3C3KA

Crystal structure of an uncharacterized protein from actinobacillus succinogenes
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
272
structure length
267
Chain Sequence
b'KTGMLLVMVSNIANPFCAAVVKGIEKTAEKNGYRILLCNTESDLARSRSCLTLLSGKMVDGVITMDALSELPELQNIIGAFPWVQCAEYDPLSTVSSVSIDDVAASEYVVDQLVKSGKKRIALINHDLAYQYAQHRESGYLNRLKFHGLDYSRISYAENLDYMAGKLATFSLLKSAVKPDAIFAISDVLAAGAIQALTESGLSIPQDVAVVGFDGVDISQITVPALTTVQQPSEQIGMKAVSLLLEQIHSDVHHLLPWKFVRRQSSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanine racemase
publication title Crystal structure of an uncharacterized protein from Actinobacillus succinogenes.
rcsb
source organism Actinobacillus succinogenes
molecule tags Isomerase
total genus 107
structure length 267
sequence length 272
chains with identical sequence B
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3kA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3kA01
4F11A 3TD9A 3JY6A 3JVIA 2FEPA 3H6HA 3O2SB 5HM6A 4MR8A 4RK1A 3DBIA 5JNUA 4D74A 4W5RA 5CNJA 5TQ2A 3T8YA 4ETMA 3JPWA 5BQ3A 3OQNA 1PUXA 1SD5A 1PEAA 1MVOA 1ZDMA 3FGZA 3O75A 1JLKA 2R48A 2H0AA 1MB3A 3FFTA 4EYKA 1QP7A 3C97A 3RVMA 4TMYA 4CBVA 1TVMA 4DADA 3NNSA 1QKKA 3LMKA 4ZMSA 4LE1A 5C5CA 4RK5A 4N76A 2HSGA 3QLUC 4IF4A 4MRMA 1AB5A 3R0JA 4D6XA 3KKEA 3MF4A 5FWXB 1NY5A 2HQOA 3C3WA 4N47A 4ZJPA 2FVYA 3E61A 5KQGA 1YS7A 4N03A 3RVQA 4Q7EA 1XHFA 3L49A 4H3KB 4EVQA 3Q41A 3IP9A 1M5TA 1R8JA 3CG4A 3OLXA 2FN9A 4FE7A 1QP0A 9ABPA 5EWJA 3H75A 1EFAA 4JASB 3B2NA 3KHTA 4G0ZA 4IGAA 3I42A 3MIZA 4E7PA 2E4WA 2JCGA 3O74A 4KQCA 5GOTA 4EYOA 3Q15C 4MR7A 1H9CA 1GLGA 2I6FA 4NV3A 1JFVA 2A9PA 1QMPA 4MPTA 2RGYA 4RK0A 3K9CA 3KLNA 1FFGA 3LUKA 1P2FA 1USGA 4S04A 2CHFA 3JPYA 1FQWA 3HSYA 4EYGA 3HS3A 1PHRA 3IPAA 3EQZA 4MR8B 4RK6A 1E6LA 3QEMA 4ZYLA 4W5TA 4OG2A 2PLNA 3OO0A 4RS3A 5TQ2B 2MSKA 2GWRA 2JBAA 4KVFA 5ED4A 3KLOA 2PUCA 5JNVA 4OBBA 4EY3A 3OMWA 3H5IA 3QLVC 3GL9A 3LUCA 4KNYA 2PKXA 2IPAB 2FKAA 1A0OA 4RDCA 1IIBA 3Q7RA 2M1ZA 3OLYA 2PUDA 2A9RA 3NBMA 1GUBA 1P6UA 4N0PA 1VPWA 1K68A 3MM4A 1FSPA 4MRMB 1PNRA 2PUEA 2FSPA 1E6KA 1SXIA 4LDZA 3LFTA 1W25A 1F51E 2ID7A 1BAPA 4YP9A 3EULA 2NZUG 4HNQA 1ISRA 3OMXA 3RH0A 3LUJA 3QELA 4O5AA 5EWJB 5FWYA 4RKQA 5IULC 3M6MD 2NT4A 4L85A 3RVOA 2GBPA 3N0WA 3CU5A 3N0RA 3HEBA 3BBLA 4GNRA 4QPJC 1M2FA 5FBKA 3BILA 1DRJA 2FQYA 3O2JA 4M88A 4MR7B 2QSJA 3CKMA 1YTUA 1JFTA 1P8AA 4EYQA 2F8SA 3TMYA 1XHEA 1SXHA 2FXIA 3QLUA 4TN5A 4ETIA 1ISSA 2LPMA 2L2QA 3FDFA 3H5TA 4XASA 3MYYA 3NNDA 5TPWA 1Z25A 2FW0A 2LBPA 3IDOA 2KYRA 2ZAYA 4RY8A 1DP4A 2OENG 3SG0A 3VNBA 2BGGA 3HV2A 4LDAA 1T34A 5FBHA 4YWHA 4OLAA 3H6GA 2RJOA 1KRXA 1A2OA 4G97A 3EGCA 4N0QA 3LKBA 3H5VA 4UHJA 2LP4Y 3QEMB 1ABEA 2PUAA 3D02A 4YV7A 4O1HA 5KQMA 3KSMA 4Z0NA 3ROTA 4LE2A 2CD7A 3CLKA 4RXMA 2FTKE 5HQJA 1L5ZA 7ABPA 1CYEA 2LIVA 2GKGA 3JS5A 2PJUA 2RJNA 1FFWA 1YK1A 3CS3A 2MYTA 5DKFA 5JNTA 4YRZA 3IP7A 3LUGA 5EWMB 3JVDA 2O20A 1YMVA 2GX6A 4G0QA 5JNWA 3F7NA 5PNTA 1URPA 2MSWA 3GRCA 1JL3A 3UK0A 1TM2A 2VYCA 5KWSA 2JVIA 3HO1A 2HQRA 5TE9A 4HNSA 2DRIA 1USKA 4F8JA 4KPYA 3LUAA 2VK2A 4QYMA 5CNIA 2JRLA 4Z99A 1VRVA 8ABPA 2VUHB 4Z4FA 1ZN2A 2P9HA 2N9UA 3GV0A 4PZ0A 1RZRD 2IKSA 1JH9A 2FLWA 2CHEA 2QZJA 5FWYB 4GPAA 4RZSA 2JK1A 2B4AA 2R47A 2PUBA 1J56A 1D1PA 3IP5A 5JS1A 3EODA 2H3HA 5IUKC 3QLVA 3SNKA 1APBA 3N8IA 1NXVA 2E4YA 1L5YA 4G86A 1PEYA 1VLZA 1Z13A 4WZZA 4KRFA 3GYBA 1DCFA 5F64A 5JS2A 1D2AA 1RXIA 1M5UA 4G0OA 5TPWB 4IMIB 3OQOA 3NNNA 3LTEA 1FFSA 3T38A 2PE5A 3CZCA 3JTEA 2FQXA 4MAAA 5EWLA 3KYJB 1DBQA 1TJYA 3H5LA 3HCWA 3KYIB 3QEKA 4LX8A 3N53A 4MQEA 3DLHA 3URMA 2MYUA 2LUOA 4WT7A 3N0XA 4MR9A 5JNRA 1JBEA 4RY9A 4F06A 4OTZA 1C0EA 2ID9A 1EWVA 1DRKA 3IP6A 6ABPA 3I45A 4DQDA 5C5EA 4MS4A 1P6QA 2PAFA 3ILYA 4JA2A 1RZRA 4JB0A 4KFCA 2OQRA 3G1WA 1D5WA 2JVKA 4XAQA 3L6UA 2Q5CA 5KI6A 1QP4A 1JWLA 3RVLA 4JB2A 1EAYA 3GBPA 5TQ0A 2QR3A 1JDPA 1YIOA 4EVRA 4KK3A 3SY8A 1JDNA 3EDCA 2W42A 5JNSA 1YS6A 5IUJC 5KQLA 3LUHA 1U04A 1ZGZA 3N75A 5TPZD 4EUKA 3FFXA 5KC9A 1YK0A 5IC5A 3OQMA 1JF8A 2QXYA 4RU1A 1PNTA 1Z15A 1SRRA 2YHBA 1NXSA 2AYXA 3HUUA 1D4ZA 4PYRA 2HJ9A 4EGSA 1Z12A 3MA0A 2E4XA 3LOPA 4MS3A 1E6MA 2PL9A 4QICA 1BVHA 3A0UA 2L18A 3Q9SA 4LZLA 1MIHA 1OXKB 3C6QA 5IEBA 3RVJA 1QQAA 4F3TA 4KK4A 1DJMA 1YMUA 2HQBA 5HKOA 3BRQA 2JB9A 4S05A 4MQFA 4XLTA 3RVSA 5DGCA 4XFKA 5EWLB 3UUGA 1BDHA 1F4VA 2A9OA 4YCSA 1KRWA 1DC7A 1RXEA 3N6VA 4MQEB 5KC8A 3NHZA 4OATA 2QU7A 3LKVA 4Q6BA 4Z4CA 5KQPA 1EWKA 4MGEA 2JVJA 4MR9B 5T3YA 5GQSA 3CRNA 3O21A 1K66A 2IDMA 3RVKA 1Y1LA 1LK0A 5IEJA 4W5NA 1ZVVA 5TPZA 3OLWA 1M2EA 4G0MA 4PEVA 4MS4B 3P9YA 3SQNA 3T6KA 2R4QA 3HDGA 2NUBA 2QVCA 2V0NA 4JP1A 5BRJA 3QX8A 1GCGA 4IRXA 2IPMA 3UKJA 3HM9A 5FWXA 4KREA 3MQ4A 2WJWA 3TX6A 4FE4A 3O2QB 1ZY2A 3HK2A 2JBAB 5TQ0B 4YGXB 1U0SY 4KZKA 1YVUA 2XDYA 1Z18A 4ETNA 2FN8A 3W9SA 4MLDA 5IUNC 4RY0A 3C3KA 1DCMA 4YO7A 4LE0A 4H60A 3LUDA 1OXBB 3EQ2A 2J48A 3OLZA 4DN6A 1Z2EA 5E3JA 5ABPA 1DCKA 4Z4EA 3HXMA 1NATA 3O1JC 1KGSA 3VNAA 4RWEA 4NCBA 1ZITA 1S8NA 1B00A 3Q7SA 4MS3B 1DBWA 2L17A 3D8UA 4MS1A 2QV0A 4ML3A 1LJUA 1D1QA 2WMYA 1BDIA 2B1JA 4W5OA 5TQJA 1VKRA 4P98A 3GBVA 3QELB 1DZ3A 3GWGA 1ZAYA 3OLVA 3NHMA 1JX6A 3FFWA 4RKRA 3EJWA 2VUIB 3M9XA 3F6CA 4MQFB 1QQBA 2RDMA 5CHYA 4Q6WA 3CZ5A 2IOYA 4MLCA 4IMJB 1ZESA 4KQ9A 4L4UA 2WY2D 1XWWA 4RSMA 5DCLA 1USIA 3DZDA 1NXWA 2WJAA 3H5WA 1GCAA 2E4UA 1QO0D 1QNLA 3DGEC 4PE5B 4ZPJA 3I09A 1UDRA 4H3HB 4D6YA 3QK7A 2QVGA 3C3MA 2MSLA 4XXHA 4OLBA 4NQRA 2X7XA 1U2PA 3O1HB 5B3JC 2WRZA 2ZWMA 2IPLA 3A0RB 3BRSA 3O1IC 3F73A 4G0XA 1LBHA 3SM9A 3TO5A 3LUFA 3K4HA 2PMCA 4Z4IA 3M9WA 4PICA 1E2BA 3OO1A 1WETA 3HDVA 4O1IA 1GUDA 1ZGGA 3DLBA 2YHAA 3ILHA 3T95A 4ZMRA 2WWVD 4JAVC 2FLKA 1DC8A 1Z2DA 1DBPA 4IILA 3GA5A 4RV5A 4YS6A 4B09A 4RK7A 4NCAA 1DG9A 1Z26A 1LBIA 2PL1A 3S99A 1ZH2A 2FEKA 4MS1B 3KCNA 4WUTA 3Q7TA 2WB4A 5IX8A 3H5OA 1W9HA 3RQIA 3KG2A 1EHCA 3KS9A 4G0YA 4EVSA 4Z9AA 1QO0A 4FB4A 3GT7A 1I3CA 1EWTA 3H1EA 3MMNA 5DLEA 2TMYA 4Z4GA 3RVRA 3F6PA 3I5AA 4JOQA 3A10A 4Z9BA 4HYEA 1NXPA 4RK4A 1U8TA 2CWDA 4QYWA 4RXUA 1RPJA 2AYZA 2GI4A 2NT3A 2FMKA 3CG0A 4MYRA 5CNMA 5T7BA 1ZHHA 3E3MA 4P1ZA 4N41A 3CFYA 2PUFA 3EAFA 1NTRA 1NXXA 1Z16A 3IPCA 3ROFA 1KMIY 3OM1A 2E4VA 5EWMA 2IYNA 1ZH4A 2MYNA 2MYPA 2F8TA 5BRAA 3CNBA 5DTEA 2P4UA 3KTOA 4LRQA 3QX9A 2FQWA 3BREA 2R25B 1BA2A 4XARA 3HUTA 4RXTA 4NICA 1MB0A 1CHNA 2FMHA 2L19A 3OM0A 1U2QA 1Z17A 4TLLB 2A9QA 3FMVA 4E7OA 3HZHA 1NXOA 4WXMA 5BR1A 1SXGA 3CHYA 1BDJA 3HVRA 4TLMB 2PUGA 2FMFA 4YR7A 3G85A 1C4WA 1CEYA 3SAJA 4WWHA 3A3KA 2QW1A 2E4ZA 3RVPA 1A04A 2FEWB 1AB6A 2NZVG 2IPNA 2M98A 5CNKA 4HNRA 3KJXA 5B3JA 5HSGA 3H1FA 1NXTA 5I4CA 4KMRA 1QPZA 2FMIA 4W5QA 1LJLA 3HJFA 2HPHA 1TMYA 1JHZA 4YLEA 4WXEA 6CHYA 3CTPA 4Y9TA 4Z4HA 1RNLA 1TLFA 4G0PA 3RVNA 3DGFC 5IBQA 3QLTA 4F12A 1JFSA 4KV7A 1HEYA 3TB6A 4UHKA 3H1GA 1ABFA 5D2CA 1JYEA 1MAVA 1JYFA
chains in the Genus database with same CATH superfamily
4LCJA 4KE9A 4V0OA 4ER5A 2ZZMA 1MB9A 3HKEB 5ILQA 4K28A 3HXOA 3E1KA 3D6UA 4EARA 4F3RA 3QE0A 4JFAA 4TLBA 5JFTA 4ZOLF 5AIBA 1E6EA 3D8TA 2PZFA 4IPTA 1HZZC 3MJDA 2YOGA 1ECPA 3GAFA 2I54A 1U0GA 4B3IA 2YZ7A 2NUPB 4ZO9A 2VTVA 3WWPA 1HL7A 5JRDS 3WLFA 2IH4A 4HCJA 1YZFA 3QWHA 1KEKA 1L6RA 2JFWA 5AW5A 1PT6A 1VLHA 1MABA 1V1RB 4LK3A 3RVMA 1E0SA 1B26A 2GH1A 3IOBA 4JBWA 2OKCA 2IHJA 3EW7A 3HWSA 3WIEA 1Q19A 3NNSA 1WZUA 2H7VA 5DSZA 1DJPA 5K3CA 4GICA 2O1WA 3E15A 4HQFA 2ZRHA 3ASVA 3JYQA 4PNHA 4J2OA 4UAUA 5C4GB 5EZYF 4EEKA 3QVOA 1WDTA 2FSGA 2PJZA 2NNLD 2PFKA 2P9QA 4C4ZA 1PI3A 5K3BA 3CIOA 3PA8A 1GRCA 5K3FB 3WRWA 4BV8A 3LHFA 2I4OA 3IOEA 2O8CA 1Y3FE 1Z0UA 3LVRE 1EDBA 1N8SA 5BV0A 1IY8A 1PR1A 1U0LA 4HDNB 3CLTD 5LNK1 3E70C 1U28A 3DOJA 4G0ZA 2BZSA 5EQJB 1J9GA 3TD6A 2I62A 2JCGA 4OA8A 2XEDA 3LT0A 1GKLA 5DASA 4DC0A 1SK9A 4CDNA 2AOXA 2JARA 1HF3A 3ZU6A 4RPHA 3VKGA 3GJSA 4A6EA 3F7MA 4KRYA 4HDKA 3OHMA 3SE7A 3KB1A 4EPYA 3KLPX 4Q3KA 5JROA 3ONEA 3VVLA 1EA7A 2WKPA 2I8LA 3ESXA 4HDCA 3GVXA 1R0ZA 3AF5A 4O2RA 4TGLA 1NPDA 2J7PA 4QRIA 3HB0A 2QT9A 4CL3A 1X1TA 2HWUA 4EKIA 4JH0A 1WDMA 3A4LA 5CR9A 3ZE9A 2GVDC 1GFSA 4HWRA 5CA1A 1JPJA 3FTQA 2QRUA 5CVJA 2HHHB 1OFTA 2R1TB 1F8UA 2P2DA 3FMGA 4G4SO 4CM6A 2Y4NA 3EC7A 7YASA 3NHJA 3X2FA 1CJVC 3G8DA 3UJ6A 2QVYX 4C7OB 1H2YA 1W94A 3H5IA 4HUQA 1E6WA 1XKXA 3QLVC 3QFCA 2QE6A 3FNHA 4WZBE 4OQEA 2NO9A 2MTBA 1J90A 3MOSA 3W3ZB 4ARCA 4X3OA 3EOZA 3NG1A 2XNSA 4O2BF 5KKCA 3WY9A 1M5RA 3V7WA 3PC2A 1ZCAA 4JI1B 4EKDA 5CT4A 1K68A 1RBZA 5B1IA 5JTUA 1RCTE 2OTCA 4UM5A 3DMRA 5B7GA 3T1OA 1H2HA 2JKVA 2XIJA 1JIQA 4QUAA 2R84A 4LF8B 2H7YA 2HSEA 4GBED 1ZVMA 3IQWA 4KR6A 1SC3A 4TZ6A 5T4EA 4BMZA 4B4DA 3ZJUA 1J9EA 4GP9A 5FRDA 1A1VA 1BVYF 3O1LA 1ID1A 1MB2A 2GUWA 2HA3A 1P29A 4R8LA 4DA6A 4AKTA 5ALVA 3TF5A 4GKJB 1OXUA 4QRHA 3WBKA 2NP6A 3S2UA 2H5JA 2C3YA 1IAQA 2RI6A 2WK1A 3JYOA 1J25A 4RELA 4YBZA 3R9XB 1P81A 4Q47A 2AFHE 5DI3A 3LFUA 1N5DA 1LPSA 1P9LA 4PLHA 1I32A 2HF9A 3KQUA 4ETIA 1ISSA 2I7XA 5BUSA 5IHXA 1A8IA 5D01A 3G23A 2H52A 5AW9A 3WB9A 1RU3A 1EFTA 4K6OA 2EP5A 3RAPR 3SK0A 2VNSA 3TLYA 2ZAYA 1ZJZA 2ONCA 3COWA 4RKFA 4C5AA 2IUFA 1KI6B 5KVQA 4YWHA 2PSEA 4A2PA 5K8IA 2AXQA 4OM8A 2VAMA 4RF4A 4D4JA 4JA0A 3LCCA 3RJMA 2XZOA 2Z43A 3QEMB 1TX4B 4MUJA 3E48A 2R8XA 5D6NA 1XTSA 2B4TO 2OBLA 1HNNA 2FNAA 3IIEA 3FTEA 3DBOB 1F0PA 2C4WA 3IVGA 1AK2A 4NZMA 3FHTA 3JAKB 1OXSC 7ABPA 2CCKA 5IKEA 2X58A 2FN4A 3LYAA 1TXGA 2P30A 1RI4A 3CLSD 3PUIA 3G0HA 2PKQO 2YWDA 4ND7A 4D3XA 3TLJA 4DR2B 2R8PA 3PJEA 5MDHA 3OUTA 1KOLA 4COOA 4M4SA 4DR4B 2H1WA 1WXQA 1D6MA 3QU5A 5FAXA 4R2KA 5PNTA 1PJ8A 1GFZA 2W2MA 4XIIA 4CTMA 4DDVA 2R79A 2W8BA 5KWSA 2VJAA 1KEWA 1F3LA 3IA2A 3ZHOA 3NGXA 3LUAA 3QENA 3K73O 3L3BA 3PI7A 2VTEA 1NVMB 1ZN2A 4M1MA 4F56A 6LDHA 3N6XA 1XMVA 2QBYB 1UT5A 2IOQA 4I2VA 4I9HA 5FWYB 1R66A 1YQUA 3OPYB 5B1YA 1XLVA 3BD7A 5DF1A 5HGJA 3S1AA 2PUBA 2P1ZA 2Q41A 4ZQHA 1QBGA 2B5OA 4OV6B 5CD1A 3QVSA 1YB2A 2XE4A 3OZTA 4UMFA 1PWZA 1VCMA 1PBTA 1UDCA 5TGTA 3AF4A 1DARA 1E5VA 2DAPA 2QTMA 3CXUA 4UFOA 3BZUA 5KOHA 3I3OA 3SHFA 4L74A 1H6AA 4EX7A 4LOJA 2QAGC 1U8AA 2G3YA 4XUEA 4AJJA 3AEUA 5LP6A 3LCJA 4R6XA 4CM3A 3UPDA 3T38A 3IHTA 1OH5A 4URXR 5J4VA 3AY7A 2NUTB 5KSOA 2CZGA 1N0VC 1LLUA 1G8GA 1RZUA 2OZPA 3JX9A 5DNAA 5CFNA 4NOJA 1PR4A 3EG9B 1NMXA 1CJMA 1SBHA 1P6XA 1WPXA 3Q1KA 1HYHA 4WT7A 1NAHA 2J45A 2JJQA 4IQGA 4K8OA 5JYEA 1I6KA 3VR5H 1WV0A 2YWCA 4P5PA 3MOIA 1EWVA 2HDOA 4ALJA 1JG4A 1C2YA 2ZJAA 1JDZA 1XZEA 1QZ3A 3HDYA 1VCHA 2NU8B 3M6VA 2BZGA 4URYR 4CMKA 4G65A 5KTRA 5D6OA 2P8JA 3MTIA 3AVQA 1D5WA 3ZWVA 4CRWB 5EERA 2NADA 4RS4A 2RKOA 2QPAA 2BHSA 3STWA 1DEAA 1LB1B 5JO9A 5E4YA 2UYCA 4Y2XA 1BH2A 2B7BA 3PWTA 4EG7A 2FK8A 5LMNB 5A06A 4FGUA 3HKCA 2W42A 4HN9A 2BHNA 1FTYA 1SHUX 2YDYA 5FQOA 4B8YA 1YJAA 2FEOA 1YS6A 1BW9A 3V42A 2BFFB 5IUJC 2B69A 4BUCA 1EM8B 1U04A 4REQA 3BQMB 4EUKA 4EF5A 5DISB 1B2RA 2P7HA 1ZG3A 2OR3A 3W6UA 5AHRA 2ZI3A 3SYNA 3NVDA 2NYVA 1VHWA 2G5PA 3JD0A 3VTKA 3ZQUA 3CLRC 1J2UA 5L51A 5A3JA 3JQCA 1D4ZA 2NV0A 4C2TA 3B48A 2WZCA 1AGNA 1RAAA 4FOTA 4QBHA 4IWYA 1VPTA 4LV5B 4K9SA 4MUMA 2YJGA 4C3ZA 1SCNE 2WWXA 1KWKA 3FWHA 1T10A 3A0UA 2L18A 2PGDA 3ND6A 4KGDA 4RO0A 1WVIA 4YXFA 5JBNA 4Q7MB 4NFYA 4DUPA 1GDTA 2G82A 1TOAA 1I1HA 1T26A 1T8YA 2NTEA 1YZQA 3DEJA 1LQTA 3DE2X 4PG5A 1D2CA 1CB7A 3FOBA 4G1MB 2L0XA 5CU7A 2A9OA 1TM1E 4N0DA 2R8YA 3LW7A 4AZVA 1EUDA 1UBRS 4MI3A 4Y2TA 3SBOA 4O3MA 1X39A 1U28C 5ALSA 1YR8A 1EWKA 2BKUA 5DW3A 1T5LA 2H06A 3H3FA 1CY0A 2AJDA 2IVFA 3WV5A 4TYNA 5BO5A 1ONOA 3K0AB 1PJAA 2R60A 3DHEA 3E3NA 3GJ4A 3RVKA 1VLLA 1OZ0A 4N49A 5HF6A 2FZCA 3PWZA 1O1YA 2H0RA 5CBKA 1XVTA 3EXEA 4LYEA 3T3GA 3WTBA 4GSLA 4A27A 1D09A 4X60A 5IVHA 4A0HA 1Z5VA 3Q0EA 3AKEA 1FX0A 2ARKA 4XTCS 1YKSA 1UPTA 1CJUC 2JBAB 5TQ0B 4BO4A 2YDXA 4R01A 2PD6A 1QZZA 5EAIA 2M1XA 4KZKA 2XD9A 3L6EA 5EHZA 4WEOA 2AFIB 1V4BA 2IXFA 3FBGA 2Z4SA 2VIIA 5KS2A 3RADC 2QN3A 5F4BA 1CRZA 4GWLA 3RWOA 2TECE 3GJYA 3LUDA 5I47A 3E81A 3K35A 4F93B 3I23A 2OBBA 4ALIA 5JAIA 1XZDA 4OMDA 4RC9A 4P81A 1EFDN 1FVHA 1RWNA 3A9UA 1FP6A 2BR4A 2FG6C 2HJVA 4RF3A 3VNAA 5LKAA 3QVTA 1DBWA 2FY8A 2OC4A 4J9UE 4Q4JB 4UOEA 4YHBA 4QG3A 4DLVA 3KZMA 2LZ0A 3M5DA 4FEYA 4PZAA 2CNBA 1U2EA 3UCXA 2Z2JA 1RPTA 1YRYE 4QA9A 4R2WA 5FNZA 3WRYC 3SZMA 4EA8A 2BYTA 1HV8A 4S2UA 5J4HA 3UJBA 3P0HA 1QS0A 2DU8A 4DV1B 4OHUA 4U63A 1I80A 1NN0A 2Q6KA 1GZ4A 2ZWAA 3WHIA 1XTJA 1DG1G 4MINA 3MWDB 5EXXA 3BWXA 1LLDA 4QVIA 2JLAA 2H31A 2ODWA 3P0RA 3VYUB 2IYTA 2QQ5A 1NW6A 2Q50A 4RGYA 4CLRB 1JSRA 4RD1A 4AO6A 1LV7A 4HS9A 2PR2A 3UY4A 4DARA 5JVDA 2XMSA 1ZZGA 4ZPJA 3TCNA 1E92A 1SUAA 4YUWA 1QF7A 3FOWA 4HMPA 4Q15A 5CHEA 4D6YA 3LQQA 3E22B 4BLWA 4REOA 3KKZA 4F97A 1G42A 2EWVA 2VPTA 2L82A 3DH0A 5FI1B 3DM5A 3VH2A 5BW4A 4CKZA 1NGSA 3IERA 3LP8A 1GN8A 3MZ0A 3JWIA 4I46A 2CBGA 4NZPA 5H9VA 1XA3A 2BUAA 1TZJA 4EHDA 1IXYA 1PJQA 4JKIA 4M49A 5AQ1A 5BSVA 4W8HA 2OUKA 3S0JA 1O54A 5JQGB 4GO1A 5IN4A 1OTHA 3UMSA 4IKEA 1PZGA 1AJEA 3NTLA 2JCXA 3PFBA 4LOIA 4AUMA 4DKXA 4KXNA 4YJ3A 1BWSA 1HE5A 1FOEB 2C7GA 1M6HA 2FLKA 2YJNA 4B87A 4II2A 4EPTA 3QI2A 1Z29A 2Z2KA 4Q1CA 4I1OA 4HXEB 1N34B 2CMKA 1DG9A 2JFBA 2OA0A 4POOA 1N7GA 2V5AA 3QLJA 2A1TR 5IX8A 1TA9A 2OHJA 4TSFD 1F8YA 2IYOA 2O0LA 3PFCA 1X7GA 4P6VF 3RS8A 3U7QA 1OE0A 2GCEA 1DTWA 4ZYLA 3ZLJA 1I3CA 3DLIA 2LGJA 3LNCA 3KQYA 5G0VA 4V3CA 5JI2E 3IEIA 3UQYS 2VRBA 2J4CA 5CDYA 1NQ5A 3KHKA 2IF2A 1E1YA 4E2ZA 2JDIA 5IJXA 4RGBA 3SF8A 1SCUA 1Q7BA 2JLUA 3L05A 1O94D 3FWYA 3R7LA 4L16A 5I9NA 2PUFA 2OM2A 4OLHA 4R2LA 4GC9A 3IOCA 4TV8F 1CW2B 1NTRA 4ZVKA 3ES9A 1RC0A 3MGCA 5AICA 2A92A 5AYVA 3ZJ4A 2RI1A 4P8RA 1Q7RA 4INPA 1YASA 3L8DA 3RFCA 1NDHA 2JH8A 3H17A 3OE4A 4RENA 3WKEA 5FOQA 1JG2A 1E18A 4DUYB 2RGBA 1XLUA 4WIAA 1Q3KA 2ASEA 4HAXA 1NMSA 1CR4A 1GT6A 2C5GA 3NPAA 3AM5A 2BVNA 3HL0A 1XMXA 3INYA 5F3DA 1HYQA 5CJ2A 2AJ8A 4AWAA 4CDRA 3GFSA 1N2EA 3RT9A 3UPUA 1B6GA 2HRRA 2RC5A 1O5IA 1VCOA 4G26A 2H5EA 3CPHA 4O1MA 2WAOA 4BAUA 3OZCA 3K9HA 1VHDA 4TLLB 3GJ5A 3HZHA 3QWIA 4HXYA 3QU4A 3ZVKA 2V55B 2QLBA 2WKQA 2XJ4A 3T61A 3STYA 4V1CB 2HH9A 1JLMA 1M8PA 1ISHA 1Q11A 3G9XA 3GB9A 1C4OA 4GR4A 2BEWB 5IJ9B 3JVUA 1K7XB 1PE0A 1H22A 1CJKC 1PR6A 4AN1A 2JFUA 4FK8A 3RVPA 4GPTA 2Q3HA 4FX2A 2QEQA 3NOVA 4O02B 4IV5A 1B15A 1BN7A 4JHLA 2BEJA 1L4GA 5KUTA 3FYTA 2J07A 5H4HA 4KMRA 1Q0QA 2FA9A 1LJLA 3FOEC 2V6GA 1EXVA 1L9XA 2FWMX 4HRYA 5I9LA 1WMSA 3K9GA 3LRTA 1JHOA 3BSSA 4ZAVA 4AQYB 4BQPA 2MR6A 4LIPD 4GPBA 5HPYB 3BE5A 1PJBA 5DBHX 2UYHA 3ZGOA 1NR5A 3Q3VA 1OGIA 5LBIA 1UJ4A 1WXFA 2IBMA 3MBOA 4QXOA 4RDHA 1NYLA 2VHJA 1RLOA 2WTMA 5IARA 5HWSA 3TGPA 5ALRA 3C5HA 1AGPA 2VDJA 4BNMA 1R5OA 4YJHB 1BKDR 1XNGA 1OLUA 1RBMA 2HPVA 3A3NA 5DHPA 2V6MA 2R2AA 1W5AA 4NY1A 2W2VA 1NZFA 4Z2AA 2P6UA 2OBXA 3QF7A 4JU9A 4RK1A 5DK6A 4YAIA 1IOZA 1Q3TA 3S2GA 2UZIR 2CZQA 4GWKA 2C2KA 1ZCZA 1ZNWA 1KU0A 3GA0A 1M8GA 4Y2JA 3ZNNA 1KQGA 1SAYA 3H0EA 3O9VA 3PDIB 1QH0A 2YS6A 3FFTA 3FZNA 2HC9A 4KRXA 4HX9A 2QD2A 1B4DA 4TUYB 3C97A 1ENYA 4NJMA 3PITA 3VR5D 4CBVA 1DAEA 2IL1A 4MA5A 5IHPA 3IIJA 4GHWA 1M34B 1TKRA 4OBXA 2WM9B 4TMWA 2WIFA 3OZVA 4LX0A 2N0SA 5B36A 3AVVA 1TK9A 5I9IA 2J6HA 2PA3A 3DAGA 3MF4A 1TADA 1M7BA 3G68A 2VYNA 1Y7IA 1E62A 4FWIB 1UXKA 4E46A 4G1EB 1YS7A 1JFRA 1XDDA 4TS9A 4C7MA 1XHFA 3ADKA 2YBDA 3L49A 1VYUA 3IMEA 3PDHA 4UU8A 4YCCA 2X86A 3PNVA 3MJTA 5F33A 2DEUA 2G88A 1ZD1A 4JOBA 4B5KA 3I73A 4N5NA 4A0GA 1NRIA 1VPVA 1AQIA 1FTWA 1LVGA 1JV2B 4YRAA 4FFBB 1EVYA 1L7XA 4M6WA 4N7JA 3Q8XB 3I6BA 4INOA 2CN1A 1DI0A 3G88A 3BEOA 1P91A 5M2QA 5CW2A 1BCRA 2JLCA 4YBRA 3DPSA 3UXYA 4XJSA 2GSWA 3K96A 3EFEA 3R5SA 3BD6A 3FUVA 1UR5A 4X54A 5LBUA 4MRRA 3U9LA 3ITKA 4HLQB 1L5HA 2CHFA 5IAOA 2ZT7A 3BQ9A 1JKJB 1PFVA 5AI8A 3DD1A 3QMPA 2XXAA 3NLLA 1PQ4A 4JWTA 1ZAKA 2CVPA 5DO9A 1J8QA 3NUGA 4F38A 1BH6A 3ZHQA 3A58B 3FVWA 3UJ9A 2ZSFA 3PZRA 4IJMA 3KSZO 4OFWA 4QX6A 4DCOA 2EV9A 2X4IA 2PH3A 4OG2A 4BLQA 5TXGA 2WLTA 1EJ2A 3F46A 4C6HA 1YQGA 1UF9A 4EI8A 2XVYA 1PL8A 5JNVA 2QTLA 4WD3A 5AVTA 4ME6A 1DKQA 4KMSA 4M7PA 5G4KA 4QU0A 4MUAA 2DQZA 1P9OA 4EUSA 1VKZA 1OFUX 2PUDA 2J32A 4DUGD 3NIGB 4GR9A 4OGFA 1E61A 3Q1LA 2PD3A 4LDZA 3VVCA 1ZIOA 5AVWA 3GRVA 1KSJA 4HDRA 1QHHA 3NATA 4NZNA 4M8KA 2JGLA 4QTYA 2J0QA 2BONA 3A27A 3O8CA 3BMNA 1QKIA 3O83A 1V5IA 1XRMA 4RA9A 3JWHA 1BHO1 1GAQA 5CH3A 5AKEA 3C7DB 1DG3A 4IGFA 3N59A 2O59A 1KIAA 3GFOA 1AK9A 4IS2A 1N0UA 3FPHA 1K2VN 3CPJB 3EPRA 1BX0A 4CPDA 1T2CA 3SZ3A 4CCSA 4PLPA 1W96A 1R0BA 1D2RA 2OYSA 3EN0A 3R3YA 3QPVA 2VWQA 5DX1A 4WCFC 3TOSA 1YL5A 4AX8A 1Q0ZA 3R0QA 2Q5EA 4F3CA 4TVOA 1H3EA 5ER9A 3SYLA 3QWFA 3MYYA 2RGCA 4ROTA 3JCZA 3PQ6A 5J58A 4FMPA 3AUAA 2OENG 3ZOKA 2IEYA 2Q8PA 3HKBB 1OXXK 1PJZA 3TSOA 3DR5A 4JOSA 5AKJA 1SUDA 5IZCA 1FXWF 3M89A 4G9GA 3GG2A 5BYKA 4RABA 1U81A 3QJYA 1HYBA 1Y5IA 1IJEA 4HAIA 1VLMA 1PGJA 2XNJA 3EF1A 1DHTA 4UNSA 3UJCA 1L8LA 2BMEA 3GX1A 4BYGA 4XVHA 4ZT7A 4FC7A 1W36B 4BAGA 3CZRA 3LXMA 4UPEA 2CSXA 4QXMA 1Z56C 2H29A 1K63A 1DKOA 4HSGA 3A1WA 2H4XA 4QOEA 4RESA 3C39A 3EE6A 1GTL1 4O4JB 1TQ6A 3TIVA 2GX6A 3AIOA 4YGYA 1LXCA 1URPA 1DIRA 3D1JA 3OFNA 3DQQA 1X9GA 1GZHB 4B47A 3QXSA 1MKYA 4RVCA 5F2OA 1M1UA 3DNMA 4DV7B 2ERXA 1SU8A 3GV0A 3QBDA 4JGGA 1CUSA 5J1SB 1ZD8A 4V0NA 1JH9A 3WMRA 1QWSA 2JK1A 3KT8A 5DN9A 2IYWA 2RHWA 1OV6A 2G4VA 2PE5A 5CX1B 3FHCB 3IP5A 1WD5A 3VU0A 2A1TS 2ZUFA 1UMDB 1XYGA 2Z2ZA 1I3MA 2Q2NA 3KBBA 4M1QA 1GUAA 2P40A 5EYPB 3SNKA 2WYIA 3NH6A 3KIPA 3ZTTA 1HKUA 1EWYA 2AW5A 3ZU5A 2PJRA 2GQ0A 3OOWA 4X45A 1L3CA 1B8PA 2Y92A 4LHSA 5IAGA 1L7BA 1FSZA 1WLSA 2E4YA 2REQA 2VWGA 1TTPB 3ICCA 1YQWA 5F64A 3WWYA 3EY9A 1JEOA 3IBSA 4OUDA 5KTNA 4YCMA 2AXPA 2I4LA 2Z83A 2ZRIA 3LY7A 4IMIB 5EHQA 3VPDA 4BFXA 1AQYA 4GIBA 5CLIA 4PAQA 3JVVA 1LI5A 3D4PA 4QJIA 3KYJB 3FN4A 2VDWA 2ZYGA 1HG0A 2ZVJA 5EXEA 1UKBA 3I5XA 5D3ZA 3V4RA 2GYUA 2YY5A 2VP5A 4RD2A 3E4DA 4KMOA 2ZBRA 5LZ4A 2RHJA 4R6WA 5ALZA 4MR9A 4NDNE 2FPRA 4V2UA 5HCNA 3ZS9A 3WYDA 2CLFB 2CFTA 1E1QA 4RVFA 4GE3A 3OX2A 2Y76A 3GR6A 5SYNA 2ZYIA 2ZYDA 3ZDFA 3JQ7A 3TSAA 1SK8A 3DWGA 1XCLA 2IA5A 3PE4A 4DBLE 5KYGA 1MZPA 1E98A 3B6KA 5JJBA 4TX1A 1LPOA 4MTLA 2IV3A 1CUIA 3ETJA 3KJEA 1PR5A 2H57A 4JVNA 4WLFA 3NALA 5FCDA 4J1SA 5BQFA 1X1CA 2IPOA 4C04A 3S1LA 1Y3HA 2H7CA 1IAVA 1K6XA 4P9NA 4XCVA 1SWVA 3GH1A 2PUJA 4PYLA 2R5FA 3L8YA 2Z3VA 3CV3A 1AZLA 1GNPA 1HE3A 1YIOA 3ILXA 3N2KB 4M0UA 5FPPA 1JDNA 2Q07A 3HA3A 4MUEA 4JJGA 3CMMA 4WNAB 1Z68A 2AOVA 1IQUA 3AQIA 1QTQA 2VTKA 5LB2A 1G98A 3CSDA 3W05A 1HLFA 1E1RD 1MH1A 1QHXA 3W79A 4KQ1A 4DL9A 3BXOA 4EX6A 2O6LA 3D7SA 5JCJD 2A67A 2QKYA 3C1UA 5KNCD 1F8GA 4PSDA 4XJXA 4IOJA 3U6KA 1H1DA 1SWWA 3G7NA 2IYFA 2HJ9A 3S70A 4EGSA 1IL0A 1L5WA 1X7XB 3GJXC 1XDGA 3LQFA 1QUEA 4KKVA 1W4LA 1F1JA 3LWDA 4MS3A 3OQ1A 5E38A 5EZQA 1OQAA 2OPBA 5T8KA 1EAMA 1CJTC 1GNLA 2VUTA 3WP0A 1PJCA 3MPUA 5AK4A 5JLAA 2RBEA 1Q22A 2Q62A 3T3IA 1C3VA 3EB9A 5DYNA 5HKOA 4QUIA 3AKYA 1TMOA 1OFGA 1R16A 2WAYA 3NTQA 2ZYSA 4RL4A 3BIXA 3OQJA 4OSEA 4WLOA 3T7IA 2JRCA 4BO2A 1YQEA 3V1LA 2MJLA 1A4UA 3K16A 2EXXA 4DBVO 1DC7A 2HCRA 1CJSA 4Q19A 4GKBA 4BFLA 1PFKA 3FYUA 2Q7OE 1F9AA 1UDAA 2P0EA 2F1IA 2VPIA 1A9XA 4U1RA 3FPJA 2CUKA 1ECBA 3R8XA 4D9JA 5I9MA 1DIGA 4OIFA 1I8TA 4M83A 4PWZA 4XSVA 4BNGA 5HW0A 1GEEA 3PJFA 2Y1WA 4PC2A 2NUBA 4RLFA 3QX8A 1GCGA 4L95C 4UCQA 4R8KA 4MWCA 1SHLA 3FPCA 4D96A 2O2DA 2WJWA 2WWGA 3VXKA 4QWMA 5C7YA 4F86A 1VIYA 1K0UA 1TQ4A 1SQSA 4PV7A 5DT9A 4OSOA 1TFRA 1XO1A 2V6BA 2CJXA 2WTAA 4J8PA 5GM1A 2WJIA 3NU1A 3V7UA 2QQEA 5ERYA 2XGGA 1XD8A 2I29A 1W88B 3KEGA 1T5DX 4GSKA 4GRAA 8MHTA 4I6GA 1DTEA 4YUZA 2C0QA 5H1YA 1UM8A 1L2TA 1XMPA 2O2HA 1DAPA 2ZULA 1J2TA 1A2QA 1DBVO 3DXYA 4LPSA 4X95A 1QV9A 3I34X 4CIBA 4EABA 4PX9A 1PZNA 1XU4A 3ZQKA 2VT6A 1GRRA 4MI9A 4YI5A 3WLSA 3R7FA 4RZUA 2B0JA 5I4KA 3UWMA 3A26A 3EVGA 4QM6A 3SFZA 1E0DA 5TQJA 1YSCA 1MB4A 1NBEA 2PZ8A 3IBTA 1GZ3A 2B21A 4MMZB 1AKEA 4DCJA 4UTVA 1ZAYA 2HY7A 2ADOA 1IWOA 2ZJBA 4V0QA 2BKXA 3QSGA 4JC5A 1M67A 4YFVA 5G0TA 4TTSA 4YN3A 3KCQA 4WESB 3TPZA 4RVUA 3UK7A 2CUZA 4Q37A 3MCTA 3K0KA 3AUTA 3PQ4A 3FMPB 4AAYA 1N5JA 2AFRA 2JI7A 2VYFA 4MPPA 5EMHA 4R9NA 2IHTA 4N6OA 3IE0A 1U4SA 2YV3A 2J5BA 2P2YA 4HAYA 2WICA 1LU9A 1KZ6A 1YAHA 2J1LA 1W4AA 2ZSJA 3B1YA 3DWIA 3OAAA 1LVUA 4FT2A 4G4SP 1S2LA 4ITRC 2E4UA 4J03A 5EIEA 1RXCA 4GXQA 3VHQA 2OY0A 4EGQA 2XAUA 4GDFA 2O8DB 1Z4QA 1J00A 3BHIA 2REOA 1DJLA 3LQ2A 4YVFA 4EHIA 3EXHA 2VP9A 1RQGA 2JFQA 3COZA 2HLPA 4MQ6A 4E2FA 1FQOA 5EY5B 5MFPA 4Q4CA 4RSGA 2W58A 1UBTS 2J31A 3KELA 4A3SA 1DC3A 2GJ8A 2XQIA 1DWQA 4TXLA 4YRTA 1JAZA 1XYVA 2BI8A 2O06A 5DI9A 3Q2KA 2VR1A 5F1PA 1LW7A 2HDNB 2HZBA 4AM8A 5IZCC 3Q4GA 4IJQA 5K1ZA 1C0IA 2BDUA 4QQFA 1G3MA 1GOTA 2QPOA 3DDZX 1R4AA 2G4LA 2ZROA 3EDYA 3L6OO 2XV1A 3OIWA 3QIAA 3DTVB 2QY6A 4DCPA 1VLJA 1X8XA 3M5WA 3THWB 4PO8A 2CBXA 4IXNA 1RI3A 2NTJA 4OQLA 4WRRA 3HMQA 2E1RA 3NJRA 4NPAA 4WY8A 4NCAA 3EQ6A 3T9CA 1CUUA 2O8EB 1FLVA 2VK1A 4KI0A 4HGOA 4TV9A 4U39A 4KUGA 1X7ZA 2QMOA 3OY7A 4OI2A 3ZHYA 1VL2A 4B0OA 3K71B 4OLFA 1M2WA 4O0MA 3VHXB 5BWLA 2Q9CA 2J4DA 4WXRA 4YC7A 3E7FA 3N2GA 1YULA 1B43A 1BVUA 2QTHA 4AKHA 3G2QA 2GWHA 1GN9A 1CYEA 1SKYB 4FN4A 3M4YA 1RADA 4X6LA 2V8OA 2AJBA 1LRJA 3AP2A 4JUBA 4EUNA 5DYYA 1W4BA 1T6NA 3DB1A 3SWWA 1TFUA 3RFXA 4IX9A 4QYIA 3N8KA 2WAMA 4JQOA 3UVEA 5A4AA 3D2LA 1XUOA 4NJEA 1C29B 3IR6A 1ELOA 5JNLA 4JEMA 5CK4A 2O07A 1V39A 3FTNA 3ISJA 3CEHA 4Q3LA 5BYBA 1VSTA 4KTTE 5C1OA 1YCDA 1U8EA 4LCBA 2P1DA 4ZHQF 1XCJA 1P3JA 1GNVA 1IXKA 2C99A 2MMCA 1QAOA 3B1KA 4PZ9A 4OJYA 1N5IA 4ERNA 5KNBH 4JR0A 3COPA 5ILOA 1AHNA 3SI7A 4M21A 1YB1A 1NSTA 4XLLA 1R9NA 2VPZA 3RSCA 3SFVA 3SR4A 5EIAA 3MT9A 3RCBA 1YHZA 2OHVA 3IE2A 1NUTA 1SULA 4I50F 3ORFA 4OXIA 2AK3A 2FZWA 2JLSA 4A2CA 1ZLYA 5GGYA 3E9EA 3MC1A 1NYQA 1EGAA 3CHYA 4HR7A 1C1XA 2OO5C 2BFCA 3M5PA 2OQVA 3WMGA 1VSUA 2BN4A 1M6EX 4WBNF 2JIBA 1SBNE 3GEPA 4YR7A 1WD7A 5TIIA 3WQSB 3T1VA 4RM3A 4D5EA 2QW1A 3DUFB 2ZP1A 2FPIB 3FCSB 3FVTA 2WINI 2G06A 2UZ1B 3CJTA 2JGIA 5B3JA 5EIHA 3KXKA 3M81A 1MCZA 5B4VA 2R6FA 1YFZA 2OP0A 3PPVA 2B94A 1ZK4A 5K0JA 2OCPA 2PX0A 2WFMA 1YKGA 3CX4A 3NHFA 1FK8A 1CUBA 4NYMR 1QYDA 1FFEA 4HFNA 3VI4B 4IHKA 3HN2A 3CN7A 2J9RA 4HUJA 2DUUA 2V45A 3WZMA 5JASA 2PCLA 2OZLB 1CERA 4QGAA 5IBQA 3WMWA 5JZVA 1JPNA 2VAWA 1V0JA 2AQIA 5A6SA 1H23A 1WE2A 3IKTA 2CDAA 3SMVA 1J8MF 1JYFA 4DNPA 4ZJZA 4FZ5A 3KC2A 3R8CA 2B98A 1R0SA 2Z9BA 3EYAA 4BASA 4DV6B 2OCBA 1RWQA 2OGTA 5DYWA 3JRNA 1HEUA 4E08A 2H08A 4KVZA 1EB8A 1Q7TA 1EGVB 2ZJ5A 2CB9A 2G77B 1RHUA 1W73A 4MUFA 3V7FA 5BN5B 2EBWA 2I78A 3CUTA 2GRUA 2SBTA 3O7MA 5K3DA 3V00A 3VO1A 3OQNA 4AS2A 3K0SA 3PRYA 3KR2A 3BKWA 2AOUB 1PSZA 2VEOA 1E3QA 5EINA 4ZVMA 1YOBA 3WYAA 5HQ3A 4I1YA 2I2CA 5DNYB 2RAPA 4QXQA 4D97A 1PU2A 1WBBA 4R9UC 3LO5A 4TMYA 1V7ZA 2IYYA 4BQIA 3PQEA 4J7UA 4IIGA 1XTTA 4QU8A 2G72A 4H3SA 1ZC3A 1T2VA 2WWRA 2BFMA 3N8HA 4RK5A 4B82A 4FQ7A 4O8CA 3WKAA 2F43A 4K0KB 2C0CA 4XB6B 1TQ8A 1GNSA 1P3DA 1SCBA 3E9QA 4R3UC 3UFXB 1XCGB 5IMBA 2XODA 3CRW1 1Q83A 1JT2A 2BL4A 3DZFA 4YCAA 3PNKA 2WP0A 3LBHA 3OCJA 4BPRA 2GLUA 2CLDX 3GNSA 1UKEA 3IJEB 4NNOA 4FCWA 1QM5A 4TTRA 4CQLA 3VKUA 1HSOA 5IWCA 1S1CA 2GGSA 4NULA 3N8GA 5B7QA 4AUNA 5IJ0A 5C4MA 2GN8A 4E21A 1OCEA 1P2UA 2PS1A 1KMHA 2X6RA 3P71T 4IIFA 3KVVA 1Y8ZA 5KYUA 1J97A 2Z4TA 1K6IA 4Y2VA 2WWTA 3ZHUA 3UK1A 3K9CA 1QGAA 4W8GA 1QLJA 5KU1A 3HV0A 5FADA 4QTTB 3OEYA 3PUWA 1U1CA 4O6VA 4YRFA 2AX3A 2I4MA 3WO0A 2JCYA 3I53A 3CY6A 3DE4X 3PUVA 3ITNA 1VC2A 4Q9AA 4Y67A 4S24A 3HBMA 5FFFA 1C8KA 1PDOA 4IDCA 3KVYA 4WKOA 4HNVA 1QGDA 4ZN6A 2Z3ZA 3I9V1 4QECA 1T4GA 4M0KA 1PQPA 4XKJA 5TQ2B 4B4VA 2O05A 5B4UA 1XA4A 2MSKA 2HWKA 1FJGB 4KE6A 2GEVA 1N78A 2ACVA 2O50A 2Z2IA 3SXUA 5F5LA 3D0RA 4U2GA 4MVXA 5LB4A 2I4IA 3H4MA 3W5SA 1VSVA 4AXBA 2Y1FA 3PE3A 3IDQA 4RVOA 1VGRA 1Z06A 3H4IA 3RUPA 2M6KA 4OJKA 4Q1AA 4KX5A 1WLYA 3D8HA 3FOZA 3RYIA 2M1ZA 3W3AH 4FIDA 3QVGB 4HXGA 1KIMA 2IU6A 1AXRA 2VBIA 3ZU2A 2UXDB 4FZJA 2Z30A 1LRLA 1UOPA 2FGJA 3D6HA 1T9GR 2Q0SA 3D6TB 2PGNA 4TTTS 1S3SA 1TF5A 1ZWLA 5AW3A 3EXHC 1B0ZA 1M72A 3QXHA 3RVDA 4GRIA 5JQWA 2RSLA 2PLAA 4UTXA 3ZD6A 4UULA 3C6YA 1IPFA 1TM5E 2YY6A 3VGJA 2NT4A 1OD6A 1OIXA 4JYBA 1ZSYA 1HYGA 2P75A 4XOUA 4AP6A 3R3ZA 4GNRA 3N0RA 2GPNA 1N2SA 2PT6A 3UHOA 1NBAA 4D0RA 3TLGB 3NM5A 4F4CA 3M7IA 1UANA 5BR8B 2RC6A 2R5WA 2RGGA 2VJMA 1NURA 4Z9FA 4ZA2A 1I1OA 1WW2A 3O91A 4D43A 5H4GA 1BQEA 3ZK7A 5JHHB 5LP1A 2P3LA 3BCRA 2QORA 1ISFA 1JU3A 3BFVA 3I6IA 3A4VA 3QLUA 4TYYA 2YN2A 3PNPA 4HNAA 1CQIA 3LYLA 4JMLA 4XGRA 5FPSA 4I5GA 3EQ9A 4P80A 1A4IA 5TPWA 1NVKA 4L6AA 1NBMD 2KYRA 3RUCA 2PX4A 1GTG1 2CK3A 3EIXA 3UAVA 4GM1A 4MRPA 2VQEB 4WLEA 1MFPA 2UXCB 1BE8A 3FY4A 2FSVA 3MJEA 3O8OA 3NBAA 2CNNA 4PCUA 3HGMA 1J21A 2C3OA 1TF7A 2XUOA 4RA6A 3BMCB 1PZEA 4UU1A 4BFVA 3M9LA 4WGGA 5JWHA 3ROTA 1CUJA 4UBNA 1ANKA 3K6SB 5DSXA 1ZM4A 2QTBA 4OREX 4X9XA 3TE7A 2J3MA 1VDZA 4WUVA 1LI7A 2B2CA 3AB7A 4HTFA 2FAXA 1UOOA 1VMDA 1KR5A 4GXTA 5DNVA 1YZNA 2X4GA 3AFNA 4EJSA 2JLRA 5C8ZA 1W2GA 4HF7A 3O93A 4ZXPA 5CB4F 3GRCA 5EXSA 4NBWA 2H2HA 2DETA 5TE9A 3FW1A 3IT2A 2X9LA 1YHYA 4L57A 4F8JA 5IBPA 4NRDA 5ES4B 3RTAA 4MUIA 5SYMA 6Q21A 5L4NA 4OL0A 4C0KA 4ZQEA 4IF6A 4CMGA 5L7TA 1XXLA 3M49A 2W22A 1CQPA 1O5TA 5JW6A 2ALJA 1RRPA 2IKSA 1IZ0A 1UCFA 2VQDA 1FLNA 4ZV4A 4AYTA 1PWXA 3D6MA 4FW9A 1A9QA 1IC6A 4UJ5A 4DPMA 2AI2A 1FNSA 3JQRA 3QE4A 1Q7GA 4OHOA 1WXHA 4B84A 5AKLA 4C4AA 4IM7A 4E4TA 4KZPA 4EHAA 3U56A 5H3HA 1NRXA 1BEUB 1TYEB 2JI6A 2XZDA 1QGYA 5H0IA 3ZLVA 2ZDQA 2YHSA 4LJRA 2EX0A 2A5LA 2VL7A 4ZI3A 3MINB 2OO3A 3PFFA 5FTLA 3Q7QA 3DVQX 3VMFA 4KRFA 4OKIA 5J4KA 5JS2A 2NU7A 4IH1A 1ID8A 4ZI2A 3R3UA 4UNIA 1JE0A 3OU2A 3ZLUA 1EFRD 3DOEA 4MAAA 1YNOA 1ZBDA 3KYDA 1MA3A 4LISA 1O95D 4I9FA 4IVQA 3HYLA 3RUEA 4ER6A 3H5LA 4U6QA 2YWBA 2DH5A 1M0WA 2LCFA 4FHEA 3ZWQA 2IXGA 4PGAA 5BSMA 2LUOA 2ZAIA 4PANA 3TTXA 1EZZA 2F1KA 3WICA 4DJ5X 1Q1QA 3DL0A 1IM8A 1QE5A 3C5CA 1RJFA 3IEXA 4CTNA 1KO7A 1CEEA 2EKBA 1VE9A 1JFLA 5LQRA 2PAFA 1RZRA 2I2FA 1IULA 3SYMA 4BZZA 1NV9A 1J0EA 1T91A 3WL4A 1KAMA 2VJLA 3HCPA 1D0IA 2K6GA 2EATA 5JRJA 3CZMA 3D8SA 3FGPA 4GPEA 4K6GA 4YLGA 2DE0X 1RLIA 2XITA 3CO5A 3AFGA 2ZPTX 2AOWA 3MG9A 4JC0A 2EDCA 5DOZA 3SY8A 4BMCA 4YT8A 5CVDA 3A1TA 4Z5XA 3U16A 1B0UA 1N57A 2BFBA 3M4ZA 3C43A 2NAPA 2WTNA 1AA6A 4JSRA 1SUWA 2KPOA 2HIGA 2B3TA 2YC2C 4O63O 2XGJA 1QDUA 1SQGA 3CZAA 3E5MA 4DB2A 3ED5A 1V4NA 1WSAA 3Q3EA 1PLLA 1RHRA 3TD2A 5FOSA 4PIVA 4L22A 3TH5A 2Q3FA 3BGSA 3CKYA 1GSIA 1U7WA 5D84A 1ST3A 3L7JA 3K5WA 2PMEA 1H2RS 5IM4A 4B3SB 1Y80A 2M9MA 3EA5A 3MTAA 3OA2A 1U2RA 4HEJA 4KWHA 1VGQA 1WCIB 1TJ4A 4KCGA 3HYRA 4YP6A 3HB1A 2EW8A 1TVKA 3HYNA 4C21A 1MF7A 1KO8A 1N75A 2Z95A 2ZE8A 4KAAA 3VR4H 2DWCA 1R2QA 4UUOA 1FLAA 4P38A 1MAUA 3WL6A 3RD5A 1UBUS 3AR3A 3UAOA 5EIOA 2HL6A 3RTCA 2FG7C 1A76A 4YCBA 1XQ1A 4JMPA 4N0EA 1BD3A 2O3TA 2B8EA 3NHZA 3SSMA 3AH8A 3DMTA 4UEJA 5EMNA 5T3YA 1FDVA 4OBWA 4HDSB 2PN1A 2IOHA 3RVBA 1S7GA 4ZK2A 3U7GA 3O21A 1SJ9A 2OCXA 4BGUA 1G3QA 5BOSB 3H2YA 5J2TF 2SCUB 3K94A 2D8MA 3OF5A 4PEVA 5FOVA 2HMTA 1J1IA 1KI9A 1MAHA 1A88A 1TD9A 1ZVKA 2AI1A 2RHHA 3EMKA 3OWHA 4Y2SA 4OXXA 3CKKA 3VISA 4DVJA 4R81A 1WUKS 4WKGA 1NVAA 4Y6SA 2GZRA 4EHKA 2W6JD 3O2QB 3DBRB 1T5TA 1TZMA 5JY1A 5DNEA 3RLIA 1GUYA 4H1TA 2R9VA 3H9JA 1HDXA 4EO4A 1GXSB 1CFZA 3A4NA 1L3IA 9LDTA 1B76A 3PFGA 2A3NA 2HHLA 2H6EA 1O94A 2H8GA 2VHWA 3UWSA 1XR3A 2BMWA 2IW3A 3HABA 4MLDA 3QV2A 4O4LB 1U5BB 2PX3A 4PHFA 4YJFB 3W5UA 3S81A 4Q7QA 3DR3A 2OFWA 1XMQB 1OXBB 2ZIEA 3KDPA 4RJ2A 4D5GA 3I9JA 2BKAA 4LBVA 2QD3A 4HWGA 4M1EA 4IIJA 3ZLBA 3BTVA 3G2KA 1JR3A 4TWJA 2H2GA 3IKLA 2EOAA 3WLAA 1T5HX 2Y1DA 3UUFA 1MXHA 3ZE7A 4QPCA 2GBFA 3PXBA 4B71A 1ZNXA 2SNIE 2RB5A 2V65A 2WVAA 4OY3A 1IEVA 4C03A 1NJ5A 1NJSA 2BGTA 3OLVA 3DUWA 2VQSA 2WQ7A 3JQAD 3EIFA 3EC1A 2QUKA 4LJLA 4MIKA 3V3TA 3JARA 2C8JA 3WAJA 2Q0HA 3E5NA 4E5UA 3DVAA 2IOYA 2GEUA 3KOMA 4N3AA 1TEVA 1LS6A 2KB0A 2C59A 1CEQA 4CFZA 2YFHA 5TJ9A 1HFEL 2QN8A 3NHUA 1SQ0A 1D8AA 1YBFA 5E3IA 3GOHA 5TNXA 1YBMA 3P9PA 5E7JA 3AR5A 4RFSB 1V2GA 4IX1A 4M99A 1WXDA 2H9AA 3AEYA 2HIAA 2IP4A 3GJ3A 1FRNA 1M1YA 2EG9A 2YOFA 4GYKA 4TSRA 3RSLA 4NL4H 3CVWA 1QVRA 3B38A 3H0KA 4YK7A 1DINA 4CODB 2WKRA 5A7FA 1KYQA 4M7RA 1E9SA 3LT1A 1LBHA 1T9AA 1ZJJA 1IY0A 5GZ1A 1X19A 4B3RB 5A05A 4D42A 2ZRLA 3K4HA 1AS0A 4FBMA 4IIBA 3UB3A 4B8ZA 4KHPB 1XVAA 2UUPA 1QC5A 1HKHA 3HDVA 4U9IS 4DYDA 4CIXA 4K9OA 5BURA 5BORA 3LIIA 1DMSA 1G18A 2QX7A 3B1WA 3PWKA 3GT3A 4UD6A 2C2XA 1GTMA 3ZC3A 5C0OE 4YA6A 4LW8A 4R1QA 4DDUA 3QUCA 3JYPA 1H3FA 1SBTA 5L53A 2EGUA 2YN0A 2WIBA 3KPWA 3ONDA 4FOLA 2GZ2A 3SSOA 2QTVB 3GFTA 3GA5A 4YS6A 4DWVA 2IKQA 6REQB 3QPCA 4H1WA 1PFWA 3ROQA 1CR0A 4L5IA 3V46A 2HN9A 1F6BA 1J0CA 1XNJA 3E1GA 3UKDA 1ZO8A 4EB3A 4XYGA 4L0DA 1U1FA 4JELA 2CY0A 4Z4GA 5LLSA 2TMYA 3ANYB 3GJ6A 3EFOA 4OLJA 5KYYB 5CUQA 1VKNA 3AI1A 4Y1GA 2BTQA 3ZGNA 1NXPA 5KTMA 4NCXA 5DIFA 2PKRA 3UMMA 1PL7A 4MGYR 4RDIA 2X9QA 3ETHA 5CYFA 1JBKA 1UQUA 4PCLA 5DJ5A 5AFSA 1PS0A 1OUMA 4ZI5A 1CP2A 3QUSA 4O8ZA 3R6GA 2D5CA 3GGDA 4M0CA 1D3AA 1Y4ZA 4ER3A 4ZO6A 1PAUA 1KMIY 1R6BX 3OM1A 1CTQA 3K53A 1ACLA 3JRWA 2I99A 4U2DA 2ZIXA 4UVEA 5ARCA 3M6IA 3KJNA 2FUG6 3O31A 3EF0A 2DWUA 4RHCA 5ALLA 4DZRA 3TW8B 2RH4A 2D7DA 5LM3A 2OV6A 3IJRA 4TZ0A 3VU9A 4CCYA 4ZIRA 3NDPA 4HAVA 1AV7A 2GNPA 4KWEA 4LZZA 4MUBA 3WLEA 4E2WA 3JZFA 2QG9A 5AW1A 3ERCA 3IPRA 5JAZA 2OCDA 3G0OA 3VAAA 3ZNQA 2DKNA 1ZYUA 4UW9A 4YROA 4DMRA 2L19A 1Y3CE 1GPNA 5F1OA 1YZGA 5EEHA 1UL1X 3WO1A 2O7NA 1F2UB 3MLEA 4NS1A 1VMIA 3GA7A 2BGKA 3U7EB 3WOVA 1T4MA 3WR5A 1JR3E 4JSTA 3M3DA 3UMJA 2ID8A 2W6MA 1AB6A 2EIXA 3EZYA 4XA8A 3WGMA 1JJ7A 4LYFA 1QYRA 3EZ9A 2HMVA 4M0LA 1K89A 4H16A 4FGWA 4Q24A 1EVEA 3C3CA 4NBLA 1I01A 2XSZD 2UZAA 3ICEA 1H8ED 2PX2A 3N8DA 3OVMA 3W8EA 2DHCA 3BWVA 2NVUB 2I5PO 4Y6LA 3QFRA 3ZEAA 3QEAZ 3OWXA 3KD2A 1KP2A 1ZK1A 3VR3A 1LSUA 4LC1A 5H81A 1CY4A 1G3RA 2E2WA 3GHYA 1RMQA 4IWXA 3QEJA 1X1DA 3DEZA 5KJ1A 3QLTA 1K92A 2BHRA 5ERGB 2IBSA 3OEHD 3O90A 3T7DA 3LJKA 1QG6A 3C6ZA 4I66A 3V4FA 1NVVQ 1R50A 2GD1O 4ERXA 3LDHA 2O7QA 5EXPA 2WUVA 4DXAA 821PA 4AY5A 2E37A 3K8ZA 2Y1LA 1B6SA 3FHJA 1LRKA 1M1YE 2ADMA 3NYWA 4F9FA 1PWHA 5K2OA 1C1HA 3QKWA 2ZREA 1I2BA 1ZRHA 1Q15A 2P8SA 2GBLA 4GZ5A 1KZYC 2X8JA 3RSHA 3T8YA 1JXMA 4FFPA 4FGKA 4P84A 1SD5A 3TFWA 1IK4A 2Y8EA 4GP7A 4JKOA 1XPRA 2OV2A 2LKDA 1GL9B 2HF2A 2ZVDA 4QOHA 3ZDBA 1GU7A 3AI3A 1DJNA 2ZUDA 5JJ5A 2RCNA 1QVZA 1RJ9B 4OXNA 5LJIA 1L5MA 2FR8C 3V7YA 2XTNA 1PT9A 5CT9A 3SEQA 3ZH9B 1ORWA 3F3YA 3CSSA 4QFCA 4WZBB 4BTEA 4ZMSA 3SC3A 2GNAA 1QRUA 2W11A 4JLAA 5KOYA 3EPKA 2F3SA 2CV0A 2VHEA 3NANA 4OHZA 5LQNA 2VPYA 4GM0A 1ATZA 1M75A 2DBZA 1BDMA 1OGYA 2J46A 3CBGA 2B6HA 1E5XA 1CP3A 1GY8A 4M2LA 3P0EA 4W5RA 1DFIA 1W36D 4PG8A 3OE5A 2ZQZA 4NU8X 3U40A 2QS9A 3GU3A 2AJCA 1N2JA 2E0IA 3KDAA 4JASB 4NP6A 1IHXA 4NH0A 3U3KA 5CG1A 3TQFA 3EGDB 5FLEX 2IJGX 2WT4A 4HWTA 2J3EA 3MMZA 5A3QA 3LGXA 1U0OC 3OQBA 2ZWIA 4IIDA 1QE3A 3CURA 2YH2A 4G4JA 1EFVA 1KI3A 1CYDA 2OFOA 3AERB 4S3MA 4TROA 2GXQA 1JEYA 1JFVA 2FWPA 4ENPA 1TZKA 2AFHB 2B25A 4BV3A 2GK6A 3SQLA 5BT9A 1SKBA 2P2NA 3KLNA 3OKCA 5CEEA 2X5XA 3AHGA 1W52X 3G49A 5E0OA 4O59O 2WZQA 3MS7A 1XQ6A 3TUZC 1Y4SA 2PK3A 2VAPA 1KR2A 2DT5A 3ZE8A 3OX1A 4TS3A 2YNMC 4X85A 2H2DA 2E48A 3EK2A 2ZI7A 2Y0DA 3WQHA 5F73A 2X2PA 5JAHA 3ZI7A 3U4MA 2FVXA 3CONA 4DPKA 2PUWA 2JD0A 1N5RA 2C8KA 3UC5A 3K5PA 1G8FA 2BGWA 1DKRA 1G8JA 2DFNA 1Z7EA 2Q1SA 1PK8A 2QSYA 1P0MA 2RHRA 4GSYA 4KVFA 3AUJB 4OHPA 4I1IA 5EEGA 1IOVA 3RK0A 1RZVA 3IVAA 2R97A 3KOWA 4HWKA 2ZJ4A 4UHEA 3VR2D 1C8BA 4B4WA 4EY3A 4ZDJA 1MAAA 2A2ZA 2P7IA 3ESDA 5CDUA 1MABB 3VX4A 2NIPA 3NIDB 2Y93A 1WNTA 2QVZX 3EOAI 3PGA1 1YJBA 3EZNA 1DEKA 4YRLA 3X43A 4RDCA 1SUFA 2I1WA 1UPAA 2OHFA 2ODAA 5I7UA 2RGWA 3OLYA 4DIMA 2Q5JA 3EZXA 4JI0B 2F4NA 2NO1A 4KIGA 1L7OA 3SBXA 1THMA 4F1JA 5EKDA 1N5MA 3L1IA 3V2UA 3ZQJA 3W1EA 4QLBA 4PW0A 2EKQA 3WGYA 3IUSA 1NE2A 3PG5A 1RBYA 3NTUA 5EUQB 4DG5A 1VIAA 2GILA 1E7RA 2YW9A 3OPMA 2FX2A 1Q91A 2O8CB 4F96A 1WY7A 3ZCQA 1CY7A 1WEHA 1QFYA 4CG1A 5AVQA 1JNXX 2RG7A 3T4XA 2A4MA 4M0DA 4IJVA 2Y1OA 4ZCQA 1JQJC 1U8ZA 3P9ZA 1KFJB 1QFZA 4LRTB 2LE0A 5E6RA 5KDDA 1Y34E 1MPXA 2FQYA 1BG6A 1IONA 2DPYA 1HO3A 1UXIA 3LX5A 5DHQA 3K8QA 4HDKB 1OIVA 1H6BA 1BWRA 3OM9A 1LKZA 2F17A 5DLPA 1SFRA 3MILA 4S0ZA 2FW0A 3GGJA 5EJ5A 4LTMA 1AGYA 4EF4A 1U31A 1PG0A 3R0IA 4KGXA 4CI9A 1L8QA 4MSUA 4LPKA 3V8VA 1YJQA 2EW1A 5CA1B 3D8RA 3MYRA 3IESA 3ZDAA 2TMKA 2XRFA 5JANA 4UHJA 3HCBA 4X64B 1V26A 1OYWA 4LAFA 3HYTA 2EFJA 4EZEA 3PHJA 4MUKA 4Z0NA 3HNOA 2XQFA 3AFMA 4NEHB 3OZWA 4OMCA 4OKNA 3UAGA 4I3HA 5JH7A 1I33A 4PYJA 1XPJA 1SC9A 1FFWA 1YR6A 4HUQB 4EWLA 3K9FC 3QE2A 4EJMA 5DKFA 4AKEA 4NBNA 1EEXB 2JHAA 3GZTB 2V7PA 4O2AA 3DDOA 1YMVA 3BIOA 3NW9A 5HS6A 1J23A 2PWZA 2PBLA 1C3XA 3P2YA 2BZ1A 2HQRA 5FBWB 2X6TA 2IEZA 4Z2YA 5ALEA 3EXFA 1HDOA 3TZEA 2GA8A 1DSSG 1SKUA 4G07A 4YRJA 4OB8A 2H1LA 2QN1A 4ZOLA 5FXMA 1H5QA 3HP4A 1G5FA 1EB9A 1KH1A 1RHMA 4GOKA 5LD2C 2OORA 1M6YA 2PRKA 4GLJA 3RTEA 5KYVA 2VG8A 4R54A 4KEAA 3H8JA 2ZB8A 5FOWA 1UKAA 3U62A 2C84A 1H8HA 4GU5A 1OB5A 2RH9B 2E5WA 1J39A 3F74A 3HR8A 5LQSA 5I7EA 5K3EA 2NX2A 4WZZA 3DO5A 4MAFA 3CLUC 3GDGA 2PU5A 3GYBA 4ZO7A 3IB3A 1X7DA 3R3XA 5AKIA 2YHUA 3ZDDA 1EK0A 4I4LA 2EL9A 4FJ0A 3K15A 4MP6A 3QVVA 1PEDA 1R8XA 2WU0A 3HR7A 2H1HA 3JTEA 3USZA 3AP1A 1CRWG 1YOVA 3DLHA 1X1SA 3SLRA 4BO8A 1HTBA 4B4OA 3CNQS 1VL5A 4MQEA 1DO8A 1ZOIA 2BCJQ 3G82C 4KBFA 2ZUBA 3VJLA 1E3IA 1ODIA 1TI7A 4L8WB 1KJQA 2QJTA 4D9IA 1YNSA 2P2LA 1YRWA 4Y2UA 4IV8A 2ZYUX 1IJKA 1L9KA 1Y9JA 4CCAA 1YL7A 2DX7A 4FBLA 4UTZA 1KYVA 1LTQA 2GJKA 1U7TA 3GZ4A 1H42A 3THSA 1U80A 2Q5CA 3BGOS 1X9IA 1NNSA 4LRWA 3AZPA 5HE9A 3V1KA 1EAYA 1FP1D 1IXZA 2LRHA 2PUVA 2QHXA 3C14C 2W8BB 4Q4DA 1GPYA 1M8KA 1OX5A 1SHZA 2FZEA 3EDCA 1K5PA 5EQTA 4D8VA 3S44A 2H59A 2GF2A 2EW2A 1SN7A 3F4LA 5KC9A 3GARA 1YK0A 4ALLA 4BC1A 3T4EA 4ITUA 4MW0A 1K8QA 3LPDA 3PVCA 3DFUA 4RTLA 3S1AB 5U4QA 4YQYA 1GCOA 2IYZA 2XTZA 4QC2A 3TG8A 3JQQA 2MIIA 3AO0B 5HIAA 5JEDA 3HB4X 1E2NA 4KACA 3VJRA 4Y0VA 3RO7A 3BG5A 4FS3A 3RC9A 5E9JA 1VE1A 3QUTA 2EDAA 4L72A 3RVJA 5ICMA 4JROA 4O2BA 5ELMA 1Z7WA 2IEIA 2CFSA 2HQBA 3ADPA 1T1GA 1T36A 1ES9A 3AEUB 5LP6B 2JEOA 3DTVD 4MQFA 2SKDA 1FS4A 1JJBA 2DHDA 2ILVA 2O2JA 1GTSA 1U6JA 2V8BA 1C1DA 3ST7A 2GAOA 3GRUA 5DB4A 3ZBTA 2F62A 3IDAA 4I0WB 3CX8A 2RHGB 3D6VA 3PLNA 4ALKA 4YAKA 1SA0A 3E27A 3F1KA 1AS2A 4OA5A 2YIVX 4EFMA 4RTOA 1VMKA 1UXHA 3WB2A 1N8KA 3LCMA 4KTVE 1ZU5A 2I3AA 4ZGBA 1YRHA 1FDWA 4J75A 3VGPA 3WNCA 4HHEA 5IAJA 3A3YA 4N12A 4JP1A 3VU1A 1W6UA 2EF0A 3LYHA 4BTVA 1JXOA 1KFBB 1Z6ZA 4KFTA 5DE3A 4EG6A 2E82A 3DLAA 1JE1A 3QY0A 1KDPA 4Y9SA 1E79A 5JC8A 1T0PA 1QCZA 1D1SA 1KJ8A 2XUPA 4US2R 2XDQA 4OXYA 2C3MA 3HKCB 1U0SY 3EA0A 4IOLA 1MEJA 3AL2A 3PC4A 1E1DA 1BW9B 1UEXC 1ZRMA 3WBJA 3ZIDA 3CVUA 1NI5A 2JK0A 2P5TB 5J23A 4REQB 3W9SA 1G5IA 5IUNC 4EJ6A 5JY6A 2W6ID 2QTRA 4IJ5A 1CZNA 1IUPA 4B4UA 3DLCA 3FNQA 4FKZA 3G8YA 3MRXA 4L9SA 1OWPA 3SC6A 4Z7OB 5ARBA 3PGMA 4O08A 4BVHA 2R4UA 3O1JC 1VTKA 3QX7A 4LNHA 1XJQA 3RAJA 3AP3A 5BNWA 4K9QA 1IEWA 1VLQA 2WYWA 3OJOA 3J81A 2GOYA 3L0OA 3TZQA 1WOMA 4TQ9A 4AJ9A 3IV7A 1Y7LA 2WMYA 2CHGA 4K3UA 4Y2GA 4BBJA 1IVNA 4YJ2F 3EIHA 3MGKA 4J0GA 1DS6A 1R0RE 3F6BX 1B73A 3TZKA 3H2JA 3U7RA 1KL7A 3BXXA 3HJRA 1Z6PA 2UYOA 3ZY2A 5KNDH 3O8QA 4GRDA 1IHUA 1HC7A 3A32A 4K86A 4MLCA 4HYYA 2WF8A 3NOOA 3ED1A 1QHNA 2Y3IA 3DLTA 2BGRA 3FZGA 4E12A 1A7JA 4DMCA 2VSFA 4EBBA 1EUDB 3V80A 1EFCA 3B7GA 3TCXB 2ZI9A 2WJAA 4QVGA 5AW4A 1FZTA 3GRPA 4ZVVA 1QNLA 3CA8A 2KE5A 4MIYA 1HFJA 3TNDA 4FU0A 1MOZA 1KBZA 4IZIA 1O6BA 4Y2RA 5HA5A 1P1HA 3L77A 3EXEB 3FR7A 3CUEF 4WCVA 5K6TA 2DUWA 4JL5A 2CXRA 3IQHX 2AGVA 1DLIA 5HHTA 5IVKA 3SZRA 1NJ1A 1P4SA 1Z0KA 4UUQA 2R6DA 2HDHA 2VDUE 1SG0A 2YJ3A 4NU6A 4NOMA 3L18A 2AMYA 1ZVJA 1VJTA 1IDOA 1S9HA 2FLVA 3SR3A 2A5FA 4G1UC 2I6SA 1L0BA 1U8FO 4N65A 4BEJA 2G6BA 1Z7GA 2ZIGA 2VRCD 1IY9A 5FUWA 3B78A 5ALDA 3AI7A 2V3WA 3CF0A 2JG3A 4X91A 3MMSA 1OZGA 1U3GA 3VNQA 4BNTA 5IDQA 1QRDA 2HI0A 4HSEA 5F9HA 4ZCSA 4D3ZA 1XI2A 2V74B 3QIVA 4HL6A 1WEKA 5BPHA 5JCOC 3G5LA 4B09A 2Q29A 3OD1A 5SYAA 5BNZA 1QPGA 4HH0A 3RARA 1TEZA 4F8EA 2I0FA 1P2SA 2PL1A 1JYSA 1EDEA 3DZ8A 2WJJA 4MVJF 1A7UA 4UZEA 5HF9A 4LBYA 5JG7A 5A5DA 5BWMA 2QV7A 3U80A 4EG1A 2NGRA 2XUFA 5C9ZA 5ELXA 1B3BA 1X6VA 3UHFA 1I6WA 1U8XX 4KVAA 5A1JA 3BIFA 3OA0A 1OI2A 2P35A 1EGMB 3I5AA 4GM4A 1MO2A 2ZBEA 5LUBA 4BNKA 2D62A 3O4HA 4E15A 3SIWA 1QS0B 1NX9A 4R05A 2HJSA 4AF8A 5AUQA 3QY9A 4JL6A 5HUJA 1JU4A 1PJTA 1G8HA 1ZNYA 1BE6A 2QSUA 3OJ0A 4MK4A 1GV1A 3BMQA 3E9NA 2A3RA 2KBEA 1UBGA 1JWAB 3IOYA 4U7TB 4C0AC 4DEYA 2BLLA 4U7DA 1JKXA 1RAHA 3ESCA 4FUTA 4FJ2A 4US0R 2AXNA 4X7PA 4DM7A 3UOAB 1EE1A 3CW9A 3U3JA 5C80A 5JVDB 5ALHA 2R6JA 3HBAA 3HXQA 1A2KC 2NPIA 2OXCA 2FRVA 2AMJA 2ZUVA 4KXFB 4NBUA 2Q2OA 1INLA 2LW7A 2QNIA 1U2DA 4MRAA 4B45A 1Z36A 1W9MA 4B81A 4GNKA 2X0FA 3KYCA 1PGNA 5DHRA 2QQ0A 5JDCA 4I19A 1POXA 3FKSA 2RARA 3LPMA 5AP9A 3W06A 1Z82A 3U3OA 2RGUA 1ZUHA 4XARA 1VE6A 1SB8A 5ER6A 5HJ7A 1AQUA 4AMZA 2EFCB 4L08A 4NV0A 4PYOA 2G83A 4Q01A 2B2NA 2J3DA 4QDTA 4XFJA 1UEJA 4X61A 4Z9XA 3L9WA 1QQ6A 2DJIA 4NZOA 3FYHA 1P1FA 1MIOA 4YJ3B 4D3FA 1XZCA 3F4KA 3HI4A 3CVXA 3AJAA 2ZKLA 4TTPA 4C06A 4JUDX 2R96A 2JGNA 4WWHA 1CEYA 1I14A 3A11A 3ZVRA 5C51B 2I7DA 2F64A 3K31A 4K3VA 3ZKWB 4RJTA 5DLDA 5ALTA 2EP7A 1A50B 5CM8B 4BE4A 1W49A 1G3IA 1X38A 4ND2A 3U6BA 4TWIA 4I8IA 4AK9A 5KTPA 4QU5A 4NZYA 2NQ8A 1TJNA 1V6SA 1ZUNA 3I2GA 2QZPA 1DTWB 3D4NA 3NIWA 1JHXA 4HX5A 4KG7A 2D2EA 4FEGA 2NUTA 5FL7A 1Z75A 4FW8A 5JPDA 3C3BA 3IBYA 5B57C 2OOKA 2QTNA 5JSUA 4BQSA 1Z08A 3GLHA 4GLOA 2KWIA 2V3VA 1FXSA 1XCMA 3R41A 1JFSA 1Y8QB 1KDYA 2A5GA 2AS0A 4Y1FA 1S02A 4AVYA 3UEOA 4BIIA 1SCUB 5HCIA 4BFUA 1HE4A 2OBMA 3QYAA 4JVOA 2FWBA 3SQMA 3PDUA 4JUFA 2YR0A 4P7KA 4OSPA 4Y3UA 3RH0A 4FMCB 5FPYA 1MNQA 1V43A 3OIVA 2ZUWA 3HGQA 4LOHA 4O4HF 1VIVA 3HJAA 2E49A 1DX9A 3QF4A 4ODIA 5CGZA 5HM6A 5C1DA 2JFHA 3A06A 5AVXA 3HVHA 4MQUA 1FNCA 5HXAA 2VLBA 1F3OA 1PNVA 1T3ZA 2R00A 4QJ4A 4QGSA 5AXAA 4KKXB 3SKYA 3B52X 3ISVA 3OE7A 1G6HA 1GNRA 1P0IA 2EJVA 1I9CA 2NZJA 3IAS1 1PEAA 2FPXA 2FQQA 1AUXA 2KW5A 4GPD1 5BUQA 4DYVA 1QANA 4Q66C 3WHKA 2H0AA 4A8JC 4DLUA 5EJEA 3VNVA 3AKZA 1Y5NA 2OESA 5JD3A 3PL5A 1D6NA 2GCIA 2IEDA 2V7TA 1T29A 3V33A 5K6AA 2NO0A 2RH5A 2QTZA 3LHDA 4I9GA 4JVSB 4UHBA 5FEMA 3TM5A 1REQA 1SUBA 2ZYHA 3LMKA 1EIZA 1P73A 4IDGA 3B3AA 3DPUA 3T35A 4N5IX 3R0JA 3KKEA 3ZDQA 1DV2A 1YRBA 4E94A 4N47A 3I4LA 3ZZ0A 2Q3LA 2FVYA 2KHZA 4JP8A 1FUKA 3GJQA 4ND5A 4Q7EA 5ITVA 4YMVA 5ALKA 2K7ZA 2CMFA 3WDMA 5AK5A 1ODCA 4BJ3A 4WY2A 2BI7A 4XIYA 4GOJA 4ALMA 4DNXA 1UFOA 4TT3A 4HQRA 1XB2A 3B2NA 2AV6A 3G2HA 5F2NA 1QXSA 4LZJA 5I5GA 4EKEA 5A9SA 1C4XA 4CMEC 4L15A 5LIRA 4LK2A 1RQ7A 1BMQA 2Y0BA 4UDNA 2PS3A 3WIDA 3LQ4A 3S27A 1NIJA 4AICA 3ND9A 4YRNA 4MR7A 3WK7A 3QUBA 4MDYA 4X1KA 4BKPA 2QGNA 2GTHA 5IK2D 1WVGA 3HTXA 5K4HA 4DPLA 3MAAC 3TBHA 1P0FA 2RGYA 3LIPA 4XEHA 1LWNA 1DEOA 3DEYX 2DTDA 3LUKA 3OZXA 1N6HA 1QORA 1XDZA 4Y7DA 1USGA 2D7JA 3TINA 4EFDA 4DDTA 4MARA 1GCIA 1ODJA 4EYGA 3D4OA 3U7FB 1YA8A 1OLUB 2A0FA 2XTJA 2YV5A 3EZ6A 5U9CA 2QE7A 4B73A 5HRAA 3RJTA 3ZBPA 4O4JF 5CXXA 3WYFA 3WG9A 3OO0A 4NFHA 1PW7A 2VHZA 5GVRA 4DOMA 2JBAA 1PLKA 2GXAA 4LHZA 1Y9DA 4GZ3A 2JIOA 1YR1A 4P58A 5EQDA 4GE0A 1XRQA 2H0QA 2I7VA 2YCBA 4ZT5A 1D03A 3WDLA 4B40A 1V96A 4NJMB 5GAJA 1HI9A 4JENA 2CVHA 2FZ4A 1HLPA 1OFHA 2LCIA 1N6PA 3F4BA 3ROZA 2YZGA 3R74A 1EFRA 1IVYA 1M6NA 5KEIA 5D5PA 1FS5A 4A0QA 4KQJA 4P5EA 2P11A 1U98A 2NO5A 3P9XA 3ABRB 1GG9A 3CE6A 3UMGA 4TQGA 1QKJA 1I24A 2QIOA 4TV8A 5REQA 2ETXA 2I2AA 2NZUG 3VOTA 1ISRA 4JR1A 2GM4A 4C43A 5FULA 1YZKA 5AO9A 1M74A 4RKQA 2EFGA 4L73A 4BB9A 4CL2A 4L85A 3E2PA 1FTSA 2Q1XA 4LVUA 3WKBA 1QIIA 2F3PA 1YDWA 5TMEA 1ZI8A 4MVJP 5HCUA 4XYLA 2PXCA 1B42A 2WUGA 1SBZA 2J0UB 3GLHE 5J43A 1GQFA 2VPPA 4MA4A 4M6WB 4G5FA 2XCOA 3MWDA 5JZMA 3C7TA 2VXBA 5CFQA 2X4DA 2Z58A 1C0KA 1HG1A 1JLSA 1PBNA 1BCRB 4TL8A 2VZ0A 3QBJA 4B9EA 4KI7A 2L2QA 1KY2A 5KNBA 3PFNA 2RD2A 1L5HB 1M1NA 1CF4A 2XXAB 1T34A 1P9RA 4KO3S 4G81A 4QDOA 3WZLA 4KDFA 2CLHB 5H5JA 2H92A 4G97A 1YIAA 4AY3A 2M6LA 1F6WA 4AROA 3GRRA 3CJRA 1ABEA 4DEVA 1JQ5A 3OZIA 4DNFA 1DKNA 2AN3A 2OGUA 1LPMA 2V7VA 4K03A 4MVWA 1SOAA 3KSMA 5T41A 1ZM3A 3SICE 1YO6A 2FFAA 1Q7EA 3IMCA 1KMQA 3KKLA 3OCYA 1A9RA 1OVGA 1ZK3A 2XOKA 4A82A 5JBQA 5G4KB 4E5PA 1Z63A 5DU2A 2WP8J 1KK3A 1GVHA 2B30A 4FGLA 3KKNA 3GAZA 1ZU4A 1ZL0A 4RYLA 4GVPA 3GUYA 3G9TA 4L9WA 4GI2A 2Q9BA 2WF5A 4CZ2A 4P4TA 2R6HA 4BMPB 4YMUA 2QZ4A 5ECWA 3D3NA 2FZGA 5KDOA 4HDRB 4WZAA 1ZQ1A 4BWGA 1RCUA 4KPYA 2BKLA 5KWJA 2W8ZA 1DZIA 3S68A 3OIYA 3LU1A 3REQA 2ONJA 4FE3A 4G1VA 3BMNB 3V3KA 5FNVA 4AO7A 4ZHSA 4RA9B 1TQHA 4RKYA 3HR4A 1DQSA 3L0BA 2Y2VA 5TMPA 3U1BA 4W82A 3R40A 4URHA 1WF3A 1JSXA 4M7WA 4RAOA 2A58A 1KJIA 5BWOA 4OHBA 1W0CA 2O9JA 1EVLA 1SVOA 1C7IA 2CSUA 3ECSA 3ZWNA 4Z1MA 2XE7A 3D6JA 3H8VA 5CGQB 4BEWA 3ANMA 3O5AA 1QIEA 4LV8B 4R8VA 1BYIA 1BGWA 3WGVA 3A31A 4TRRA 3S6JA 2JGFA 1TA4A 4NQZA 1A71A 1RLUA 1AZTA 2QT1A 5A7HA 2A14A 3VYTB 3GVHA 5THXA 5IYZA 2DBRA 2A7XA 4R2MA 2OCKA 2Y0EA 2EC5A 4G67A 1OAOA 1PL6A 3P19A 3ZPXA 1OYVA 1U3CA 2G9VA 3EZ7A 4BTLA 3CNHA 1WPQA 1CQJA 4QEZA 3N0XA 1GGJA 4I1RA 3D31A 4MJLA 2DWPA 2XF8A 4CKWA 3L0PA 3ZNOA 4DQDA 2WJGA 1CDEA 3BMOA 1JHUA 3T7KA 3UA4A 3D0KA 4JB0A 1R12A 1NUPA 3CNLA 2G7ZA 4MNTA 4GI3A 4HDMA 5LCXA 1RWOA 3AJ9A 2JVKA 2PA0A 4EGFA 4HT3B 3PBKA 4NLLA 3X0DA 4YRPA 4DWOA 1Y1QA 2DQYA 3BPSA 3EXAA 3AYXB 3SIPA 4DCCA 3GD5A 3KUXA 3TSZA 1YBHA 3JD4A 1QH9A 4RAQA 5BT8A 2ZR7A 3DL2A 4ONEA 3ROEA 1U65A 3BB3A 4JJKA 2BDTA 1CUVA 3DHNA 3ZV5A 2C04A 5B1SA 5TPZD 1S3GA 3RAEC 4OXRA 1ZJ5A 4E1VA 3FWNA 1V5WA 2FMTA 4H0CA 1Y6FA 4B43A 1OSNA 1KY3A 2B3DA 2PYZA 2HZ7A 4J0KA 2C9CA 4JY7A 4OHRA 3C6KA 3HY6A 1NXSA 2ETVA 2FGKA 2Q5FA 3BK2A 4J0HA 4DANA 5KJCA 2XZTA 2HLNA 4IQ0A 1SVLA 2HDWA 2W2NA 4LGVA 2OYRA 3DOFA 4CLOA 2FHSA 1T2AA 2XB2A 3Q9SA 1F5NA 2H7XA 3SX4A 1OXKB 4NFSA 4RV9A 1EWRA 3KQPA 3O38A 3OIDA 1L8OA 4IHQA 1Q6YA 4KK4A 2VAVA