3C3SA

Role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWAHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 64
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3c3sA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3c3sA02
1B06A 2ADQB 1XDCA 1EN4A 1SZXA 1ZLZA 1QNMA 1AVMA 1GN2A 4F6EA 1BS3A 2QKAA 1ZSPA 5A9GA 3DC6A 1ZUQA 1N0NA 3KKYA 1KKCA 3OT7A 1GN4A 1MSDA 1JA8A 3RN4A 1I0HA 4X9QA 4GUNA 3EVKA 1MA1A 4JYYA 1IXBA 4YIPA 3DC5A 1EM1A 2ADPA 3C3TA 1EN6A 3C3SA 1VARA 1MMMA 1AP5A 5AG2A 3LSUA 1P7GA 2QKCA 4YIOA 1WB7A 1AR4A 1N0JA 4JZ2A 1XUQA 4FFKA 1I08A 1GN3A 2GDSA 4JZGA 1LUVA 1WB8A 1AR5A 2AW9A 1IX9A 3CEIA 1AP6A 4C7UA 2RCVA 3K9SA 2CE4A 1GN6A 2P4KA 3AK1A 2CDYA 1ZTEA 3AK2A 3IC9A 3TJTA 1BSMA 1IDSA 4E4EA 1XREA 3AK3A 3BFRA 1D5NA 4BR6A 1MNGA 1BT8A 1VEWA 1Y67A 3MDSA 1LUWA 1PM9A 1XILA 1JR9A 1EN5A 1PL4A 3QVNA
chains in the Genus database with same CATH superfamily
3CSXA 3VQVA 2ZXWC 4WCEV 1QVGU 4WFFA 4GYCB 3AG2B 5E79Z 3G67A 3OTFA 5BMVB 1PL0A 2Q9LA 1AI5A 1R3LC 2ZR2A 4NXNO 1VQMV 4JV5B 1B6QA 1B04A 3HKBA 3RN4A 3CP1A 3SYAA 4RQFA 4ICGA 1BGYH 4LFAB 1GO3F 4LF8O 4PV1B 1HP8A 1PNMA 4CS3A 4Z1MG 3CCMV 3K3WA 3HKEB 4UCOA 4UCRA 1OCCC 4I4TB 1K5QA 3ZIAG 4LF5B 1EM1A 1HW7A 4JI3B 5LXTB 1Q90D 1SA0A 1FXHA 3JALA 4OX9B 3OEHG 2QWNB 2ODMA 3BY6A 2YEVA 5EC1C 2YC0A 2DYRC 1KP2A 1H2KA 2ZCEA 5JJNB 3D3QA 3FFQA 1YITV 3ABUA 4RAIA 4FLUA 1IX9A 2JS3A 2ZM6O 3HKCB 3R66A 1VQ7V 2MW2B 4P2ZA 1I5YA 1XHXA 2IW5A 3ZCCA 3ZEDA 2C2AA 1T5EA 2IBZH 2PF4E 2ZNIA 2VRZA 1G6UA 1GK9A 2GTAA 1HWYA 1XOUA 1FOUA 2XAJA 1QVFU 1VEWA 2UXBO 2F1MA 1UJWB 3L73H 5JJEB 2CTQA 4ZI7B 4P9OA 5IT9N 3HKDA 2WLIB 1SQBH 1NJIW 4WBNB 2VQFO 5KHJA 4DV0B 3RFRA 1TUEB 2E76B 5IYDO 1ZSPA 2IJIA 1YIJV 5C93A 3RYHB 3W7SA 5JH7B 3VQWA 1YXBA 3OUSA 1AI6A 3DC6A 2DW4A 2PYJA 4B7KA 3JD4A 1N32B 5FPOA 3K04A 5CMUA 3BABA 4IL6Z 3UKMA 5LXTA 1ZL8A 3CCQV 1Q6HA 4J9YB 4JYYA 2YIBD 1LR1A 1YF2A 3JSLA 2DWEC 2LQTA 4X65O 1DK1A 4DW1A 2RQ6A 1YDXA 4BIUA 4L87A 4F6RA 3ETDA 1E79G 5KUMA 1J5EB 3OAAG 3J81N 1MG1A 5FLXN 3ZS8C 4O4HB 3E22A 1S5HC 2QDOA 3E8HA 4UVCA 2LW7A 3APOA 4TUYB 1SA0B 3BAAA 4O4HA 3IJ4A 4H0LB 4I4TA 1ROPA 2ZDIC 2H94A 3WB0A 4LH6A 4X66O 1FYJA 3ML0A 4C7UA 1SESA 4WFAV 3ZRVA 2YIBA 1F4NA 4QPJA 2VQEB 4CH5A 2EINC 3RWRD 1I5XA 3AK2A 3SJCC 3T4ZA 3AK3A 4RO2A 4LF6O 1XL4A 4TSFG 1Y4MA 2EJRA 4GKJO 3N2KA 4GX2A 4TV8B 4NXMO 4O4IA 1WPXA 4F4LA 4HBNA 3THOA 3K79A 3VOUA 3IC7A 1SZXA 1QNMA 2Y4UA 3E22B 1Y6XA 2BTQA 3SJQC 2BSKB 1BHAA 2OIEA 2Q0OC 3AG1C 3L71H 1OCRB 1ZUQA 3KKYA 1EBOA 1KKCA 3DXRB 4PDLA 4DV1O 2WLIA 1KP3A 5IJ9B 3IAYA 2QM7A 4QPKA 1K5SA 4J10A 3BHPA 4TQDA 3AG3C 4YJ3B 1BE3H 1SQVH 3RW0A 3K03A 1YEWA 2ZE5A 5LHGA 2EZOA 3SR2C 4B3TO 1HR0B 3H9VA 3VBBA 4YXWG 2PI5A 3ZMSA 1XBLA 3T1HO 1TA8A 4MTGA 4BW9A 3LDDA 4BWAA 2ZKOA 3BCCH 4MVMA 2EIKC 4DUZB 2M6YA 1XMOO 1BQZA 3CJHB 1NI8A 1I08A 1Q43A 5B1BB 1QQCA 2YXLA 3A0RA 3B40A 3LNNA 4MTFA 1K97A 1JOYA 1K4DC 1Z2GA 4X62B 4IIJA 3CCVV 3CCUV 3K58A 4YJ2A 1RM1C 2VWKA 4ZBMA 5L3BA 3CWBH 2Y69B 4JF3A 1YTFD 1Q5OA 3L70H 2EILB 1N33B 2EIMB 2UXDO 1FFXB 3B4SA 4JGSA 2P22C 2IJHA 3K5LA 3LDEA 1L8DA 2E3CA 1XI1A 1L0NH 4O4LA 3UT5B 5FPRA 3QVNA 1BMFG 2HJDA 5L3DA 3OGCC 1HR0O 4NKGB 2Q69A 1VQLV 2XT9A 2QM8A 2ZE6A 3ZRSA 2XTAA 1QU7A 2R72A 4E2LA 3N2GA 1NBMG 3FX7A 1CP9A 4CH3A 3B77A 4PDVA 1NR1A 5C8YA 1FXKB 3ETQA 3FAVB 4XDJA 3ZBHA 5JVDB 3UQ8A 4XBFA 3G6BA 3U10A 3D3IA 3VQYA 1SQPH 5LA6B 2QA4V 5LMUB 1D5AA 4R6ZA 3U11A 1X4TA 4OX9O 4CH6A 3ZHQA 3FD9A 4UUJC 3ZHUA 4J11A 3RYIB 1V54B 4GZRB 1FXKA 4G28B 1QBZA 3CCSV 3OUFA 2Q5ZA 3LSUA 3AG4C 4Z2WA 1VQ4V 4JI6B 2EJ7A 2GTSA 1Q82W 4FFBA 1XNQO 4WFEA 3D8CA 4JASA 4DR6O 4JV5O 3K59A 2QTOA 2PY5A 1CPYA 3X2QC 1IXMA 3R65A 1NH2D 4JI4B 5KX5B 1W59A 4DV0O 2HJFC 2Y69C 1TVKB 4QNHB 2EIKB 3JASA 5IWAO 3CC4V 3OTOB 4DR4B 1MSWD 3D36C 3HR0A 4LH7A 5J2TA 1Q3EA 2Q4PA 5B3SB 3MDSA 4I0XB 1JR9A 1EN4A 2F66C 1WAZA 3WFVA 1GN2A 1NZ6A 2A0LA 4WBNA 1GM8A 3ETEA 2YIDA 3DSQA 5JCOC 3VQXA 1NTKH 2B5UA 5B5EZ 1K73W 1NTZH 1FPOA 4FLZA 1N36B 1XNQB 1VQOV 5H5NA 3M8AA 1KQSU 1JA8A 4PA4A 5EC2C 4PJ0Z 1K8AW 3K5NA 3CCLV 2P06A 4W4KA 4JAVA 3FB7C 3RYCB 4JI0O 3KCYA 4ZIBA 1NQTA 4G27B 3B8NA 4X65B 3EVKA 1YJNV 4JI2B 4U7OA 4LWSB 2BCCH 4PD4F 1HNZO 3H1IH 4RUEA 3CRRA 2B1IA 2KG7A 3C3SA 1KUQA 1Y74A 3LUTB 5BR8O 3ABKB 3S3XA 1GRJA 2ZXWB 1QLNA 2Y4TA 1GN3A 2GDSA 4TOIA 3A8TA 1VF5B 4EFBA 3KDRA 4FLWA 3ASNC 4DV1B 3ICXA 4B3MO 1ZX3A 4MS2A 2QJ1A 4X88A 3H1HH 2CE4A 4K0KB 1R1BA 1G8MA 5LOVA 2AZ0A 2CH7B 1K3EA 5DEDA 4LBEC 5KAIZ 1OZ0A 3SPHA 4R50A 1BT8A 2ZE7A 2W6IG 2AHYA 2X0LA 4DV7B 5IWAB 3F7YC 4DR1B 3H1LH 4FM0A 1OJHA 5LHHA 2LP7A 2IM9A 3ZX6A 5K1XA 1Q81W 2ADQB 4FLVA 3RGBA 2QKAA 1H8EG 1V55B 3CRCA 1SERA 2OYQA 2LFSA 2JGUA 3OT7A 1PD3A 4MVRA 4X1KB 3OR7C 2R70A 2V4DA 3E35A 3MHSC 5LBQA 3DGEA 1ZL8B 1IBKB 2UUBO 3BA8A 1MA1A 2BOBC 1PKXA 2EIJC 1MZEA 2LJ2A 3T1HB 1IXBA 3LNMB 4O4JB 1OCOB 4O2BB 2Q7HA 4R7CA 4I50A 3IFXA 4I5SA 3JATB 2DYRB 3T1CA 1M4UA 1P7GA 4NTXA 2ZNJA 3SJAC 3UM7A 5FNVB 1QR8A 3JAWA 3QO5A 3CD6V 1SS3A 3OGIB 2K1EA 3E89A 4B3MB 2XUMA 2ILMA 4UCSA 1Z5VA 2WPDG 3HKDB 5FL7G 5J9PC 4DR6B 4UB6Z 2EULA 4I50B 1L1FA 1RP3B 3CMEV 3PJSK 4QJFB 5J2TB 4AQYB 1P4RA 1H2MA 2NR5A 3CXHF 4UXNA 1SF9A 1FS0G 2ZDIA 3ZMUA 2P90A 4DUZO 1IVSA 3LDCA 2UU9O 3HB3B 1FD9A 5EBMC 4JYAO 2YXHA 4IGGA 2IJJA 2WLKA 4DYLA 3JD1A 1ZLZA 5FNVA 5KAFZ 1VQ8V 3RVZA 2X6BA 1BS3A 5LMUO 3ASOC 5A9GA 2HVJC 3H01A 2VS0A 3E8FA 4YHHO 3JAMN 4O2BA 3F5TA 2NLJC 5L3EA 4J9ZB 1N36O 3K57A 4NXNB 2XASA 5CB4B 1IBLB 4CH4A 3OE7G 4QE9A 4O2AA 2RDCA 4JI1O 4TT3G 1M57B 3UO3A 3T2MA 5CN0A 1R6NA 1THZA 5B1AC 2OWOA 2CK3G 2JJ2G 4MVUA 1SC5B 5EYPB 2B1GA 4J7KA 1YI2V 3QG5A 3ZMZA 1KC8W 4KP4A 2Z5UA 4LF5O 3K08A 1NTMH 1H2NA 3RYFA 4DR2B 2P4VA 4LF7B 2UXDB 2ITCC 3OTOO 4DR4O 4LNUB 1S3JA 2ZM6B 1DF5A 4YIOA 3TK1A 1AR4A 1XUQA 3E83A 1E1QG 3JSNA 2OTJV 2NNUA 3EXAA 3UCSC 2Y48A 3WB2A 2QE7G 3E86A 3WU2Z 5L3GA 5IYZA 1ZAUA 4I55B 1GN6A 4UVAA 4DW0A 2JIZG 4H13B 2OTLV 5CB4A 4PA7A 5JVDA 3L75H 4JYAB 3BFRA 1FAFA 2UUAB 2WLJA 4X64B 2OIGA 2QWOB 3CCJV 3BEHA 5JJJB 5JWPA 5CBGA 1PV0A 2HR3A 1OCRC 3KZIZ 2UXCO 2L35A 1OHHG 5IJ0B 1A32A 2B9ZA 2ZE8A 3CYOA 3K9AA 1VQKV 2OCHA 2Q73A 2P6JA 2GV9A 4DO2A 4JI7B 3ZHTA 4OGQB 1FXKC 3JYCA 2KSDA 1H5WA 4FMTA 2DYSB 2JGDB 4X8AA 3L9DA 1BHBA 4ZI7A 3DTUB 3RYCA 3ASOB 1I0HA 1N34O 4HYOA 3F7VC 1J5EO 2EX3A 3P32A 1WNSA 2Q7EA 5GTHZ 2JVDA 3OR6C 5BXZA 4H44B 2FKXA 3DC5A 2QSAA 2D2CB 1FJGO 1TAEA 2L6LA 1AROP 4ZKIA 1HNZB 3E8BA 5AG2A 2XAHA 3W7UA 1OV9A 3AG2C 1OCCB 2QTSA 4LF6B 4BW5A 4FFBB 1XL6A 1YCIA 4UCVA 2Y0PA 1XNRO 1N4CA 1YSCA 3ZRWA 1EZVH 3WG7B 2F23A 1ZWIC 4GX0A 2OCCC 2VQFB 3B09A 4GKKB 3BVOA 4YY3B 1DLBA 3JASB 3SYOA 4JPRA 3W7WA 1TVKA 3M99B 3AK1A 4KHPB 1R6KA 3ETGA 4GX5A 1I7FA 2Q6AA 1R3KC 4K8ZA 3NXSA 4LF4O 1GKFA 1RSOA 4ABMA 1OCOC 4NTWA 1P7BA 1XEQA 1JFFB 1FXVA 2BTQB 1EFRG 1UFIA 2E5LO 4K0KO 2DMXA 5H6QA 2LGQA 4I7ZB 1PNLA 4TV8A 4LNUA 5EYPA 1XHZA 5CBFA 2E75B 4XDKA 2UUCO 4FK5C 3B2EE 4X66B 1AILA 1ORQC 1HNXB 3AG1B 1VQ6V 3TGUH 3RVYA 5TISZ 3OW2U 1SZTA 3OD4A 4DV6O 2QM4A 1S76D 1JQ0A 5C8YB 4O2AB 4PA6A 2UUBB 2IU3A 1WJZA 4GKJB 3K5OA 1WA8A 3W7XA 4DV3O 4JTAB 4DV5O 2LO1A 2R9RB 2YICA 4FLXA 4OPHA 3N2GB 3GWOA 1Q86W 2W0FC 4MVZA 4ZOLB 1KD1W 2HG5C 2JEUA 2P5OA 2OT5A 3HPLC 2QKSA 4NVPA 4RUFA 1LNQA 5DM6V 3CE2A 4FFKA 3PN1A 4Z1VA 4WF9V 2GSMB 5DECA 1V54C 5KLVH 2WLMA 1QR9A 3N27A 4LWSA 1VIBA 4FPPA 1G4YB 1SQFA 1KKDA 2K9PA 5F2VO 2CTRA 4P9PA 3F5WC 2CUGA 4DK1A 5HFLA 4GCZA 5H2FZ 2ITDC 1VQPV 4IIJB 3TJTA 4CZZA 1W2BU 4J7JA 1MNGA 4TV9A 5KMGA 3ZJZA 3STZC 2UXXA 4B3RO 5LGTA 1V9PA 3SJBC 2V7QG 1JJ2U 3WG7C 4KFMA 4RWUA 5L3CA 2O57A 1EN5A 2JGDA 4DV5B 1PL4A 1X59A 1IBKO 4LF9O 4B08A 1GH6A 2KQXA 3ZRXA 4HNAA 1H2LA 5JQGB 1M56C 4U3FH 4X1IB 4F6EA 1US6A 4UV8A 3ABTA 4AQYO 1Y66A 2UXNA 1AI4A 3K06A 4DR7O 1M1KW 4DR7B 1MOFA 4NYKA 1YHQV 2ZQMA 4TV9B 5KHGA 5KMGB 2PI4A 5CA1A 3JALB 1XMQO 1Y76B 2LGWA 5H9CA 1CEZA 1SRYA 5D5QA 4JYCA 2WSSG 2AHZA 1K34A 3GWKC 3I55V 2RMKB 2GBOA 4FZ1A 3HKEA 4GUNA 1YTFB 2KKWA 3AEIA 5KX5A 3A0HZ 3JCZA 2YIAA 1Q7YW 2CTPA 3AG4B 1M56B 4L8JA 3TXSA 1Q6UA 4YHHB 4YIPA 3ZHRA 3W7TA 2FL4A 1DTOA 1VQNV 4B3RB 2Q8VA 3CRAA 1AR1B 2DWDC 3I5DA 4ZHQA 1TGOA 3CCRV 2A7WA 4MW3A 2JK5C 4Q20A 3RYIA 2XAQA 1WB8A 2CTWA 1AR5A 3P3PA 3IGAC 5BY1A 1YJ9V 4CBCA 4ZHQB 2JRIA 4PI2A 4CS4A 3JD3A 2A3QA 3RBZA 3AG3B 1AJPA 3ZHSA 3I56V 2CH7A 2YUAA 2FB5A 1VF7A 1K9MW 4IYIA 4K35A 2N74A 2YSUB 1N33O 3TETA 1FJGB 2XOKG 2F93B 3QO8A 3SYQA 4LFCO 4DUYB 4UVBA 1N32O 5EIBC 5L3FA 4KUMA 4X1IA 3ABMC 1AI7A 4P30A 2E74B 2DOSA 1S0VA 4MSWC 4UB8Z 3TCUA 1NS1A 4B3SO 1BL8A 2BOCC 2P67A 3G80A 3QF7A 1KBHA 1NKDA 4EB6A 2W0XA 2FTKA 2AGAA 2V1DA 2HLDG 5ITZA 1R73A 1H2SB 2Q0AA 4LFCB 2WLLB 1CXZB 1O9GA 5J2UB 1SQQH 5EZYB 2YXYA 1W0KG 4DRXB 1VARA 4DV3B 3CS5A 4JI2O 3A0BZ 1NR7A 4X20B 1M90W 4CC6A 2F4VB 3LSSA 4HAMA 4UV9A 4HNAB 4JI3O 2KB1A 4X89A 5B66Z 1I94O 2YEVB 4FLTA 4LF8B 2WWWA 1N34B 2DJVA 5J2UA 4IHJB 1KYOF 2N05A 2QGNA 1QHTA 2Z3YA 1S5JA 3JATA 1JNBA 3ABLC 1GM9A 4UCTA 2ZR3A 2F43G 1HNXO 3L72H 1E1RG 4KXRA 3BA9A 4JI6O 2CAZC 1XREA 2HHHB 2BTOA 1PPJH 2RJZA 3DXRA 1U96A 1BCCH 3SPJA 4BIOA 5B1NA 4K8XA 1RPOA 5IYZB 4PA9A 4OPAA 2ZINA 2UXCB 5GW7A 4DV7O 3OMAB 1B06A 3AG7A 2BSKA 3MAQA 4LF4B 1WLEA 3FYIB 4AI8A 2DQ0A 4BAYA 1AVMA 3JD0A 3K5MA 3JAKB 1ENVA 4PI0A 4FM2A 2UUCB 3CMAV 4JI7O 2DN9A 2XAFA 2A9HA 2DYSC 4GX1A 5EBWC 3OFNG 4NB5A 4PDRA 4R8CA 4TWKA 4DR3O 2D3OW 2QWQB 4FJCC 3MD0A 2EINB 5DN6G 4H33A 3SDLA 3FYEB 5LA6A 2PTMA 2OCCB 3M7MX 3E8GA 2AXTZ 4TQFA 4LFBB 1K33A 4NXMB 5BMVA 1GTOA 1IBMO 4X1YB 4LFBO 2F95B 4DV6B 2F4VO 2X7RB 1MMMA 1BZKA 1QLEB 2QWPB 1H8HG 2VWJA 2X6AA 2WA3A 1NVPB 1K92A 3RT3C 2W6JG 1G1XB 2QWRB 4MTXA 3JAKA 5D5PA 4X62O 1RSOB 3ABLB 4MVOA 2H3OA 2CGOA 2DQ3A 5LYJB 3GB7C 3JARA 1AP6A 4O4LB 2KG7B 2RCVA 3OEEG 3K9SA 4U3JB 2P4KA 4YJ2B 1P49A 1QLEC 2EBOA 5CA0A 5GONB 1SQXH 4H37A 5CA1B 5LL6Y 4DV2B 3ZRWB 5KHIA 4LR3A 1YZBA 1LUWA 3O9OA 1XILA 4I9QA 1F51A 3Q4HA 5EK0A 3RYHA 3SYPA 4LCUC 3K0GA 1WP7A 1AJQA 4DV2O 3ZN1A 4J41A 4LP8A 4HZ3A 2HFEC 3T4DA 5LMNO 4AHCA 4DV4O 4PHZA 3EHBB 4I9WA 4GT1A 2UUAO 5IYCO 5IJ0A 1S72V 4JI5O 3H1KH 2HKOA 3S3WA 1K4CC 3L74H 4IYHA 4MVSA 5ITZB 5E1AC 3J7AU 1JMKC 3B8MA 1XMOB 4D7TA 4B7EA 5EZYA 1F4MA 5KHKA 1TUBA 1NVPD 2EZPA 2EILC 3KG2A 3OM3B 1F23A 5GONA 4EB6B 1EZJA 4LF7O 2ADPA 2Q7GA 2N04A 1EN6A 1IURA 3ZN0A 3CC2V 4LF9B 5KA5A 5IJ9A 4A5UB 1XMQB 4G2KA 5IE9A 1Z5WA 2WA4A 1N0JA 1WA8B 3SPCA 1LUVA 4O4JA 2YDEA 1GM7A 5HFMA 2AW9A 2PZSA 3RYFB 4X1YA 1M9NA 3CRMA 4D7SA 4JTDB 2JEXA 1IBLO 1R6TA 1AB3A 4DUYO 3CX5F 1JVMA 1M57C 4I55A 2ZT9B 2Y0IA 2ZD9A 4ASUG 1IDSA 4E4EA 4DR5O 1K7DA 3HKBB 1D5NA 3STLC 4JAUA 2X6CA 3MHHC 2JS5A 3JD2A 1NT2B 3J80N 4JI1B 4JI8O 5BZBA 4NTYA 1WN7A 3G71V 2PYLA 2YI8A 3QNEA 1UPGA 4QGPA 1B3QA 1DGSA 2VQEO 2IH3C 3EFFK 5IDJA 4BIZA 2ZIMA 1Y74B 4FZ0A 5LP6B 2RNBA 4FIPC 5A2QN 4J42A 1W0JG 2BE3A 4XDLA 3ZMTA 4EEQA 1VF6C 4NR1A 2ETNA 1O9HA 4JI8B 2H8PC 5IYBO 4DXWA 4B3TB 2PUSA 3TXQA 1JCHA 1JX9A 2PGGA 4FVMA 4WFHA 2Q68A 4N23A 2UXBB 2R9IA 3A2FA 1HNWO 1RPRA 1Y76A 2IH1C 3OMNB 1HNWB 4EFEA 5JH7A 1S77D 1H38A 4QE7A 1R3IC 1FFTB 5LHIA 3T1YO 4CC5A 1WB7A 2M7WA 3CC7V 4WFGA 5H6RA 1IZ3A 4X64O 3JAWB 2JDIG 3UO2A 2JJ1G 5JQGA 1D2DA 1VQ5V 3CEIA 5K1PA 4DRXA 2E5LB 3Q4HB 3FB6C 4LFAO 5B1AB 1TUBB 1SQGA 2CGNA 4MW8A 4LC1A 4MT8A 2CDYA 4N21A 1FKAO 3IC9A 3ZMVA 1BSMA 2RN9A 2ATKC 4BR6A 4J7ZA 4KL1A 4WFBV 2YI9A 1Y67A 3QO7A 4U3JA 3SPGA 1NU1H 3LSQA 3JARB 2HHHO 3HKCA 1GAXA 2EIMC 5LP6A 2IJKA 1OCZB 4JAAA 5CBHA 4DR1O 1MZFA 4PA3A 1OCZC 3G4SV 3CCEV 2GHYA 1JJOA 4I0XA 4DV4B 4ZOLA 1VP7A 4UCUA 1VQ9V 4KHPO 1GN4A 1MSDA 2XAGA 5EBLC 4K3AA 3CRQA 1RFYA 4B3SB 1COWG 2HP8A 4O4IB 1VF6A 1I94B 4YY3O 3OMIB 4IT5A 3T1YB 4CS2A 2AZ2A 4DK0A 4X9QA 3G6EV 2XHBA 3BPZA 5LYJA 5LGUA 3P30A 1WP8A 5KA6A 3GVMA 4D6TH 1IJGA 2LW1A 3X2QB 4MTOA 5BR8B 3U0ZA 1SKVA 3CHXA 1IBMB 5B1OA 4RQEA 5KHHA 2QKCA 3ZHVA 3H1JH 3CXCU 4TUYA 2FYUH 1NH2B 3BRCA 4JZ2A 4EKWA 3CPWU 2Q67A 4UFZA 4GKKO 4JYBA 1SETA 4AILC 1JFFA 1Q6IA 4F6RB 4DR3B 1L0LH 2IU0A 1XNRB 4JTCB 2LFRA 4OXSA 1R3JC 3E2EA 4FM1A 2A79B 5LOVB 4FLYA 1FFXA 1MABG 1ZTEA 1KB9F 4Q6GA 3WB1A 5IY5B 2FMLA 4J80A 3SYCA 5GTIZ 1P84F 1WPBA 1M93A 1XQ8A 1PM9A 1GMGA 3JCUZ 2XNDG 5B3SC 5LGNA 1DF4A 3P3NA 5B1BC 3ABMB 1XDCA 2HVKC 3APQA 2QEXV 2MK3A 3UT5A 1RM1B 4GLXA 1M5IA 2GUZA 1N0NA 3FB8C 2A06H 1U97A 2WLHA 2Z0AA 5LMNB 1HDJA 2G38A 4PELA 4DR2O 1S5LZ 2WLNA 2ZIOA 2WLLA 3SPIA 1AJNA 4U7NA 4YJ3A 5CA0B 2QR4A 4PDMA 2P7TC 3K0DA 3NR7A 1N8RW 1J95A 4IHJA 1YVWA 4QIWF 3C3TA 2DE0X 2GUZB 3CJHA 1AP5A 2ARHA 3FB5C 1KECA 2EIJB 3CB2A 5EIBD 1Q8IA 4X20A 4JI0B 3QTCA 2UU9B 4JI4O 3ABKC 4MVQA 3SGIA 1H2GA 1VMGA 1JPXA 1KU9A 4JZGA 1PNKA 4JI5B 1YJWV 1F7YA 3O65A 5LP6C 5KUKA 3D36A 5CA3A 3ASNB 3KCXA 2NN4A 1URFA 2R9AA 2YS8A 2HEPA 3N2KB 5IY5C 1PP9H 1V55C 1QCEA 4X1KA 1KMIZ 3FKSG 4DR5B 5JCOA 4W4LA 1BQ0A 3C90A 2WAMA 3FAVA
chains in the Genus database with same CATH topology
1B06A 2ADQB 1XDCA 1EN4A 1SZXA 1ZLZA 1QNMA 1AVMA 1GN2A 4F6EA 1BS3A 2QKAA 1ZSPA 5A9GA 3DC6A 1ZUQA 1N0NA 3KKYA 1KKCA 3OT7A 1GN4A 1MSDA 1JA8A 3RN4A 1I0HA 4X9QA 4GUNA 3EVKA 1MA1A 4JYYA 1IXBA 4YIPA 3DC5A 1EM1A 2ADPA 3C3TA 1EN6A 3C3SA 1VARA 1MMMA 1AP5A 5AG2A 3LSUA 1P7GA 2QKCA 4YIOA 1WB7A 1AR4A 1N0JA 4JZ2A 1XUQA 4FFKA 1I08A 1GN3A 2GDSA 4JZGA 1LUVA 1WB8A 1AR5A 3KDRA 2AW9A 1IX9A 3CEIA 1AP6A 4C7UA 2RCVA 3K9SA 2CE4A 1GN6A 2P4KA 3AK1A 2CDYA 1ZTEA 3AK2A 3IC9A 3TJTA 1BSMA 1IDSA 4E4EA 1XREA 3AK3A 3BFRA 1D5NA 4BR6A 1MNGA 1BT8A 1VEWA 1Y67A 3MDSA 1LUWA 1PM9A 1XILA 1JR9A 1EN5A 1PL4A 3QVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B06 A;  2ADQ B;  1XDC A;  1EN4 A;  1SZX A;  1ZLZ A;  1QNM A;  1AVM A;  1GN2 A;  4F6E A;  1BS3 A;  2QKA A;  1ZSP A;  5A9G A;  3DC6 A;  1ZUQ A;  1N0N A;  3KKY A;  1KKC A;  3OT7 A;  1GN4 A;  1MSD A;  1JA8 A;  3RN4 A;  1I0H A;  4X9Q A;  4GUN A;  3EVK A;  1MA1 A;  4JYY A;  1IXB A;  4YIP A;  3DC5 A;  1EM1 A;  2ADP A;  3C3T A;  1EN6 A;  3C3S A;  1VAR A;  1MMM A;  1AP5 A;  5AG2 A;  3LSU A;  1P7G A;  2QKC A;  4YIO A;  1WB7 A;  1AR4 A;  1N0J A;  4JZ2 A;  1XUQ A;  4FFK A;  1I08 A;  1GN3 A;  2GDS A;  4JZG A;  1LUV A;  1WB8 A;  1AR5 A;  2AW9 A;  1IX9 A;  3CEI A;  1AP6 A;  4C7U A;  2RCV A;  3K9S A;  2CE4 A;  1GN6 A;  2P4K A;  3AK1 A;  2CDY A;  1ZTE A;  3AK2 A;  3IC9 A;  3TJT A;  1BSM A;  1IDS A;  4E4E A;  1XRE A;  3AK3 A;  3BFR A;  1D5N A;  4BR6 A;  1MNG A;  1BT8 A;  1VEW A;  1Y67 A;  3MDS A;  1LUW A;  1PM9 A;  1XIL A;  1JR9 A;  1EN5 A;  1PL4 A;  3QVN A; 
#chains in the Genus database with same CATH topology
 3CSX A;  3VQV A;  2ZXW C;  4WCE V;  1QVG U;  4WFF A;  4GYC B;  3AG2 B;  5E79 Z;  3G67 A;  3OTF A;  5BMV B;  1PL0 A;  2Q9L A;  1AI5 A;  1R3L C;  2ZR2 A;  4NXN O;  1VQM V;  4JV5 B;  1B6Q A;  1B04 A;  3HKB A;  3RN4 A;  3CP1 A;  3SYA A;  4RQF A;  4ICG A;  1BGY H;  4LFA B;  1GO3 F;  4LF8 O;  4PV1 B;  1HP8 A;  1PNM A;  4CS3 A;  4Z1M G;  3CCM V;  3K3W A;  3HKE B;  4UCO A;  4UCR A;  1OCC C;  4I4T B;  1K5Q A;  3ZIA G;  4LF5 B;  1EM1 A;  1HW7 A;  4JI3 B;  5LXT B;  1Q90 D;  1SA0 A;  1FXH A;  3JAL A;  4OX9 B;  3OEH G;  2QWN B;  2ODM A;  3BY6 A;  2YEV A;  5EC1 C;  2YC0 A;  2DYR C;  1KP2 A;  1H2K A;  2ZCE A;  5JJN B;  3D3Q A;  3FFQ A;  1YIT V;  3ABU A;  4RAI A;  4FLU A;  1IX9 A;  2JS3 A;  2ZM6 O;  3HKC B;  3R66 A;  1VQ7 V;  2MW2 B;  4P2Z A;  1I5Y A;  1XHX A;  2IW5 A;  3ZCC A;  3ZED A;  2C2A A;  1T5E A;  2IBZ H;  2PF4 E;  2ZNI A;  2VRZ A;  1G6U A;  1GK9 A;  2GTA A;  1HWY A;  1XOU A;  1FOU A;  2XAJ A;  1QVF U;  1VEW A;  2UXB O;  2F1M A;  1UJW B;  3L73 H;  5JJE B;  2CTQ A;  4ZI7 B;  4P9O A;  5IT9 N;  3HKD A;  2WLI B;  1SQB H;  1NJI W;  4WBN B;  2VQF O;  5KHJ A;  4DV0 B;  3RFR A;  1TUE B;  2E76 B;  5IYD O;  1ZSP A;  2IJI A;  1YIJ V;  5C93 A;  3RYH B;  3W7S A;  5JH7 B;  3VQW A;  1YXB A;  3OUS A;  1AI6 A;  3DC6 A;  2DW4 A;  2PYJ A;  4B7K A;  3JD4 A;  1N32 B;  5FPO A;  3K04 A;  5CMU A;  3BAB A;  4IL6 Z;  3UKM A;  5LXT A;  1ZL8 A;  3CCQ V;  1Q6H A;  4J9Y B;  4JYY A;  2YIB D;  1LR1 A;  1YF2 A;  3JSL A;  2DWE C;  2LQT A;  4X65 O;  1DK1 A;  4DW1 A;  2RQ6 A;  1YDX A;  4BIU A;  4L87 A;  4F6R A;  3ETD A;  1E79 G;  5KUM A;  1J5E B;  3OAA G;  3J81 N;  1MG1 A;  5FLX N;  3ZS8 C;  4O4H B;  3E22 A;  1S5H C;  2QDO A;  3E8H A;  4UVC A;  2LW7 A;  3APO A;  4TUY B;  1SA0 B;  3BAA A;  4O4H A;  3IJ4 A;  4H0L B;  4I4T A;  1ROP A;  2ZDI C;  2H94 A;  3WB0 A;  4LH6 A;  4X66 O;  1FYJ A;  3ML0 A;  4C7U A;  1SES A;  4WFA V;  3ZRV A;  2YIB A;  1F4N A;  4QPJ A;  2VQE B;  4CH5 A;  2EIN C;  3RWR D;  1I5X A;  3AK2 A;  3SJC C;  3T4Z A;  3AK3 A;  4RO2 A;  4LF6 O;  1XL4 A;  4TSF G;  1Y4M A;  2EJR A;  4GKJ O;  3N2K A;  4GX2 A;  4TV8 B;  4NXM O;  4O4I A;  1WPX A;  4F4L A;  4HBN A;  3THO A;  3K79 A;  3VOU A;  3IC7 A;  1SZX A;  1QNM A;  2Y4U A;  3E22 B;  1Y6X A;  2BTQ A;  3SJQ C;  2BSK B;  1BHA A;  2OIE A;  2Q0O C;  3AG1 C;  3L71 H;  1OCR B;  1ZUQ A;  3KKY A;  1EBO A;  1KKC A;  3DXR B;  4PDL A;  4DV1 O;  2WLI A;  1KP3 A;  5IJ9 B;  3IAY A;  2QM7 A;  4QPK A;  1K5S A;  4J10 A;  3BHP A;  4TQD A;  3AG3 C;  4YJ3 B;  1BE3 H;  1SQV H;  3RW0 A;  3K03 A;  1YEW A;  2ZE5 A;  5LHG A;  2EZO A;  3SR2 C;  4B3T O;  1HR0 B;  3H9V A;  3VBB A;  4YXW G;  2PI5 A;  3ZMS A;  1XBL A;  3T1H O;  1TA8 A;  4MTG A;  4BW9 A;  3LDD A;  4BWA A;  2ZKO A;  3BCC H;  4MVM A;  2EIK C;  4DUZ B;  2M6Y A;  1XMO O;  1BQZ A;  3CJH B;  1NI8 A;  1I08 A;  1Q43 A;  5B1B B;  1QQC A;  2YXL A;  3A0R A;  3B40 A;  3LNN A;  4MTF A;  1K97 A;  1JOY A;  1K4D C;  1Z2G A;  4X62 B;  4IIJ A;  3CCV V;  3CCU V;  3K58 A;  4YJ2 A;  1RM1 C;  2VWK A;  4ZBM A;  5L3B A;  3CWB H;  2Y69 B;  4JF3 A;  1YTF D;  1Q5O A;  3L70 H;  2EIL B;  1N33 B;  2EIM B;  2UXD O;  1FFX B;  3B4S A;  4JGS A;  2P22 C;  2IJH A;  3K5L A;  3LDE A;  1L8D A;  2E3C A;  1XI1 A;  1L0N H;  4O4L A;  3UT5 B;  5FPR A;  3QVN A;  1BMF G;  2HJD A;  5L3D A;  3OGC C;  1HR0 O;  4NKG B;  2Q69 A;  1VQL V;  2XT9 A;  2QM8 A;  2ZE6 A;  3ZRS A;  2XTA A;  1QU7 A;  2R72 A;  4E2L A;  3N2G A;  1NBM G;  3FX7 A;  1CP9 A;  4CH3 A;  3B77 A;  4PDV A;  1NR1 A;  5C8Y A;  1FXK B;  3ETQ A;  3FAV B;  4XDJ A;  3ZBH A;  5JVD B;  3UQ8 A;  4XBF A;  3G6B A;  3U10 A;  3D3I A;  3VQY A;  1SQP H;  5LA6 B;  2QA4 V;  5LMU B;  1D5A A;  4R6Z A;  3U11 A;  1X4T A;  4OX9 O;  4CH6 A;  3ZHQ A;  3FD9 A;  4UUJ C;  3ZHU A;  4J11 A;  3RYI B;  1V54 B;  4GZR B;  1FXK A;  4G28 B;  1QBZ A;  3CCS V;  3OUF A;  2Q5Z A;  3LSU A;  3AG4 C;  4Z2W A;  1VQ4 V;  4JI6 B;  2EJ7 A;  2GTS A;  1Q82 W;  4FFB A;  1XNQ O;  4WFE A;  3D8C A;  4JAS A;  4DR6 O;  4JV5 O;  3K59 A;  2QTO A;  2PY5 A;  1CPY A;  3X2Q C;  1IXM A;  3R65 A;  1NH2 D;  4JI4 B;  5KX5 B;  1W59 A;  4DV0 O;  2HJF C;  2Y69 C;  1TVK B;  4QNH B;  2EIK B;  3JAS A;  5IWA O;  3CC4 V;  3OTO B;  4DR4 B;  1MSW D;  3D36 C;  3HR0 A;  4LH7 A;  5J2T A;  1Q3E A;  2Q4P A;  5B3S B;  3MDS A;  4I0X B;  1JR9 A;  1EN4 A;  2F66 C;  1WAZ A;  3WFV A;  1GN2 A;  1NZ6 A;  2A0L A;  4WBN A;  1GM8 A;  3ETE A;  2YID A;  3DSQ A;  5JCO C;  3VQX A;  1NTK H;  2B5U A;  5B5E Z;  1K73 W;  1NTZ H;  1FPO A;  4FLZ A;  1N36 B;  1XNQ B;  1VQO V;  5H5N A;  3M8A A;  1KQS U;  1JA8 A;  4PA4 A;  5EC2 C;  4PJ0 Z;  1K8A W;  3K5N A;  3CCL V;  2P06 A;  4W4K A;  4JAV A;  3FB7 C;  3RYC B;  4JI0 O;  3KCY A;  4ZIB A;  1NQT A;  4G27 B;  3B8N A;  4X65 B;  3EVK A;  1YJN V;  4JI2 B;  4U7O A;  4LWS B;  2BCC H;  4PD4 F;  1HNZ O;  3H1I H;  4RUE A;  3CRR A;  2B1I A;  2KG7 A;  3C3S A;  1KUQ A;  1Y74 A;  3LUT B;  5BR8 O;  3ABK B;  3S3X A;  1GRJ A;  2ZXW B;  1QLN A;  2Y4T A;  1GN3 A;  2GDS A;  4TOI A;  3A8T A;  1VF5 B;  4EFB A;  3KDR A;  4FLW A;  3ASN C;  4DV1 B;  3ICX A;  4B3M O;  1ZX3 A;  4MS2 A;  2QJ1 A;  4X88 A;  3H1H H;  2CE4 A;  4K0K B;  1R1B A;  1G8M A;  5LOV A;  2AZ0 A;  2CH7 B;  1K3E A;  5DED A;  4LBE C;  5KAI Z;  1OZ0 A;  3SPH A;  4R50 A;  1BT8 A;  2ZE7 A;  2W6I G;  2AHY A;  2X0L A;  4DV7 B;  5IWA B;  3F7Y C;  4DR1 B;  3H1L H;  4FM0 A;  1OJH A;  5LHH A;  2LP7 A;  2IM9 A;  3ZX6 A;  5K1X A;  1Q81 W;  2ADQ B;  4FLV A;  3RGB A;  2QKA A;  1H8E G;  1V55 B;  3CRC A;  1SER A;  2OYQ A;  2LFS A;  2JGU A;  3OT7 A;  1PD3 A;  4MVR A;  4X1K B;  3OR7 C;  2R70 A;  2V4D A;  3E35 A;  3MHS C;  5LBQ A;  3DGE A;  1ZL8 B;  1IBK B;  2UUB O;  3BA8 A;  1MA1 A;  2BOB C;  1PKX A;  2EIJ C;  1MZE A;  2LJ2 A;  3T1H B;  1IXB A;  3LNM B;  4O4J B;  1OCO B;  4O2B B;  2Q7H A;  4R7C A;  4I50 A;  3IFX A;  4I5S A;  3JAT B;  2DYR B;  3T1C A;  1M4U A;  1P7G A;  4NTX A;  2ZNJ A;  3SJA C;  3UM7 A;  5FNV B;  1QR8 A;  3JAW A;  3QO5 A;  3CD6 V;  1SS3 A;  3OGI B;  2K1E A;  3E89 A;  4B3M B;  2XUM A;  2ILM A;  4UCS A;  1Z5V A;  2WPD G;  3HKD B;  5FL7 G;  5J9P C;  4DR6 B;  4UB6 Z;  2EUL A;  4I50 B;  1L1F A;  1RP3 B;  3CME V;  3PJS K;  4QJF B;  5J2T B;  4AQY B;  1P4R A;  1H2M A;  2NR5 A;  3CXH F;  4UXN A;  1SF9 A;  1FS0 G;  2ZDI A;  3ZMU A;  2P90 A;  4DUZ O;  1IVS A;  3LDC A;  2UU9 O;  3HB3 B;  1FD9 A;  5EBM C;  4JYA O;  2YXH A;  4IGG A;  2IJJ A;  2WLK A;  4DYL A;  3JD1 A;  1ZLZ A;  5FNV A;  5KAF Z;  1VQ8 V;  3RVZ A;  2X6B A;  1BS3 A;  5LMU O;  3ASO C;  5A9G A;  2HVJ C;  3H01 A;  2VS0 A;  3E8F A;  4YHH O;  3JAM N;  4O2B A;  3F5T A;  2NLJ C;  5L3E A;  4J9Z B;  1N36 O;  3K57 A;  4NXN B;  2XAS A;  5CB4 B;  1IBL B;  4CH4 A;  3OE7 G;  4QE9 A;  4O2A A;  2RDC A;  4JI1 O;  4TT3 G;  1M57 B;  3UO3 A;  3T2M A;  5CN0 A;  1R6N A;  1THZ A;  5B1A C;  2OWO A;  2CK3 G;  2JJ2 G;  4MVU A;  1SC5 B;  5EYP B;  2B1G A;  4J7K A;  1YI2 V;  3QG5 A;  3ZMZ A;  1KC8 W;  4KP4 A;  2Z5U A;  4LF5 O;  3K08 A;  1NTM H;  1H2N A;  3RYF A;  4DR2 B;  2P4V A;  4LF7 B;  2UXD B;  2ITC C;  3OTO O;  4DR4 O;  4LNU B;  1S3J A;  2ZM6 B;  1DF5 A;  4YIO A;  3TK1 A;  1AR4 A;  1XUQ A;  3E83 A;  1E1Q G;  3JSN A;  2OTJ V;  2NNU A;  3EXA A;  3UCS C;  2Y48 A;  3WB2 A;  2QE7 G;  3E86 A;  3WU2 Z;  5L3G A;  5IYZ A;  1ZAU A;  4I55 B;  1GN6 A;  4UVA A;  4DW0 A;  2JIZ G;  4H13 B;  2OTL V;  5CB4 A;  4PA7 A;  5JVD A;  3L75 H;  4JYA B;  3BFR A;  1FAF A;  2UUA B;  2WLJ A;  4X64 B;  2OIG A;  2QWO B;  3CCJ V;  3BEH A;  5JJJ B;  5JWP A;  5CBG A;  1PV0 A;  2HR3 A;  1OCR C;  3KZI Z;  2UXC O;  2L35 A;  1OHH G;  5IJ0 B;  1A32 A;  2B9Z A;  2ZE8 A;  3CYO A;  3K9A A;  1VQK V;  2OCH A;  2Q73 A;  2P6J A;  2GV9 A;  4DO2 A;  4JI7 B;  3ZHT A;  4OGQ B;  1FXK C;  3JYC A;  2KSD A;  1H5W A;  4FMT A;  2DYS B;  2JGD B;  4X8A A;  3L9D A;  1BHB A;  4ZI7 A;  3DTU B;  3RYC A;  3ASO B;  1I0H A;  1N34 O;  4HYO A;  3F7V C;  1J5E O;  2EX3 A;  3P32 A;  1WNS A;  2Q7E A;  5GTH Z;  2JVD A;  3OR6 C;  5BXZ A;  4H44 B;  2FKX A;  3DC5 A;  2QSA A;  2D2C B;  1FJG O;  1TAE A;  2L6L A;  1ARO P;  4ZKI A;  1HNZ B;  3E8B A;  5AG2 A;  2XAH A;  3W7U A;  1OV9 A;  3AG2 C;  1OCC B;  2QTS A;  4LF6 B;  4BW5 A;  4FFB B;  1XL6 A;  1YCI A;  4UCV A;  2Y0P A;  1XNR O;  1N4C A;  1YSC A;  3ZRW A;  1EZV H;  3WG7 B;  2F23 A;  1ZWI C;  4GX0 A;  2OCC C;  2VQF B;  3B09 A;  4GKK B;  3BVO A;  4YY3 B;  1DLB A;  3JAS B;  3SYO A;  4JPR A;  3W7W A;  1TVK A;  3M99 B;  3AK1 A;  4KHP B;  1R6K A;  3ETG A;  4GX5 A;  1I7F A;  2Q6A A;  1R3K C;  4K8Z A;  3NXS A;  4LF4 O;  1GKF A;  1RSO A;  4ABM A;  1OCO C;  4NTW A;  1P7B A;  1XEQ A;  1JFF B;  1FXV A;  2BTQ B;  1EFR G;  1UFI A;  2E5L O;  4K0K O;  2DMX A;  5H6Q A;  2LGQ A;  4I7Z B;  1PNL A;  4TV8 A;  4LNU A;  5EYP A;  1XHZ A;  5CBF A;  2E75 B;  4XDK A;  2UUC O;  4FK5 C;  3B2E E;  4X66 B;  1AIL A;  1ORQ C;  1HNX B;  3AG1 B;  1VQ6 V;  3TGU H;  3RVY A;  5TIS Z;  3OW2 U;  1SZT A;  3OD4 A;  4DV6 O;  2QM4 A;  1S76 D;  1JQ0 A;  5C8Y B;  4O2A B;  4PA6 A;  2UUB B;  2IU3 A;  1WJZ A;  4GKJ B;  3K5O A;  1WA8 A;  3W7X A;  4DV3 O;  4JTA B;  4DV5 O;  2LO1 A;  2R9R B;  2YIC A;  4FLX A;  4OPH A;  3N2G B;  3GWO A;  1Q86 W;  2W0F C;  4MVZ A;  4ZOL B;  1KD1 W;  2HG5 C;  2JEU A;  2P5O A;  2OT5 A;  3HPL C;  2QKS A;  4NVP A;  4RUF A;  1LNQ A;  5DM6 V;  3CE2 A;  4FFK A;  3PN1 A;  4Z1V A;  4WF9 V;  2GSM B;  5DEC A;  1V54 C;  5KLV H;  2WLM A;  1QR9 A;  3N27 A;  4LWS A;  1VIB A;  4FPP A;  1G4Y B;  1SQF A;  1KKD A;  2K9P A;  5F2V O;  2CTR A;  4P9P A;  3F5W C;  2CUG A;  4DK1 A;  5HFL A;  4GCZ A;  5H2F Z;  2ITD C;  1VQP V;  4IIJ B;  3TJT A;  4CZZ A;  1W2B U;  4J7J A;  1MNG A;  4TV9 A;  5KMG A;  3ZJZ A;  3STZ C;  2UXX A;  4B3R O;  5LGT A;  1V9P A;  3SJB C;  2V7Q G;  1JJ2 U;  3WG7 C;  4KFM A;  4RWU A;  5L3C A;  2O57 A;  1EN5 A;  2JGD A;  4DV5 B;  1PL4 A;  1X59 A;  1IBK O;  4LF9 O;  4B08 A;  1GH6 A;  2KQX A;  3ZRX A;  4HNA A;  1H2L A;  5JQG B;  1M56 C;  4U3F H;  4X1I B;  4F6E A;  1US6 A;  4UV8 A;  3ABT A;  4AQY O;  1Y66 A;  2UXN A;  1AI4 A;  3K06 A;  4DR7 O;  1M1K W;  4DR7 B;  1MOF A;  4NYK A;  1YHQ V;  2ZQM A;  4TV9 B;  5KHG A;  5KMG B;  2PI4 A;  5CA1 A;  3JAL B;  1XMQ O;  1Y76 B;  2LGW A;  5H9C A;  1CEZ A;  1SRY A;  5D5Q A;  4JYC A;  2WSS G;  2AHZ A;  1K34 A;  3GWK C;  3I55 V;  2RMK B;  2GBO A;  4FZ1 A;  3HKE A;  4GUN A;  1YTF B;  2KKW A;  3AEI A;  5KX5 A;  3A0H Z;  3JCZ A;  2YIA A;  1Q7Y W;  2CTP A;  3AG4 B;  1M56 B;  4L8J A;  3TXS A;  1Q6U A;  4YHH B;  4YIP A;  3ZHR A;  3W7T A;  2FL4 A;  1DTO A;  1VQN V;  4B3R B;  2Q8V A;  3CRA A;  1AR1 B;  2DWD C;  3I5D A;  4ZHQ A;  1TGO A;  3CCR V;  2A7W A;  4MW3 A;  2JK5 C;  4Q20 A;  3RYI A;  2XAQ A;  1WB8 A;  2CTW A;  1AR5 A;  3P3P A;  3IGA C;  5BY1 A;  1YJ9 V;  4CBC A;  4ZHQ B;  2JRI A;  4PI2 A;  4CS4 A;  3JD3 A;  2A3Q A;  3RBZ A;  3AG3 B;  1AJP A;  3ZHS A;  3I56 V;  2CH7 A;  2YUA A;  2FB5 A;  1VF7 A;  1K9M W;  4IYI A;  4K35 A;  2N74 A;  2YSU B;  1N33 O;  3TET A;  1FJG B;  2XOK G;  2F93 B;  3QO8 A;  3SYQ A;  4LFC O;  4DUY B;  4UVB A;  1N32 O;  5EIB C;  5L3F A;  4KUM A;  4X1I A;  3ABM C;  1AI7 A;  4P30 A;  2E74 B;  2DOS A;  1S0V A;  4MSW C;  4UB8 Z;  3TCU A;  1NS1 A;  4B3S O;  1BL8 A;  2BOC C;  2P67 A;  3G80 A;  3QF7 A;  1KBH A;  1NKD A;  4EB6 A;  2W0X A;  2FTK A;  2AGA A;  2V1D A;  2HLD G;  5ITZ A;  1R73 A;  1H2S B;  2Q0A A;  4LFC B;  2WLL B;  1CXZ B;  1O9G A;  5J2U B;  1SQQ H;  5EZY B;  2YXY A;  1W0K G;  4DRX B;  1VAR A;  4DV3 B;  3CS5 A;  4JI2 O;  3A0B Z;  1NR7 A;  4X20 B;  1M90 W;  4CC6 A;  2F4V B;  3LSS A;  4HAM A;  4UV9 A;  4HNA B;  4JI3 O;  2KB1 A;  4X89 A;  5B66 Z;  1I94 O;  2YEV B;  4FLT A;  4LF8 B;  2WWW A;  1N34 B;  2DJV A;  5J2U A;  4IHJ B;  1KYO F;  2N05 A;  2QGN A;  1QHT A;  2Z3Y A;  1S5J A;  3JAT A;  1JNB A;  3ABL C;  1GM9 A;  4UCT A;  2ZR3 A;  2F43 G;  1HNX O;  3L72 H;  1E1R G;  4KXR A;  3BA9 A;  4JI6 O;  2CAZ C;  1XRE A;  2HHH B;  2BTO A;  1PPJ H;  2RJZ A;  3DXR A;  1U96 A;  1BCC H;  3SPJ A;  4BIO A;  5B1N A;  4K8X A;  1RPO A;  5IYZ B;  4PA9 A;  4OPA A;  2ZIN A;  2UXC B;  5GW7 A;  4DV7 O;  3OMA B;  1B06 A;  3AG7 A;  2BSK A;  3MAQ A;  4LF4 B;  1WLE A;  3FYI B;  4AI8 A;  2DQ0 A;  4BAY A;  1AVM A;  3JD0 A;  3K5M A;  3JAK B;  1ENV A;  4PI0 A;  4FM2 A;  2UUC B;  3CMA V;  4JI7 O;  2DN9 A;  2XAF A;  2A9H A;  2DYS C;  4GX1 A;  5EBW C;  3OFN G;  4NB5 A;  4PDR A;  4R8C A;  4TWK A;  4DR3 O;  2D3O W;  2QWQ B;  4FJC C;  3MD0 A;  2EIN B;  5DN6 G;  4H33 A;  3SDL A;  3FYE B;  5LA6 A;  2PTM A;  2OCC B;  3M7M X;  3E8G A;  2AXT Z;  4TQF A;  4LFB B;  1K33 A;  4NXM B;  5BMV A;  1GTO A;  1IBM O;  4X1Y B;  4LFB O;  2F95 B;  4DV6 B;  2F4V O;  2X7R B;  1MMM A;  1BZK A;  1QLE B;  2QWP B;  1H8H G;  2VWJ A;  2X6A A;  2WA3 A;  1NVP B;  1K92 A;  3RT3 C;  2W6J G;  1G1X B;  2QWR B;  4MTX A;  3JAK A;  5D5P A;  4X62 O;  1RSO B;  3ABL B;  4MVO A;  2H3O A;  2CGO A;  2DQ3 A;  5LYJ B;  3GB7 C;  3JAR A;  1AP6 A;  4O4L B;  2KG7 B;  2RCV A;  3OEE G;  3K9S A;  4U3J B;  2P4K A;  4YJ2 B;  1P49 A;  1QLE C;  2EBO A;  5CA0 A;  5GON B;  1SQX H;  4H37 A;  5CA1 B;  5LL6 Y;  4DV2 B;  3ZRW B;  5KHI A;  4LR3 A;  1YZB A;  1LUW A;  3O9O A;  1XIL A;  4I9Q A;  1F51 A;  3Q4H A;  5EK0 A;  3RYH A;  3SYP A;  4LCU C;  3K0G A;  1WP7 A;  1AJQ A;  4DV2 O;  3ZN1 A;  4J41 A;  4LP8 A;  4HZ3 A;  2HFE C;  3T4D A;  5LMN O;  4AHC A;  4DV4 O;  4PHZ A;  3EHB B;  4I9W A;  4GT1 A;  2UUA O;  5IYC O;  5IJ0 A;  1S72 V;  4JI5 O;  3H1K H;  2HKO A;  3S3W A;  1K4C C;  3L74 H;  4IYH A;  4MVS A;  5ITZ B;  5E1A C;  3J7A U;  1JMK C;  3B8M A;  1XMO B;  4D7T A;  4B7E A;  5EZY A;  1F4M A;  5KHK A;  1TUB A;  1NVP D;  2EZP A;  2EIL C;  3KG2 A;  3OM3 B;  1F23 A;  5GON A;  4EB6 B;  1EZJ A;  4LF7 O;  2ADP A;  2Q7G A;  2N04 A;  1EN6 A;  1IUR A;  3ZN0 A;  3CC2 V;  4LF9 B;  5KA5 A;  5IJ9 A;  4A5U B;  1XMQ B;  4G2K A;  5IE9 A;  1Z5W A;  2WA4 A;  1N0J A;  1WA8 B;  3SPC A;  1LUV A;  4O4J A;  2YDE A;  1GM7 A;  5HFM A;  2AW9 A;  2PZS A;  3RYF B;  4X1Y A;  1M9N A;  3CRM A;  4D7S A;  4JTD B;  2JEX A;  1IBL O;  1R6T A;  1AB3 A;  4DUY O;  3CX5 F;  1JVM A;  1M57 C;  4I55 A;  2ZT9 B;  2Y0I A;  2ZD9 A;  4ASU G;  1IDS A;  4E4E A;  4DR5 O;  1K7D A;  3HKB B;  1D5N A;  3STL C;  4JAU A;  2X6C A;  3MHH C;  2JS5 A;  3JD2 A;  1NT2 B;  3J80 N;  4JI1 B;  4JI8 O;  5BZB A;  4NTY A;  1WN7 A;  3G71 V;  2PYL A;  2YI8 A;  3QNE A;  1UPG A;  4QGP A;  1B3Q A;  1DGS A;  2VQE O;  2IH3 C;  3EFF K;  5IDJ A;  4BIZ A;  2ZIM A;  1Y74 B;  4FZ0 A;  5LP6 B;  2RNB A;  4FIP C;  5A2Q N;  4J42 A;  1W0J G;  2BE3 A;  4XDL A;  3ZMT A;  4EEQ A;  1VF6 C;  4NR1 A;  2ETN A;  1O9H A;  4JI8 B;  2H8P C;  5IYB O;  4DXW A;  4B3T B;  2PUS A;  3TXQ A;  1JCH A;  1JX9 A;  2PGG A;  4FVM A;  4WFH A;  2Q68 A;  4N23 A;  2UXB B;  2R9I A;  3A2F A;  1HNW O;  1RPR A;  1Y76 A;  2IH1 C;  3OMN B;  1HNW B;  4EFE A;  5JH7 A;  1S77 D;  1H38 A;  4QE7 A;  1R3I C;  1FFT B;  5LHI A;  3T1Y O;  4CC5 A;  1WB7 A;  2M7W A;  3CC7 V;  4WFG A;  5H6R A;  1IZ3 A;  4X64 O;  3JAW B;  2JDI G;  3UO2 A;  2JJ1 G;  5JQG A;  1D2D A;  1VQ5 V;  3CEI A;  5K1P A;  4DRX A;  2E5L B;  3Q4H B;  3FB6 C;  4LFA O;  5B1A B;  1TUB B;  1SQG A;  2CGN A;  4MW8 A;  4LC1 A;  4MT8 A;  2CDY A;  4N21 A;  1FKA O;  3IC9 A;  3ZMV A;  1BSM A;  2RN9 A;  2ATK C;  4BR6 A;  4J7Z A;  4KL1 A;  4WFB V;  2YI9 A;  1Y67 A;  3QO7 A;  4U3J A;  3SPG A;  1NU1 H;  3LSQ A;  3JAR B;  2HHH O;  3HKC A;  1GAX A;  2EIM C;  5LP6 A;  2IJK A;  1OCZ B;  4JAA A;  5CBH A;  4DR1 O;  1MZF A;  4PA3 A;  1OCZ C;  3G4S V;  3CCE V;  2GHY A;  1JJO A;  4I0X A;  4DV4 B;  4ZOL A;  1VP7 A;  4UCU A;  1VQ9 V;  4KHP O;  1GN4 A;  1MSD A;  2XAG A;  5EBL C;  4K3A A;  3CRQ A;  1RFY A;  4B3S B;  1COW G;  2HP8 A;  4O4I B;  1VF6 A;  1I94 B;  4YY3 O;  3OMI B;  4IT5 A;  3T1Y B;  4CS2 A;  2AZ2 A;  4DK0 A;  4X9Q A;  3G6E V;  2XHB A;  3BPZ A;  5LYJ A;  5LGU A;  3P30 A;  1WP8 A;  5KA6 A;  3GVM A;  4D6T H;  1IJG A;  2LW1 A;  3X2Q B;  4MTO A;  5BR8 B;  3U0Z A;  1SKV A;  3CHX A;  1IBM B;  5B1O A;  4RQE A;  5KHH A;  2QKC A;  3ZHV A;  3H1J H;  3CXC U;  4TUY A;  2FYU H;  1NH2 B;  3BRC A;  4JZ2 A;  4EKW A;  3CPW U;  2Q67 A;  4UFZ A;  4GKK O;  4JYB A;  1SET A;  4AIL C;  1JFF A;  1Q6I A;  4F6R B;  4DR3 B;  1L0L H;  2IU0 A;  1XNR B;  4JTC B;  2LFR A;  4OXS A;  1R3J C;  3E2E A;  4FM1 A;  2A79 B;  5LOV B;  4FLY A;  1FFX A;  1MAB G;  1ZTE A;  1KB9 F;  4Q6G A;  3WB1 A;  5IY5 B;  2FML A;  4J80 A;  3SYC A;  5GTI Z;  1P84 F;  1WPB A;  1M93 A;  1XQ8 A;  1PM9 A;  1GMG A;  3JCU Z;  2XND G;  5B3S C;  5LGN A;  1DF4 A;  3P3N A;  5B1B C;  3ABM B;  1XDC A;  2HVK C;  3APQ A;  2QEX V;  2MK3 A;  3UT5 A;  1RM1 B;  4GLX A;  1M5I A;  2GUZ A;  1N0N A;  3FB8 C;  2A06 H;  1U97 A;  2WLH A;  2Z0A A;  5LMN B;  1HDJ A;  2G38 A;  4PEL A;  4DR2 O;  1S5L Z;  2WLN A;  2ZIO A;  2WLL A;  3SPI A;  1AJN A;  4U7N A;  4YJ3 A;  5CA0 B;  2QR4 A;  4PDM A;  2P7T C;  3K0D A;  3NR7 A;  1N8R W;  1J95 A;  4IHJ A;  1YVW A;  4QIW F;  3C3T A;  2DE0 X;  2GUZ B;  3CJH A;  1AP5 A;  2ARH A;  3FB5 C;  1KEC A;  2EIJ B;  3CB2 A;  5EIB D;  1Q8I A;  4X20 A;  4JI0 B;  3QTC A;  2UU9 B;  4JI4 O;  3ABK C;  4MVQ A;  3SGI A;  1H2G A;  1VMG A;  1JPX A;  1KU9 A;  4JZG A;  1PNK A;  4JI5 B;  1YJW V;  1F7Y A;  3O65 A;  5LP6 C;  5KUK A;  3D36 A;  5CA3 A;  3ASN B;  3KCX A;  2NN4 A;  1URF A;  2R9A A;  2YS8 A;  2HEP A;  3N2K B;  5IY5 C;  1PP9 H;  1V55 C;  1QCE A;  4X1K A;  1KMI Z;  3FKS G;  4DR5 B;  5JCO A;  4W4L A;  1BQ0 A;  3C90 A;  2WAM A;  3FAV A; 
#chains in the Genus database with same CATH homology
 1B06 A;  2ADQ B;  1XDC A;  1EN4 A;  1SZX A;  1ZLZ A;  1QNM A;  1AVM A;  1GN2 A;  4F6E A;  1BS3 A;  2QKA A;  1ZSP A;  5A9G A;  3DC6 A;  1ZUQ A;  1N0N A;  3KKY A;  1KKC A;  3OT7 A;  1GN4 A;  1MSD A;  1JA8 A;  3RN4 A;  1I0H A;  4X9Q A;  4GUN A;  3EVK A;  1MA1 A;  4JYY A;  1IXB A;  4YIP A;  3DC5 A;  1EM1 A;  2ADP A;  3C3T A;  1EN6 A;  3C3S A;  1VAR A;  1MMM A;  1AP5 A;  5AG2 A;  3LSU A;  1P7G A;  2QKC A;  4YIO A;  1WB7 A;  1AR4 A;  1N0J A;  4JZ2 A;  1XUQ A;  4FFK A;  1I08 A;  1GN3 A;  2GDS A;  4JZG A;  1LUV A;  1WB8 A;  1AR5 A;  3KDR A;  2AW9 A;  1IX9 A;  3CEI A;  1AP6 A;  4C7U A;  2RCV A;  3K9S A;  2CE4 A;  1GN6 A;  2P4K A;  3AK1 A;  2CDY A;  1ZTE A;  3AK2 A;  3IC9 A;  3TJT A;  1BSM A;  1IDS A;  4E4E A;  1XRE A;  3AK3 A;  3BFR A;  1D5N A;  4BR6 A;  1MNG A;  1BT8 A;  1VEW A;  1Y67 A;  3MDS A;  1LUW A;  1PM9 A;  1XIL A;  1JR9 A;  1EN5 A;  1PL4 A;  3QVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...