IUV A;  5JLW A;  2XSD C;  5K7F A;  5CW8 A;  3VUQ A;  3RD3 A;  1ORK A;  3G1L A;  3IV5 A;  2G7G A;  1P7J A;  5FKN A;  3S1Q J;  2NP5 A;  3NXC A;  1IDZ A;  4AUX A;  2JN6 A;  1UI6 A;  2OF7 A;  4IHX A;  5K7H A;  1MBG A;  2DA1 A;  5M3F J;  2E2H J;  3B6C A;  3KNW A;  3MNL A;  2TCT A;  3JRB A;  2O7T A;  2FBQ A;  1H88 C;  4V2G A;  2ID3 A;  4QTR A;  1P7I A;  2LP0 A;  5F04 A;  1LE8 A;  4GCT A;  1BW6 A;  3S14 J;  2TRT A;  2QF7 A;  2JA6 J; 
#chains in the Genus database with same CATH topology
 2HOA A;  2WY7 Q;  1FMW A;  3H9Q A;  4W1U A;  4XID A;  3L2R A;  1BM9 A;  5FJ8 J;  1MMG A;  3MAJ A;  2FOW A;  1BL0 A;  2JMW A;  2XHK A;  4LG0 B;  3BOQ A;  2ZME C;  1PUF A;  1R22 A;  2YVH A;  2OC6 A;  4RAF A;  4L5J A;  3BZK A;  5M3M J;  1IUF A;  2OPT A;  5C44 J;  3BPX A;  4Y17 A;  3TP0 A;  3VOE A;  3W2W A;  2DMT A;  1ITY A;  1R4M B;  2PJP A;  5LFA A;  3PUF A;  3ECH A;  1JE8 A;  1BA5 A;  4GRI A;  3GTK J;  4P1W A;  3LA3 A;  3KKD A;  1IV6 A;  1UI5 A;  2W57 A;  1GVJ A;  2DDB A;  2XIG A;  3FBN B;  1YHQ I;  3E5Q A;  2VUM J;  1I1S A;  3KZY A;  3ROU A;  1UHS A;  2L3D A;  3JRH A;  3VW0 A;  2P5L C;  2Y48 A;  5EGO B;  1P9Q C;  2LD5 A;  3K8P C;  4MFE A;  1SMY F;  4CZC A;  4QLC U;  1STZ A;  3L09 A;  4XSZ F;  4D5C A;  4XLP F;  4A2U A;  2WC2 A;  3BQY A;  1VQM I;  3U9G A;  4BHP A;  3WTW C;  2V4J C;  3V8J A;  4Q4Z F;  1DP3 A;  4ANJ A;  3R0A A;  1TBX A;  5LD2 C;  1MBJ A;  2XKP A;  5J6X A;  3PNV A;  2G3B A;  1WJA A;  4F7Z A;  5LEJ A;  2OU2 A;  4DW6 A;  2HQR A;  2X4H A;  3BC8 A;  3NAU A;  1NTC A;  3SHF A;  4BJ5 C;  5F0C A;  2MYS A;  3ZMV A;  4AVZ A;  3PPB A;  1S7E A;  3EYI A;  1FLI A;  3DPJ A;  2DK8 A;  3CCE I;  3L2V A;  2CW7 A;  1H0M A;  4J00 A;  3QOD A;  4IQJ A;  2EFO A;  1LFB A;  1Y8R B;  4C2U A;  1REP C;  5D6E A;  1QQI A;  2QSF X;  5K58 A;  1U6G A;  2ZME A;  3IAM 2;  1RZ4 A;  3O8G A;  3FXR A;  5K5O A;  2LOO A;  2DMN A;  1OQY A;  2DO7 A;  1T8I A;  3OYN A;  3HTJ A;  4C3I J;  5EF6 A;  5H6R A;  2CUF A;  3TBI A;  4B3A A;  5EEH A;  2HPM A;  5DD8 A;  2QWT A;  2Q2E A;  1MMD A;  3BRO A;  3VWB A;  3GZN B;  2K86 A;  1RKT A;  2E5Z A;  2ZBK A;  4XMY A;  2FU4 A;  5FFZ A;  4XQF A;  1X1B A;  1SFX A;  1Z9C A;  2W4S A;  4V2F A;  4FE4 A;  2W7N A;  2BY1 A;  1WI9 A;  2F4O B;  4YEJ A;  3WHB A;  1ERD A;  4I01 A;  1YG2 A;  1RR8 C;  5HS7 A;  2EV0 A;  2ZJP F;  1FWZ A;  3TOA A;  3KP7 A;  3A01 B;  5D1R A;  2OQR A;  2OZU A;  1TWA J;  4EJT A;  3M1C A;  1RC9 A;  4A0X A;  5E1W A;  2R7X A;  3FIS A;  3QOE A;  5GAH J;  5HOO A;  2XPV A;  1R5I D;  5EYR A;  5J3L A;  1ZGW A;  2ZJQ F;  2VPR A;  6PAX A;  4RB2 C;  2ECC A;  2RV8 A;  3V7C A;  1VI0 A;  1XG1 A;  1R1V A;  2L7M P;  1ZK8 A;  2ZOY A;  2D1V A;  2RVC A;  4M74 A;  2DT5 A;  2STT A;  2FXA A;  4XKB A;  5HNH A;  1AKH B;  1Q1V A;  4WXD A;  2MGQ A;  3WTY C;  3LAP A;  2KZV A;  3WOD F;  4KMU X;  1JKO C;  4DQ2 A;  4BHB A;  1G8X A;  3LFK A;  3IUO A;  5L3C A;  2G7U A;  1XGN A;  3GZ5 A;  1TTY A;  4P5O A;  3DBL B;  3KP3 A;  4MK6 A;  5HS8 A;  3CQZ J;  4N9H A;  2VC1 A;  1FYK A;  2FX0 A;  3VSL A;  3S5R A;  5ICF A;  2XAS A;  1P2F A;  1I39 A;  4ZH4 F;  2YX4 A;  1JKP C;  3AL0 C;  5M5X J;  2QZ8 A;  5D5X B;  1RUN A;  4IHY A;  4UUS B;  2M30 A;  5C4Y A;  2E60 A;  4GXO A;  1FBS A;  2L9V A;  3OIQ A;  4CZZ A;  1S7O A;  2W82 A;  2M9H A;  5DCM B;  2H09 A;  4L0Y B;  2J5P A;  1HKQ A;  3BG5 A;  3KZZ A;  2K9S A;  3LWF A;  3ZMU A;  3CUQ C;  3F0C A;  4NQW B;  3BCB A;  1OMI A;  4HV5 A;  3L2U A;  3HPH A;  1G3Y A;  3Q9V A;  3HDD A;  2KFD A;  1FIP A;  1YW7 A;  4HF0 A;  1SD4 A;  3TW7 A;  2HGC A;  3PJR A;  2HKU A;  2LC2 A;  3LOC A;  2JA8 J;  4RA2 A;  4KIB A;  3DV8 A;  2LVS A;  3J80 Z;  2VBY A;  4Z2Y A;  2R5Y B;  2DW4 A;  3SZP A;  1K79 A;  2K9N A;  1F1Z A;  2YUS A;  2H1L A;  3KZI C;  1D0Z A;  2EZK A;  3LWJ A;  2KP6 A;  4BQQ A;  2L9N A;  3GLX A;  1ETY A;  1WGX A;  1IUY A;  2IW5 A;  3TO6 A;  1VQO I;  2ETH A;  3RQ4 A;  4ZYA A;  3C07 A;  1W36 C;  4L9N A;  4CYD A;  3OIO A;  4A3I J;  3IWZ A;  1IG7 A;  2DLL A;  3BG9 A;  1SGM A;  2O5R A;  5CVV A;  2XGD A;  1BR2 A;  5L3F A;  1ZYR F;  2ISZ A;  1FYM A;  2EIM H;  2X1D A;  1XDU A;  1ZEL A;  5H9T A;  3GO5 A;  2O61 A;  3HIM A;  4KDP A;  1TQP A;  3Q0V A;  1MD0 A;  3E6B A;  3PNY A;  3F6V A;  1YRN A;  3L7W A;  3CDH A;  1V54 H;  3EUP A;  2P5V A;  4CUG A;  3J81 K;  1SFK A;  2XRO A;  4HBL A;  2Y69 H;  5ILV A;  4HX4 A;  2B7E A;  3VOK A;  2M87 A;  1D1B A;  2GUH A;  3VIB A;  2PZ9 A;  4PCQ A;  4JP0 A;  4CCJ A;  3Q5F A;  1A6I A;  3K1M A;  2CFO A;  4E7Z A;  2V6E A;  3CUQ A;  3DLA A;  4LB5 A;  4MHG A;  1T95 A;  2HVQ A;  2MD5 A;  4QPO A;  2DXI A;  4XOP A;  2DCE A;  1OR7 A;  3SDB A;  3HHG A;  2RKH A;  4BQO A;  4F3Q A;  3AG3 H;  1O7L A;  4AC0 A;  1FBQ A;  1X1P A;  3LSM A;  2WUI A;  4XR6 A;  1YX3 A;  2FNA A;  2VKV A;  3K2A A;  2XPW A;  5HS9 A;  3TO9 A;  2OTL I;  1CGP A;  3AAF A;  1FJL A;  2X6Y A;  4U0Y A;  1ODD A;  2R93 J;  3CLQ A;  1FEX A;  1E17 A;  1TW2 A;  2ZB9 A;  1MJA A;  4AD9 A;  2W25 A;  4L5E A;  5D5W B;  1IRX A;  3F9K A;  3BTL A;  1W5T A;  4HX8 A;  3BNI A;  2BV6 A;  3I59 A;  3K4J A;  1YJN I;  2OUM A;  5E1Z B;  2WAF A;  2MSY A;  2NP3 A;  3OYM A;  3ABU A;  3QAH A;  4A3E J;  2QBY A;  3VP5 A;  3BQZ A;  2VQG A;  3ZMS A;  5DCF A;  2DPU A;  4OD4 A;  2KPM A;  3H3V K;  5FKM A;  1BN5 A;  2ELJ A;  3ZQQ A;  3SYT A;  1K6O A;  4L0Z B;  4DJA A;  4FX0 A;  1KQ0 A;  2P4W A;  4UB8 C;  3I5U A;  3HOX J;  3FMS A;  1GXQ A;  1GV2 A;  1T56 A;  3GZI A;  1J7K A;  2JK3 A;  3J80 K;  4RS8 A;  2PI0 A;  1T6S A;  2Z5U A;  4DOZ A;  4XRF A;  1YIT I;  5B1B H;  1W5S A;  3JRG A;  4IJA A;  2WV0 A;  3OYJ A;  4JX6 A;  2A6H F;  4U87 A;  2BY3 A;  1XGS A;  3MKZ A;  2CJJ A;  2ZC2 A;  3FM3 A;  2R0Q C;  3NNR A;  1R7J A;  4KMF A;  3EET A;  5D8L B;  4I0A A;  1IDY A;  1MDM B;  2HFH A;  2YR2 A;  5H20 A;  2NOG A;  3VYT B;  4DYQ A;  4HNU A;  3K4M A;  3K4K A;  1SC7 A;  4LOC A;  1HW5 A;  2LR8 A;  1K61 A;  4AVP A;  4IKF A;  1OCZ H;  2BHZ A;  1YFH A;  3HTS B;  4BH9 A;  3FXL A;  2CS3 A;  4X1E A;  2HPI A;  1BI3 A;  2MG4 A;  1F36 A;  2NS0 A;  3HRS A;  3G71 I;  3OY9 A;  2CRG A;  2R4G A;  2HXI A;  4FTH A;  3QYB A;  3LSR A;  4KIG A;  1MBF A;  3CCS I;  4IVN A;  3VVZ A;  1O3Q A;  2H6B A;  2F48 A;  2HU9 A;  4HDV A;  2E35 A;  1JTX A;  4BL0 B;  4G6T B;  2KHM A;  1LUJ B;  2X48 A;  1XCB A;  3EQL F;  4WXC A;  4ACI A;  3O60 A;  1PUF B;  1L0O C;  1OIS A;  3FZV A;  3HGG A;  2GXG A;  3M9A A;  3CP2 A;  3HTI A;  4AYB A;  1WVR A;  3HC7 A;  4EM1 A;  4RM2 A;  1IGN A;  1QHG A;  5IOY A;  3BP8 A;  4QSH A;  4EJU A;  3PM1 A;  2HEO A;  3ZN1 A;  2NYX A;  2XUB A;  3ASO H;  3H1C A;  3TDU C;  2QLZ A;  2WWY A;  3H3Z A;  1UFM A;  4U9L A;  2BBY A;  2RN7 A;  2KRC A;  5TGT A;  1I3A A;  1ZG1 A;  3QWL A;  2HS5 A;  3DKY A;  3GEZ A;  3PL8 A;  1U3E M;  3CLO A;  4G94 A;  1YTY A;  2DA4 A;  3AFH A;  4G7Z F;  3A4C A;  4UUT A;  3GW2 A;  2DAO A;  3BR6 A;  2MD0 A;  3DBR B;  3VOD A;  5HNF A;  4BHC A;  1CF7 A;  5DUI A;  2VXD A;  4I09 A;  2H1K A;  4HZF A;  5IP7 J;  3DTI A;  3GLL A;  3R4K A;  5EEA A;  1ACI A;  1T0F C;  5J47 A;  3HRM A;  4L9J A;  2EBI A;  4YEL A;  4BDY A;  2EK5 A;  4HEA 2;  2F2E A;  2DT6 A;  3BCA A;  3KCC A;  2F4M B;  1VFC A;  1ETX A;  1V5G A;  2X1C A;  3DP7 A;  5FLX Z;  3F23 A;  2E36 A;  2X6O A;  5AIP A;  2F4I A;  2XF6 A;  2PMU A;  4F91 B;  2QTQ A;  2IS6 A;  3H0D A;  1B4A A;  4DIQ A;  2O8K A;  4O5V A;  2WAE A;  3BWG A;  4I99 C;  1FBU A;  2DMU A;  4U0V A;  3EUH A;  5BOX A;  1LDJ A;  1MNE A;  2EA4 A;  3S2D J;  1R36 A;  1Y56 A;  1UAA A;  3C7J A;  5JLW A;  2IGK A;  4IQ4 A;  4B8X A;  5CW8 A;  2IRF G;  3OWT A;  3IV5 A;  2ZME B;  1P7J A;  3H3U A;  1KZH A;  5J4V A;  4O6J A;  3OYB A;  3S1Q J;  1IV8 A;  4IHX A;  1TZL A;  2V9K A;  3KNW A;  3B6C A;  1WJD A;  2W1O A;  2FBQ A;  2Q2E B;  4V2G A;  4KT5 C;  3KX2 A;  4GGG A;  4QTR A;  2PQ8 A;  1P7I A;  3GZ6 A;  5F04 A;  1SD6 A;  1BW6 A;  5E8I A;  3OS1 A;  2P6T A;  3MQ0 A;  3CD6 I;  1OYI A;  2DTR A;  4DNC A;  3G73 A;  3WGI A;  2JA6 J;  1BI1 A;  2Y9Y A;  3JSP A;  1GLN A;  3ZMT A;  3E6C C;  3RSN A;  2CQX A;  3W2A A;  3S3N A;  2E1M C;  2DOD A;  2WTE A;  4RM3 A;  5CVI A;  1JUP A;  4C3J J;  2UXO A;  1BW5 A;  3GEU A;  1X4P A;  3GFM A;  5GPA A;  3H36 A;  1R5G A;  4WXH A;  4IHW A;  1E3H A;  2PMZ A;  1EF4 A;  1JUS A;  4JX5 A;  3K0L A;  3CF2 A;  5FD6 A;  3GFI A;  4HPQ A;  2X6X A;  5J8F A;  2Y75 A;  2KL4 A;  4ENN A;  2KIM A;  2DFI A;  3MKL A;  4J01 A;  1ZR2 A;  5E17 F;  3E0J B;  4A0Z A;  2IP2 A;  2YU9 J;  2M2E A;  4HF1 A;  1X1D A;  3AKZ A;  2K9Q A;  4E70 A;  3HZJ A;  3G3Z A;  1ZAO A;  1G3W A;  4WIB A;  4JOM A;  1DQU A;  1MBE A;  4L9V A;  1YYV A;  2D6Y A;  3J7Z I;  3ERE D;  1VQL I;  2E5N A;  2N8G A;  2VI6 A;  4LLN A;  4ZTJ A;  2MC4 A;  3DFG A;  4XN3 A;  1VQ4 I;  3NI7 A;  1SFE A;  2EZI A;  1U5T C;  2RNG A;  2IAI A;  1MND A;  1IN4 A;  1B8I A;  1MH4 A;  3ANG A;  5L3G A;  1JT6 A;  1DGR M;  4CA0 A;  1K4S A;  4Q48 A;  3HBL A;  2Q1Z B;  1XGM A;  1D3Y A;  1R1U A;  1Z21 A;  2W85 A;  3H35 A;  3MMY B;  1PP8 F;  3HSF A;  2Z33 A;  2HOE A;  2XAQ A;  2LY1 A;  1GT0 C;  3PUB A;  5IT3 A;  1HBX G;  2B1E A;  5FLX K;  4TV7 A;  2REK A;  4E6K G;  5DDG A;  3RKW A;  2ZSH B;  2W53 A;  5C4J J;  4AM3 A;  4RGX A;  4K2E A;  3QP6 A;  2P81 A;  2JA5 J;  1ZTR A;  3QOP A;  4M3D A;  3OYF A;  5CLS A;  2QYO A;  5LRS A;  3RKX A;  3GTO J;  1RES A;  2Y30 A;  2EIK H;  3BR2 A;  3TO7 A;  2F5E A;  4BXU A;  1QU3 A;  4OIN F;  2F07 A;  4A93 J;  4OIQ F;  1YO5 C;  2EV5 A;  3VFZ A;  1X1C A;  4OOI A;  4OU0 A;  2I5U A;  3KP4 A;  2DOA A;  4G7H F;  2MH9 A;  2QWW A;  1UST A;  2LKP A;  1WSU A;  1JHF A;  2QQ9 A;  1K83 J;  1N77 A;  2FBK A;  4HOB A;  1R4N B;  3ZRG A;  3JRE A;  3AQS A;  1LFU P;  4JL3 A;  2D45 A;  3WTT C;  3GME A;  1W5C C;  4S0H B;  4I0B A;  2DA6 A;  5L3B A;  1HA8 A;  2WV1 A;  4H4K C;  4BY1 J;  2YS9 A;  1LPQ A;  2L7Z A;  1QZY A;  4NDL A;  2JRM A;  4C30 A;  3CWR A;  2K3P A;  1YRN B;  3EPZ A;  4A3B J;  5EFY A;  2DA2 A;  4IRG A;  4YFK F;  3MKW B;  4IOA F;  1U5T A;  3P9T A;  4E7K A;  3QPL A;  3VVX A;  2L02 A;  2IVM A;  3AL0 B;  1VQ6 I;  4A3C J;  3L2Q A;  2Q8K A;  3A0H C;  3TQN A;  5D18 A;  4HDU A;  3RKQ A;  4EVI A;  5FLV A;  3JSJ A;  4IPA A;  3CUQ B;  4ZZL A;  4XRS G;  3IH4 A;  3V7S A;  4PXI A;  3TKY A;  3EYY A;  1Y1W J;  4HQE A;  3CCR I;  2A6E F;  2FE3 A;  2ID6 A;  1JJ6 C;  3P9K A;  3NEU A;  4PFO A;  2DOE A;  2KIF A;  4BKX A;  4F55 A;  1NH3 A;  4EV0 A;  2M7B A;  3GBG A;  4HG2 A;  4NBQ A;  1H9G A;  2LDU A;  4AIK A;  2QSG X;  3RTR A;  4MXM A;  4HLX A;  2RC4 A;  3DPT A;  1K7A A;  3WTZ A;  1DU6 A;  4B3X A;  3JAM Z;  1DP7 P;  1JUM A;  3FM5 A;  4CXF A;  4CYC A;  1VQ8 I;  2VJI A;  2V26 A;  2GIV A;  1XSX A;  3D5L A;  4KFC A;  4M6X A;  1V55 H;  1E3O C;  1HOM A;  3E5U A;  2RHA A;  4LIT A;  2QQA A;  3I59 B;  1WQ2 A;  2VL8 A;  3RZD J;  2IA1 A;  2MAB A;  2WAQ A;  1MSF C;  2VE9 A;  2AHQ A;  5E3O A;  2NXN B;  3OYH A;  4B44 A;  4ESJ A;  3E5X A;  2QBY B;  5C4X J;  2CUJ A;  2K4B A;  3VYR B;  4A3F J;  2Z2S B;  3ZQI A;  2CFX A;  1KON A;  2WB1 A;  4AU7 A;  3I64 A;  3S1N J;  1LEB A;  2IT0 A;  1WH7 A;  4WF2 A;  3IRQ A;  1P92 A;  2B0L A;  1VQ5 I;  3ML6 A;  1YIO A;  3CJN A;  1W0T A;  3JRD A;  4EGZ A;  2ACJ A;  3FKJ A;  3BY6 A;  2FRH A;  3T5X A;  2LRE A;  2XC7 A;  3GX4 X;  1XTA A;  4PDK A;  3PFY A;  3FXM A;  4HKU A;  3KEO A;  1Z1D A;  1I6X A;  2FD5 A;  5CVU A;  2EPF A;  4I02 A;  2BW3 A;  3CME I;  2OTJ I;  5HBU A;  3NWS A;  1NG7 A;  5LHI A;  3CUO A;  2MH2 A;  4I6Z A;  3M1E A;  5D4R A;  3M07 A;  2JUG A;  1VQP I;  1YS7 A;  3K70 C;  4MLO A;  2YVE A;  4EM0 B;  3WTX C;  2R7W A;  5EEG A;  1T2K A;  2QEX I;  3UR3 C;  2ICW G;  1SAX A;  1UEL B;  4GFL A;  1LFP A;  4IZZ A;  2HNH A;  3ZPL A;  2JQ7 A;  4B48 A;  1B72 A;  2HVS A;  2XDV A;  3FWE A;  3HOV J;  1MBK A;  5ICC A;  3WTS C;  3MFK A;  4CHU A;  3COA C;  1X4O A;  1W36 D;  1NG6 A;  1SAN A;  2A6T A;  4Y15 A;  3H5R A;  2CUE A;  1WHU A;  3JSO A;  2HR3 A;  4IRI A;  1ZGJ A;  2E19 A;  1S7A A;  4I2O A;  3D5R C;  4AC6 A;  3PQJ A;  3F8N A;  2MC3 A;  2EZH A;  3KE2 A;  1OCO H;  2O9L A;  2H27 A;  3ZMZ A;  1XS9 A;  2VKD A;  1B6A A;  2E1N A;  2M34 A;  3V7R A;  4V19 K;  4YIF A;  1S5L C;  2GZW A;  3WHC A;  3TOB A;  2VOD A;  4CCL A;  3HOT A;  5GPC A;  2IS4 A;  4FAS D;  4L18 B;  3RPQ A;  3Q3S A;  4A6D A;  1YIJ I;  4ME9 A;  2QGU A;  4ASN A;  2VPL A;  1X2M A;  4FHT A;  5FGM A;  1ZLK A;  1QZZ A;  1R00 A;  5JLX A;  3HL2 A;  1V5F A;  3M8J A;  1HF0 A;  2FA5 A;  1WJB A;  4FX4 A;  3QP5 A;  3B81 A;  4GYI A;  4S04 A;  3SQN A;  4C3H J;  4YII A;  5FB2 A;  1UHM A;  1XC5 A;  2JT1 A;  4EM2 A;  1EH6 A;  2LMD A;  3V78 A;  1HST A;  1CF7 B;  3DWL E;  2A5W A;  2JPC A;  4UVA A;  2EIN H;  4NEL A;  4AF5 A;  1U2W A;  1BR4 A;  3EUK L;  2H8R A;  5D6F A;  4MNU A;  2G9W A;  1U9N A;  2COB A;  3I54 A;  3E7Q A;  4RAZ A;  3KPH A;  2Q24 A;  4UV8 A;  3TW6 A;  1HCR A;  3FXQ A;  2GBY A;  3RH2 A;  1C0W A;  3ABT A;  2P7V B;  3ONQ A;  2CH0 A;  2UXI A;  2AXL A;  2VJJ A;  5AON A;  2W24 A;  2M7A A;  3BG6 A;  3TMO A;  3MVP A;  3SZT A;  1XMK A;  2OV7 A;  5IOZ A;  5FLM J;  4WK8 F;  3E1S A;  1B9M A;  4LLG F;  2M4K A;  3DQV C;  5ICE A;  3OYD A;  5FRN A;  3OS2 A;  3OOP A;  3R6S A;  3F21 A;  2V79 A;  5LLQ A;  1Z7U A;  3CC4 I;  5J4Y A;  2A3S A;  5BMZ A;  2V1U A;  1AHD P;  3DU5 A;  1SVM A;  4X0G A;  3LSP A;  1FSH A;  3BHQ A;  1YOV B;  1LJ9 A;  2P6S A;  4YZE A;  4G6Q A;  1SAU A;  4W97 A;  3DBH B;  2UXU A;  2ZCN A;  5JFR A;  1JXS A;  1QHH D;  1ULY A;  4RMN A;  3Q0W A;  5DV5 A;  4XBF A;  4BAC A;  4GCK A;  2J5O A;  5KNL A;  3IC7 A;  2HQ5 A;  3I56 I;  3REO A;  2M8G X;  1KA8 A;  2A61 A;  2FBH A;  3F8F A;  4PK4 A;  3WTV C;  1OFC X;  4PJL A;  3V4G A;  1UHW A;  1T39 A;  9ANT A;  2O3F A;  5CKT A;  4DYR A;  3A03 A;  4I7H A;  2ZJ2 A;  4IL6 C;  3GUD A;  2AS5 F;  3HB9 A;  1LVK A;  1NK2 P;  4IHT A;  3VSK A;  4R79 A;  2GOM A;  5TJJ A;  4BGD A;  3UKG A;  4QPQ A;  1EJ9 A;  4FE7 A;  5ED4 A;  2L4M A;  5DEQ A;  2VOO A;  2HQA A;  2P5K A;  1D5V A;  3JW4 A;  4EEF G;  4A3L J;  1IXR C;  1TLH B;  1YJ9 I;  2XGE A;  4DGW B;  2KLO A;  1WJC A;  3HHH A;  5HDG A;  1J0R A;  3O3K A;  2KIS A;  4C2M J;  2QKO A;  1TW3 A;  4AYB N;  3L2W A;  1EH7 A;  4XLN F;  4PJ0 C;  4NC7 A;  1UCR A;  1A04 A;  1UZC A;  2JPB A;  1TT5 B;  4ON0 A;  1U78 A;  5E3N A;  3HEF A;  1O4X A;  1VQ7 I;  4BBR J;  5TRD A;  1IN7 A;  4AID A;  2HWV A;  1JI8 A;  4DBR A;  2RGV A;  1QNT A;  1KQ8 A;  1ZRD A;  1R71 A;  2VN2 A;  3ULQ B;  3SZG A;  1X2N A;  1X1A A;  3I4N J;  2E2I J;  3CCV I;  5J1Y A;  4A5N A;  4XIC A;  3OYG A;  4Y52 J;  2JSP A;  4IOC F;  1E0E A;  3KYL A;  2X0L A;  3I0T A;  2G7L A;  2EWN A;  2ZXH A;  4XON A;  3MZY A;  1B8I B;  2WA0 A;  2XB5 A;  2O7O A;  3F8M A;  1ONV A;  4BY7 J;  2PBI A;  3DKW A;  5L3D A;  5BQT A;  5HAW A;  2HDD A;  3KYD B;  4YIR X;  3KET A;  3NPI A;  4ZDL A;  3I4M J;  3BJB A;  1BJZ A;  1P6R A;  5F08 A;  4B43 A;  4PGH A;  3R60 A;  4ZJZ A;  3B02 A;  4ENK A;  4CCO A;  4PJM A;  4D7N A;  2I8D A;  5F1R A;  3F1B A;  3IWF A;  3LA2 A;  1FSE A;  2DMP A;  3UNG C;  3RCO A;  1FNN A;  2V9V A;  1PVE A;  3FHN A;  2XSD C;  2MLK A;  3V8L A;  4Q5S F;  2HDW A;  3VUQ A;  3RD3 A;  3E6M A;  4ZDO A;  3G1L A;  2L54 A;  3PSI A;  2G7G A;  2FOK A;  2A07 F;  1IDZ A;  2EV6 A;  2UXX A;  3QYE A;  4AUX A;  2JN6 A;  4LMY A;  1UI6 A;  2OF7 A;  2E2H J;  2MFZ A;  2TCT A;  3JRB A;  3DTK A;  4NC8 A;  2XKO A;  4PZJ A;  5J40 A;  2F5C A;  2FML A;  2ID3 A;  2HKX A;  2R7V A;  3GF2 A;  1T08 B;  2LP0 A;  3LQR A;  4PJJ A;  3S14 J;  5JHU A;  2TRT A;  1U8R A;  2QF7 A;  2QQB A;  2GIZ A;  1BBY A;  2ME6 A;  1APL C;  2M45 A;  2HQN A;  3S1M J;  2IBD A;  4P96 A;  1VQN I;  2BY0 A;  1ZH5 A;  3BCG A;  3H0G J;  5GAE J;  4XLH A;  5FRM A;  2R7Q A;  3HSE A;  3DXJ F;  4B09 A;  1BIB A;  2E1O A;  2LNB A;  5CXG A;  2L4A A;  2CW0 F;  1U5T B;  4XOR A;  2PMZ N;  3H5A A;  4XKW A;  5FMP A;  1LNW A;  2EZL A;  3KP5 A;  4D9J A;  1RET A;  2K27 A;  4BQN A;  4BXX J;  2XRL A;  1FY7 A;  1Z05 A;  1Z6T A;  3FXU A;  3HOY J;  4BE1 A;  1RR7 A;  1H8A C;  2ZNY A;  2QM3 A;  1RIO H;  1DPR A;  2JZY A;  3GFJ A;  1HQC A;  1OYW A;  2PFB A;  3ISP A;  5EZH A;  1KYW A;  2DMQ A;  2Y2Z A;  1DGW Y;  3IAS 2;  3SXY A;  3BZC A;  1N25 A;  3E3V A;  2JUC A;  2WY8 Q;  3CCM I;  4B1R A;  3RI4 A;  4MIM A;  3WU1 B;  1T98 A;  5E8G A;  3H92 A;  3WE3 A;  3WGG A;  5B3S H;  1J59 A;  3FBI B;  3DLL F;  2W84 A;  2CQ7 A;  2OD5 A;  4CSW A;  3OV8 A;  3F6O A;  4E7H A;  2CU7 A;  4CYC B;  1A36 A;  1IXC A;  3MCZ A;  3VDX A;  3CF5 F;  1SEU A;  2H6C A;  4GYG A;  1ZAR A;  3M8E A;  1EKE A;  1R58 A;  4A12 A;  3OYK A;  2VJ4 A;  2PEX A;  3GYH X;  2IS1 A;  3G56 A;  3ASN H;  1XDS A;  3I3L A;  1AA7 A;  1U9O A;  3GWZ A;  3E97 A;  3FMQ A;  1OYY A;  3VEP A;  5B1A H;  1BR1 A;  5LRR A;  3MZ8 A;  3K1N A;  2TDX A;  2FMY A;  4JKZ A;  2EJR A;  2IGM A;  4OIO F;  1R6R A;  3LJL A;  4GCL A;  1V3F A;  3RZO J;  2CSO A;  4HST A;  1FTZ A;  2L9R A;  2NOJ B;  4QIW N;  4PSX A;  5FKO A;  1ENH A;  2ZCM A;  2M1B A;  3O6B B;  1ZLJ A;  2HTJ A;  3NRV A;  5EJC A;  2CG4 A;  4BQA A;  1EA3 A;  2STW A;  4BE0 A;  1JTY A;  3C1D A;  3L00 A;  1R23 A;  3P9I A;  3VYU B;  4F92 B;  1Y6I A;  3IKT A;  3CO6 C;  3PO2 J;  2BW3 B;  2YU3 A;  5M5Y J;  3M4O J;  3VB2 A;  4UXN A;  3J7A Y;  1S8N A;  1KU3 A;  1ZQ3 P;  2K4J A;  2QCO A;  3LAJ A;  2R7S A;  1O3S A;  3I55 I;  3LNQ A;  1D1A A;  2CGP A;  2BZT A;  3HJE A;  1W1W E;  4D5F A;  3FKI J;  4E4H A;  1LQ1 A;  2WBM A;  3EGQ A;  4M3F A;  4CCN A;  3OIP A;  1VQK I;  4LK1 F;  3IRR A;  2ME0 A;  1D8K A;  2DFH A;  4M9X A;  4BDZ A;  2DG8 A;  4YFX F;  5LHH A;  4CGZ A;  4P9U A;  3AQT A;  1B59 A;  2QVO A;  3CRJ A;  3OOU A;  1B72 B;  1TT0 A;  3IH3 A;  2VBX A;  4ZYD A;  5JVT A;  3E6D A;  3N4M A;  3S3M A;  5CJ9 A;  1O7F A;  2HDC A;  3A1Y A;  3V8K A;  3JTG A;  4Y3O A;  1MJB A;  5HLH A;  3OYA A;  2DG7 A;  4RAY A;  3BR0 A;  3WG9 A;  5IT9 Z;  1IW7 F;  1TWC J;  2Y31 A;  4L9T A;  3HTH A;  3HIF A;  2R3S A;  1U0J A;  4RLQ A;  5KVR A;  2A05 A;  3H9J A;  4GFB A;  1Y0U A;  3ABM H;  2XAG A;  5KAI C;  2E34 A;  1GDT A;  3I58 A;  4BEH A;  2BEO A;  5HLG A;  5EG0 A;  2W48 A;  2L2O A;  3ZN0 A;  3CJR B;  5IYB J;  3WU2 C;  1T0F A;  1IAW A;  1FOX A;  2AQF A;  1POG A;  3ZXS A;  3IHU A;  2PMH A;  2OJE D;  3BLY A;  2K9L A;  4GCV A;  2EFN A;  4ZC3 A;  1D5Y A;  3BJO A;  2KQR A;  2LTP A;  2VT3 A;  2LRD A;  4D7M A;  1F43 A;  2LFB A;  1W7P D;  3KKC A;  4KYW A;  2JA7 J;  1YE9 A;  2ZO4 A;  2CQN A;  2WAQ N;  4LLL A;  3C2H A;  3LA7 A;  3F8B A;  2V9P A;  3GTM J;  2LKX A;  2JVG A;  2H94 A;  2FSW A;  1PUE E;  4IRH A;  1SVO A;  2R7Z J;  2WB1 N;  4M3E A;  4Y13 A;  3VOX A;  2O0Y A;  2F5V A;  3KFW X;  4U0W A;  1ETK A;  3O8H A;  3KYC B;  2EFW A;  4Q47 A;  4KNY A;  2L5Q A;  4N9I A;  1AOY A;  1D0X A;  2NAZ A;  2Z1D A;  1IF1 A;  2OI8 A;  3QU3 A;  3R61 A;  1Y1V J;  2MA3 A;  4IEJ A;  1HDP A;  4ESB A;  1W4M A;  1X19 A;  2FJ1 A;  2M4G A;  4WX9 A;  2DFF A;  4HX7 A;  3X2Q H;  4MEX F;  2Z99 A;  5D19 A;  3RIR A;  3K2Z A;  1XB4 A;  3FIW A;  1YW8 A;  2EH3 A;  1P4W A;  2XF5 A;  4KIS A;  2QA4 I;  4XN0 A;  1MZB A;  5HLT A;  5LGN A;  4DZP A;  2IS2 A;  1OCP A;  2IJL A;  4E7S A;  4UV9 A;  3FF5 A;  3HPG A;  3CCL I;  2V57 A;  4EAT A;  1SFO J;  1N78 A;  3CDI A;  2GXA A;  2ZSI B;  2HZT A;  3BDD A;  1G3S A;  2R7O A;  5IYC J;  2NRA C;  1IRG A;  4AIJ A;  2HTS A;  4N4O B;  1A6Q A;  2I10 A;  5BPI A;  5IYD J;  2OA4 A;  1XD7 A;  2V1D A;  1WRJ A;  4MEY F;  5LGU A;  2LKS A;  3CDL A;  2X51 A;  3LL7 A;  3K70 D;  3OR2 C;  2QQ8 A;  1ON2 A;  3LSJ A;  2RQP A;  1QZE A;  3PFI A;  1OLT A;  4A3D J;  2NS7 A;  3HKZ N;  3HRT A;  2VAS A;  3VW1 A;  5DYM A;  2PG4 A;  2CWE A;  1SD7 A;  1CQT A;  2VQC A;  4FIS A;  3VW2 A;  4A5M A;  1JHH A;  5IT9 K;  3N05 A;  2YPR A;  3P5J A;  3DTE A;  2PFV A;  1S9H A;  5FKL A;  1K4T A;  2ZXJ A;  2QKM B;  3EDP A;  3K4L A;  4G7O F;  5H2F C;  2FNP A;  4XRS A;  4Y7N J;  3P7N A;  2CV2 A;  4BJ6 C;  4UB6 C;  5ICG A;  1JT0 A;  1D8J A;  1USS A;  4PGG A;  2R92 J;  5EDN A;  3CMA I;  3HM5 A;  3M7G A;  1ZG3 A;  3RPU D;  4IHS A;  3CZ6 A;  2LY9 A;  4HNV A;  1LB2 A;  3ZP5 A;  2HYJ A;  2R7T A;  4XM3 A;  2VT2 A;  4QWQ A;  1LKX A;  1OCC H;  1Z7L A;  4B47 A;  5K7Z A;  1BOA A;  4BU2 A;  2VXZ A;  5J8C A;  5D4S A;  5B66 C;  1Q1H A;  1AU7 A;  2P7C B;  1I1G A;  4XLE A;  1RNL A;  2GXB A;  5DAJ A;  3T8R A;  4X6A J;  1S29 A;  2D5V A;  1HXD A;  3IP4 B;  2EB7 A;  2JSC A;  4F52 A;  1MW7 A;  4JX4 A;  1HC8 A;  4UY8 I;  4PSW A;  3BTI A;  2RQQ A;  2QIB A;  2KT0 A;  1ZHF A;  2DYR H;  2RRE A;  3HSR A;  4G8X A;  4YG2 F;  2OCC H;  3G6E I;  1IC8 A;  1FTT A;  1ETO A;  2UXN A;  3WTU C;  3K4B A;  2FQ4 A;  2G7H A;  3HTU A;  2DA3 A;  4G12 A;  2BVL A;  3K69 A;  4OWR B;  4ZZD A;  1YI2 I;  1QPI A;  4PJN A;  4RB1 A;  2DK5 A;  4OMY A;  4OIR F;  3G2B A;  5FD5 A;  3K9T A;  1TWH J;  2BXY A;  2BYV E;  1BIA A;  3PQK A;  4ESF A;  2PJR A;  5CQE A;  4MFD A;  1KU7 A;  5IP6 A;  5F0H A;  2NVX J;  5KHD A;  3FX3 A;  1J5Y A;  2OZ6 A;  4XLA A;  5CVJ A;  4DZJ A;  3ZQG A;  3JRF A;  4PUS A;  4LB6 B;  2A2F X;  3IH2 A;  1ETV A;  2G7S A;  2A69 F;  1HW2 A;  4ZYE A;  2DA5 A;  2K7L A;  3HUG A;  2IA2 A;  4KN7 X;  1OCT C;  3ON2 A;  2JJ7 A;  1ETW A;  1GVD A;  1JGG A;  4KN4 X;  4NN1 A;  2MLG A;  1LDD A;  3HOW J;  2B9S A;  1TNT A;  2XF7 A;  1OCR H;  4XOT A;  4L62 A;  4HYE A;  2UXP A;  4D1Q A;  2Y0S A;  1BC7 C;  4M9Z A;  2BY2 A;  1FT9 A;  2LBF A;  4RGU A;  2CO5 A;  2F6C A;  3ELK A;  3CJQ B;  1LDK B;  2DQL A;  5FO5 A;  4II2 A;  3GTG J;  3S2H J;  4CDG A;  2ESN A;  5L3E A;  1A35 A;  3GTL J;  1HDD C;  2JRT A;  4CIC A;  2HOT A;  4H0E A;  5CXI A;  4ICH A;  1ZGA A;  4YFN F;  3S16 J;  1W7P A;  4L5I A;  3BZ6 A;  3KZ9 A;  4XL9 A;  4U7D A;  3H9G A;  4EJO A;  5F0F A;  1UB9 A;  3I4P A;  4LIV A;  4C2T A;  2DDA A;  1WJE A;  4MGR A;  5BS6 A;  1R5H A;  1JJ8 C;  4KWA A;  3TED A;  5LBQ A;  1O3R A;  1MMN A;  2R5Z A;  3PSF A;  3JR9 A;  2A68 F;  3HOS A;  2XSJ C;  2Z9O A;  2MBF A;  1YX5 A;  5F1J A;  1GHC A;  2XAH A;  3FK6 A;  1I50 J;  4UNO A;  2DJN A;  3HKZ A;  4P9F A;  3K10 A;  2FJI 1;  4FET A;  3FXO A;  1YS6 A;  5DUK A;  1TL8 A;  3G1O A;  2OBP A;  2EQR A;  2ESH A;  1WFX A;  5K5Q A;  1R9T J;  4M6V A;  1OJL A;  5C3E J;  5HLI A;  3V42 A;  4ITV A;  4BYY A;  1G6N A;  3J7A O;  3F22 A;  3MZH A;  2UV1 A;  3U1K A;  3VTI A;  1GV5 A;  3DCF A;  3RQI A;  4RAG A;  3HE0 A;  2IEK A;  2D1H A;  4YRV A;  4BJT A;  1HKT A;  1K78 A;  1Z0X A;  3FHZ A;  1DDN A;  4CCM A;  4DVY P;  3BR3 A;  4OIP F;  3BPV A;  4I98 B;  3CMM A;  3GTQ J;  1IZ1 A;  1H89 C;  2LLK A;  1JGS A;  3ZR8 X;  1R1T A;  2KIQ A;  4NB5 A;  2MW8 A;  3JAM K;  4P55 A;  5J1U A;  1PDN C;  3J81 Z;  3JCU C;  2P8T A;  4MQ9 F;  4BS9 A;  2CW8 A;  3PIP F;  5K7F A;  3LFU A;  5TIS C;  3S8P A;  3KLO A;  1SFU A;  1ORK A;  5JVG F;  1QBJ A;  2K02 A;  3JTH A;  2NP5 A;  5A2Q Z;  3QRF F;  4CH7 A;  3K6G A;  2PLY A;  2R7D A;  5M3F J;  3MNL A;  4E7L A;  5BPD A;  3LMM A;  2O7T A;  3ZCO A;  1H88 C;  2NNN A;  1FOY A;  1LE8 A;  2JVH A;  2BOL A;  3QPH A;  3I9V 2;  4WWC A;  4UVB A;  5JR3 A;  3OYC A;  3DEE A;  2DPD A;  5DS9 A;  3OL4 A;  4UHT A;  2PN6 A;  4HAM A;  2HI3 A;  3RPU A;  3GTJ J;  3M8F A;  1HW1 A;  2Q0O A;  2NX4 A;  3W6V A;  3FMR A;  4M71 A;  2L7K A;  1PJR A;  1Z6R A;  1XPX A;  3HGY A;  1BC8 C;  3WG7 H;  3L1P A;  2UUZ A;  3JRC A;  4OAZ A;  5HDN A;  4EJV A;  1X58 A;  1MGT A;  2XGC A;  3QKX A;  1H9T A;  1D0Y A;  2K85 A;  2L0K A;  4KUM A;  2DT7 B;  1PP7 U;  2QOP A;  3RYR A;  1B9N A;  2PX9 A;  5D5V B;  1S3J A;  3VVY A;  5D8K B;  2BVM A;  2GWR A;  2DN0 A;  2HYF A;  2LF8 A;  2OQG A;  4PFP A;  1FPQ A;  2COM A;  4C2M A;  3MEX A;  1GXP A;  1F4K A;  2AO9 A;  1A5J A;  1WH5 A;  1KQ9 A;  3U1D A;  4M9S A;  1OR7 C;  4XRM A;  5DM6 F;  3ZQC A;  2A5Y B;  3QQA A;  2CQQ A;  2YSR A;  2ZY9 A;  2W00 A;  3GVA A;  2HKO A;  2YVX A;  3G7R A;  4HLY A;  1VQ9 I;  1DPU A;  5F27 A;  4BEH B;  5EG0 B;  2WGB A;  4ETS A;  2M8E A;  3DKX A;  1FX7 A;  3L9F A;  3NAR A;  4RDU A;  2Y0M A;  2VBW A;  1T38 A;  3W2V A;  2IGO A;  1TP4 A;  4D0P A;  3ESW B;  4NHJ A;  3MWM A;  1G2H A;  1WI3 A;  3T6N A;  2BE5 F;  4XSX F;  1RUO A;  3G1M A;  4KIF A;  2X9D A;  1QPM A;  1VF9 A;  3QPT A;  3ZMD A;  1IRF A;  1TWG J;  2ZXI A;  1GUU A;  2KRF A;  3OR1 C;  2DOF A;  4HA8 A;  4BAY A;  2CMP A;  3FDY A;  4XKV A;  2KDZ A;  2E7X A;  3FXK A;  4BBS J;  1I27 A;  3BR1 A;  2JTV A;  1I6H J;  2FQ3 A;  2XAU A;  1QRY A;  3Q0U A;  5JI6 A;  4IX7 A;  3RJP A;  4M3G A;  5HDK A;  4ZYG A;  4O3M A;  4ZTF A;  4A69 C;  3HRU A;  2E7W A;  3BRU A;  2NVT J;  3BTC A;  5E3L A;  2RNJ A;  4KJZ A;  2XPU A;  1ZR4 A;  3KEY A;  3MD2 A;  1ZRE A;  3C3W A;  3NWT A;  5CYV A;  4LFU A;  5J1R A;  4U7B A;  3WE2 A;  3CJD A;  2DJI A;  4LIU A;  1XCV A;  2V1N A;  1B1B A;  3BR5 A;  1O3T A;  2XAJ A;  2C6Y A;  3ZOB A;  5M5W J;  5E1X A;  1FYL A;  3TDZ C;  2OCE A;  1FOK A;  5A2Q K;  1ETQ A;  1KU2 A;  2XB0 X;  1EH8 A;  3V6G A;  3KIO A;  3PO3 J;  4DYC A;  1J75 A;  3L2C A;  3BG7 A;  3OMY A;  3W6K B;  5GTI C;  3OYI A;  3WGH A;  1G59 A;  2XGX A;  2KIU A;  2UZK A;  2PBX A;  4HNT A;  1G4D A;  3KP2 A;  5B5E C;  1VZ0 A;  4CGR A;  1WCM J;  1X3Z B;  1MIJ A;  1OKR A;  3D5S C;  1Z67 A;  3BT9 A;  1UG0 A;  1YQA A;  2E1M B;  2K40 A;  5EZG A;  3ZQH A;  2EA2 A;  4LG0 A;  4IRV A;  3HTA A;  1QVT A;  2VLA A;  2KJB A;  2NVY J;  3BTJ A;  4Y4R A;  4NUB A;  4KIT B;  4M73 A;  3VPR A;  4E7J A;  2XAF A;  2VJ5 A;  1I5Z A;  1KU9 A;  2DFE A;  1FOW A;  5DD4 A;  4N0B A;  1S6L A;  4G9Y A;  1HKS A;  3HXL A;  2B63 J;  2P0W A;  4EGY A;  2HVR A;  3SJM A;  4U88 A;  3ZQF A;  4LGW A;  3HG9 A;  1VTN C;  2FUG 2;  2OAZ A;  3ON4 A;  2L01 A;  2CUZ A;  3I53 A;  3F8C A;  2ZCX A;  3DF8 A;  1WKM A;  1SVL A;  5CVR A;  1IN5 A;  3DPL C;  2ZFW A;  3E7L A;  3RYP A;  3MN2 A;  5IPA A;  5ILU A;  3S17 J;  2KRH A;  3KEQ A;  2V7F A;  1XSV A;  3GTP J;  3LSI A;  3CCU I;  5EGO A;  4HSR A;  1ZG5 A;  1X3U A;  2RAS A;  3BG3 A;  3T0Y A;  2M0M A;  2ZFU A;  2X85 A;  3DEW A;  3JRI A;  2LH9 A;  2QUF A;  3K1P A;  2JWT A;  2VC0 A;  5FHP A;  1FZP B;  2O6G E;  1E2X A;  1MH3 A;  3F72 A;  1WPK A;  3JRA A;  3OYE A;  4N4N B;  2NNY A;  2OER A;  1TWF J;  2ELH A;  2VON A;  3HOZ J;  5E3M A;  3CCQ I;  2VB6 A;  3W6J B;  2Z3Y A;  4Z6Y A;  1FMV A;  1O57 A;  2JA2 A;  1UMQ A;  4I76 A;  1QO0 D;  5BNG A;  5KAF C;  2UXH A;  5KCM A;  5GTH C;  4FQG A;  1X3W B;  3CC7 I;  5FFX A;  2GA2 A;  4KIC A;  1IO2 A;  1SMT A;  1J2X A;  5ILS A;  4LJZ F;  2DBB A;  3RKY A;  2VIX A;  2Y9Z A;  3J7Y J;  2GM4 A;  1TQI A;  5ERI A;  2Z16 A;  1DUX C;  1NK3 P;  1Y8Q B;  3FK7 A;  4EJW A;  2CYY A;  2X6W A;  1P4A A;  4JYK A;  2K5C A;  2AQE A;  1OPC A;  3M3Y J;  3K4N A;  3A0B C;  4A3G J;  4ENJ A;  2BGC A;  2R7F A;  3U21 A;  1A31 A;  2L7F P;  3LST A;  4ENM A;  4J19 A;  2LF7 A;  5F6F A;  4JNN A;  3EUH C;  2G0E A;  1DU0 A;  1SD5 A;  1HSJ A;  4RBO A;  1QGP A;  2H8W A;  2LYC A;  5F64 A;  3OS0 A;  5D5U B;  1ZRF A;  1U8B A;  1MBH A;  2FF4 A;  2GQQ A;  2PJR B;  3IKV A;  3S15 J;  2KJC A;  1TC3 C;  3QBM A;  3B73 A;  4M72 A;  1N75 A;  1EV7 A;  2DA7 A;  2ZKZ A;  2M5W A;  2EFP A;  4G6D A;  1XX5 A;  5GP9 A;  1Y39 A;  3RDI A;  4RLF A;  2XV4 S;  3ECO A;  5CPR B;  3A01 A;  1F9N A;  3HUG B;  4ZDP A;  4A6E A;  1J9I A;  3OYL A;  2ADU A;  3FRQ A;  1D1C A;  1L3L A;  1BOB A;  1XMX A;  2BXZ A;  1ZKG A;  1V4R A;  5HVQ C;  4A3J J;  4A0Y A;  3CCJ I;  2F5D A;  4JK1 X;  1R49 A;  2XDN A;  1JKR C;  2EIL H;  2IPQ X;  3VYS B;  2LBF B;  2GFN A;  4ABZ A;  3C2B A;  2RDP A;  2R7R A;  3W3C A;  1MMS A;  1IRZ A;  1RRJ A;  4LK0 F;  1V5E A;  4CCK A;  1ZRC A;  3C2G A;  2VBZ A;  3CTA A;  1ZN2 A;  2ISY A;  1AKH A;  2K9M A;  4GFK A;  4XLC A;  5LEK A;  3SDG A;  1W7P B;  2GA1 A;  4NNJ A;  2DU9 A;  1IN6 A;  4KT6 A;  3SFI A;  2D2W A;  3CP8 A;  2DQR A;  2GLO A;  4XKC A;  2R7U A;  2ELK A;  3ZQ7 A;  1Z91 A;  4R1H A;  3QPS A;  1FP1 D;  2X1E A;  4OD5 A;  4MQV A;  2R5Z B;  5GAD J;  2ZJR F;  1IN8 A;  5KK1 A;  4JBA A;  3ZGK A;  3AG2 H;  1XGO A;  4A3K J;  1Z77 A;  3D0S A;  2KZG A;  4UUS A;  3B6A A;  2DYS H;  2WAD A;  1QVU A;  3A02 A;  1WJF A;  2QSH X;  5DCM A;  4AIH A;  3CMY A;  2KDO A;  3ABL H;  3LSH A;  1TQM A;  1I3Q J;  1AWC A;  1MSE C;  1J09 A;  2VOP A;  2O03 A;  4DBQ A;  4NQW A;  1W0U A;  1Z3X A;  3S1R J;  3QU6 A;  3SWH A;  1RKW A;  2BHY A;  1UG2 A;  2KMU A;  2LK2 A;  3DPU A;  2FEZ A;  3ERM A;  4KA4 A;  3K4C A;  5AIQ A;  2HXO A;  3T1B A;  3SEQ A;  3TGN A;  1F5T A;  3GXO A;  5CQG A;  4LD5 A;  2IGN A;  2VQL A;  3R0J A;  4AWX B;  1HLV A;  2NS8 A;  1K78 B;  5FRO A;  2R5Y A;  4RB0 A;  3AG1 H;  1NHA A;  2GOX B;  3IL2 A;  1IXS B;  1YJW I;  1ON1 A;  3FXJ A;  2UWM A;  5HSZ A;  2O8X A;  4XLF A;  3TL4 X;  3C18 A;  1LVA A;  1KYZ A;  2E71 A;  4HRI A;  2HYT A;  2M0C A;  4A3M J;  4RB3 C;  4IHV A;  1YW9 A;  4OAY A;  2EFQ A;  1IJW C;  4MTD A;  4UUV A;  2B3W A;  1MJ9 A;  1Z3Y A;  3ABK H;  3LSK A;  3LHQ A;  4IXA A;  4IO9 F;  2IXS A;  1E3P A;  4HV6 A;  4XK4 A;  3D1N I;  3A2K A;  4HF2 A;  3HOU J;  3KLN A;  1BJA A;  2XRN A;  4GO1 A;  2F5F A;  5JHF A;  2DTZ A;  1LE8 B;  4M6Y A;  5LHG A;  3DU6 A;  2ZXW H;  3T8T A;  1MMA A;  4B4C A;  4EMS A;  2E1C A;  2LY2 A;  2ZOZ A;  1BI2 A;  1Y0N A;  3PAS A;  2GEN A;  2ZCW A;  3NRG A;  3OSF A;  2Y0S N;  3CO7 C;  2HOS A;  5K5R A;  1VND A;  4HQM A;  1KGS A;  5K1Y A;  3Q9S A;  4R8H A;  3G4S I;  2L9S A;  4ZYH A;  1PYV A;  2FBI A;  2DI3 A;  2VKE A;  5H6Q A;  2YX7 A;  3F3X A;  2LG4 A;  2RAE A;  2LSO A;  3SEZ A;  2NVQ J;  5E79 C;  1XSD A;  3NQO A;  4UVC A;  2CQK A;  2QEN A;  4E7I A;  5E18 F;  3BJ6 A;  4OMZ A;  2ECB A;  1FP2 A;  2QKL B;  3TP3 A;  4MTE A;  2NVU B;  4RGR A;  2K3F A;  3PIO F;  1RPW A;  1T33 A;  4MO7 A;  1LEA A;  3ZQL A;  2ZNZ A;  5IY5 H;  2E2J J;  4UDS A;  1JKQ C;  4FCY A;  2HZD A;  3DEU A;  4Y33 A;  3BJA A;  3HYI A;  3LSG A;  3CJT B;  3GCM A;  3S32 A;  3OSG A;  5FGL A;  4BXF A;  4II3 A;  5IP9 J;  2KKO A;  1WZ2 A;  4GDF A;  3WU0 A;  3COL A;  2V1X A;  3PNT A;  2V6C A;  1FC3 A;  4M3B A;  1XN7 A;  3H5N A;  5HOD A;  1MKM A;  4F93 B;  4S05 A;  3OL3 A;  3K7A J;  2CV0 A;  2VKH A;  1P4X A;  4WCG A;  1YLF A;  2IA0 A;  5DTD A;  5AQC A;  3I71 A;  1G3T A;  4HW0 A;  3S3O A;  2GAU A;  3KP6 A;  3GFL A;  1WWX A;  3CCY A;  1M1E B;  4BNC A;  1RI7 A;  5LGT A;  4EQQ A;  2VE8 A;  3S93 A;  4BUP A;  1XMA A;  4CO8 A;  5GAG J;  3O2P E;  3ANP A;  4U9N A;  5FKK A;  2IU5 A;  3NS4 A;  1FIA A;  3IUV A;  4FT8 A;  3QYF A;  1K6Y A;  3CES A;  1TNS A;  3LQQ A;  1S72 I;  3AG4 H;  4RGS A;  1MDM A;  5FKN A;  3S2W A;  3NXC A;  3U2R A;  4C9Y A;  2HYG D;  2AXT C;  2EIJ H;  5K7H A;  1MBG A;  2DA1 A;  4IF4 A;  3EUA A;  4NC6 A;  4LG3 A;  1QA6 A;  3N97 A;  2VQH A;  4BE2 A;  1WJ5 A;  1UJ8 A;  2XVC A;  5E20 A;  3SFZ A;  2CV1 A;  3MKY B;  4GCT A;  3P9C A;  4XNF A;  3CC2 I;  2M3A A;  5DM7 F;  1MNM C;  4JQF A;  1BI0 A; 
#chains in the Genus database with same CATH homology
 2HOA A;  1APL C;  2Y9Y A;  5DS9 A;  3S1M J;  2IBD A;  2CQX A;  2HI3 A;  3GTJ J;  4W1U A;  4XID A;  3BCG A;  3H0G J;  2NX4 A;  5FJ8 J;  3W6V A;  1BL0 A;  1JUP A;  4C3J J;  2JMW A;  2UXO A;  1BW5 A;  3GEU A;  3HGY A;  5GPA A;  2E1O A;  1PUF A;  5CXG A;  4IHW A;  3L1P A;  2YVH A;  1EF4 A;  3JRC A;  1JUS A;  4JX5 A;  5M3M J;  2PMZ N;  1IUF A;  1X58 A;  2OPT A;  5C44 J;  2XGC A;  3QKX A;  5FMP A;  2EZL A;  3TP0 A;  2L0K A;  1RET A;  2DMT A;  1ITY A;  2QOP A;  4BXX J;  3VVY A;  2XRL A;  3MKL A;  1ZR2 A;  3HOY J;  2DN0 A;  1BA5 A;  1RR7 A;  1H8A C;  3GTK J;  3KKD A;  1IV6 A;  1UI5 A;  2YU9 J;  2M2E A;  2K9Q A;  2AO9 A;  1A5J A;  1WH5 A;  2VUM J;  4XRM A;  5EZH A;  2Y2Z A;  2DMQ A;  3QQA A;  3ZQC A;  1MBE A;  2CQQ A;  2D6Y A;  1UHS A;  3JRH A;  3G7R A;  3VW0 A;  5EGO B;  2N8G A;  2VI6 A;  5F27 A;  4B1R A;  2LD5 A;  5EG0 B;  2WGB A;  4MIM A;  4MFE A;  3NI7 A;  3NAR A;  2EZI A;  4RDU A;  2IAI A;  4D5C A;  3BQY A;  1B8I A;  1MH4 A;  2CU7 A;  4CYC B;  3ANG A;  1JT6 A;  1G2H A;  1WI3 A;  3T6N A;  3G1M A;  1MBJ A;  3HBL A;  2X9D A;  1VF9 A;  1TWG J;  1GUU A;  2G3B A;  4DW6 A;  1GT0 C;  3NAU A;  3G56 A;  1NTC A;  2KDZ A;  2REK A;  1I6H J;  5F0C A;  4BBS J;  3BR1 A;  1U9O A;  3PPB A;  1S7E A;  3DPJ A;  1QRY A;  3Q0U A;  2W53 A;  4M3G A;  5C4J J;  4JKZ A;  4A69 C;  3BRU A;  2NVT J;  3LJL A;  2P81 A;  3BTC A;  5E3L A;  4GCL A;  2JA5 J;  2XPU A;  1ZTR A;  1ZR4 A;  4M3D A;  1LFB A;  3RZO J;  1FTZ A;  2L9R A;  4QIW N;  5FKO A;  1ENH A;  3GTO J;  1RES A;  2Y30 A;  3BR2 A;  5K58 A;  2ZCM A;  5J1R A;  3CJD A;  3O8G A;  2F07 A;  2DMN A;  3BR5 A;  4A93 J;  3HTJ A;  4C3I J;  3ZOB A;  5EF6 A;  5M5W J;  1JTY A;  2CUF A;  4B3A A;  3PO2 J;  5M5Y J;  3M4O J;  2QWT A;  1ETQ A;  2XB0 X;  3V6G A;  1K83 J;  1RKT A;  3PO3 J;  4DYC A;  1ZQ3 P;  2QCO A;  3JRE A;  3AQS A;  3LNQ A;  1LFU P;  4JL3 A;  2PBX A;  4D5F A;  3FKI J;  4CGR A;  1WCM J;  4S0H B;  3EGQ A;  2DA6 A;  4M3F A;  4V2F A;  2WV1 A;  4FE4 A;  4BY1 J;  2YS9 A;  3WHB A;  2L7Z A;  3BT9 A;  2ME0 A;  4NDL A;  2K40 A;  2DG8 A;  5EZG A;  3ZQH A;  3CWR A;  1YRN B;  3A01 B;  5D1R A;  4A3B J;  3AQT A;  1TWA J;  3HTA A;  3CRJ A;  1QVT A;  2DA2 A;  2NVY J;  5EFY A;  3OOU A;  1B72 B;  3BTJ A;  3IH3 A;  3FIS A;  3P9T A;  3QPL A;  3VVX A;  3VPR A;  2XPV A;  4A3C J;  5EYR A;  5J3L A;  1ZGW A;  2ME6 A;  2VPR A;  2ECC A;  2DG7 A;  5D18 A;  1VI0 A;  1XG1 A;  3BR0 A;  2B63 J;  2L7M P;  1TWC J;  2Y31 A;  3SJM A;  1ZK8 A;  2ZOY A;  3ZQF A;  3RKQ A;  3HTH A;  5FLV A;  3ON4 A;  3JSJ A;  2ZCX A;  4XRS G;  3IH4 A;  1AKH B;  4PXI A;  1Q1V A;  2MGQ A;  1Y1W J;  4GFB A;  3S17 J;  3E7L A;  3MN2 A;  5IPA A;  2ID6 A;  1JJ6 C;  1JKO C;  3GTP J;  5EGO A;  4BKX A;  1GDT A;  2RAS A;  3BG3 A;  3GBG A;  5EG0 A;  3DEW A;  2W48 A;  4MK6 A;  3CQZ J;  3JRI A;  5IYB J;  4MXM A;  2JWT A;  5FHP A;  2FX0 A;  3S5R A;  1DU6 A;  1MH3 A;  1JKP C;  1POG A;  1WPK A;  1JUM A;  4CYC A;  3JRA A;  5M5X J;  4IHY A;  4UUS B;  2OER A;  1TWF J;  1D5Y A;  5C4Y A;  3HOZ J;  2LTP A;  5E3M A;  1E3O C;  4D7M A;  1HOM A;  1F43 A;  2RHA A;  4I76 A;  2LFB A;  2M9H A;  1UMQ A;  5BNG A;  3KKC A;  2UXH A;  2JA7 J;  3BG5 A;  3RZD J;  2K9S A;  1MSF C;  2AHQ A;  2WAQ N;  5E3O A;  3F0C A;  5C4X J;  3GTM J;  2LKX A;  4A3F J;  3HDD A;  1FIP A;  3ZQI A;  2Y9Z A;  2GM4 A;  3S1N J;  3TW7 A;  2R7Z J;  2WB1 N;  1WH7 A;  4M3E A;  2HKU A;  3VOX A;  1NK3 P;  3LOC A;  1ETK A;  3O8H A;  2JA8 J;  3FK7 A;  2LVS A;  4JYK A;  1W0T A;  3JRD A;  2R5Y B;  3M3Y J;  2OI8 A;  4A3G J;  2K9N A;  2L7F P;  1Y1V J;  2YUS A;  4HKU A;  4J19 A;  2EZK A;  4IEJ A;  3LWJ A;  2FD5 A;  4JNN A;  1HDP A;  2G0E A;  1DU0 A;  1ETY A;  5HBU A;  1WGX A;  2FJ1 A;  4RBO A;  4I6Z A;  3C07 A;  5D19 A;  4MLO A;  2YVE A;  1U8B A;  3OIO A;  1MBH A;  4A3I J;  1IG7 A;  3FIW A;  2EH3 A;  3BG9 A;  1SGM A;  3S15 J;  2XGD A;  1TC3 C;  4DZP A;  3QBM A;  1OCP A;  5H9T A;  2DA7 A;  3HIM A;  4GFL A;  3Q0V A;  5GP9 A;  2V57 A;  1SFO J;  1YRN A;  3A01 A;  5IYC J;  3EUP A;  1B72 A;  3HOV J;  2I10 A;  1MBK A;  5IYD J;  3FRQ A;  1ZKG A;  3CDL A;  4A3J J;  2XDN A;  3VOK A;  1SAN A;  3LSJ A;  1JKR C;  2CUE A;  4A3D J;  2NS7 A;  2GUH A;  3HKZ N;  2PZ9 A;  3VIB A;  3VW1 A;  2GFN A;  4ABZ A;  3C2B A;  4JP0 A;  1A6I A;  1IRZ A;  2E19 A;  1CQT A;  4FIS A;  3VW2 A;  4AC6 A;  1AKH A;  2EZH A;  4GFK A;  2O9L A;  5FKL A;  1XS9 A;  2M34 A;  3SDG A;  4XRS A;  4Y7N J;  4AC0 A;  3SFI A;  2WUI A;  3WHC A;  1JT0 A;  2GLO A;  5GPC A;  2VKV A;  3K2A A;  2XPW A;  2ELK A;  2R92 J;  3Q3S A;  5EDN A;  3HM5 A;  4ME9 A;  3QPS A;  2LY9 A;  4HNV A;  1X2M A;  2R5Z B;  1FJL A;  5JLX A;  2HYJ A;  1HF0 A;  4A3K J;  2R93 J;  1Z77 A;  3B81 A;  1MNM C;  1FEX A;  4C3H J;  4UUS A;  3B6A A;  2ZB9 A;  4L5E A;  5K7Z A;  1XC5 A;  1QVU A;  3A02 A;  3BTL A;  3BNI A;  3CMY A;  1AU7 A;  3V78 A;  1I3Q J;  1MSE C;  4NEL A;  2MSY A;  2H8R A;  1W0U A;  3S1R J;  5DAJ A;  2NP3 A;  1U9N A;  1RKW A;  2COB A;  1UG2 A;  2LK2 A;  4A3E J;  3E7Q A;  3VP5 A;  3BQZ A;  2Q24 A;  4X6A J;  2D5V A;  2HXO A;  3TW6 A;  1HCR A;  3H3V K;  2GBY A;  3RH2 A;  5FKM A;  4JX4 A;  2UXI A;  3BTI A;  1HLV A;  2QIB A;  2KT0 A;  2NS8 A;  2R5Y A;  3MVP A;  5IOZ A;  5FLM J;  3HOX J;  1GV2 A;  1T56 A;  3GZI A;  2JK3 A;  1IC8 A;  1FTT A;  1ETO A;  5HSZ A;  2FQ4 A;  2DA3 A;  4G12 A;  3JRG A;  1QPI A;  4JX6 A;  2HYT A;  2M0C A;  4A3M J;  2R0Q C;  2CJJ A;  1AHD P;  1TWH J;  4IHV A;  3LSP A;  3BHQ A;  3NNR A;  1IJW C;  4YZE A;  1IDY A;  4MFD A;  5IP6 A;  5F0H A;  2NVX J;  4W97 A;  2NOG A;  2UXU A;  4DYQ A;  2ZCN A;  4LOC A;  2LR8 A;  4DZJ A;  1K61 A;  3ZQG A;  3JRF A;  3LHQ A;  3Q0W A;  4XK4 A;  3D1N I;  4GCK A;  3IH2 A;  1ETV A;  2G7S A;  3HOU J;  2HQ5 A;  4X1E A;  2DA5 A;  2M8G X;  1OCT C;  3ON2 A;  2JJ7 A;  1OFC X;  1ETW A;  1GVD A;  2MG4 A;  2DTZ A;  1LE8 B;  1F36 A;  1JGG A;  9ANT A;  2CRG A;  4NN1 A;  4DYR A;  3A03 A;  2HXI A;  4FTH A;  3HOW J;  3LSR A;  4B4C A;  1MBF A;  3VVZ A;  3HB9 A;  2ZOZ A;  3PAS A;  1NK2 P;  4L62 A;  2GEN A;  2UXP A;  3NRG A;  1JTX A;  3OSF A;  3UKG A;  2Y0S N;  2HOS A;  2X48 A;  4FE7 A;  3S2H J;  1VND A;  3GTG J;  3GTL J;  4ACI A;  4EEF G;  4A3L J;  1HDD C;  3O60 A;  2HOT A;  1PUF B;  3HGG A;  2XGE A;  5CXI A;  4ICH A;  3HTI A;  2VKE A;  4C2M J;  3S16 J;  2QKO A;  4AYB N;  1IGN A;  5IOY A;  4QSH A;  3PM1 A;  3KZ9 A;  2RAE A;  5F0F A;  2NVQ J;  1JJ8 C;  4KWA A;  3TED A;  1U78 A;  2ECB A;  5E3N A;  3HEF A;  1O4X A;  2R5Z A;  4BBR J;  3TP3 A;  3JR9 A;  5F1J A;  1RPW A;  1I50 J;  3FK6 A;  1T33 A;  2DA4 A;  2DJN A;  4MO7 A;  4UUT A;  3ZQL A;  3BR6 A;  2E2J J;  3G1O A;  4UDS A;  1JKQ C;  1X2N A;  4FCY A;  3I4N J;  2EQR A;  2E2I J;  3LSG A;  5J1Y A;  5FGL A;  4XIC A;  3OSG A;  1R9T J;  4M6V A;  2H1K A;  1OJL A;  5IP7 J;  5C3E J;  4Y52 J;  5IP9 J;  5EEA A;  4AF5 A;  3COL A;  2G7L A;  2EBI A;  4M3B A;  5HOD A;  1B8I B;  1VFC A;  1ETX A;  2XB5 A;  1GV5 A;  2O7O A;  3DCF A;  3K7A J;  4BY7 J;  3RQI A;  3HE0 A;  5HAW A;  2HDD A;  2IEK A;  3NPI A;  3I4M J;  3BJB A;  1BJZ A;  2X6O A;  5DTD A;  5AQC A;  2QTQ A;  1Z0X A;  5F08 A;  2O8K A;  3CCY A;  3BR3 A;  3GTQ J;  4D7N A;  1H89 C;  2LLK A;  3F1B A;  2MW8 A;  2DMU A;  2DMP A;  3ANP A;  5J1U A;  3S2D J;  5FKK A;  2IU5 A;  1FIA A;  3IUV A;  5JLW A;  2XSD C;  5K7F A;  5CW8 A;  3VUQ A;  3RD3 A;  1ORK A;  3G1L A;  3IV5 A;  2G7G A;  1P7J A;  5FKN A;  3S1Q J;  2NP5 A;  3NXC A;  1IDZ A;  4AUX A;  2JN6 A;  1UI6 A;  2OF7 A;  4IHX A;  5K7H A;  1MBG A;  2DA1 A;  5M3F J;  2E2H J;  3B6C A;  3KNW A;  3MNL A;  2TCT A;  3JRB A;  2O7T A;  2FBQ A;  1H88 C;  4V2G A;  2ID3 A;  4QTR A;  1P7I A;  2LP0 A;  5F04 A;  1LE8 A;  4GCT A;  1BW6 A;  3S14 J;  2TRT A;  2QF7 A;  2JA6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...