3C3RA

Alix bro1 chmp4c complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
ATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 6-interacting protein
publication title ALIX-CHMP4 interactions in the human ESCRT pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 126
structure length 357
sequence length 357
ec nomenclature
pdb deposition date 2008-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3c3rA00
2OEVA 3UM1A 2R05A 3ZXPA 3C3OA 3UM0A 3UM3A 3RAUA 3ULYA 3R9MA 5CRVA 5CRUA 2R02A 3C3RA 2XS8A 2OEWA 2XS1A 3UM2A 3C3QA 2R03A 1ZB1A
chains in the Genus database with same CATH superfamily
1OCRE 1WDYA 2FI7A 3CVUA 5DIZA 3FH8A 1TNBA 2LNIA 3QC1A 2DYRE 3NOGD 4GTRA 4KVOA 3EHMA 3CVLA 1JUQA 5FIOA 1TNUA 4I1MA 2Y1LE 1EF1C 4LUNU 2LUHA 3AG1E 1X81A 4I1OB 3SY2A 5BXOA 3I4RB 2VTBB 1TR4A 3DXMG 1OCOE 3EIQC 4PDXA 1FCHA 1UW4B 3DPYA 3EIJA 1ZB1A 3VLFA 4GCOA 4K5BA 2F37A 3FTSA 4M3OA 3KEZA 2JEKA 1BD8A 1UJJA 4JPSA 4AY6A 1SVXA 2ZGDA 2X6KA 3C3RA 3L08A 5LCWJ 4GTTA 3L17A 1O1RA 2KZTB 5AARA 4R7LA 3UUXA 2WXNA 3T8MA 3NAWA 1LD8A 3ULQA 4DX1A 3PNLB 2AVPA 2WXIA 4Y6WA 4XX5A 2FF4A 4O6FA 1IHGA 3IV0A 3L22A 3QK0A 4M7CA 1N9AA 3SNXA 4L9PA 3G2TA 3LDZA 3LJ3A 3GZSA 4YNDA 4FHJA 3LY8A 2C0MA 4TRQA 1O1TA 3JYSA 3NQPA 4G8LA 4I6JA 1SA5A 5ANRA 4A3TA 3ISMC 4I1AA 3SFZA 4ILGA 5BT1A 3GZ2A 3RO2A 5J08A 3T9KA 1JCRA 2J4BA 2WXMA 3W9FA 1PC2A 5H7PA 3IKOB 1NP7A 4KZCA 3EJNA 4MBGA 2X6JA 5EIDA 1N0QA 3B13A 2BF0X 3Q7FA 4LNBA 1N54A 3T8KA 4TXPA 4LNGA 3LS8A 4U0SA 2H6IA 2NSZA 3FWVA 3ASHA 3BG1B 1H2TC 3LYAA 4ANWA 1H6PA 2X6HA 2ETBA 1NA3A 3Q79A 4IULA 1U2VG 3FDHA 3SBSA 1WM5A 3UIPC 1N94A 1EPUA 3RRNB 5LCWC 4DI4A 4FHKA 3B7TA 4AJWA 4WNGA 3FEYA 4MKTA 2XEHA 3ZPJA 3UINC 1E8YA 2A5EA 1DCQA 3FU6A 3NB2A 2Y4UA 5EKQD 3PZ1A 4TUUA 5FZQA 3TXNA 3L6AA 3EU5A 3EUVA 2ETCA 2XHEA 2XCCA 2OVBA 5CRVA 3ML8A 3CIAA 4HFGA 5ARFA 3I5PA 3D9HA 2GW1A 4J8DA 3RSEG 2QY7A 5FTPA 3TG5A 3ZFWA 1Q2ZA 3OXGA 1E8XA 1O5MA 2EQXA 3UM1A 2ZU6B 1Z3YA 1KLXA 4PS7A 1H6KA 3ZXSA 3GW4A 4GA1A 4EZJA 4GMRA 4U04A 5ENQD 4PUCA 2R03A 3URZA 4ILHB 1ZBPA 5G05J 3D9KA 4O1OA 3JQ0A 4IRUA 3ASDA 2R2LA 3U4TA 3QWPA 1OWMA 1E96B 4U07A 3E34A 4OVVA 3QWWA 2R59A 4LSZE 1TNYA 4AM9A 4U96D 5AQAA 2I6HA 4GZ6A 1IKND 2XCBA 4WNDA 4KYOB 3PZ2A 3D9PA 3Q47B 5B1BE 3D9JA 3Q5MA 1NFIE 3FTUA 4EHMA 4U0UA 3V79K 3UM0A 4FP7A 5G04J 3LVRE 3MGBA 5FQ6A 1AWCB 3L16A 1LD7A 2P58C 5KJKA 3ENEA 4BY6A 5JA4D 1E7UA 3FTVA 4C0EA 1Z3XA 3O4ZA 1QQEA 5EDSA 3QB2A 3FP3A 2JABA 4TXRA 1TEZA 4AIFA 2XGSA 4HI9A 3EDTB 1N4SA 3OTNA 4TXQA 4APFA 4J8EA 2WXPA 3C5RA 3MA5A 4J6IA 2GRRB 5HS0A 3FFLA 3Q9NC 4FA6A 1QZ2A 3CKCA 3F6QA 4PS3A 4HOQA 3D9NA 2RD0A 1EYHA 1ELRA 3G2UA 4GTMA 3ASOE 3QWVA 3ZGQA 5G05C 4WUYA 1TN6A 3V30A 3G2VA 2DYSE 4JEUA 3DSVA 4K03A 1TN8A 2FO7A 5A7DB 2IOSA 1D9SA 3D9OA 4ME2A 3UKUG 2CHZA 2YHCA 5CMWA 1KZOA 2Y0BG 2FULA 1QNFA 4I2ZA 5CECB 3BUAA 3Q15A 1H0AA 5CEDB 2XZTG 4DI3A 3SO8A 5ENRD 4RG9A 3FUKA 4HI8A 4KZ0A 2BKKB 2R5SA 4BWRA 2EILE 2XS8A 4L23A 5G04C 4GTPA 1X5BA 1MX2A 3PNTB 4K5AB 3OXLA 1LTXA 4HOUA 3G2WA 3AG3E 3BG0B 2V0PA 3LY9A 4I43A 1K8KG 4NACA 3FTZA 2LAIA 3FU5A 3D9LA 4BFRA 2MRIA 1OWNA 3FTWA 5KNHD 5HQ8A 4DK5A 4AXHA 2IJGX 2J09A 2XPIA 3ASNE 3SGHA 1K1BA 1E8ZA 2IU1A 2L6JA 3PUKA 3U64A 3TWWA 1P5QA 2WPVA 5G55A 3JUIA 3NOCD 1NZNA 2BTDA 3RJVA 3E4BA 4RQIA 3N71A 4NURA 2RFAA 2ZXWE 5M72A 4GYOA 3ZIMA 1S64A 4JD2G 3PVLA 4EECA 3PEUB 3U3WA 2WQ6A 5D2MC 1MYOA 3FTYA 1IQUA 2J08A 3Q9UC 3SFYA 4IN3B 3FUMA 2EINE 3VTYA 3TXMA 3FHEA 1JCQA 2NYJA 4YDEA 3AG2E 3QDNA 5G2NA 3GYZA 5CHEE 4GTSA 3RK6A 4WWNA 2XRYA 4Q69A 5AN8A 4GZCA 3P1UA 2P9KG 4BX9A 4UUCA 3ESLA 5EX3A 3CLJA 2PL2A 4KMOA 4HLLA 4X8QA 1HH8A 1V55E 3B7BA 1BI8B 2X38A 5BNWA 5FZSA 2GRMA 4C0MA 1N11A 4G8KA 4UI9K 2RG8A 5CMYA 2DBAA 4OAVB 1KT0A 1YCSB 3LKUA 3L54A 3UM2A 1S0PA 3ZYQA 2P9NG 2EIKE 4GB9A 3MKRA 4URKA 3ULYA 3R9MA 1Y6IA 2UWJG 2VTBA 3MEKA 3AJIA 5HRYA 3TWSA 4AEZC 2XENA 4U8YD 2LO6A 4DUIA 1AP7A 4HS2A 2Y3AA 4CEMA 4JW1A 3T5VA 3CVXA 3B95A 2F8XK 1E8WA 4WNEA 4G1TA 4ACLA 4EPZA 5JHAA 4JA9A 1U3CA 1H2UA 1SQMA 2LSUA 2OV8A 4XI9A 2KZTA 2BUGA 4DRXE 5FZRA 4JEHA 5BXUA 3CHOA 4C48B 2XGMA 2JLBA 3CKBA 4CCAA 4GZ5A 4GTOA 3CVWA 4HRLA 4HORA 1N95A 1S63A 1D8DA 3LXUX 1RZ4A 5AENA 2WXFA 1OWPA 4TV3A 5HKPA 3HDXA 2PQRA 4ATGA 3DWLG 1DC2A 2WVIA 4N39A 4OAUC 1VDYA 2VSOE 2L9BA 2VSXE 3DSXA 3PE4A 3ZW3A 2KCVA 3EU9A 4AVXA 4BEPA 3RRUA 1JPLA 4HXIA 2PM7A 4ABNA 4UQYA 3PEVB 3DSWA 1IQRA 3TWVA 3ESKA 2KCKA 3UIOC 3LCAA 2VYIA 2FO1E 4BSXA 4W9RA 1OCZE 2CHXA 2XRZA 1FVHA 5KBAA 5KNGA 3ZYLA 3FULA 1OWOA 2CG2A 3HXFA 5ITZF 4J7WA 5BUZA 2VJ8A 3TWTA 3B7RL 4GMJA 4FU3A 4Q94A 3NBNB 5FQ7A 4YVQC 4DX2A 2VGXB 3KSQA 3KEAA 2HO1A 2IQCA 3KSLA 4ZHBA 2WB2A 1ZU2A 3AS5A 4BETA 5T4YA 4Z68A 5BV1A 4QFVA 4A55A 3HXEA 3X2QE 3CQGB 3LPZA 4CRWA 1MZCA 5KJNA 4GYYA 2P9LG 3NZSA 3TL5A 5E75A 3QAQA 3CQCB 1HG2A 2ZIRA 3CK7A 4V3IA 4HRNA 2VSNA 3V31A 1O1SA 3HVEB 3IEGA 3FUEA 4CDNA 2IY0C 3CVVA 3E30A 3LEWA 1FVFA 1K1AA 3WG7E 3RIBA 3UXGA 1HS6A 4J8YA 3FY4A 3LY7A 5AQ9A 3SI5A 2Y4TA 3CHSA 2NC9A 2PZIA 4XE0A 4JXTA 4BX8A 2KATA 4FC8A 4KT6B 4FJZA 3CEQA 4N3CA 2AXUA 4HRMB 3L9TA 3UT7A 2ZGGA 3ONLA 3TWRA 5A6CA 1Y8MA 2WQ7A 4AV7A 4NRHB 3D3MA 4O60A 3AAAC 4FJYA 5CRUA 4HLEA 1KT1A 1YMPA 4DX5D 4ANVA 4ZFHA 3CVQA 3CSFA 3J5QB 5KJLA 4GMLA 3HHMA 1TJFA 4XI0A 2I9CA 2DZOA 2OVFA 4GCNA 3SBTB 2QC9A 2AXVA 2WXGA 3V2OA 3T5XA 3JCKC 2MOWA 5AIJA 3RU0A 2A4ZA 2WXHA 4G11A 5CERB 2HE0A 4FULA 3MYVA 4LRZA 1FT1A 4XKCA 2CFUA 3CR3A 3RKVA 1N0RA 2CFZA 3QJZA 3SHFA 3ZU7B 3JXJA 4L7TA 2DWZA 4YDOA 4N5QA 4WWOA 4G2VA 4UWLA 4HQDA 3HXCA 1JCSA 4WAFA 3HXDA 2HR2A 2CG3A 2J49A 4I17A 2QFCA 4HOTA 1HU3A 2FBNA 3QOUA 1UN8A 5CBNA 4FADA 4BT9A 2AJAA 4HBDA 4UQXA 5ENOD 2IFUA 4B93B 3AS8A 4E85A 2V5QC 3UMVA 1RW2A 3BU8A 3E32A 5E76A 4OVUA 3MX3A 2DVWA 1TN7A 4NIKA 1ELKA 3VLEA 4I6EA 5EIBE 4NQ0A 1IYGA 2OOEA 3LVQE 2X6IA 5C1DA 3SFXA 3IXEA 2A5UA 1NA0A 5D66A 3ABKE 3CVNA 4UWHA 4ILIA 4K5CA 4PS8A 4B8AA 2B6CA 1QBQA 3WXXA 3PRZA 2J9QA 3UT8A 1A17A 1MJ0A 4MRUA 3SD5A 3KAEA 4BESA 3GZ1A 4N3AA 5EX0A 2GRPB 3AG4E 2OCCE 5CEAA 5AJDA 1BU9A 1KZPA 4KVMA 2P9UG 1Z5SC 4BSZB 5EYLA 3Q7AA 3DBSA 3DPDA 1QYMA 1TNOA 5AQ7A 1L5JA 1TYQG 3ZYKA 2WXLA 1KPSB 5JJTA 4F6RD 2LXMA 4E6HA 3FU0A 2ILRA 2NXPA 2XQ0A 4G25A 4LEUA 1BPOA 3FTXA 4JA7A 4N2SA 1N4PA 4N5CA 4JHJA 3EHQA 3MV3B 2J4DA 3MZLB 2H6GA 3AS4A 3ABLE 5ENNA 2VGYA 2J8SD 3HYMB 3CVYA 3R9AB 3VLDA 3IHYA 3MKQA 3MKQB 4P29A 1TJCA 4OYSA 4U8HA 4Q96A 4H7YA 4GTVA 3ABME 1H2VC 4BERA 2GGFA 4B8CB 4JHRA 3NZUA 3CV0A 1XNFA 2IONA 3UI2A 1JWGA 3PE3A 5EN5D 3Q73A 2HYZA 3FUIA 4AY5A 4I2WA 3RO3A 3FUJA 4LERA 3P2BA 4GPMA 3UM3A 4DLQA 4J8SA 2LSVA 2AW6A 2XPYA 1DNPA 5LFAA 3C3QA 1OXJA 5FWQA 2C2LA 5B3SE 3PZ3A 4I6GA 2V5FA 3ZHEA 2MHKA 3ZHEB 2IO2C 3FUDA 2VSYA 4F7AA 4J8FA 1H19A 4UQZA 5HI7A 4LG6A 3PUJA 1GW6A 4L2YA 3Q4AB 3DSSA 3MCXA 4HB5A 1V54E 2GRNB 2ONDA 1EDUA 3CK9A 2VQ2A 3OAWA 4J0UA 3Q49B 3TGOA 5KJMA 4B89A 4CT0A 3I3NA 1Z6TA 5ENPD 4EZLA 3ZNGA 2RFMA 4L2LA 3FH5A 1IHBA 2IF4A 1OY3D 2XEEA 4KXKB 3ZKJA 5ENSD 3UTMA 4KBQA 2WXJA 3FH7A 5JJ7A 4JHKA 2DCPA 3CVPA 4G23A 2WXQA 1N4RA 4N2QA 2XPZA 4QQIA 5ARGA 3AU5A 3PREA 3UQ3A 2XZDG 4CGVA 2HM8A 5BV0A 4APOA 1PAQA 4A1GA 3HG0D 2PQNA 2P9SG 3UT4A 4TUMA 3C72A 3IHVA 2H6FA 1FT2A 3VTXA 3ZEFA 5FT9A 3BQOA 1NI1A 5KWDA 2C0LA 2I1JA 4JB8P 3TJPA 5LOZA 4DX6D 2XEVA 5AQBA 3HXBA 3DSTA 3S2AA 5DBKA 2EIJE 3FUNA 3TWUA 4ANXA 2EIME 3U9WA 2R02A 1OWLA 3CSTA 1H6OA 5JHBA 3ZVVA 4RLYA 3PZ4A 1N4QA 3DXKG 3TG4A 4ACKA 3APDA 4CT4A 1HX8A 4B94A 3FEXA 1OUVA 5IY5E 3JQ1A 1G3NB 4B0ZA 3DEOA 1UOHA 4XEIG 1WAO1 4A63B 4U95D 4JZYA 3ZUVB 4DPRA 2P9PG 4JL0A 5AYWD 4CZ2D 4Y6CA 5CCMA 2VGXA 4CDMA 4GTQA 1SA4A 1BLXB 4EBAG 4XIFA 3ZRHA 2LXLA 4C9BB 2B0OE 2L0IA 3DSUA 3SQVA 2QYJA 3ZYMA 1HFAA 2I1KA 4GU5A 1MQSA 2QYUA 3HVEA 3C98A 2L6BA 5ENTD 3TWQA 4F53A 3CHRA 4ATZD 3B7SA 1HF8A 4UI9J 4K0RA 1TNZA 2OEWA 2XS1A 3V2XA 4I9EA 2F8YA 5J90A 2H6HA 4WWPA 3FU3A 2V8SE 4G26A 2YNQA 2WMNA 4EQFA 2WXKA 3I4GA 3CHPA 3U66A 1FPPA 3EHRA 2Y69E 4UWKA 3APFA 4GPKA 3JXIA 2IOLA 2GRQB 2R05A 3E37A 3R7QA 5FINA 4F1SA 3FUHA 4GZ3A 4A3VA 3ML9A 1HXIA 2V4LA 5FJYA 3ASGA 2KC7A 5FQ4A 4YVOA 4JVSA 2YHEA 3AU4A 4DLOA 4EZKA 1PY1A 2M63A 2FEZA 3CK8A 1UG3A 2V4HC 5BW8C 5JMND 1NL4A 3JUEA 4PH4B 4GAAA 5FQ8A 5B1AE 1HG5A 3C3OA 3PH0C 1DVPA 4UWGA 3QKYA 4MS6A 5KCMA 2P9IG 5T8IA 2E0IA 2CHWA 2WM9A 2BEDA 4U0ZA 4L1BA 2I2OA 4UI9C 4YDWA 2PNNA 2MYOA 3MV2B 2PM6A 3L82A 4D10C 1BI7B 1MX6A 4BTBA 1A5EA 5A23A 4UWFA 4U63A 2OEVA 4GYWA 4HNAD 3ULEG 3G2SA 5JJ6A 3FUFA 1D8EA 2IEJA 2VGEA 3Q78A 2WXOA 4ANUA 2XGOA 4LCTA 5ANLA 3UKRG 5AAOA 4YDYA 1JWFA 1WY6A 5LX8A 4HOSA 4EBAA 1B89A 3ZN3A 1HZ4A 5T3RA 4AOFA 1K3ZD 2QZAA 4H7XA 3O48A 3B7UX 4IYPA 3MJWA 2Q7FA 3ONKA 3E33A 3UX4A 2ZISA 2YQ8A 4RVBA 2AWIA 2DIWA 3APCA 3BEEA 4O1PA 1N52A 3L13A 5EILA 3LJNA 5D0QD 3CHMA 3DEPA 5D0OD 1E90A 2X6FA 3KS2A 4CYMD 3ASFA 2KM4A 3D9IA 1W3BA 3SZ7A 4XKBA 5AJLA 3W9GA 3D9MA 3RAUA 3PZDA 3QNKA 1UJKA 3S7JA 1UN9A 3Q75A 3OXFA 2RKKA 4DX7D 2IO3C 2L0TB 3CHQA 4XZ4A 4A1SA 4HVBA 1SZAA 1YYHA 2E2EA 3R7RA 3S7DA 3CGHA 4F3VA 5BPPA 2LAHA 2DZNA 2YINA 3HIZA 2P2CP 4DJAA 1ELWA 5CBOA 2R17C 2AXZA 1SZ9A 3IBEA 2J07A 2GRLA 2UY1A 2BKGA 2UY1B 5EYPF 3UPVA 2WXRA 3PS6A 4BT8A 1MHQA 4AP2A 3K9IA 5LP0A 2X3MA 1U3DA 1OCCE 3EHNA 3TAXA 1INZA 3SF4A 4JC8A 4U7EB 1SW6A 1YA0A 2KXPC 1S70B 4CDRA 1LF8A 4LNUD 2WQHA 4BTAA 1OT8A 4G24A 1HE8A 3NF1A 4GA2A 4RSYA 4N3BA 1HO8A 3QARA 3J5PA 3S7BA 4FLBA 5C2YA 2ETAA 3PDNA 1IXVA 4U8VD 2GROB 4F1PA 4I9CA 4RG6A 2F0YA 1WG0A 3KD7A 4CGWA 4GZDA 1DCEA 1XGWA 4GA0A 3ZXPA 5CCLA 4FLHA 3DRAA 2KCLA 2KBXA 3RRMB 1E7VA 4WNFA 3HRAA 3TWXA 1MX4A 3S7FA 4MLPA 2WMOA
chains in the Genus database with same CATH topology
2OEVA 2OEXA 3UM1A 2R05A 3ZXPA 3C3OA 3UM0A 3UM3A 3RAUA 3ULYA 3R9MA 5CRVA 5CRUA 2R02A 4JIOA 3C3RA 2XS8A 2OEWA 2XS1A 3UM2A 3C3QA 2R03A 2OJQA 1ZB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEV A;  3UM1 A;  2R05 A;  3ZXP A;  3C3O A;  3UM0 A;  3UM3 A;  3RAU A;  3ULY A;  3R9M A;  5CRV A;  5CRU A;  2R02 A;  3C3R A;  2XS8 A;  2OEW A;  2XS1 A;  3UM2 A;  3C3Q A;  2R03 A;  1ZB1 A; 
#chains in the Genus database with same CATH topology
 1OCR E;  1WDY A;  2FI7 A;  3CVU A;  5DIZ A;  3FH8 A;  1TNB A;  2LNI A;  3QC1 A;  2DYR E;  3NOG D;  4GTR A;  4KVO A;  3EHM A;  3CVL A;  1JUQ A;  5FIO A;  1TNU A;  4I1M A;  2Y1L E;  1EF1 C;  4LUN U;  2LUH A;  3AG1 E;  1X81 A;  4I1O B;  3SY2 A;  5BXO A;  3I4R B;  2VTB B;  1TR4 A;  3DXM G;  1OCO E;  3EIQ C;  4PDX A;  1FCH A;  1UW4 B;  3DPY A;  3EIJ A;  1ZB1 A;  3VLF A;  4GCO A;  4K5B A;  2F37 A;  3FTS A;  4M3O A;  3KEZ A;  2JEK A;  1BD8 A;  1UJJ A;  4JPS A;  4AY6 A;  1SVX A;  2ZGD A;  2X6K A;  3C3R A;  3L08 A;  5LCW J;  4GTT A;  3L17 A;  1O1R A;  2KZT B;  5AAR A;  4R7L A;  3UUX A;  2WXN A;  3T8M A;  3NAW A;  1LD8 A;  3ULQ A;  4DX1 A;  3PNL B;  2AVP A;  2WXI A;  4Y6W A;  4XX5 A;  2FF4 A;  4O6F A;  1IHG A;  3IV0 A;  3L22 A;  3QK0 A;  4M7C A;  1N9A A;  3SNX A;  4L9P A;  3G2T A;  3LDZ A;  3LJ3 A;  3GZS A;  4YND A;  4FHJ A;  3LY8 A;  2C0M A;  4TRQ A;  1O1T A;  3JYS A;  3NQP A;  4G8L A;  4I6J A;  1SA5 A;  5ANR A;  4A3T A;  3ISM C;  4I1A A;  3SFZ A;  4ILG A;  5BT1 A;  3GZ2 A;  3RO2 A;  5J08 A;  3T9K A;  1JCR A;  2J4B A;  2WXM A;  3W9F A;  1PC2 A;  5H7P A;  3IKO B;  1NP7 A;  4KZC A;  3EJN A;  4MBG A;  2X6J A;  5EID A;  1N0Q A;  3B13 A;  2BF0 X;  3Q7F A;  4LNB A;  1N54 A;  3T8K A;  4TXP A;  4LNG A;  3LS8 A;  4U0S A;  2H6I A;  2NSZ A;  3FWV A;  3ASH A;  3BG1 B;  1H2T C;  3LYA A;  4ANW A;  1H6P A;  2X6H A;  2ETB A;  1NA3 A;  3Q79 A;  4IUL A;  1U2V G;  3FDH A;  3SBS A;  1WM5 A;  3UIP C;  1N94 A;  1EPU A;  3RRN B;  5LCW C;  4DI4 A;  4FHK A;  3B7T A;  4AJW A;  4WNG A;  3FEY A;  4MKT A;  2XEH A;  3ZPJ A;  3UIN C;  1E8Y A;  2A5E A;  1DCQ A;  3FU6 A;  3NB2 A;  2Y4U A;  5EKQ D;  3PZ1 A;  4TUU A;  5FZQ A;  3TXN A;  3L6A A;  3EU5 A;  3EUV A;  2ETC A;  2XHE A;  2XCC A;  2OVB A;  5CRV A;  3ML8 A;  3CIA A;  4HFG A;  5ARF A;  3I5P A;  3D9H A;  2GW1 A;  4J8D A;  3RSE G;  2QY7 A;  5FTP A;  3TG5 A;  3ZFW A;  1Q2Z A;  3OXG A;  1E8X A;  1O5M A;  2EQX A;  3UM1 A;  2ZU6 B;  1Z3Y A;  1KLX A;  4PS7 A;  1H6K A;  3ZXS A;  3GW4 A;  4GA1 A;  4EZJ A;  4GMR A;  4U04 A;  5ENQ D;  4PUC A;  2R03 A;  3URZ A;  4ILH B;  1ZBP A;  5G05 J;  3D9K A;  4O1O A;  3JQ0 A;  4IRU A;  3ASD A;  2R2L A;  3U4T A;  3QWP A;  1OWM A;  1E96 B;  4U07 A;  3E34 A;  4OVV A;  3QWW A;  2R59 A;  4LSZ E;  1TNY A;  4AM9 A;  4U96 D;  5AQA A;  2I6H A;  4GZ6 A;  1IKN D;  2XCB A;  4WND A;  4KYO B;  3PZ2 A;  3D9P A;  3Q47 B;  5B1B E;  3D9J A;  3Q5M A;  1NFI E;  3FTU A;  4EHM A;  4U0U A;  3V79 K;  3UM0 A;  4FP7 A;  5G04 J;  3LVR E;  3MGB A;  5FQ6 A;  1AWC B;  3L16 A;  1LD7 A;  2P58 C;  5KJK A;  3ENE A;  4BY6 A;  5JA4 D;  1E7U A;  3FTV A;  4C0E A;  1Z3X A;  3O4Z A;  1QQE A;  5EDS A;  3QB2 A;  3FP3 A;  2JAB A;  4TXR A;  1TEZ A;  4AIF A;  2XGS A;  4HI9 A;  3EDT B;  1N4S A;  3OTN A;  4TXQ A;  4APF A;  4J8E A;  2WXP A;  3C5R A;  3MA5 A;  4J6I A;  2GRR B;  5HS0 A;  3FFL A;  3Q9N C;  4FA6 A;  1QZ2 A;  3CKC A;  3F6Q A;  4PS3 A;  4HOQ A;  3D9N A;  2RD0 A;  1EYH A;  1ELR A;  3G2U A;  4GTM A;  3ASO E;  3QWV A;  3ZGQ A;  5G05 C;  4WUY A;  1TN6 A;  3V30 A;  3G2V A;  2DYS E;  4JEU A;  3DSV A;  4K03 A;  1TN8 A;  2FO7 A;  5A7D B;  2IOS A;  1D9S A;  3D9O A;  4ME2 A;  3UKU G;  2CHZ A;  2YHC A;  5CMW A;  1KZO A;  2Y0B G;  2FUL A;  1QNF A;  4I2Z A;  5CEC B;  3BUA A;  3Q15 A;  1H0A A;  5CED B;  2XZT G;  4DI3 A;  3SO8 A;  5ENR D;  4RG9 A;  3FUK A;  4HI8 A;  4KZ0 A;  2BKK B;  2R5S A;  4BWR A;  2EIL E;  2XS8 A;  4L23 A;  5G04 C;  4GTP A;  1X5B A;  1MX2 A;  3PNT B;  4K5A B;  3OXL A;  1LTX A;  4HOU A;  3G2W A;  3AG3 E;  3BG0 B;  2V0P A;  3LY9 A;  4I43 A;  1K8K G;  4NAC A;  3FTZ A;  2LAI A;  3FU5 A;  3D9L A;  4BFR A;  2MRI A;  1OWN A;  3FTW A;  5KNH D;  5HQ8 A;  4DK5 A;  4AXH A;  2IJG X;  2J09 A;  2XPI A;  3ASN E;  3SGH A;  1K1B A;  1E8Z A;  2IU1 A;  2L6J A;  3PUK A;  3U64 A;  3TWW A;  1P5Q A;  2WPV A;  5G55 A;  3JUI A;  3NOC D;  1NZN A;  2BTD A;  3RJV A;  3E4B A;  4RQI A;  3N71 A;  4NUR A;  2RFA A;  2ZXW E;  5M72 A;  4GYO A;  3ZIM A;  1S64 A;  4JD2 G;  3PVL A;  4EEC A;  3PEU B;  3U3W A;  2WQ6 A;  5D2M C;  1MYO A;  3FTY A;  1IQU A;  2J08 A;  3Q9U C;  3SFY A;  4IN3 B;  3FUM A;  2EIN E;  3VTY A;  3TXM A;  3FHE A;  1JCQ A;  2NYJ A;  4YDE A;  3AG2 E;  3QDN A;  5G2N A;  3GYZ A;  5CHE E;  4GTS A;  3RK6 A;  4WWN A;  2XRY A;  4Q69 A;  5AN8 A;  4GZC A;  3P1U A;  2P9K G;  4BX9 A;  4UUC A;  3ESL A;  5EX3 A;  3CLJ A;  2PL2 A;  4KMO A;  4HLL A;  4X8Q A;  1HH8 A;  1V55 E;  3B7B A;  1BI8 B;  2X38 A;  5BNW A;  5FZS A;  2GRM A;  4C0M A;  1N11 A;  4G8K A;  4UI9 K;  2RG8 A;  5CMY A;  2DBA A;  4OAV B;  1KT0 A;  1YCS B;  3LKU A;  3L54 A;  3UM2 A;  1S0P A;  3ZYQ A;  2P9N G;  2EIK E;  4GB9 A;  3MKR A;  4URK A;  3ULY A;  3R9M A;  1Y6I A;  2UWJ G;  2VTB A;  3MEK A;  3AJI A;  5HRY A;  3TWS A;  4AEZ C;  2XEN A;  4U8Y D;  2LO6 A;  4DUI A;  1AP7 A;  4HS2 A;  2Y3A A;  4CEM A;  4JW1 A;  3T5V A;  3CVX A;  3B95 A;  2F8X K;  1E8W A;  4WNE A;  4G1T A;  4ACL A;  4EPZ A;  5JHA A;  4JA9 A;  1U3C A;  1H2U A;  1SQM A;  2LSU A;  2OV8 A;  4XI9 A;  2KZT A;  2BUG A;  4DRX E;  5FZR A;  4JEH A;  5BXU A;  3CHO A;  4C48 B;  2XGM A;  2JLB A;  3CKB A;  4CCA A;  4GZ5 A;  4GTO A;  3CVW A;  4HRL A;  4HOR A;  1N95 A;  1S63 A;  1D8D A;  3LXU X;  1RZ4 A;  5AEN A;  2WXF A;  1OWP A;  4TV3 A;  5HKP A;  3HDX A;  2PQR A;  4ATG A;  3DWL G;  1DC2 A;  2WVI A;  4N39 A;  4OAU C;  1VDY A;  2VSO E;  2L9B A;  2VSX E;  3DSX A;  3PE4 A;  3ZW3 A;  2KCV A;  3EU9 A;  4AVX A;  4BEP A;  3RRU A;  1JPL A;  4HXI A;  2PM7 A;  4ABN A;  4UQY A;  3PEV B;  3DSW A;  1IQR A;  3TWV A;  3ESK A;  2KCK A;  3UIO C;  3LCA A;  2VYI A;  2FO1 E;  4BSX A;  4W9R A;  1OCZ E;  2CHX A;  2XRZ A;  1FVH A;  5KBA A;  5KNG A;  3ZYL A;  3FUL A;  1OWO A;  2CG2 A;  3HXF A;  5ITZ F;  4J7W A;  5BUZ A;  2VJ8 A;  3TWT A;  3B7R L;  4GMJ A;  4FU3 A;  4Q94 A;  3NBN B;  5FQ7 A;  4YVQ C;  4DX2 A;  2VGX B;  3KSQ A;  3KEA A;  2HO1 A;  2IQC A;  3KSL A;  4ZHB A;  2WB2 A;  1ZU2 A;  3AS5 A;  4BET A;  5T4Y A;  4Z68 A;  5BV1 A;  4QFV A;  4A55 A;  3HXE A;  3X2Q E;  3CQG B;  3LPZ A;  4CRW A;  1MZC A;  5KJN A;  4GYY A;  2P9L G;  3NZS A;  3TL5 A;  5E75 A;  3QAQ A;  3CQC B;  1HG2 A;  2ZIR A;  3CK7 A;  4V3I A;  4HRN A;  2VSN A;  3V31 A;  1O1S A;  3HVE B;  3IEG A;  3FUE A;  4CDN A;  2IY0 C;  3CVV A;  3E30 A;  3LEW A;  1FVF A;  1K1A A;  3WG7 E;  3RIB A;  3UXG A;  1HS6 A;  4J8Y A;  3FY4 A;  3LY7 A;  5AQ9 A;  3SI5 A;  2Y4T A;  3CHS A;  2NC9 A;  2PZI A;  4XE0 A;  4JXT A;  4BX8 A;  2KAT A;  4FC8 A;  4KT6 B;  4FJZ A;  3CEQ A;  4N3C A;  2AXU A;  4HRM B;  3L9T A;  3UT7 A;  2ZGG A;  3ONL A;  3TWR A;  5A6C A;  1Y8M A;  2WQ7 A;  4AV7 A;  4NRH B;  3D3M A;  4O60 A;  3AAA C;  4FJY A;  5CRU A;  4HLE A;  1KT1 A;  1YMP A;  4DX5 D;  4ANV A;  4ZFH A;  3CVQ A;  3CSF A;  3J5Q B;  5KJL A;  4GML A;  3HHM A;  1TJF A;  4XI0 A;  2I9C A;  2DZO A;  2OVF A;  4GCN A;  3SBT B;  2QC9 A;  2AXV A;  2WXG A;  3V2O A;  3T5X A;  3JCK C;  2MOW A;  5AIJ A;  3RU0 A;  2A4Z A;  2WXH A;  4G11 A;  5CER B;  2HE0 A;  4FUL A;  3MYV A;  4LRZ A;  1FT1 A;  4XKC A;  2CFU A;  3CR3 A;  3RKV A;  1N0R A;  2CFZ A;  3QJZ A;  3SHF A;  3ZU7 B;  3JXJ A;  4L7T A;  2DWZ A;  4YDO A;  4N5Q A;  4WWO A;  4G2V A;  4UWL A;  4HQD A;  3HXC A;  1JCS A;  4WAF A;  3HXD A;  2HR2 A;  2CG3 A;  2J49 A;  4I17 A;  2QFC A;  4HOT A;  1HU3 A;  2FBN A;  3QOU A;  1UN8 A;  5CBN A;  4FAD A;  4BT9 A;  2AJA A;  4HBD A;  4UQX A;  5ENO D;  2IFU A;  4B93 B;  3AS8 A;  4E85 A;  2V5Q C;  3UMV A;  1RW2 A;  3BU8 A;  3E32 A;  5E76 A;  4OVU A;  3MX3 A;  2DVW A;  1TN7 A;  4NIK A;  1ELK A;  3VLE A;  4I6E A;  5EIB E;  4NQ0 A;  1IYG A;  2OOE A;  3LVQ E;  2X6I A;  5C1D A;  3SFX A;  3IXE A;  2A5U A;  1NA0 A;  5D66 A;  3ABK E;  3CVN A;  4UWH A;  4ILI A;  4K5C A;  4PS8 A;  4B8A A;  2B6C A;  1QBQ A;  3WXX A;  3PRZ A;  2J9Q A;  3UT8 A;  1A17 A;  1MJ0 A;  4MRU A;  3SD5 A;  3KAE A;  4BES A;  3GZ1 A;  4N3A A;  5EX0 A;  2GRP B;  3AG4 E;  2OCC E;  5CEA A;  5AJD A;  1BU9 A;  1KZP A;  4KVM A;  2P9U G;  1Z5S C;  4BSZ B;  5EYL A;  3Q7A A;  3DBS A;  3DPD A;  1QYM A;  1TNO A;  5AQ7 A;  1L5J A;  1TYQ G;  3ZYK A;  2WXL A;  1KPS B;  5JJT A;  4F6R D;  2LXM A;  4E6H A;  3FU0 A;  2ILR A;  2NXP A;  2XQ0 A;  4G25 A;  4LEU A;  1BPO A;  3FTX A;  4JA7 A;  4N2S A;  1N4P A;  4N5C A;  4JHJ A;  3EHQ A;  3MV3 B;  2J4D A;  3MZL B;  2H6G A;  3AS4 A;  3ABL E;  5ENN A;  2VGY A;  2J8S D;  3HYM B;  3CVY A;  3R9A B;  3VLD A;  3IHY A;  3MKQ A;  3MKQ B;  4P29 A;  1TJC A;  4OYS A;  4U8H A;  4Q96 A;  4H7Y A;  4GTV A;  3ABM E;  1H2V C;  4BER A;  2GGF A;  4B8C B;  4JHR A;  3NZU A;  3CV0 A;  1XNF A;  2ION A;  3UI2 A;  1JWG A;  3PE3 A;  5EN5 D;  3Q73 A;  2HYZ A;  3FUI A;  4AY5 A;  4I2W A;  3RO3 A;  3FUJ A;  4LER A;  3P2B A;  4GPM A;  3UM3 A;  4DLQ A;  4J8S A;  2LSV A;  2AW6 A;  2XPY A;  1DNP A;  5LFA A;  3C3Q A;  1OXJ A;  5FWQ A;  2C2L A;  5B3S E;  3PZ3 A;  4I6G A;  2V5F A;  3ZHE A;  2MHK A;  3ZHE B;  2IO2 C;  3FUD A;  2VSY A;  4F7A A;  4J8F A;  1H19 A;  4UQZ A;  5HI7 A;  4LG6 A;  3PUJ A;  1GW6 A;  4L2Y A;  3Q4A B;  3DSS A;  3MCX A;  4HB5 A;  1V54 E;  2GRN B;  2OND A;  1EDU A;  3CK9 A;  2VQ2 A;  3OAW A;  4J0U A;  3Q49 B;  3TGO A;  5KJM A;  4B89 A;  4CT0 A;  3I3N A;  1Z6T A;  5ENP D;  4EZL A;  3ZNG A;  2RFM A;  4L2L A;  3FH5 A;  1IHB A;  2IF4 A;  1OY3 D;  2XEE A;  4KXK B;  3ZKJ A;  5ENS D;  3UTM A;  4KBQ A;  2WXJ A;  3FH7 A;  5JJ7 A;  4JHK A;  2DCP A;  3CVP A;  4G23 A;  2WXQ A;  1N4R A;  4N2Q A;  2XPZ A;  4QQI A;  5ARG A;  3AU5 A;  3PRE A;  3UQ3 A;  2XZD G;  4CGV A;  2HM8 A;  5BV0 A;  4APO A;  1PAQ A;  4A1G A;  3HG0 D;  2PQN A;  2P9S G;  3UT4 A;  4TUM A;  3C72 A;  3IHV A;  2H6F A;  1FT2 A;  3VTX A;  3ZEF A;  5FT9 A;  3BQO A;  1NI1 A;  5KWD A;  2C0L A;  2I1J A;  4JB8 P;  3TJP A;  5LOZ A;  4DX6 D;  2XEV A;  5AQB A;  3HXB A;  3DST A;  3S2A A;  5DBK A;  2EIJ E;  3FUN A;  3TWU A;  4ANX A;  2EIM E;  3U9W A;  2R02 A;  1OWL A;  3CST A;  1H6O A;  5JHB A;  3ZVV A;  4RLY A;  3PZ4 A;  1N4Q A;  3DXK G;  3TG4 A;  4ACK A;  3APD A;  4CT4 A;  1HX8 A;  4B94 A;  3FEX A;  1OUV A;  5IY5 E;  3JQ1 A;  1G3N B;  4B0Z A;  3DEO A;  1UOH A;  4XEI G;  1WAO 1;  4A63 B;  4U95 D;  4JZY A;  3ZUV B;  4DPR A;  2P9P G;  4JL0 A;  5AYW D;  4CZ2 D;  4Y6C A;  5CCM A;  2VGX A;  4CDM A;  4GTQ A;  1SA4 A;  1BLX B;  4EBA G;  4XIF A;  3ZRH A;  2LXL A;  4C9B B;  2B0O E;  2L0I A;  3DSU A;  3SQV A;  2QYJ A;  3ZYM A;  1HFA A;  2I1K A;  4GU5 A;  1MQS A;  2QYU A;  3HVE A;  3C98 A;  2L6B A;  5ENT D;  3TWQ A;  4F53 A;  3CHR A;  4ATZ D;  3B7S A;  1HF8 A;  4UI9 J;  4K0R A;  1TNZ A;  2OEW A;  2XS1 A;  3V2X A;  4I9E A;  2F8Y A;  5J90 A;  2H6H A;  4WWP A;  3FU3 A;  2V8S E;  4G26 A;  2YNQ A;  2WMN A;  4EQF A;  2WXK A;  3I4G A;  3CHP A;  3U66 A;  1FPP A;  3EHR A;  2Y69 E;  4UWK A;  3APF A;  4GPK A;  3JXI A;  2IOL A;  2GRQ B;  2R05 A;  3E37 A;  3R7Q A;  5FIN A;  4F1S A;  3FUH A;  4GZ3 A;  4A3V A;  3ML9 A;  1HXI A;  2V4L A;  5FJY A;  3ASG A;  2KC7 A;  5FQ4 A;  4YVO A;  4JVS A;  2YHE A;  3AU4 A;  4DLO A;  4EZK A;  1PY1 A;  2M63 A;  2FEZ A;  3CK8 A;  1UG3 A;  2V4H C;  5BW8 C;  5JMN D;  1NL4 A;  3JUE A;  4PH4 B;  4GAA A;  5FQ8 A;  5B1A E;  1HG5 A;  3C3O A;  3PH0 C;  1DVP A;  4UWG A;  3QKY A;  4MS6 A;  5KCM A;  2P9I G;  5T8I A;  2E0I A;  2CHW A;  2WM9 A;  2BED A;  4U0Z A;  4L1B A;  2I2O A;  4UI9 C;  4YDW A;  2PNN A;  2MYO A;  3MV2 B;  2PM6 A;  3L82 A;  4D10 C;  1BI7 B;  1MX6 A;  4BTB A;  1A5E A;  5A23 A;  4UWF A;  4U63 A;  2OEV A;  4GYW A;  4HNA D;  3ULE G;  3G2S A;  5JJ6 A;  3FUF A;  1D8E A;  2IEJ A;  2VGE A;  3Q78 A;  2WXO A;  4ANU A;  2XGO A;  4LCT A;  5ANL A;  3UKR G;  5AAO A;  4YDY A;  1JWF A;  1WY6 A;  5LX8 A;  4HOS A;  4EBA A;  1B89 A;  3ZN3 A;  1HZ4 A;  5T3R A;  4AOF A;  1K3Z D;  2QZA A;  4H7X A;  3O48 A;  3B7U X;  4IYP A;  3MJW A;  2Q7F A;  3ONK A;  3E33 A;  3UX4 A;  2ZIS A;  2YQ8 A;  4RVB A;  2AWI A;  2DIW A;  3APC A;  3BEE A;  4O1P A;  1N52 A;  3L13 A;  5EIL A;  3LJN A;  5D0Q D;  3CHM A;  3DEP A;  5D0O D;  1E90 A;  2X6F A;  3KS2 A;  4CYM D;  3ASF A;  2KM4 A;  3D9I A;  1W3B A;  3SZ7 A;  4XKB A;  5AJL A;  3W9G A;  3D9M A;  3RAU A;  3PZD A;  3QNK A;  1UJK A;  3S7J A;  1UN9 A;  3Q75 A;  3OXF A;  2RKK A;  4DX7 D;  2IO3 C;  2L0T B;  3CHQ A;  4XZ4 A;  4A1S A;  4HVB A;  1SZA A;  1YYH A;  2E2E A;  3R7R A;  3S7D A;  3CGH A;  4F3V A;  5BPP A;  2LAH A;  2DZN A;  2YIN A;  3HIZ A;  2P2C P;  4DJA A;  1ELW A;  5CBO A;  2R17 C;  2AXZ A;  1SZ9 A;  3IBE A;  2J07 A;  2GRL A;  2UY1 A;  2BKG A;  2UY1 B;  5EYP F;  3UPV A;  2WXR A;  3PS6 A;  4BT8 A;  1MHQ A;  4AP2 A;  3K9I A;  5LP0 A;  2X3M A;  1U3D A;  1OCC E;  3EHN A;  3TAX A;  1INZ A;  3SF4 A;  4JC8 A;  4U7E B;  1SW6 A;  1YA0 A;  2KXP C;  1S70 B;  4CDR A;  1LF8 A;  4LNU D;  2WQH A;  4BTA A;  1OT8 A;  4G24 A;  1HE8 A;  3NF1 A;  4GA2 A;  4RSY A;  4N3B A;  1HO8 A;  3QAR A;  3J5P A;  3S7B A;  4FLB A;  5C2Y A;  2ETA A;  3PDN A;  1IXV A;  4U8V D;  2GRO B;  4F1P A;  4I9C A;  4RG6 A;  2F0Y A;  1WG0 A;  3KD7 A;  4CGW A;  4GZD A;  1DCE A;  1XGW A;  4GA0 A;  3ZXP A;  5CCL A;  4FLH A;  3DRA A;  2KCL A;  2KBX A;  3RRM B;  1E7V A;  4WNF A;  3HRA A;  3TWX A;  1MX4 A;  3S7F A;  4MLP A;  2WMO A; 
#chains in the Genus database with same CATH homology
 2OEV A;  2OEX A;  3UM1 A;  2R05 A;  3ZXP A;  3C3O A;  3UM0 A;  3UM3 A;  3RAU A;  3ULY A;  3R9M A;  5CRV A;  5CRU A;  2R02 A;  4JIO A;  3C3R A;  2XS8 A;  2OEW A;  2XS1 A;  3UM2 A;  3C3Q A;  2R03 A;  2OJQ A;  1ZB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...