3C3KA

Crystal structure of an uncharacterized protein from actinobacillus succinogenes
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
272
structure length
267
Chain Sequence
KTGMLLVMVSNIANPFCAAVVKGIEKTAEKNGYRILLCNTESDLARSRSCLTLLSGKMVDGVITMDALSELPELQNIIGAFPWVQCAEYDPLSTVSSVSIDDVAASEYVVDQLVKSGKKRIALINHDLAYQYAQHRESGYLNRLKFHGLDYSRISYAENLDYMAGKLATFSLLKSAVKPDAIFAISDVLAAGAIQALTESGLSIPQDVAVVGFDGVDISQITVPALTTVQQPSEQIGMKAVSLLLEQIHSDVHHLLPWKFVRRQSSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Actinobacillus succinogenes.
rcsb
source organism Actinobacillus succinogenes
molecule tags Isomerase
molecule keywords Alanine racemase
total genus 107
structure length 267
sequence length 272
chains with identical sequence B
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3kA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3kA01
3BRQA 3KCNA 2FTKE 2IOYA 1A04A 4YR7A 3HCWA 1TVMA 2P9HA 3L6UA 3RVKA 1MVOA 3KLNA 4RY8A 2HQRA 3EDCA 1TLFA 2HQBA 5TPZD 5ABPA 5JNVA 4WXMA 3W9SA 4MQFB 2FMKA 4UHKA 1NXWA 1SXGA 1ABEA 3OLXA 5TPWA 3ILYA 3TMYA 3DGFC 2QW1A 5TPZA 3OO1A 1Z2DA 1BAPA 3GBPA 3OLWA 4YP9A 4EGSA 1EWVA 5TE9A 2GBPA 2LPMA 2Q5CA 1NXOA 4HNRA 1ZH4A 2E4UA 1JYFA 5IUNC 1BDJA 3LUDA 1ISRA 3S99A 3H75A 2HQOA 3JS5A 3JTEA 2QVCA 2BGGA 4MAAA 4ZMSA 3K9CA 4D74A 1ZAYA 1C4WA 1TJYA 3NNDA 4TMYA 5GQSA 2WRZA 4H3HB 4L85A 1VPWA 6ABPA 5ED4A 2RJNA 1USGA 3C97A 3E3MA 4Y9TA 3KTOA 5HQJA 2FEPA 5CNJA 4S05A 1FQWA 4WZZA 2N9UA 1ZN2A 3JVIA 3O74A 3N75A 3SM9A 1JDPA 1QO0A 1R8JA 5PNTA 5KI6A 2VK2A 4W5TA 2MYUA 4O1HA 5JNWA 3H5IA 4HYEA 4N76A 4G97A 5KQPA 5TQ2B 3CG4A 4RDCA 1Z16A 1F4VA 3I5AA 3JPWA 2ZAYA 1ZHHA 2CWDA 4RK1A 3VNBA 1JYEA 3G1WA 4H3KB 3DZDA 4MR8A 1LBHA 3RVPA 2CHFA 2F8SA 5TQ0B 1EFAA 2I6FA 3UKJA 3GYBA 5DCLA 4Q6BA 4ZJPA 3KLOA 4IMIB 5IUJC 1YK0A 1Z18A 3F6CA 4RY0A 4G0OA 3TD9A 3KS9A 3TX6A 4TLLB 4W5QA 1NTRA 1HEYA 3CG0A 3LUCA 4JASB 2IPLA 4YWHA 4OLBA 3KSMA 4IGAA 4OLAA 5EWJA 1SXHA 3OM0A 2LIVA 1KMIY 4ZYLA 3HS3A 3M6MD 1EAYA 1TM2A 4JA2A 4M88A 2PE5A 1YTUA 4MQEB 4KPYA 2VUIB 4MLCA 4XARA 1JL3A 5FWXB 1ZGZA 3QLUA 1DBWA 2M1ZA 3T95A 1AB6A 1YVUA 3HVRA 2HJ9A 3Q9SA 4OBBA 2B1JA 3QLTA 3E61A 2X7XA 2CD7A 2FMHA 4IMJB 3IPAA 1JH9A 4PICA 4ETIA 1JBEA 2JK1A 4Z4EA 4RK0A 4WT7A 5BRJA 1QKKA 3EQ2A 1MIHA 5HM6A 2E4ZA 1OXKB 2H0AA 1JHZA 1S8NA 1Z17A 3CZCA 3D02A 3A3KA 3CKMA 3QLVA 1BVHA 1E6MA 1QO0D 3FMVA 2NZUG 3MQ4A 4EY3A 4RKRA 4G0MA 5KWSA 4MS1B 1QQAA 5KQLA 1KRXA 5TQJA 4P1ZA 1DC8A 1ZY2A 2MYNA 4N41A 4KV7A 3I42A 1QPZA 4MQFA 1Z25A 4JP1A 1Z13A 1CHNA 4WXEA 3RQIA 5KQGA 1L5ZA 1T34A 2PLNA 1JDNA 3CZ5A 1ZH2A 2LUOA 4ETMA 4F8JA 2PAFA 4MYRA 3HUUA 5JNUA 3G85A 1ZGGA 3OLVA 2PKXA 2WJAA 2PUDA 2FVYA 1VKRA 1PEYA 2AYZA 4S04A 1UDRA 2WJWA 3A10A 1ZVVA 1CYEA 2ZWMA 1OXBB 3C3KA 3HUTA 1D1QA 5TPWB 5D2CA 3A0RB 3EULA 4NCAA 1CEYA 3H5WA 4GPAA 5F64A 5JNRA 4OG2A 2QSJA 4RXMA 4LDZA 4FE4A 3CU5A 3QEMB 2RGYA 3OMWA 4ML3A 2IYNA 2MSWA 5CNMA 4F12A 4MR9A 1FFSA 2JCGA 2JBAA 3QEMA 4QICA 2FQXA 1BDHA 1MAVA 3LMKA 3F6PA 3IP6A 1JFVA 3OM1A 3TB6A 4NQRA 3F73A 4MS4B 3FFXA 2GKGA 3O2JA 4LZLA 3SG0A 1WETA 4H60A 3GBVA 4W5RA 4OTZA 1PEAA 4ZPJA 1PHRA 4KZKA 4N03A 3O1HB 4XFKA 3H6HA 3QX9A 1Z15A 1GLGA 4YO7A 4LE1A 2JVJA 5CNKA 5HKOA 3N6VA 4RKQA 4MR7A 5IC5A 4QYMA 1QP4A 4JAVC 1A0OA 2E4VA 1LJUA 3SAJA 4EYQA 1DRJA 5DGCA 2LBPA 3I45A 3OQMA 4XAQA 2PL1A 2QVGA 2L17A 4KFCA 3GWGA 4QYWA 5IEBA 4EYGA 5B3JA 4Z4GA 4RV5A 4Z9BA 2A9RA 3SY8A 3B2NA 1EWTA 4DQDA 1I3CA 2RJOA 1USIA 1P2FA 4G0ZA 1GUDA 5EWMA 3T38A 1JF8A 3NNNA 2YHBA 4NCBA 3A0UA 4YGXB 5KC9A 5E3JA 1NXPA 4G0XA 1NXXA 3IPCA 3JY6A 4O5AA 4Q7EA 5IX8A 4KNYA 2MSLA 4KQCA 1U04A 4YCSA 4LE2A 1QP0A 1B00A 2TMYA 3IP7A 4RZSA 4GNRA 3N8IA 4JOQA 2WWVD 4TN5A 4NICA 4RWEA 4KREA 4OATA 1IIBA 1NXTA 4O1IA 4Z4CA 3GT7A 1GUBA 1K68A 3EQZA 4ETNA 1JLKA 4PYRA 4RU1A 2IPAB 3GA5A 1W9HA 2CHEA 2IDMA 4Z4IA 1YK1A 3BILA 3FFWA 2PUFA 3HZHA 3RVOA 3BBLA 3UUGA 4MS1A 2QV0A 2FMFA 1YS7A 1DBPA 1U8TA 2MSKA 3LUKA 3NBMA 2IPNA 4Q6WA 2FSPA 3CS3A 3P9YA 4IRXA 4N0PA 5FWYB 2HSGA 3K4HA 5KC8A 2FEWB 2R48A 1ZDMA 2GWRA 3MM4A 1RXEA 3QLVC 2MYTA 1M5UA 3O2QB 3CRNA 4WUTA 1XWWA 4CBVA 5IUKC 2A9OA 5B3JC 3VNAA 5HSGA 4Z99A 1M2FA 2XDYA 3LKVA 2PUBA 4NV3A 4RSMA 1JFSA 1LK0A 1K66A 1P6QA 2L18A 2FMIA 3N0RA 4PZ0A 3H6GA 1VRVA 3DLHA 4YRZA 1YS6A 3KHTA 2QZJA 3RVLA 1YMUA 3LUFA 4IILA 4D6YA 4YV7A 5JS2A 1Y1LA 3F7NA 4XASA 3CNBA 8ABPA 4MR9B 3LOPA 3Q41A 3BREA 1PUXA 4W5OA 2F8TA 2A9QA 4EVSA 4MLDA 5BRAA 5DLEA 4PE5B 2QR3A 3MIZA 2JRLA 1E2BA 3CLKA 4MS4A 1TMYA 1FFWA 1U2PA 2ID9A 3H5TA 3NHZA 4KMRA 1DG9A 4EVRA 2PMCA 3I09A 1NXVA 4Z4HA 2FLKA 3LFTA 4F3TA 4DADA 3ILHA 2PUGA 1ZITA 3Q7RA 5BQ3A 3SNKA 3QLUC 3RVRA 3M9XA 2GI4A 4MS3A 1XHEA 5BR1A 2GX6A 3OQOA 2OQRA 4MR7B 3C3MA 4WWHA 1MB0A 5C5CA 1E6LA 4EVQA 4MS3B 3HV2A 4HNQA 4W5NA 9ABPA 4PEVA 4N47A 2HPHA 3MF4A 3HM9A 3O21A 3OMXA 1F51E 4Z9AA 3D8UA 3HSYA 4KVFA 4FE7A 1PNRA 1PNTA 1SXIA 4F06A 1Z12A 1ISSA 1M5TA 2V0NA 3C6QA 2R25B 1RNLA 3H1EA 4JB2A 3RVMA 4DN6A 4EUKA 1RZRD 1DCMA 1JX6A 3TO5A 1J56A 1FFGA 3T8YA 3KKEA 3LUHA 2PUEA 3RVNA 3RVJA 3RVQA 4G86A 2A9PA 3NHMA 4RS3A 1A2OA 3O1JC 3O2SB 2QU7A 3H1GA 1BDIA 3O1IC 4RK6A 3UK0A 4UHJA 1D4ZA 1LBIA 1DCKA 2QXYA 1KRWA 4MQEA 2JB9A 3GV0A 2IPMA 3QELA 5JNSA 3HXMA 1D5WA 1DZ3A 1SRRA 2ID7A 3EGCA 3N53A 2JVKA 5FBHA 1GCGA 2W42A 4TLMB 3OLZA 5IULC 4E7OA 3RVSA 4YS6A 2FW0A 2FXIA 3FFTA 4P98A 3OO0A 3M9WA 4YLEA 2MYPA 4LE0A 3EODA 5I4CA 5CHYA 3IDOA 3Q7TA 1DC7A 1VLZA 4LRQA 5DKFA 2E4YA 2NUBA 3H5LA 3HJFA 1Z26A 3LUAA 1DJMA 4E7PA 4XXHA 3T6KA 3KYJB 3OLYA 3OQNA 2AYXA 3CHYA 2M98A 1FSPA 3H1FA 4G0PA 5CNIA 3KYIB 3ROTA 3LTEA 3R0JA 3SQNA 6CHYA 2PL9A 1NY5A 2WY2D 4JB0A 1P6UA 3FDFA 2FLWA 4RK4A 1RZRA 3QX8A 1MB3A 2WMYA 2LP4Y 1SD5A 3NNSA 2NT3A 3QK7A 5JS1A 1QNLA 1U2QA 2H3HA 1BA2A 3JPYA 5FBKA 1DRKA 2J48A 2OENG 3HEBA 4G0YA 1RXIA 3MYYA 1GCAA 3FGZA 3GRCA 2FKAA 4QPJC 2PUCA 4N0QA 2JBAB 4RXTA 2PJUA 3H5OA 4EYKA 5GOTA 5IBQA 4EYOA 3RH0A 2FQYA 1ABFA 1QP7A 2FN9A 4FB4A 3EAFA 2WB4A 4KK4A 4LDAA 4RK5A 3MA0A 2E4XA 1DCFA 1H9CA 1KGSA 2L19A 5TQ2A 5IEJA 3N0XA 1DBQA 3HDVA 1L5YA 2VYCA 1JFTA 4F11A 1RPJA 3Q7SA 5DTEA 2R4QA 4MGEA 5TQ0A 1EHCA 2PUAA 4LX8A 4KK3A 4ZMRA 1NATA 2RDMA 3EJWA 2FQWA 5T3YA 4Z0NA 1URPA 1USKA 3IP5A 3LUGA 3MMNA 3KG2A 1EWKA 1U0SY 3C3WA 4MR8B 3CFYA 3Q15C 1P8AA 3LUJA 3LKBA 5EWMB 3HDGA 3L49A 1LJLA 5EWLA 3URMA 2FN8A 2P4UA 2IKSA 4RK7A 3DGEC 4XLTA 2VUHB 3H5VA 4RY9A 4MRMA 3GL9A 1NXSA 3JVDA 5EWLB 2L2QA 3KJXA 5T7BA 1DP4A 1ZESA 3ROFA 3DLBA 5KQMA 4MRMB 3BRSA 4B09A 1QMPA 4KRFA 5EWJB 1W25A 1E6KA 5C5EA 2R47A 4KQ9A 4RXUA 2B4AA 2FEKA 2KYRA 2DRIA 1YIOA 2YHAA 5FWXA 4D6XA 2NT4A 4G0QA 3QEKA 7ABPA 2JVIA 4IF4A 1AB5A 4L4UA 3QELB 1Z2EA 1XHFA 4MPTA 1JWLA 2O20A 3CTPA 4Z4FA 1QQBA 1YMVA 5JNTA 3N0WA 2NZVG 1APBA 3O75A 3HK2A 5FWYA 1D2AA 2E4WA 3HO1A 1C0EA 3DBIA 1M2EA 1D1PA 3IP9A 4HNSA
chains in the Genus database with same CATH superfamily
1A7JA 3BRQA 3VI3B 4MV8A 5CX4A 2XUGA 3JQEA 3UANA 1GG2A 1OFIA 3T3IA 2YFHA 5CLGA 3C70A 1MVOA 1EXVA 1VJRA 1LUAA 1YKFA 3BHNA 3LX4A 2OGZA 2Q4OA 4QT0A 4B47A 3ZCPA 5NLLA 1QZUA 2X1MA 5BMVA 5JMTA 3CN7A 1M33A 2FMKA 3UV7A 2GTHA 2ZRJA 4D8VA 3DXZA 4BP8A 4N48A 1Q74A 2QPAA 5DCWA 3ILYA 5H80A 3QVSA 2A1IA 4X00A 1Y7HA 2YV2A 3UCXA 2VZ9A 4DJDC 4ADSG 1U2GC 2WMNB 5B3AA 5LIRA 5EPUA 3RG2A 5J5VA 3GGGA 4BVJA 3CSUA 4Y7DA 4WZBA 2PWAA 4MYDA 2IZ7A 3A9TA 3MMSA 2VPTA 3UMVA 2BTOA 3MD0A 4YUAA 2AMFA 1TD9A 3NUZA 4EGFA 1NT4A 1SOAA 1JKXA 1OXSC 4QJIA 5TRTA 4D74A 2GKSA 2W71A 1W7AA 1ZH8A 1XP5A 4JJFA 2IK8A 2O14A 5E7IA 1I7QB 4WNYA 1JHMA 5IS2A 3JQGA 4LK3A 3FYTA 3LIPA 3E3MA 5BMVF 2VF7A 4R83A 1YQTA 5E1OA 3ZZMA 4IIDA 1XTJA 3OURA 1NF2A 4GKJB 2X77A 4A8PA 4CDRA 2A57A 2CK3A 1GYRA 2C4TA 2GVNA 2Q1SA 3V7NA 3IGFA 4HNHA 4Q3EA 1OH5A 4OGLA 5ECYA 1UC5B 1KAEA 4O3MA 3ACBA 3B1YA 1QV9A 3E9RA 3L7AA 3KKZA 2CWDA 4RK1A 3PKJA 4UDYX 4JODA 4UE3S 5JCJD 4HHEA 5LKAA 1JZQA 1YR2A 2OHGA 1M66A 1PF7E 1UMBA 3WHKA 1UWVA 4DM3A 1Z0JA 1KJIA 3MMPA 1RLOA 1R3UA 4YRQA 2OZVA 4RY0A 2N1MA 3QOFA 5DH9A 3UCEA 4BQRA 3CVWA 2OG1A 5EJ9A 3TW8A 2OBXA 1NM5C 1R4MB 2IDJA 3KSRA 4DV2B 4G8DA 3OOWA 3Q3JB 4YB8A 4ZT6A 1VRWA 3I4FA 4I4NA 3KWJA 1GFSA 1C1HA 3LHFA 4K26A 3SYTA 3H2KA 4EGAA 1O0SA 3TEMA 1XTSA 2OGSA 2P5SA 1HG0A 2N47A 2X2FA 2HJHA 2JLZA 2CE2X 2X86A 1GTVA 2XCOA 4XD7A 5NULA 3WHIA 3ZDFA 2C2GA 3PQDA 4GS5A 5AK0A 3HVRA 1DHRA 2WG0A 4OBBA 1REQA 1G3UA 3DBOB 1T36B 3LUPA 2ZB4A 1K4YA 2GZSA 2CD7A 3WKCA 2J3KA 1JXOA 2O8VA 2W4MA 3GFTA 2ZP1A 3NTOA 4J43A 4IWNA 4PICA 3KOYA 4Q47A 4E1BA 1TT7A 5BRJA 1DHTA 1E7QA 4TQUS 3X1KA 2CF5A 1OXKB 2CUNA 2GM9A 1TK2A 1TMOA 3CXUA 2I2AA 3K9WA 4M8NE 3ZCSA 5KX5F 4Z86A 4ND4A 1PJBA 1T3ZA 4HH4A 4C6TA 1RQRA 2JZCA 4LHZA 5DFAA 3ZLUA 1JJIA 1YZNA 3LNTA 2D2FA 3UJDA 3AB3A 3DYBA 2FPWA 3MWYW 3QPDA 4BMNA 2CC2A 2NU8A 4EHLA 3MB8A 3I42A 4DUYB 3PXGA 1NI4A 2JKVA 4MPDA 3A3NA 3ZGXA 3DHNA 4GQBA 3RBAA 1AHNA 1B0PA 1OH6A 1OX5A 2H1IA 2JIZD 3DPUA 4HYYA 3VJKA 1TCCA 4OV6B 3AVYA 2WTNA 1RWWA 1LW7A 3V1UA 4BBJA 4FZ5A 2VLIA 4ON9A 1YL5A 4Y2TA 2QBYB 1Z3CA 2JIRA 5KKCA 4KRYA 1WQ3A 3HUTA 4WLEA 4D46A 1WVIA 2B1IA 1CBUA 2YWJA 2QBYA 3O4GA 3A25A 1QU2A 3KKMA 3KNZA 3P5BA 3TOVA 1DXQA 2AMJA 3B3GA 4WEQA 2VJQA 1NSYA 1NI5A 4FPXA 4KO3S 1P9RA 3IJ5A 3E4DA 1I3NA 5K01A 2I9PA 1R6XA 2JLQA 1Q6ZA 2R66A 1G1MA 1OZ0A 4QNRA 4MJ7A 4ZALA 1BQ3A 1IC6A 3UWDA 2QVLA 4BLWA 1VA4A 3I83A 1EXDA 2CVOA 2F9MA 5AKZA 1V3QE 4ZARA 3S2EA 3OFNA 5IXJA 4NQRA 1SXQA 1J0CA 1GY8A 3GW8A 4HDMA 1LDMA 3R76A 4HJRA 2CFRA 1E9VA 3PXEA 2GEFA 3LT1A 1T0BA 3QXGA 3OZFA 3ZD9A 1I9CA 1A7UA 2OFWA 1FIUA 3K8ZA 1LPBB 4YDRA 4WZAB 3OKFA 4JJKA 2BKXA 3FWKA 3WQSB 1R8YA 3JAWB 2VUSA 3OBBA 3GWZA 4IJ6A 2VAVA 4DUPA 5GZ1A 4CF4A 1UMDA 4MW1A 4YFVA 4F8EA 4ZGGA 2ZI4A 4NBSA 3V2UA 3GLIB 4JUAA 1WCXA 2B4YA 2OUKA 2RBGA 3PD0A 4WKOA 3QY9A 1EM8B 1N2CA 3HWX1 4OOFA 2QQ0A 2HRZA 2OCIA 3Q7PA 1FNSA 4QYWA 1DFIA 4YWJA 4D4GA 1UDCA 4Y3UA 4Q39A 5B3JA 1F20A 1MDBA 1QXSA 2UUOA 2ZS7A 3ZDRA 4U7GA 4TPKA 9MHTA 1GUDA 3AG6A 3F47A 5KDLA 4MI3A 3QFTA 2VYND 3H86A 4G5YA 5LZ4A 1IJFA 3SVLA 1JAHA 3LBHA 3WMFA 4KLNA 2WVGA 4AG6A 3D6MA 2TECE 4UNSA 3AEXA 3QKTA 1KEEA 4FE3A 2X5OA 1CERA 1JQBA 3ND9A 4UZSA 4MV0A 3C7TA 1XV5A 2Z98A 1NZJA 3QEAZ 3ZGZA 1ZRNA 3PC3A 3KEFA 4QQFA 4TV9A 4TSRA 1DO0A 1UK9A 1VPLA 2YX1A 1ODCA 4IHQA 3L4BA 3WHLA 3VVLA 3HYTA 1E2NA 2HMVA 1UBNA 4M1ZA 4MVJI 4KSCA 3TWOA 2DQYA 5C52B 2EHDA 2HLDD 2CL0X 2XZTA 3CT6A 3TF5A 3R3XA 3D3JA 2X0DA 1GV1A 4B35A 2WWFA 4MWBA 1RRCA 1U28C 2H4WA 3A4YA 1THGA 2FLVA 5EFZA 4JI0B 3ZVRA 1Y1TA 3VR6H 1SH7A 4RPGA 2CJWB 2HHHB 3EF0A 1M83A 1PK8A 3O26A 2BFPA 3EZNA 4JWKA 4EO4A 4YRSA 4P22A 5L3SA 3ETHA 4O4JF 1Q0PA 4N0PA 5FNZA 4I3HA 2XITA 1JIIA 2AFVA 2Q4EA 1KSHA 1QONA 3L05A 5FBRB 5TEVA 2LW7A 4C3ZA 3U1BA 5CFZA 3HDQA 3L7CA 4I50A 2VT7A 1JHAA 3O5AA 1FU7A 2IS4A 1CIJA 1SULA 3D4OA 1RXEA 4FJ2A 2R8ZA 2MYTA 1M5UA 1TL7C 3QLVC 1W4LA 4L95C 5HIAA 2CDRA 2NSDA 1Q77A 1QAMA 4LRWA 1BO6A 4QC2A 5HTKA 5IJAA 4RSMA 4GW3A 4NAUA 1VHQA 3PGLA 2XTZA 1OI7A 3AY7A 2HRQA 2P2YA 3Q1LA 5EKXA 5CB4B 5F1KA 1U6JA 1RVV1 1XRQA 5K8TA 3AI3A 4ZCQA 1NQ5A 3FCAA 1RXVA 3AF5A 1T9ZA 5F35A 4E21A 4P53A 1ZM4A 2YUTA 4QU0A 4XASA 1AA9A 4CIWA 3D4NA 3H0EA 1Y33E 2B34A 2ESRA 1S3FA 2VXOA 3GN1A 3M2PA 2W58A 3Q9UA 4KQJA 7MHTA 2YWEA 3TR5A 3SLGA 4TMKA 2WV9A 2VRCA 4RKFA 1Z9BA 3O9ZA 1IN5A 1Q0SA 1ZM7A 1QGED 3DDSA 1O94A 5CVJA 5FTNA 2KS6A 4MXDA 1BEZA 1FEZA 2JHCA 4ALJA 3F5FA 4JLDA 4M1OA 4HNGA 1GADO 2EQAA 4AKSA 3GRFA 4RPJA 4EJSA 3FSJX 5EZ6B 3S1SA 3BWDD 4QRDA 3SNKA 4V3CA 3VH3A 3ZU6A 1NBMA 2FX5A 4DT1B 4FHFA 2AJBA 5KKNB 2CXQA 1M1UA 2GX6A 3D8SA 3LVQE 4O2BF 5ETJA 1ULSA 1AV7A 4UEWA 5EKDA 2A88A 3LS2A 3VZCA 3SVTA 2ZZNA 1T8RA 5FO1A 3NFRA 2ETXA 5KNCH 4RMJA 1N77A 4NJMB 3VJRA 1TX4B 2QSYA 2YRXA 2YXDA 2RAVA 2WUDA 3F1KA 4AMYA 4WOJA 5FD8A 1FTGA 4QU8A 1YR8A 3NCTA 3WYEA 1YBFA 2FN7A 3VZPA 1RI5A 5CD1A 3PDWA 2CYCA 3ZVNA 3PITA 4CQLA 3RVMA 3VU9B 4LOKA 2D62A 4DN6A 1RC1A 4CNBA 4CDGA 4TTJA 5JH7F 4EQ6B 3DQPA 1ONNA 1JKMA 4I5FA 1YZ3A 5HK9A 1PFQA 1UOOA 2IUEA 3UA4A 3W77A 1D7OA 4PCLA 4B6RA 2PUEA 3AP1A 2HRCA 2WNHA 3OD5A 4KI7A 3TLEA 3DE4X 4UCWA 3BE4A 4OGWA 2A9PA 4HXGA 4OLJA 4EZIA 5AW0A 2QU7A 1EVKA 4G3XA 1RYYA 1FLDA 1UCFA 5D8DA 4AWBA 2PZ8A 3CMMA 4AWAA 1WULS 3WAJA 3U44A 2QQGA 4KI0A 1GLNA 4KIWA 1SOVA 5G40A 3ZW8A 4NHOA 3HXMA 4Q3BA 2Z5GA 2LKCA 1G7SA 2Z09A 4JLNA 4JP8A 5BMOA 5C1OA 2NO1A 1BXZA 3GAAA 3FYHA 1FE8A 2O0JA 3PGVA 4Q0MA 4Q1VA 5ER9A 2YBDA 1G2QA 5DWQA 4J49A 5JSKA 5IJ0B 1OFVA 2HWXA 4MITA 4EHIA 1ZSVA 5FOSA 1JAZA 4HWSA 3R4CA 5CFQA 3VNSA 4YPFA 1V1MB 5I4CA 5FA5A 5M34A 3GF4A 5AHXA 5FADA 3WYCA 4QLBA 4NG4A 4RTJA 3FKSD 1OXXK 1GA1A 1MHPA 2JGLA 4FYHA 3G0OA 1QZ3A 3GMIA 1RI2A 2ZUWA 4J4TA 1V1MA 2BR3A 3I3SR 2AV6A 1ADBA 4BKRA 4BB5A 5IT4A 4DB4A 2BM8A 2C3YA 1MA3A 2Q5LA 2IW3A 5CH8A 3I4CA 5LDGA 4I81A 2XZOA 1KERA 1A97A 2VDLB 4WNIA 2OBYA 3OHSX 2BEVB 3AR8A 4FC7A 4G0PA 4XLZA 2O8DB 2E48A 1YDFA 1MP0A 1V1RA 2IYFA 3BWCA 2WYOA 5KX5A 2ZRIA 3R0JA 2WY2D 4O2RA 3LXXA 3HB0A 1UH5A 2WJHA 2O1EA 5JO9A 3MJTA 1SQ0A 1U3CA 2DFVA 1JHDA 3GD7A 4E5UA 4CEIA 1W4ZA 1TZMA 1HRDA 3A9SA 3QG1A 4BB6A 1FPQA 4WZAE 1DBIA 4L5AA 4NULA 1IUNA 1YBMA 1YFZA 2QDKA 2IEBA 1P2VA 1M34E 1DFHA 2CMKA 1X8LA 1QK4A 3OZSA 3W8EA 2NV2B 3N5KA 5F9HA 3GLGE 2FR8C 4GLLA 2GN4A 4UHBA 1NYRA 5DYWA 1E9AA 3WRYA 1AMOA 3T94A 4AS1A 1DJLA 3WR5A 2PN1A 3ETJA 4BFSA 3COYA 3V4ZA 2VJNA 4C03A 4DR4B 4YMGA 4GRDA 1ZC4A 2AXPA 3S4YA 5JAUA 3QKRB 2CLKB 2IDZA 3I9NA 4ISBA 5BN3A 3TPZA 4OJQA 1KP3A 4FX2A 1T25A 3JAWA 3NBXX 1N7JA 2GN0A 4AJ4A 5ALSA 3N86A 3UTDA 5LSAA 3U7IA 4KBFA 3ZWYA 3C3BA 3AL0C 2QP3A 3S44A 4DG5A 4X94A 3D7MA 5D3ZA 4C3OB 2BC9A 5CW2A 1NDQA 1XLWA 1EVQA 3K0HA 4HLDA 4IYJA 4POOA 3QOYA 1NATA 4MCHA 2BGKA 2I3BA 4KQGA 1H5NA 3QUCA 3RSZA 1EWKA 4WUVA 2P9GA 2OVBA 4G1EB 2GXQA 4MZXA 4D4HA 1RE1A 4A2CA 2RGWA 2F48A 2JD2A 2HW8A 2AMLA 1GQRA 1WMEA 2G67A 4D0NA 2WD7A 4M54A 2QAGB 5F7OA 5IBRA 3R5XA 4LUCA 3JVDA 2O3UA 5AW9A 4QFCA 3A4VA 3SFTA 3R24A 3ZLJA 3EG9A 4A10A 3GRRA 1DPFA 3E3AA 2C1EA 4JU8A 1G5QA 3FZGA 3NAZA 1QU3A 3Q2KA 2QEQA 2XGSA 1DIOB 3G17A 4HZIA 5EVCA 4N54A 1JT2A 5ECDA 2ZXUA 3QVUA 1L4GA 2MWMA 4E70A 2FJPA 4HH3C 1YCGA 4G5OA 4UASA 4ZAVA 2GLUA 5A71A 4NE2A 4PANA 4DMGA 2REBA 1NC1A 3AZQA 4CRWB 3FHTA 1J09A 3EUWA 1NMEA 2CNKA 2O3QA 3AC0A 1KQ3A 3E03A 3QELB 2PLRA 1R8SA 2LIPA 3C5CA 4HB4A 5G53C 5J2UB 5LBUA 3IHLA 3TZKA 3FAKA 5AM0A 5LQAA 2WW8A 5DYYA 1KY2A 1XWIA 1FJHA 2PGLA 5EIXA 5HP4A 3CV3A 2YV1A 1DTEA 1P1BA 1TA0A 2M6SA 4E03A 2JATA 2YDYA 2Z3ZA 4N3AA 1TVMA 2GRAA 3C74A 3DBVO 5EE3A 2VRBA 1Z08A 2EZTA 2WNSA 1NVEA 2I6SA 4JENA 4G2TA 2ZTSA 5HZGA 4HO1X 1QKJA 3NANA 3MOSA 2ZIAA 1E3QA 1DI0A 1EFHA 1OWLA 1II0A 3DMFA 5ABPA 1PTJC 2AEEA 1HKUA 4JSRA 2YQ4A 2RB5A 3P9CA 4LZJA 4CIAA 1HLFA 3K4PA 4PQFA 4JGGA 3AFGA 1HDEA 2HDOA 2QYSA 4Q9KA 3GDFA 2CLEB 2P30A 4GNKA 3IV7A 4DLPA 1FFEA 3M83A 1DINA 3DHEA 1PWYE 1QRRA 1E89A 1NSTA 4NYIQ 4D9FA 1JXQA 4ZI5A 1ZH4A 2E4UA 1T5BA 4XUCA 1T5TA 2FX2A 3KUUA 4XJVA 4D9EA 3LUDA 4HMPA 4A3SA 2FMXA 3H75A 2G6BA 4B2PA 3RV4A 4RVHA 3ZGVA 3QA9A 3KR9A 4IEFB 1EG7A 4M0EA 3UUEA 2WKRA 1PTKA 2GBIA 2SKDA 3ROMA 1YJBA 2I1WA 3SOPA 1F1JA 3QKSB 4JBNA 4D2IA 1JSCA 4LOIA 3HTXA 1H4VB 1M8PA 1E66A 4H3HB 2GYUA 3ZHSA 2ZJAA 3DTNA 6ABPA 1EP1B 2ZRKA 5JZMA 1E0JA 2HRRA 1B8OA 1VKZA 3AIKA 1DQYA 3NIGB 4HEA6 1GZSA 3PNQA 1V43A 1VPEA 3PB3A 4QUAA 5D3MA 4GMFA 5AUQA 2NTNA 4P81A 5AQEA 5MDHA 2EYQA 3O74A 4M1TA 3SD7A 1DKUA 4KQMA 3FOFC 1RQNA 3OJ0A 3DKKA 1PQUA 1MB2A 2YYAA 1RR6A 4N76A 3DZCA 1MTZA 2HD4A 2I8AA 2BRUC 1X8KA 3KT0A 3VR4D 2D4HA 3G1WA 3WGQA 3PLAE 1E3MA 2OP0A 3E3LA 3D64A 1COWD 3ZBQA 5B4TA 1R9NA 3RIHA 1U0JA 3UKJA 3KT3A 3GLGA 5DCLA 2AEMA 5ULLA 3MJRA 1YZYA 2AB0A 1B93A 2H4XA 2RI1A 4FYXA 1YCFA 2X8LA 3B82A 1TAGA 4YONB 5TS2A 3NTVA 2R2AA 1U7ZA 1KJYA 3I30X 1H94A 1UBOS 1X80A 1D04A 1P1FA 1T8UA 2X5NA 2FWAA 2NG1A 4QVGA 3T99A 3IAS1 3CE9A 3CZ9A 2H16A 1KMMA 4RF3A 4WLOA 1W52X 3KQVA 2PNJA 3BKWA 3UM9A 4ZYLA 1W47A 2XA2A 1VGVA 2VXYA 4D8WA 5JVDF 4JA2A 4RMHA 4O0LA 1TVCA 2X2EA 3BH0A 2PE5A 1F1BA 2ZRDA 3KDSE 1JL3A 1L0BA 1GZ4A 3GJXC 4DLWA 3CUYA 2HJ9A 4JIMA 3E58A 4UNNA 2B1JA 2OORA 2WKPA 3IHKA 2QN6A 4MZDA 4Y9UA 5J2UA 3N6RA 3V2HA 4X62B 5FR2A 3D1LA 4X65B 3I72A 1FVFA 1MUUA 3FTCA 4YAWA 4ZQIA 1D4AA 3PHBE 4M2LA 2P79A 4NFSA 1BE0A 5EOVA 1VLVA 3U09A 4I2VA 4PRYA 3O7WA 5EZYA 4DSOA 5I6DA 5D87A 3AF0A 3RU3A 1A2BA 2FPPA 4H2DA 5H3LA 3I0ZA 3R0QA 1TI7A 3WJ7A 1GKUB 4NOKA 4EY3A 2HSZA 2CVQA 4CGYA 2DBZA 4FR0A 1H4QA 1CZRA 1ZAYA 1NX9A 4ZO6A 5LQSA 5KQLA 1ZY2A 3HB7A 2CFSA 3L0OA 4QATA 3OEWA 4GZ6A 4N41A 2FK8A 3W3AD 1A27A 3NEAA 2MR5A 3G0GA 4IJKA 2I99A 1BQ4A 5KQGA 1L5ZA 5AP9A 3GGJA 3IUYA 3A1NA 4Z6KA 2G36A 2E1PA 1XQXA 2C3OA 4OXIA 1S2LA 1W59A 5KVCA 2WJAA 2YJZA 2FVYA 1VKRA 4HDRB 1GPNA 2CBZA 1SCUA 1XPOA 3A10A 3OTHA 1U0EA 1E79D 2QLMA 3NP9A 2EFHB 4H59A 4OJKA 3A0RB 4KQEA 3UK7A 5HR5A 4IQGA 1CUFA 5K05A 4BNFA 5TDHA 3U2QA 2X2OA 4NCAA 5JNLA 5CA0B 2VDWB 4KXNA 5B6JA 1ZA2A 4KWTA 4FNGA 3OMWA 4BEJA 1C9NA 3CGGA 3U62A 2VA8A 2CXHA 2WHXA 4M87A 5CP8A 5BWNA 1RLUA 1GCUA 1ECPA 3K1AB 3IB3A 4PO3X 2RGUA 1UC4B 4C2AA 5K0EA 1CF4A 3G68A 1LZKA 3UCFA 5HFJA 1M6NA 2GAIA 4G01B 1P2BA 4PAOA 3EY9A 2E21A 2Y2UA 1N75A 1OW3B 2B1RA 4NZYA 2EGUA 5FOXA 4HWPA 1EK1A 1SKYE 3DQQA 3MS7A 2WBLC 3N39C 3JD4A 1JNYA 4LYAA 3O1HB 4C30A 4KH1A 1YOBA 4JUFA 3H6HA 2VTBA 1XZIA 1ZNWA 1YBVA 4Q3OA 5TMBA 4L50A 5DHSA 3FDZA 2WYVA 3IUPA 4QRIA 5JVDB 1W75A 3W4IA 4BJ5A 5CCXA 2WB2A 2V7EA 4ZCPA 2C7QA 2X4LA 3AM3A 5DGCA 1DG1G 5K3BA 4BNLA 3M0EA 1VJ0A 2CFOA 5F98A 2BKLA 2YQZA 1O57A 5CDFA 3RHSA 4N18A 3WGUA 1RAHA 4KFCA 1WMDA 4G4GA 5IEBA 3PIIA 4EK9A 1BU8A 1SQGA 4RS4A 2PZFA 4CG0A 3PNLA 3ULKA 1KHHA 4G84A 1FU8A 2IFTA 5FPQA 1KDRA 3QVTA 4U2KA 2XT9A 4LOHA 3KOUA 3MWFA 1BWRA 3WRYC 4CM4A 3EEOA 4C7VA 5AHWA 1H1LA 3ZDZB 5A2GA 4R84A 1Q17A 5AVUA 4AY2A 1X87A 2VNSA 2Q5JA 2Y6VA 1NV8A 2QZZA 3K1JA 1CSEE 3ESAA 4ZOAA 1JIJA 1JI3A 1XC7A 2XIJA 5F12A 3S2YA 4YCSA 2TMYA 3I04A 1SO8A 4HT3B 5M04A 5J1SB 4DARA 3KAJA 3GR6A 3PHHA 1ZUWA 421PA 4NENA 1WDLA 1DS6A 4UATA 3L04A 1WXWA 2GS9A 4OJMX 4YXWD 1G6KA 4LY0A 1IIBA 3SYMA 3ZHXA 1O03A 1NW9B 1REQB 2ZYTX 2O05A 2JK0A 2PKEA 1R0BA 4PZZA 1W85B 3W5HA 2VPZA 3F1LA 4DAOA 2C98A 1MH1A 4OI2A 2XA9A 2GK3A 2PVPA 3HNRA 3OZTA 4PYRA 3PVCA 3EAQA 1SXJE 4RKEA 3AILA 3GEEA 4P93A 2Q50A 5LQCA 5DM4A 1GP2A 1JEAA 3FM9A 2MSKA 5F2OA 4D3YA 5HKOA 2PVCA 4CT5A 4MP3A 4F96A 5F1PA 4TTVA 3A32A 4C6TB 1G19A 2HMWA 4Q3LA 3LPDA 2R48A 4M9RA 2WQZA 2OR3A 4MIYA 2C2HA 3BCUA 3CSSA 3GA7A 3C7AA 4B6OA 3WKEA 3EWAA 5I9MA 5EJAA 1RMYA 2Y1FA 4FDUA 5IUKC 4YRLA 4EB3A 1Y5MA 2I66A 3WGLA 4TZKA 4DLXA 4B83A 1JB9A 4J7AA 5BOSB 3CJQA 3PBKA 1FNBA 4KYUA 2PCJA 1I14A 1XF9A 2J33A 4H31A 1YS6A 3ZBUA 3DLHA 3B20A 3LHKA 2DEUA 5JAPA 2PBRA 3LUFA 3WBFA 3TTYA 1Y1LA 3M70A 3WNVA 3RADC 3K0EA 1RKXA 3F7NA 1C29B 4RCVA 3A37A 3ADKA 3UFXB 4XWTA 1FTSA 2JRCA 5C53B 1F2UB 4GL4A 1FTNA 4K6GA 1NMSA 2Z2KA 3IULA 2V54A 3OM9A 2QTTA 4XX0B 5KSZA 3MIZA 1N2SA 3BH7A 2IH4A 4BQEA 2WFLB 3OAAA 4LWPA 1ZUD1 1FFWA 2ZOSA 4I0WB 4JYPA 4OHWA 4Q9AA 4EVRA 4A8JB 2D59A 3GGSA 5ICSA 3BCHA 4TVBA 1PV4A 1UBMS 2O2HA 3ILHA 1VB3A 4PLVA 5DRTA 1PV1A 5GJBA 1OU0A 1Z6YA 3MB5A 5KYUB 2OK7A 2P6PA 2XBUA 1PYGA 4I1OA 4HMQA 4AS2A 2B99A 3F7TA 3OPNA 5BR1A 3OQOA 5TY0A 1QH8B 1UOQA 3EOBI 4MR7B 5DTJA 4DA0A 4R2XA 4TKUB 3Q8XB 2JF0A 2BSAA 4WCFA 4E0BA 5IK2A 5BYJA 1R4AA 3VOAA 1E1LA 2XTJA 4UDXX 4KMOA 5ERXA 4EABA 4JI7B 3GLTA 3Q9NA 1M8KA 4IXNA 4OCZA 4P34A 1UMCB 3EUFA 5CA1F 2FRDA 1VSVA 1Q19A 2VDRB 3I58A 4K2HA 3TFWA 1Z2AA 2H8GA 5FH9A 5ILOA 1D1TA 1UMCA 2RGBA 1G8MA 1M6VA 3DMTA 3H04A 4IEEA 2RHMA 3M5WA 3WGZA 5IWCA 1M5TA 1UDWA 4GKKB 5D85A 3U5TA 2D3WA 3PU6A 3A1DA 3EXG2 3LPLA 1MO3A 1UBLS 4GEKA 4PLZA 5JH7B 1EUYA 2GZDA 4JB8A 1QZZA 3N7AA 5EJMA 2ZYWX 3PQ3A 1M2KA 4RYLA 3CVXA 4C7MA 3CLTD 4IOLA 2BFFB 2IRWA 3LL7A 4PZLA 4ER3A 3ECCA 3R5FA 2EFCB 1YDEA 5J43A 1DCKA 1AS0A 2DUNA 3HFJA 2ZULA 2DPGA 3TM4A 4HDCA 2IPMA 3OOJA 2G9NA 1B16A 4AYXA 5HKKD 9LDBA 2H0RA 1Q7TA 3PZBA 2XWPA 3N53A 3N5CA 2OHVA 4D5GA 2D0PB 2JGIA 3N2LA 4NJOA 4OMUA 3U4HA 2DH5A 7GPBA 3JYPA 1PFUA 5ALYA 4BKMA 1BHO1 5JPCA 2PIDA 4YS6A 1P0FA 2C7OA 1Q5PA 5A3RA 3K1ZA 3QFFA 2Y6UA 4I19A 2BL4A 2PUHA 2EKPA 1W44A 3RT7A 1JHPA 3IDOA 3SI7A 4NCNA 1X9HA 2KSQA 1SM4A 3PWZA 3VC7A 3ZK9A 4AJKA 2HNBA 1EWQA 1P7ZA 3HBNA 1MPTA 2BI4A 2ZRCA 1FUYB 2UUPA 5ICFA 3DKVA 2VDNB 3E5NA 5J2UF 4M36A 1HLDA 1RXYA 3OZEA 4X97A 4ZQCB 1QLHA 3PEWA 2P9QA 4DIOA 2ZT6A 4C4PA 3VDRA 1IIRA 2ZRBA 3LXUX 2V98A 3K53A 3QW4B 4L9SA 2FGKA 1E1MA 4C0BA 1OKKA 3C43A 4O8ZA 1IQRA 3S3TA 2AC7A 1UM8A 1YR1A 2QN3A 1JECA 3FNBA 3FLMA 3KEGA 3KQYA 4LBZA 4Q03A 3RK0A 1HMYA 4PWYA 3M1IA 3PYLA 1ZJJA 3IERA 2WMYA 1NVUQ 2BFDA 1HYGA 2POCA 2YCBA 4QPCA 3UTCA 1T3HA 3AUAA 3BN3A 5AW2A 5DNCA 1Y4DE 2YTZA 1Q83A 2WHEA 4MYUA 1CTQA 4Q1BA 4HV4A 5BV0A 1BS2A 4N1AA 1G59A 4TUYB 3SBXA 5KYGA 4QNMA 4B6JA 2GM4A 4B3RB 4Y2UA 4P4SA 1ZIDA 5BNFA 1VI2A 2QLNA 3PC2A 5KTSA 4JR2A 1K6MA 1M2NA 3HBAA 2CXTA 3VZRA 4JBHA 1D4OA 4AJHA 1QGDA 3J81k 1RAFA 2J9XB 3HACA 2VZLA 1HURA 3NM5A 1Q7EA 1T29A 1KJQA 1FTQA 5TJHA 3RPEA 3G3EA 1QRSA 3ZQJA 2IZ5A 4QWMA 1B2LA 2X5XA 4QIHA 2ZJFA 1DCFA 3V4LA 3O73A 5U4QA 1XMXA 1SBNE 5AOBA 4JCOA 1KBZA 4ENTA 2V58A 4N7RA 1K4KA 1SFRA 1X2EA 3L8YA 4CLOA 3FF4A 4F21A 3PDIA 2OO3A 3I1JA 1FK8A 1MRSA 4HRVA 4HWOA 2GD0A 4Y2YA 3RS4A 3EJWA 3UVEA 2XRYA 4IF6A 4TWRA 4CKEA 5REQB 2Q62A 3M6AA 1PWEA 3KU4A 2ZRQA 4DLZA 2PZAA 4UFNA 4WK4B 1FP4B 1P1CA 2C77A 2DYKA 3FW1A 4M0PA 4E09A 3Q8KA 3DNFA 1VJCA 1W0KA 2CLFB 2TSYB 3VPGA 1BOOA 2GR9A 4UTNA 2CLLB 2EX1A 1NXSA 2ZWOA 4GMDA 4OFXA 1NVGA 1FXWA 2C9CA 3KJXA 1YRQA 3IVRA 3BTSA 4IDOA 5AW5A 1FS4A 2H48A 1Z83A 1A9ZA 1EQAA 3UO8B 1P75A 1J49A 2PJZA 3L93A 4UU1A 4XQ0A 3ZWVA 1E6KA 1L4UA 4A4DA 4WBNB 3GLUA 1OBHA 1W48A 3L43A 4BGVA 1A69A 1E9CA 5FNVA 4NOJA 1H23A 1SWVA 3CKYA 1W73A 2WP0A 4M89A 3ASUA 1HLGA 2HDWA 1TRHA 4XDGA 3CKLA 3Q88A 4F8YA 3U44B 1GR0A 4ZJYA 1X7YB 1JR4A 2RC5A 5BN4A 1QOZA 3WP1B 1WB5A 4LZWA 1OHHD 5E9WA 3CYFA 4L51A 4GI7A 2CL6X 4H0CA 1NYLA 4K3UA 4NCJA 3W1EA 4Z4FA 2X2PA 2P2SA 3RAPR 3QM1A 1XZAA 2PDAA 1IL0A 5DHAA 3KSAC 3LP6A 3QV2A 5AK4A 3T9FA 5EEGA 3TGLA 1WXHA 1FQJA 2ZE8A 1IG3A 3K0CA 5DX1A 2NSHA 3D3EA 1VZ2A 4O25A 1ZC3A 1J2JA 4EKNB 4RIHA 2BJWA 4PFJA 2OZKA 2FYTA 5C8DA 2FPIA 4DCVA 5B7GA 1N2HA 3MUEA 4RFLA 1CDOA 4JEIA 2M2IA 4GP7A 1UKVY 2I4TA 4HGQA 4PSCA 5L4SA 4J0EA 3M9LA 3DPSA 1N2IA 3DTYA 4PSAA 3HP4A 3GQBA 4ZZIA 3BAFA 1KFJB 1WOYA 1C50A 2GYWA 1WX1A 4J1SA 1ABEA 3TRHA 5JSQA 4G23A 3DOUA 2FG6C 3HI6A 2IE0A 4OHKA 1QR2A 4YUVA 1SD2A 3O92A 2COKA 5LDDC 3RBVA 4EGSA 2VBIA 3LG2A 4IKEA 5EMMA 4ZT3A 4D8XA 4QKQA 1UBGA 2O6LA 3R3UA 4PX3A 2O2IA 2QVZX 5AD1A 1E3DA 3VVCA 1OC2A 2ZWIA 1R9MA 1FX0A 2YJNA 2YWCA 3JS5A 3EZFA 5L7YA 2EDCA 1OT3A 3J7AC 3P4YA 4YHBA 1I51A 4GO1A 4DMFA 4KN9S 3ADBA 3K9CA 1T4MA 3D8RA 3SEZA 2XBLA 3K7EA 1G63A 1F0PA 1M0SA 2P67A 2XHZA 1XPUA 2E18A 2JC3A 3WISA 4AJOA 2FFHA 2VS1A 3O47A 4Y9TA 3ZCVA 2EZ8A 3FTNA 3OPQA 2CCJA 3IILA 1AUPA 4MB2A 4P3PA 3O4JA 1Y7TA 2FZ4A 3C3YA 1D3AA 2WZDA 1G17A 3CF0A 4BBZA 5FHRA 1JI0A 2YY7A 3A4LA 2ADMA 3OCCA 4XZ3A 5PNTA 1USWA 4O1HA 1Q57A 4B43A 4YP0A 4ZGWA 1AC5A 2BHTA 2PX8A 4MTCA 4JBWA 5TF0A 1KYXA 3ZQUA 3KQTA 1W19A 3E7PA 5F78A 4OXNA 2AVNA 2NW6A 1EFAA 1I7PA 1S2NA 3CRMA 3PS9A 4HPWA 1JQJC 2BSXA 4NPAA 1XVIA 3T3DA 1VKHA 2J6CA 4RY2A 5KHAA 3EOAI 4OKSA 2IYAA 3KPYA 1JJ7A 1IJEA 3OIVA 3K0FA 5KTTA 5G0VA 3EXHC 1M5RA 3W6PA 2R5FA 5J4HA 4MKHA 2WSIA 6YASA 1K3TA 2G0TA 3ZU2A 1F14A 4D8YA 4LSWA 1ZNZA 3CLSC 1I30A 1P2DA 3OM0A 3A9RA 3HRHA 1U90A 3NO4A 1NW4A 2D1QA 2RHJA 1YAJA 3A11A 4YRIA 1E7YA 3UAGA 3ILSA 1Q1GA 3VR3D 3WZMA 2REQB 4MQEB 2A58A 4LCJA 4MROA 5A3JA 4RX1A 4HDNA 5GZ3A 2W6PA 3HYCA 4KE9A 1Z0UA 5AKHA 3EC7A 4UM9D 4KTVE 3OFKA 1R9GA 5IC4A 3FPHA 3IAHA 5JJKA 3V4PB 4YCAA 5SYMA 3I5XA 4AY6A 1KU0A 5MFPA 4CQNA 2FMHA 2ZAGA 1VXOA 3TVTA 1JBEA 1WEKA 1E5LA 3TLGB 1IB6A 2I7TA 1QKKA 2AHOA 2OBMA 1ZYUA 2XOXA 3EQ2A 4R0VA 3RTGA 3VV3A 5CB8A 5J5CA 3GK3A 3GX1A 3B6EA 3H9GA 3DPIA 1XCOA 3RRMA 1TAUA 4FHCA 4BJHB 1NUTA 3DP9A 1TU0A 3SXUA 1VCIA 3GEHA 3ZV5A 3ELDA 3ID6C 2QN9A 3LWNA 3MHTA 1X7DA 2PTHA 5AOVA 3ELUA 1TYCA 2QAIA 2QAGC 3PNOA 3EGEA 1MHTA 4D9KA 2MHCA 4GKAA 5CPBA 3TZEA 3ZIAD 2DFPA 1Z2NX 2XB4A 1KBOA 1QQTA 2GPSA 4KYTA 4V0OA 5C18A 2ODNA 4HGZA 5A05A 3WMRA 2BBWA 4WKGA 1XU9A 2NQTA 2P11A 3PXXA 4FHDA 4FLEA 3SC2B 1SR8A 2C1ZA 4CMAA 1HT2E 2HTEA 1JFFA 4NFHA 3JYHA 3JWGA 3PQ5A 4ZJUA 2VCEA 2H1FA 4NDNE 5FAXA 4RVUA 2AYZA 2XMQA 1OXBB 1I3MA 2QY6A 3FYCA 2Z8ZA 2AR0A 3GLHB 4RVCA 1SG9A 2Q3MA 3V8RA 3UK2A 1SCUB 3OTIA 1CEYA 3HMQA 2VNHA 2Z9CA 4H3SA 4P8RA 3PGA1 3H9QA 3DLCA 2JHFA 4MV6A 1DOZA 2R00A 3SZRA 1CUEA 2E6UX 5J4LA 5INTA 4MJXA 3PRHA 1MB9A 1ISHA 1FFSA 3DUFB 1Y34E 1OB2A 2Q1WA 3M5PA 4UUQA 4B4DA 1BDHA 2R62A 2NVWA 2GOYA 4QJ3A 3VDXA 4W7IA 1OPXA 2WVJA 4BCCA 4YQEA 3CLUD 1WKVA 2FSSA 3AIIA 2HUPA 1SUAA 3MUOA 4GGMX 4GM1A 4MRRA 3SG0A 4PAMA 3KYDA 5CA1B 1I0ZA 2C4UA 3SIXA 3IAM1 5AMXA 1OI4A 1QVRA 3QP9A 4IDQA 2B3TA 2FE4A 4KLRA 5COQA 3QQ5A 2X9QA 2JH8A 1IDOA 5I3ZA 2QTBA 3CONA 5EI5A 3U3KA 4L5BA 3AY0A 3GUCA 3SAJA 2XMBA 3SCZA 3WS7A 1F9EA 1DRJA 4ZAFA 2PT6A 5B36A 1G3MA 5JD5A 1Z4JA 1SG6A 2AE1A 4JOCA 2XMZA 3OQMA 2RK3A 2EP8A 1WDWB 1WUKS 3N8NA 5LQRA 2FMTA 4EYGA 3ANTA 2JI4A 1UDXA 4IX1A 4MLZA 5K0JA 2Q6VA 1J8DA 2HU7A 4JVSB 1VKOA 2J4CA 2RJOA 4EB8A 4B81A 4DJ5X 4N39A 3EXFA 3EXHA 1SPBS 2Y67A 3V1KA 4F3YA 3H16A 1LSUA 1ZLXA 3JR3A 3VPBA 1QDUA 1MMFB 2MSNA 2PX6A 4M53A 1CNFA 1JHXA 1NXPA 2FFQA 4TZ6A 1FZQA 1C7RA 4JYZA 4D97A 4BXOA 4AZ3B 2EG5A 2HF8A 2ORIA 5BN5B 3V34A 2F4VB 1O87A 1E63A 1KS2A 1T9KA 5ICMA 2WR8A 2XAUA 3BQNB 2WSYB 3TIFA 1QORA 5B6PA 2BMJA 1J20A 1B0ZA 1F38A 2A3RA 1YQ9A 4MKZA 1XMPA 3EUEA 4ALNA 4JOQA 2QQ5A 3GCWA 3MXOA 4E12A 5JV5A 1OIXA 4DSAA 4F56A 5C7OO 1E0SA 1K68A 2CHUA 1Y63A 1T5HX 5KAPA 3ZWNA 4PG4A 1FRFS 3D3KA 4TKVA 5IRCD 3FYSA 3MSXA 1NF8A 4YMHA 1A8HA 3IV9A 3UT0A 2E6KA 2J5QA 5IM4F 3FVVA 2FPLA 1LVGA 2GESA 2O8NA 4IS2A 4OP3A 3ABIA 4QDJA 4AK9A 4EA8A 3URKA 3BIOA 2HSGA 1HFKA 2PZGA 2BN4A 2YMLA 3IPLA 5A5EA 3JAKB 4F4IA 3U5ZB 1UBHS 1JEJA 2DSTA 4N0DA 5EIHA 2BEKA 2ZVQX 1FVXA 1W5SA 2O2XA 4HGYA 1H2WA 2PM8A 1CNMA 3PXUA 1YTUA 1OAAA 5HCNA 3BL5A 5K6RA 2EZ4A 1PR9A 4ND6A 1JFSA 2EDAA 3S2GA 3EEIA 1JILA 2JCBA 3O0TA 3P8ZA 3T06B 4K40A 3H4VA 4CTMA 4IY1A 4Q9NA 3LU1A 4MVJF 2WG1A 1B1CA 2YHIA 3COPA 3H8WA 3TGWA 4BV8A 4OFZA 1FFBA 5JJ5A 5KVSA 2VQEB 1ZR2A 5JCJA 3A6PC 4RA9B 5C7YA 2JASA 1A9RA 3AIOA 3NAQA 3NXKA 3PUYA 1S3SA 2WMDA 4MLDA 1R66A 4REQA 5E4TA 3UT5A 3ORFA 4PE5B 4C06A 5J58A 5EXDA 1RI1A 3QBTA 4FGLA 4LA4A 2JRLA 4MEBA 4DWOA 5L53A 2B0JA 2O2YA 4FCCA 4ENPA 5A1JA 4QFDA 3AUFA 5DN6D 1XFAA 2WNIA 2HK8A 5BR8B 1AH2A 5TX7A 4MULA 1TA4A 4R01A 4J7XA 2O8FB 1VJ5A 1VBFA 4NLLA 2GB4A 1L2TA 5I01A 2PUGA 3FMIA 3WL8A 1QHGA 2B5VA 3INRA 2Q5IA 3DBLB 2FG5A 3NR2A 3QLUC 3RYFA 1FDIA 4KSYA 4GPTA 4Z49A 1NP3A 2ZU6A 3TTVA 2WP8J 4MVJA 2HO5A 3OCJA 5H0IA 1LLQA 5C5CA 4TS3A 1SKUA 3LOQA 2NUAB 4B76A 1EDOA 4FDLA 1OASA 1LPNA 5E9JA 3FOEC 3HM9A 1K7XB 3OIFA 2HHAA 4CHGA 4WCVA 3IODA 4NYIR 4OPMA 3NEYA 3EGOA 4QXOA 1MAWA 5JZSA 3ITDA 3RUAA 3NHPA 2YR0A 4JCCA 5DLDA 2J8ZA 1CRLA 4K9MA 2GD2A 3QSYA 4QD3A 2VP0A 4EAQA 1FQOA 1E0KA 1Z7BA 5LMCA 1Z39A 3LRXA 1ORHA 1E18A 2GCNA 3AZOA 4FGZA 5F51A 3LGAA 3HDJA 5B6IA 3K0SA 4CKBB 1J56A 1TKBA 3I1FA 4NABA 3EGWA 4YJ3A 4UXIA 4YJGB 5I9LA 3CUUA 1C8VB 1G4UR 2G9VA 2NTVA 3BIXA 4Z2AA 5ITZB 3HL4A 3LLVA 5E6UB 3VVMA 3WLJA 3FOZA 4Q4LA 5JEDA 1YI1A 2ZU0C 3MPUA 3IR5A 5H8WA 3O1IC 3B60A 3DMGA 3TR0A 4Z54A 1LEHA 3HWWA 4AYTA 3S1AB 5E0KB 1GG8A 5K3CA 3A70A 7REQA 1QX4A 4XFJA 4EHAA 1EK6A 1NU6A 3NBFA 5AVYA 3OQVA 4M1SA 2BKUA 2HWKA 3CR3C 4LMPA 3T61A 4DIBA 1GCGA 4M8KA 2AQHA 4OLFA 4E07A 5LD2C 4C14A 3FOCA 1IULA 1V5WA 2IYXA 3I76A 4FI3C 4JT2A 4OHVA 4WOBA 4WLVA 3A6KA 3U6KA 5EPOA 5TMDA 1CJUC 3CUSA 1UODA 3UENA 2DKFA 2ZSKA 4IDPA 4NYMR 4JVMA 3WK7A 1GR1A 5FORA 4Z3OA 3REOA 1DADA 3IDSA 1R0KA 1W9MA 3OQPA 1INLA 4RPKA 5KAMA 4OHOA 3T12A 1O6CA 3V1LA 1AE1A 2C8LA 4PHTA 5AI6A 4N7BA 4RMGA 5B4VA 4E7PA 2A9KA 2Z8YA 1Q7CA 3OI7A 4KGVA 4CCAA 3B5JA 1Q0LA 4JQYA 3A2KA 4B9EA 2QG9A 4IOJA 1ZK4A 1SXJD 2BEUB 1XTIA 1QUEA 1LU9A 3DOIA 1FA9A 3BXOA 4JN6B 2ZB8A 3LQKA 5CD9A 5B1DA 5K03A 4GLJA 2B5WA 4RORA 4E94A 4IJWA 2X4GA 4KKVA 2JGDB 3JQAD 4RFSB 3IO5A 4MNTA 2L69A 2ZTLA 5ANRB 2R7MA 2R86A 3FETA 4EG6A 4ENSA 3M34A 1E1KA 4R7ZA 2JCSA 3QWFA 4MGHA 2O9JA 2DHCA 2EARA 3CUVA 3ENQA 4G37A 1EBUA 1N6KA 3LD9A 1H85A 3EWIA 5FOWA 3UB4A 4EF6A 3AR4A 3MYYA 2XBMA 3OZDA 2FWNA 2HLPA 2Z1NA 5LQUA 1NN1A 2YFQA 1TQHA 1SC6A 2A1UB 2VTEA 3OJXA 2CK3D 2I0FA 2YXPX 1AF7A 2PJUA 3V3TA 4L0CA 3PNSA 2Q49A 4QG7A 4DWVA 4HNAA 3P2YA 4PAGA 5AKGA 1JU3A 5A03A 4FN5A 1QP7A 1LVUA 3RBXA 3UC9A 1EGMB 1IAVA 5SZIA 2FJ0A 1CJBA 5ALDA 2WJ4A 3HU1A 3UK6A 1NTOA 2OM6A 4XUEA 3FGNA 3HEMA 1NN0A 5SY4A 5EQTA 5KYUA 1NDUA 5IN5A 4BMCA 1N0VC 3DLPX 1I4EB 5TQ2A 1DQSA 4US0R 4ECAA 821PA 3BE5A 4Q9LA 1RPJA 3D6VA 2QYHA 4ER5A 4CEHB 1IU9A 2GN2A 1Z6GA 3FCUB 4I36A 4NFLA 5THXA 3G7NA 1PFYA 4GP9A 4RLFA 3SEAA 4B3FX 2V74B 4YJKA 4LX8A 1UEXC 2B1GA 1ZUIA 3LE8A 4CBVA 4S1TA 2V7VA 3IKTA 1SBIA 2BMEA 1E7WA 3PDUA 3L8EA 1LQUA 2P90A 4MW7A 3Q15C 1ODIA 4YMWA 1MR3F 2ZJBA 3PEFA 5FPSA 2JFNA 1L4YA 3QTTA 4LXUA 1C1DA 2XCQA 4KFSA 1ZOSA 3HCPA 1RYBA 4MUHA 3BUSA 4XLTA 3VC3A 3FTEA 4JQCA 2A2ZA 5G0UA 1C7JA 5LZ7A 1Z0IA 2JFFA 2ZYVX 1E9FA 3OFVA 1HY3A 2I7XA 2IYSA 2R1UA 2V6IA 3HG7A 3ETEA 3D5TA 3W3AA 2GPAA 4I5GA 5A6VA 3OIYA 3C39A 4A6EA 4NFYA 1R0RE 4V0NA 5B2ZA 4UTPA 2EOAA 3DCJA 2VJBA 3DT9A 4G8BA 1O95C 3MLAA 2GHIA 1PVOA 3T0FA 3Q4GA 4G2NA 2RCYA 5IPFA 1NASA 3KIPA 2I2CA 1UMKA 2ONCA 2E82A 1W4BA 3K09A 2R1TA 4BO7A 4XEHA 2X0NA 1AKVA 2FFJA 3O93A 4OB6A 4PIMA 1OV6A 2VQ6A 3KFVA 4OB8A 3TZCA 1C9YA 1K8QA 2PX5A 3C3JA 3PF9A 2D1RA 4G5HA 1PSWA 3DAPA 1ML4A 4G1VA 4MHOA 4B84A 5AVRA 2QIPA 3E5RA 1G1AA 5FI0B 3N2GB 5D1NA 5H81A 4EI9A 4ZT4A 1XZNA 2QTHA 3HP1A 3KCNA 2ZRFA 4FZVA 4YMTA 3FTFA 4TWAA 2OV8A 4BDTA 2ZIZA 4MYSA 3M6FA 2B8JA 3ENVA 1RWBA 3H1BA 4PIVA 3FYDA 4NCXA 1ZD4A 4PG5A 4ZPXA 4ARSA 5BMVB 5KU7A 5JXJA 1Y3FE 3S40A 1QTIA 2FWRA 3F67A 3GG2A 3W9SA 4AKTA 5CB0A 1RQ2A 1WXDA 1J24A 3EPJA 1FFYA 3GDHA 3NS7A 3ZDBA 3IE0A 4YRCA 4YXWA 1QYCA 4AD8A 1NFFA 5CFOA 4GBMA 3KU1A 3LSYA 3IOBA 4Q3AA 2EBHX 3HYSA 1N5DA 1UBRS 1XTQA 5LUBA 2FEOA 1KR2A 1ZI6A 1M2OA 3C6KA 3FZQA 3G88A 2ADFA 3OESA 3WB1A 1OTXA 3D6UA 4IDBA 4DB2A 1DX9A 3LY7A 1A9XB 4TXHA 3TN7A 3MAJA 3DCYA 4LMRA 4C0QC 1F3OA 1NWCA 2C2BA 4KH0A 4YDHB 4LS3A 4CM7A 2O06A 1B76A 2VJOA 3GCDA 2A0WA 2X0JA 3EGIA 1QQ7A 1N2EA 1UEJA 4JLKA 4KQ1A 5CX1A 4DC1A 1VPDA 1VMEA 2CFTA 4PV7A 4W1RA 5JSZB 3ORSA 1U0TA 4FM9A 5BORA 2KPOA 3Q72A 5K8CA 2W00A 4RPIA 1ILEA 1U0FA 1WD7A 4N6GA 3SJCA 3H65A 5CCBA 3OZ7A 1GQSA 1LI7A 2JCYA 2ORYA 1T3GA 2VBCA 4LDJA 5CNJA 1W29A 4HDMB 3HH8A 5AHRA 2ZREA 1OOEA 2QTVB 4AKEA 1V25A 5KTNA 5KU1A 3A36A 1XQ1A 4CVNA 4ACAA 1Y37A 3B8HA 3T3EA 2G1UA 1ONSA 4RZ2A 5ERYA 1CZLA 5KI6A 1EMDA 1RAGA 1Y5IA 4Q01A 4HYEA 4FFLA 2UUAB 3CUTA 2W90A 2EC5A 3D6HA 4RDCA 1FPMA 2QTLA 3TNJA 3PHLA 4GECA 4JJAA 1QLWA 2GXSA 3EJ6A 2AVDA 3J81A 4H3KB 3F98A 2WYHA 1ST3A 3E2PA 4F4JA 1PCXA 4ZIRA 4HUTA 5FOTA 1AHIA 4UVGA 3W5DA 3D7LA 4Y2JA 3LM8A 3GZNB 2ORVA 4R81A 1YK0A 2X7HA 1QYXA 1BCSA 4G1CA 3TX6A 4CFZA 5MHTA 5ALJA 1HEYA 4I9HA 1KTIA 1NC3A 2AKAB 2B4TO 3DEHA 3K0KA 4MYCA 3U9SA 3NOQA 3Q8LA 2J09A 3PA8A 5EWJA 2NWQA 3W9BA 3QXHA 3O94A 5T3UA 1L7AA 4WNAB 1U80A 4CG3A 1UPTA 3EEBA 1IVNA 3M6MD 5IM4A 3WE7A 2RHHA 4CM9D 1M6EX 1A9TA 5FWXB 1XN4A 3UC5A 3W4JA 2XUJA 2C4WA 3ZXYA 4QYIB 4QUKA 3T95A 3EZLA 1GGNA 2XF2A 3CUWA 3R6DA 3WBBA 1AJEA 4PR0A 1ECCA 1CU1A 4U1RA 5U4XA 3SE7A 2ONZA 4YPVA 5BPHA 5G0TA 1IEQA 4BUCA 1CR6A 1P61B 4LF8B 4J0JA 1LVHA 4YT4A 1WHSA 3GLFA 4Q37A 4I4TA 3QUQA 2WK1A 2QM7A 4FYWA 2C5LA 2B83A 1V7CA 4DBLC 3VX4A 3C5HA 4C4RA 3MTGA 4HLQB 3N7TA 3W2HA 1JG6A 2XDQA 5DI3B 2WAXA 2Q8PA 1AKEA 2JEOA 3C3PA 2B6NA 3H99A 2XQKA 1L7QA 1T1GA 1NM5A 2D2VA 5ELLA 4DYHA 3N2IA 3W5JA 2YOGA 2OEPA 4PLHA 4LBWA 4ZEWA 5KQSA 1L5KA 4L3WA 4CKCA 3L8MA 2BUCA 4KLCA 2JAHA 1NNEA 4MUKA 5FPTA 4BEVA 4TV8B 1Z25A 4W7HA 4I4CA 2D2IA 3AHIA 3RQIA 2Z08A 5HFNA 1JW9B 1FMTA 4EEXA 4URZR 3Q3EA 1W36D 2A4KA 3I2YX 4MYRA 3HUUA 5JAQA 3WYFA 4JI4B 4C04A 1BQEA 3CNLA 3BWYA 4LF7B 4MUBA 2EBFX 2NO6A 3OF5A 4M99A 4Q02A 3AWIA 4LV6A 5ERGB 5A9TA 4C7OB 1SXJB 1QGOA 1BMDA 3MFYA 4Y9RA 2QORA 4M4SA 1XZKA 4JHLA 4IVQA 4PPFA 3VHXA 5BWBA 3RW9A 4K8RB 3ZJYA 5DGHA 5F3WB 1VKNA 4LXIA 4EW6A 1EIZA 3L6RA 1T2VA 3CCCA 5CNMA 5FUBA 1E8DA 2F1IA 5LN1A 3RYCB 1P3DA 4LF9B 4KXVA 2WFAA 3WP0A 2DERA 1NBMD 2JPDA 1GSOA 2JGFA 4QPDA 3DAGA 5DIFA 5CMLA 1PG5A 4GPBA 2CFCA 4HAYA 2VOEA 4KJZA 2GKGA 3RHZA 1Q11A 1KDZA 3WHPA 1DO8A 5YASA 5FPYA 2VHEA 1RQ7A 1WL8A 4WFJA 1G8JA 2C03A 2BLLA 1EDBA 5JIBA 1HX7A 1GQFA 1X1RA 2XRMA 1YL6A 2ATVA 4LHSA 5KOJA 1O6GA 4KZKA 3DWFA 2HN9A 3HN6A 2P8SA 3LQYA 3PRJA 3PDIB 3LYAA 3WADA 1ZQ9A 2F43B 3ZHTA 1F48A 1NNLA 3OICA 1JR3D 2FFBA 4IXWA 2XMSA 2FPUA 4N6OA 3RRFA 2E4VA 3GFSA 5DYTA 2PZEA 3GEMA 2H00A 2I33A 2CXSA 4JI5B 2WU1A 3E7FA 2PL1A 3NT2A 3UMMA 2UYHA 2QMOA 2OMKA 2OHOA 3NOXA 3TMAA 3WFIA 1TU4A 2C99A 1PR3A 2F9FA 2I8LA 3SY8A 3WAGA 4W8HA 4LCEA 1P2FA 3P0HA 4MMXB 2ECPA 2YHBA 3LFHA 3QPCA 2AWOA 4X7MA 1WU7A 3WKAA 2YVUA 3D31A 2O1XA 4KPGA 4PQRA 3RQSA 3RU7A 4PG8A 3BA6A 4RSGA 4RULA 2B3DA 1G5HA 4KPUB 4TQAA 4XD2A 1MQSA 3INYA 1II8A 5KPDA 3DMPA 5K6AA 4RZSA 2A0YA 2BY4A 4MQLA 1L5NA 5KJ1A 1E5DA 4XB6B 3OHMA 5FNVB 1AK9A 1KPIA 4HLCA 5CPFA 3JASA 3Q7EA 3AERB 2P40A 1EFRA 4QDZA 2VDVE 4X5OA 1AV6A 3DE1X 1JLKA 1DGQA 3L5OA 3GA5A 3CSDA 1Z62A 5CVUA 3RB8A 5E8RA 4C1BA 4EP1A 3AUJB 3NCHA 3B3JA 4PPYA 1FYFA 2GM3A 3D3NA 4KCGA 1JEQB 5AVTA 2FMFA 3BHIA 1B0UA 4UOEA 5IF3A 1V45E 2B98A 4MUNA 3DEYX 5EKUA 4ZCSA 2C1XA 1GZHB 3QPBA 1CXZA 1HQDA 3K4HA 3COVA 4X7RA 4V39A 2CL5A 2VF5X 5LMZA 1GKIA 1EVEA 2X8JA 3FNHA 3CRNA 5DT2A 2V9CA 3FGPA 1GAQA 1X9IA 1PLKA 2EIXA 2OV4A 1P6QA 4EKIA 2IIPA 2KM1A 1ESEA 2H1SA 2QMYA 2CW5A 4EZBA 5JSHA 2Z3VA 2CL7X 3CF4G 1P39A 1XNJA 3WRXA 1BH6A 4DQUA 2OBFA 5A4DA 4JKOA 2FSHA 4XJTA 5JXWA 4LNAA 4UUNA 5E95A 4LXYA 5BSTA 4DM4A 5IHPA 4KKXB 4ZAGA 2UVPB 1N1DA 1AY0A 1BN6A 1FDVA 1QE5A 3R41A 3EB9A 4D5EA 4CEHA 3T9BA 5B1EA 5ALIA 3Q41A 1PWZA 1ONBA 2BZ0A 2H29A 2W48A 3BREA 3BGVA 3FLBA 4JK3A 5DJ5A 4DCJA 2F8TA 5BRAA 2QNRA 2V9ZA 4FJ0A 5KINB 1IATA 1N9GA 2FWJA 3CNEA 5TARA 4TQGA 1GTG1 4KQIA 3LVBA 3PC8A 1N8KA 5A3SA 1TJPB 3PIRA 4LV8B 3EFOA 2Z95A 3STWA 4RPCA 1ES9A 1BD3A 4IRMA 2YYYA 2A33A 1KWGA 2F3UA 4UMEA 4L9WA 4RPLA 3ZE2B 2V9PA 1U7DA 3TTTA 3GNTA 4MDYA 1LI4A 4P82A 2NZYA 5AVXA 2GZHA 5AJTA 2ZR8A 2C2YA 5EJ4A 2WQ7A 1RWNA 1T9AA 1V47A 5D7NA 2QLTA 4RA6B 2OK8A 1ENPA 4LHVA 1FDSA 1FNNA 4MCAA 2HPHA 3DXYA 2OYSA 2V7BA 5EUQB 4DCOA 3LBYA 3IEXA 3NM4A 3HR4A 1U8XX 2ERXA 2RE8A 1C0IA 2Q41A 4Q4HB 4D8TA 1ZISA 4FGJA 3KT6A 1PW7A 4I55B 4BQIA 3PYXA 1CC1S 2IZOA 3Q2OA 4JQZA 1WTAA 4O33A 3UIEA 4EPYA 3H2SA 2RG7A 2J0UA 2V97A 3EIUA 4GOND 3TW8B 3L6DA 3VSAA 4BTVA 1XQ9A 2DCMA 3PJRA 1SXIA 4S2UA 4Y0VA 4E2WA 1NNI1 1PD0A 4K6KA 3WQRA 1V16B 2HBZA 1ULBA 2R25B 5BRNA 1K9SA 1DSSG 2GJKA 2IEAA 4J0IA 4JB2A 5EE9A 2GPJA 2Y1DA 3RYHA 1X13A 3I73A 2WT4A 2EP5A 4D80A 3SQDA 3RD5A 3WLSA 4M1YA 5DM0A 1SHJA 4TZTA 4B4WA 4CNQA 4DNOA 3RVJA 3VZQA 3TZQA 5FKJA 3N8KA 1FFHA 4Q82A 1RWMA 2V7TA 1XLTC 4GXTA 1ECBA 1BDIA 5FOVA 2WV7A 1Q12A 4CMEA 3MMZA 3ERCA 3GLFB 3WTCA 1W4AA 2NPOA 3GV0A 3FPSA 4G5FA 2H57A 4H15A 3RHFA 2ODQA 4AF7A 2GZRA 2ZCUA 4M0FA 2UUBB 2QN2A 4J3JA 3VR5D 3KDAA 4B9AA 1EDDA 5FBHA 4BNHA 4YCCA 4LRUA 7REQB 2O3TA 4BDSA 1EP9A 5BVGA 1Z0FA 3EGXA 4BMXA 5FTJA 3DULA 4YQZA 5FYQA 4E7OA 4Z9XA 4N82A 4XW2A 3GOQA 3RC3A 3WIEA 1U11A 3NW9A 1IXKA 4DG9A 4DCMA 4WZ6A 2KW5A 1KZ9A 2OG2A 4YBRA 4CM1A 2VF2A 3TBHA 5EIOA 3WB9A 1DC7A 1YGYA 2EL7A 3RC8A 1H3EA 4YRBA 2ZR7A 3NVAA 3SXPA 1OJLA 1ZMBA 3ZW7A 3H5LA 4AXBA 4PYOA 1MJGM 1H5UA 3VHLB 4BEBA 4HUQB 3K2QA 4B48A 3HU5A 1QANA 4HQLA 1HLPA 2PXCA 3PI7A 4PC3A 3DFFA 1KJJA 3C6BA 1Q22A 2ZE6A 4IV0A 1EFKA 2OQIA 3FWPA 1TK3A 1ZCZA 4WJKB 5IARA 3DM5A 1N6OA 1B6RA 1UT5A 2WIDA 4QE3A 3D8HA 4RD4A 4LFBB 1SD5A 3AJRA 4K1XA 3CF2A 1E99A 2DBVO 1NP7A 1E9BA 1JJBA 1GU0A 1UT6A 1VJGA 2I78A 2O7QA 4B6SA 3WA7A 3EVFA 1JA0A 4BMDA 3O91A 4KZPA 3LCVB 3IAUA 4FOLA 2X9LA 2YIMA 2WF7A 5CA0A 2QZ4A 3G9TA 5ENDA 2OENG 1MVLA 3AETA 4ZVNA 1GCAA 1J9ZA 1QYDA 2GEJA 1J6UA 4OU4A 5D5PA 5GONB 3TKAA 3ZHOA 4BP9A 3AHGA 1NUPA 3FJOA 3EYAA 3JTMA 3Q5GA 4FCTA 4KIJA 4N0QA 1ZIYA 1Y8AA 2D3TA 4RXTA 1K27A 4ZVPA 5GOTA 3ZE9A 4EYKA 3AEUA 2IXFA 3FPGA 1CZOA 3UWPA 3SS9X 4TL9A 2B9VA 3DA8A 4RJLA 2B8WA 3LTNC 3HFRA 1DDGA 3WMEA 5JANA 1TW3A 3AYZB 3IUBA 3DH0A 4E88A 5FCDA 3BIFA 1QQ5A 4LK2A 3IV6A 5TQ0A 2YMPA 3B6JA 1RJWA 1UZAA 4NV0A 4OHUA 3DC2A 1NQVA 1XCGB 3HI4A 3R5HA 1ND5A 2AOWA 2XX3A 2G7MC 1RTKA 2VHXA 1LDEA 3JALB 3NHUA 1TQ4A 4R31A 2XT6A 1NPTO 4BQFA 3E8XA 1QTNA 3I92A 3HN2A 4PXAA 5LBIA 3I32A 3DNPA 1V6SA 3EF3A 3WWOA 3ZHZA 1NW8A 1GUZA 2FN8A 2FP4A 4L6IA 1A5BB 1NX6A 2IGBA 2AD1A 1FMLA 2YIDA 3FTQA 4O0MA 4YX9A 1V5GA 3TLZA 3BRWA 2B37A 1XCLA 1ZESA 2WD7B 2XB9A 4LC9A 2P68A 4TSFA 4OX9Y 3L8DA 1B23P 5F1OA 3VZSA 3KTDA 5H9WA 1KTVA 1S1CA 1EB8A 3M6LA 3BK7A 2QE7A 3AHJA 4PR3A 4RJJA 4BVKA 1R18A 1H0SA 5EE1A 1AO0A 4U2CA 4ZVSA 1NJGA 3OE4A 1OAOA 3HKEA 1WKBA 2DRIA 2CZGA 4TL8A 2YYSA 3QBJA 3DEAA 3JQBC 1N0WA 3IQFA 2LCQA 1CR4A 3DOJA 1C2YA 4R1TA 2CVPA 1WQ4A 3L5KA 4MW4A 5BNTA 2W2XA 3BRCA 1G2IA 3CTPA 1A72A 1EUZA 1X6VA 4HB0A 2G80A 2JD0A 2I55A 4X8MA 3M4NA 5LYYA 3U3JA 5ENVA 3WGMA 5ALOA 3HXPA 2N3ZA 2HU8A 2CBGA 3ESQA 3C5EA 4J3NA 3WG9A 4CM6A 1PK9A 1ZWKA 4NR0A 4P4TA 4WX2B 1MDFA 1UBUS 3Q3CA 3QXXA 4KVZA 3WYNA 2RK4A 5CXUA 2BE7A 1KK2A 2QSZA 2O7RA 4IGEA 2GETA 2WSMA 5H59A 3SKVA 2HJWA 5LR6A 4GG1A 5FAKA 2GPWA 3DVRX 3FN4A 5AXAA 4G5QA 4EHNA 1GAJA 3V6LA 5IBCA 2QGZA 3PR3A 4OHXA 4GLBA 5JEEA 1T6NA 3I2HA 3OLXA 2GTPA 3HN7A 1E4EA 1PV2A 3E7DA 1YZGA 1H8HA 1W0JD 1HE1C 3LC2O 2P6RA 4HLNA 1IN8A 5IH3A 4OGGA 5TE9A 2GBPA 1Y9EA 2LGJA 4ROSA 2H7CA 4KBGA 3FSGD 4I4LA 3DWEX 5AXBA 1GSIA 4B2IA 3JQRA 4L6AA 5DXAA 3SHWA 5KPJA 2WDPA 5M5BA 1UK7A 4URFA 5THKA 4CM8A 1CRWG 2A59A 1BE1A 1R10A 1UZLA 2FQ1A 2FHPA 4O6VA 4OBEA 2GXAA 3K72B 4EO7A 1LFAA 4XUDA 4FFDA 2XGGA 5L7TA 4AZ0A 4P4GA 4FW8A 4BL5A 5CVVA 5ESXA 3ZUGA 4C08A 2VJYA 1ICEA 4L28A 3P2OA 1P7PA 1X8XA 4P7JA 1DX4A 5DASA 3O8DA 4ZDKA 4CMEC 2O8BA 1YO6A 1DELA 2C3MA 3SF8B 4N9QA 4S05A 2IS6A 3D9QX 3C6XA 3DVAA 4H1VA 3CA8A 4LYJA 2DHEA 1LK7A 1E2QA 3BFJA 3SF8A 1BHJA 2J9GA 4MV3A 5JSYA 3KD3A 3N0TA 2K7FA 2QMHA 3ZI4A 3AR7A 3MWKA 5AW6A 2KMLA 4OH7A 1U8YA 2NUAA 5SZJA 3D2LA 3N6XA 3RVPA 2IHZA 1BMQA 4FR2A 4UM9B 2V4MA 4Z0TA 4AZWA 1Z6ZA 2D2EA 5JFTA 3E2IA 1Z4NA 5IP5A 3KLOA 2J46A 3KYCA 1KXZA 3LBFA 4P4LA 4K81B 2OXEA 4IW3B 1WM1A 2IPLA 1TM1E 3C3DA 3G2KA 3KVRA 5IAGA 4BCDA 4DMLA 4I7EA 4GE0A 4IFEA 5B64A 4H1UA 4IVRA 5FUMA 1JU4A 1KMIY 1JV2B 3QRWA 1E1CA 4PG6A 3O4RA 1PVDA 1J8VA 5EMLA 2QL7A 1K6IA 3WLLA 4CM4B 1KOLA 1ZH0A 5B1IA 3A6JA 4GWLA 4KPYA 2AZXA 3KRTA 1IXSB 2E49A 2XZPA 3MRTA 3R3ZA 1ZGZA 4HB3A 4QGSA 5TC4A 5L3ZA 3DQZA 4BGUA 2M1ZA 2DFLA 5AM2A 1YJ8A 1QFZA 2O4CA 2VT2A 3WXBA 1NOJA 3Q0TA 1U9IC 2A0FA 2A0UA 3AF2A 4HS9A 4RK0A 2BHRA 1I7SB 1D2GA 3IFSA 3RKSA 3RWOA 3S7TA 4BVBA 4DANA 3ZD7A 2E4ZA 1T0PA 1QGYA 4WEOA 4R2LA 2NMVA 3N28A 1TCAA 3VTKA 1N6IA 5JMPA 4OHPA 2BFCB 3I6IA 4C0HA 3MQ4A 2SCUA 5AOCA 3JZFA 5AM3A 2QHXA 4FBGA 4N8EA 3HVKA 1UBKS 1XBTA 2PH3A 1GUYA 2M6KA 2DWCA 3CN9A 1IJKA 2J32A 3INTA 2I3AA 3OOHA 2YZ7A 3B6IA 3OTWA 2O0MA 1PQYA 4Y2XA 1OLSB 3CLTC 3H2JA 3LY9A 4AM8A 4RVDA 4D99A 1PZEA 4JWTA 4BQQA 2P7IA 3DD1A 3PUKA 2PD6A 2X42A 4BWFB 2ORWA 4XQEA 3SX0A 2PQMA 4B79A 3DAOA 3GZTB 4MQ5A 1DTSA 1Z34A 3NVDA 1Y6FA 3NHRA 5CGZA 2J7PA 2ZWMA 4QOIA 5GMOA 1IMOA 4KITB 3AM1A 2QTCA 2R7LA 3HU3A 1XHLA 4JQOA 3UOGA 3IPXA 5JLAA 4H77A 3SLKA 2VNAA 3CKKA 2J6BA 3RROA 3GUYA 3ET4A 1YA6A 3BF8A 2Z6UA 5A0TA 1NUUA 1XALA 3PGXA 3K1AA 3ET5A 2ES4A 4K3VA 2P9EA 2MSWA 3G13A 4X1IA 1XTPA 4KUEA 1SIOA 3FXAA 1Y4ZA 4IIBA 1MFZA 4ME6A 2ISQA 2VDQB 1L1QA 3IPYA 1YBHA 4YO8A 2NYRA 4LJ6A 3RBZA 1YE8A 3ESRA 1U2GA 1NDHA 3GP5A 4FFPA 4KYIB 1JAXA 3T7TA 3F6PA 3IP6A 4QL3A 3W06A 5C32A 3DFMA 4XX1A 5FIUA 3T9AA 3UHAA 2C2MA 1MAUA 1FY2A 3TTSA 1LRJA 4BE4A 4ESHA 1LS6A 1T1JA 4QZVA 3GNLA 4MW6A 2JJ2A 1PJ4A 2Y0BA 4WAUA 2GK7A 4RH1A 2O59A 3ZLBA 1E9EA 2HMUA 2H2FA 2IL1A 2P7HA 3PUIA 3V8QA 2PKRA 5CXQA 3CRQA 1Z15A 1GZDA 1Y7LA 1G9TA 1UJCA 4DZTA 2IY8A 4HB2A 4LVUA 5AM5A 4Z1MA 4IIUA 2IOFK 1L5HA 3VPXA 3ZTTA 5IDWA 2QRKA 4EFNA 3R3VA 3BD8A 1Y42X 2PV7A 1Z37A 5ICGA 1WZEA 1XDUA 2Y93A 2C9YA 4INPA 4I14A 1Y3IA 4ASUD 3QI2A 4C0KA 2JI7A 3QQPA 2DM6A 4WESB 3GJZA 4JLPA 3TDNA 4BPRA 5DP2A 2ECOA 2D4AA 3ABZA 4YIKA 2X5KO 4LQCA 3KJHA 5FPPA 4LOAA 2C2WA 2D0DA 3RC9A 4HTFA 4ZGBA 2IA5A 3EQ8A 2IGTA 3JYNA 2JBWA 4FFNA 4DLBA 4URHA 1JF8A 5E6SA 4BFWA 4BQSA 3NOOA 5AESA 1L1EA 2EKQA 4R51A 5IMBA 3PVSA 3TB4A 5IYZF 4CQJA 5B4UA 3HXLA 1HYBA 2CDNA 4V0SA 1NY6A 1T13A 2XTAA 4GUDA 3TIVA 1CJCA 4S35A 3HPQA 1N5LA 3RASA 2GF2A 4CETA 1KKUA 2I22A 3O90A 1TZJA 2Y99A 2OKGA 3MGBA 2B2NA 3GBSA 4FB5A 2BFFA 1M2WA 5CIYA 4G1BA 4QARA 3AVWA 1P6XA 2HLHA 4YC7A 1AZSC 1BCRA 1G60A 4O1IA 3DC7A 2C00A 5DM1A 4TYNA 1ECFA 3EQZA 2X0RA 3R2JA 5DM70 3PNMA 3ICEA 4Q4JA 2EBWA 2Q7XA 2ZTVA 3EFHA 3P9RA 3K31A 3PTZA 4R7TA 2BFCA 2UYQA 5B53A 4BAZA 4BLUA 3K5HA 1PL8A 2J3LA 4DY4A 2VWPA 3TLXA 4DCUA 4EA6A 2VH1A 3GVIA 3IT0A 4PGFA 4Z1OA 1Z56C 2GBLA 4FFBB 4BMYA 5HRCA 4WCDA 4CV3A 3CS3A 3OCUA 2J31A 3KFXA 3P9YA 4IRXA 4BLVA 1ZNXA 1P2UA 4M83A 4RF5A 4X0EA 3WVNA 2E2WA 3E9NA 3IUNA 4LHXA 5KC8A 1JQKA 3QPUA 2XOKD 3LECA 2XDAA 4EWLA 4CZ2A 1JMYA 1RQXA 2A7XA 5I7UA 5KWSA 3HB9A 1Q1EA 4RE5A 5FDFA 5KQRA 3M7IA 1MOPA 1OR8A 3E0QA 4LDPA 1CP2A 3PI6A 3KYBA 1S7GA 2IYOA 5HKLA 1Y48E 1QWSA 2HX1A 3AW9A 4FQ5A 2XEDA 2F3TA 2QZJA 2INGX 3KKOA 5CXXA 1DV2A 4M49A 2D5BA 3EMBA 5JAHA 4C2BA 5KSWB 2PH1A 4BFXA 3BMQA 1TM5E 3F7OA 3QVXA 3ZCXA 1YQWA 3C15C 3IHTA 3LOPA 4XX0A 1QH9A 5BW4A 1A4XA 2PPLA 1XTKA 3GDWA 2ZIXA 4A91A 4AY5A 5JSFA 2HAEA 4GYWA