3C3SA

Role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
196
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWAHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 64
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3c3sA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3c3sA02
3TJTA 1WB8A 1ZTEA 1IX9A 2CDYA 1XREA 3AK2A 1BT8A 1JR9A 4YIPA 1VEWA 1SZXA 1IDSA 1P7GA 4FFKA 1VARA 1I08A 2QKCA 1IXBA 1MA1A 1D5NA 3RN4A 3IC9A 1GN6A 1ZSPA 1KKCA 4E4EA 4JZGA 3OT7A 4BR6A 4JYYA 1N0JA 1Y67A 4X9QA 1PL4A 3CEIA 1XUQA 2CE4A 2RCVA 3C3TA 5A9GA 1QNMA 3K9SA 1MSDA 4GUNA 3LSUA 3QVNA 3KKYA 1ZUQA 1MMMA 1GN3A 1EN4A 1XDCA 2GDSA 4YIOA 1EN5A 2AW9A 3EVKA 1GN2A 3AK3A 1AVMA 4C7UA 1PM9A 1XILA 1BS3A 3DC6A 1EN6A 1EM1A 1LUWA 3DC5A 1N0NA 3AK1A 1LUVA 2P4KA 1AR4A 2ADPA 1JA8A 2QKAA 1GN4A 1I0HA 2ADQB 5AG2A 4F6EA 1MNGA 3MDSA 1WB7A 4JZ2A 1AP5A 3C3SA 1BSMA 1AR5A 1AP6A 1B06A 1ZLZA 3BFRA
chains in the Genus database with same CATH superfamily
4B3RO 3CXCU 4X65O 4DV4B 3ABTA 2CTWA 3JATB 4IYHA 2UXCB 4PELA 1OCZC 1VMGA 3E2EA 1AI7A 1TUEB 2ODMA 4IIJB 1M93A 1FD9A 4LWSB 4E2LA 3MHHC 1XHXA 3RW0A 1XNQO 3JATA 1D5NA 4NXMO 3ABMC 3VQXA 5IYDO 1EZJA 1NTMH 4E4EA 5B1BC 3JYCA 4JI2B 4IIJA 5KMGB 5FPRA 2P6JA 2VRZA 2QM7A 1SC5B 4O4LA 3DXRB 2QR4A 3ML0A 5D5QA 4K8XA 2QM8A 3CX5F 4WF9V 3G67A 4QPKA 4U3FH 3T1CA 1W0KG 2LFSA 1NTKH 4B08A 3OGCC 3P3PA 4RUFA 3RYIA 3TGUH 2JGDB 3C3TA 2M7WA 5JQGB 2WLMA 1WLEA 5KMGA 4MVUA 3ZHVA 1R73A 2QWQB 1QLEB 4JV5B 4FLTA 2IM9A 2ATKC 3K03A 2JGDA 3L74H 1AI6A 2YIBD 4I7ZB 4LF5O 1VF6A 3LNMB 2FB5A 2D2CB 4DR5B 3DTUB 3JAMN 2FKXA 1YCIA 1YSCA 1SF9A 2ADPA 3ZHUA 5IYBO 2BOCC 4F6EA 3H1HH 3FKSG 2FMLA 2HJFC 4F6RA 3X2QB 2QWPB 4CS3A 4NTYA 1TAEA 3OR6C 3OUSA 2Z3YA 5LGTA 3CCEV 2NLJC 4BIZA 1YITV 1CEZA 1B6QA 1YZBA 4LF6O 2LW1A 1I5XA 4JI6O 3DGEA 3ETDA 5CA3A 4UCRA 4DR4B 4JYAO 1SZXA 1F23A 1P7GA 4MVRA 4DR6B 1OHHG 2F93B 4D7SA 1GAXA 4IHJB 3TXSA 5IY5C 1TVKA 1J5EB 2GTSA 2OCCC 2ITDC 2QEXV 3B8NA 3IAYA 1Y6XA 1HNZO 2A79B 4JYYA 5KHIA 3UCSC 5KAIZ 5B1OA 4IHJA 3ZHSA 4O4JB 1YJNV 3MD0A 2LW7A 2CK3G 2Y69B 2CE4A 3O9OA 3TETA 3WU2Z 2W6JG 1HWYA 1MSWD 3HKBA 5BMVA 5GTIZ 4PA9A 1WP8A 5IWAB 3LSUA 4MTGA 2EULA 3EXAA 3ASNB 4O4JA 3ZIAG 4WCEV 2GV9A 1BQZA 2JJ2G 5LP6B 4AQYO 4LH7A 1HP8A 2WA3A 2UU9B 4KFMA 5H9CA 1YEWA 2F4VB 2P67A 4GX5A 5GONB 2YEVA 3QO5A 4JF3A 2E3CA 5EBWC 2WA4A 3FAVB 2EIJC 5LP6A 1SQXH 3TXQA 2DYRC 5JJNB 5H5NA 4RUEA 3T1HB 4X1YA 1EBOA 4LF4B 2YXHA 4WFHA 2RJZA 1TA8A 1B3QA 1SS3A 2GUZA 4YXWG 3G6EV 1U96A 3TJTA 2WLNA 2ZNJA 1AI5A 1QVFU 3A0BZ 1V55C 4DV1B 4YHHO 4K0KB 4DV3O 1VIBA 5LHHA 5KA6A 4UCVA 1RPOA 3W7TA 1FXKB 4ZKIA 4X64O 5CA1A 3JD3A 4JI8B 2WLKA 1S5LZ 4X66O 1COWG 4FLXA 2HHHO 2Z5UA 1OCZB 3QO8A 3OFNG 3CMAV 2W6IG 4RO2A 5DN6G 4DR1O 4H37A 4ZI7B 4FLZA 2Q0OC 3FB6C 1FXKA 2ZIOA 3B40A 3OTFA 3ZCCA 1H8HG 2ZE7A 1O9GA 4UB6Z 4TV8A 4J80A 1YTFD 4TWKA 4UCOA 2XT9A 1M1KW 1Z5VA 4JGSA 4KP4A 4W4LA 4ZI7A 3CD6V 5B1BB 4EFEA 1H8EG 1CP9A 3HB3B 3SJQC 4Z2WA 4GCZA 1AJQA 1XOUA 3S3WA 3B4SA 3CCRV 1CXZB 4OGQB 2JEXA 3G71V 3AK3A 1IBMB 4FM0A 2KG7A 4I0XA 1F7YA 1AVMA 1PM9A 1RM1B 3OTOB 5ITZB 2A7WA 5EBMC 2N74A 2Q69A 3RFRA 2AGAA 4TSFG 2NR5A 2XASA 2ADQB 1NS1A 3U0ZA 4KHPO 1G1XB 3HKDB 1N36O 2VQEB 5FLXN 2UXDO 2BTQB 5ITZA 4JYBA 4U7OA 1Q6IA 2OCHA 4EB6A 1AR5A 2XAFA 2YDEA 2A9HA 4UXNA 4DR2B 4JAAA 3O65A 3G80A 3K06A 3HKDA 3G4SV 1ZTEA 3QF7A 3CE2A 3P3NA 1MOFA 4LF9B 1M5IA 3W7XA 4MW3A 1TUBB 1OCRC 3ZX6A 4XDJA 4LF8O 4HZ3A 1XNRO 4GKJO 4PDVA 2X6CA 1RPRA 4GKKB 2YI8A 4UFZA 4FJCC 1K4DC 1U97A 2C2AA 4TUYA 4UB8Z 1JX9A 1R6KA 3K5OA 2CTQA 4JZGA 1K33A 3CCQV 4TV9B 4J11A 2QA4V 1VQKV 3QNEA 1Q81W 3WFVA 4YJ3B 5IY5B 2OTJV 2QWOB 1XMOB 3ZN0A 2P5OA 1KMIZ 2OCCB 4MS2A 4QE7A 5EBLC 3RWRD 5LXTA 4GUNA 3E8GA 4UUJC 2IJIA 4YJ3A 5LMUB 1JJ2U 4PD4F 4YIOA 2P22C 1IBLB 2AW9A 2VQFB 2Q7HA 2AZ0A 2WLJA 2GBOA 1K73W 3H01A 2HP8A 2ZR3A 3LSQA 1NZ6A 1AROP 1QLEC 3DC6A 1EM1A 4NTXA 2XAJA 1RSOA 4MT8A 2F23A 2YS8A 3SJCC 5J9PC 1HNXO 1OCOB 4CH4A 1Z5WA 3SDLA 3JASB 3ZRWB 4FMTA 1AR4A 1HR0B 4X8AA 1IBKO 4LF7O 1JJOA 4ZBMA 3K5LA 4DV0O 1NH2B 5BR8O 3T1YB 4ZOLB 1M57C 1S72V 3M99B 5L3GA 1R3IC 3ZRWA 2PUSA 3CC7V 2VWKA 3JCZA 5KHHA 4LH6A 2EINB 3IFXA 4I50A 4AILC 3ABUA 3D8CA 3RVYA 1NJIW 3SJAC 2UUBO 4JASA 4PHZA 1XQ8A 3OUFA 4DR7O 3MHSC 3THOA 3RYFB 3BAAA 2Q6AA 5HFMA 1N8RW 4BW5A 3KG2A 3E8BA 5L3EA 4CBCA 1GN6A 5IDJA 3JARA 1NBMG 2QGNA 1R6NA 3M7MX 1SZTA 4JI0O 3RYFA 4DV6B 2CTPA 1S77D 2R9AA 1SERA 4L87A 1N33B 2WLIB 3CEIA 4JPRA 1TGOA 1WPXA 4FM2A 2RCVA 2EILB 4GT1A 2CH7B 3B09A 3K9SA 3ZRVA 2Q73A 4LFAO 3EFFK 3APOA 3L72H 2UUCB 2Y69C 1ZAUA 2AHYA 2JK5C 4ZHQA 1SETA 1BMFG 5L3FA 1JFFB 1XDCA 2QKSA 2WLIA 4MVQA 1EFRG 1EN5A 3SPCA 4JI4O 3CC4V 1R3LC 3D36A 5GW7A 2AHZA 2LO1A 5JH7B 4DV2B 4FVMA 3WB0A 2O57A 5CA0A 3D3QA 3SGIA 1NH2D 1JFFA 4OPHA 3A2FA 4FLWA 3HKCA 2BOBC 1PKXA 4DV4O 5L3CA 2UXCO 1SESA 4JI5B 5BY1A 4BIUA 2NN4A 1B06A 4PJ0Z 1H2LA 2DWDC 5EZYB 2HVKC 2N05A 3L75H 1YI2V 1O9HA 4NB5A 1N34B 1BL8A 3GVMA 5KX5A 4HNAB 4YIPA 1PNKA 4YJ2B 3UKMA 5EZYA 1IXMA 3JSNA 1N4CA 1WA8A 4JI2O 1VQOV 4G27B 3H1IH 5KHKA 1FXKC 4H44B 4O2BB 4HYOA 4PA6A 4GLXA 1FS0G 2EX3A 1PNLA 5CMUA 4X1IB 4EFBA 4TQDA 4NR1A 1E79G 1OCRB 1P49A 3JAWB 1Q86W 1OZ0A 2CGNA 4O2BA 2Q9LA 3K79A 4JV5O 3OMAB 3D3IA 3WB1A 4XBFA 2QTSA 2F66C 4LC1A 4TOIA 1FPOA 2YIAA 3JAWA 2ZINA 3AG3C 4JI7B 1EN4A 2JDIG 4LWSA 3SJBC 4DR5O 3FFQA 3EVKA 2DW4A 4KL1A 3Q4HB 3KDRA 3W7UA 3SYAA 4I4TB 2WLLB 3WG7C 2Y0PA 3L73H 4WFEA 2A0LA 2WLHA 2DWEC 1Q3EA 2CTRA 2UXNA 3JSLA 1RM1C 3E86A 3CRCA 3CP1A 5AG2A 1Q8IA 1JOYA 3DXRA 4I4TA 3A0RA 2WLLA 3BY6A 1DF5A 1OJHA 1Q43A 5H6RA 5JQGA 4UVCA 2MW2B 2B9ZA 1ZLZA 1IVSA 2DOSA 4MW8A 2ZM6B 1XHZA 4JYCA 1NR1A 3AG7A 1WB8A 5C8YB 1NT2B 1M57B 4CS4A 1XNQB 2RN9A 5EC2C 1WN7A 1J5EO 1NQTA 4O2AB 4FLYA 2XNDG 3UO2A 3J81N 5C8YA 4DUZB 3L70H 3BA9A 4G2KA 4ICGA 5E1AC 3R66A 4L8JA 4DUYB 5KUMA 4O2AA 1Q82W 3OM3B 5IWAO 4LFCO 3ZN1A 2KB1A 3FB8C 2IH1C 4N21A 2XHBA 1H5WA 1DF4A 5A9GA 2GSMB 4J41A 3JAKB 2UU9O 3ICXA 5FPOA 2UXBB 4AI8A 4LF5B 1H2GA 3BVOA 3OMIB 4OX9B 1QU7A 1E1QG 1VQ4V 5FL7G 2QWRB 2DE0X 4GZRB 5KUKA 5EYPB 4BWAA 1N0NA 3ABLB 1YTFB 3T1HO 2GTAA 3IJ4A 1OV9A 2IU3A 4B3TO 4IGGA 1MABG 1ZL8B 4WFAV 1OCOC 1I5YA 3ZJZA 1VQMV 3W7WA 5CBFA 2A06H 3ZS8C 2PYJA 4DV1O 1G8MA 5EYPA 2F1MA 4LF6B 5J2UB 3SPIA 1ZL8A 1SRYA 1YHQV 3UQ8A 1PL0A 1GTOA 1G6UA 2QJ1A 2EINC 2QM4A 3WB2A 4B3SB 2OWOA 5B1AB 5B1NA 4BIOA 3RBZA 1THZA 1VARA 1BCCH 5GONA 5B5EZ 1PP9H 2Q7GA 4GX2A 1HNZB 4FM1A 2FYUH 1MA1A 5LGUA 2PI4A 1IJGA 3FAVA 5D5PA 1S5HC 4JTAB 2HFEC 3K0DA 1SQVH 4LFBO 4H0LB 1MG1A 3OD4A 1AR1B 4DR3B 4GX1A 1EZVH 1IZ3A 1SQQH 3RT3C 4CS2A 1ORQC 2PI5A 2YC0A 2Y0IA 5KLVH 1W0JG 2B1IA 2LQTA 3CCMV 3N2GB 1QR9A 1IBMO 1OCCB 3CMEV 2P90A 5F2VO 5L3BA 3OTOO 1LR1A 3UM7A 3KCYA 2EILC 5KAFZ 1KC8W 4K35A 3D36C 1ZUQA 1MMMA 2HKOA 1H2NA 2GDSA 1QVGU 1CPYA 1GN2A 1I94O 3SYPA 2EBOA 2OTLV 5EK0A 1XILA 3RYCB 5JCOC 1LUWA 3CB2A 3AG3B 4QNHB 2VQEO 4RQEA 3AG2C 3H1KH 1R3KC 3GB7C 4I55B 3K59A 2HLDG 1JA8A 4J7JA 1M4UA 4B7KA 2YICA 3WG7B 1QCEA 3K04A 4DR2O 1WB7A 2LP7A 4B3MO 2Q7EA 3CCJV 1SQPH 4YHHB 3C3SA 3QO7A 4DV3B 4QJFB 1HNWO 4I55A 3F7YC 2X0LA 4LF9O 2UXXA 3A0HZ 2IW5A 2Q5ZA 4FK5C 3UT5B 2HEPA 1GK9A 1FJGB 4JAVA 1XL4A 3CJHB 4GKKO 1JR9A 3J7AU 4J10A 3K5MA 1QLNA 1DTOA 4X1KB 1N32O 4JI1B 2BCCH 1Q6UA 3UT5A 1P84F 1KP3A 5LYJB 1XMOO 1KKDA 1BGYH 2BTQA 1KB9F 1WJZA 4DRXB 4X1KA 1ZX3A 2ZT9B 2ZXWB 4X88A 1JVMA 1YVWA 1ENVA 2ZE6A 2L6LA 4IT5A 5LYJA 5LMUO 1S76D 3R65A 4TT3G 4Z1MG 3W7SA 5LA6B 1IBLO 2VQFO 1DGSA 1MZFA 2WSSG 2UUAB 5CB4B 1GM9A 2IBZH 1QHTA 3QVNA 5CBHA 3JD4A 1GN3A 1TUBA 3LNNA 4G28B 2IJJA 2R9RB 4MVZA 5LA6A 4FLUA 1HR0O 4NKGB 3H9VA 5CBGA 4N23A 1N36B 2V7QG 3T1YO 5EC1C 4WBNB 4TV9A 4CH6A 1K3EA 2DN9A 1H2MA 3K57A 1SA0B 3OR7C 2QE7G 3LDDA 4W4KA 2OT5A 5IJ9B 3F5TA 1T5EA 3EHBB 3E22B 2KKWA 4O4HB 4ASUG 3K58A 3VOUA 1KBHA 3OE7G 4MTXA 3BFRA 4FLVA 1KD1W 2F43G 2EZOA 1H2SB 5B66Z 4LF8B 1XNRB 1Q7YW 3E22A 4O4HA 1P7BA 1F51A 2L35A 1KUQA 2Z0AA 4BAYA 1FXVA 2AZ2A 3BRCA 1VF5B 3U11A 1IXBA 1G4YB 4DV6O 5IT9N 1BHBA 3JASA 2JVDA 1N33O 2HR3A 2H3OA 1V9PA 1ZSPA 3E35A 1SKVA 1JPXA 1Y74B 3VQVA 2CGOA 3B77A 4X62B 2Q4PA 4ZOLA 1N0JA 5JVDB 2UUCO 2JIZG 4FPPA 3B8MA 1S3JA 4DK0A 4YY3B 4NYKA 2YIDA 2IU0A 1WP7A 2ILMA 1M90W 3AG4C 1Q5OA 5EIBD 3LUTB 1QBZA 5JVDA 3ZHTA 1Y76B 2RDCA 2XAQA 2H94A 5DM6V 2B5UA 4H33A 1K8AW 3CXHF 4JTCB 1S0VA 3FX7A 2KSDA 2Y4TA 3K9AA 2JS5A 3DC5A 3LDEA 3AK1A 5LMNB 2MK3A 2P7TC 1Y76A 4JI5O 3B2EE 3PN1A 4LCUC 1GKFA 5LL6Y 1YJWV 1I0HA 4JI3O 3SPHA 1UPGA 3ABLC 1M56B 4UCUA 3RVZA 1VF7A 4P2ZA 1N34O 3AG2B 4NXNB 2HVJC 2CH7A 2Y48A 4XDLA 3JALB 3HPLC 2N04A 3CWBH 2EZPA 5H6QA 2E76B 2X7RB 4DR7B 1MZEA 4FZ0A 1H2KA 3OEHG 2E5LB 5JCOA 2DMXA 2XAHA 1FFTB 3ZMSA 1XL6A 1XREA 1BT8A 2EIMB 2PY5A 1GRJA 1VEWA 3JALA 4DW0A 1Z2GA 3E8FA 1Q90D 2EJ7A 2ZIMA 1I7FA 5JH7A 1DLBA 3CRRA 4CH3A 2JJ1G 1XI1A 4BW9A 3OEEG 1YJ9V 5B1AC 1NVPB 4PDMA 4MVMA 1GM8A 1BE3H 3CRAA 3KCXA 2Y4UA 2YXLA 1Y67A 3SR2C 1X59A 2R9IA 4UV8A 3CCLV 2XOKG 3IC7A 1XUQA 2ZR2A 2ITCC 5K1PA 4UVAA 1H38A 3TK1A 3CCVV 4CC6A 3A8TA 5LBQA 5C93A 4I9QA 1FFXB 3L9DA 3ZHRA 4HNAA 5E79Z 5IJ0B 4YJ2A 3ZHQA 4DW1A 1OCCC 4R6ZA 1QQCA 4LNUB 4HBNA 4QPJA 1R3JC 5KA5A 1FFXA 3SYQA 4X1IA 5IJ0A 3MAQA 4RQFA 2WAMA 5H2FZ 4Q6GA 1GO3F 4LNUA 1UFIA 4GX0A 4NVPA 4WFFA 3ETGA 2ZM6O 3MDSA 4DV7B 3K3WA 1L1FA 3STLC 4O4LB 1VQNV 1BSMA 4J7KA 1L0LH 2BE3A 3FB5C 3KZIZ 2ZKOA 3P30A 3SPGA 1V54B 1GM7A 3RYIB 3E83A 4PDRA 2ZD9A 5JWPA 3CSXA 2CDYA 3Q4HA 4DV5B 1XMQB 3AK2A 4UCSA 2D3OW 4DUZO 3K0GA 4FIPC 4B3RB 1K5SA 4X65B 3VBBA 4CC5A 1IDSA 3I5DA 1NVPD 1I08A 2ARHA 1PD3A 3SPJA 4DUYO 2Q0AA 3RN4A 5J2TB 4DR4O 3P32A 4DR6O 3AG1C 4I5SA 4ZIBA 4Z1VA 1US6A 4X9QA 3ZRXA 4NXMB 4H13B 1KECA 4DXWA 2UXBO 5J2TA 1UJWB 4OPAA 2CUGA 4F6RB 4OX9O 2ZXWC 1L0NH 2ZDIC 2Q67A 4KXRA 1Y4MA 1NR7A 3NXSA 4OXSA 1AJPA 2EIKC 5B3SB 3AG4B 2IJHA 1EN6A 2AXTZ 3PJSK 2R72A 5EIBC 3JD2A 5K1XA 2PGGA 3CRQA 3QG5A 2ETNA 3N27A 2YXYA 2P4KA 1TVKB 4B7EA 4D7TA 2P06A 2F4VO 3ABKB 2QTOA 1AP5A 4KUMA 5IE9A 1AP6A 2W0FC 4R7CA 3JAKA 5CN0A 1NKDA 4B3SO 1YDXA 1KYOF 3OAAG 4MVSA 4LF4O 2PYLA 1FAFA 3HKBB 5BMVB 1IX9A 2A3QA 3C90A 4R8CA 1FOUA 1IURA 1URFA 2F95B 4U7NA 3BHPA 1PPJH 4TQFA 1K9MW 4K0KO 3FB7C 1Q6HA 4DR3O 5LHIA 2JGUA 3IC9A 4JI6B 4JYAB 4IYIA 4DYLA 1VP7A 4LFCB 2YEVB 1GH6A 4JI8O 1P4RA 2GHYA 2XAGA 3OGIB 4P30A 1M9NA 5J2UA 1PNMA 4LBEC 2PF4E 1VQLV 1DK1A 1FXHA 4J7ZA 3RYHB 4X1YB 3GWOA 5IYCO 1KP2A 3JD0A 3ASOC 2GUZB 1PV0A 2DQ3A 2X6BA 1HDJA 1W59A 1YXBA 3FYEB 1NI8A 3RYHA 4QGPA 3OMNB 4B3TB 4IL6Z 2ZNIA 3ZMVA 3F5WC 1NU1H 5CA1B 1B04A 5TISZ 4FFBB 4X89A 3CCUV 3CC2V 3G6BA 5GTHZ 4AQYB 2QKAA 1GN4A 3RGBA 1QR8A 2E75B 4CH5A 1WPBA 1FJGO 4PV1B 1WNSA 4JZ2A 4FFBA 3N2GA 4P9OA 4TV8B 5LGNA 4K3AA 1M56C 2DYSC 1R1BA 4J9YB 4JI1O 4K8ZA 1YIJV 1JMKC 1KU9A 4PI2A 1K34A 2Q8VA 5KHJA 2BTOA 3RYCA 3ETQA 3ABMB 1A32A 5JJJB 4LFBB 2QKCA 1LNQA 3TCUA 1AI4A 1AILA 1AJNA 2H8PC 2EIMC 1RP3B 2KG7B 2XUMA 4I0XB 1L8DA 3UO3A 1VQ9V 3GWKC 2OYQA 2B1GA 2ZE8A 4PI0A 1D5AA 1X4TA 2ZQMA 4JTDB 4X64B 1FKAO 1KKCA 4J9ZB 1WAZA 3T4DA 3T2MA 5JJEB 1NTZH 4X66B 3OT7A 2HHHB 1VQ7V 3J80N 1VQPV 2UUAO 2DQ0A 3I55V 3ZEDA 3IGAC 3K08A 4DO2A 4RWUA 1K7DA 2M6YA 5KHGA 4DR1B 2PTMA 3BEHA 4PA3A 4QE9A 4QIWF 3LSSA 3AG1B 4EB6B 1I94B 1VQ6V 3CJHA 4RAIA 4CZZA 3HR0A 1VQ5V 1SQGA 3H1LH 3H1JH 2KQXA 5BXZA 1D2DA 4NTWA 2LJ2A 2W0XA 2LGWA 4ABMA 4PA4A 3SYOA 4B3MB 4DRXA 2V1DA 1K97A 4MTOA 3FD9A 1HNWB 2VWJA 2Q68A 2EIKB 3ZRSA 2V4DA 1K5QA 2ZDIA 4TUYB 1JQ0A 4HAMA 2ZCEA 3BA8A 4U3JB 1Y66A 1VQ8V 5CB4A 4UCTA 4KHPB 2E74B 5DECA 4AHCA 3LDCA 2UXDB 3T4ZA 4I9WA 5HFLA 3CYOA 3E8HA 1SQFA 1N32B 1XBLA 3U10A 5LXTB 1KQSU 2JS3A 1AB3A 1V54C 4PA7A 4U3JA 2R70A 4R50A 4FFKA 2EJRA 4FZ1A 3S3XA 1ROPA 3CPWU 1K4CC 3VQYA 4EKWA 1F4NA 4WFBV 4X62O 1FYJA 3ZBHA 4WBNA 4WFGA 3BPZA 1RSOB 1SA0A 1JCHA 4YY3O 5A2QN 4LR3A 2PZSA 4BR6A 1BHAA 1VF6C 5IJ9A 4GKJB 2BSKB 3F7VC 5LOVB 2QDOA 3JCUZ 5LHGA 5L3DA 5DEDA 2QSAA 4P9PA 2YI9A 1BZKA 1MSDA 4X20B 3JD1A 4J42A 1ZWIC 3KKYA 4I50B 3E89A 1W2BU 2BSKA 5LOVA 5LMNO 2P4VA 1HW7A 2NNUA 4F4LA 4C7UA 3ASOB 4X20A 2CAZC 2DJVA 2HG5C 3CHXA 2EIJB 3QTCA 2G38A 3SYCA 3X2QC 2DYRB 5FNVB 5B3SC 1Y74A 4NXNO 2ZE5A 3JARB 4DV2O 4UVBA 1RFYA 3STZC 2K1EA 3ETEA 1HNXB 3ZMUA 2E5LO 3ZMZA 2HJDA 1V55B 3ABKC 5FNVA 2X6AA 1IBKB 2IJKA 4LF7B 4XDKA 3HKEB 4DV0B 5BR8B 2JRIA 3APQA 2OIEA 5IYZB 4Q20A 4ZHQB 2DYSB 4D6TH 3HKEA 1S5JA 4MVOA 4JAUA 3ZMTA 1J95A 2UUBB 2VS0A 1K92A 3CS5A 1E1RG 3BCCH 1SQBH 5IYZA 2JEUA 2QWNB 5CA0B 3BABA 4PDLA 2OIGA 4O4IB 3L71H 3HKCB 2K9PA 2YSUB 2RNBA 1PL4A 3ASNC 2XTAA 2RQ6A 2WWWA 2FTKA 1GMGA 2RMKB 4JI0B 5LP6C 1QNMA 3DSQA 4UV9A 2YUAA 3AEIA 3N2KB 1YF2A 3OW2U 2LGQA 4O4IA 2IH3C 1R6TA 3M8AA 3CRMA 3NR7A 5KX5B 4LFAB 4MTFA 1BS3A 4JI7O 3N2KA 4DK1A 4JI3B 3I56V 1BQ0A 2FL4A 1WA8B 4EEQA 4DV7O 4JI4B 3CCSV 1LUVA 3K5NA 1JNBA 1F4MA 1XEQA 2WPDG 5BZBA 1MNGA 4LP8A 2LFRA 4MSWC 4GYCB 3FYIB 2YIBA 3VQWA 4A5UB 4DV5O 1XMQO
chains in the Genus database with same CATH topology
3TJTA 1WB8A 1ZTEA 1IX9A 2CDYA 1XREA 3AK2A 1BT8A 1JR9A 4YIPA 1VEWA 1SZXA 1IDSA 1P7GA 4FFKA 1VARA 1I08A 2QKCA 1IXBA 1MA1A 1D5NA 3RN4A 3IC9A 1GN6A 1ZSPA 1KKCA 4E4EA 4JZGA 3OT7A 4BR6A 4JYYA 1N0JA 1Y67A 4X9QA 1PL4A 3CEIA 1XUQA 2CE4A 2RCVA 3C3TA 5A9GA 1QNMA 3K9SA 1MSDA 4GUNA 3LSUA 3QVNA 3KKYA 1ZUQA 1MMMA 1GN3A 1EN4A 1XDCA 2GDSA 4YIOA 1EN5A 2AW9A 3EVKA 1GN2A 3AK3A 3KDRA 1AVMA 4C7UA 1PM9A 1XILA 1BS3A 3DC6A 1EN6A 1EM1A 1LUWA 3DC5A 1N0NA 3AK1A 1LUVA 2P4KA 1AR4A 2ADPA 1JA8A 2QKAA 1GN4A 1I0HA 2ADQB 5AG2A 4F6EA 1MNGA 3MDSA 1WB7A 4JZ2A 1AP5A 3C3SA 1BSMA 1AR5A 1AP6A 1B06A 1ZLZA 3BFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJT A;  1WB8 A;  1ZTE A;  1IX9 A;  2CDY A;  1XRE A;  3AK2 A;  1BT8 A;  1JR9 A;  4YIP A;  1VEW A;  1SZX A;  1IDS A;  1P7G A;  4FFK A;  1VAR A;  1I08 A;  2QKC A;  1IXB A;  1MA1 A;  1D5N A;  3RN4 A;  3IC9 A;  1GN6 A;  1ZSP A;  1KKC A;  4E4E A;  4JZG A;  3OT7 A;  4BR6 A;  4JYY A;  1N0J A;  1Y67 A;  4X9Q A;  1PL4 A;  3CEI A;  1XUQ A;  2CE4 A;  2RCV A;  3C3T A;  5A9G A;  1QNM A;  3K9S A;  1MSD A;  4GUN A;  3LSU A;  3QVN A;  3KKY A;  1ZUQ A;  1MMM A;  1GN3 A;  1EN4 A;  1XDC A;  2GDS A;  4YIO A;  1EN5 A;  2AW9 A;  3EVK A;  1GN2 A;  3AK3 A;  1AVM A;  4C7U A;  1PM9 A;  1XIL A;  1BS3 A;  3DC6 A;  1EN6 A;  1EM1 A;  1LUW A;  3DC5 A;  1N0N A;  3AK1 A;  1LUV A;  2P4K A;  1AR4 A;  2ADP A;  1JA8 A;  2QKA A;  1GN4 A;  1I0H A;  2ADQ B;  5AG2 A;  4F6E A;  1MNG A;  3MDS A;  1WB7 A;  4JZ2 A;  1AP5 A;  3C3S A;  1BSM A;  1AR5 A;  1AP6 A;  1B06 A;  1ZLZ A;  3BFR A; 
#chains in the Genus database with same CATH topology
 4B3R O;  3CXC U;  4X65 O;  4DV4 B;  3ABT A;  2CTW A;  3JAT B;  4IYH A;  2UXC B;  4PEL A;  1OCZ C;  1VMG A;  3E2E A;  1AI7 A;  1TUE B;  2ODM A;  4IIJ B;  1M93 A;  1FD9 A;  4LWS B;  4E2L A;  3MHH C;  1XHX A;  3RW0 A;  1XNQ O;  3JAT A;  1D5N A;  4NXM O;  3ABM C;  3VQX A;  5IYD O;  1EZJ A;  1NTM H;  4E4E A;  5B1B C;  3JYC A;  4JI2 B;  4IIJ A;  5KMG B;  5FPR A;  2P6J A;  2VRZ A;  2QM7 A;  1SC5 B;  4O4L A;  3DXR B;  2QR4 A;  3ML0 A;  5D5Q A;  4K8X A;  2QM8 A;  3CX5 F;  4WF9 V;  3G67 A;  4QPK A;  4U3F H;  3T1C A;  1W0K G;  2LFS A;  1NTK H;  4B08 A;  3OGC C;  3P3P A;  4RUF A;  3RYI A;  3TGU H;  2JGD B;  3C3T A;  2M7W A;  5JQG B;  2WLM A;  1WLE A;  5KMG A;  4MVU A;  3ZHV A;  1R73 A;  2QWQ B;  1QLE B;  4JV5 B;  4FLT A;  2IM9 A;  2ATK C;  3K03 A;  2JGD A;  3L74 H;  1AI6 A;  2YIB D;  4I7Z B;  4LF5 O;  1VF6 A;  3LNM B;  2FB5 A;  2D2C B;  4DR5 B;  3DTU B;  3JAM N;  2FKX A;  1YCI A;  1YSC A;  1SF9 A;  2ADP A;  3ZHU A;  5IYB O;  2BOC C;  4F6E A;  3H1H H;  3FKS G;  2FML A;  2HJF C;  4F6R A;  3X2Q B;  2QWP B;  4CS3 A;  4NTY A;  1TAE A;  3OR6 C;  3OUS A;  2Z3Y A;  5LGT A;  3CCE V;  2NLJ C;  4BIZ A;  1YIT V;  1CEZ A;  1B6Q A;  1YZB A;  4LF6 O;  2LW1 A;  1I5X A;  4JI6 O;  3DGE A;  3ETD A;  5CA3 A;  4UCR A;  4DR4 B;  4JYA O;  1SZX A;  1F23 A;  1P7G A;  4MVR A;  4DR6 B;  1OHH G;  2F93 B;  4D7S A;  1GAX A;  4IHJ B;  3TXS A;  5IY5 C;  1TVK A;  1J5E B;  2GTS A;  2OCC C;  2ITD C;  2QEX V;  3B8N A;  3IAY A;  1Y6X A;  1HNZ O;  2A79 B;  4JYY A;  5KHI A;  3UCS C;  5KAI Z;  5B1O A;  4IHJ A;  3ZHS A;  4O4J B;  1YJN V;  3MD0 A;  2LW7 A;  2CK3 G;  2Y69 B;  2CE4 A;  3O9O A;  3TET A;  3WU2 Z;  2W6J G;  1HWY A;  1MSW D;  3HKB A;  5BMV A;  5GTI Z;  4PA9 A;  1WP8 A;  5IWA B;  3LSU A;  4MTG A;  2EUL A;  3EXA A;  3ASN B;  4O4J A;  3ZIA G;  4WCE V;  2GV9 A;  1BQZ A;  2JJ2 G;  5LP6 B;  4AQY O;  4LH7 A;  1HP8 A;  2WA3 A;  2UU9 B;  4KFM A;  5H9C A;  1YEW A;  2F4V B;  2P67 A;  4GX5 A;  5GON B;  2YEV A;  3QO5 A;  4JF3 A;  2E3C A;  5EBW C;  2WA4 A;  3FAV B;  2EIJ C;  5LP6 A;  1SQX H;  3TXQ A;  2DYR C;  5JJN B;  5H5N A;  4RUE A;  3T1H B;  4X1Y A;  1EBO A;  4LF4 B;  2YXH A;  4WFH A;  2RJZ A;  1TA8 A;  1B3Q A;  1SS3 A;  2GUZ A;  4YXW G;  3G6E V;  1U96 A;  3TJT A;  2WLN A;  2ZNJ A;  1AI5 A;  1QVF U;  3A0B Z;  1V55 C;  4DV1 B;  4YHH O;  4K0K B;  4DV3 O;  1VIB A;  5LHH A;  5KA6 A;  4UCV A;  1RPO A;  3W7T A;  1FXK B;  4ZKI A;  4X64 O;  5CA1 A;  3JD3 A;  4JI8 B;  2WLK A;  1S5L Z;  4X66 O;  1COW G;  4FLX A;  2HHH O;  2Z5U A;  1OCZ B;  3QO8 A;  3OFN G;  3CMA V;  2W6I G;  4RO2 A;  5DN6 G;  4DR1 O;  4H37 A;  4ZI7 B;  4FLZ A;  2Q0O C;  3FB6 C;  1FXK A;  2ZIO A;  3B40 A;  3OTF A;  3ZCC A;  1H8H G;  2ZE7 A;  1O9G A;  4UB6 Z;  4TV8 A;  4J80 A;  1YTF D;  4TWK A;  4UCO A;  2XT9 A;  1M1K W;  1Z5V A;  4JGS A;  4KP4 A;  4W4L A;  4ZI7 A;  3CD6 V;  5B1B B;  4EFE A;  1H8E G;  1CP9 A;  3HB3 B;  3SJQ C;  4Z2W A;  4GCZ A;  1AJQ A;  1XOU A;  3S3W A;  3B4S A;  3CCR V;  1CXZ B;  4OGQ B;  2JEX A;  3G71 V;  3AK3 A;  1IBM B;  4FM0 A;  2KG7 A;  4I0X A;  1F7Y A;  1AVM A;  1PM9 A;  1RM1 B;  3OTO B;  5ITZ B;  2A7W A;  5EBM C;  2N74 A;  2Q69 A;  3RFR A;  2AGA A;  4TSF G;  2NR5 A;  2XAS A;  2ADQ B;  1NS1 A;  3U0Z A;  4KHP O;  1G1X B;  3HKD B;  1N36 O;  2VQE B;  5FLX N;  2UXD O;  2BTQ B;  5ITZ A;  4JYB A;  4U7O A;  1Q6I A;  2OCH A;  4EB6 A;  1AR5 A;  2XAF A;  2YDE A;  2A9H A;  4UXN A;  4DR2 B;  4JAA A;  3O65 A;  3G80 A;  3K06 A;  3HKD A;  3G4S V;  1ZTE A;  3QF7 A;  3CE2 A;  3P3N A;  1MOF A;  4LF9 B;  1M5I A;  3W7X A;  4MW3 A;  1TUB B;  1OCR C;  3ZX6 A;  4XDJ A;  4LF8 O;  4HZ3 A;  1XNR O;  4GKJ O;  4PDV A;  2X6C A;  1RPR A;  4GKK B;  2YI8 A;  4UFZ A;  4FJC C;  1K4D C;  1U97 A;  2C2A A;  4TUY A;  4UB8 Z;  1JX9 A;  1R6K A;  3K5O A;  2CTQ A;  4JZG A;  1K33 A;  3CCQ V;  4TV9 B;  4J11 A;  2QA4 V;  1VQK V;  3QNE A;  1Q81 W;  3WFV A;  4YJ3 B;  5IY5 B;  2OTJ V;  2QWO B;  1XMO B;  3ZN0 A;  2P5O A;  1KMI Z;  2OCC B;  4MS2 A;  4QE7 A;  5EBL C;  3RWR D;  5LXT A;  4GUN A;  3E8G A;  4UUJ C;  2IJI A;  4YJ3 A;  5LMU B;  1JJ2 U;  4PD4 F;  4YIO A;  2P22 C;  1IBL B;  2AW9 A;  2VQF B;  2Q7H A;  2AZ0 A;  2WLJ A;  2GBO A;  1K73 W;  3H01 A;  2HP8 A;  2ZR3 A;  3LSQ A;  1NZ6 A;  1ARO P;  1QLE C;  3DC6 A;  1EM1 A;  4NTX A;  2XAJ A;  1RSO A;  4MT8 A;  2F23 A;  2YS8 A;  3SJC C;  5J9P C;  1HNX O;  1OCO B;  4CH4 A;  1Z5W A;  3SDL A;  3JAS B;  3ZRW B;  4FMT A;  1AR4 A;  1HR0 B;  4X8A A;  1IBK O;  4LF7 O;  1JJO A;  4ZBM A;  3K5L A;  4DV0 O;  1NH2 B;  5BR8 O;  3T1Y B;  4ZOL B;  1M57 C;  1S72 V;  3M99 B;  5L3G A;  1R3I C;  3ZRW A;  2PUS A;  3CC7 V;  2VWK A;  3JCZ A;  5KHH A;  4LH6 A;  2EIN B;  3IFX A;  4I50 A;  4AIL C;  3ABU A;  3D8C A;  3RVY A;  1NJI W;  3SJA C;  2UUB O;  4JAS A;  4PHZ A;  1XQ8 A;  3OUF A;  4DR7 O;  3MHS C;  3THO A;  3RYF B;  3BAA A;  2Q6A A;  5HFM A;  1N8R W;  4BW5 A;  3KG2 A;  3E8B A;  5L3E A;  4CBC A;  1GN6 A;  5IDJ A;  3JAR A;  1NBM G;  2QGN A;  1R6N A;  3M7M X;  1SZT A;  4JI0 O;  3RYF A;  4DV6 B;  2CTP A;  1S77 D;  2R9A A;  1SER A;  4L87 A;  1N33 B;  2WLI B;  3CEI A;  4JPR A;  1TGO A;  1WPX A;  4FM2 A;  2RCV A;  2EIL B;  4GT1 A;  2CH7 B;  3B09 A;  3K9S A;  3ZRV A;  2Q73 A;  4LFA O;  3EFF K;  3APO A;  3L72 H;  2UUC B;  2Y69 C;  1ZAU A;  2AHY A;  2JK5 C;  4ZHQ A;  1SET A;  1BMF G;  5L3F A;  1JFF B;  1XDC A;  2QKS A;  2WLI A;  4MVQ A;  1EFR G;  1EN5 A;  3SPC A;  4JI4 O;  3CC4 V;  1R3L C;  3D36 A;  5GW7 A;  2AHZ A;  2LO1 A;  5JH7 B;  4DV2 B;  4FVM A;  3WB0 A;  2O57 A;  5CA0 A;  3D3Q A;  3SGI A;  1NH2 D;  1JFF A;  4OPH A;  3A2F A;  4FLW A;  3HKC A;  2BOB C;  1PKX A;  4DV4 O;  5L3C A;  2UXC O;  1SES A;  4JI5 B;  5BY1 A;  4BIU A;  2NN4 A;  1B06 A;  4PJ0 Z;  1H2L A;  2DWD C;  5EZY B;  2HVK C;  2N05 A;  3L75 H;  1YI2 V;  1O9H A;  4NB5 A;  1N34 B;  1BL8 A;  3GVM A;  5KX5 A;  4HNA B;  4YIP A;  1PNK A;  4YJ2 B;  3UKM A;  5EZY A;  1IXM A;  3JSN A;  1N4C A;  1WA8 A;  4JI2 O;  1VQO V;  4G27 B;  3H1I H;  5KHK A;  1FXK C;  4H44 B;  4O2B B;  4HYO A;  4PA6 A;  4GLX A;  1FS0 G;  2EX3 A;  1PNL A;  5CMU A;  4X1I B;  4EFB A;  4TQD A;  4NR1 A;  1E79 G;  1OCR B;  1P49 A;  3JAW B;  1Q86 W;  1OZ0 A;  2CGN A;  4O2B A;  2Q9L A;  3K79 A;  4JV5 O;  3OMA B;  3D3I A;  3WB1 A;  4XBF A;  2QTS A;  2F66 C;  4LC1 A;  4TOI A;  1FPO A;  2YIA A;  3JAW A;  2ZIN A;  3AG3 C;  4JI7 B;  1EN4 A;  2JDI G;  4LWS A;  3SJB C;  4DR5 O;  3FFQ A;  3EVK A;  2DW4 A;  4KL1 A;  3Q4H B;  3KDR A;  3W7U A;  3SYA A;  4I4T B;  2WLL B;  3WG7 C;  2Y0P A;  3L73 H;  4WFE A;  2A0L A;  2WLH A;  2DWE C;  1Q3E A;  2CTR A;  2UXN A;  3JSL A;  1RM1 C;  3E86 A;  3CRC A;  3CP1 A;  5AG2 A;  1Q8I A;  1JOY A;  3DXR A;  4I4T A;  3A0R A;  2WLL A;  3BY6 A;  1DF5 A;  1OJH A;  1Q43 A;  5H6R A;  5JQG A;  4UVC A;  2MW2 B;  2B9Z A;  1ZLZ A;  1IVS A;  2DOS A;  4MW8 A;  2ZM6 B;  1XHZ A;  4JYC A;  1NR1 A;  3AG7 A;  1WB8 A;  5C8Y B;  1NT2 B;  1M57 B;  4CS4 A;  1XNQ B;  2RN9 A;  5EC2 C;  1WN7 A;  1J5E O;  1NQT A;  4O2A B;  4FLY A;  2XND G;  3UO2 A;  3J81 N;  5C8Y A;  4DUZ B;  3L70 H;  3BA9 A;  4G2K A;  4ICG A;  5E1A C;  3R66 A;  4L8J A;  4DUY B;  5KUM A;  4O2A A;  1Q82 W;  3OM3 B;  5IWA O;  4LFC O;  3ZN1 A;  2KB1 A;  3FB8 C;  2IH1 C;  4N21 A;  2XHB A;  1H5W A;  1DF4 A;  5A9G A;  2GSM B;  4J41 A;  3JAK B;  2UU9 O;  3ICX A;  5FPO A;  2UXB B;  4AI8 A;  4LF5 B;  1H2G A;  3BVO A;  3OMI B;  4OX9 B;  1QU7 A;  1E1Q G;  1VQ4 V;  5FL7 G;  2QWR B;  2DE0 X;  4GZR B;  5KUK A;  5EYP B;  4BWA A;  1N0N A;  3ABL B;  1YTF B;  3T1H O;  2GTA A;  3IJ4 A;  1OV9 A;  2IU3 A;  4B3T O;  4IGG A;  1MAB G;  1ZL8 B;  4WFA V;  1OCO C;  1I5Y A;  3ZJZ A;  1VQM V;  3W7W A;  5CBF A;  2A06 H;  3ZS8 C;  2PYJ A;  4DV1 O;  1G8M A;  5EYP A;  2F1M A;  4LF6 B;  5J2U B;  3SPI A;  1ZL8 A;  1SRY A;  1YHQ V;  3UQ8 A;  1PL0 A;  1GTO A;  1G6U A;  2QJ1 A;  2EIN C;  2QM4 A;  3WB2 A;  4B3S B;  2OWO A;  5B1A B;  5B1N A;  4BIO A;  3RBZ A;  1THZ A;  1VAR A;  1BCC H;  5GON A;  5B5E Z;  1PP9 H;  2Q7G A;  4GX2 A;  1HNZ B;  4FM1 A;  2FYU H;  1MA1 A;  5LGU A;  2PI4 A;  1IJG A;  3FAV A;  5D5P A;  1S5H C;  4JTA B;  2HFE C;  3K0D A;  1SQV H;  4LFB O;  4H0L B;  1MG1 A;  3OD4 A;  1AR1 B;  4DR3 B;  4GX1 A;  1EZV H;  1IZ3 A;  1SQQ H;  3RT3 C;  4CS2 A;  1ORQ C;  2PI5 A;  2YC0 A;  2Y0I A;  5KLV H;  1W0J G;  2B1I A;  2LQT A;  3CCM V;  3N2G B;  1QR9 A;  1IBM O;  1OCC B;  3CME V;  2P90 A;  5F2V O;  5L3B A;  3OTO O;  1LR1 A;  3UM7 A;  3KCY A;  2EIL C;  5KAF Z;  1KC8 W;  4K35 A;  3D36 C;  1ZUQ A;  1MMM A;  2HKO A;  1H2N A;  2GDS A;  1QVG U;  1CPY A;  1GN2 A;  1I94 O;  3SYP A;  2EBO A;  2OTL V;  5EK0 A;  1XIL A;  3RYC B;  5JCO C;  1LUW A;  3CB2 A;  3AG3 B;  4QNH B;  2VQE O;  4RQE A;  3AG2 C;  3H1K H;  1R3K C;  3GB7 C;  4I55 B;  3K59 A;  2HLD G;  1JA8 A;  4J7J A;  1M4U A;  4B7K A;  2YIC A;  3WG7 B;  1QCE A;  3K04 A;  4DR2 O;  1WB7 A;  2LP7 A;  4B3M O;  2Q7E A;  3CCJ V;  1SQP H;  4YHH B;  3C3S A;  3QO7 A;  4DV3 B;  4QJF B;  1HNW O;  4I55 A;  3F7Y C;  2X0L A;  4LF9 O;  2UXX A;  3A0H Z;  2IW5 A;  2Q5Z A;  4FK5 C;  3UT5 B;  2HEP A;  1GK9 A;  1FJG B;  4JAV A;  1XL4 A;  3CJH B;  4GKK O;  1JR9 A;  3J7A U;  4J10 A;  3K5M A;  1QLN A;  1DTO A;  4X1K B;  1N32 O;  4JI1 B;  2BCC H;  1Q6U A;  3UT5 A;  1P84 F;  1KP3 A;  5LYJ B;  1XMO O;  1KKD A;  1BGY H;  2BTQ A;  1KB9 F;  1WJZ A;  4DRX B;  4X1K A;  1ZX3 A;  2ZT9 B;  2ZXW B;  4X88 A;  1JVM A;  1YVW A;  1ENV A;  2ZE6 A;  2L6L A;  4IT5 A;  5LYJ A;  5LMU O;  1S76 D;  3R65 A;  4TT3 G;  4Z1M G;  3W7S A;  5LA6 B;  1IBL O;  2VQF O;  1DGS A;  1MZF A;  2WSS G;  2UUA B;  5CB4 B;  1GM9 A;  2IBZ H;  1QHT A;  3QVN A;  5CBH A;  3JD4 A;  1GN3 A;  1TUB A;  3LNN A;  4G28 B;  2IJJ A;  2R9R B;  4MVZ A;  5LA6 A;  4FLU A;  1HR0 O;  4NKG B;  3H9V A;  5CBG A;  4N23 A;  1N36 B;  2V7Q G;  3T1Y O;  5EC1 C;  4WBN B;  4TV9 A;  4CH6 A;  1K3E A;  2DN9 A;  1H2M A;  3K57 A;  1SA0 B;  3OR7 C;  2QE7 G;  3LDD A;  4W4K A;  2OT5 A;  5IJ9 B;  3F5T A;  1T5E A;  3EHB B;  3E22 B;  2KKW A;  4O4H B;  4ASU G;  3K58 A;  3VOU A;  1KBH A;  3OE7 G;  4MTX A;  3BFR A;  4FLV A;  1KD1 W;  2F43 G;  2EZO A;  1H2S B;  5B66 Z;  4LF8 B;  1XNR B;  1Q7Y W;  3E22 A;  4O4H A;  1P7B A;  1F51 A;  2L35 A;  1KUQ A;  2Z0A A;  4BAY A;  1FXV A;  2AZ2 A;  3BRC A;  1VF5 B;  3U11 A;  1IXB A;  1G4Y B;  4DV6 O;  5IT9 N;  1BHB A;  3JAS A;  2JVD A;  1N33 O;  2HR3 A;  2H3O A;  1V9P A;  1ZSP A;  3E35 A;  1SKV A;  1JPX A;  1Y74 B;  3VQV A;  2CGO A;  3B77 A;  4X62 B;  2Q4P A;  4ZOL A;  1N0J A;  5JVD B;  2UUC O;  2JIZ G;  4FPP A;  3B8M A;  1S3J A;  4DK0 A;  4YY3 B;  4NYK A;  2YID A;  2IU0 A;  1WP7 A;  2ILM A;  1M90 W;  3AG4 C;  1Q5O A;  5EIB D;  3LUT B;  1QBZ A;  5JVD A;  3ZHT A;  1Y76 B;  2RDC A;  2XAQ A;  2H94 A;  5DM6 V;  2B5U A;  4H33 A;  1K8A W;  3CXH F;  4JTC B;  1S0V A;  3FX7 A;  2KSD A;  2Y4T A;  3K9A A;  2JS5 A;  3DC5 A;  3LDE A;  3AK1 A;  5LMN B;  2MK3 A;  2P7T C;  1Y76 A;  4JI5 O;  3B2E E;  3PN1 A;  4LCU C;  1GKF A;  5LL6 Y;  1YJW V;  1I0H A;  4JI3 O;  3SPH A;  1UPG A;  3ABL C;  1M56 B;  4UCU A;  3RVZ A;  1VF7 A;  4P2Z A;  1N34 O;  3AG2 B;  4NXN B;  2HVJ C;  2CH7 A;  2Y48 A;  4XDL A;  3JAL B;  3HPL C;  2N04 A;  3CWB H;  2EZP A;  5H6Q A;  2E76 B;  2X7R B;  4DR7 B;  1MZE A;  4FZ0 A;  1H2K A;  3OEH G;  2E5L B;  5JCO A;  2DMX A;  2XAH A;  1FFT B;  3ZMS A;  1XL6 A;  1XRE A;  1BT8 A;  2EIM B;  2PY5 A;  1GRJ A;  1VEW A;  3JAL A;  4DW0 A;  1Z2G A;  3E8F A;  1Q90 D;  2EJ7 A;  2ZIM A;  1I7F A;  5JH7 A;  1DLB A;  3CRR A;  4CH3 A;  2JJ1 G;  1XI1 A;  4BW9 A;  3OEE G;  1YJ9 V;  5B1A C;  1NVP B;  4PDM A;  4MVM A;  1GM8 A;  1BE3 H;  3CRA A;  3KCX A;  2Y4U A;  2YXL A;  1Y67 A;  3SR2 C;  1X59 A;  2R9I A;  4UV8 A;  3CCL V;  2XOK G;  3IC7 A;  1XUQ A;  2ZR2 A;  2ITC C;  5K1P A;  4UVA A;  1H38 A;  3TK1 A;  3CCV V;  4CC6 A;  3A8T A;  5LBQ A;  5C93 A;  4I9Q A;  1FFX B;  3L9D A;  3ZHR A;  4HNA A;  5E79 Z;  5IJ0 B;  4YJ2 A;  3ZHQ A;  4DW1 A;  1OCC C;  4R6Z A;  1QQC A;  4LNU B;  4HBN A;  4QPJ A;  1R3J C;  5KA5 A;  1FFX A;  3SYQ A;  4X1I A;  5IJ0 A;  3MAQ A;  4RQF A;  2WAM A;  5H2F Z;  4Q6G A;  1GO3 F;  4LNU A;  1UFI A;  4GX0 A;  4NVP A;  4WFF A;  3ETG A;  2ZM6 O;  3MDS A;  4DV7 B;  3K3W A;  1L1F A;  3STL C;  4O4L B;  1VQN V;  1BSM A;  4J7K A;  1L0L H;  2BE3 A;  3FB5 C;  3KZI Z;  2ZKO A;  3P30 A;  3SPG A;  1V54 B;  1GM7 A;  3RYI B;  3E83 A;  4PDR A;  2ZD9 A;  5JWP A;  3CSX A;  2CDY A;  3Q4H A;  4DV5 B;  1XMQ B;  3AK2 A;  4UCS A;  2D3O W;  4DUZ O;  3K0G A;  4FIP C;  4B3R B;  1K5S A;  4X65 B;  3VBB A;  4CC5 A;  1IDS A;  3I5D A;  1NVP D;  1I08 A;  2ARH A;  1PD3 A;  3SPJ A;  4DUY O;  2Q0A A;  3RN4 A;  5J2T B;  4DR4 O;  3P32 A;  4DR6 O;  3AG1 C;  4I5S A;  4ZIB A;  4Z1V A;  1US6 A;  4X9Q A;  3ZRX A;  4NXM B;  4H13 B;  1KEC A;  4DXW A;  2UXB O;  5J2T A;  1UJW B;  4OPA A;  2CUG A;  4F6R B;  4OX9 O;  2ZXW C;  1L0N H;  2ZDI C;  2Q67 A;  4KXR A;  1Y4M A;  1NR7 A;  3NXS A;  4OXS A;  1AJP A;  2EIK C;  5B3S B;  3AG4 B;  2IJH A;  1EN6 A;  2AXT Z;  3PJS K;  2R72 A;  5EIB C;  3JD2 A;  5K1X A;  2PGG A;  3CRQ A;  3QG5 A;  2ETN A;  3N27 A;  2YXY A;  2P4K A;  1TVK B;  4B7E A;  4D7T A;  2P06 A;  2F4V O;  3ABK B;  2QTO A;  1AP5 A;  4KUM A;  5IE9 A;  1AP6 A;  2W0F C;  4R7C A;  3JAK A;  5CN0 A;  1NKD A;  4B3S O;  1YDX A;  1KYO F;  3OAA G;  4MVS A;  4LF4 O;  2PYL A;  1FAF A;  3HKB B;  5BMV B;  1IX9 A;  2A3Q A;  3C90 A;  4R8C A;  1FOU A;  1IUR A;  1URF A;  2F95 B;  4U7N A;  3BHP A;  1PPJ H;  4TQF A;  1K9M W;  4K0K O;  3FB7 C;  1Q6H A;  4DR3 O;  5LHI A;  2JGU A;  3IC9 A;  4JI6 B;  4JYA B;  4IYI A;  4DYL A;  1VP7 A;  4LFC B;  2YEV B;  1GH6 A;  4JI8 O;  1P4R A;  2GHY A;  2XAG A;  3OGI B;  4P30 A;  1M9N A;  5J2U A;  1PNM A;  4LBE C;  2PF4 E;  1VQL V;  1DK1 A;  1FXH A;  4J7Z A;  3RYH B;  4X1Y B;  3GWO A;  5IYC O;  1KP2 A;  3JD0 A;  3ASO C;  2GUZ B;  1PV0 A;  2DQ3 A;  2X6B A;  1HDJ A;  1W59 A;  1YXB A;  3FYE B;  1NI8 A;  3RYH A;  4QGP A;  3OMN B;  4B3T B;  4IL6 Z;  2ZNI A;  3ZMV A;  3F5W C;  1NU1 H;  5CA1 B;  1B04 A;  5TIS Z;  4FFB B;  4X89 A;  3CCU V;  3CC2 V;  3G6B A;  5GTH Z;  4AQY B;  2QKA A;  1GN4 A;  3RGB A;  1QR8 A;  2E75 B;  4CH5 A;  1WPB A;  1FJG O;  4PV1 B;  1WNS A;  4JZ2 A;  4FFB A;  3N2G A;  4P9O A;  4TV8 B;  5LGN A;  4K3A A;  1M56 C;  2DYS C;  1R1B A;  4J9Y B;  4JI1 O;  4K8Z A;  1YIJ V;  1JMK C;  1KU9 A;  4PI2 A;  1K34 A;  2Q8V A;  5KHJ A;  2BTO A;  3RYC A;  3ETQ A;  3ABM B;  1A32 A;  5JJJ B;  4LFB B;  2QKC A;  1LNQ A;  3TCU A;  1AI4 A;  1AIL A;  1AJN A;  2H8P C;  2EIM C;  1RP3 B;  2KG7 B;  2XUM A;  4I0X B;  1L8D A;  3UO3 A;  1VQ9 V;  3GWK C;  2OYQ A;  2B1G A;  2ZE8 A;  4PI0 A;  1D5A A;  1X4T A;  2ZQM A;  4JTD B;  4X64 B;  1FKA O;  1KKC A;  4J9Z B;  1WAZ A;  3T4D A;  3T2M A;  5JJE B;  1NTZ H;  4X66 B;  3OT7 A;  2HHH B;  1VQ7 V;  3J80 N;  1VQP V;  2UUA O;  2DQ0 A;  3I55 V;  3ZED A;  3IGA C;  3K08 A;  4DO2 A;  4RWU A;  1K7D A;  2M6Y A;  5KHG A;  4DR1 B;  2PTM A;  3BEH A;  4PA3 A;  4QE9 A;  4QIW F;  3LSS A;  3AG1 B;  4EB6 B;  1I94 B;  1VQ6 V;  3CJH A;  4RAI A;  4CZZ A;  3HR0 A;  1VQ5 V;  1SQG A;  3H1L H;  3H1J H;  2KQX A;  5BXZ A;  1D2D A;  4NTW A;  2LJ2 A;  2W0X A;  2LGW A;  4ABM A;  4PA4 A;  3SYO A;  4B3M B;  4DRX A;  2V1D A;  1K97 A;  4MTO A;  3FD9 A;  1HNW B;  2VWJ A;  2Q68 A;  2EIK B;  3ZRS A;  2V4D A;  1K5Q A;  2ZDI A;  4TUY B;  1JQ0 A;  4HAM A;  2ZCE A;  3BA8 A;  4U3J B;  1Y66 A;  1VQ8 V;  5CB4 A;  4UCT A;  4KHP B;  2E74 B;  5DEC A;  4AHC A;  3LDC A;  2UXD B;  3T4Z A;  4I9W A;  5HFL A;  3CYO A;  3E8H A;  1SQF A;  1N32 B;  1XBL A;  3U10 A;  5LXT B;  1KQS U;  2JS3 A;  1AB3 A;  1V54 C;  4PA7 A;  4U3J A;  2R70 A;  4R50 A;  4FFK A;  2EJR A;  4FZ1 A;  3S3X A;  1ROP A;  3CPW U;  1K4C C;  3VQY A;  4EKW A;  1F4N A;  4WFB V;  4X62 O;  1FYJ A;  3ZBH A;  4WBN A;  4WFG A;  3BPZ A;  1RSO B;  1SA0 A;  1JCH A;  4YY3 O;  5A2Q N;  4LR3 A;  2PZS A;  4BR6 A;  1BHA A;  1VF6 C;  5IJ9 A;  4GKJ B;  2BSK B;  3F7V C;  5LOV B;  2QDO A;  3JCU Z;  5LHG A;  5L3D A;  5DED A;  2QSA A;  4P9P A;  2YI9 A;  1BZK A;  1MSD A;  4X20 B;  3JD1 A;  4J42 A;  1ZWI C;  3KKY A;  4I50 B;  3E89 A;  1W2B U;  2BSK A;  5LOV A;  5LMN O;  2P4V A;  1HW7 A;  2NNU A;  4F4L A;  4C7U A;  3ASO B;  4X20 A;  2CAZ C;  2DJV A;  2HG5 C;  3CHX A;  2EIJ B;  3QTC A;  2G38 A;  3SYC A;  3X2Q C;  2DYR B;  5FNV B;  5B3S C;  1Y74 A;  4NXN O;  2ZE5 A;  3JAR B;  4DV2 O;  4UVB A;  1RFY A;  3STZ C;  2K1E A;  3ETE A;  1HNX B;  3ZMU A;  2E5L O;  3ZMZ A;  2HJD A;  1V55 B;  3ABK C;  5FNV A;  2X6A A;  1IBK B;  2IJK A;  4LF7 B;  4XDK A;  3HKE B;  4DV0 B;  5BR8 B;  2JRI A;  3APQ A;  2OIE A;  5IYZ B;  4Q20 A;  4ZHQ B;  2DYS B;  4D6T H;  3HKE A;  1S5J A;  4MVO A;  4JAU A;  3ZMT A;  1J95 A;  2UUB B;  2VS0 A;  1K92 A;  3CS5 A;  1E1R G;  3BCC H;  1SQB H;  5IYZ A;  2JEU A;  2QWN B;  5CA0 B;  3BAB A;  4PDL A;  2OIG A;  4O4I B;  3L71 H;  3HKC B;  2K9P A;  2YSU B;  2RNB A;  1PL4 A;  3ASN C;  2XTA A;  2RQ6 A;  2WWW A;  2FTK A;  1GMG A;  2RMK B;  4JI0 B;  5LP6 C;  1QNM A;  3DSQ A;  4UV9 A;  2YUA A;  3AEI A;  3N2K B;  1YF2 A;  3OW2 U;  2LGQ A;  4O4I A;  2IH3 C;  1R6T A;  3M8A A;  3CRM A;  3NR7 A;  5KX5 B;  4LFA B;  4MTF A;  1BS3 A;  4JI7 O;  3N2K A;  4DK1 A;  4JI3 B;  3I56 V;  1BQ0 A;  2FL4 A;  1WA8 B;  4EEQ A;  4DV7 O;  4JI4 B;  3CCS V;  1LUV A;  3K5N A;  1JNB A;  1F4M A;  1XEQ A;  2WPD G;  5BZB A;  1MNG A;  4LP8 A;  2LFR A;  4MSW C;  4GYC B;  3FYI B;  2YIB A;  3VQW A;  4A5U B;  4DV5 O;  1XMQ O; 
#chains in the Genus database with same CATH homology
 3TJT A;  1WB8 A;  1ZTE A;  1IX9 A;  2CDY A;  1XRE A;  3AK2 A;  1BT8 A;  1JR9 A;  4YIP A;  1VEW A;  1SZX A;  1IDS A;  1P7G A;  4FFK A;  1VAR A;  1I08 A;  2QKC A;  1IXB A;  1MA1 A;  1D5N A;  3RN4 A;  3IC9 A;  1GN6 A;  1ZSP A;  1KKC A;  4E4E A;  4JZG A;  3OT7 A;  4BR6 A;  4JYY A;  1N0J A;  1Y67 A;  4X9Q A;  1PL4 A;  3CEI A;  1XUQ A;  2CE4 A;  2RCV A;  3C3T A;  5A9G A;  1QNM A;  3K9S A;  1MSD A;  4GUN A;  3LSU A;  3QVN A;  3KKY A;  1ZUQ A;  1MMM A;  1GN3 A;  1EN4 A;  1XDC A;  2GDS A;  4YIO A;  1EN5 A;  2AW9 A;  3EVK A;  1GN2 A;  3AK3 A;  3KDR A;  1AVM A;  4C7U A;  1PM9 A;  1XIL A;  1BS3 A;  3DC6 A;  1EN6 A;  1EM1 A;  1LUW A;  3DC5 A;  1N0N A;  3AK1 A;  1LUV A;  2P4K A;  1AR4 A;  2ADP A;  1JA8 A;  2QKA A;  1GN4 A;  1I0H A;  2ADQ B;  5AG2 A;  4F6E A;  1MNG A;  3MDS A;  1WB7 A;  4JZ2 A;  1AP5 A;  3C3S A;  1BSM A;  1AR5 A;  1AP6 A;  1B06 A;  1ZLZ A;  3BFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...