3C3KA

Crystal structure of an uncharacterized protein from actinobacillus succinogenes
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
272
structure length
267
Chain Sequence
KTGMLLVMVSNIANPFCAAVVKGIEKTAEKNGYRILLCNTESDLARSRSCLTLLSGKMVDGVITMDALSELPELQNIIGAFPWVQCAEYDPLSTVSSVSIDDVAASEYVVDQLVKSGKKRIALINHDLAYQYAQHRESGYLNRLKFHGLDYSRISYAENLDYMAGKLATFSLLKSAVKPDAIFAISDVLAAGAIQALTESGLSIPQDVAVVGFDGVDISQITVPALTTVQQPSEQIGMKAVSLLLEQIHSDVHHLLPWKFVRRQSSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Actinobacillus succinogenes.
rcsb
molecule keywords Alanine racemase
molecule tags Isomerase
source organism Actinobacillus succinogenes
total genus 107
structure length 267
sequence length 272
chains with identical sequence B
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3kA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3kA01
1USKA 1PNTA 1Z18A 3GL9A 2BGGA 5E3JA 2KYRA 5IUJC 4RY0A 4RK1A 4TLMB 1JYEA 1Z13A 4KK3A 1M2FA 4G97A 1H9CA 4EYQA 1YS7A 2WRZA 5EWJA 4S05A 1RXEA 1OXBB 1NXPA 2MYTA 3HK2A 2FLWA 3BREA 3DZDA 3N0RA 4P98A 4RXTA 3GYBA 5DTEA 4ZMSA 1QQAA 1QP4A 5DCLA 2QZJA 1DP4A 3LUJA 4MLDA 4NCBA 2ZAYA 4W5TA 3JS5A 4GNRA 4OLAA 4MR8A 4WZZA 1TMYA 2HQOA 3CS3A 4ZYLA 2QSJA 1KMIY 1QP7A 2FXIA 1TJYA 2RDMA 2MYPA 2OQRA 3OLZA 2F8TA 3Q7RA 4G0YA 4KPYA 1Y1LA 4Q6WA 3RVOA 2JCGA 3F7NA 1ZH4A 3QELB 3A0RB 1JF8A 4WUTA 1JLKA 1ZDMA 3CHYA 4JASB 4YP9A 9ABPA 6ABPA 1BDHA 2WWVD 2RJOA 4YWHA 5BRAA 2F8SA 4N03A 1QO0A 1EWKA 5DKFA 3TD9A 2PUDA 1JX6A 2MYNA 1KRWA 1C0EA 1NXTA 4O5AA 5KQGA 4PEVA 3L49A 3FDFA 4IMIB 1URPA 4EY3A 3EULA 5FWYB 4D74A 3FFTA 4NV3A 3QELA 2GKGA 3KJXA 5BR1A 3G85A 2QV0A 3HUTA 1QMPA 2FKAA 3LOPA 1DZ3A 4OTZA 4N0QA 2A9PA 1ZY2A 4PE5B 4XLTA 2E4UA 1Z15A 1ABEA 5TQ2B 3RVRA 3CG0A 5KQLA 1RZRD 3QX8A 3RVJA 3JY6A 4RY8A 1FQWA 1ZH2A 4LZLA 4MR7B 2VYCA 5FWYA 1USIA 2A9RA 4M88A 1Z26A 5PNTA 5JS2A 1P8AA 3GV0A 3L6UA 4G0ZA 1YS6A 1QO0D 3NNDA 4MQEA 4MS4B 1FSPA 5TQ2A 3C6QA 1LK0A 5CNMA 3LTEA 4UHJA 3HVRA 2HQRA 3MQ4A 3OLVA 2AYZA 4MR7A 3RVSA 4Z4IA 1E2BA 1M5TA 1U2QA 2ZWMA 1C4WA 3RVLA 4MS4A 3RVNA 1DCMA 3H1GA 4KV7A 4EYGA 4N47A 2J48A 2FMHA 2HJ9A 2JVKA 2LUOA 4MQFB 4OLBA 3H6GA 1K68A 5C5EA 3OMXA 4Z4CA 3R0JA 3GWGA 3I5AA 2PL1A 3KG2A 3NBMA 2WY2D 3HDVA 3JTEA 3OM0A 3HCWA 1APBA 4NQRA 2L2QA 4KVFA 1M2EA 2R25B 4MQFA 2JVJA 5T3YA 3A10A 4G0QA 3SG0A 4CBVA 6CHYA 3S99A 4YCSA 1ZGZA 2FQYA 5CNKA 5JNSA 2AYXA 4QYMA 1S8NA 2IDMA 4RK4A 4G0MA 3CRNA 1YK1A 4JOQA 4Z99A 1MIHA 1RNLA 5B3JC 4QYWA 2MYUA 3D8UA 2QXYA 1LJUA 4TN5A 1A04A 1GUDA 1D5WA 4FE4A 4MS1B 5HQJA 2WB4A 3MMNA 1ABFA 2IOYA 5EWMB 2CWDA 2ID9A 4Z4EA 3HEBA 4Z9BA 1QPZA 3F6PA 3QEMB 1JFTA 1KRXA 4F11A 4DADA 4QICA 5KQMA 1Z17A 2QU7A 2FTKE 4YLEA 4ETNA 2FEKA 1P6UA 2PL9A 1E6MA 4RWEA 3TB6A 3BBLA 3HV2A 3SQNA 4MS1A 1JH9A 2RGYA 5EWMA 4Q7EA 2Q5CA 1YMVA 4ETIA 3DLBA 3QEMA 2DRIA 3H5TA 4ML3A 4Z0NA 1DBPA 3F6CA 3K9CA 2I6FA 1VLZA 3O75A 4LE1A 3C3WA 3C97A 1EFAA 4O1IA 1GCGA 1SXHA 4L4UA 5IULC 5GOTA 3QX9A 3OO0A 5JNTA 3B2NA 4MS3B 1F4VA 1NXSA 2IPMA 1VRVA 3P9YA 2MSLA 5CNJA 4YRZA 3CZ5A 4MLCA 2RJNA 3QEKA 2PUBA 2FQWA 3QLVC 1I3CA 4H60A 2E4XA 3UK0A 1CHNA 4GPAA 2GX6A 1NTRA 1P6QA 3C3KA 4RU1A 4EYKA 3EGCA 3OQNA 4RK0A 4JAVC 1EAYA 4MS3A 1EWTA 2MSWA 4WWHA 5JNUA 4W5RA 2WJWA 4EUKA 3KCNA 2HSGA 2V0NA 5DGCA 1BVHA 3I45A 2R48A 4KZKA 1ZGGA 3HXMA 4G0PA 4WXEA 3D02A 1RZRA 5C5CA 3ILHA 2NUBA 5TQ0B 4P1ZA 1Z12A 5KC9A 4LE2A 1OXKB 1QKKA 3OLYA 3Q15C 4Q6BA 3Q9SA 4D6YA 3NHMA 3FGZA 3N8IA 4O1HA 1DBQA 3JPWA 1DBWA 3M9XA 3FMVA 5TQ0A 4MRMB 4G0OA 4OBBA 3CU5A 3EODA 3KYIB 1AB6A 3OLWA 3QLUA 1LBHA 1DG9A 3O1IC 1YIOA 1JFVA 5KQPA 1B00A 4RK6A 2A9QA 5IX8A 3FFXA 2PMCA 1DRJA 2FN9A 1T34A 4MRMA 2PJUA 1W9HA 1CEYA 2H3HA 4G0XA 3RVMA 5ED4A 2A9OA 3IP5A 4RSMA 3LMKA 2FSPA 4OG2A 1ZAYA 4NCAA 2CD7A 3ILYA 4RK7A 1E6KA 1DC7A 1KGSA 1LJLA 2O20A 3O1JC 3H5OA 2JVIA 3O2JA 3OO1A 2L17A 3I09A 2PUFA 4XASA 2PUGA 1W25A 4ZPJA 1PEYA 5IC5A 4WT7A 4IF4A 3CNBA 5F64A 4HNSA 1ZESA 4QPJC 3CFYA 2NT3A 3GBVA 3M6MD 4JB2A 3CKMA 3SNKA 4DN6A 4EVQA 1UDRA 3CLKA 2B1JA 1A2OA 4RXUA 3GA5A 4KREA 5TE9A 1RPJA 1NXWA 2E4YA 1NXVA 4RKRA 3N6VA 5JNWA 4FE7A 4H3KB 2QW1A 1BDIA 3E61A 2X7XA 3Q41A 3RQIA 5GQSA 3CTPA 3DLHA 2VK2A 3LFTA 4XXHA 4LX8A 1F51E 3LUDA 1JDPA 4KK4A 1D1PA 3SY8A 1QQBA 3GT7A 4RXMA 3IPCA 3M9WA 1ZVVA 4H3HB 2W42A 2FEWB 4RS3A 3T8YA 3H5VA 4RY9A 3W9SA 2QVGA 3ROTA 1A0OA 4W5QA 4RKQA 5JNVA 1PNRA 1WETA 3LUGA 3FFWA 3GBPA 5TPZA 3IP6A 2M98A 1PHRA 4HNQA 3EQZA 4OATA 3T38A 4N41A 1DC8A 4ZMRA 2FMFA 4KRFA 4IILA 5IEJA 5I4CA 3H5WA 1U2PA 3LUKA 5FWXB 5HKOA 3DBIA 3VNAA 4HYEA 1XHFA 2PUCA 3HJFA 1U8TA 3MA0A 3IP7A 4YS6A 4E7PA 4EYOA 5HM6A 4PYRA 4MPTA 3H1EA 1CYEA 3RVPA 2ID7A 4W5NA 1EHCA 2H0AA 2P4UA 1FFSA 2L18A 5FWXA 2CHEA 3A0UA 4KNYA 5TPZD 1DRKA 1NXXA 1ZITA 2FW0A 3N0WA 1MB0A 4YGXB 3LUFA 4JB0A 1Z25A 3TO5A 3Q7SA 2IPLA 3BRSA 4N0PA 3H75A 3EDCA 2PUAA 3UKJA 1QP0A 2JB9A 1SXGA 2LIVA 4Z9AA 3EAFA 3SM9A 3A3KA 2IPAB 2GBPA 1SD5A 4RK5A 5DLEA 3LKBA 1P2FA 2FVYA 2LP4Y 4RDCA 3QK7A 3SAJA 3HM9A 1VPWA 3UUGA 1LBIA 5ABPA 5KI6A 3T6KA 3H1FA 7ABPA 4MR8B 3JVDA 4FB4A 2IPNA 1L5YA 4F8JA 3OM1A 2HQBA 1R8JA 4MR9B 4N76A 4L85A 2JK1A 3JVIA 3MYYA 1TM2A 4G86A 5JNRA 4S04A 1FFWA 3KSMA 1AB5A 2TMYA 8ABPA 4EGSA 3KLOA 4MYRA 3F73A 1Z2EA 3IP9A 1JL3A 2WJAA 3HSYA 2L19A 2YHAA 4MR9A 4DQDA 3O2QB 4IGAA 3KKEA 2VUHB 1QNLA 2FEPA 4IMJB 3MF4A 1Z2DA 5HSGA 5D2CA 2PUEA 2HPHA 1ISSA 4EVRA 4IRXA 3MM4A 5FBHA 4ETMA 1TLFA 3CZCA 1D1QA 4YO7A 1XHEA 1SXIA 1BDJA 1TVMA 1JFSA 1FFGA 3NHZA 5BQ3A 4KQCA 1RXIA 3O2SB 3MIZA 4XARA 4F3TA 1U04A 5BRJA 4LE0A 2FQXA 4JA2A 5EWLB 4EVSA 4MQEB 4Z4GA 4NICA 2PAFA 1GUBA 4LRQA 1E6LA 1DCKA 4ZJPA 3RH0A 3EJWA 3G1WA 2FMKA 1PEAA 3BILA 5TQJA 3T95A 1MAVA 1YK0A 1Z16A 2WMYA 2R4QA 4HNRA 5EWLA 3TX6A 3LUCA 3JPYA 5JS1A 5KC8A 4PICA 5B3JA 2E4ZA 2LBPA 1MB3A 3NNNA 2MSKA 3QLUC 1DJMA 2OENG 1IIBA 3H6HA 4UHKA 3N75A 1VKRA 2GWRA 2GI4A 3KS9A 1NY5A 4KMRA 3O21A 4F12A 1EWVA 4MGEA 5CHYA 3LKVA 5T7BA 2NZUG 3DGFC 1NATA 4LDZA 1JBEA 1JYFA 4TLLB 1ISRA 2YHBA 3ROFA 2N9UA 3LUAA 3KTOA 3TMYA 2NT4A 1K66A 1J56A 1YVUA 2CHFA 2QVCA 5TPWB 2E4VA 3EQ2A 1PUXA 4E7OA 4F06A 3HUUA 2E4WA 3IDOA 3QLTA 4KQ9A 5IUKC 4YV7A 4W5OA 2JBAB 3OQOA 1ZHHA 1YMUA 4B09A 1D4ZA 4Z4FA 1JHZA 1HEYA 4JP1A 3O1HB 3DGEC 2IYNA 2VUIB 3O74A 1GLGA 2IKSA 1NXOA 5TPWA 2FLKA 3VNBA 1YTUA 3RVQA 4Y9TA 3OMWA 1XWWA 3KYJB 4RV5A 3OQMA 1DCFA 3E3MA 3KLNA 4XFKA 3RVKA 2JBAA 2NZVG 3QLVA 1D2AA 3IPAA 3Q7TA 3HZHA 3HS3A 4XAQA 3H5LA 2JRLA 2LPMA 5IBQA 2PLNA 1BA2A 1USGA 2FN8A 3HDGA 3CG4A 3NNSA 5IEBA 3OLXA 2R47A 1BAPA 2P9HA 3KHTA 4KFCA 4MAAA 1JDNA 5IUNC 5CNIA 1L5ZA 3URMA 4RZSA 3I42A 3LUHA 1MVOA 3BRQA 3HO1A 5KWSA 1ZN2A 1GCAA 2FMIA 4WXMA 2QR3A 2XDYA 3C3MA 3N0XA 4Z4HA 2PE5A 4YR7A 3H5IA 4LDAA 3K4HA 5FBKA 4TMYA 3N53A 2PKXA 5EWJB 4D6XA 1U0SY 2B4AA 2M1ZA 1M5UA 1SRRA 3GRCA 4PZ0A 1JWLA
chains in the Genus database with same CATH superfamily
3QZUA 5E3JA 1ITZA 1HNNA 3PUYA 5L8VA 3R8XA 1UPFA 1K98A 1LI7A 2I8LA 2WAOA 1V6SA 3FX2A 2CVOA 4POAA 3T5CA 1H9CA 3UXEA 4LDNA 1KFCB 2CK3D 4XM2A 3DAPA 1FYEA 3D7NA 3FAKA 3HRKA 3UJ7A 3AKCA 2FLWA 2GEDA 2YY5A 3FTCA 3QQ5A 5EIOA 4X71A 1TEVA 3CONA 5BN5A 2FK7A 4WI1A 5K0LA 3LRXA 3R9KA 4ITUA 2XTMA 2QZJA 2WJ6A 4BNVA 1E62A 2VG8A 3OZSA 1FY2A 3VSAA 4CKWA 2WM2A 1RM5A 1TK9A 2X2PA 3PSHA 5DBGA 2Q9BA 1ZCJA 4FCTA 3K16A 4WY2A 3NJ4A 4C7OA 1JJVA 2YJ3A 3F71A 3BH7A 2IX3A 3J7AC 3UK6A 1MEEA 1KRHA 5A0FA 5BN4B 2F8SA 4ZO6A 5SYMA 3VOSA 1CJUC 1OLSA 2QJWA 2GCOA 2WSYB 4FT4A 3IRVA 1ZRNA 4UHDA 4RDIA 2F8TA 3R8CA 4UM9D 1BE0A 2QUHA 5HNKA 2HA4A 4D2IA 2YX1A 3EZNA 1TM4E 4GOJA 4JASB 1JPUA 5EMLA 2QDXA 4NG4A 4YP9A 1CFJA 1SVMA 1UKYA 1Z5GA 3EFHA 4H7DA 4JR0A 4K28A 4AP9A 3AVXA 4M0MA 3ED5A 1SC1A 2I6QA 2PX3A 4XGRA 1ZCFA 1D1TA 4W1PA 4CMEC 4LQLA 1BEUB 1DIBA 1WCV1 2EOAA 1XZEA 3DBHA 2J59A 4M1SA 4KDFA 3EULA 2X13A 1HDCA 2XYHA 1DAFA 4YN3A 4R71A 2LDXA 4FLMA 2NZYA 1Z22A 2VZ9A 1XZFA 1NN3A 3O8QA 5EUMA 1VZ2A 2CXNA 3ZDRA 4FGZA 3ZK9A 4OTZA 1W5AA 3UEOA 3B1YA 3SHTA 3DUFB 1RYNA 1IATA 2H4YA 2GVDC 1KNQA 5IAJA 1ABEA 2ZQ5A 1NOIA 1N6OA 3VJMA 5CA0A 1UMDA 4BO7A 2Y67A 1NBOA 4TRMA 3OM8A 1TW2A 4RGQA 2M2IA 5JS6A 1N2HA 3PQDA 2PD6A 2NU6B 1J5XA 2VP6A 2Z43A 3HFJA 3MLEA 3UF0A 1AUVA 4A8JA 5JSZA 5F76A 4BFTA 1NVWQ 2AE1A 2REXB 2WD7A 3RUAA 2CFCA 2PLAA 4DS3A 1ZUWA 2V96A 2OXTA 3V4OA 2WF5A 5TQ2A 4JB3A 5JTUA 4LYFA 3MJSA 1C3OB 1CRZA 1AF4A 4XQ0A 3R9IA 3O0TA 3HVRA 2ZZNA 1GA6A 2B99A 5JQWA 2MT9A 4M6WB 5DSXA 4MR7A 4TV9F 5KNCD 1SUAA 4G24A 1BGXT 1L5WA 1YIAA 4HX2A 4IHAA 2VK8A 5JO9A 2ZWMA 4I5GA 4L08A 4RVDA 4TQUS 5CBPA 3GEPA 1BHQ1 2CLOB 1C4WA 3DQQA 1KOGA 2HMSA 1FF9A 3M5WA 4NJMA 5ES4B 3M82A 5F9MA 4B17A 3F1KA 1U4OA 3R3HA 3KQPA 3RANA 4W99A 4DA0A 3TLGA 1HT3A 4NOLA 1OIXA 2H17A 4BC1A 1SY7A 4K9DA 5IARA 4ESHA 4EQ6A 2QX7A 3JWJA 5HS4A 4OLBA 5EJGA 3ZQJA 1UKBA 3CRZA 4E3WA 5BNZA 2V7QA 5I5GA 5CT5A 3IIEA 1MA0A 3V4LA 1PDVA 2DB3A 2P2DA 3CNLA 4YAFA 2FW1A 2QM3A 2QYSA 3JTEA 4I7EA 3HQ4O 4OHCA 4Y2PA 2BRUC 1PGNA 2HMWA 1Q92A 3OJFA 3WNDA 3JYQA 1XI2A 4NTZA 4KNVA 4AW9A 3QKUA 3VTAA 4CODB 5GZ6A 5J5CA 4QYMA 4B6PA 2FX3A 5KOIA 1SEVA 4R2IA 2ATXA 1N4DA 1AO0A 1T6ZA 3K8QA 3SMQA 1VPEA 3W5HA 2QXYA 3W78A 3KX2A 1BN6A 1DINA 1GPYA 5E6SB 1HFKA 3K2IA 1VG8A 4LRXA 1G2OA 2DBVO 2CWDA 2H4WA 3P9ZA 4IDBA 1CRLA 4S1OA 1QPZA 3OPYB 4AU1A 2G88A 1Q0RA 3MCWA 2XE8A 2JGMA 1OYOA 5JYDA 2YH2A 1T1JA 2FTKE 2WFZA 2P6OA 1WKVA 1WMDA 1ZWKA 3C5VA 3M9LA 3C7KA 4JJGA 1KHTA 2Z1NA 4L0DA 4ZAXA 3P2IA 4C4XA 3BTOA 1F2UB 4KPFC 4YCMA 3OFKA 4A1FA 4LDQA 3AGQA 5JH7B 1U3WA 1T0IA 1UPBA 4HAIA 3TDMA 1YMVA 4AB1A 4JI1B 3SGLA 2QLLA 2OCBA 1DIAA 1VCNA 1DEHA 4FYKA 5JANA 2O2ZA 5ICSA 4NMLA 4Z9YA 2R8XA 3Q6MA 3GLFA 4BVLA 1R6BX 3ACDA 4J7AA 3KKPA 2FUG1 3LV8A 4NECA 5E7JA 5BN1A 4I1PA 1P2VA 4Q7MB 3VYUB 121PA 4K05A 3HXQA 3P9YA 3HCPA 3JCZA 1IOZA 3G7SA 3TDNA 2R6FA 1UOOA 2PD4A 4AZ0B 4F4IA 3EQ6A 1RIFA 3W6PA 1QV7A 2E4XA 4WE3A 2RGWA 2EGUA 5BYAA 2V6BA 4PX5A 4UTRA 1TC2A 4NG5A 3IV6A 3RE1A 2Q2OA 4OKNA 3NP9A 1EWTA 1BX0A 1RI5A 2WAMA 3H11A 2XOEA 4G0NA 2VPIA 3WIOA 1E2BA 3LCJA 2E1PA 1KL7A 4GLFA 4JP2A 3RUFA 5KB3A 2P2NA 3JALB 4C30A 2Y05A 4ND7A 5DHPA 4EJ0A 1X7ZA 2AZTA 4YRBA 1RSZA 1PV4A 3TRFA 4YRDA 4U7TB 1BYIA 2XCLA 4RLSA 1O57A 4ND8A 2DH5A 1U3CA 2F67A 3FGZA 3HSSA 1UKAA 3RM3A 5LBUA 4WHMA 1DBQA 1XTRA 1Z56C 3EDYA 1EBFA 1BKSB 4EVIA 3QUAA 1AKMA 1ZLYA 2D5LA 2I7DA 5B37A 5EIFA 1C8KA 4AMYA 5TQ0A 2JGEA 3DZ8A 4R68A 1WVIA 1SKYB 3EWNA 2FPPB 2ZR9A 1KK3A 1BXRB 2ESRA 2C3OA 3CVXA 1XGKA 2WLTA 4K0KB 1BWSA 1BQEA 4YA6A 5IHXA 4C88A 4K6GA 3V4SA 1QIJA 3NC1C 3INGA 1ZJYA 3Q0IA 4FCCA 1SCBA 4TV9A 2XGOA 1QH9A 4X6LA 4CF7A 4MO9A 5JC8A 1N57A 4F6RA 2R44A 3IEVA 1EX9A 2BTQB 3A26A 4LYGA 5DHQA 5ALGA 5I7OA 4RQTA 3RJTA 3Q9UA 2NZJA 1CT9A 2P4HX 3G3EA 4HB3A 3V1YA 3GNQA 4DDVA 3ZWCA 1YBFA 4UKDA 1LW6E 4RVSA 4FGKA 3K9HA 1PT8A 2CV1A 3HDHA 1JR6A 1M54A 1E7MA 3LRTA 2X4IA 3LVFO 2D00A 4PGAA 3A8TA 1T5HX 4OX9B 2PUGA 3F4LA 4HB2A 1A88A 2G1AA 5DCYA 4CI9A 3LVBA 1IG0A 3VHLB 1EQAA 5HRAA 4BU0A 1UFKA 1HLFA 5DRYA 3NV7A 2Q0HA 4TLAA 1U6IA 2XI4A 3CFYA 4CR7A 5LDHA 1HA3A 2GN0A 2O7VA 4AUNA 3SNKA 1WNTA 4ZHQB 1XPJA 4QTXA 1DC4A 3D3WA 3QOWA 2LGJA 5NLLA 2WE8A 5CCEA 5FUWA 3HWRA 3WKEA 4NF2A 4Z3KA 3LCVB 4KREA 1A4XA 4Y0NA 4DIMA 3GLGA 4QGAA 1NW7A 2CV0A 1QFJA 3A05A 1KSGA 3NUQA 3RAEC 3JZMA 4BLRA 5AVSA 1ZR2A 1UQRA 4XGKA 2A8YA 2ODPA 3T54A 1HLDA 4JX8A 4A0SA 4BEVA 4CFZA 1OXSC 1P0PA 1F38A 1WPXA 3Q3GE 4HMOA 1MX1A 2WIKA 2XUJA 3UAYA 1BIFA 2EEPA 1GUFA 1PVDA 1DBVO 1WBJB 2J6IA 5E1BA 4RETA 4TZKA 3ZWDA 3PRKE 2IOHA 3AEQA 3T7AA 4E30A 1QONA 2JGFA 3PHBE 4ECEA 3MN1A 1PTKA 1GARA 1G9SA 3I4CA 1E3SA 4P36A 3O8RA 3D1VA 4BNIA 5AHXA 5DDIP 1LKZA 1WETA 3AUFA 4J29A 3G88A 1EGAA 2GXAA 3HGMA 2Q50A 2VDKB 4Q3EA 1E98A 4RQAA 1PHRA 4BEBA 3E05A 3EIHA 3L6BA 3GB9A 4NESA 5LQNA 4DLYA 5IS2A 1DQNA 1J70A 1WV0A 3LHKA 3B53X 3P0HA 5CT9A 2GRAA 3NX4A 1VOTA 1JE0A 1Q2XA 1RYEA 1T5SA 2KW5A 3DBIA 4UJ3A 1N2OA 1TQ2A 1HT1E 1EVYA 5LZ2A 5HM6A 3VNVA 1D0VA 2BZGA 1XZDA 821PA 2DWQA 4PYRA 2DUJA 3THYA 1OBFO 3H1EA 5CAEB 1FW8A 3GUVA 2VTEA 3MWKA 4MJ7A 1X1QA 3UANA 1U0GA 1W581 4EFNA 4BQNA 2Y0BA 4DLNA 4S0XA 3ZHBA 2DKOA 2XE4A 5U4QA 3TKAA 3E1SA 1HOTA 3RASA 2B8JA 4D3FA 2QL9A 4BXOA 4FWBA 3KSRA 3BRSA 3SZUA 1TC1A 1L7RA 2DJ5A 1ZLXA 5G1NA 1U28C 4YXFA 3DL7A 1FYWA 3I2IA 5AHKA 3VMMA 1KTVA 4W7HA 4Z9AA 3ZJVA 5DNCA 3A3KA 2IPAB 3CZQA 4KAJA 1VIYA 1VKZA 1SD5A 5IJZA 4FW9A 2YOHA 4GC9A 1Z0AA 4HH4A 5U1PA 3OZRA 2GN6A 1Y3DE 5SICE 3MK31 1WF3A 2Y3IA 1QR6A 5F4ZA 3UUGA 3GFQA 4UFNA 5BSHA 4FKZA 5CD1A 2GPSA 3FMPB 5AOBA 1ADYA 1MC4A 4CQNA 4FB4A 3PFGA 4F8JA 3PDIA 2IJGX 4PSAA 4HNAA 4D9GA 1AU9A 2HMTA 2PUJA 2V7WA 3LUBA 5K2MA 2YMLA 2NUTA 2GB4A 2GBIA 1PUIA 2V4UA 1PF7E 3JVIA 4D44A 1F1JA 3MT9A 4PQGA 1R4AA 4S04A 1IRXA 3KSMA 2CFSA 4KV9A 4PO9A 4CJXA 1PT6A 2PWAA 4NCKA 4XX0B 3EF0A 1H22A 3QUQA 3QIVA 4BO2A 1BDMA 2YHAA 5D3QA 1IYZA 5AK3A 5A7HA 3TE6A 2YHIB 2QRLA 2C2KA 3C3AA 2VUHB 2NUAB 5FUYA 1B15A 4FX5A 4MYCA 3T99A 1AGXA 1ZCAA 4R81A 1Z2DA 4BFZA 1UWVA 4YRKA 4D9HA 1NM5C 3WAJA 4GE0A 5I9TA 1QRAA 1R50A 5IM4F 4KX5A 2X41A 3T7TA 3C8MA 1MX5A 3GJ6A 4QYIB 3EBPA 1A77A 3P9SA 4MEJA 3V55A 2Y93A 1XTSA 3HJFA 3MMZA 2FP4B 1C30A 4XD7A 4NBWA 4ZVTA 3SSMA 1UDBA 3GAMA 1VBKA 5ENZA 1B1AA 1E1MA 5JLAA 3I0MA 1JAYA 4ZYZA 3WB9A 1KH3A 3I0NA 2XVMA 4JA2A 1VSQA 4DLRA 4EVSA 1AKYA 3DEFA 4MQEB 1Z08A 1JIJA 3PIRA 4KWCA 4IZOA 5KYUB 2ZJBA 3R6WA 5LLTA 1PFGA 2QTAA 4Q1FA 5BNIA 2WZQA 4QU8A 3EMVA 2V1XA 5ECGC 1V2HE 3I61A 5CURA 5EPOA 4DR7B 3BCRA 1VXRA 2HA3A 4P2GA 5JY6A 4LJ4A 1EBUA 2XEDA 1UZMA 4KMOA 3O8DA 4PC3A 3Q0EA 4AIIA 2IDJA 6REQB 1NPDA 3GDOA 1YB7A 4L2IB 5CLJA 1M2VB 4KSCA 1KZGB 4TUYF 3DE4X 4HMQA 3OP4A 3LC2O 2P2SA 3E7FA 3MQFA 4S1NA 1O6BA 4LYHA 3W3ZB 1DJMA 1P3Y1 3IKLA 3L6RA 1JBQA 3PK0A 3V33A 1QG6A 1PDWA 2QE7D 2SECE 1S1CA 4LGMA 3WQBA 3STYA 2OHJA 3SXPA 1D5CA 4V1CB 2G76A 1CJCA 2IA5A 2ORYA 1THZA 3LHIA 3ROPA 2PTGA 2W2LD 5T7BA 4CEJB 1QHEA 1TO6A 2Q9CA 3UAVA 2AXNA 3VGJA 4IIDA 2IOFK 3HV0A 3T5BA 4DIEA 3E7DA 4F96A 4KRXA 3DDHA 2EJWA 2NT4A 1RYZA 1P74A 2P91A 5J40A 1I3LA 1NDUA 2PX5A 3EQ2A 4OHBA 2X5JO 4NU8X 1G38A 1G8AA 1POXA 5IUKC 2ILTA 1KI6A 2A94A 3G89A 3H13A 2NU8A 4YV7A 3K9WA 5AUOB 1OZ0A 3AOEA 2QPAA 5FFMA 3FOFC 4ER3A 5LMUB 1D4ZA 1M1NA 4YJDA 1JHZA 2OHVA 3OSUA 3O1HB 2VUIB 1UINA 2BFNA 2I71A 4UMVA 4WNIA 2YIJA 3C48A 3TRKA 3P1JA 1YTUA 2WV7A 4IDQA 1FP1D 5CDFE 3NKFA 5HBGA 3U56A 1BHO1 1KZ1A 4QWMA 3PLNA 5T4HA 4GPD1 1HBJA 5C4GB 5A3SA 2OWEA 2NZVG 4HLQB 4Y2GA 1O4VA 2F62A 4GR4A 3HS3A 2QD1A 4EZIA 3RLIA 1T29A 2VRCD 4Q1EA 3C41J 1ID1A 2BGJA 4A82A 3MVEA 2FZEA 5D6NA 3BHIA 2H85A 1R8XA 3GLTA 1JA1A 2QRPA 3OLXA 4D9KA 4IDNA 5DLYA 3QU4A 1XYVA 1J9GA 2HWYA 3EOZA 5BWLA 1PX0A 1KR2A 2E5WA 3OCCA 1Z82A 4EZBA 4BVGA 3IHLA 2FZCA 4UCFA 221PA 2ZVDA 3SIPA 4RV9A 1VBFA 4GT1A 1EGVB 1VTKA 3K5PA 4A2QA 1DRUA 1RWNA 4G5RA 4LDAA 3C8ZA 5EHZA 2WV9A 3UGKA 2RAFA 4KQ1A 4EFMA 1AZLA 1E2HA 3C87A 3ZJTA 4C4OA 2IEZA 1YR6A 2R2AA 1P45A 3RAFC 1LQ2A 1A7KA 4L6IA 3VR6D 2H2FA 4AXBA 4LK3A 4JH0A 1Q1NA 2J3JA 1PE0A 1ZL0A 3GL9A 5CB8A 3QVGB 1Y9DA 1BXKA 4QQFA 3GJ3A 4Y6GB 1D6JA 2ZDQA 4IUYA 4YCNA 5FWDA 2FX2A 1ZBQA 3P5SA 3A9WA 2E5FA 2L0XA 3IR7A 5T6MA 1VKNA 3VR3D 3U5ZB 1II9A 1QQAA 4MTCA 1NC3A 1R9JA 1NVUQ 2C5FA 4MGYR 4AQDA 3V8EA 4TSKA 1LTQA 4JITA 2ADMA 1NUHA 1LA2A 1XRRA 3HJTA 1PQ4A 1V95A 2ZBFA 3CXRA 4EHHA 4HG2A 4EPYA 5IM4A 4AJKA 4W5TA 3Q6NA 3PC2A 5JH7F 1LLCA 2BGIA 2BM8A 3RS4A 1KFJB 5HJ2A 3B6KA 5AK4A 3PTAA 4BO5A 5D84A 4G26A 5C53B 1I2CA 1KEVA 2PXXA 4C5CA 3OQBA 3Q8XB 2I6GA 2WJ3A 4EEKA 4G0YA 2ZYDA 5TS3A 3RNOA 1OBHA 1TT5B 1P9LA 4J9VA 1FCJA 2FRDA 3C5EA 4MZDA 1CUCA 4RHTA 4YT5A 3EA4A 4C4YA 4DQUA 2PV0A 1Q14A 1V0JA 5BRAA 1V5FA 2GJAA 4RTOA 2C7PA 2WF6A 3HUDA 1G5PA 1O0SA 1UH5A 2RKOA 2I1VB 1EX7A 1X15A 4KO3S 1QPBA 4ZQHA 5EGNA 3DLPX 2CLIB 1NOKA 4O4IF 1MGPA 3GLQA 4Q00A 2RHLA 3JQBC 5EFOA 1EVKA 2ZITA 3OIFA 3FFTA 3E6AA 1QVVA 3PFCA 2Y1OA 4TVOA 2RJ3A 3ROQA 2NW6A 4FHDA 2C1ZA 4FHFA 1JTVA 4M9XA 3ZH9B 1W75A 2SCUB 3UOGA 1M8JA 4LZNA 2XWBF 1C9KA 3D7MA 1M6VB 3UJAA 5ER6A 1WX1A 3IOBA 1E4VA 1JIVA 5G41A 1J8VA 2ECOA 1W0CA 2Y1EA 4JODA 1YTLA 4NOKA 4QNRA 4UNNA 5CW1A 5BUCA 4JLOA 3Q7IA 4UPDA 1DTWB 2EFCB 2TSYB 4D8VA 3WKBA 5DBFA 4G0ZA 5ULLA 4MS4B 2VSXA 1GTVA 1T2DA 3IUNA 5DRTA 1NASA 1H66A 3C6QA 3LQKA 5DHAA 1L4EA 1QK5A 5TY0A 2BZ1A 4ARVA 2VT6A 4BU1A 3LLMA 5IAGA 1QC5B 1OOEA 2CFIA 1YZYA 3ESDA 1B41A 2H11A 2WYVA 2OAEA 3DB1A 1JEOA 4LJSA 1N36B 2FOXA 1E63A 2UYGA 1NHWA 4KGZA 4IIUA 1C3OA 4PC7A 2AF4C 3C6ZA 3KOUA 4EF5A 2IYQA 5K0EA 2G4LA 3KJNA 4M6WA 1JWBB 4EK9A 1ENOA 1DJPA 1K68A 2QGFA 3OMXA 3QVMA 4EX7A 5CIYA 3JAMA 3B9RA 1E3LA 3GRZA 4ZCRA 4OMDA 1XQ6A 4NFHA 3T1NA 5A02A 1EWYA 3HDVA 3CO0S 4L4XA 3A6GA 4MCHA 4Y6QA 2WPNA 4NKRA 4PG8A 2OBBA 3RS2A 3N2EA 1TCBA 4LZJA 3AUSA 2C92A 2IIVA 1E2GA 5T3YA 8AT1A 3CVUA 2NNLD 1NR1A 3C3CA 4MJLA 1E2DA 1CS4C 3UJCA 3DZFA 3JQAD 4KXFB 4I55F 3QE3A 5IWCA 5KWIA 1KMMA 2A0WA 4U7DA 4NMHA 1LV8A 1M7GA 1Q7TA 1P31A 2JDIA 1OKKA 2IYSA 3IJEB 2GZ2A 3OQ6A 1OMOA 5KAMA 4MS1B 1C8BA 3PUHA 2OLJA 4JOCA 1IQ0A 1I13A 3MMNA 3UHPA 3V1KA 1Z6ZA 4F5ZA 3IVAA 2YWFA 4LOKA 4Z9BA 4ZHQF 4BBZA 4R9RA 1G8MA 4N5NA 4C7XA 4P33A 3NBYC 1J8MF 1Z4IA 3DS8A 2FA9A 2W2OA 1EGMB 2QAIA 4YJ2B 1XRSB 1SNYA 2HNBA 3AY0A 2IX9A 1KVTA 2KWIA 2ZUSA 3GH1A 3FPKA 5E6SA 4X20B 5CUQA 3WXMA 3WGGA 1TOAA 1YRBA 3D8BA 3E9YA 1QDEA 4PQEA 3Q8LA 2AR0A 3A6KA 4L07A 1GITA 2AUMA 2DQYA 3OPYA 4HF7A 4LPSA 4LOAA 3TCKA 4I14A 4M9SA 3KZCA 1CZNA 1HDGO 1C3EA 4ND6A 4FYWA 3F5QA 3I8XA 3NORA 3UHOA 5BUQA 1G6KA 3TSOA 2ZYTX 1Q1AA 1OV6A 1F2UA 2EYQA 3LYHA 4NE7A 3SC2A 1LPOA 1E2PA 3O3NB 5JH7A 3VC7A 3B3JA 5T57A 1H42A 4Q19A 3PD1A 4CM6A 2FPKA 3ZUPA 4YP0A 1WTAA 2EFJA 3NT2A 1GPNA 4WXYB 3FCCA 4MRSA 1HTBA 4AL4A 3IPYA 4QELA 3R3SA 1AKEA 3K8OE 5EPEA 3ZH2A 1Z2NX 2RGUA 4F8YA 1XN4A 3OQNA 3Q7PA 3U49A 1O94A 3FHJA 4TWJA 2O1SA 4QUHA 1Q0TA 2JAQA 2POCA 1T25A 3B1JA 1GSOA 2XRFA 4LVOA 5H02A 4A1OA 5F7OA 4C14A 1A8HA 3BA6A 4XZ3A 5H81A 3GA0A 3QYJA 4AZ0A 3O38A 5KQRA 1PFYA 1PJ2A 4JP3A 2LTAA 3GRKA 4JR2A 4A0RA 3GU3A 3DE2X 1AC5A 1KO5A 2BSXA 4EHNA 1ZGGA 3HXOA 4DA6A 2GHIA 2W6JA 3OEHA 3PQCA 2PL5A 1U7WA 4X92A 1ODLA 3PRHA 3CE6A 4HLUC 5HPYB 3K5WA 1HOXA 2BJHA 4N3AA 4Q6BA 3SYRA 1GPMA 1LVGA 3WQRA 2XBMA 1WAMA 4KJZA 5IANA 4WV3A 3II6X 2DG2A 3JALA 2WWTA 3OSZA 5EFZA 1JP7A 5E3HA 1KPHA 2WJZB 3EGDB 1RCFA 2M1XA 4DAEA 3JQPA 4FHEA 3NPMA 4HPWA 3M1AA 1AMOA 1K6IA 4F9GA 2CKMA 1YS1X 3DPUA 3EXG1 4R1QA 4YUAA 1KJWA 3L0DA 2X40A 3OLWA 1Q77A 1YI0A 2GSWA 2GZRA 2NTJA 3MHPA 2QTRA 1Q3TA 2OUKA 4GWGA 5CT4A 4QU9A 1D8AA 1Z4PX 1NI5A 1GL9B 1KOJA 2Q7XA 2YIDA 1N5DA 2CXRA 1XFDA 3COSA 3NJRA 4C0XA 1DKLA 4WA7A 1D2NA 4RFSB 3W2TA 3H04A 2XUHA 2OFOA 4HH0A 2FPPA 1M6YA 2HDOA 5TR9A 1Z2OX 4A10A 4AIRA 4PYMA 2C2ZA 3EVCA 5FFNA 3RB8A 3WLHA 2XCRB 1ZRMA 3GD7A 4JLVA 3HVIA 1FZQA 1LPMA 4PGGA 1QQ7A 1T0BA 3DLAA 1T9GS 5AXBA 4NS1A 1RJGA 4K9MA 4TQAA 5IVPA 3COJA 1L4GA 1TIBA 1ZPDA 1Y37A 2OV3A 3EWAA 3L7MA 3OG9A 3OO1A 1NMEA 1U3UA 4JU9A 1IZ0A 1EQ2A 4GHWA 3U4GA 4D80A 4BNYA 4UHFA 3NIWA 3BD6A 1E0DA 2BTQA 3V6LA 4A5SA 3LRPA 5LN1A 5LA6F 5LMNB 2WIDA 2AEEA 2ZFUA 2X5OA 5ALVA 1YE5A 5F64A 3LBHA 5JROA 3FWHA 1V8PA 4KPGA 3W1EA 2WYWA 4I6EA 5DYTA 4A6PA 2PVCA 2PRJA 4RDXA 5FI3A 1I2BA 5K3CA 3IUJA 3IUBA 3QOXA 1A2OA 4LYDA 4EKIA 4WQMA 2ZYGA 3CKYA 3VJRA 1L2TA 2O3TA 3CX8A 2ZJ6A 3SSNA 4JQOA 3VU0A 1TUGA 1BGWA 2JJQA 4C22A 5AW2A 4N5DA 1ILWA 5HUJA 1NZFA 9MHTA 4YI5A 2IODA 3LZ6A 4LC0A 2A5DA 4ZHQA 1AQ6A 1JALA 1Y7PA 3MOGA 2QRMA 3U7QB 3ZWBA 5EZYB 2W37A 3LS2A 4FHZA 4BPRA 3OZGA 1EFRD 4RXMA 2EKQA 4PNEA 5KKCA 1HYHA 2J0VA 1EK5A 1C1DB 4WFKA 2GEKA 3FN4A 4K9KA 2CYCA 2ZSIA 5EXXA 4AMGA 3QVOA 3ZHUA 2OMKA 1VHWA 2AE2A 1L5GB 3ZDQA 1M2NA 5DN6A 3SE7A 4CF3A 1A82A 2F9LA 1GUYA 3GMSA 3MRXA 4PC6A 5IVDA 2Z6AA 1YKGA 2WHEA 1Q1BA 2GLXA 2ZJ5A 2EERA 3DULA 3FB1A 2NYUA 3EQZA 3FYUA 2GO7A 2C97A 3ITNA 4TL9A 1VE5A 4AQ7A 1AHHA 3TXXA 4D0NA 3RJMA 2JIZA 2Y1KA 4B48A 5B1IA 3ET4A 3L7NA 3UNXA 1KY2A 1R6UA 4ZREA 3KTFA 1QGUB 3FE2A 4I1OA 4KDCA 1O95D 4QBTA 4PCVA 4DV1B 3ISVA 4HLNA 2PUCA 1KMHB 1P5HA 4WL0A 1G55A 4XW2A 4X7PA 1UWLA 3T06B 1SOAA 4RPIA 2IEIA 3VMFA 3H2GA 3BWEA 3WWCA 2EXXA 2FFQA 3K94A 1CULC 1LSOA 3UGTA 4JLJA 1QH1B 4BQFA 1J8FA 3OC0A 4WGGA 4ENWA 1M1YE 1ZU5A 5H3CA 4C4TA 5JMPA 4UUQA 4A4DA 2HHCA 3AWDA 4GX5A 4GSYA 1YA8A 2AWNA 2D1RA 3BPSA 3HFGA 3OZTA 3T52A 5JAZA 3Q8KA 2PEZA 5HKLA 3MS4A 4DCJA 2HK6A 2B6NA 4I4TB 3WICA 3IEUA 4XJTA 2ZQYA 4FPXA 5CAEA 3KO8A 2F4NA 3A4YA 3G0BA 3GJ8A 3AILA 2H54A 4J16C 3BB1A 3DDZX 4R51A 3T12A 4B4WA 1I51A 3TEJA 5HEKA 1UT8A 1T35A 2D2IA 1KS2A 1JXMA 3PNMA 1LPNA 4DM4A 3NAGA 3ZY4A 2DHQA 2DLDA 4KBYA 3PVSA 5ALJA 1S1MA 3ST7A 3HM2A 5JS8A 2ONZA 4LSGA 1IBRA 3GGSA 3E8SA 4X1YB 5KI6A 3U1TA 3T6KA 1F3LA 4R9NA 3FI9A 2XTAA 7ABPA 1A9OA 1GLVA 4MARA 5CGQB 5DTMA 1SXQA 1QIGA 2PM8A 1D2CA 4OLHA 4DILA 2C4WA 4N76A 5JJKA 1Z8DA 1GYPA 4DEYA 4TSFA 1MQ9A 4JI4B 3V7NA 5JAUA 1CETA 4WLNA 3D8TA 1AT1A 4TT3D 3TPFA 1H2AS 2J67A 2R2GA 3A1WA 3OTWA 4L4YA 3DTVB 4PRYA 4M7OA 5DHRA 2VHYA 4ALMA 5HWSA 3LNCA 4M4SA 1NBMA 3K6SA 3B1XA 1CUHA 1USVA 2IIBA 3CB2A 4MJXA 2IHNA 1FW6A 2V54A 3TYXA 3TJMA 1EFLA 4ZCTA 1G66A 4TTQA 4YJFB 3NBFA 1Y5RA 2HTFA 1KEEB 2AHOA 1W2HA 3GNSA 2JCVA 4XX0A 4RNDB 5EI5A 4CL2A 1EXDA 1NUQA 1GP2A 1Y9EA 2ZU0C 4KEAA 4CIAA 4Q93A 4N8DA 4AF6A 5ECDA 2GAAA 4LF8B 4QT0A 3KZ1E 2C00A 3IMGA 2AUNA 2YHIA 3NDJA 4G8CA 4YAGA 2NUAA 4IX1A 5CG1A 2OBFA 3L7LA 4REOA 3EBLA 1VLMA 3KFXA 4OYRA 3ZLBA 2O2JA 3V32A 2Y71A 1CY6A 4CQMB 5KVVA 3CKKA 3H4IA 2Q3JA 2X0FA 5I4BA 3R6LA 3STVA 4AZ3B 4G5YA 4LJ7A 1C2TA 4QYIA 1XK6A 4QEKA 1OBOA 2GPTA 1GUBA 3LVQE 2FP4A 4MUJA 1KYYA 3S2IA 3WRWA 5JI2E 5BOSB 3UIEA 5LKAA 3IVRA 4F0JA 4YAWA 4XOUA 3U7IA 5L7TA 5J2TB 2O1WA 1MAVA 4QNMA 3RS8A 1NVMB 2W83A 1YK0A 1T5IA 2GETA 2OBLA 3B85A 2R7LA 5EUCA 3PDWA 1ZXBA 4RHEA 2ZE6A 4V39A 5KYUA 1GGKA 5E9AA 5HIMA 1PFKA 3V4FA 3AI1A 1RAGA 4JQYA 1DFHA 1TEZA 2WUGA 1IIBA 3L4JA 2VUUA 2CFTA 4V0NA 4JNKA 3RKRA 6REQA 2HLHA 2VJOA 1NN1A 4GNKA 4MGEA 2BEWB 4L2IA 4B35A 2H1IA 1M2VA 5TMDA 4ZGWA 4YIHA 3IO5A 2WA2A 2HXSA 4KN6A 4MRAA 2JIPA 4GXTA 3ORQA 5JHHB 1PT7A 5K01A 4NU5A 4JI3B 4M0EA 1PJQA 4LGCA 1R6TA 1PP4A 2O0LA 4KQ9A 4V1CA 5ILOA 5JALA 1Z4QA 3BIOA 2JH9A 4HDOB 4CEJA 1QIHA 2IXGA 3OEWA 3PCRB 4RHCA 1RVDA 1EP2B 2YOFA 4U6SA 3T94A 2ZT8A 3CSDA 4FBGA 1JKXA 3UQYS 1IM5A 4BQEA 3L4KA 4DTCA 4Q9KA 3ZBUA 3G79A 3SFVA 1GNRA 4A73A 2C4UA 1T24A 2HDHA 3I34X 4LJLA 3BD8A 3MELA 3WB1A 3ZN2A 2NP7A 1VM6A 4OAOA 3UW1A 2JRLA 2R8PA 2OVBA 4DZRA 1F9EA 4ZAWA 4YMWA 4KFCA 1J25A 2AOXA 2LW7A 3EEIA 3GVPA 2DF8A 3KDPA 4QXMA 2DX7A 3AY6A 4ARAA 3AIMA 3F4BA 1FX1A 2GVNA 3K92A 3G5LA 5J47A 2NO9A 2FMIA 1V48A 2ZIGA 4MUYA 3THXB 1BJTA 1N6RA 2AXEA 3FR8A 3IOCA 3IV7A 3KVOA 4N49A 3N0XA 5E0KB 3NPAA 2O2GA 4X7MA 3F9CA 2O3JA 3C6MA 3VO8A 3EVGA 5HKAA 1WUTA 1XRLA 4R41A 5T6BA 4BZXA 3QE4A 1B3BA 2B4AA 1R18A 1SCQA 1LEHA 3E5MA 3LCUA 4L4SA 4QFCA 1SRRA 2BSQA 1AK9A 3LT2A 1RBQA 5GAJA 1I6MA 2XB9A 1HH4A 1YULA 2QT1A 2BGGA 5IUJC 3A14A 4RY0A 4F04A 1V3TA 2QPLA 3BSYA 2HADA 5BRNA 4JA0A 3LECA 4RKYA 4R84A 2WJYA 3S2EA 1P2GA 3D2BA 3IL2A 1Q3KA 2UKDA 5DYWA 1JHYA 3C1AA 1IJFA 4Z1MA 2B83A 2CFOA 3HK2A 1ZUIA 2XSZD 4RXTA 3DD5A 4YCBA 1UR5A 4FSHA 5DTEA 4ZMSA 3ZLJA 1HX7A 2HK7A 5H9VA 3QVGA 2QMEA 1FPMA 1ST3A 3FR7A 1QRRA 4KI7A 3HBMA 4YJ2F 4QX6A 3THRA 3AKZA 4MULA 2AI1A 4H6PA 3IHTA 1FTQA 4MROA 1VPDA 1RLTA 2AG5A 3KZOA 3CLRD 4YQEA 3STHA 3ZXXA 3DE1X 1WCYA 4WLEA 1P9NA 5TDHA 2FQ1A 1TJYA 3EGOA 4QOFA 3S40A 3LGSA 2G7MC 5D7NA 3Q7RA 2XA1A 3R20A 5BW5A 1PJTA 2WBLC 5D5HA 3QELB 4LXYA 5LQDA 3VSBA 2JGDB 1M1UA 1QSGA 2LNDA 1F7VA 1KOLA 1C0EA 2BKLA 4H4CA 3CXUA 3P9CA 2JCSA 4O2AB 1V7PC 1R88A 2I2XB 3R3WA 3TL6A 1URPA 2QQEA 3B52X 4GECA 2VBCA 2NQ2C 4JFAA 5B2EA 1AXEA 3DEJA 3H84A 5CHEA 3SJAA 1FP4B 3CLUC 5JXHA 4GF5A 5BSFA 1MJ5A 2P0EA 4ND3A 4S3MA 1JLRA 1FNMA 5J63A 3TNJA 1QGOA 4LJAA 1YDWA 1G0OA 2KI5A 4FOOA 4UBOA 2P8SA 5K3EA 4K9NA 3SVTA 2Q46A 2RK4A 3DDWA 1LX7A 4MW1A 4JEIA 1OI3A 2C5BA 3CUEF 2HMYB 2SCUA 1V8OA 2X5NA 3VH4A 3B89A 2EFYA 1M6VA 1HPLA 1WQ3A 1U9YA 4KPEC 5CNMA 4KO8A 4WY5A 4DW8A 4EG8A 3WLNA 2C9OA 3ABIA 4M0KA 2PL3A 3RVSA 1DTWA 3I9V1 1P4GA 1ISFA 3L1HA 3MJFA 2JLZA 4N82A 2F3UA 4MS4A 3R7SA 3QA3E 1FOEB 1WQ4A 2O7QA 2HPVA 3A1EA 1J06A 1RWQA 2ET6A 4PYIA 1QC5A 4D8YA 4DLKA 4R6WA 5ICEA 5LP6B 3CE9A 4B6SA 3I8SA 2ZSJA 2R8RA 2JLRA 2PL1A 4XGQA 4E70A 3AM5A 3NBMA 1AS2A 1YASA 2O3SA 2PCLA 3E27A 2RGDA 4ZYXA 2JJ8A 3A3YA 3H2ZA 4DDHA 2DFVA 2Y2UA 2XNDD 3ET5A 1CD5A 2GZ1A 2R8BA 1OWPA 3KV1A 2R25B 3A32A 3MLBA 4LF5B 1PFQA 1C0KA 2XVXA 2DVMA 2JFUA 2VHVA 3IKVA 3NCTA 3PE3A 1LWOA 3G0GA 3R5XA 1QGED 4M1YA 3UUEA 3DKPA 4M1MA 3WLEA 1S8NA 2PSJA 3B5JA 1Q11A 3JQGA 4GAEA 4O3FA 1Y6RA 4U7JA 1TD1A 2FQQA 1RNLA 3SEAA 3NIDB 4B74A 3NBKA 4QGGA 4KIFA 3W5JA 1SO8A 4XX1A 4BCBA 4WOKA 2UZIR 1GUDA 3LM8A 1C4KA 2W6ID 5HQJA 1MH9A 4YCAA 1ZQ1A 2WTUA 1IXKA 1R12A 4IZIA 1SUCA 2XECA 1E4EB 3EZYA 1VE1A 1TAQA 1X0XA 2B3DA 2GAOA 1KRXA 5JASA 4Q3OA 1V4NA 4HWRA 1HLPA 3EXIB 4D8UA 1K9VF 1VE6A 2QW0X 1E6MA 3C24A 3EW7A 3IQHX 4EG6A 1H8HA 2CC2A 2PQ6A 1QX4A 2RARA 3L41A 4MS1A 4N9WA 2ODAA 5GGXA 2D8MA 5EY5B 4CF5A 1R37A 1SHJA 2VWPA 1XCJA 5EXEA 3CRVA 4KVGA 5AI9A 3LO5A 4KWHA 3VZRA 1B23P 5H70A 2CLFB 2W00A 3ORFA 4QRDA 3VPAA 4IFBA 4OQQA 2VA8A 4H1WA 4YJ2A 5ANRB 4LE1A 1KMQA 2YJ4A 1R8SA 5EMMA 5J2UF 1UBHS 2Y1CA 3C5CA 3ZK8A 2XMPA 4JQZA 4X20A 4JT2A 2QJFA 3H4MA 3PGXA 4JCOA 4MS3B 5DJ5A 2VUTA 1F4VA 2EU8A 4FJ1A 5EJFA 3GO4A 1SIOA 1R27A 3QPUA 1L5MA 1XJ5A 1IK4A 3F8SA 2EEZA 3NHJA 2TRSB 4PSKA 2ZBGA 3C8UA 4CKBB 4DM3A 4F4UA 1I3CA 1TPYA 3T3HA 4LK2A 4PONA 3WXBA 1YB2A 1OB5A 4PO3X 2QV7A 3B3FA 4I6JA 2H59A 4JC0A 2OPHA 1DEOA 4DSOA 3L07A 2PUHA 3I01M 3OVMA 4IEIA 4WWHA 2DCMA 3AUYA 3HXLA 3D2CA 4NAUA 5DHTA 4C4SA 3KUKA 4NJOA 1INLA 2W4MA 3GI1A 3O3CA 3C98A 4QOJA 4AXXA 5B7GA 3ODGA 3BFJA 2XRZA 3I45A 4WZBE 4HKTA 3UVEA 2FMUA 1DX4A 1OUMA 4I9NA 4IDGA 1A96A 5C5CA 4FNMA 4AX8A 4EARA 1ZOPA 2QMYA 1XLWA 4M46A 5HOEA 2BTEA 3ZDDA 4N7BA 1WZCA 4RM3A 2VZLA 1Q19A 1F06A 1MCZA 3IQXA 3LDUA 5CFPA 2B4KA 5KYNA 2RGNC 2WOJA 3X0DA 3ES9A 2JZNA 4BFUA 4I4TF 3HNRA 4II2A 4JWKA 1IWBB 3ER9A 3OFND 1OH7A 1E1RA 2Q8QA 4P22A 4ZDIA 5EEGA 1GG8A 5DHSA 5GP1A 4IBOA 3LK6A 3SBEA 5GADl 1VSBA 3SR0A 4AWXA 2ZUFA 2GJ8A 3EGDA 4R9SA 4RD6A 3CGGA 3GGPA 2H2IA 4W6ZA 3LXMA 4MV6A 4TMVA 2Y0EA 3NOQA 3PENA 3PVZA 2FN9A 1A50B 1CY8A 1NNUA 2HZ7A 2VBFA 3H1AA 3EWSA 1VLQA 2XMGA 3MPOA 1XLTC 4H15A 1DWUA 2CEAA 3MSXA 5F1OA 1EK0A 1JKMA 2AC7A 4INAA 4RF4A 1ZR4A 3V1NA 1KO4A 2O52A 4FBLA 5H4HA 2I34A 1VL6A 2H1FA 3WJ1A 1NG9A 1G16A 1HE5A 2AOWA 3UMBA 4NCAA 4DLXA 2NO0A 3QVUA 1JXQA 2I65A 3FRIA 4HYYA 3WLAA 5KKNB 4V02A 3WL4A 4RFSA 1IM2A 1PIWA 2BGNA 2Z9CA 4US1R 3B12A 5E2IA 2KJQA 4P4UA 3RFUA 1HQKA 1P81A 4JCCA 4FDMA 3UJ8A 4ZI3A 1WDKA 4D8TA 4AMVA 3CH5A 2HK8A 2I8CA 2QXTA 4RPLA 5AQEA 4B3CA 4XYMA 4PTYA 3RAPR 4A8TA 1PSWA 1WPQA 4O8ZA 4XD2A 4ICIA 3HGTA 5FPTA 1R4MB 3SMVA 3M6MD 2MIIA 1UDRA 2D54A 2BH2A 1X8XA 5AJHA 1GR1A 2WKPA 5DX1A 3U0VA 2Q0SA 3GFSA 1SVUA 5E1MA 3BEOA 3FNGA 3AVYA 4HNHA 4EUSA 5HJ7A 2QW1A 3JYOA 1B8NA 3BXZA 3R75A 1N75A 4XM1A 1WD7A 1F0NA 2R00A 2PRYA 3SZOA 4OP3A 5AVRA 4X62B 4ZAVA 2ONJA 1YI8A 3FF4A 3L3BA 4E2ZA 4HS4A 5HQTA 2JGRA 5BSMA 3UMCA 4N65A 3H1BA 1X9HA 4L22A 3VRHA 1JU4A 2OVFA 1S2OA 4BY9E 5BWMA 2QEQA 3UWPA 1XF1A 5JZ9A 1Z2AA 3H7AA 3TLKA 3UV7A 1R0RE 5J2TF 5CFOA 5KJFA 4I99A 2C5EA 3SD7A 5F2NA 1A0OA 2FX5A 4KMSA 3U7QA 2P30A 3W8FA 3ZTYA 5EZYA 2EJUA 2FZVA 4AFNA 1JLLB 3M6AA 2Q4EA 2BDEA 4KL8S 3NRJA 5TPZA 1XDUA 4X60A 2IYZA 2VTKA 1JPNA 3AY3A 1C1DA 1H4TA 2BGUA 4JXJA 5HA5A 1XMJA 4Z0TA 1QHSA 1SCJA 2QSYA 3B60A 2IVFA 1DC8A 2ZUDA 4INZA 4WJKB 5IEJA 2VXBA 4IF6A 3GFBA 1CY4A 2ADFA 4EA8A 3PLAE 1U2PA 2VEOA 3EDMA 2D1QA 5EINA 4LJ5A 1UC9A 4E14A 3L0ZA 4Q3NA 3AHHA 2H5JA 5FI5A 3PUWA 1F20A 4H16A 2LD4A 3ZKWB 2YV4A 4XYLA 1YRLA 1WLYA 3FROA 2BW0A 4K9LA 2QUBA 4V3CA 5BQFA 3Q1KA 3O47A 5LKRA 1CQPA 4JJFA 1WHTB 1O3YA 4Y1RB 2X9LA 4OFZA 3RFVA 1MMFB 4P32A 2CL5A 1FDWA 2AKAB 4HC4A 2AW3A 1X7DA 2EIXA 2MTBA 2X6RA 2XXJA 3CR3C 4C7KA 5I7SA 1T36B 1VRCA 1LVHA 1RQLA 2QD2A 1WHSB 3NRBA 1GDDA 1P2UA 1G291 3CF4G 1KMHA 3PNPA 1V8ZA 2F1JA 3BB3A 4QAJA 3U4QB 4C4ZA 1Y3HA 1CUIA 2WTXA 1SIUA 3DC7A 2J9RA 1ODTC 1QH1A 2Z56A 5AUNB 1A69A 1QP0A 5FLEX 3G5UA 4K8OA 1KE1A 2FJ0A 2YCBA 4EHKA 2DM6A 2FCRA 3UWDA 3WRXA 1E60A 4R2XA 1A9YA 3Q4GA 3PPYA 3QK7A 4I4TA 1G8KA 2WJPA 3VC1A 3IE1A 3B82A 1X13A 4X7RA 2P9EA 4DWJA 1L3IA 4OHRA 4ZA2A 1HETA 2CNDA 1C4OA 4G5OA 2LRHA 4P4NA 1OW3B 3AXTA 4RTPA 1E9FA 1K6JA 2YY7A 4GOLD 4BJ5A 2CLMB 2HUPA 5EJ6A 1YE8A 1H5QA 2YDYA 3WGMA 4RJJA 2LE0A 1RQGA 3T5MA 1JA0A 1Z5VA 2R1UA 2VEDA 4I4CA 1FSGA 2OEPA 3JWPA 4TYMA 4X1YA 5DNYB 3PJFA 3HJNA 1OASA 2W58A 5B7NA 2J9FB 1K7SN 4JJKA 4MHSA 4EI9A 2YJ5A 3FHOA 1WZEA 5HS6A 1RLMA 3R5SA 4PGMA 3PR3A 5COBA 1M83A 4IMJB 1XXHA 3HMQA 1V1RB 1DB3A 4L5AA 3QW4B 1U8CB 1NF8A 2C3PA 4F8EA 4HDNB 4FQ5A 1XHEA 2EW8A 1K8RA 3DTVA 4MVJP 2WWIA 4XLLA 5BQPA 8ADHA 1IHDA 1T8PA 1CB7A 3KXLA 4MAFA 3AJRA 3C6XA 3NHZA 3AOGA 5FYDA 4B32A 3RWOA 4AS3A 2IOQA 4LFBB 2PPVA 5FX2A 2XWSA 1GSIA 4OFXA 4YJFA 3KWLA 4UNSA 1P2DA 3P4XA 2ZBEA 5CX1B 3K31A 5DSZA 1KEEA 2AG6A 4FYJA 3ASUA 4FZVA 1QK3A 4FR5A 3FTDA 4H7FA 2FZWA 1UUFA 4MKHA 3ICWA 4GRIA 3CJQA 1QIKA 4DNOA 5CLIA 4OO3A 1RQXA 2Y0DA 4WK2B 5TQJA 1QBKC 4DXAA 3DDNA 4M1TA 4R9UC 5T3UA 3MGKA 2VP9A 4DNPA 3MGCA 4HNRA 4CQMA 4DXDA 1YZUA 5AUPB 1TAHA 2RC5A 4AZ3A 1MU0A 1ZMTA 5KC8A 4JEHA 2Y2VA 2ZS7A 3S29A 2XRMA 4Y9UA 5GVRA 2A1TR 1YJ8A 5DCWA 4LA4A 5BOSA 1QHNA 3G0OA 4HATA 2VPXA 2YBEA 3LHDA 4Y2UA 4POOA 1A9QA 5J2TA 3N75A 1VKRA 2MSNA 4IWXA 1SM4A 1NY5A 1QO7A 521PA 3RRMA 4B76A 2YN0A 3UMRA 4BNDB 4WKGA 5A5EA 1G60A 1HZZA 2DHRA 2GCIA 3GUCA 3RWMB 1N34B 5DNDA 2F4VB 1K08A 3N8HA 3SIXA 4R3WA 4LXTA 1I7NA 1ZNZA 1HFJA 4Q1VA 3RC2A 4EJMA 3SHOA 2JEYA 1UEXC 2ZRHA 4BGEA 2CXUA 1UAGA 1XQ1A 1TQ6A 2ISSD 2PKWA 2H57A 1ZM2A 2R751 2VPPA 1BVRA 3A1DA 1LRJA 3HUUA 3ANSA 1T4BA 3QLTA 4K03A 1U4NA 4D7AA 1GKUB 2BEWA 4DV3B 2FPUA 1HNXB 3S4YA 3COYA 4JJAA 3GIDA 4NMWA 4UM5A 3BXOA 5TLSA 1IPEA 3KD3A 2JRCA 3RRJA 1BX3A 1JI0A 2Y8EA 1M0EA 1EHYA 4DE5A 3W5IA 2D5BA 2Z2IA 1M6NA 1TVCA 5CVCA 1EFHA 4G63A 5CCBA 1B8UA 1UJ4A 3H0KA 1XDSA 1IAQA 3SVZA 2OZEA 1N32B 5JCZA 4C05A 1FBNA 2D7CA 3SS9X 3T0IA 4BFWA 5CEEA 2R47A 3E18A 2DLNA 1FXWF 3EARA 1TRHA 4G65A 1FNSA 1SU8A 5NULA 2QGZA 4OJMX 1NVBA 5LP6F 1C7EA 1OWNA 3EMDA 3URMA 4C43A 1P6XA 4R8RA 2G06A 1W0JA 1G2IA 2FZGA 1H1LB 1OQAA 1GCAA 2X77A 4OBXA 4M1QA 1CVIA 2DH6A 4WXMA 4B85A 4JJ4A 2H08A 2PGNA 1PN3A 1AZSC 2OHGA 4DSZA 3H8JA 5L6LB 1O6CA 5FBKA 3BGDA 4FGJA 4P3OA 5EWJB 3NTRA 3UV6A 4ZDKA 4O25A 4M99A 3CH7A 2K7FA 1U0SY 2OA0A 5J5AA 2ZPUA 2H07A 3AHFA 5BN4A 5FYQA 1E2JA 4IXWA 4CWAA 2B25A 3THXA 4P34A 3PIIA 4Y7DA 3OAAD 3T5PA 3ONEA 1XTBA 2VAPA 5C32A 3KZXA 1A4UA 1LJ8A 2YZGA 1YL6A 4N3NA 3UFBA 4NFSA 1EFTA 4QVIA 3NVAA 4AS1A 4ZCLA 4GSKA 4RKWA 4OD0A 4RTJA 1NXPA 4DVJA 2ZIUB 2HHLA 2YDXA 4LCEA 3NTVA 3TVYA 4GVPA 3DZDA 4LDRA 4QL3A 2OFWA 5EKTA 4ARIA 5DASA 1D0SA 1T1SA 4CKYA 5T8KA 4R1TA 3S68A 3D0RA 4EG0A 5E9WA 1IN4A 4QOEA 3AC0A 1JSLA 4HWKA 4RENA 1T2UA 2C4TA 3NEAA 5ESXA 5JHGB 2JIRA 3M6XA 3HKBB 2G04A 3VC3A 4MVXA 3D81A 2RDMA 4H9GA 1U2RA 1U65A 2R1ZA 3PC3A 3DMHA 1YMQA 1EFAA 1PO7A 1PR4A 1U2DC 4IS3A 2NQTA 1Q7CA 3KCQA 2AN9A 2YYAA 4P83A 2C4HA 4DV4B 1EUCB 1RFLA 3B1ZA 3KJEA 4LWZA 2R8OA 5TVKA 3STXA 4X41A 1O9BA 3ZDAA 2IU6A 3PFHA 2CLCX 4OOEA 1W9MA 2QA5A 1CB0A 3VPFA 1D8TA 2JBHA 5I6DA 1YOVB 1M1XB 2AJDA 5FWYB 3IUEA 4J0FA 4D74A 5LFAA 3QELA 2OCIA 1MG5A 2GMWA 2H7YA 3L2OB 3RQSA 1KIAA 1G63A 3T7EA 3B5EA 3OE7A 4KLCA 2J3LA 5DT2A 3F5FA 2JF0A 3H3FA 2X1VA 4UMDA 3TTXA 2B30A 3QYAA 1RZRD 3L8CA 2PX4A 1U94A 3D59A 4O2AA 3R09A 3BDIA 1KI1A 5FO1A 2FWNA 1NW5A 1UC5B 3U3JA 2A9RA 4AN4A 3ZHRA 2BE7A 1P29A 3KR2A 1FP4A 1P8AA 3BGWA 3TECE 1OXXK 1KIMA 1MOQA 2GA8A 4RE6A 3T7SA 1PV1A 2FRVA 3DKRA 4FFBB 3OY2A 3IAM1 3VPBA 1TZKA 2DHDA 3OZUA 4MMZB 3D2LA 5A7GA 2ACVA 4QJ5A 3OLVA 1NIJA 4QTUB 3V8VA 2VJQA 4BMDA 2IE8A 2C54A 2JJ1D 2Z5VA 4HRXA 2P3SA 1AVTA 4Q5IA 4JI8B 1HC7A 3MB8A 5CJPA 1OLXA 3H9JA 5C0OE 1T2VA 2HH9A 5CFNA 3QG1A 2LKCA 3NAQA 3O4HA 4N8SA 4YPVA 1F60A 2GN4A 2J87A 2LXNA 3NT4A 4HQ6A 3G13A 2QYTA 4OQMA 1CF9A 3LXXA 2QT9A 2O6HA 1E64A 3NI2A 5JG7A 1KJJA 2HA7A 1N1MA 3BXFA 1ZXXA 4E5YA 5CDHA 3HYLA 3A31A 1C7JA 2QD5A 4S1VA 3WLTA 1GN9A 4QJ3A 3HH8A 1FXWA 1APBA 2HSWA 2Z2XA 2IF0A 4G1EB 1KJ8A 1TK3A 4Q03A 4FFRA 1J24A 3AEYA 4Q47A 3RG2A 4D9IA 5AVXA 5LP6A 2I3AA 2WUFA 5IMSA 4IXMA 5TXGA 3WBJA 2FR8A 2WF7A 5H68A 3C8DA 4ND4A 3X1MA 3DEHA 5CVVA 5C4IA 2J0UB 1Q57A 3A7DA 1J0EA 4JOQA 3PG5A 4BAGA 2QN6A 1E3IA 3IR5A 2JAUA 1E5VA 1FQOA 1TZCA 1YZLA 4ID9A 4OHWA 1FU4A 4QYWA 3ZHTA 4B44A 2XCQA 4L7VA 3GGCA 2UXBB 3CNHA 5FAXA 4X7BA 3SLKA 1N3BA 4L5YA 2AOUB 5EWMB 4JYZA 2WIGA 4Z3OA 1FXSA 4S1TA 3FG9A 2G6TA 2YYSA 1T1RA 1NLMA 2EL9A 3OPQA 4BGDA 5IG2A 2ZJFA 1Z17A 1EVQA 2AZDA 1DX6A 3DOUA 1X7XA 1XU4A 4UEWA 4X3CA 4YAUA 2BELA 1QRUA 4KP7A 2EF0A 3D8HA 4RWEA 5C5DA 4BATA 3HY4A 1JHQA 2FETA 4X8OA 3ZY6A 1W1IA 4F56A 3SFTA 3IAS1 1O8BA 1HK7A 2X1HA 1E4EA 2ZPAA 3W4JA 2HU2A 2CJYA 3ZQ6A 2ZJ2A 3EXIA 2QHXA 1ETHA 4XVQA 1HSOA 4O1IA 4I8DA 2I6XA 3K70C 1Q17A 3ITEA 3LD9A 3P9XA 4FKMA 4N7JA 4B3DA 4D4KA 2P5UA 2XKKA 1O0CA 3ELDA 1W4CA 1GU7A 2OK7A 1KVSA 1R0YA 1QLWA 2W2QA 2D1SA 3K1AB 2WK1A 1KPIA 2X3UA 3L8MA 2GWHA 4Q4HB 4X8MA 3N2ZB 5M5BA 1H3FA 1WW8A 2QLMA 4QJ4A 2HLDD 4H7EA 2WF8A 4QG7A 4D8XA 4KE9A 3D1LA 1IZ7A 1ZMBA 3H9GA 4OMUA 3HZOA 3VYTB 3P2KA 4MS3A 4Z54A 4EI8A 4L9SA 2MSWA 4M1KA 4WECA 2AEFA 5DWVA 5IKXA 1WXDA 2ATVA 4S35A 1JHOA 1NRIA 3OC6A 4CKBA 4EUKA 1N9GB 1Y8QB 2A14A 2JJ2D 5HIIA 4EG7A 4PN7A 4ZICA 5DGCA 4R8LA 4CM5A 1N92A 2W98A 4N48A 2ZDHA 4FFNA 4G5XA 2M9MA 3ILHA 4NDAA 1JSCA 2CDBA 1CPYA 1XO1A 2EIHA 2O3UA 1JIUA 2OE2A 2PV7A 3I53A 3X1WA 1A9PA 2O5EA 2JFOA 1R66A 2QTZA 3HKEB 3CMCO 3E03A 2DPMA 4UMFA 1SB8A 1XJWA 1KEWA 2DHEA 4D6YA 3CM0A 5IWAB 3IIJA 1R0WA 5BNWA 2H4ZA 5FV7A 2I2DA 1T8TA 2QY6A 2PGIA 421PA 4BJ1A 1N7IA 2H63A 4N0EA 4BHTA 3WLFA 3TGLA 4GXRA 2YKGA 1TJ5A 4P0PB 4D0LB 3HP1A 5EMJA 4PYNA 3UV3A 4YNBA 3AVUA 3PQEA 2DWCA 1LBHA 5F78A 3VUFA 4BMXA 1S3GA 1IEVA 2WM8A 4HN9A 9GPBA 1QWOA 4U0JA 3WSTA 2FW6A 1RJDA 3VHRA 4DAOA 4JLDA 1P1BA 2CZQA 3RIGA 1E8DA 1DRJA 1YAHA 2DZDA 3R0VA 4O8CA 2VPWA 4QPZA 4YMIA 5DX8A 5U4XA 4FZRA 4MA5A 5A0TA 2PFGA 1U8EA 1EK1A 3ONFA 3MD9A 1IBCA 4G9GA 1YL7A 5L3RA 4KGDA 3WDSA 1LGYA 3N7UA 5LMZA 1QTQA 1FP7A 2IUEA 1AUQA 3HUFA 1WU7A 3TL2A 1FU7A 2QZ9A 5CW2A 1MV5A 3HFRA 4F4JA 1NNEA 1NJ2A 5GTDA 1I4OA 4XB2A 4QXRA 2EW2A 1E58A 2CVHA 1AURA 4ZPXA 2V6IA 3QHAA 4PG7A 1VL2A 1E5TA 2WTBA 3ONDA 3LBAA 1Q22A 2PH5A 1K7CA 2PRIA 3CA8A 4Q9DA 1MF7A 3USCS 4KG7A 5EE3A 5A4IS 1QGAA 5I7UA 1QYRA 2NT3A 2VNSA 5EE9A 2ZUVA 3L46A 4JB2A 1CUAA 3L4BC 2IUFA 1L5KA 2F55A 5DTIA 2FJUA 2X8AA 3DMDA 2GLUA 2K4MA 2ZRMA 4UBMA 1JHAA 5AK6A 4ENVA 2PHZA 3EEQA 3PE6A 1NULA 2PWBA 2W4QA 4CM9A 1JE1A 3WBFA 1R4MA 2X5KO 1HT2E 5GQSA 2WAXA 3RKUA 1KQ3A 4OHOA 2BMAA 3GLFE 1UFRA 2DY0A 3UCXA 4NFLA 4Y2YA 1P18A 3ZV6A 3M4YA 4Z7JA 1JJ7A 2X0IA 4UM8B 3RYCB 4EHLA 3LKZA 4CM4B 2E9SA 5KVAA 3SHFA 3STWA 2WEKA 1L9XA 2K2WA 1C7ZA 2CNWA 2IYXA 1ZGAA 1WSDA 1TM3E 2MMCA 3FVWA 4M9QA 5JNVA 3FBWA 4D3YA 2R11A 1XCOA 3T1YB 3CIFA 5EIXA 1N4AA 1EMDA 3BH6A 5CK5A 5EPUA 2WWRA 4DMMA 5B36A 3GW8A 2D5IA 4LS3A 4WK6A 2QX6A 1Q91A 5C9ZA 4B0OA 2Y9PB 1FNNA 2JLQA 1II0A 3EGXB 4FZ5A 3K20A 5ALXA 2OZLB 2XNJA 3B38A 4E31A 2PEYA 4GGOA 1WB4A 3RROA 5HKOA 3U7FB 2PJRA 3T0GA 1YBMA 5FLYA 1JLLA 3UYKA 4M22A 2OFPA 3RRBA 3AWIA 5B55A 4QG3A 4JI7B 5JD6A 2WU0A 1PDOA 4C0KA 1YONA 4GQAA 3IAM6 1S89A 3MWDB 4YUXA 3FETA 4IIVA 3ZHQA 1OFGA 3REFA 1HF3A 1FRNA 1SUEA 4AJEA 5JCJD 4XEHA 2BBWA 4G89A 3ENWA 4J7CA 4JJ8A 4UE2A 3HMKA 3WRYA 3HJUA 3GJ7A 3DSRA 4JC8A 3PFKA 1RRPA 3KAJA 4NYIR 4OI4A 3BXPA 4W9NA 3FKQA 3W9UA 5FOVA 2CBXA 5GONA 1QG2A 1S0UA 2CVFA 1FNBA 5J4KA 1CUGA 1FRVA 2CXHA 3UJPA 3ZKWA 4KR6A 1BEEA 1QDLB 5GY7A 2BKVA 4FFVA 2IGBA 4HJRA 2G28A 2WA1A 4PXSA 1VHDA 1WHTA 4Y1RA 5FHRA 1MAHA 2IUSA 3RRNA 1FZTA 1Z7WA 4EHDA 5B1YA 1G5IA 1H5NA 1PJSA 1SKAA 4C5BA 2XXAB 2EV9A 3NATA 4RK5A 1T36A 4LNAA 2O9JA 3HDQA 1WHSA 3NUGA 2ZWOA 3ZG6A 3H9QA 3NTLA 4M1WA 1XP5A 3U4QA 4IH4A 4IJ5A 5LYJB 1KAEA 1B0ZA 1B73A 1Q7GA 2EDAA 3NDRA 1J23A 2QOEA 4I3FA 3WBKA 5LOVF 1KPGA 4BKPA 1O9GA 4E4YA 4ZAGA 4EMBA 3RSHA 2VQEB 3L79A 4OIMA 1KS9A 1JQ3A 1RJWA 3U13A 2HA0A 2QWXA 5C8VA 3FTQA 4JZYA 3EFOB 5JNRA 1CR0A 1TNDA 3TEMA 5A9RA 1M6HA 3JQDA 3ECAA 2I55A 1KJQA 4EGSA 3ICEA 5G1OA 4RH0A 3F73A 1Y4AE 2FLVA 4ESEA 1NVTA 3WQQA 1NN5A 3C4VA 1SUDA 3I83A 1PZFA 4FIZA 3U4HA 4X93A 3TOXA 3ZS9A 1MR3F 2BHSA 1HRDA 2FEPA 4IFTA 6GPBA 3L92A 3E1KA 1S96A 1TM5E 2IHYA 2ZIEA 3EIWA 2YQ4A 2QNRA 1Q0UA 1X0VA 2ERYA 3GVHA 4OB6A 4Q3LA 4G1UC 4YTEA 4ZVSA 4HV4A 4AQYB 4FGWA 3TGPA 3E4DA 5KU7A 4YACA 3VKUA 1FFGA 4JLWA 4A6XA 3PUKA 1ZH8A 5HVNA 2K2QB 2VJYA 4JR1A 4DMFA 3SXUA 4E6PA 2IXEA 2ZAMA 5C7YA 2NGRA 1V1RA 2Q27A 2NYAA 5EIHA 5H0IA 5F4BA 1AKTA 2HGSA 3T7CA 4WJZA 3A37A 4HDNA 4ALNA 4GLOA 5K3FB 3WGNA 4ZZ0A 4PG5A 2ASEA 4RH3A 5FR1A 2ZI4A 1K3UB 1D09A 1LCIA 2X7JA 3RH0A 1DEKA 3RSZA 2FMKA 2FW7A 1KEZA 5DGXA 4B6RA 3OKAA 3NRCA 5CX1A 4OCZA 5FEUA 1XRJA 2GQ0A 1X8LA 3ZQKA 5BW4A 1MG0A 5H9WA 2AFRA 3N8GA 2JS7A 4EUNA 2LBPA 1AXGA 2IXTA 4EKEA 1LBTA 2QXUA 4ISBA 3VNUA 2OFFA 2B8EA 2B0CA 3JQEA 1QYWA 2GK4A 1WVMA 1QVRA 1KERA 3SOZA 1A4RA 1PI3A 3I76A 4KMRA 3KUXA 4WCVA 3RTGA 4L27A 2BVNA 3CPHA 3H17A 1OT3A 2NZUG 3P26A 4LOHA 4LY6A 3TX2A 4MVJM 1COWA 1JEEA 2P6PA 3FUXA 5B6JA 3ELWA 1FYXA 4BTVA 4TX1A 1NGSA 2XDQB 5FADA 3AF4A 1U02A 2A0XA 1GJRA 1RI1A 1EDDA 2PPLA 1CEQA 3JRNA 4RMJA 4ZN6A 4F06A 2E4WA 4BNDA 1H2WA 2OECA 4ARUA 4UAUA 1UEJA 1ZHHA 4AG6A 2IF2A 3ZDCA 1V11B 3TQRA 1NQTA 2C07A 5F2KA 1MT0A 5IVHA 3MTGA 4MV8A 3QMWA 1YCFA 5AKEA 3T7RA 3D3NA 1WB5A 1XRNA 4YJHB 3VNBA 1NT4A 4FDUA 4PRZA 3OMWA 4L78A 6Q21A 2ZETA 1K8YB 1W94A 3KLNA 4WESB 3QLVA 1Z5WA 3RRXA 1D2AA 4YX9A 3UPUA 4HSEA 3NBAA 2GM5A 3AYZB 1M0TA 4TQ9A 1KE2A 1V7ZA 2WP0A 4B7ZA 1BA2A 1U0EA 2XR1A 3PQ6A 4REMA 1IZ8A 5IMBA 4AN0A 2XBUA 1U1IA 4NHOA 2JJYA 1C14A 2ECPA 1UOEA 3HPQA 4UHBA 5I9BA 2J9GA 1JVSA 2EWVA 1J0AA 4WA8A 1OFTA 2YZ7A 5GM1A 4TLBA 1IY9A 3OPNA 1S9DA 1ZXLA 3N2NA 1YS4A 4HQKA 4IL5A 3RDPA 3U3MA 1F0KA 3D4OA 3T9AA 4E1AA 5B1SA 4FOLA 1O95C 2ST1A 1NKSA 1N1DA 1VJCA 1I5EA 3OICA 3A2MA 5KSPA 2XD9A 3O5AA 5EJIA 1DWPA 3BRWA 4TTPA 2GTHA 3LNTA 2FUCA 1J90A 3RBZA 5KTPA 2JEOA 4G1CA 1Y9AA 1WWKA 3NLLA 1TZ2A 2NZ2A 1H1LA 2P9CA 3BD9A 3HNOA 3TBFA 3O8CA 1PNTA 1QUFA 1VG9B 5K0SA 3HCOA 3SZRA 1RLJA 1C3XA 1KYVA 3ANXA 4R5MA 1ZUNB 5CP8A 3O2NA 3RNLA 3WMWA 4P31A 2KPOA 2REBA 5EWJA 3KUCA 1WUKS 4K9OA 2BY4A 2JPDA 4BVFA 4M1OA 5FA8A 1N5JA 2GUGA 2C2GA 3V7FA 4P98A 3R5JA 4UEJA 2KM1A 1IRIA 1TIPA 1W93A 5JOQA 3U4AA 4N7RA 2PYZA 3K0KA 3OZFA 5HQ3B 1RYFA 1ECLA 4XDGA 3TMAA 4F93B 4LAFA 3I9NA 4X54A 1GPJA 1J39A 3V9AA 1V26A 1QAMA 3SYNA 1AQJA 4LF6B 3EN0A 4DQLA 2QSJA 3FPHA 2FXIA 5IKOA 1XVIA 1M1YB 3A2LA 3L01A 2QNIA 1DDGA 1GV1A 1SBHA 4P3PA 1DQYA 3QJ5A 5FPYA 1Y1LA 3WWPA 4EB6B 5AJXA 3PPXA 1OVGA 2J3HA 1OFIA 3DNMA 2EZ9A 6ABPA 1Y1QA 3QJGA 3QHQA 4U9HS 1R0LA 2WWVD 4HZIA 5D1NA 4LXHA 3ZWKA 3TE7A 3ZCQA 5CVDA 4DPKA 3HKBA 1PR1A 1U2ZA 3PA8A 4S0ZA 2RCYA 2ZSFA 5SY4A 4D92A 5B3KA 2ZZKA 1IBSA 3L49A 4P3KA 4FYHA 4G67A 5A9SB 1I1HA 3BXGA 3F96A 3DZBA 3MXOA 4XVRA 4UATA 1G6HA 4ZI7B 2P9FA 2WFLB 2C7GA 1EUCA 1P1KA 2EQ5A 2YRXA 2OAQ1 3H9BA 3WR5A 1H8EA 5I9SA 3G2HA 4JB8A 3HXKA 4D82A 1P75A 3VSCA 4YUZA 4GOXA 2H2DA 3CG0A 4LZAA 3ADOA 4CIWA 3RVJA 2CHVA 3JY6A 4UOQA 4C2BA 4UVEA 1U9CA 1RHJA 2X86A 5FWYA 2WNIA 2YINC 5IJAA 5FQNA 4N4AA 4Q1DA 5B4UA 2W2XA 4LNHA 1ODJA 2ZS9A 3A28A 2X0RA 4JN6B 1M8KA 1OAAA 3EIXA 4QDUA 2VR1A 3HI6A 1VLJA 3MCTA 3VAAA 1L7PA 5FBVB 3QRWA 4IZ6A 2P3OA 4K26A 1NE2A 1XZJA 5K6RA 3H1GA 1ORHA 4EYGA 2OC4A 3N2KB 3P2YA 1GUAA 1KQOA 2J48A 3IQEA 3LPNA 4FFBA 1UPTA 3IILA 3KXIA 3B13B 3UWKA 2X9QA 3INRA 3LA8A 1E79A 4ZJYA 3HADA 4JI6B 1L5FA 2D4HA 3V7WA 5GJVC 3DD1A 3G2IA 3SR4A 3SHVA 3WOHA 1O96B 2WJ4A 3IPXA 3QWBA 3N74A 4UU1A 3FTEA 3HA2A 1V4BA 1DIOB 1U5CA 4OLFA 3GC6A 4O5OA 3EH1A 2D74A 2AD5A 2J4FA 4B75A 3B6EA 3FBGA 1UPCA 1T9GR 4Z53A 2QR5A 2B0JA 4FI3C 4RHFA 4X3OA 1JWAB 5EZ6B 3DZCA 3IMEA 4X9XA 2IBSA 4G0QA 1E5XA 1U98A 4ZP1A 1QYCA 1WUHS 1OGJA 2V9PA 1NJ8A 4NE9A 4YCSA 5T4EA 5LIPA 3E15A 1VPTA 2XUZA 1ZSYA 2X3YA 4DJAA 4ZQBA 4NBKA 1QX3A 4MQ6A 5JXWA 5ELXA 3E5RA 2I4NA 2WYHA 4WACA 3VH1A 3ZHYA 4F1KA 1Y4UA 4YY3B 3A6DA 1AUOA 2P62A 4H7IA 4E2WA 3VXKA 5KNBH 3KHUA 1NURA 1PHPA 2V7QD 4UTVA 4Z4EA 4GMKA 1GNPA 1T5OA 4X1KB 4IIYA 2ID8A 1NMZA 3E7PA 4A91A 4DUZB 1I7PA 2J0UA 4KQXA 2YJ6A 2B6HA 2KSQA 3GFOA 3K6KA 3NTQA 4X1OA 1CRPA 1QHXA 1P1IA 4AKTA 3SEFA 2J1LA 3GRAA 3IBGA 3SDBA 2KB0A 4BVBA 1C8LA 3MJDA 3RSCA 4KYTA 2YJGA 4UM9B 2WU3A 1MO3A 2AOUA 2NVOA 2ONCA 5EWMA 3M6WA 4EGJA 1QOPB 3KOXA 4GZLA 4QM6A 4ARZB 3SK0A 5KTOA 3RS3A 2ZB2A 3I9MA 4GRDA 4L3OA 4JLUA 4ITVA 4KR2A 5EHQA 1K86A 5HR5A 4KH1A 5D85A 5CDUA 4MKXA 2PIDA 1K89A 2VWGA 3U4DA 2H1OA 1EK2A 1JG2A 3QX9A 4C7BA 5JSHA 5LB2A 2EYUA 2IKQA 1NXSA 1U8ZA 1ZN9A 2O2CA 3CUYA 3TRDA 4IQ0A 4AZSA 5A6VA 1QG4A 5AKZA 3DOFA 2WHPB 4EPVA 5AYVA 3R9WA 3FUUA 3AVPA 2NIPA 4OYYA 4LXUA 4YRCA 4D4IA 3NOXA 1Z35A 1OWMA 3ZHOA 4DM7A 5ALUA 1NSTA 5TRTA 2X0KA 3GFRA 3ON5A 3HN6A 4PCLA 3RIEA 4A23A 4FUTA 4FFWA 1ZONA 3A1FA 4I50F 4LYJA 3SU8A 1UK9A 2HSGA 2FPIB 1RWBA 3K1AA 4Q4HA 4DG9A 1E0AA 1KY3A 5FLKA 1Z33A 2IC5A 2UVPB 3CEHA 4ZARA 4ZVOA 1PGPA 5HFJA 3ZXYA 3HXMA 2V7TA 1C9EA 1GZVA 4RANA 1EE9A 2GXQA 3KQHA 2C5SA 1BFKA 2WAYA 2C5LA 1OXKB 1X1CA 1SVWA 1T3TA 2V0CA 1TTHA 3CLRC 5JIBA 1N9GA 1Y8QA 5LD2B 2W9XA 1KZ6A 3EVTA 4MQ5A 2AKEA 4W7SA 3VU1A 1G5FA 3JPWA 3CUWA 5ALSA 3E9QA 4X85A 5TARA 1KVUA 5B58C 3I04M 1FA9A 2I1WA 5DX0A 5CG2A 5KJCA 3TB4A 1PFVA 4DIBA 4HXGA 3MFYA 1Y9JA 2GZDA 2Z4RA 2FE4A 3MGBA 5JDCC 4ENQA 2O2IA 3TSYA 4JD5A 1PTJC 3HKEA 3TWOA 3N6RA 3EEFA 2VZ0A 2P35A 3FNIA 5SZIA 3ZV7A 2OC9A 5A04A 1B00A 2Y9MB 4PR0A 4RK6A 1PJ8A 4AKIA 5UKDA 4CCAA