3C3RA

Alix bro1 chmp4c complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
357
structure length
357
Chain Sequence
ATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ALIX-CHMP4 interactions in the human ESCRT pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Programmed cell death 6-interacting protein
total genus 126
structure length 357
sequence length 357
ec nomenclature
pdb deposition date 2008-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3c3rA00
5CRUA 3C3QA 3ULYA 2OEWA 2XS1A 5CRVA 3UM1A 2R02A 2XS8A 2R03A 3ZXPA 3UM2A 2OEVA 3RAUA 3R9MA 3C3OA 1ZB1A 2R05A 3C3RA 3UM0A 3UM3A
chains in the Genus database with same CATH superfamily
3HXCA 2BEDA 3HVEB 4HOSA 3NAWA 4NURA 2PL2A 3EHQA 4AEZC 2P9IG 2VYIA 2IOSA 4GMRA 5ENQD 2V5FA 2XCCA 2GRPB 2XEVA 3OAWA 3MKQB 2WXNA 3QWWA 2QFCA 2RKKA 4XI0A 3NF1A 1V55E 4DPRA 1N4PA 4N39A 5ENNA 4EQFA 1TJCA 5D66A 1HX8A 5H7PA 1NI1A 3HXEA 4K5AB 3E37A 5FZSA 2X6JA 2WXGA 3B7SA 3D9PA 2FF4A 4CDRA 1OY3D 3T8KA 1JWGA 1YA0A 2HYZA 2R05A 3AS5A 1H0AA 2J07A 3VLFA 3N71A 2IU1A 1TN8A 2IONA 4JB8P 4I2ZA 3ML9A 1WM5A 2R17C 2YINA 3CK8A 2BF0X 3D9HA 1HFAA 3AS8A 1KT1A 4GA0A 1V54E 3ZEFA 1VDYA 2XHEA 1TEZA 5AQBA 2H6HA 3S7DA 3TJPA 1A17A 3MYVA 5D2MC 2AXZA 2X3MA 2WXKA 5LFAA 1O1SA 4Y6CA 3TG4A 3U4TA 3UM2A 2ZGGA 4EECA 1N52A 2KXPC 2WB2A 3EUVA 2DZOA 4G23A 3R7QA 2F8XK 1OCRE 3W9FA 4AY5A 3GZ1A 4GYOA 3RJVA 1XNFA 3CVQA 3IBEA 2CFUA 3SFZA 3G2TA 2XS1A 3L9TA 4BT8A 3CVUA 1BD8A 2VGYA 2XGSA 5ENOD 4ABNA 1LF8A 4KXKB 1MX4A 2BUGA 4F3VA 2J4BA 4KMOA 2Y3AA 3O4ZA 2H6FA 3ZU7B 5BW8C 3JXIA 3Q15A 2H6GA 4ZFHA 3MZLB 2VTBA 3TXNA 5JHAA 2GRMA 5FT9A 3CHQA 1MX6A 3NQPA 3T5VA 5ARGA 3ENEA 3ZIMA 1KT0A 4IULA 3EIQC 5JJTA 3MA5A 3HXBA 5JA4D 2KM4A 3FUJA 4FJYA 3S7BA 4MKTA 1TJFA 2X6FA 2WQ7A 2I9CA 3DXMG 2R2LA 5B3SE 1HU3A 4K5CA 4TV3A 1K8KG 1E8YA 5KJLA 3PE3A 4CYMD 3RKVA 3R9AB 3ZGQA 2HE0A 4NRHB 3ASFA 2CHWA 5KBAA 3FU3A 5AN8A 4J8EA 4U04A 1YMPA 3HYMB 4I17A 3U3WA 3Q49B 4GYYA 1P5QA 1YYHA 4Z68A 5G04C 4NQ0A 3PZDA 3QJZA 1JCSA 2ONDA 2ZU6B 3LXUX 2Y4TA 5HRYA 4M7CA 4I9EA 1FCHA 4TXRA 2XENA 3PVLA 4GMLA 4OVUA 1FPPA 5EN5D 3BG0B 4HI9A 4YVQC 2MRIA 3PE4A 4BFRA 2RD0A 1EYHA 5ENTD 2YNQA 1MQSA 2VGXB 3FUKA 5KJNA 1X81A 4GB9A 4KYOB 4DX5D 1OCCE 4N2QA 1IQRA 2WQHA 1LD7A 2XPYA 4JL0A 4F1PA 3SQVA 3TWRA 3S2AA 4BSXA 2L9BA 4I2WA 3FUFA 5HS0A 3B13A 3PEVB 4V3IA 5AJDA 4JEHA 5BV0A 3GZSA 4HB5A 5EX3A 4GZ6A 3HVEA 1QYMA 2DVWA 4B89A 4JPSA 3PREA 5HQ8A 4XIFA 2KCKA 2L6JA 4J0UA 4JA7A 4KZ0A 3IHVA 2LAIA 2XGMA 3B7RL 2FI7A 2PQRA 2DYRE 3ZKJA 2WXIA 3MV3B 3FTUA 1UW4B 1N9AA 2JEKA 2LSVA 3CHOA 4J7WA 3L54A 2WXJA 4PH4B 4WWOA 2NYJA 4Q69A 1SQMA 4ANWA 1NFIE 4CRWA 4PS7A 4FADA 5C1DA 4BSZB 4UWLA 3CLJA 4PS3A 4JHJA 4OAVB 3PUJA 3ZYKA 1OWOA 4I6EA 4CT0A 3KSQA 2YQ8A 3PZ1A 2VSNA 2Y4UA 4J8DA 2RG8A 5CECB 2WM9A 2P58C 4G25A 4G26A 3QAQA 3ML8A 2MOWA 4MS6A 3DSTA 2AXUA 2DIWA 1HH8A 1TNOA 4LSZE 2OEWA 1BLXB 4N5CA 1TNYA 1JUQA 2X6KA 3CEQA 4A63B 3RRNB 5ARFA 2L6BA 1O5MA 4EPZA 4JHKA 3FTXA 4N3CA 1INZA 2XZTG 1Y6IA 3E4BA 5ANLA 3ZPJA 3NOCD 4XKBA 2LO6A 4BY6A 4PS8A 4K03A 3JUIA 5J90A 2WXOA 4GTMA 3TWVA 5D0OD 1SVXA 4HNAD 3B95A 4DX6D 4EZLA 3AG1E 2P9NG 2VSYA 2EIME 4AP2A 3T9KA 3ASDA 3QDNA 5AIJA 3S7FA 3ESLA 3CVYA 1FVFA 3ONKA 1SZAA 2AW6A 2R02A 2IF4A 4IYPA 3RK6A 1UG3A 1NZNA 4UQXA 1BU9A 3RSEG 2PZIA 1N4SA 3KD7A 4C0EA 3CVWA 2ZXWE 1Z3YA 2WXQA 3L13A 4UWFA 3NBNB 4E6HA 4FA6A 3LY9A 2I6HA 2MHKA 4FHJA 3FUIA 5T4YA 3G2UA 2ETAA 3C3OA 3FU0A 4ANXA 3FUHA 1HG5A 3HXFA 1S0PA 4GCNA 3FH7A 5T8IA 1K1AA 2WXRA 3Q5MA 1HE8A 4ANVA 3UKRG 3FUMA 3R7RA 3CSTA 4GA1A 1WY6A 4ME2A 3RO2A 3RRMB 3HIZA 2A5EA 3I5PA 3RRUA 2UWJG 3HG0D 3FTZA 2P2CP 3QB2A 1E8WA 3CR3A 2VJ8A 1UOHA 3CVNA 1AP7A 2B0OE 4CT4A 3DSXA 4LNBA 1E8XA 3E34A 1TNBA 2X6HA 2GW1A 4X8QA 3ONLA 3L16A 2GRLA 3CV0A 2OEVA 4DI3A 3PZ2A 1H6OA 1N4QA 3Q47B 3AAAC 4YDWA 4ATZD 3SBSA 1JPLA 3ABME 4BEPA 2KBXA 4JEUA 4KBQA 5CEDB 2UY1A 3NB2A 5AJLA 4EBAG 2H6IA 3FEXA 5KJMA 2XPIA 2LNIA 3ISMC 4U63A 4UUCA 4JXTA 3FUNA 3IEGA 4F7AA 4NIKA 3D9NA 3HXDA 2XCBA 2QY7A 4AVXA 2V8SE 4GCOA 4GTRA 4ANUA 2PM6A 4A1GA 4A55A 3J5PA 1OWLA 2C2LA 3D9LA 3TWWA 2WMOA 3SBTB 2PQNA 4MLPA 4UWGA 2Y69E 2ILRA 3EHRA 3UIPC 2FBNA 2GGFA 3Q4AB 2XEEA 5FZQA 4HS2A 3DSUA 2OVBA 4L9PA 4C48B 3PZ4A 3AU5A 2RFAA 2MYOA 1HF8A 3Q9UC 5FWQA 4L1BA 4EBAA 1MYOA 2OVFA 4YDEA 4MBGA 4HOQA 2JLBA 3FULA 4G11A 1TN6A 5CHEE 4JD2G 3RU0A 1TNZA 2DZNA 2EIJE 1YCSB 3TWXA 2IY0C 4F53A 3QARA 4HRNA 3IHYA 3DXKG 4LG6A 5CBOA 1U3CA 3JYSA 3EHNA 3ZHEB 2KATA 3ABLE 2AXVA 1A5EA 2YHEA 2NC9A 3TGOA 4DX1A 3LVRE 2XRYA 3L82A 2L0TB 5JJ6A 4AY6A 3U9WA 2A5UA 2IO2C 3Q9NC 5ANRA 4O60A 1TNUA 3D9JA 4N2SA 3SF4A 1D9SA 2F0YA 2VGXA 5A6CA 1HG2A 2XQ0A 3ZRHA 5C2YA 2F8YA 2QYUA 3ZYQA 3FTVA 4QFVA 3TWUA 4KZCA 3RIBA 3JCKC 4Y6WA 3P1UA 1H2VC 2DCPA 1OWMA 1S63A 2P9LG 3Q7AA 4AXHA 4DI4A 1OCZE 3V31A 1PY1A 1ELWA 4XKCA 3MCXA 5T3RA 5EIBE 3JUEA 5JJ7A 1D8EA 3FU5A 2I2OA 4FHKA 3LPZA 4CEMA 4CCAA 4L2LA 1S64A 2KZTB 4J8SA 4UI9K 5CCMA 3NZSA 3SNXA 3SFYA 5FJYA 2GROB 2BKKB 4G1TA 1O1RA 3ASGA 1BI7B 4E85A 4CDMA 3EHMA 1N54A 1W3BA 3TWTA 1IYGA 1MHQA 4RQIA 1KZOA 1DCQA 5DIZA 3C72A 3PDNA 3KEAA 3JQ0A 3P2BA 3CQGB 3T8MA 2CG3A 3FU6A 3PNTB 3V2XA 3SO8A 3FH5A 2XEHA 3SGHA 3MEKA 1AWCB 1SZ9A 3CGHA 4J6IA 3UKUG 3ZYMA 3FTWA 3PH0C 3ZHEA 4AM9A 5HKPA 5AARA 3FUDA 1E7UA 4HFGA 1SA5A 3DSWA 5B1AE 1PAQA 2J9QA 4HQDA 2M63A 3O48A 3ABKE 2EINE 1N94A 1H19A 3CK7A 3PNLB 3UM1A 3FTSA 1OXJA 5FQ6A 5IY5E 2GRNB 1UJKA 3ZVVA 4YNDA 3UPVA 2V4HC 1ZB1A 3FEYA 4BX9A 3APCA 4YDOA 2P9PG 1PC2A 3U66A 3MV2B 5FQ8A 4BT9A 5FINA 4LCTA 3V2OA 1QBQA 3L22A 3NZUA 3UUXA 4HLEA 3AG4E 4RLYA 3APFA 4U8HA 3AS4A 3G2VA 3TWSA 4F1SA 2YHCA 4ILHB 3I4RB 3D3MA 1NL4A 1N95A 3PS6A 3Q79A 4I1AA 2L0IA 1OUVA 1WDYA 5KNGA 3UM0A 3BG1B 3NOGD 3UQ3A 4OAUC 5CMWA 5G05J 5CCLA 4AJWA 4WAFA 1HZ4A 4EZJA 1EPUA 3DEOA 4WWNA 3UX4A 2WMNA 4CGWA 3AJIA 3MKQA 3G2WA 3SFXA 2J09A 2LUHA 4L2YA 4U0SA 1K3ZD 3FUEA 1LD8A 2CHXA 5EILA 4FLBA 2WXMA 3B7TA 1RZ4A 3DWLG 3UT4A 1K1BA 2E2EA 4TRQA 5FQ4A 4EHMA 5ITZF 5CEAA 4HORA 1IXVA 3T5XA 3QK0A 4C9BB 4A3TA 5LX8A 3EU9A 2FO1E 3X2QE 1BPOA 5BT1A 2XRZA 4LRZA 5FIOA 5M72A 4GMJA 4U8VD 2V4LA 4F6RD 3DPYA 1N0RA 3QWPA 2C0MA 4DJAA 2CG2A 5A23A 5CMYA 1JCRA 5BNWA 4H7XA 2RFMA 1O1TA 4YDYA 4DLOA 2WXFA 3R9MA 2PNNA 1IQUA 4WUYA 2LAHA 4ACKA 3URZA 3E32A 4GZDA 2DYSE 3C3QA 2VSOE 3GZ2A 4AV7A 5BXOA 4BETA 3CVXA 5ENPD 4I6GA 1NP7A 2BTDA 4IN3B 4M3OA 3TG5A 2I1JA 5ENSD 3G2SA 2UY1B 1S70B 1OWPA 2EIKE 4RG9A 5BV1A 4HLLA 4K0RA 4UQYA 4U0ZA 4BWRA 5BXUA 1IKND 1U2VG 4J8YA 3DPDA 2LSUA 3SHFA 2AJAA 3CHMA 3V30A 2LXLA 3L6AA 3DEPA 2IQCA 3PUKA 1EF1C 3FP3A 4I43A 3W9GA 1MX2A 4GZ5A 4U95D 4ZHBA 2PM7A 4U07A 3LYAA 3TWQA 3AG3E 3PEUB 1H2TC 4KVOA 3UT7A 2EQXA 4BTBA 3AG2E 1N0QA 4G8LA 3FDHA 3PRZA 2CHZA 5G04J 1H6PA 2XS8A 1Q2ZA 3LEWA 1D8DA 4CZ2D 3OXGA 3SZ7A 3PZ3A 4DX7D 2P9KG 5KCMA 5CBNA 3KSLA 5CRUA 4UWHA 2VQ2A 4FU3A 2KCLA 1QNFA 4YVOA 4HRMB 3BEEA 2F37A 3LVQE 1QZ2A 1Z5SC 1SA4A 4WWPA 4H7YA 3FFLA 2QZAA 3MKRA 5J08A 4I6JA 3FTYA 4JA9A 1FT1A 1IHGA 4GZ3A 1GW6A 3BQOA 3APDA 5B1BE 3UIOC 4LERA 2B6CA 2ETBA 4URKA 3LCAA 4DRXE 3OTNA 5AYWD 4NACA 4U7EB 4TUUA 1WAO1 2V5QC 2R03A 2X6IA 3VTXA 1UN9A 1N4RA 1UN8A 3ZYLA 4APFA 1TYQG 3VLDA 4HXIA 3I4GA 3OXLA 5EX0A 2BKGA 2KCVA 4MRUA 3DBSA 3Q78A 3UXGA 2Y1LE 4GAAA 4O1PA 3E33A 4GTPA 1MJ0A 5AAOA 4JC8A 3DSSA 5BUZA 1H2UA 1E96B 4A1SA 1Z3XA 4UQZA 1FVHA 5AQ9A 3RAUA 4OYSA 4U0UA 4BERA 4FC8A 3GYZA 4WNGA 4PUCA 3LJNA 4RG6A 2NXPA 3IKOB 5KNHD 2ZISA 2J49A 4HOUA 3FY4A 3QKYA 4O1OA 4B8AA 1HXIA 4UWKA 4RVBA 5AENA 2I1KA 4XE0A 4ATGA 4JHRA 4DUIA 3BUAA 3UT8A 2DWZA 3K9IA 3LDZA 2ETCA 3ZNGA 3ULEG 1KZPA 3VLEA 4N3AA 3CIAA 3JXJA 3FHEA 1WG0A 3SY2A 4N3BA 3V79K 4N5QA 3ZXPA 4CGVA 5EYPF 4C0MA 1G3NB 3CHPA 4GTOA 2IOLA 2AWIA 5G05C 4BX8A 4L7TA 3LY8A 5A7DB 2P9UG 4TXPA 4GPMA 3CKCA 2QYJA 4IRUA 3EJNA 2HO1A 3GW4A 1SW6A 1DNPA 3CHRA 3ULYA 5ENRD 2VGEA 1IHBA 1DVPA 2P9SG 4B93B 3QNKA 3D9OA 1LTXA 5FQ7A 3J5QB 4ILGA 3CVLA 2Y0BG 4JVSA 3WG7E 2R59A 5KWDA 4KT6B 4GTTA 1OWNA 1OT8A 2OCCE 1U3DA 3CVVA 3CSFA 2QC9A 3Q7FA 3ZW3A 2J08A 3U64A 3CHSA 3F6QA 1NA0A 4FULA 3CKBA 2C0LA 1ZBPA 2FULA 3LJ3A 4FP7A 1TR4A 1TN7A 2HR2A 2V0PA 4JW1A 2EILE 4TXQA 4UI9J 4B8CB 4HRLA 3ESKA 3CQCB 1FT2A 4A3VA 4LEUA 5FZRA 1ZU2A 4Q94A 2XZDG 2VTBB 4UI9C 4BTAA 4FJZA 3FWVA 1JCQA 3D9IA 2GRQB 2KZTA 4P29A 4HOTA 3ZFWA 1E7VA 4W9RA 3EDTB 5HI7A 1JWFA 1BI8B 3UTMA 3B7BA 2KC7A 5AQ7A 1QQEA 4OVVA 3MGBA 3B7UX 4HVBA 5CRVA 1L5JA 5D0QD 3D9KA 4PDXA 4ILIA 3UI2A 1DCEA 4K5BA 3HRAA 2WPVA 5LOZA 2AVPA 5EKQD 4G2VA 2IEJA 3MX3A 5G2NA 5JMND 4APOA 5CERB 4J8FA 5LCWC 2R5SA 1N11A 4GA2A 3CVPA 4Q96A 2WVIA 5E75A 4GZCA 4U8YD 2WXHA 2ZGDA 4U96D 4L23A 2FEZA 3ULQA 5DBKA 3LS8A 1X5BA 4I1MA 3DSVA 4HBDA 3DRAA 2WXPA 1E90A 3LKUA 3UM3A 3SD5A 4GTVA 3KAEA 1E8ZA 4TUMA 4B0ZA 1UJJA 1HS6A 1OCOE 4XI9A 1B89A 3C98A 3MJWA 4LUNU 5G55A 3QWVA 3ZXSA 3TXMA 4BESA 4LNUD 3JQ1A 4GTQA 1KPSB 3ZN3A 4D10C 5LCWJ 3C3RA 2J8SD 3ASOE 2LXMA 2IO3C 3KEZA 2Q7FA 5FTPA 2J4DA 4GTSA 4CDNA 4RSYA 3HDXA 2GRRB 1XGWA 4FLHA 5KJKA 3FH8A 4WNDA 3ASNE 4GYWA 3UINC 3L17A 3KS2A 4KVMA 4HI8A 1DC2A 2XPZA 3VTYA 2WXLA 4GPKA 3WXXA 3D9MA 1ELRA 2IFUA 5AQAA 5EIDA 1ELKA 1NA3A 5JHBA 2X38A 1HO8A 2HM8A 3ASHA 4XX5A 3L08A 5E76A 3RO3A 4O6FA 3E30A 3EIJA 2WQ6A 3EU5A 3CK9A 4QQIA 4R7LA 4DK5A 2CFZA 4DX2A 4LNGA 4EZKA 2VSXE 4B94A 4I9CA 4G8KA 5LP0A 3QC1A 1KLXA 4XEIG 4WNEA 3IV0A 1EDUA 3TAXA 3OXFA 4JZYA 4WNFA 5BPPA 3BU8A 2JABA 3I3NA 4AOFA 3LY7A 5EDSA 3ZUVB 3C5RA 4I1OB 3UMVA 4ACLA 4AIFA 2ZIRA 1Z6TA 3Q73A 3TL5A 2FO7A 1MZCA 2NSZA 2IJGX 4XZ4A 2A4ZA 1RW2A 2DBAA 2E0IA 4GU5A 3QOUA 2OV8A 4G24A 3AU4A 3SI5A 3IXEA 5EYLA 2OOEA 1H6KA 3Q75A 4DLQA 3S7JA 3HHMA 1Y8MA 2XGOA
chains in the Genus database with same CATH topology
5CRUA 3C3QA 3ULYA 2OEWA 2XS1A 5CRVA 3UM1A 2R02A 2XS8A 2R03A 3ZXPA 3UM2A 2OEVA 3RAUA 3UM3A 3R9MA 2OEXA 3C3OA 2OJQA 4JIOA 1ZB1A 3C3RA 3UM0A 2R05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CRU A;  3C3Q A;  3ULY A;  2OEW A;  2XS1 A;  5CRV A;  3UM1 A;  2R02 A;  2XS8 A;  2R03 A;  3ZXP A;  3UM2 A;  2OEV A;  3RAU A;  3R9M A;  3C3O A;  1ZB1 A;  2R05 A;  3C3R A;  3UM0 A;  3UM3 A; 
#chains in the Genus database with same CATH topology
 3HXC A;  2BED A;  3HVE B;  4HOS A;  3NAW A;  4NUR A;  2PL2 A;  3EHQ A;  4AEZ C;  2P9I G;  2VYI A;  2IOS A;  4GMR A;  5ENQ D;  2V5F A;  2XCC A;  2GRP B;  2XEV A;  3OAW A;  3MKQ B;  2WXN A;  3QWW A;  2QFC A;  2RKK A;  4XI0 A;  3NF1 A;  1V55 E;  4DPR A;  1N4P A;  4N39 A;  5ENN A;  4EQF A;  1TJC A;  5D66 A;  1HX8 A;  5H7P A;  1NI1 A;  3HXE A;  4K5A B;  3E37 A;  5FZS A;  2X6J A;  2WXG A;  3B7S A;  3D9P A;  2FF4 A;  4CDR A;  1OY3 D;  3T8K A;  1JWG A;  1YA0 A;  2HYZ A;  2R05 A;  3AS5 A;  1H0A A;  2J07 A;  3VLF A;  3N71 A;  2IU1 A;  1TN8 A;  2ION A;  4JB8 P;  4I2Z A;  3ML9 A;  1WM5 A;  2R17 C;  2YIN A;  3CK8 A;  2BF0 X;  3D9H A;  1HFA A;  3AS8 A;  1KT1 A;  4GA0 A;  1V54 E;  3ZEF A;  1VDY A;  2XHE A;  1TEZ A;  5AQB A;  2H6H A;  3S7D A;  3TJP A;  1A17 A;  3MYV A;  5D2M C;  2AXZ A;  2X3M A;  2WXK A;  5LFA A;  1O1S A;  4Y6C A;  3TG4 A;  3U4T A;  3UM2 A;  2ZGG A;  4EEC A;  1N52 A;  2KXP C;  2WB2 A;  3EUV A;  2DZO A;  4G23 A;  3R7Q A;  2F8X K;  1OCR E;  3W9F A;  4AY5 A;  3GZ1 A;  4GYO A;  3RJV A;  1XNF A;  3CVQ A;  3IBE A;  2CFU A;  3SFZ A;  3G2T A;  2XS1 A;  3L9T A;  4BT8 A;  3CVU A;  1BD8 A;  2VGY A;  2XGS A;  5ENO D;  4ABN A;  1LF8 A;  4KXK B;  1MX4 A;  2BUG A;  4F3V A;  2J4B A;  4KMO A;  2Y3A A;  3O4Z A;  2H6F A;  3ZU7 B;  5BW8 C;  3JXI A;  3Q15 A;  2H6G A;  4ZFH A;  3MZL B;  2VTB A;  3TXN A;  5JHA A;  2GRM A;  5FT9 A;  3CHQ A;  1MX6 A;  3NQP A;  3T5V A;  5ARG A;  3ENE A;  3ZIM A;  1KT0 A;  4IUL A;  3EIQ C;  5JJT A;  3MA5 A;  3HXB A;  5JA4 D;  2KM4 A;  3FUJ A;  4FJY A;  3S7B A;  4MKT A;  1TJF A;  2X6F A;  2WQ7 A;  2I9C A;  3DXM G;  2R2L A;  5B3S E;  1HU3 A;  4K5C A;  4TV3 A;  1K8K G;  1E8Y A;  5KJL A;  3PE3 A;  4CYM D;  3RKV A;  3R9A B;  3ZGQ A;  2HE0 A;  4NRH B;  3ASF A;  2CHW A;  5KBA A;  3FU3 A;  5AN8 A;  4J8E A;  4U04 A;  1YMP A;  3HYM B;  4I17 A;  3U3W A;  3Q49 B;  4GYY A;  1P5Q A;  1YYH A;  4Z68 A;  5G04 C;  4NQ0 A;  3PZD A;  3QJZ A;  1JCS A;  2OND A;  2ZU6 B;  3LXU X;  2Y4T A;  5HRY A;  4M7C A;  4I9E A;  1FCH A;  4TXR A;  2XEN A;  3PVL A;  4GML A;  4OVU A;  1FPP A;  5EN5 D;  3BG0 B;  4HI9 A;  4YVQ C;  2MRI A;  3PE4 A;  4BFR A;  2RD0 A;  1EYH A;  5ENT D;  2YNQ A;  1MQS A;  2VGX B;  3FUK A;  5KJN A;  1X81 A;  4GB9 A;  4KYO B;  4DX5 D;  1OCC E;  4N2Q A;  1IQR A;  2WQH A;  1LD7 A;  2XPY A;  4JL0 A;  4F1P A;  3SQV A;  3TWR A;  3S2A A;  4BSX A;  2L9B A;  4I2W A;  3FUF A;  5HS0 A;  3B13 A;  3PEV B;  4V3I A;  5AJD A;  4JEH A;  5BV0 A;  3GZS A;  4HB5 A;  5EX3 A;  4GZ6 A;  3HVE A;  1QYM A;  2DVW A;  4B89 A;  4JPS A;  3PRE A;  5HQ8 A;  4XIF A;  2KCK A;  2L6J A;  4J0U A;  4JA7 A;  4KZ0 A;  3IHV A;  2LAI A;  2XGM A;  3B7R L;  2FI7 A;  2PQR A;  2DYR E;  3ZKJ A;  2WXI A;  3MV3 B;  3FTU A;  1UW4 B;  1N9A A;  2JEK A;  2LSV A;  3CHO A;  4J7W A;  3L54 A;  2WXJ A;  4PH4 B;  4WWO A;  2NYJ A;  4Q69 A;  1SQM A;  4ANW A;  1NFI E;  4CRW A;  4PS7 A;  4FAD A;  5C1D A;  4BSZ B;  4UWL A;  3CLJ A;  4PS3 A;  4JHJ A;  4OAV B;  3PUJ A;  3ZYK A;  1OWO A;  4I6E A;  4CT0 A;  3KSQ A;  2YQ8 A;  3PZ1 A;  2VSN A;  2Y4U A;  4J8D A;  2RG8 A;  5CEC B;  2WM9 A;  2P58 C;  4G25 A;  4G26 A;  3QAQ A;  3ML8 A;  2MOW A;  4MS6 A;  3DST A;  2AXU A;  2DIW A;  1HH8 A;  1TNO A;  4LSZ E;  2OEW A;  1BLX B;  4N5C A;  1TNY A;  1JUQ A;  2X6K A;  3CEQ A;  4A63 B;  3RRN B;  5ARF A;  2L6B A;  1O5M A;  4EPZ A;  4JHK A;  3FTX A;  4N3C A;  1INZ A;  2XZT G;  1Y6I A;  3E4B A;  5ANL A;  3ZPJ A;  3NOC D;  4XKB A;  2LO6 A;  4BY6 A;  4PS8 A;  4K03 A;  3JUI A;  5J90 A;  2WXO A;  4GTM A;  3TWV A;  5D0O D;  1SVX A;  4HNA D;  3B95 A;  4DX6 D;  4EZL A;  3AG1 E;  2P9N G;  2VSY A;  2EIM E;  4AP2 A;  3T9K A;  3ASD A;  3QDN A;  5AIJ A;  3S7F A;  3ESL A;  3CVY A;  1FVF A;  3ONK A;  1SZA A;  2AW6 A;  2R02 A;  2IF4 A;  4IYP A;  3RK6 A;  1UG3 A;  1NZN A;  4UQX A;  1BU9 A;  3RSE G;  2PZI A;  1N4S A;  3KD7 A;  4C0E A;  3CVW A;  2ZXW E;  1Z3Y A;  2WXQ A;  3L13 A;  4UWF A;  3NBN B;  4E6H A;  4FA6 A;  3LY9 A;  2I6H A;  2MHK A;  4FHJ A;  3FUI A;  5T4Y A;  3G2U A;  2ETA A;  3C3O A;  3FU0 A;  4ANX A;  3FUH A;  1HG5 A;  3HXF A;  1S0P A;  4GCN A;  3FH7 A;  5T8I A;  1K1A A;  2WXR A;  3Q5M A;  1HE8 A;  4ANV A;  3UKR G;  3FUM A;  3R7R A;  3CST A;  4GA1 A;  1WY6 A;  4ME2 A;  3RO2 A;  3RRM B;  3HIZ A;  2A5E A;  3I5P A;  3RRU A;  2UWJ G;  3HG0 D;  3FTZ A;  2P2C P;  3QB2 A;  1E8W A;  3CR3 A;  2VJ8 A;  1UOH A;  3CVN A;  1AP7 A;  2B0O E;  4CT4 A;  3DSX A;  4LNB A;  1E8X A;  3E34 A;  1TNB A;  2X6H A;  2GW1 A;  4X8Q A;  3ONL A;  3L16 A;  2GRL A;  3CV0 A;  2OEV A;  4DI3 A;  3PZ2 A;  1H6O A;  1N4Q A;  3Q47 B;  3AAA C;  4YDW A;  4ATZ D;  3SBS A;  1JPL A;  3ABM E;  4BEP A;  2KBX A;  4JEU A;  4KBQ A;  5CED B;  2UY1 A;  3NB2 A;  5AJL A;  4EBA G;  2H6I A;  3FEX A;  5KJM A;  2XPI A;  2LNI A;  3ISM C;  4U63 A;  4UUC A;  4JXT A;  3FUN A;  3IEG A;  4F7A A;  4NIK A;  3D9N A;  3HXD A;  2XCB A;  2QY7 A;  4AVX A;  2V8S E;  4GCO A;  4GTR A;  4ANU A;  2PM6 A;  4A1G A;  4A55 A;  3J5P A;  1OWL A;  2C2L A;  3D9L A;  3TWW A;  2WMO A;  3SBT B;  2PQN A;  4MLP A;  4UWG A;  2Y69 E;  2ILR A;  3EHR A;  3UIP C;  2FBN A;  2GGF A;  3Q4A B;  2XEE A;  5FZQ A;  4HS2 A;  3DSU A;  2OVB A;  4L9P A;  4C48 B;  3PZ4 A;  3AU5 A;  2RFA A;  2MYO A;  1HF8 A;  3Q9U C;  5FWQ A;  4L1B A;  4EBA A;  1MYO A;  2OVF A;  4YDE A;  4MBG A;  4HOQ A;  2JLB A;  3FUL A;  4G11 A;  1TN6 A;  5CHE E;  4JD2 G;  3RU0 A;  1TNZ A;  2DZN A;  2EIJ E;  1YCS B;  3TWX A;  2IY0 C;  4F53 A;  3QAR A;  4HRN A;  3IHY A;  3DXK G;  4LG6 A;  5CBO A;  1U3C A;  3JYS A;  3EHN A;  3ZHE B;  2KAT A;  3ABL E;  2AXV A;  1A5E A;  2YHE A;  2NC9 A;  3TGO A;  4DX1 A;  3LVR E;  2XRY A;  3L82 A;  2L0T B;  5JJ6 A;  4AY6 A;  3U9W A;  2A5U A;  2IO2 C;  3Q9N C;  5ANR A;  4O60 A;  1TNU A;  3D9J A;  4N2S A;  3SF4 A;  1D9S A;  2F0Y A;  2VGX A;  5A6C A;  1HG2 A;  2XQ0 A;  3ZRH A;  5C2Y A;  2F8Y A;  2QYU A;  3ZYQ A;  3FTV A;  4QFV A;  3TWU A;  4KZC A;  3RIB A;  3JCK C;  4Y6W A;  3P1U A;  1H2V C;  2DCP A;  1OWM A;  1S63 A;  2P9L G;  3Q7A A;  4AXH A;  4DI4 A;  1OCZ E;  3V31 A;  1PY1 A;  1ELW A;  4XKC A;  3MCX A;  5T3R A;  5EIB E;  3JUE A;  5JJ7 A;  1D8E A;  3FU5 A;  2I2O A;  4FHK A;  3LPZ A;  4CEM A;  4CCA A;  4L2L A;  1S64 A;  2KZT B;  4J8S A;  4UI9 K;  5CCM A;  3NZS A;  3SNX A;  3SFY A;  5FJY A;  2GRO B;  2BKK B;  4G1T A;  1O1R A;  3ASG A;  1BI7 B;  4E85 A;  4CDM A;  3EHM A;  1N54 A;  1W3B A;  3TWT A;  1IYG A;  1MHQ A;  4RQI A;  1KZO A;  1DCQ A;  5DIZ A;  3C72 A;  3PDN A;  3KEA A;  3JQ0 A;  3P2B A;  3CQG B;  3T8M A;  2CG3 A;  3FU6 A;  3PNT B;  3V2X A;  3SO8 A;  3FH5 A;  2XEH A;  3SGH A;  3MEK A;  1AWC B;  1SZ9 A;  3CGH A;  4J6I A;  3UKU G;  3ZYM A;  3FTW A;  3PH0 C;  3ZHE A;  4AM9 A;  5HKP A;  5AAR A;  3FUD A;  1E7U A;  4HFG A;  1SA5 A;  3DSW A;  5B1A E;  1PAQ A;  2J9Q A;  4HQD A;  2M63 A;  3O48 A;  3ABK E;  2EIN E;  1N94 A;  1H19 A;  3CK7 A;  3PNL B;  3UM1 A;  3FTS A;  1OXJ A;  5FQ6 A;  5IY5 E;  2GRN B;  1UJK A;  3ZVV A;  4YND A;  3UPV A;  2V4H C;  1ZB1 A;  3FEY A;  4BX9 A;  3APC A;  4YDO A;  2P9P G;  1PC2 A;  3U66 A;  3MV2 B;  5FQ8 A;  4BT9 A;  5FIN A;  4LCT A;  3V2O A;  1QBQ A;  3L22 A;  3NZU A;  3UUX A;  4HLE A;  3AG4 E;  4RLY A;  3APF A;  4U8H A;  3AS4 A;  3G2V A;  3TWS A;  4F1S A;  2YHC A;  4ILH B;  3I4R B;  3D3M A;  1NL4 A;  1N95 A;  3PS6 A;  3Q79 A;  4I1A A;  2L0I A;  1OUV A;  1WDY A;  5KNG A;  3UM0 A;  3BG1 B;  3NOG D;  3UQ3 A;  4OAU C;  5CMW A;  5G05 J;  5CCL A;  4AJW A;  4WAF A;  1HZ4 A;  4EZJ A;  1EPU A;  3DEO A;  4WWN A;  3UX4 A;  2WMN A;  4CGW A;  3AJI A;  3MKQ A;  3G2W A;  3SFX A;  2J09 A;  2LUH A;  4L2Y A;  4U0S A;  1K3Z D;  3FUE A;  1LD8 A;  2CHX A;  5EIL A;  4FLB A;  2WXM A;  3B7T A;  1RZ4 A;  3DWL G;  3UT4 A;  1K1B A;  2E2E A;  4TRQ A;  5FQ4 A;  4EHM A;  5ITZ F;  5CEA A;  4HOR A;  1IXV A;  3T5X A;  3QK0 A;  4C9B B;  4A3T A;  5LX8 A;  3EU9 A;  2FO1 E;  3X2Q E;  1BPO A;  5BT1 A;  2XRZ A;  4LRZ A;  5FIO A;  5M72 A;  4GMJ A;  4U8V D;  2V4L A;  4F6R D;  3DPY A;  1N0R A;  3QWP A;  2C0M A;  4DJA A;  2CG2 A;  5A23 A;  5CMY A;  1JCR A;  5BNW A;  4H7X A;  2RFM A;  1O1T A;  4YDY A;  4DLO A;  2WXF A;  3R9M A;  2PNN A;  1IQU A;  4WUY A;  2LAH A;  4ACK A;  3URZ A;  3E32 A;  4GZD A;  2DYS E;  3C3Q A;  2VSO E;  3GZ2 A;  4AV7 A;  5BXO A;  4BET A;  3CVX A;  5ENP D;  4I6G A;  1NP7 A;  2BTD A;  4IN3 B;  4M3O A;  3TG5 A;  2I1J A;  5ENS D;  3G2S A;  2UY1 B;  1S70 B;  1OWP A;  2EIK E;  4RG9 A;  5BV1 A;  4HLL A;  4K0R A;  4UQY A;  4U0Z A;  4BWR A;  5BXU A;  1IKN D;  1U2V G;  4J8Y A;  3DPD A;  2LSU A;  3SHF A;  2AJA A;  3CHM A;  3V30 A;  2LXL A;  3L6A A;  3DEP A;  2IQC A;  3PUK A;  1EF1 C;  3FP3 A;  4I43 A;  3W9G A;  1MX2 A;  4GZ5 A;  4U95 D;  4ZHB A;  2PM7 A;  4U07 A;  3LYA A;  3TWQ A;  3AG3 E;  3PEU B;  1H2T C;  4KVO A;  3UT7 A;  2EQX A;  4BTB A;  3AG2 E;  1N0Q A;  4G8L A;  3FDH A;  3PRZ A;  2CHZ A;  5G04 J;  1H6P A;  2XS8 A;  1Q2Z A;  3LEW A;  1D8D A;  4CZ2 D;  3OXG A;  3SZ7 A;  3PZ3 A;  4DX7 D;  2P9K G;  5KCM A;  5CBN A;  3KSL A;  5CRU A;  4UWH A;  2VQ2 A;  4FU3 A;  2KCL A;  1QNF A;  4YVO A;  4HRM B;  3BEE A;  2F37 A;  3LVQ E;  1QZ2 A;  1Z5S C;  1SA4 A;  4WWP A;  4H7Y A;  3FFL A;  2QZA A;  3MKR A;  5J08 A;  4I6J A;  3FTY A;  4JA9 A;  1FT1 A;  1IHG A;  4GZ3 A;  1GW6 A;  3BQO A;  3APD A;  5B1B E;  3UIO C;  4LER A;  2B6C A;  2ETB A;  4URK A;  3LCA A;  4DRX E;  3OTN A;  5AYW D;  4NAC A;  4U7E B;  4TUU A;  1WAO 1;  2V5Q C;  2R03 A;  2X6I A;  3VTX A;  1UN9 A;  1N4R A;  1UN8 A;  3ZYL A;  4APF A;  1TYQ G;  3VLD A;  4HXI A;  3I4G A;  3OXL A;  5EX0 A;  2BKG A;  2KCV A;  4MRU A;  3DBS A;  3Q78 A;  3UXG A;  2Y1L E;  4GAA A;  4O1P A;  3E33 A;  4GTP A;  1MJ0 A;  5AAO A;  4JC8 A;  3DSS A;  5BUZ A;  1H2U A;  1E96 B;  4A1S A;  1Z3X A;  4UQZ A;  1FVH A;  5AQ9 A;  3RAU A;  4OYS A;  4U0U A;  4BER A;  4FC8 A;  3GYZ A;  4WNG A;  4PUC A;  3LJN A;  4RG6 A;  2NXP A;  3IKO B;  5KNH D;  2ZIS A;  2J49 A;  4HOU A;  3FY4 A;  3QKY A;  4O1O A;  4B8A A;  1HXI A;  4UWK A;  4RVB A;  5AEN A;  2I1K A;  4XE0 A;  4ATG A;  4JHR A;  4DUI A;  3BUA A;  3UT8 A;  2DWZ A;  3K9I A;  3LDZ A;  2ETC A;  3ZNG A;  3ULE G;  1KZP A;  3VLE A;  4N3A A;  3CIA A;  3JXJ A;  3FHE A;  1WG0 A;  3SY2 A;  4N3B A;  3V79 K;  4N5Q A;  3ZXP A;  4CGV A;  5EYP F;  4C0M A;  1G3N B;  3CHP A;  4GTO A;  2IOL A;  2AWI A;  5G05 C;  4BX8 A;  4L7T A;  3LY8 A;  5A7D B;  2P9U G;  4TXP A;  4GPM A;  3CKC A;  2QYJ A;  4IRU A;  3EJN A;  2HO1 A;  3GW4 A;  1SW6 A;  1DNP A;  3CHR A;  3ULY A;  5ENR D;  2VGE A;  1IHB A;  1DVP A;  2P9S G;  4B93 B;  3QNK A;  3D9O A;  1LTX A;  5FQ7 A;  3J5Q B;  4ILG A;  3CVL A;  2Y0B G;  4JVS A;  3WG7 E;  2R59 A;  5KWD A;  4KT6 B;  4GTT A;  1OWN A;  1OT8 A;  2OCC E;  1U3D A;  3CVV A;  3CSF A;  2QC9 A;  3Q7F A;  3ZW3 A;  2J08 A;  3U64 A;  3CHS A;  3F6Q A;  1NA0 A;  4FUL A;  3CKB A;  2C0L A;  1ZBP A;  2FUL A;  3LJ3 A;  4FP7 A;  1TR4 A;  1TN7 A;  2HR2 A;  2V0P A;  4JW1 A;  2EIL E;  4TXQ A;  4UI9 J;  4B8C B;  4HRL A;  3ESK A;  3CQC B;  1FT2 A;  4A3V A;  4LEU A;  5FZR A;  1ZU2 A;  4Q94 A;  2XZD G;  2VTB B;  4UI9 C;  4BTA A;  4FJZ A;  3FWV A;  1JCQ A;  3D9I A;  2GRQ B;  2KZT A;  4P29 A;  4HOT A;  3ZFW A;  1E7V A;  4W9R A;  3EDT B;  5HI7 A;  1JWF A;  1BI8 B;  3UTM A;  3B7B A;  2KC7 A;  5AQ7 A;  1QQE A;  4OVV A;  3MGB A;  3B7U X;  4HVB A;  5CRV A;  1L5J A;  5D0Q D;  3D9K A;  4PDX A;  4ILI A;  3UI2 A;  1DCE A;  4K5B A;  3HRA A;  2WPV A;  5LOZ A;  2AVP A;  5EKQ D;  4G2V A;  2IEJ A;  3MX3 A;  5G2N A;  5JMN D;  4APO A;  5CER B;  4J8F A;  5LCW C;  2R5S A;  1N11 A;  4GA2 A;  3CVP A;  4Q96 A;  2WVI A;  5E75 A;  4GZC A;  4U8Y D;  2WXH A;  2ZGD A;  4U96 D;  4L23 A;  2FEZ A;  3ULQ A;  5DBK A;  3LS8 A;  1X5B A;  4I1M A;  3DSV A;  4HBD A;  3DRA A;  2WXP A;  1E90 A;  3LKU A;  3UM3 A;  3SD5 A;  4GTV A;  3KAE A;  1E8Z A;  4TUM A;  4B0Z A;  1UJJ A;  1HS6 A;  1OCO E;  4XI9 A;  1B89 A;  3C98 A;  3MJW A;  4LUN U;  5G55 A;  3QWV A;  3ZXS A;  3TXM A;  4BES A;  4LNU D;  3JQ1 A;  4GTQ A;  1KPS B;  3ZN3 A;  4D10 C;  5LCW J;  3C3R A;  2J8S D;  3ASO E;  2LXM A;  2IO3 C;  3KEZ A;  2Q7F A;  5FTP A;  2J4D A;  4GTS A;  4CDN A;  4RSY A;  3HDX A;  2GRR B;  1XGW A;  4FLH A;  5KJK A;  3FH8 A;  4WND A;  3ASN E;  4GYW A;  3UIN C;  3L17 A;  3KS2 A;  4KVM A;  4HI8 A;  1DC2 A;  2XPZ A;  3VTY A;  2WXL A;  4GPK A;  3WXX A;  3D9M A;  1ELR A;  2IFU A;  5AQA A;  5EID A;  1ELK A;  1NA3 A;  5JHB A;  2X38 A;  1HO8 A;  2HM8 A;  3ASH A;  4XX5 A;  3L08 A;  5E76 A;  3RO3 A;  4O6F A;  3E30 A;  3EIJ A;  2WQ6 A;  3EU5 A;  3CK9 A;  4QQI A;  4R7L A;  4DK5 A;  2CFZ A;  4DX2 A;  4LNG A;  4EZK A;  2VSX E;  4B94 A;  4I9C A;  4G8K A;  5LP0 A;  3QC1 A;  1KLX A;  4XEI G;  4WNE A;  3IV0 A;  1EDU A;  3TAX A;  3OXF A;  4JZY A;  4WNF A;  5BPP A;  3BU8 A;  2JAB A;  3I3N A;  4AOF A;  3LY7 A;  5EDS A;  3ZUV B;  3C5R A;  4I1O B;  3UMV A;  4ACL A;  4AIF A;  2ZIR A;  1Z6T A;  3Q73 A;  3TL5 A;  2FO7 A;  1MZC A;  2NSZ A;  2IJG X;  4XZ4 A;  2A4Z A;  1RW2 A;  2DBA A;  2E0I A;  4GU5 A;  3QOU A;  2OV8 A;  4G24 A;  3AU4 A;  3SI5 A;  3IXE A;  5EYL A;  2OOE A;  1H6K A;  3Q75 A;  4DLQ A;  3S7J A;  3HHM A;  1Y8M A;  2XGO A; 
#chains in the Genus database with same CATH homology
 5CRU A;  3C3Q A;  3ULY A;  2OEW A;  2XS1 A;  5CRV A;  3UM1 A;  2R02 A;  2XS8 A;  2R03 A;  3ZXP A;  3UM2 A;  2OEV A;  3RAU A;  3UM3 A;  3R9M A;  2OEX A;  3C3O A;  2OJQ A;  4JIO A;  1ZB1 A;  3C3R A;  3UM0 A;  2R05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...