3C2QA

Crystal structure of conserved putative lor/sdh protein from methanococcus maripaludis s2
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
341
structure length
328
Chain Sequence
b'ANIPEIENANLKPALKDSVLPDGFYSTTNHPTHVKVNDEWIEVANPKMDAVIVVYPEEKRAETKVIRKVKKGDFVLIGHNGIRVMPPESEVSSEKPKEAIIKRIAKEMHEIREEYKKTGTGGIAIVGGPAIIHTGGGPALAKMVELGYIQAILAGNALATHDIESALYGTSLGVNIKTAKPVTGGHKHHIYAINAINDAGNIKNAVESGVLKEGIMYQCIKNNIPYVLAGSIRDDGPIPDVITDSMVAQDKMRTTVMDKKMVIMLSTLLHSVATGNLMPSYIKTVCVDIQPSTVTKLMDRGTSQAIGVVTDVGVFLVLLLKELERLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized conserved protein
publication title Crystal structure of conserved putative LOR/SDH protein from Methanococcus maripaludis S2
rcsb
source organism Methanococcus maripaludis s2
molecule tags Structural genomics, unknown function
total genus 95
structure length 328
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.420.10 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 domain 3c2qA01
3.40.50.10690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold putative lor/sdh protein like domains 3c2qA02
3C2QA
chains in the Genus database with same CATH superfamily
3TO5A 3K0FB 4WT7A 5EOVA 1F2TA 2OGZA 3NWEA 3CZQA 3R09A 3WWPA 3V8VA 3S2YA 1DLIA 3V00A 4D4MA 1MCZA 3U26A 1KNXA 3GFQA 4PYIA 2ZYGA 4UZSA 4PNEA 2ZB8A 2JGRA 2VEOA 1M9NA 2W0MA 1AV6A 1BWQA 2YJ5A 3WL5A 3THWA 4N76A 4YP0A 4QREA 1ZGAA 2RH5A 3WMWA 1OZ0A 4U9HS 1GTVA 4DCVA 1QG2A 1DXOA 3TL2A 1C8LA 4WUTA 3TZLA 1F2TB 2NTNA 3K8ZA 2QUIA 1LVUA 1TJYA 2KLBA 3E9MA 1ZUD1 3WLTA 4R6XA 2BVNA 3IPLA 2JASA 4TWZA 2WQ7A 4MB2A 4C87A 3A1VA 2C84A 2UZ3A 1K7FB 4NYMQ 2ZPAA 4O4LA 3THWB 2BP7B 1G5IA 2D5IA 2JDIA 4MV9A 4L95C 2NZWA 3FUWA 2A3RA 4Q7MB 3UEOA 5BR4A 1Z4IA 1PZFA 2K2WA 3A31A 4RGVA 5A4DA 3L06A 4NV0A 1KO7A 3OQPA 1K97A 2Q0QA 5B3JA 2JGDA 4BEBA 1U8UA 5I7EA 1NNI1 4Y98A 5IAEA 4AX4A 5T6MA 1JHYA 4CV3A 3H13A 1H2YA 5G3YA 1QR2A 3P9SA 4JLNA 2Z8XA 4R69A 1POWA 4YCAA 4K3VA 1VLJA 4MUFA 3PC8C 4L1KA 1B26A 5A9SA 5BV7A 2PUTA 3C43A 1QIEA 1SPBS 1RHUA 3BD6A 3KDAA 2J08A 5EP2A 2WF7A 5DBFA 1JKXA 5J59A 1RE0A 2C03A 3B2EA 3K5PA 1JECA 4I1OA 3FTCA 1CLEA 4Q93A 1CUZA 2QVLA 5IT5A 1EXVA 4RTKA 2D2VA 5C8DA 5HHTA 2A1TR 3LOQA 4OYRA 5T3YA 1B0PA 3DUFA 3DWFA 3AHCA 4Y9UA 3R7DA 3P7MA 3EUEA 3LQQA 5A9SB 3N59A 1G21E 4EW6A 1RAHA 1HFWA 2WEKA 3EG5A 4E2WA 1E7MA 1L7MA 2A0YA 4UQPA 1OX4B 3WBFA 5LMCA 4GPD1 1F6DA 3GCGA 3GLKA 3RC7A 2V74B 2XTMA 3AX6A 5D1NA 4DM3A 4ETIA 3DUFB 5EIAA 2YFYA 5FTLA 3QVGB 3RC8A 4DAEA 1Q1BA 1QXSA 1TD1A 3PT9A 1ILEA 3GG2A 4WFQA 4MYCA 2ZATA 2Q46A 4FSDA 4MQUA 4ISCA 1E3TA 4Y7DA 2BDUA 3QFCA 4OM7A 1CF4A 4MWZA 1BX0A 5DIFA 2XQIA 3FDJA 4G81A 4H3SA 3DBLB 4KTVE 4FE7A 3AHHA 2WWIA 1QONA 3KKLA 1W9HA 5JSKA 3U7QB 4EPRA 3C8DA 4QTYA 4DB4A 1FFSA 2FPOA 4NX2A 2GEBA 4ZAYA 2QTBA 1NLFA 4DPLA 5K3OA 3E2MA 3T7EA 2YWHA 1PW5A 3S8EA 421PA 1E9FA 1L5KA 3E5RA 3JQ6A 2PUAA 2R8PA 2ZUUA 3AI1A 1FSGA 1KVQA 2WRZA 3D5QA 5DCLA 3D3WB 5A04A 4F5WA 2VCYA 3WAJA 4H1TA 1H2BA 4M88A 5BPHA 4PO9A 5HMMA 3C39A 4DNOA 1RRGA 1U65A 2QD1A 3AP3A 4G2TA 1DQSA 4KH1A 5T4BA 3D7KA 5BYJA 5F5LA 3PA6A 3MFYA 3W4JA 4BZQA 3LTNC 3CH7A 1Y5RA 3A6FA 4R0NA 4TLCA 1ZMRA 4LRUA 5E7JA 5AW6A 4MLDA 3S2EA 3MM4A 4AS3A 4INJA 4MWBA 1B8OA 2IZ5A 2IOYA 4UCFA 4CLRA 2CXPA 2WIDA 3KZ1E 3OMWA 7ADHA 5KREA 5FJIA 5A4AA 3GLRA 4EG8A 4W5RA 3L7MA 2C1ZA 5FTNA 4Q9DA 2C58A 1PLLA 3PWSA 2GR9A 4EJ0A 2XUHA 2ZR9A 1XXHE 3WYNA 1GZ7A 3GP8A 3N39C 4A1OA 3UUFA 1XKXA 1BEUB 2G77B 3CLRC 3FCEA 3LY5A 4L0CA 4U3JA 4KGDA 4PZEA 3S28A 1JR3A 2H17A 3A9CA 4KUEA 4UMFA 5CXXA 3S0JA 2PUBA 3LZDA 3VH1A 5I5GA 1O8BA 1YJQA 3PR1A 3Q87B 1IZ0A 5E4FA 4I4CA 2VJLA 1PEKE 1U8AA 3O90A 4NVRA 1PGJA 5ITZB 5TPWA 4ZYTA 5AVUA 3K0SA 2ZYIA 2P9QA 1T2EA 3ANTA 2J30A 3UICA 4RW0A 3NLLA 1W4AA 3IVGA 2EKPA 4JUAA 1GRNA 1FDRA 2YQ5A 3S5UA 4B43A 2ZXUA 2V03A 1RRKA 1QQTA 2BZ1A 2F1OA 2JFQA 4N5LA 1R64A 4MICA 4PG5A 4TT3D 5ESRA 4HDRA 4F4DA 5HJEA 2DHDA 2PPLA 1GQQA 3DP9A 3BDIA 3EN0A 4P58A 3BFVA 4EOGA 2VCHA 2EKLA 5J63A 1ZR4A 3LKDA 4X97A 5TPWB 3S55A 2A1TS 4ZK6A 4Z99A 3IE2A 3RPEA 1ZBQA 2JANA 3BRWA 3QVTA 2R84A 3LPLA 3JZDA 5JZSA 2PRSA 3H75A 1UDBA 1EG7A 5CCEA 1YI1A 3AI2A 1N2HA 1H2FA 3QBVA 4HDRB 1E64A 4P5EA 4CTOA 1TEHA 4W1PA 2IXBA 3M4XA 3TSZA 4I9GA 3B7PA 3M81A 4DR4B 3EZFA 3U56A 1M10A 3QM1A 4KE6A 3P26A 2FWIA 1YMUA 3FZEA 4QUDA 3VVCA 1ZR2A 4MA0A 3ZJVA 1A72A 2NZVG 4M55A 4DUGA 4EJ2A 5JI2E 1RC1A 4X64B 1WXHA 2P35A 4YJGA 2BGNA 4HT3B 3NBQA 5MGNA 1KH3A 4AQYB 1JT2A 1E9DA 2C2WA 1KVUA 2EXXA 3WADA 1UMDA 5TF4A 2AFRA 3I1JA 4KRGA 2NV0A 1RPJA 2VJNA 3W04A 1DIHA 1CY8A 1UPTA 1U90A 2P6NA 1II0A 2J0UA 1UINA 4FMDF 1K5PA 1GEGA 1N2EA 4YJGB 4PBRA 1Z2CA 2SICE 2V7XA 1FFBA 3NTOA 2QUJA 3QV1A 3HCNA 4LEIA 1UMDB 4QXAA 2VPZA 1R1DA 5I9BA 1SHKA 4OX9Y 3IA7A 4H7HA 3E8XA 2YZNA 3G7NA 4C6HA 3H5AA 3GLGE 3QW2A 2GLTA 4FHCA 2J0UB 3BERA 1AUVA 4R1SA 2NSYA 4ZXPA 2A9FA 4CQLA 2G28A 3GT4A 2EF0A 2FZWA 1Q1EA 4HQOA 5FWAA 4BO4A 3CO0S 3EIQA 5JAUA 2EQAA 5AXDA 2BTEA 3T3GA 2EX4A 2I29A 3TLCA 1FUYB 3AVUA 1G8HA 3GNQA 2A4KA 4RC9A 2Q50A 2XYPA 4I55B 4W99A 4UU0A 3EEOA 4RVUA 2W2QA 4WDQA 1CT9A 1CZRA 1K63A 3COZA 2PS3A 1Z5WA 1D0VA 3FKJA 4UVIA 2YASA 4X92A 2O2GA 3FOFC 4NZYA 2ZTMA 3ZD8A 5ES3A 2Z09A 3DT6A 1KU0A 2CHFA 4ARZA 1QVWA 1EVIA 2DOKA 1EUCB 2HUPA 4QOEA 2ODNA 2DECA 3GVCA 3WYCA 1VSVA 3NEPX 2Z6AA 1Z0IA 1AKNA 1CJCA 2O54A 4Z6KA 3B9QA 2P5TB 5ALMA 2ZWIA 2O7VA 1XCPA 3HB7A 4N5HX 4YDSA 4EY4A 4EW3A 2E4WA 3K5IA 4OHFA 1WG8A 2WVGA 4N7JA 1HFKA 1T9GR 1WY7A 2O2SA 3KP1A 3PEEA 3II6X 1SG6A 2O1XA 2XYGA 1VIAA 1DELA 1EUDB 1QUEA 2VT2A 3LXMA 3R20A 4W82A 1FSPA 4GZMA 1QGYA 3IV7A 2P79A 4NCKA 2P75A 4ILEA 4F4CA 5D86A 3SSAA 2JLBA 3T4PA 4NDZA 3Q11A 1X7YA 1DINA 3C15C 3ZU3A 1GQRA 4Y6PA 2FX3A 1C7RA 4DLVA 1CP2A 1OWLA 2A5LA 4HYTA 1JKFA 2ZRJA 4G8CA 1DAGA 2AOUA 3S1AB 3VHXA 1YB6A 4HQ6A 1YFLA 2OD7A 3QELB 1C80A 4RE5A 1X7YB 3RS2A 4UD2A 4LA4A 4K6CA 1ZAKA 1SB8A 3AF0A 3JQAB 3MGKA 1Q3KA 4UATA 1PT5A 4WVFA 5C35A 2RIRA 1H4SA 2J9RA 2UUPA 2FPMA 2H7VA 3MOSA 2JLWA 2IXFA 3HYLA 4JHLA 3WS7A 1UBGA 3DONA 1AHIA 4IKOA 1UADA 3FGZA 1RPNA 3ROFA 1OT5A 1RYEA 2WVHA 4FE4A 1N2BA 4KI7A 3QLEA 3S68A 4BE9A 4F5EA 4HPWA 2CXQA 1U0OC 3V3TA 5FEUA 1GDTA 4XR4A 2YIDA 3LFHA 1RR6A 2MYNA 1EGHA 3UJAA 2Y1OA 2HV9A 3FCYA 1WJGA 1W6RA 3KJFA 5J2TF 5TJHA 16PKA 2GAJA 1Y4AE 5AK4A 3EPJA 1QX3A 1JU9A 2QL9A 3KTFA 1XC7A 2VNHA 3D02A 1MUUA 3DULA 4QUJA 1NXWA 1M8KA 1SMKA 2JZNA 2MSNA 2UZ1B 2BBOA 2C04A 2JKZA 3CPSA 3DE6X 3H4VA 4HC4A 4I1SA 2ZQYA 4KQIA 1G6KA 4M0PA 4C7MA 1BVUA 3ETDA 4KIUA 1KQOA 4J2HA 1O94C 2HMAA 3SHVA 3UB2A 3C4JA 4H6WA 1KZHA 3QV2A 3NHPA 1M0EA 4WLFA 3NDPA 1UZUA 2FEXA 4IHJA 1YZ3A 3VKUA 4F9TA 3P71T 3LVRE 5T3UA 4DL9A 2IYTA 3IR6A 2YVLA 1MT0A 1IZYA 3OE5A 1E62A 3F3KA 2ZG6A 1BX3A 1ZVMA 6CHYA 3NHAA 1BFKA 1N75A 2ZI3A 4RDHA 3UVEA 5KIAA 3CYFA 1RMYA 1UBJS 1C9DB 1RABA 1TMGE 4WWHA 4K6GA 3VM6A 3RCBA 3D7LA 3HN7A 1P18A 4OQEA 4TMKA 4B34A 1P0PA 2ZE5A 2ORED 2Q8PA 3R5FA 1G5PA 1R27A 2DHCA 3H1EA 2H1LA 3AM3A 2EFHB 3BXHA 4MAAA 4MIOA 2Q2OA 2WHPB 3LSTA 2QRQA 2GLUA 3VR3D 2WE8A 1VE6A 5DLDA 2Q5OA 1JMVA 4RPKA 3PRJA 2Z9CA 3OCZA 5HVNA 1W34A 3O91A 3OCJA 4BNYA 3TLMA 1NXXA 1PFGA 1XCMA 5FPPA 1R5BA 1V2GA 4QOGA 2C00A 2YIMA 4LN1A 3H42B 1SIOA 2JLZA 3DDSA 3EGOA 1MOZA 4MDEA 1ZG3A 3RI3A 4FGWA 3NJRA 2PSSA 3IUJA 1V16A 2HA7A 3WGGA 1N5KA 4Q7LA 1WX1A 2E89A 5AJUA 3FUTA 4MVJF 5FBWB 2TRSB 4D4JA 2NOAA 3JALA 4RLHA 1RWNA 2VH1A 3DLAA 4K9KA 1MX9A 1DAPA 4C78A 5K20A 3MWDB 5EJMA 3EIWA 1I3OA 4FEGA 3C5HA 5LDGA 2GN9A 2R8EA 1NBAA 2YJ6A 1W8IA 2CL0X 2FPRA 3NXKA 1U3CA 1ZN8A 4F0JA 5AP9A 2VYCA 5IH3A 3T52A 1IVSA 1T5LA 1I5RA 3E9ZA 4FFSA 1VIDA 3VPCA 1M1XB 4LOAA 1Z0DA 3ZYCA 4KFTA 1ZIYA 1OBFO 1GN9A 5HIKA 3C6ZA 3S7TA 3QWBA 4YUYA 1KRXA 4J16A 1YRYE 4KC0A 5KU7A 1XSEA 4ON9A 1BRMA 4I3HA 4QPZA 1IMOA 3NGMA 3JQEA 1PJZA 4CN9A 1LC0A 1UC9A 4PS1A 5BO5A 2XB6A 2GHQA 1M7GA 2GD0A 3OURA 4QPPA 4CMIB 3ZHSA 4BX2A 3FY4A 5IHXA 4TN5A 5TVKA 2CT8A 1GUZA 2RCNA 1UWVA 1ZGBA 4IDAA 4Q01A 5ICMA 2V7UA 3THYA 1ESDA 4ZYVA 1UOQA 1W29A 2BMWA 2QL6A 1N8SA 3QWIA 1T2NA 4XARA 2H18A 2JS7A 4E1AA 4EA6A 4Z7OB 5FOQA 3CUTA 3FLEA 1OLSA 4RFVA 4R1OA 1DI0A 3KPVA 1MC1A 3QUBA 3VPGA 3K0HA 4B4KA 4BQOA 2HEGA 2Z1MA 2TMGA 3R6TA 1EEXB 1V11A 4JBGA 1XZGA 3S27A 3SK0A 4ES6A 3QI2A 2F43B 3THYB 1U1DA 4OJYA 1J39A 4YJFB 1QX4A 3HXOA 2X42A 2VZ0A 3TQOA 5DJ5A 3GPBA 3R24A 4XSHA 3SR3A 1WNFA 1DFHA 3WGNA 4H7JA 3GA0A 1D0SA 4CR7A 4C2AA 1E2KA 1RZRA 3RJZA 1T2DA 3T7AA 3VKGA 2FEKA 4KZPA 2YV1A 1NRWA 2PL5A 2M6SA 2W93A 5TT1A 1RWPA 1KO4A 3TR5A 2AEFA 4ZVKA 4C3ZA 3H8VA 1IXRC 2WTNA 4LXXA 1CX9B 1S1MA 2XBUA 4AM8A 5HA5A 1V3VA 3OTHA 4KRFA 1Z7BA 5DW3A 2CNBA 1WVMA 5FOUA 1KKLA 2PXCA 4EB0A 1JEAA 3OIFA 3LRTA 4XUDA 4BFZA 4DLBA 2GSWA 5JCOA 4YCSA 5EXPA 1Q77A 1S3IA 1N6OA 1PWHA 4HRYA 2VVTA 4ND7A 2OGSA 4RK1A 3A58B 1YCFA 4UMVA 4WGGA 2PSFA 4R8SA 4PRLA 4RSGA 5E38A 2Q4OA 1MF7A 5I9IA 4DILA 1NVVR 5HKBA 3GI1A 4W5QA 1MO2A 5FXMA 3CKKA 1KYZA 4X1OA 3R6LA 2BBSA 2VXBA 1CUEA 1S7CA 3DFIA 3OQ1A 2LCFA 4LY3A 1N7IA 2PKQP 4NMLA 3QF4A 4EO4A 4E22A 2ZRAA 2UZAA 1ML3A 1TT7A 3OOEA 3ACCA 1EFPA 4JB3A 1PQPA 3NX4A 3ODGA 1CUVA 4GRIA 3KEQA 2DZDA 1VSTA 4B09A 4WN9A 3STVA 3VR6A 1P6UA 2JW5A 3ETLA 3OEED 1BS2A 4KO2S 4MR8A 5CNMA 1CD5A 1Z08A 4CI9A 3L7BA 4DIUA 3SIPA 1YASA 1X92A 4KPGA 5JO0A 4BMZA 3RRFA 2OVBA 4UM8B 1EFPB 5EKTA 2EKZA 4BGDA 1TW2A 1YKGA 2BELA 3DQZA 2CJYA 1FIUA 5F9FA 4QXOA 1P4HA 1WABA 5FADA 2VWQA 1FMFA 2Q3JA 2H1CA 4MR8B 5GJCA 4E3WA 5A4MS 3WHKA 3R6WA 4XJVA 3R9KA 1B23P 5EFOA 4B82A 4LJ7A 4QGBA 3IFSA 3DNMA 4NOKA 1A1VA 5K99A 4C29A 2QK4A 2OESA 2JVJA 3F96A 3KEOA 4OQMA 1IQUA 3D4PA 3DVAB 4BP9A 4G0OA 3P9RA 4LYAA 1QE3A 2OQVA 4ZTZB 4FMDB 4AKSA 2I7TA 1TYBE 4WA8A 5FYQA 2OV3A 2X9NA 1GKKA 2YX1A 5IJAA 2WTUA 4FTWA 1X1CA 1L6RA 4G5OA 3GLUA 1GPWB 1M7HA 4K8RB 3W6OA 4IH9A 5DLYA 1V9CA 4ODIA 1N36B 3UGTA 2BZSA 3ZJ4A 4XVQA 4Y1EA 5C80A 3V7FA 4UBKA 4P0PB 3WO1A 4RMHA 3QTLA 4AUNA 3Q9UA 2PKRA 4WGFA 4ARIA 3TTUA 2AF3C 3Q5GA 4YP9A 5JWRA 1UL1X 3PJGA 1NFFA 4O2BA 3JPWA 1DC7A 4REMA 3NOOA 1KY4A 5ALTA 3CRNA 3DM9B 1CE8A 3BMNB 3IUQA 4NJMA 2DHQA 4U2GA 3WDKA 4AY5A 1DMRA 3H9CA 4Y2UA 1WHSA 4JB0A 2H7XA 3I64A 1XTBA 1BCRA 2MJLA 3KXDA 5EXXA 5EQTA 1VCNA 4KNWA 4LXYA 2P11A 4PC3A 3SM3A 3OIGA 3VMMA 1T9AA 4IIUA 5AKYA 1NR7A 1RJFA 5IEBA 1CE8B 4NJMB 5JFTA 3ORFA 1TZCA 4R1PA 4F1JA 4WBNA 5B53A 2RC6A 1PQ4A 4XAQA 3DG9A 5JAIA 4NMMA 1H9BA 2H2HA 4U6NA 1BCRB 1HETA 2RAFA 4FSHA 4EP1A 5JSQA 3UAYA 2RKBA 4JXJA 1Q0QA 4QQKA 3RSCA 1U02A 1V4BA 1ZRNA 1X7DA 2QDKA 2WSBA 4DDWA 2J0EA 4I1IA 1CJVC 1FSFA 4RV4A 1QKIA 2JGKA 4II7A 3LOUA 5HQTA 2F59A 1C1YA 3UXMA 2JI4A 4W8OA 2NPOA 2C1XA 5AI0A 2VQ3A 4XB1A 3PIRA 4EGJA 1QFXA 3UAGA 5AW4A 3CV3A 3UWPA 4PVDA 5ALVA 5E6RB 4X54A 5A0FA 4CMGA 2CYAA 2UUBB 3AIMA 3E5NA 1DKUA 3TI9A 3V7UA 4JEIA 1TQ6A 4L4UA 1GZVA 5JSUA 1VPVA 3ZVMA 1XRNA 3A25A 1CUWA 2I1QA 2P9HA 2W37A 5IUKC 2ZEJA 4JYPA 3TBFA 1UIMA 3WLFA 4OFBA 1YS7A 3IBYA 5LCXA 1E1YA 2VSYA 3V4PB 2W42A 1GNRA 5ABPA 4QO7A 3AB3A 3MCUA 4OF4A 3CEAA 4QJ5A 1XQWA 1XZHA 1G8SA 2HRRA 3SKXA 1U4SA 5L40A 1ZLYA 1OU0A 3B7WA 3MS4A 2WZCA 2QT0A 4LOJA 4PCLA 5HE8A 2QNIA 1R88A 4MQLA 2HQRA 4Q3OA 3F9IA 5EEGA 3HVJA 5TEWA 4GKKB 4UZFA 3SHTA 5FWYA 4DC1A 1ABFA 2R1TB 5AM0A 3KQQA 4DWWA 4B6SA 4AKGA 4X1YA 2G7ZA 5K6AC 1AU9A 4MUJA 2BL4A 2B6HA 1NSTA 1P5HA 5J2TB 1OBHA 1CY4A 2VZLA 3RV3A 3AZOA 4D9KA 5BSEA 4B0OA 1RHKA 2GEFA 1ZUNA 2IDKA 3F47A 3N2NA 3KAPA 3B2NA 4EJFA 3V1UA 5LNK1 4UAJA 1DG3A 1JKIA 3IUYA 4MJXA 4RZQA 4J9UE 5FWYB 1I24A 3O94A 2H3HA 5F51A 3G1TA 2YZ7A 3OQ6A 1RYBA 2YZKA 3EEFA 3Q9LA 3QVJA 4X1YB 3M83A 4CQJA 4EAAA 2HHHB 1YR9A 2CDCA 1DTEA 3DBHA 1PRYA 4HWGA 4DRXA 1ZUNB 5BPFA 4QBTA 1GWNA 2GJAA 4E46A 1XTSA 4M1MA 2HH9A 1L1FA 4B3GA 1NY5A 4W8GA 2HBZA 4EJSA 3H8JA 1MHTA 3M5CA 1D1PA 3A1SA 3I83A 5H68A 1U28A 4JP2A 2DR0A 3H11A 2ODAA 2Q9CA 5AI5A 1JAYA 2GZAA 2WPDA 5GVRA 2FEMA 1DEHA 5KKCA 5LQMA 4Q4CA 2JLVA 4KHPB 1H2RS 5ENVA 3B53X 5GGYA 2H1RA 4JEHA 1C7ZA 4HXYA 5DVZA 4F3TA 2P78A 2RHTA 2G88A 4XASA 5L8VA 3TW0A 3SQDA 1JXQA 3BE8A 4WOCA 3KQLA 1SIUA 1KI8A 3ANMA 3O4IA 3H11B 2AGVA 1Z88A 5AKJA 1AKWA 5GAJA 5FWDA 3RKUA 4D41A 5FTKA 1T26A 1SG0A 5JQGF 4OMDA 3SR0A 1QFSA 3C8ZA 2B1GA 3BWDD 4LMBA 2YFHA 4UD6A 1YHNA 3G23A 1FYFA 4WCFC 3RE1A 4CM6A 1DAOA 3TL6A 4BMCA 3CG4A 1W19A 1GNQA 1VL5A 2NUBA 5JCZA 1N5DA 1Y4SA 3X1JA 2EU8A 5H4GA 1R4MA 4WZAB 3TUZC 1ZN2A 4FYJA 3C3PA 1EPUA 1KFBB 5BN4A 3JWJA 4PPQA 1QHXA 3B82A 1HDEA 4WJZA 3GOHA 4HFRA 1NBEA 3JQGA 3ZLUA 2Y68A 4EHFA 1YT5A 1BKYA 4GPEA 5B6JA 2ZYSA 3BMXA 1R4MB 4IPTA 2CFOA 2JFWA 2XX3A 1ZCBA 5NLLA 4Z3OA 1M0WA 4RTRA 1X86B 4QX6A 2VYFA 4KLRA 5BN4B 2C0PA 2J0VA 3PE4A 4HEA6 2Q7OE 4CM8B 2DH6A 4C08A 4KXWA 4HLDA 3HNOA 1ZJYA 2I7CA 1DJQA 5GJVC 3ACBA 4AN4A 5HR5A 3ADCA 1KJIA 1Y8ZA 3K9CA 1CUBA 2I2WA 4HLCA 4ZT5A 1UT5A 2QLMA 4HF7A 2IZ0A 4NIMA 1BROA 1YQEA 2CXSA 4JIGA 1FTNA 3G2MA 4RVCA 4UOQA 3C87A 1KS2A 3UV7A 1DC8A 1G3QA 3ADPA 3AM4A 5D3ZA 5LR6A 3K6RA 5DYNA 4AJHA 3C74A 1G4AE 2OXRA 3AF6A 1E2JA 2D00A 1SN7A 3KTAA 5BORA 1M1YA 5JAZA 3IAEA 1KI3A 4OAOA 3EW7A 2R8YA 1L7DA 5CCXA 2OSVA 1VL8A 2XYRA 5K3FB 1OA1A 3V9AA 2FUEA 4DC9A 2OYSA 3F46A 3KUUA 1TUIA 1TYZA 1W4LA 2OE2A 2OZLA 3SKVA 3LQKA 3RTDA 3TUIC 3HVKA 1P45A 3WQQA 3RROA 5ALRA 3BT7A 4MEBA 4ZIRB 1KFJB 2X2EA 4M0EA 4U4AA 2BSQA 2XBLA 2RKOA 3H7IA 1U7TA 2YYZA 4LPSA 1AK1A 5CFOA 2AUMA 2BFFB 4O4JF 1LPNA 3V1NA 4B85A 5F3WB 2WJJA 2HA5A 1NJ6A 1YRLA 3W5UA 1IHPA 4C0AC 1ZK3A 2PUGA 1NPDA 1Q16A 2F9MA 2PEYA 4ROTA 1P1RA 1AN0A 1Q17A 4XZ3A 5IULC 1GNPA 3TIIA 1G1MA 2C2BA 3KBBA 5IFLA 1BN6A 2D5LA 2O8FA 3NCHA 4B17A 2GT1A 2Y93A 1Q7EA 4F45A 4DJAA 1GG9A 4KVAA 1LDNA 3RF7A 2ZIGA 4JZYA 1TLLA 4H59A 1QS0B 4MQBA 5DTJA 4DGQA 2VTEA 3RSLA 1OLOA 2BGUA 2Q3LA 1P0MA 3RTBA 5ES4B 1FMTA 2CMKA 2ZFUA 3DS8A 2P2NA 3BQMB 1TL7C 3JAWA 3RFUA 4DMGA 3GLFE 2N9UA 2O8FB 4TXMA 2ZSAA 4CJXA 4N3AA 1DBRA 5LXTA 4YHBA 3K15A 1JH9A 4YCBA 1FS5A 2HK6A 4TXNA 3TNFA 1KYIA 2P2GA 1OBOA 2VK8A 2HSDA 2ID4A 2RK3A 3DL4A 3K0AB 1CDEA 3PX3A 2R47A 2XUAA 3ENNA 1PJ8A 1WXIA 4IP0A 3W3ZB 3JAWB 2G0NA 4OATA 5BN3A 3QY9A 3TNLA 4JT4A 3OKCA 1SKYB 1SIBE 1O6ZA 3FB4A 3PWZA 4AJ4A 3V1KA 1J2TA 2D54A 1B15A 1DL5A 4XB6B 4IIVA 1T1IA 4J0GA 5J5VA 4HSEA 4B3IA 4NJEA 2Z0MA 2JFXA 3RIHA 3TLXA 1QIGA 2FWPA 4GRDA 4CN8A 1EVZA 4IY1A 4LVOA 3W9YA 5BN3B 5IHPA 4YJ3F 4RM3A 2NT4A 4UTXA 2YHBA 3GRUA 2EIXA 1UOEA 3IRUA 3P2KA 4OUDB 4WXMA 5TDHA 2B1RA 5FBVB 3GLIE 5JU6A 3GJYA 2XDAA 4MUBA 1ESNA 1GZSA 4MV6A 2MU1A 2YVKA 4PZUA 2DUUA 4ITUA 4RTMA 1N0IA 2R7AA 1OB2A 4KOEC 1BHO1 1JAHA 4YN3A 5KTSA 4LYEA 2FOXA 1WUYA 1Y81A 1NLUA 5JCJA 4CKBB 3KSUA 4JIMA 5KNCH 3K9FC 2A8YA 3AVPA 2FSHA 1RS0A 3PYMA 4UW9A 3QE9Y 3AG6A 4HLQB 4C4XA 4PM4A 4RTNA 1KJ9A 4C4PA 1NVEA 4GEGA 4PYRA 2YUTA 2WSSA 3OT4A 4D9FA 1M6VA 2I87A 4GX5A 3HB4X 4M76B 4RGYA 3QEBZ 4L5YA 3ADKA 3WL3A 4OJMX 2HXSA 3OP4A 1JIIA 3N8IA 5CFNA 2GFIA 5KMGA 2FMIA 2AG8A 3SFTA 4KQGA 2JHFA 2FN9A 5SZJA 3PQ7A 4F06A 5C2JB 1GG2A 1Z26A 2Q21A 3AUYA 3LRPA 3QK7A 2LTAA 2J9YB 5KBYA 2ZRFA 4G36A 1NW9B 4EA7A 2DETA 5HNKA 1ODKA 1Q1ZA 4NOLA 2POQX 3EIOA 2PXAA 3IE1A 4ND4A 3JQ7A 3LDAA 5CB8A 2ZJ0A 1OWNA 2EWWA 2FZEA 3MUFA 2FXIA 3URMA 1UPAA 4TRMA 5KYGA 5C4MA 1MAVA 1BO6A 2OV1A 3ZQKA 4ZCPA 1RVDA 1AZLA 1SC1A 3D1JA 4BFLA 2VYNA 3ZY4A 5J1SB 4B2LA 5EIFA 1ZRSA 2I8LA 2YHSA 3KZOA 4YWHA 4CTNA 2QLTA 4LNUB 3DMTC 3BRSA 4AW9A 2A6PA 3FJ1A 3N58A 4FGLA 4G8BA 4M1ZA 5F12A 5LUBA 1JQEA 1ZD9A 4GLOA 4JENA 4NG5A 4R2XA 5KYWB 5LYJF 1SVWA 3B6JA 4L0DA 2WBLC 5JMPA 3ZGVA 5EJ6A 1YR1A 2NU6A 1KJQA 4ZC8A 2PLWA 5KVQA 5KO2A 4UBOA 3T1HB 1Z37A 3COWA 1W59A 2XTZA 1UOOA 3F5FA 4GMDA 3F2IA 5EJFA 7MHTA 2ZANA 3NNDA 3SPXA 3TGLA 3GBVA 3EA5A 3HBLA 1BNCA 3EMDA 4RVOA 1RTTA 4YMVA 3NJ8A 4LZWA 1RQNA 1JIQA 3E5HA 1OAOC 4COKA 4CT4B 2G72A 5DKFA 4ZHQF 1DADA 3HKEA 3HCPA 4EFDA 2HK7A 2LP4Y 4P3XA 4FDLA 2YN4A 1JEEA 3AG5A 2INGX 1PR0A 1HFJA 2QMUA 1VJGA 1V1RA 2O3QA 1E7WA 1JG2A 2JFOA 4ZT3A 9ABPA 1F7UA 1JHZA 1WXGA 1HEUA 4RL4A 3UT6A 3HKEB 4CEIA 4E12A 1YNSA 2Z57A 3ERCA 2J67A 1KAGA 3SYMA 3ZVNA 3HM9A 3QITA 2GK4A 4IFBA 5IM5A 4S35A 2UZ0A 1NP6A 5EHGA 4U63A 2GEDA 1PJ3A 3ZJUA 1ZJ6A 5C32A 3M49A 4B7CA 4PZLA 3B85A 4Q02A 4DA7A 5AUOB 4RAOA 2ZSHA 4GDMA 2QR5A 4Y2HA 1UZNA 3LNCA 3D2CA 4QAJA 3JRNA 4TYMA 1MQSA 4UNIA 1MC4A 2MSLA 5AVTA 1S0UA 3LD9A 3OJWA 1R9MA 2FW0A 2WD8A 3U0BA 1Q0UA 1CJMA 1GY8A 4C0XA 3SIRA 2FF5A 1ZISA 2JFGA 2IW3A 4XX1A 2IH2A 3T1YB 2IS6A 2RGNA 1QQ7A 1WB6A 3EIFA 4XFJA 3CUWA 1Y9ZA 3FD8A 3PE3A 4TL9A 3RYFA 4M36A 4A0GA 1K8ZB 3GGCA 3GELA 1OF1A 4AY4A 1CEYA 3KJQA 4ARUA 4R05A 2XHEA 3U44B 2AUTA 1SK8A 5IN5A 5T57A 4YEDA 1LPBB 1R4NB 4GGMX 1J70A 2BGGA 4M1WA 2V58A 2V7GA 4MI6A 5TMPA 5G1PA 1GTSA 2YJNA 4RHXA 4TWRA 5F73A 4H3HB 3G8BA 4P08A 3A9TA 2VG8A 1D7OA 3TX6A 3N86A 5KWSA 1M1NA 4Q12A 3FDXA 2JBAB 2YV5A 4XLLA 1WKCA 1LPMA 3H6GA 3BPSA 2QVZX 1MFPA 2JFUA 5BV0A 1NUTA 4UDNA 1QO0A 3TGWA 2OUIA 2DEUA 1ZJ4A 2PH5A 2FMXA 1F8UA 3P2OA 1JLKA 4L8GA 5JQGB 4WY8A 2PX8A 3OLWA 3CJTA 4IVQA 1QLJA 3ZLBA 4HZIA 2ZBVA 1HLDA 4JJAA 5C1DA 5H82A 4K1LA 1M1NB 1X7XB 4YJHB 3AR9A 1IZ9A 2A57A 4PINA 1ZKMA 2P4EA 3ND8A 3L49A 3N0VA 3SP1A 2K6GA 1DKPA 2OFOA 2PTGA 2OUKA 2O2YA 2PRIA 2ZUDA 3N2EA 3N2YA 4L73A 4TQ9A 2BZGA 1MO3A 2C8LA 1AMOA 4GT1A 3OTQA 4HDKA 3QOFA 3CKLA 5AH0A 4Y1FA 1E0DA 1YIAA 1ZC4A 1KZ1A 3I8SA 5EP4A 3AQ4A 2XXJA 4EVQA 4FINA 5JD5A 4MRAA 3K70B 1QGDA 1P72A 3MD0A 2XXBA 4YASA 4B8ZA 3V34A 1T9HA 1DIAA 5M29A 3H9BA 1OFUA 1Y63A 3ISJA 4FGSA 1MXFA 4MW9A 5FLEX 1HPLA 2SKDA 5KCMA 4LFCB 5KWEA 3Q3EA 4M4SA 1KEPA 3UK0A 1PDVA 2E0IA 2KM1A 3USCS 5DOVA 5KTTA 1F8GA 5TS3A 1W1UA 3W6PA 3IVCA 1EGAA 2PBRA 3D3QA 3JQ9A 5F2NA 3HZHA 2Z9DA 3U37A 2IDJA 1VMEA 4EW1A 1QCCA 2R48A 2R68A 3P0FA 3GJ8A 4XW2A 3ABRB 2VSOA 3SC2B 4BJHB 1RHRA 1AGPA 1UBEA 1G8JA 2ADFA 4BTLA 4GZLA 1NW6A 4KW7A 4NULA 1C2TA 1HDCA 4QICA 2I2FA 1FBTA 2I6FA 3RJ5A 3UW3A 3GUHA 2YXLA 5I8WA 3G5MA 1OBVA 4O4JA 3V55A 5EKUA 1BJRE 1ULAA 1GUFA 1QDLB 1Y3BE 2ADOA 3QPCA 4GOMD 4EHAA 2AHOA 4ZVQA 2VPXA 1DQRA 4KMRA 3ZU4A 2CJFA 2Q4RA 1A2KC 2OB1A 3WNCA 1UFQA 2DVMA 3GMDA 2GVDC 6NULA 2CLIB 2PX2A 4NAUA 1E4VA 4RVGA 4QARA 2EJUA 2QHXA 3DHYA 3GHYA 4RD1A 3BWEA 3IEKA 3TQSA 5ITWA 1Z83A 4IGFA 4MXDA 2WZDA 1JR2A 4O4JB 4WLEA 5DNDA 4Q7JB 5LB2A 1L8LA 2QTMA 2WK1A 3WB1A 4JI1B 1J9EA 4FEEA 4QT0A 2D7CA 2V9ZA 4IXMA 3ZPXA 2XMPA 2M1XA 2PXHA 2OA0A 5KYUA 1OXVA 2ZOSA 2HYIC 5K8IA 4C22A 2ZRCA 2WSIA 1VCIA 1W4CA 4KX5A 4US0R 3UJNA 3WFIA 1K86A 5BOVA 4HDNA 1F51E 4JUFA 1I3KA 4PZYA 5IRCD 1ISHA 5IU6A 1G6OA 3DH0A 4EYEA 2NUAB 4KFRA 4GQIA 3WGJA 4KSYA 4DJFC 2JB9A 3JATA 2FPWA 4P54A 3WRXC 5JS7A 1DAFA 3I5YA 4XXHA 3NH9A 3L8FA 5DTIA 1KAMA 2NMVA 2P2DA 4P2BA 4WH0A 3RUPA 1J2YA 2J59A 1FNCA 2FETA 3KQVA 2WIBA 2IIQA 5E8RA 4KWTA 4RGBA 2K7ZA 3P1JA 3C41J 4JP8A 1MENA 2O5RA 5F5XA 1SFRA 1XTVA 1X1AA 3PDCA 5UKDA 1E59A 1QE5A 4QIHA 3U49A 4UTVA 1XRSB 4PU0A 4YI3A 4NSNA 1U2TA 2Y1GA 3ZE7A 3MTIA 3VHRA 1E92A 2FWRA 4TKUB 5JXWA 2WVAA 2ZUTA 1ENZA 1Z06A 2R8RA 3REFA 1X8KA 3I5UA 3S2GA 4JYBA 4J4BA 3ZVRA 4WLOA 3EH2A 4ETMA 2C5SA 2Y9MB 4ZCQA 1BXKA 2JJ2A 3DMHA 3E23A 1S4QA 2IYWA 3I73A 3L5OA 3NOVA 4HUQB 2HIMA 4KACA 4YJ3A 4ZTBA 5U1PA 5K6TA 5EWLA 1BE6A 1KH1A 2OZEA 2XB4A 2DM6A 2P2CA 4YREA 3EDCA 1X0VA 2HJHA 3AKDA 1N9GB 2PNFA 2X2OA 2OORA 1L4EA 1JDVA 2RAVA 3AONB 4C30A 4YLYA 1ZW6A 1VXOA 4RETA 1IN8A 1QV7A 5DYWA 1ETHA 4QNMA 4YJ3B 1IU9A 4Y9TA 1PFVA 1T8SA 5EWLB 1SQ0A 3ZY3A 4ZJZA 5JNLA 1ECBA 2P4QA 4MGHA 2O2CA 3IAM1 3NKFA 3LC2O 5CK4A 1HDIA 3LLCA 4WE3A 4HQRA 1GADO 1XE3A 1IQ0A 2XWJI 3NHRA 4HB0A 4JBYA 5HMLA 3U2QA 4NABA 1I3MA 4XE5A 2BE9A 2FI1A 2VHCA 4CETA 3UKDA 2VHXA 2QAGA 3WLKX 1RBMA 3M1AA 5GJBA 1I4LD 2EP7A 4E6EA 5JECA 2VDOB 5JS6A 3ZDFA 2W6ZA 3ONEA 4DV0B 5B57C 5LNK6 1IONA 2Q5CA 1EVLA 3TCNA 4QM7A 3R5TA 3PC8A 4YP5A 3ANYB 4DLLA 1ZN7A 1W2HA 3FPAA 3LDGA 3NYRA 1QYCA 3NWPA 3JQFA 5A5FA 4JMPA 4M1OA 2PFKA 1GKYA 1LDMA 5EAIA 1JYEA 3SG0A 4BX9A 4ESEA 1QVVA 3H5TA 4AKIA 2FZLA 2WLTA 3C7CB 1JQJC 2QX6A 3QVVA 5JE8A 4I5FA 5CM2Z 4Q3EA 4XWWA 3OY2A 4JI2B 3U1TA 4B3BA 5AM4A 4GS5A 5EXDA 4A5SA 1KP3A 3AGPA 3PNOA 2VAXA 3D9QX 1EU1A 1E1LA 4MR7A 3EVFA 1ESEA 1P4GA 2OPBA 4G63A 4B6OA 1GYPA 4ND8A 5CYGA 3O8OB 3T5AA 1OFHA 5H16A 1JA9A 3GXOA 4KMOA 2QUAA 5EE0A 3DNPA 3MJ4A 5IKOA 4Z1OA 4GI7A 1NBWB 4QEZA 5KQPA 3SC6A 2UVQA 1DBSA 2QPTA 3RUDA 3UBMA 5CYOA 1KZ9A 3IKVA 1G38A 4MR7B 4H27A 4NFYA 1JYFA 4BFVA 3F98A 3AMVA 4ND8B 3H65A 3O6VA 3M5PA 3BE6A 3T7IA 1CC1S 3PXBA 1FVXA 2YWGA 1JR3E 3LTEA 2PE5A 2R62A 5LYJB 1CJKC 1ODLA 3OHMA 4A1FA 4C4TA 1D6JA 4XWAA 5TARA 4Q9NA 3DEJA 3NRBA 2Q3MA 3OX1A 4ZHQA 3OQOA 1G2QA 1FP6A 1U5CA 3I9JA 5FKJA 2HY7A 1GAWA 4RV9A 2AYXA 1QAOA 2H8KA 1QTQA 1U8CB 2G1JA 4WLVA 5IBQA 4TS1A 2G8NA 2X5NA 1L1RA 2VNKA 4TUYA 2A88A 3MGBA 5CPBA 3L8MA 5EA2A 5L3VA 3E15A 1FFDA 3JSAA 2VK2A 2PGAA 1EX7A 2OHFA 4ZHQB 1X74A 2GMWA 4XM1A 1LS6A 2JFVA 2PSDA 2WKRA 1LQTA 2G17A 1VBNA 3JWEA 4JSTA 5EUBA 1P7WA 3FYCA 1P7VA 4LYFA 1XK6A 3K9QO 4HH4A 1Q21A 2IF2A 3H19A 4JJ4A 1ZD8A 2CFRA 3CT6A 2Z83A 3H86A 2ZIUB 2WZQA 3N05A 1OI2A 4ESVA 3CF4G 3FVWA 3IAHA 4WK2B 1KQNA 4F4JA 2O7RA 3JR3A 1I2MA 6YASA 5LL6P 2IS4A 2VHWA 1MQ8B 2AMVA 3J81k 1BEEA 3OOCA 5AKIA 2O2XA 1PW7A 3LYHA 2XDWA 3FRHA 4K6HA 4YGYA 4LE2A 1WD5A 4EG0A 1KO8A 1RSZA 1TVKA 2X1HA 1YQWA 1M83A 2Q5FA 3CRRA 3NDJA 4B80A 4UKDA 4EKIA 5BUQA 5LDDC 2EDCA 3KQYA 3R77A 1MJGM 2DPLA 5A4FS 1JIJA 1KAOA 2QIOA 3A2NA 4HQLA 1PVOA 4IJQA 4RENA 1G8YA 4C0LA 2BEVB 3GN1A 4OBEA 1A8UA 3RS7A 4ZCRA 4JLSA 1TVKB 2E18A 3S2IA 3PR3A 3B5IA 1SK9A 2XUKA 3KQTA 1Q0TA 1JJFA 1SXJC 5KPDA 1GRVA 3ILXA 1W5SA 5DYYA 4W7IA 5FQOA 1SBQA 2DGDA 4CMHA 1Z0ZA 1AQNA 1DKQA 2BJWA 3RSOA 4H1WA 1E79A 3GIWA 4MKIA 3S5JA 1NJ1A 3OSUA 4MP6A 5L9AA 1RVV1 3T41A 1SU8A 4IM7A 4I8XA 3T7DA 1E32A 2QMQA 1SC4A 1I80A 1GNLA 1XTPA 2YFQA 4J07A 1NJ8A 1UXIA 1JPNA 5JWOA 3IEIA 4GKVA 4JU8A 5ER9A 4MWDA 5I5EA 3TTTA 4DEYA 4LZNA 1AF7A 1ELOA 4QDXA 3FDZA 2FPXA 1AF4A 1NBOA 1BGXT 3GLHB 3SMQA 3VDXA 1USVA 4I6GA 1NKVA 1JBKA 4M83A 1KRHA 1RXUA 4R7GA 4S04A 1R6BX 2H4HA 2WILA 3O21A 3NJ4A 3VR4D 3DLPX 4F56A 3T12A 1BA2A 3BGDA 4QUGA 4AB1A 3TDMA 5K8VA 1FP2A 1NVVQ 1UWCA 3IOMA 2DAPA 4OCZA 1XLVA 3M6WA 2PFSA 2C2MA 5A4IS 5GPBA 1T0UA 1BDJA 2OEPA 3H83A 3EFBA 2NZUG 4WASA 3JXEA 2I6UA 5FTMA 5LBTA 5EWJB 4BYGA 5B37A 4G0PA 4BCDA 4KWEA 2QTGA 1U4NA 3ASUA 2V55B 3OD5A 2RONA 1OCEA 1JG3A 3O8CA 2O4CA 1PL6A 1SUEA 1MTZA 1ZL2A 3LWBA 3OO0A 1A5SB 4KPFC 3O31A 1A9QA 5CA0F 5SY6A 2D62A 3JWIA 1P5ZB 2XOXA 3QP9A 1COWD 2CVQA 1WS6A 1W88B 2GM5A 2HGZA 2VPYA 3A28A 3HA3A 4O59O 1L5QA 1XZAA 3ETGA 2QVXX 4YMIA 5D5PA 4RULA 4BQEA 1HZJA 1H5UA 5D7BA 4KXYA 4ZAFA 4BV8A 4RLSA 1T6BY 1IL0A 2I76A 4JLVA 3IL2A 3KLPX 1VFNA 3VDRA 4OQYA 5KNDD 3MLEA 4CMCA 3WKBA 1M54A 4H6XA 1IUNA 3PUJA 2GS9A 1ECCA 3Q8XB 4IGEA 2GD6A 3C2QA 2IP1A 3HBAA 4WESA 2A0WA 4J7CA 4TT8A 4YMSA 3LK6A 3NM4A 3WLAA 2HFKA 3OQJA 3ZH2A 4QATA 3IQDB 5DM1A 2IS2A 4XKJA 3AYZB 3ND7A 1V7CA 1KZ6A 1FEZA 1LH0A 5KKAA 2BFEB 4FFRA 1M6WA 1TW3A 3VC2A 1PEAA 3OECA 3LY8A 4WESB 4R1UA 2AXEA 3TWOA 2G5TA 5I7HA 5DHFA 3USZA 4R8RA 2B3DA 1R50A 4N5DA 3FOAA 1GPLA 1PFYA 1MIOA 4RADA 4I8DA 4FMPA 1WKBA 3IP3A 4HWSA 4EB6B 2HCRA 3OOHA 3KWFA 2YCLA 3ITEA 3LGAA 3LT4A 3LPCA 3SYKA 1H6AA 3QEMB 4ZAXA 4J0CA 1L3CA 3RRZA 5IT4A 3EPPA 3D6FA 5K8TA 2N75A 5JAHA 2XUZA 2QD2A 1U2EA 2ZS7A 3C6XA 1MKYA 4BU0A 2QN7A 4FEYA 4BFCA 1L5ZA 2QBYA 3UJPA 2WA1A 2HNAA 1N78A 3AFNA 3GL9A 4UHFA 521PA 2FFBA 5SY9A 4XJXA 4O3MA 2CDRA 1U8FO 1N8NA 4A03A 5JDCC 5K4AA 5LVAA 1AQJA 3P96A 1MO4A 4HGZA 3UOAB 1HZZA 3FGPA 3ROQA 1Z5PA 4DADA 3H5RA 5L4NA 1DU4A 1NZDA 3KSRA 2A7XA 1GT91 2UVPA 4OGKA 4RTOA 2PZ8A 1SU4A 4N6GA 2VPTA 1YGYA 5ETJA 5CXSA 4LYJA 4BDSA 1GCGA 2CNOA 1T5IA 2QL5A 1WSAA 1EYZA 1EDBA 3DCIA 1EWRA 1RHMA 1Q57A 4IFIA 3VNQA 4TMWA 3IDFA 2P77A 4BOYA 2CLEB 1IM5A 1JQDA 4JBXA 1KQGA 3UUEA 1R5NA 3DTVA 1O0BA 2YJZA 3A9RA 5AKLA 3LZ6A 1K0FA 4FR5A 4KQHA 4Q00A 3TE7A 1EI9A 1Q84A 2ZTSA 5IAGA 5A3VA 3X1ZA 1A9RA 1FXUA 2IJGX 4OHUA 3LQFA 1CULC 1JQAA 4AP6A 1D5WA 2FPIA 4BP3A 1FDSA 4DARA 2NPIA 3GIDA 1RJEA 1FBNA 1RJ9A 1IG3A 2FMUA 4ZOAA 3W77A 4F3KA 5C5CA 2DPMA 3LCUA 1RPZA 1P1CA 2R4TA 3C5VA 3BGSA 3Q3GE 4MS1B 4DBLE 5IDQA 5EWMA 3TLKA 2C8JA 1XAJA 3EGDA 4GSLA 1HQDA 4J03A 4DFDA 3TH5A 1LDEA 2FR8A 1WL8A 2GTHA 3FKSA 3H0KA 4IMPA 1NXOA 3IUNA 3TB6A 3JAKA 1DG1G 2DMRA 2HK9A 3GBSA 2P0AA 1ZGZA 1RJ9B 1O0CA 3H87A 3AV0B 3WGMA 1II9A 4FNOA 3OTGA 4NDNE 3D6UA 3AR3A 3NHZA 4FR0A 5FR1A 2ZWAA 4B8WA 4F6LA 3PPIA 5EWMB 1TQ2A 4C6TB 3OQNA 5FF9A 1KGDA 2QTLA 2YDXA 1H6BA 3CMCO 3LLVA 5E7MA 1PLKA 4DNFA 3JY6A 1YOVA 4GPTA 5G40A 3D7RA 2YNMD 3ZWPA 2FHSA 1FXWF 1WMFA 3JAKB 2R5FA 4XWGA 1KDTA 2ZUWA 3KHSA 4AUKA 5JSFA 3UMVA 2JI9A 2OD9A 2EL7A 3ZCSA 5LMUB 4FDVA 4FWTA 3V7NA 1SZPA 1SZDA 2ZS9A 2ZUSA 2G1PA 1N4AA 3DLHA 1Z38A 3TG8A 2FPPA 4PR0A 1HV8A 5EJIA 1IY0A 1DRVA 1H3FA 1V43A 2EERA 3FN4A 1YOVB 3JPYA 3LWNA 3N28A 4TV8F 5AT1A 3V2HA 3DMPA 2E4VA 3FYHA 4UFOA 3S7ZA 3HKDA 2L17A 1NQVA 2NVOA 3QMVA 4UHJA 3O8QA 1P81A 3ECSA 4DMRA 4QLOA 3D1LA 5BVHA 4CR8A 4HB4A 5GV8A 5IDYA 1FDIA 2OHGA 1KVTA 3RIGA 5B6IA 2QZ9A 5JNUA 5DSXA 2OK8A 2X3FA 1A95A 3HKDB 2B4QA 2EFEB 4DR6B 2WG0A 3RREA 1NJGA 4TL7A 1MH9A 2PH3A 4FUQA 1LUAA 2IZOA 3MCTA 1JSRA 5LXTF 3T15A 2YY5A 3GWGA 5BVHB 4DQXA 1PNRA 1FUUA 2BGIA 3MGGA 3P4UA 1TVEA 1G0OA 3L8EA 3RVDA 4YRKA 3B52X 2P6OA 4QU0A 1I7DA 1PR5A 1FJ2A 2UUCB 4CM4A 2O8BA 3WYFA 3P0RA 5B5SA 5IDWA 4A2PA 4CM9D 1OAAA 3PT5A 1U9CA 3WL4A 1NSFA 4JMLA 3GFPA 5CA1F 2R6HA 3H99A 3DQPA 5FTWA 3PUYA 3VOAA 2CHGA 4M21A 4TL8A 1XZ8A 3MRXA 5SYAA 3QF7A 5EIXA 3BIOA 4HJXA 2RHGB 5EZYF 3V5NA 1Z22A 2ONZA 2GHIA 3RG2A 4C89A 4CM4B 1NNUA 4M22A 1P4SA 3KEGA 4HDCA 3B6EA 2VRCD 1NX9A 4HGOA 4NI5A 1TZBA 3OLVA 1DAMA 1ZI9A 2P62A 4OH7A 1N5JA 1MDFA 2I6TA 2AJTA 1SA0B 1U0JA 2BEUA 1QIDA 3PC2A 2B0CA 2FUKA 3HY6A 4DSNA 3BRQA 3H3XA 2G8LA 2X5JO 5KU1A 1HF3A 1T5HX 2G36A 4EG6A 4KPYA 4MJ7A 3UJ3X 3KKMA 3PEWA 2D59A 1UPBA 2J7PA 2MYUA 2P9YA 2W2PA 3AUTA 2NNWB 3BWCA 3KJXA 3KOXA 3R4VA 4S1OA 1I0LA 3RHFA 5E3HA 1M2JA 5IXJA 1LPAB 4IS3A 1IIBA 2ZJ4A 3MJSA 1N1MA 4S1NA 1P7CA 4TMYA 3ZE9A 4BVAA 5BSVA 1H4QA 1VG1A 4TTTS 1W0KA 3T06B 2WZBA 4FN5A 5LQSA 4B75A 3PE6A 4V0OA 4P7JA 5KNDH 5KTYA 4Q3NA 1V9SA 3O4RA 5DHAA 3WZLA 2W4IA 3UJ7A 1E7QA 1B6GA 2NXWA 3ELYA 3EB9A 1RW4A 2BTOA 1BCSA 2XNJA 1V1MA 4DXHA 5KYYB 1ZA2A 3A4MA 2X8LA 2YRXA 1AS3A 3EVTA 4I3GA 3TBKA 3NM6B 1IK4A 3ON5A 3WLHA 2IEIA 4F21A 3PK0A 4G8JA 2Y1LA 2YZMA 4YRLA 2JHPA 3TW4A 2BOVA 2ZCJA 3LUBA 3CZ5A 2PZFA 4EVRA 2HU8A 2SBTA 3WDSA 4LK3A 4F91B 5DCYA 3FROA 1BCSB 3CMMA 4C4AA 3LOPA 1JHUA 1E0AA 3WB2A 2CLCX 3N2KB 1US8A 1W0JA 4C7OB 4QVIA 1ZH0A 3MRTA 3MF4A 1WPXA 4KQJA 4PONA 3H17A 4EG7A 2DG2A 3SJCA 4LY9A 1EK1A 3I76A 1CQZA 2JJMA 3N3AC 4W5OA 3M9LA 3NO4A 1CQIB 3O2JA 5A7GA 1QIMA 1XDDA 3PUIA 4DV1B 1TD9A 4FILA 4KL8S 2AMJA 2FK8A 2FW7A 1K88A 1F5SA 2Q8NA 1B43A 1R6UA 3AW8A 3BQNB 3HUTA 2ZJZA 4PPNA 5ICFA 4BNFA 3X1MA 4YDHB 3B9BA 1TYEB 2HWUA 4OQFA 5DM4A 4IH1A 4EGFA 3A6KA 4ZQFA 4HVCA 4Z4GA 4BMOB 3E7DA 3N76A 1Z7WA 2BE7A 1Q0ZA 1ANKA 1D9ZA 2JIMA 4CM3A 3EPKA 2O0HA 1D2RA 1JDBC 2ZUEA 2IXEA 3KHTA 2CCJA 1NVAA 1NU8A 1QQ6A 3OCVA 3AU9A 1H1DA 3UCEA 3JV7A 4XPIA 1SHLA 4FM9A 2CNLA 3ZX4A 1SCNE 3DJYA 4BLUA 3EYAA 1GCOA 2FP4A 4UTOA 3EEBA 3A4NA 2X0KA 1OGIA 3KB2A 1ZH4A 4KXMA 3WK4A 2P1RA 3AUJB 3HMQA 1XRMA 3A1CA 4CU2A 3DDNA 4I4NA 3K3PA 3NBAA 3U81A 2OK7A 1QCYA 2VLIA 4OPMA 3U1VA 1TPYA 4C9BA 3PGKA 4AL4A 2XY4A 4V2IA 4DKJA 1H5NA 2ZTLA 3MYYA 1I7NA 1NLMA 1RYHA 2FPUA 2J6HA 2XRFA 2BFBB 3ASVA 2IUFA 2VRWA 1V8FA 3BCSA 3FVTA 3CEJA 3IT1A 4JLMA 4M53A 1H3NA 4MJ3A 5CA0B 4US2R 3KT0A 2ZK7A 3BULA 5L95A 4D81A 1R8JA 2BUCA 2Z58A 2ZWOA 4MUNA 4EQZA 3CLUD 5HKKA 5KNCD 2ZRQA 3GJ7A 1LNSA 1ABEA 1E96A 1UJ6A 2AUNA 3O3CA 1F12A 4O1IA 4ID3A 1Z2EA 1USKA 3NHKA 4HLNA 4O3FA 5DN6A 4RKQA 3WC4A 1Z62A 3LYAA 1EDDA 4BQNA 3VTKA 4I9NA 5HK9A 1XQVA 3E35A 1JG4A 4HWPA 1DNPA 1T0HB 1GN8A 3H2KA 3DEKA 5SICE 1IBSA 4BE7B 4MZXA 3A06A 4MJLA 1UKZA 4RFSA 4KMSA 1O5OA 3OZTA 1YQUA 2GX6A 3IAM6 4X85A 3TSCA 2ODTX 4MW1A 3ZV3A 4AJOA 4MA5A 2VQFB 1JH8A 2CJWA 1E2LA 4IIJF 1HL7A 1WBBA 4UULA 2IPXA 2XPCA 4OQ4A 1RQGA 1JRLA 4CLDA 1U1IA 3KWMA 2WQ6A 2AMYA 4XVCA 4HGRA 4ZK2A 3QYFA 1ZIPA 4K9PA 5KHLB 4QQNA 3WX0A 1CUSA 2B61A 3WIEA 3R8FA 1Z6ZA 2ZTVA 4J2OA 1FYDA 1ST3A 1IFXA 3ANSA 1NTRA 1T4CA 3DCNA 4NONA 4PW0A 5DXAA 2NAPA 1D1TA 3OY7A 1H8EA 3V4SA 1KEKA 2ZR7A 4BNNA 2CJWB 1EESA 1HQKA 1DV2A 2FPSA 4L4YA 1ZOSA 2HRDA 3VKVA 3WAGA 1X2EA 2QV7A 2VHUA 5CVJA 3TJZA 3TZKA 1Z17A 1J0XO 2XVXA 4FQ8A 5CHEA 4LF7B 1DJNA 2ECQA 4DUZB 1SOWA 1KK0A 1WCWA 1S9DA 3NBYC 1XP8A 2RFLA 3NBZC 5C31A 5IYZF 1T4CB 2NAFA 2BRUC 2QDXA 2WUFA 3W9BA 4KSCA 2ZWVA 3UK1A 4BNKA 4B3SB 2LBPA 2J6BA 2D1TA 1R5OA 1ZCAA 4IYJA 3OC6A 4RDCA 3TVYA 3ZGNA 4CNBA 2JF0A 5J1TB 2R96A 3NYWA 5IT0A 3OEHD 1YACA 5L3ZA 2B4YA 1B41A 1Q6ZA 4KODA 4WY5A 1Z6YA 4FFOA 3EEYA 3GRVA 4ER6A 5JJ5A 4RE6A 2WWXA 3BK7A 1VI6A 2XOKD 2B5OA 3FFBA 5EHQA 3ZCQA 5K0SA 5HK8A 4AS1A 4WTOA 4I1PA 4D3XA 2HPVA 2RGUA 3BL5A 5KTNA 4AXBA 4BMSA 1N32B 2I4NA 3E18A 1ZNYA 2P3QA 1AIPA 1NW5A 1U0TA 1VJ0A 3H04A 1VL1A 4X20A 4M7WA 2NVUB 1B76A 3ONDA 1GPDG 2ZLBA 2XVAA 3OIYA 3C8MA 4EITA 4M9UA 3GYBA 2PA0A 4NENA 1VIMA 3KT3A 5JLJA 5BR7A 3GRZA 4OKSA 4ZOLA 2GM4A 1B6TA 4JI6B 2MINB 1N33B 3FFWA 4J0QA 4DR2B 4UM9D 4E07A 4B6FA 4ZI7A 1PUXA 5BNZA 5K0TA 1WMAA 1TADA 5ERYA 4ALKA 4FYVA 4DCJA 1TKCA 3JYPA 1QHSA 3LW8A 2ZRLA 4L4RA 1EQ2A 4KU4A 4A2QA 2GOYA 4BBPA 3S2ZA 4BNJA 4BTVA 4ZOLB 2ZRPA 1W75A 1CF2O 2Y77A 1THTA 3NEYA 3N5KA 3Q41A 1VZ3A 3ITKA 1P2FA 3BD8A 3L3BA 2Y0BA 2VZ9A 2FG6C 4RIIA 3ZW9A 4D56A 4RKEA 5DEIA 5JYCA 2PBLA 5JCXA 3ISVA 3GY0A 2G7MC 3FTDA 1GFIA 2HJWA 4WEQA 3P0EA 3RGGA 1M2OB 3V32A 4MKFA 2BGJA 4GM0A 1KY3A 1ZWKA 4ZTUB 3AY6A 2YDYA 621PA 1KDRA 3PLNA 3WL8A 3TDNA 1Z7GA 5CTJA 2B9VA 3BA6A 1U4OA 1E0SA 4F38A 4DLYA 3EUAA 3SZMA 3SXUA 4BNUA 3D4LA 1F2VA 3BXEA 1J00A 1K6IA 2CEAA 3BRCA 1GARA 3AVWA 3ZQUA 3PXCX 4P1ZA 5TE9A 1VKNA 2HLDA 2LGJA 5DSTA 2P9TA 1AQUA 2WFZA 4DY4A 1FA9A 2HWXA 4TV8B 4B8YA 3ZV5A 3VSAA 5JRDS 2D5CA 4N82A 2JCGA 4XUGB 5FPSA 2DUJA 1M1YE 2YMLA 4W5TA 2NO5A 3E22A 5EKXA 3ED5A 3DMDA 2EEPA 1DX9A 2YS6A 3DVRX 3JSXA 4Z9YA 1XD2B 4U5XA 1AZTA 4MQ5A 1NNEA 2E48A 1DIRA 2PN1A 3GEBA 1MPXA 2J32A 1R6TA 5E6UA 4DV6B 4M0DA 4BLPA 3RQSA 1Y1SA 3REQA 3RVNA 2VUHB 4GUAA 4U2CA 3VNRA 3VR5A 4E33A 4II2A 4WCFB 3F0TA 2F1IA 3BSWA 3TJMA 3MJDA 2ZSIA 4MV5A 7ABPA 2UAGA 2OB2A 3AQIA 1UKVY 4KO8A 4M8KA 2XUFA 3FTQA 3K31A 4LV8B 4RSHA 5EZYA 5IN4A 2AKYA 2J5BA 2PG3A 1KU6A 3BMQB 4RK5A 4XX0A 4B32A 1DBWA 1TECE 1XZFA 2ZTHA 4G07A 3ZWBA 4NK5A 2BBWA 1YS9A 2LDXA 4R1TA 3SS9X 1NVTA 4EGQA 4EW2A 5CA1B 2J33A 1JNYA 1W25A 3AF3A 2D2FA 2HBQA 5FOWA 4M8NE 2IV7A 4UVDA 3MAGA 4LRSB 2NZXA 4AO6A 5EZYB 3BSYA 2PWYA 1MX1A 4P4GA 2W58A 4TLMB 1UP6A 2WDZA 2WVJA 3AERA 3AOEA 1XCBA 4IIBA 1EP2B 2OWDA 3GFOA 4KB5A 3WGIA 4X7PA 1AK9A 2ZIXB 3HUUA 4ERNA 3SIXA 2ZIVB 4IG4A 4OA8A 1GGJA 2OFPA 2P9JA 2VLBA 3LUJA 2ZJFA 4FCCA 3HADA 2O2IA 2P7IA 5HQJA 2GJ9A 1M6YA 2X6QA 4R2MA 3Q7QA 4CI0B 3ADBA 4RPJA 4XWKA 1S9HA 2UYOA 5E4TA 4M87A 1YJAA 2I78A 4E2XA 2EGUA 2PMCA 2OM2A 4PICA 1TYCA 4GVXA 1IN1A 1USWA 1EWYA 1LX6A 1NPTO 4CG3A 1H4VB 1G8FA 3WL7A 2ZYVX 3UAXA 4CLXA 2GN6A 2VRBA 1JHDA 5EP1A 2BM9A 1NOJA 1C14A 4F04A 2ZI6A 3GD7A 1GVNB 3UWMA 5I3CA 2OAQ1 4LWZA 2YNMC 1EBBA 1ZJJA 1HTBA 1U9JA 1RHQA 4NZPA 1H23A 5BYBA 2J4CA 2DQYA 2GKGA 3T56B 2RE8A 4NAHA 3N3BC 4NY1A 3PC7A 3C7KA 4B7ZA 1XALA 3LPNA 4CEJA 1FQKA 4KITB 1DGQA 2IEZA 2VNAA 3HRKA 3GFGA 3N0XA 3DZHA 1TA9A 2XMSA 1A7KA 1Y42X 3BFPA 4PYMA 3WO0A 1SBHA 2IUSA 1X70A 4O2LA 1Z45A 1ND5A 4FZ3A 5CCBA 1XL1A 1UKEA 3GPLA 3IEPA 4G0MA 3BWBA 1NBMA 2AOTA 3KR0A 2B7CA 1P2GA 4NH4A 4ILKA 1QHNA 4Y6LA 1W9MA 4NBRA 4QVGA 5IUJC 5JC8A 4UNRA 1JHVA 3GJZA 4B44A 1YOBA 1FP4B 1WUJS 1NWHA 2E9SA 2X5OA 3B6IA 2CMFA 4FE3A 5JAPA 5EXEA 2QRPA 3HU5A 3EBOA 1XIVA 2F90A 4KE9A 5AVOA 5TGTA 2AOTB 1KYXA 2XUDA 1JBQA 4YXWA 3GRPA 1BA3A 2IP4A 3OM9A 2XXAA 1I1HA 1J1ZA 4OXNA 5JMOA 1PZXA 3H5NA 1TCAA 1TM4E 5EXTA 3PEVA 3PDIB 1RCUA 2CL5A 2HMSA 2P0EA 3BHJA 1A8PA 3GZNA 5HZKA 1G3IA 2YIVX 4GGPA 5AM1A 1PZEA 3MW8A 1X87A 4ESOA 3C5EA 4OKIA 4Z4EA 1OXBB 1TKBA 3A05A 3F6BX 2Y1KA 3COYA 3F2VA 2XXAB 5EMJA 2C3OA 1EGMB 3AR8A 3DVQX 1QVZA 2N46A 4ZRMA 2FX2A 2JJ1A 1NT4A 3IQXA 3X44A 1QH9A 2DTDA 4W7HA 3L46A 1FRQA 4C20A 1Z82A 2PLFA 3GZNB 4MB6A 5AKHA 2P5SA 4MWEA 2IA5A 3UJDA 3OHSX 4R01A 2WY2D 3ZU5A 4EFMA 3IGFA 1P9LA 2FMFA 3Q7SA 1LD3A 4IUDS 3QFFA 4CHTA 5P21A 2O19A 4M99A 3TX2A 3OT1B 3W78A 2IEGA 3JARA 2G9ZA 5EUMA 4BBJA 4ZOQI 5BMVF 4KR6A 4BQIA 2V8OA 3S8MA 3O8RA 2C4NA 2R44A 5IC4A 2AYZA 3A4LA 3FNQA 4BRUA 4GL2A 4RQAA 2ORWA 3VR2D 2JAXA 1G5HA 1HMPA 3FE2A 2B1QA 3PUXA 4G4SP 3WLLA 4D0GA 1GU1A 1JKJA 1TJNA 3O7WA 5HTKA 3RS5A 3ZEIA 1E99A 3G2PA 3PFIA 1SUDA 2WPNA 4IWNA 2QE7A 1YZKA 4OHRA 3H5WA 5KZMB 5JZBA 3GXBA 2J41A 2QYTA 3HBFA 2F8MA 3TNJA 4CCYA 3VI3B 4F46A 1Q1GA 3PPWA 1X94A 5JPIA 4OI1A 3UOGA 1R0WA 2FXVA 2ZROA 3QJGA 4RXTA 4UQOA 4GOXA 3EZYA 4PO1A 5IF9A 3O84A 4XVRA 3RVJA 4HO1X 1TXGA 1BW9A 3ETCA 3PQ2A 1W7AA 2LZ0A 3L02A 3S44A 3ZZNA 1I7SB 1J49A 4Q1CA 4YUAA 3IOYA 4B4UA 2WW8A 4DYVA 4IVNA 3CNHA 2VDQB 4IIJB 4QECA 4W1SA 5LJLA 1N77A 4OQDA 3VPXA 2PFGA 2YJGA 3WOVA 1G98A 4PYLA 3WNDA 4DIEA 4IF6A 5TB5A 5A6SA 2D1SA 3K8OE 1ODIA 1PWXA 1Q7TA 5AKGA 4I1UA 5JYBA 3A27A 4L4SA 8ABPA 1WIWA 4DCUA 1QP4A 2BN4A 3JD0A 4BHTA 1HRDA 2YFKA 3ORHA 3GQBA 1UBKS 3CIOA 1FLAA 4GOOD 4MV8A 4OOFA 5FL7A 10MHA 4MR9B 4CG2A 4QSHA 5ALLA 1SM4A 3VXKA 1U5BA 4RH3A 1PTJC 1IPFA 1ZRMA 3O3MB 4HAUA 2Y9PB 1DV1A 2ZI4A 4MI3A 5CB4F 4IDGA 4H3KB 4MW0A 3RBXA 5IYZB 3HJFA 2X9LA 3FWPA 1E77A 4Q3BA 1G60A 5F33A 5ALIA 3GQBB 5CLJA 4GM1A 3O26A 1F06A 2AN4A 1D2NA 3N8GA 5B58T 4C5BA 3DOIA 3I52A 3B48A 4UZEA 1RKBA 4E6PA 4YRZA 3N70A 1XKLA 1CRQA 2H7YA 3MOGA 3QXHA 5AKXA 1E9RA 1OAOA 1WPRA 3EY9A 4TQAA 1AQ6A 1JB9A 4M1QA 1K7YA 3I45A 4QD3A 4BFUA 4DMCA 1X2BA 1JLMA 1J99A 4KI0A 4FQ7A 4F12A 1GAXA 3N2GB 4D0SA 4V0MA 3JVEA 3AEQB 5C1OA 1QHYA 2NU8A 5FDFA 4JI3B 3GGGA 2GEVA 1NMEA 2VAMA 2NXEA 2ZBQA 4KKVA 3MWKA 2PVPA 3KVOA 4G0YA 4Y6GB 2AEEA 3AFGA 4D92A 5LQNA 4AMBA 1T36A 5CX4A 1A97A 3GPDG 1I94B 4V0RA 1K92A 1T6ZA 1VJ1A 3KE9A 3K1AA 2I6GA 4D9JA 5FOVA 3AHGA 1M8JA 2WAXA 5MN4A 1SKMA 1V5WA 2VJBA 2JAWA 4GBED 2EZUA 1KQFA 2EZ9A 4HMOA 2PX4A 3BD9A 1ISRA 4Y18A 3CLUC 5L4LA 1BXRA 1CIJA 4A26A 2AOWA 4D3DA 2PT9A 4RTQA 4HWRA 1SQSA 1VL6A 3ZGYA 4E13A 4AF8A 1A69A 1JQ5A 5IDXA 3NUGA 2JCXA 1N1GA 4BP1A 4L3OA 2GBLC 3U7IA 3CVUA 3RYHA 2R9VA 1XFAA 3NHYA 2JZOA 4OREX 3A9UA 1BXRB 3VX4A 4H6PA 3O1IC 3AEKB 2HN9A 4PS0A 5BWCA 3RT7A 5ERXA 2ALJA 3E84A 3IBCA 3QEJA 1VPWA 2H16A 1PYDA 4P3OA 3HGMA 1IJBA 4EUEA 2VZEA 5AOBA 1UMBA 1VKJA 3DD5A 3NUQA 2G07A 4XFKA 5IUNC 3ZDQA 3LF1A 2NXCA 4HH1A 2ZPUA 4ZALA 4ENWA 3H9GA 3PTLA 2A5YB 2IHVA 1A7JA 3UFXA 4ZICA 5KNBD 3R0QA 1QZXA 2WAMA 2VH5R 3DAYA 3EQ8A 1HWYA 3QXJA 4RM2A 4YCLA 3VUEA 4OMUA 3A6ZA 2I6QA 3GO4A 1P6XA 3RFTA 3I12A 5JANA 3RRYA 1LWNA 1UMBB 1MW9X 1XJCA 3UWSA 1U8YA 2PGOA 5D51S 3BWMA 3CR7A 4TWBA 2ZUFA 5EVJA 3I9MA 3IVXA 4DANA 1Z6PA 1CUFA 4KN8A 3SYRA 3OX4A 2IPAB 4IDPA 1KFKB 1T13A 1L8XA 1H05A 1RAFA 3I6BA 3L6OO 4BNWA 3PRKE 3NFRA 4MCIA 3OJLA 2JKVA 4L72A 1V71A 3HEAA 2IYSA 5ITZA 1F1JA 2YV4A 3P9NA 5FO0A 4EGCB 4ER5A 3DXFA 1NY6A 3PA8A 2OBMA 4F9GA 3A4IA 1LRLA 1C50A 1C81A 3EC1A 3FZQA 3ND5A 2PMWB 3DJFA 5AWFC 1XOIA 3VSEA 3IDQA 2BCEA 1SXGA 1KBOA 3QXSA 4NYIR 4WY2A 1GZ6A 2AS0A 2WHQA 1O6FA 4OHPA 1YCHA 4Q82A 3WHPA 4A10A 5GMOA 4PAWA 3HB0A 3R7SA 1BG6A 1UAAA 4B35A 2H1VA 2H1FA 2OKGA 3DVSX 2IU0A 4DRZA 1MORA 1GGKA 2Y3IA 1D2GA 3EDQA 4KIGA 2KQUA 4PHGA 1DQPA 1PZMA 3FHOA 2J3HA 3MT7A 1RRCA 1VI2A 2Z08A 4JDUA 4EFNA 1PP4A 2YIJA 4FZJA 3QU4A 5C7YA 2L0XA 2X7HA 3N1UA 1T6NA 1CRPA 2XEXA 3TW8A 1ISFA 1SVIA 1X0XA 2I4IA 3HS3A 3NT5A 3UH0A 4DQVA 2ID9A 5IZCC 3U09A 2DERA 4IG9A 3H8WA 4C1NA 3LHIA 4U6QA 4KWCA 2RB4A 5IVPA 1SPXA 2FUG6 1M1UA 2FCAA 1MFZA 1Q19A 2G9VA 2YH2A 4YH1A 4AWAA 4F2DA 1TYDE 1T5SA 2FWBA 2QXYA 4C3UA 3DOFA 2XYVA 3JCZA 4G5XA 2ZYWX 2X77A 2XWPA 4UU1A 1RYDA 1JLLA 4J3JA 1GL3A 1TOAA 4UVGA 4W6ZA 2FWMX 2PUWA 4K9NA 4BNGA 2GVZC 1E2PA 1GR1A 1R0KA 1U9IA 2C3UA 3OUZA 4QJBA 1ZMTA 1MEJA 2ZIWB 3FIJA 4J49A 1Q7RA 2MR6A 4UNPA 3ZWXA 5IAOA 4QTUB 5KHOC 5DBOA 3ILYA 4V39A 3TUJC 1F7VA 1UM8A 4HLUA 1CDOA 4E5PA 3MCWA 2IYOA 5G0VA 4CQNA 1Y8QA 4BLRA 5JAOA 3KB6A 5JHHB 1IRXA 1CXZA 1VKHA 4IXDA 1NQTA 4J76A 3I5XA 4RNDB 1AGNA 1NMYA 2WOJA 3HMKA 3DC7A 4GMFA 4UU7A 1WPQA 3ZY2A 1JILA 3BEDA 2FEOA 4RMIA 3AP1A 3OZVA 3VYSB 3BIWA 1NW4A 3EISA 1JI0A 3HKCA 5DXFA 3RTAA 3W2EA 4BVKA 1Y8QB 4DSZA 3F5QA 1KHTA 1V41E 1VLQA 3KJGA 4UBLA 5KQMA 2W2KA 5F64A 2VQDA 1GTJ1 3AETB 2C4MA 3UXYA 2E4YA 3D0OA 1HDRA 2CXOA 1N1EA 1TUBA 5KYKA 1VIVA 3X43A 5DISB 2NN3C 3HKCB 3WLEA 1E2NA 2F6RA 1DUIA 5I7VA 4IKEA 1TM2A 2Z3VA 3NOQA 2PO5A 3RS4A 1Q2XA 5CDGA 2BFWA 3EG9B 1PGNA 2DH5A 4FFVA 5KWVA 5LA6F 3W2GA 2IUTA 2Z8YM 4AY3A 3KOMA 1THGA 3JD4A 3ET4A 2QQ5A 4O8ZA 4PO3X 5A7HA 1FW8A 3ZCPA 1XVAA 4NMHA 5JI3E 1W36D 2GSDA 3DCYA 2P27A 4CFSA 2QMHA 4ZFNA 5JFGA 1M1ZA 1EJ0A 2PU5A 1MA0A 3A6JA 4J8PA 3ZDYB 2QV0A 1CEEA 5EN4A 1F0KA 2BMEA 2XQGA 1C3OA 3EA0A 4NZ9A 4ENSA 1QGUB 4M8LA 1LS1A 1OE0A 2EOAA 1MOQA 1Q95A 4PV7A 3QUQA 4P4TA 2VJPA 4IXNA 1R0CA 2ICAA 1Z0FA 2DWOA 3WRYC 1KP2A 2PLRA 4ZYYA 3P9XA 3R3XA 1P3DA 2F2TA 1ZITA 4AIIA 4YQFA 3UJ6A 4DCCA 4P35A 3WWYA 4L08A 2G40A 3ZS9A 4BLWA 3L01A 1KQ3A 1TDJA 4FYKA 1XA0A 1UMCA 3LUPA 5BMVB 1OREA 3NBKA 3BEOA 3CU5A 4H15A 2APJA 1GPUA 1XV5A 4BP8A 3AR7A 3CE6A 3ZWKA 2PL3A 3BICA 3FZNA 3Q40A 5KC9A 5AW7A 5FR2A 1A1SA 2WUWE 3W8EA 2QRJA 1F8FA 2BR5A 3A9WA 3D3JA 2VQEB 3PHBE 1N6LA 4M9XA 2AD1A 3EMBA 3MUNA 4ARVA 2TMKA 5LN1A 1X7ZA 4G1UC 2Y0CA 3L0OA 4NATA 4PWZA 3BL6A 3WLJA 4DV7B 4Y2PA 5KDOA 1OB5A 3QLUC 1TCUA 2ZSFA 3PQFA 1KEVA 3IMEA 2EHDA 3GEHA 4G0XA 3VV3A 4YMTA 1FX0A 1JXMA 2FEAA 4OLHA 3ZK7A 5FLXA 3BF7A 1QRTA 1NOIA 4KQWA 2IZ6A 1OHHD 1X7ZB 3K0EA 5BSKA 5C81A 2ZBPA 3FNIA 4ECAA 4GSKA 5KS2A 1GZ4A 3SJ7A 1IUOA 3FG9A 3R23A 3UKOA 4BZZA 5EGNA 1E3EA 2XLCA 1YONA 1SHTX 1WRBA 4FN4A 4LCJA 1N6IA 3BJMA 3EGWA 1U81A 2C3PA 3KKOA 5DOZA 2C96A 4X41A 4WKGA 3AKEA 3NGLA 4CF5A 1TPZA 1PJQA 5CB4A 4CNQA 2BT4A 2FJUA 3P27A 2BUBA 4WDRA 1JZTA 3BAZA 4JBHA 4TTJA 1VMAA 4YB8A 2IODA 5GP1A 3W1VA 3KO8A 1CZUA 2SCUA 3VPSA 4KN9S 3UCXA 3VZQA 1NE7A 3DFZA 1J24A 1K0UA 4CKXA 3CPJB 3RUEA 2Z2YA 4D44A 1LBTA 1ENPA 1TC1A 1I01A 2FN8A 4QPJC 5CB4B 4KDRA 3OIDA 5F7ZA 4KYUA 3EF1A 3FTEA 3SICE 4HB2A 4MB0A 3QEKA 1CG6A 1G20A 4AAYA 1RT9A 4RJIA 3DBIA 3FMPB 1AGRA 1W6UA 3WB9A 2OCGA 2Z4SA 1K8XB 2FQ1A 3EARA 3FI0A 4G5SA 2FWNA 4LJ4A 4XD7D 5EMLA 1Q44A 3QFSA 3WWOA 2GEJA 2VP9A 3EVCA 1XRRA 3Q9NA 4K7JA 5E95A 1MC8A 1V6SA 3Q7PA 4B3TB 2I80A 3UA3A 2EP8A 4JN6B 2H51A 1G20B 3ORQA 4D57A 5EQFA 3DZDA 4FBMA 5DIZA 2IUEA 1QVAA 1Y0BA 2G80A 3ZKAA 1J7KA 3RLIA 3IUEA 3GT7A 4MX8A 4CKEA 3ZLTA 5GZ1A 3GHHA 4FMCF 5HWSA 2DLCX 5KJCA 3K5WA 1P1IA 1CUJA 4FEAA 1R8SA 5DLPA 3SX2A 4EL0A 5BUSA 4ND1A 4B47A 1XMVA 3PZRA 1L8QA 1LX7A 1RD4A 2P5UA 2QUHA 3C5WP 1PDWA 4WNAA 1T9ZA 1W85B 1NA5A 3GROA 3KYIB 1C3XA 1I3LA 4TTIA 4TTRA 5HRCA 4HYYA 1QH8B 2QPAA 3KHUA 4AZSA 4I5DA 4PRZA 1TIKA 3ZDDA 1NUHA 4P98A 1DJMA 4YQZA 4BQSA 3FPKA 2ATVA 1NMZA 1FB5A 4WZZA 1DTWB 1EZZA 1V1JA 2VK1A 3M0EA 4UEQA 2HA6A 1JHOA 5C7OO 4BKRA 5C1PA 1AM4D 4A8PA 4P84A 2WINI 2ORIA 1MC5A 3G6KA 1EVYA 3TZ6A 2C99A 2XA9A 3L6RA 4RF5A 5IBRA 5A4JA 4TYYA 3AFIA 4U02A 1KXJA 1SUWA 3HRHA 3Q15C 2JGMA 1NTOA 4MV7A 1H4TA 1SXJA 2XMZA 1T8WA 2G04A 2BJVA 1CUXA 3PHGA 4HYEA 3AESA 3STXA 1UBLS 4NFHA 1C7FA 3KVRA 2GWHA 4WZBA 4HX9A 2JAQA 4KIJA 3A04A 4MS4A 2JFPA 2FUNB 4LFBB 1WA5A 4DSAA 2JA1A 4EF4A 1ULZA 2QRVA 1JEJA 5IJZA 2JIPA 5D3QA 3GK3A 3Q8LA 3O92A 1QTRA 1SXJB 1UEJA 1NI5A 1P29A 2REQB 4C1BA 5A02A 4BLQA 3AESB 1XPUA 2UVDA 1K6JA 1U0EA 3EBLA 2DR2A 4AKHA 3RTEA 3AV3A 1X39A 2SKCA 3W2HA 4XLTA 2Y92A 2Z2JA 4LNAA 1JFTA 2BY4A 2IHBA 1FFGA 3LPDA 5E1BA 3E1KA 1JHPA 1ZGHA 1NF3A 3OIWA 5CDTA 1F8YA 1BDMA 3VJRA 1GDHA 3MMNA 4WKPA 1FRFS 1TZJA 4FFBB 5FX2A 1V5IA 5DFAA 4DIMA 5CLLA 4JV5B 5I45A 3SZOA 4TXJA 1WMEA 5B55A 1CYDA 4G85A 3RUIA 4IDNA 2Q2NA 4GZ3A 2WD7A 3GVIA 4P93A 5HGJA 1WZCA 3T0FA 5I4BA 4TRJA 4ND6A 4LF8B 2AMLA 3TECE 3D31A 5LLTA 1HSZA 1C0EA 4A91A 5BOSA 2BM1A 3EXEA 3O9ZA 4AYTA 4ZXFA 3PFFA 4RJKA 4I8IA 1NWCA 4ZT4A 2JD1A 5EMMA 5SYNA 3V3KA 4HVTA 4JZKA 5AK5A 2O8VA 3A0UA 4FFPA 4HBZA 5AI4A 3WMRA 4EBBA 5EHXA 2RAPA 2P68A 2JI6A 3ZV6A 3GGJA 1JPVA 1PFQA 2R7LA 5CB0A 5JS8A 1JE0A 4K81B 2OAEA 3EWAA 2PQ2A 3KC2A 1Y6FA 1MR3F 3IB3A 4P22A 1MB4A 1GRRA 4NWIA 3LS2A 4V0KA 3HJUA 6REQA 4PC2A 4DNTB 3JQ8A 2CLDX 3E9QA 3HGTA 1U0RA 2AJLI 3KXLA 4KYTA 3RAJA 4CQMA 2DXIA 1B6SA 4QDKA 4Q4AA 2PY6A 5C3MA 3U31A 4WN9B 4KBFA 1VA5A 1DOAA 2ES4A 5J9FA 4HAOA 3E05A 5J2UF 2NSDA 2CDBA 3U0VA 4DVJA 3MS7A 1E9SA 2LIPA 3SM9A 5IBCA 4MW4A 2X6RA 4PR3A 4AF6A 1YUBA 4RABA 4FGZA 2SNIE 2FJPA 4NOMA 4WNYA 5LKRA 1VGQA 3CZRA 2V54A 4C6SA 2W71A 1QHIA 2IOQA 1AVTA 4CQMB 2B83A 1KE2A 1MAAA 4ZVLA 4Q4AB 1G18A 4TVKA 3HJRA 4P81A 5AK6A 2D8AA 5I6DA 5HRUA 4M8IA 1XGKA 4JSYA 1G5RA 5KJ6A 4IWYA 2YY7A 4JVOA 1E6EA 2PH1A 3NKVA 2Q28A 3OAAD 2QTHA 2AQHA 2MR5A 3HR8A 2QI9C 3WJ2A 3QEAZ 4WPGA 4LUCA 3RW9A 3DB2A 2YUIA 5DGXA 5CD1A 2HBRA 5HBRA 1Z4QA 1Y1QA 1IPHA 3LXUX 2FPLA 1U31A 1KOJA 4LBWA 4E94A 1QU2A 1V8DA 2Y1FA 3K9GA 2FZ5A 3PQ6A 3CR3C 1YNOA 1ZUIA 4HI0E 4JT2A 4BMYA 1U6JA 1TK3A 2H0RA 5G1OA 3DFFA 2ZT6A 2V6BA 3PFHA 5KQGA 3R3YA 5DM0A 3F67A 1PJ4A 4OMCA 2W6CX 4N7MA 5JADA 1A4UA 1E1RD 3V2GA 3ENVA 1K7XB 4RANA 3CLKA 3PVCA 2HU5A 4LHEA 3TINA 2D4HA 1U0SY 3GGSA 1Z5ZA 1KDVA 3GGPA 5TXGA 5A2QA 1O96A 2F3TA 3M4YA 4W9NA 5DNUA 4CDNA 1YBAA 3A37A 4J6EA 4IVPA 4G24A 5G02A 5JXHA 3OZFA 4G26A 4ZO7A 4EQ6B 1CR2A 4B5KA 1T5OA 4DV5B 5LIRA 3DDWA 3HZOA 3NAGA 5DX1A 2AWOA 4BQFA 1O58A 2O23A 3I6QA 4HH3C 2NLOA 5JD3A 3H0CA 3JYQA 4YACA 3MNFA 3LUGA 1FFEA 4V0QA 3V9PA 2X5KO 3VDNB 1UWKA 3INTA 5H9VA 3UMGA 5LA6B 3OZBA 4N8SA 1X80A 1PT6A 1ZVKA 2OILA 4C4OA 3V33A 1YFZA 2H0QA 2BH9A 3UCFA 5C18A 2PK3A 3I62A 4L9WA 3OTOB 1P0QA 2BFAA 2EKDA 2GGSA 3NAZA 1B0UA 3QJ5A 4QTZA 4X3CA 3GUCA 3EFOB 5EQJB 1N9ZA 1XQYA 4P36A 2IHYA 1T3SA 2HCBA 1BQEA 1VP3A 1QH0A 2F9FA 5ESWA 1P4RA 3C45A 1XF1A 1V48A 2DU8A 2NTJA 2W83A 2O05A 3GRFA 1UEXC 2J85A 3O8NA 4UREA 5CDYA 4BVJA 1UBTS 4PAMA 4ETNA 4LDZA 1S8AA