3C3SA

Role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWAHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 64
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3c3sA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3c3sA02
1EN6A 4BR6A 1PL4A 1GN2A 1XREA 1B06A 3QVNA 4X9QA 1AP6A 1ZSPA 1QNMA 1GN4A 1LUVA 4JZ2A 1JR9A 1LUWA 3KKYA 1ZLZA 3IC9A 1EN5A 2CE4A 1PM9A 1IXBA 1XILA 1AR5A 4JZGA 1XUQA 3AK3A 2P4KA 3AK1A 1AVMA 3C3SA 3BFRA 5A9GA 3OT7A 1BT8A 3TJTA 1VARA 1BSMA 5AG2A 2ADQB 2GDSA 1MNGA 2AW9A 1P7GA 2QKCA 1IDSA 3CEIA 1MSDA 4YIOA 1BS3A 1AP5A 3DC6A 1AR4A 1SZXA 1GN6A 1D5NA 1GN3A 1ZUQA 1N0JA 1WB7A 4F6EA 1I08A 1WB8A 1N0NA 1KKCA 1MMMA 1MA1A 4C7UA 4YIPA 3LSUA 1ZTEA 3K9SA 4JYYA 3RN4A 3C3TA 4E4EA 1EN4A 3AK2A 2CDYA 2ADPA 3MDSA 1JA8A 1I0HA 1VEWA 1Y67A 4FFKA 1IX9A 1EM1A 2RCVA 3DC5A 4GUNA 2QKAA 1XDCA 3EVKA
chains in the Genus database with same CATH superfamily
1GO3F 1AI5A 3W7UA 4HNAB 3VQWA 1QHTA 2R72A 2HR3A 1B06A 3VOUA 4P2ZA 1VQ6V 3ZS8C 4JTDB 1S72V 1MZFA 1QNMA 4DUYO 4L87A 1Q3EA 1ORQC 5L3BA 1I94O 3CWBH 4BIUA 2KG7B 2E76B 3ABLB 1JNBA 4UCSA 4JZGA 5EZYB 2UUAB 5ITZA 2YIBD 4DR6O 4EEQA 3AK1A 3OEEG 1V54C 4OPAA 1YTFB 1TUBB 1BHAA 3JSNA 3ZHUA 1HNZB 3N2GA 4UV8A 1NVPD 2DYSB 4DV0B 4EKWA 4LNUA 1AJQA 2QR4A 4YJ3B 2UXDO 2DQ0A 4J7ZA 4X62O 5JH7B 3K58A 1P7GA 2ZNIA 2QEXV 3TXSA 3ETQA 2ZXWB 1AP5A 2EZPA 5LMUB 2CH7A 4NKGB 1SQPH 1GK9A 4UFZA 4J11A 1XOUA 4UCRA 2OCCC 4LF5O 4F6EA 3SJBC 2ZM6B 1Q6HA 3L71H 3H1IH 4I50A 3SPIA 5B66Z 4QPKA 2NR5A 5FNVA 4WFEA 1XMQO 2W0FC 1GTOA 2Q4PA 3JALB 3DXRA 4HBNA 4D6TH 2QM8A 3BY6A 1XBLA 5BY1A 1FFTB 3G67A 4UCVA 1PP9H 2YDEA 3STLC 1XHXA 2E75B 3N2KA 4TWKA 4DV6O 3DC5A 1K9MW 5EYPA 2PUSA 5GTHZ 3W7WA 3HKDB 3T1CA 4NTWA 2F93B 2HLDG 1IBLB 4I0XA 4GYCB 2E5LB 3T1YO 3FYEB 4B3SO 2QM7A 4X1IA 1ZSPA 3ASOC 3K0DA 2QKSA 3RWRD 3CRAA 3THOA 4LF6O 1N8RW 3K9AA 4TV8B 3ABTA 1P84F 1XMOO 5GONB 3CXCU 1GM9A 2XAHA 3K08A 3KG2A 1YI2V 1US6A 1RM1C 4GX5A 3OM3B 2OCHA 4YJ3A 1NT2B 4MVZA 1BT8A 5IY5C 2F43G 4LF9B 3DGEA 5B1AC 3L72H 2YIBA 2AW9A 4AILC 2EX3A 1YEWA 2IW5A 2P06A 2JGUA 3IFXA 3U10A 4FFBA 4IT5A 2KB1A 1W2BU 2ZE8A 4FLXA 4TT3G 1OCOC 3B77A 2BOCC 1NTKH 5JVDB 3JAMN 3SPHA 1NR7A 5GONA 4J7KA 2W6IG 1TA8A 4NTYA 1XMOB 1ZTEA 1M93A 5LMUO 4J80A 1M1KW 1XNQB 5JWPA 3RYHB 4NR1A 2ZM6O 3ABMB 4CS4A 5EIBC 5KX5A 3AG3B 5J2TB 4P9OA 3DSQA 2PYLA 1QLEB 1I0HA 2BSKA 3BAAA 4JPRA 4JASA 1Q90D 2WLJA 1IBKB 1IX9A 1EM1A 1AILA 3SPGA 1OZ0A 2CK3G 2X0LA 5KAFZ 3WG7B 3UO2A 1FS0G 1SF9A 1ZWIC 2ITDC 2ILMA 1HWYA 3JD3A 3K3WA 3L73H 3WFVA 3HKBA 3HKEA 2Z0AA 2WLHA 1GN4A 3MHHC 4LF7B 3JAWB 4JI4O 4EB6B 1VF7A 5H5NA 2JJ2G 1VF5B 2F23A 4PA3A 3T2MA 4MVUA 1ZL8A 2ATKC 2K9PA 2Q0OC 2A0LA 3HKCB 4U3FH 3AK3A 3ZBHA 2Q8VA 3JALA 3F7VC 4P9PA 4IIJB 1Q81W 1CXZB 4MW8A 3B40A 3OT7A 1KC8W 1K5SA 1J95A 2IJHA 3K0GA 2WWWA 4DK1A 1ROPA 3K5OA 3B09A 1HW7A 5KAIZ 1FD9A 1FAFA 2JGDA 1NH2D 4O2BA 3ML0A 5JJJB 4UB6Z 4LF7O 2AHZA 4MTGA 1YF2A 3M7MX 3ICXA 1SESA 4B3TO 4H0LB 5TISZ 2PZSA 2RNBA 3H01A 2EBOA 2EJ7A 4F6RB 3LNMB 4FLVA 4DRXA 1K5QA 1OCRB 2RMKB 3D36A 4A5UB 4FLWA 4LFBO 2A3QA 2ADPA 5IDJA 3SPCA 4JI8B 4K0KO 1BZKA 2WPDG 3J81N 3KCXA 5LBQA 1R3IC 2GUZB 3DXRB 1YZBA 2ZR3A 4UUJC 5GW7A 1XNRB 1VQPV 4K8ZA 1OCZC 4MVOA 1YJWV 5A2QN 5CB4A 3LNNA 1NU1H 3JAWA 4D7SA 3TK1A 5HFMA 2R9IA 1RP3B 4U3JA 4QPJA 1M5IA 3HKDA 4LF4B 4I7ZB 2CAZC 2P22C 2N04A 4FLTA 1FOUA 4B3RB 1HNXO 3CE2A 1BCCH 1LNQA 5K1PA 2VRZA 1I5YA 2Z3YA 4I55B 1K92A 1QBZA 1X4TA 3M8AA 3ASNB 4MSWC 3K57A 4O4HB 4ZI7B 2A9HA 5L3EA 3W7TA 2EINC 2LW1A 3JARB 3H9VA 1DLBA 3CB2A 3OGCC 1DK1A 1OCZB 3F7YC 3ZRXA 1BHBA 3D3IA 1GRJA 3IJ4A 3ABKC 1S5HC 2WSSG 5LP6A 1SZTA 4TUYA 3RBZA 4IYIA 1HNXB 1H8HG 4MTOA 3FD9A 4LFAO 3K5MA 2WAMA 2EINB 3M99B 5ITZB 1I08A 3JD0A 5J2UB 1XQ8A 1KKCA 2NLJC 1IZ3A 5E79Z 5B3SB 2QWNB 3AG4C 1EN4A 2Q7HA 3ETGA 1NTZH 1F4NA 1KUQA 4KHPO 4PA7A 3B8MA 3GVMA 3T1HO 3OUSA 2VWJA 5LP6B 1N34B 3JAKA 1HNWO 2HJDA 1R73A 4TUYB 2UXBB 5CA1B 3CCEV 4GUNA 3H1JH 2GV9A 2L6LA 4PJ0Z 1P4RA 2LGQA 3SYPA 1H2LA 3P3PA 1KB9F 3AG2B 2E3CA 4JI6O 2N05A 2XAGA 1AB3A 2OIGA 5IT9N 3P3NA 1UFIA 4JI1O 1S77D 1WN7A 2WLNA 4KP4A 2EIJB 4NTXA 5IYCO 1S3JA 1P7BA 2OWOA 3S3XA 1W59A 3QTCA 1K34A 2BTQB 1PNMA 1OCCB 1IXBA 1Y76B 4JI5B 1FXKA 2B5UA 1R3JC 1THZA 2IJIA 1H2GA 4MS2A 5CA3A 4DR1B 2YI9A 4B3RO 2UXBO 1K73W 3APOA 4FLYA 2DW4A 3FB7C 3X2QC 3JASA 4JV5O 1PNKA 4JYBA 1VARA 2EIJC 5B5EZ 4Z1MG 2WLIB 1H2MA 2XT9A 1Q7YW 4JI0O 3CSXA 2P7TC 4K3AA 3HR0A 3VQYA 1IXMA 4LWSA 1BS3A 5CBHA 2QA4V 1EZVH 4CH4A 1AI4A 5IJ9B 2DJVA 3JD1A 5DECA 1BE3H 1MMMA 4Z1VA 3G6EV 1WPXA 1KP2A 4ZOLA 4DR2O 4WCEV 4DR1O 2FL4A 2VWKA 3ZRWB 2CTQA 2Y0PA 1WP7A 2P5OA 2ZNJA 2ITCC 2UXNA 5KHIA 2VQEB 3E8FA 5CBFA 1NVPB 2RN9A 4GT1A 3ZMUA 1VQMV 4MTFA 3N2GB 4DR4B 2UUCO 1AR1B 1Z5VA 5LYJB 1R3LC 3WG7C 5KHHA 5D5QA 4K0KB 4B7EA 3CC7V 3K59A 3HKCA 2DQ3A 2X6CA 3JATB 1NH2B 4RQFA 4CC6A 2UU9B 2CE4A 3G80A 1B3QA 4JF3A 5J2UA 2X6BA 3CCSV 2IBZH 1V54B 2ZT9B 1G4YB 5B1NA 2R9AA 3AG1C 2C2AA 3Q4HA 4H44B 2EZOA 2EIMB 2KG7A 2EILB 1JMKC 1JFFA 1AJPA 4ZKIA 4GKKB 2PI5A 2UXCO 3VBBA 4DV5B 5JCOC 3ZHRA 3ZRSA 4NB5A 1T5EA 5B1OA 3E22B 3OUFA 3HKBB 2QGNA 4UCTA 4HYOA 1KU9A 1VQ9V 1DF4A 4PDLA 3ZRWA 1MA1A 1PNLA 3K9SA 3QNEA 1PL0A 2B9ZA 1RSOB 5LOVB 3CCRV 1SQFA 2QTSA 1U97A 3OR7C 2F4VB 5DN6G 5D5PA 1IBMB 2XAFA 2DMXA 2DN9A 3ZN0A 1M57C 5KA5A 1S5LZ 2RCVA 4DW0A 3FYIB 5E1AC 4U7NA 3RYCA 5GTIZ 1Q43A 2LGWA 4X64O 1M57B 1JVMA 4F6RA 2BTOA 1ZAUA 4BR6A 3CC4V 1YJNV 5JQGB 4X1KB 2E74B 1GN2A 2UUAO 1BMFG 5EZYA 2ZE7A 3JCZA 4IHJB 3QVNA 3AG3C 1N34O 1VQKV 3ZMVA 2Q0AA 4O4HA 4ZI7A 1VQLV 4DUZO 2BE3A 3E83A 4DO2A 2CTRA 1IVSA 5EC1C 3ETEA 1J5EB 4J42A 4CH3A 3W7XA 2IU3A 2OTJV 1GM7A 4JI6B 1PKXA 3A0BZ 1NS1A 1OJHA 2R9RB 3T4ZA 2UU9O 4YY3B 4NXMO 2IJJA 1K8AW 1FXVA 1W0KG 4B3MO 1FXHA 3U11A 4X65B 2HHHB 4X20A 1NR1A 4JAAA 5CA0A 4EFEA 4LF9O 4JI2B 2JRIA 2Q9LA 5LP6C 3IAYA 2M6YA 4OPHA 4LFCO 1OHHG 1JOYA 2JK5C 4BIZA 3UCSC 1WB7A 2GTAA 4CS2A 1J5EO 4JI3B 5LGUA 4C7UA 1KYOF 2NN4A 3CC2V 1CEZA 4UVBA 4FIPC 1NZ6A 3F5TA 3CCJV 2XAQA 3SJQC 5B3SC 5FL7G 2YUAA 2PYJA 3AK2A 3NXSA 4O4IB 2ETNA 3P32A 1A32A 4AI8A 5H6QA 2HKOA 2QWPB 1K33A 3GWOA 4JI2O 2D2CB 3B8NA 4BW5A 1YVWA 2PGGA 4E2LA 4K8XA 4X1YB 2H94A 4FJCC 3FB5C 5K1XA 4I4TB 2BTQA 4RWUA 3R66A 5LMNB 4DV4O 2AHYA 1AI7A 5J2TA 1V9PA 1PL4A 3BA9A 4FVMA 5CMUA 1F23A 2ZIMA 5FPRA 2GTSA 5FNVB 3CRCA 1YITV 1LUVA 2JVDA 1FPOA 3JD2A 1EN5A 1FJGO 2JEUA 2Y4TA 4JI5O 3AG1B 2EIKC 5H9CA 1YTFD 3KCYA 4DRXB 1TGOA 1PD3A 4W4LA 1FFXB 5KMGB 3T4DA 4BIOA 3UT5B 1XL4A 4PI0A 1Q6IA 3JCUZ 4O2AB 4YJ2B 5C8YA 4LF5B 2GSMB 4PA4A 2DYRC 5JVDA 3RW0A 4ZOLB 1S76D 1L8DA 1IDSA 4IIJA 2DYSC 1RPRA 5BMVA 1K3EA 1H5WA 1QLEC 1N33O 4RAIA 3LSSA 3I5DA 1KBHA 5KX5B 2B1GA 1WPBA 2QSAA 4X66B 1N0NA 1Y74A 2HEPA 1FFXA 3LSUA 4FK5C 2EIMC 3JD4A 3OEHG 4PD4F 4GKKO 4JYYA 1R6TA 1VQ4V 3UKMA 1O9HA 3ABMC 2WLLB 4FPPA 4O4JA 4R7CA 5C8YB 1H38A 1R6KA 4CBCA 4DV1B 3ZRVA 1HR0O 1Y67A 1SA0A 3HKEB 3JARA 4WF9V 4B3SB 1XL6A 2QKAA 1JQ0A 3U0ZA 4J41A 3D3QA 1Q5OA 5FPOA 3EFFK 3ZX6A 3EVKA 2O57A 3KDRA 2GUZA 3SJCC 3PN1A 4UB8Z 4FLUA 3ZMZA 4DV2B 2QTOA 3H1KH 4ZIBA 1KP3A 1MOFA 1LUWA 3KKYA 1VQOV 4RUFA 2FKXA 2DWDC 4UXNA 4DYLA 2JEXA 1KKDA 3JSLA 3UT5A 4ZHQB 3K04A 3OR6C 1XMQB 4U3JB 5EIBD 1YDXA 2XAJA 2AZ2A 1SC5B 2Q5ZA 2ZQMA 2XUMA 1FJGB 4B3TB 3NR7A 4KUMA 4DV7B 2UXCB 2ZDIC 2ZINA 1KMIZ 1Y6XA 3HB3B 4JYAB 2QKCA 3APQA 3CEIA 5CA1A 1IJGA 2LQTA 1FKAO 4PDRA 3BA8A 5KHJA 4NXMB 1SERA 1XI1A 2ZR2A 1VQ8V 3RT3C 4FFBB 3E8GA 3WU2Z 4O4JB 3LSQA 4XDKA 3UQ8A 1TUBA 3ETDA 3Q4HB 4KFMA 4BAYA 1VP7A 4D7TA 1OCCC 5CBGA 2GHYA 1VQ5V 4JYCA 3A0HZ 4E4EA 1CPYA 1KECA 2WA3A 4X8AA 1GM8A 1SS3A 2B1IA 4DV0O 5KLVH 1Q6UA 1GKFA 1OCRC 3SYCA 4J9YB 4MTXA 3JYCA 2IJKA 3I56V 3CP1A 1DTOA 1SQXH 4JTCB 5KMGA 2Z5UA 4AHCA 4PHZA 2M7WA 4MVMA 3ZMSA 2V1DA 5B1BC 1EN6A 3K5NA 1XREA 5BXZA 1M56B 2A7WA 1TUEB 1H2KA 3D8CA 4X9QA 5LXTB 1AP6A 3STZC 1EZJA 1SQVH 1WLEA 3RVZA 4G27B 2Y48A 2UUBB 4OGQB 2QDOA 4J10A 3K5LA 4GX1A 4FM2A 4PA6A 3G71V 2OIEA 4EB6A 1R1BA 3BPZA 1F4MA 3CHXA 3CCVV 3F5WC 1N4CA 4BWAA 3AG2C 1TVKB 4I0XB 2KKWA 2XHBA 2OTLV 3K03A 4G28B 3CYOA 1EFRG 4ASUG 4OXSA 1HDJA 1IBLO 2FYUH 2GDSA 2ZXWC 2OCCB 4RO2A 4JAUA 5KHKA 4YXWG 1MSDA 2ARHA 2CTWA 4IHJA 2IU0A 1L1FA 1D5NA 3CCUV 3VQXA 1YIJV 4JYAO 1YJ9V 5IYBO 5J9PC 3JAKB 4L8JA 1TVKA 2XASA 1EBOA 1AJNA 3E35A 5IYZB 4JI4B 1VMGA 2X7RB 4KL1A 3UM7A 3MDSA 3SJAC 4IL6Z 1HP8A 2DE0X 4CZZA 2JS3A 4X66O 1WA8B 4LR3A 4WFBV 3E89A 4QIWF 4XDJA 5EK0A 4MVSA 3L9DA 2F1MA 2WLLA 5IJ0B 1QLNA 1BL8A 1SKVA 2WLMA 3C90A 2IH1C 2DWEC 2Q68A 1OCOB 2Q73A 4LBEC 3HPLC 3QF7A 4CH5A 4OX9O 3ZIAG 3E22A 4DR5B 3RYIA 4NVPA 5LHIA 5KHGA 3CD6V 4O4LA 1K4CC 3LDEA 1N36B 3SPJA 4GLXA 4YJ2A 1AR5A 1R3KC 2Y69C 1COWG 3L74H 5L3GA 1BQ0A 4TQDA 1GMGA 2H8PC 2ZE6A 5C93A 1IBKO 2QE7G 4LF6B 4DV2O 5LGNA 2EILC 1QQCA 2ADQB 3VQVA 3MAQA 3ZHTA 2XNDG 3WB0A 2RQ6A 5BR8B 3E8HA 4I9WA 4IGGA 5KA6A 4UVCA 1SQQH 3QO8A 2PY5A 1N32O 1HNZO 4DR7B 1RFYA 2GBOA 1ZUQA 4UVAA 1NKDA 1B04A 4X1KA 2PF4E 3J7AU 2RJZA 3RYHA 3T1HB 2BOBC 2Y4UA 4B08A 1V55B 4HAMA 3PJSK 4J7JA 3GB7C 1DF5A 4TV9A 3QO7A 2MK3A 2K1EA 5EC2C 5LYJA 4FLZA 1K97A 4PDVA 2X6AA 2ZCEA 5H2FZ 1PV0A 3DTUB 2YXHA 5BR8O 1K7DA 5B1BB 3CX5F 4ABMA 3TXQA 2F66C 3ASNC 1QR8A 2FB5A 2CGNA 5EYPB 3OTOO 4U7OA 3IC7A 4DR3B 4ZBMA 4RQEA 3A2FA 4DUZB 1Z2GA 1V55C 5L3DA 1ZX3A 3OD4A 4QNHB 3B4SA 4XBFA 2FMLA 3SR2C 4PELA 4YHHO 4LF8B 5IYZA 2MW2B 4X1IB 1XNRO 1Y76A 3ABLC 4O4IA 3TJTA 3MHSC 5IE9A 3E86A 2UUBO 4KHPB 3EXAA 4DV7O 3ASOB 4X62B 1WA8A 3G6BA 3SDLA 3LUTB 5H6RA 2P4VA 2Q67A 2LFRA 2Y0IA 3DC6A 4LF4O 1LR1A 2ZE5A 2WLIA 4R6ZA 3CPWU 4LFCB 1MZEA 1GN6A 3UO3A 1W0JG 4I9QA 2Y69B 1GN3A 2QM4A 4MW3A 4TV9B 5LHHA 4YHHB 1G1XB 4ZHQA 2VS0A 4EFBA 4DK0A 2KSDA 1D2DA 1XEQA 3BVOA 3I55V 4GX0A 3SYOA 4AQYB 1JJOA 3OAAG 1UJWB 1VEWA 2UXXA 5LXTA 1B6QA 1FXKB 1I7FA 1WJZA 4PV1B 1QCEA 3EHBB 2CH7B 3QO5A 3SGIA 4PA9A 3RYFA 2N74A 1XDCA 1QVFU 2AXTZ 3IGAC 1QVGU 2E5LO 4QE9A 4JI0B 1I5XA 5KUKA 1ENVA 2ZKOA 4X89A 1MG1A 2PTMA 3X2QB 3AG7A 4XDLA 4X1YA 4PI2A 5L3FA 4X65O 3L70H 4LH7A 2EULA 2P90A 5LL6Y 2V4DA 3AG4B 3OTOB 1DGSA 2G38A 5CA0B 1NTMH 2RDCA 1XUQA 4K35A 2P4KA 1VIBA 4X20B 3OE7G 4DR5O 4DV3B 3ABKB 1H2NA 3BRCA 4FMTA 1NJIW 3OMIB 2LJ2A 3N27A 5AG2A 3S3WA 1F7YA 2YIAA 1ZL8B 1NBMG 2H3OA 3ZJZA 1CP9A 1AR4A 3OTFA 2HVKC 2YSUB 5CN0A 4J9ZB 4I5SA 5JJEB 2KQXA 5FLXN 5B1AB 1F51A 3GWKC 4O2BB 2FTKA 1H2SB 1IBMO 2Q7EA 2YI8A 4YIPA 3CCLV 3ZHVA 3OGIB 3JASB 1XNQO 1QR9A 1YSCA 5IJ0A 3RN4A 5BMVB 4LP8A 3C3TA 2QWOB 4DR7O 2ZDIA 4MVQA 2V7QG 5F2VO 3TGUH 3CRQA 4ICGA 1HR0B 2NNUA 3CRMA 2W6JG 1AROP 4LFBB 4AQYO 1HNWB 4LNUB 4WBNB 4DR2B 3D36C 3O9OA 3RFRA 3FAVB 2BCCH 2F95B 4N21A 1U96A 4TQFA 2JJ1G 3MD0A 3K79A 5CB4B 4H37A 4LC1A 4JAVA 2YICA 2CTPA 1VQNV 5LHGA 4DXWA 1M56C 2Q69A 3BFRA 2W0XA 3OMNB 2LFSA 4CC5A 2YEVB 4I55A 1Y74B 3SYQA 3AEIA 1D5AA 3CS5A 4FZ1A 4RUEA 5IY5B 4DV3O 1K4DC 5HFLA 2YIDA 5IWAB 4R50A 1N32B 2JDIG 1SETA 3RYIB 2AZ0A 4H13B 1RM1B 1P49A 4X64B 4JV5B 3L75H 5BZBA 2QWQB 1Q8IA 2WA4A 3CCQV 1KD1W 1M4UA 4O4LB 1FXKC 4N23A 4CS3A 1WB8A 2YS8A 1S0VA 5JH7A 3ZEDA 5LA6B 3A0RA 2VQFB 1BQZA 4FM0A 2A79B 1YCIA 2YEVA 1XHZA 4BW9A 1OV9A 2CGOA 2HJFC 4B7KA 4WFGA 1E79G 1SQGA 4HNAA 2Q6AA 4LFAB 1WNSA 3TETA 5LMNO 4W4KA 4CH6A 3CMAV 3A8TA 4FM1A 3H1HH 4GKJB 3FKSG 4JGSA 1G6UA 1VQ7V 4Q20A 5IWAO 3QG5A 3OW2U 3CJHB 4B3MB 2XOKG 1JJ2U 2VQEO 4TOIA 3CCMV 3ABUA 1R6NA 5EBMC 2JIZG 1Q86W 4JTAB 1SQBH 3J80N 2HG5C 4DR3O 2P67A 1JCHA 3BCCH 1RPOA 3RYFB 4UCUA 3ZHQA 1E1QG 2ZIOA 5IJ9A 4JZ2A 1L0LH 3ZCCA 2QJ1A 1NI8A 4NXNB 4GZRB 2F4VO 3BHPA 2UXDB 4JI3O 1NQTA 1XILA 4LF8O 2LW7A 3RYCB 1Y66A 4LH6A 1AVMA 3C3SA 1BGYH 4WFHA 1SA0B 1UPGA 1JFFB 4JI1B 1O9GA 2HP8A 1Q82W 5IYDO 1VF6A 1N33B 4TV8A 4G2KA 4I50B 2YXLA 2Q7GA 4HZ3A 3RGBA 4LCUC 3WB1A 5JJNB 2ODMA 4YIOA 3ZN1A 3BABA 4R8CA 3ZHSA 2IH3C 3RVYA 1RSOA 1YXBA 5L3CA 4F4LA 1GH6A 4Q6GA 2A06H 3E2EA 4X88A 4DV1O 4DV6B 4H33A 1L0NH 3E8BA 4YY3O 3OFNG 1AI6A 3FB6C 4FZ0A 4MVRA 1JA8A 5DM6V 2OT5A 4MT8A 2YC0A 1VF6C 3LDDA 3CXHF 2EJRA 2VQFO 1TAEA 2OYQA 4FFKA 1SRYA 2AGAA 5LGTA 5JQGA 4DUYB 3K06A 5EBWC 1BSMA 1I94B 2P6JA 4GX2A 4GKJO 4O2AA 4P30A 1PPJH 2LO1A 2WLKA 4UCOA 3G4SV 4DR6B 2JGDB 1X59A 3FX7A 1JR9A 2UUCB 1ZLZA 2HFEC 3IC9A 1PM9A 1WP8A 2JS5A 5KUMA 1N36O 4IYHA 1E1RG 5LOVA 2QWRB 4LWSB 1URFA 3O65A 4WBNA 4I4TA 4JI7O 3N2KB 2HVJC 4NXNO 3FAVA 5A9GA 1QU7A 2DYRB 3ZMTA 2YXYA 3B2EE 2D3OW 3FB8C 4DV4B 1JPXA 3R65A 1MNGA 4TSFG 3SYAA 4DW1A 3TCUA 3W7SA 1GAXA 1S5JA 2L35A 3CMEV 1MABG 3CRRA 3BEHA 4WFAV 1IURA 1M9NA 1M90W 3KZIZ 3CJHA 1KQSU 5EBLC 1SZXA 2HHHO 3WB2A 4KXRA 3P30A 1N0JA 1FYJA 4PDMA 1JX9A 5DEDA 4QGPA 2PI4A 4QE7A 4Z2WA 1H8EG 2R70A 1Z5WA 3FFQA 2DOSA 4DV5O 2CUGA 2EIKB 2ZD9A 1G8MA 4JI7B 4NYKA 2BSKB 1MSWD 1WAZA 5JCOA 4WFFA 2CDYA 5LA6A 2IM9A 4UV9A 2XTAA 4JI8O 1YHQV 4OX9B 2LP7A 1Y4MA 4GCZA 3H1LH 3JATA 3LDCA 3T1YB 4DR4O 3OMAB 4QJFB
chains in the Genus database with same CATH topology
1EN6A 4BR6A 1PL4A 3KDRA 1GN2A 1XREA 1B06A 3QVNA 4X9QA 1AP6A 1ZSPA 1QNMA 1GN4A 1LUVA 4JZ2A 1JR9A 1LUWA 3KKYA 1ZLZA 3IC9A 1EN5A 2CE4A 1PM9A 1IXBA 1XILA 1AR5A 4JZGA 1XUQA 3AK3A 2P4KA 3AK1A 1AVMA 3C3SA 3BFRA 5A9GA 3OT7A 1BT8A 3TJTA 1VARA 1BSMA 5AG2A 2ADQB 2GDSA 1MNGA 2AW9A 1P7GA 2QKCA 1IDSA 3CEIA 1MSDA 4YIOA 1BS3A 1AP5A 3DC6A 1AR4A 1SZXA 1GN6A 1D5NA 1GN3A 1ZUQA 1N0JA 1WB7A 4F6EA 1I08A 1WB8A 1N0NA 1KKCA 1MMMA 1MA1A 4C7UA 4YIPA 3LSUA 1ZTEA 3K9SA 4JYYA 3RN4A 3C3TA 4E4EA 1EN4A 3AK2A 2CDYA 2ADPA 3MDSA 1JA8A 1I0HA 1VEWA 1Y67A 4FFKA 1IX9A 1EM1A 2RCVA 3DC5A 4GUNA 2QKAA 1XDCA 3EVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN6 A;  4BR6 A;  1PL4 A;  1GN2 A;  1XRE A;  1B06 A;  3QVN A;  4X9Q A;  1AP6 A;  1ZSP A;  1QNM A;  1GN4 A;  1LUV A;  4JZ2 A;  1JR9 A;  1LUW A;  3KKY A;  1ZLZ A;  3IC9 A;  1EN5 A;  2CE4 A;  1PM9 A;  1IXB A;  1XIL A;  1AR5 A;  4JZG A;  1XUQ A;  3AK3 A;  2P4K A;  3AK1 A;  1AVM A;  3C3S A;  3BFR A;  5A9G A;  3OT7 A;  1BT8 A;  3TJT A;  1VAR A;  1BSM A;  5AG2 A;  2ADQ B;  2GDS A;  1MNG A;  2AW9 A;  1P7G A;  2QKC A;  1IDS A;  3CEI A;  1MSD A;  4YIO A;  1BS3 A;  1AP5 A;  3DC6 A;  1AR4 A;  1SZX A;  1GN6 A;  1D5N A;  1GN3 A;  1ZUQ A;  1N0J A;  1WB7 A;  4F6E A;  1I08 A;  1WB8 A;  1N0N A;  1KKC A;  1MMM A;  1MA1 A;  4C7U A;  4YIP A;  3LSU A;  1ZTE A;  3K9S A;  4JYY A;  3RN4 A;  3C3T A;  4E4E A;  1EN4 A;  3AK2 A;  2CDY A;  2ADP A;  3MDS A;  1JA8 A;  1I0H A;  1VEW A;  1Y67 A;  4FFK A;  1IX9 A;  1EM1 A;  2RCV A;  3DC5 A;  4GUN A;  2QKA A;  1XDC A;  3EVK A; 
#chains in the Genus database with same CATH topology
 1GO3 F;  1AI5 A;  3W7U A;  4HNA B;  3VQW A;  1QHT A;  2R72 A;  2HR3 A;  1B06 A;  3VOU A;  4P2Z A;  1VQ6 V;  3ZS8 C;  4JTD B;  1S72 V;  1MZF A;  1QNM A;  4DUY O;  4L87 A;  1Q3E A;  1ORQ C;  5L3B A;  1I94 O;  3CWB H;  4BIU A;  2KG7 B;  2E76 B;  3ABL B;  1JNB A;  4UCS A;  4JZG A;  5EZY B;  2UUA B;  5ITZ A;  2YIB D;  4DR6 O;  4EEQ A;  3AK1 A;  3OEE G;  1V54 C;  4OPA A;  1YTF B;  1TUB B;  1BHA A;  3JSN A;  3ZHU A;  1HNZ B;  3N2G A;  4UV8 A;  1NVP D;  2DYS B;  4DV0 B;  4EKW A;  4LNU A;  1AJQ A;  2QR4 A;  4YJ3 B;  2UXD O;  2DQ0 A;  4J7Z A;  4X62 O;  5JH7 B;  3K58 A;  1P7G A;  2ZNI A;  2QEX V;  3TXS A;  3ETQ A;  2ZXW B;  1AP5 A;  2EZP A;  5LMU B;  2CH7 A;  4NKG B;  1SQP H;  1GK9 A;  4UFZ A;  4J11 A;  1XOU A;  4UCR A;  2OCC C;  4LF5 O;  4F6E A;  3SJB C;  2ZM6 B;  1Q6H A;  3L71 H;  3H1I H;  4I50 A;  3SPI A;  5B66 Z;  4QPK A;  2NR5 A;  5FNV A;  4WFE A;  1XMQ O;  2W0F C;  1GTO A;  2Q4P A;  3JAL B;  3DXR A;  4HBN A;  4D6T H;  2QM8 A;  3BY6 A;  1XBL A;  5BY1 A;  1FFT B;  3G67 A;  4UCV A;  1PP9 H;  2YDE A;  3STL C;  1XHX A;  2E75 B;  3N2K A;  4TWK A;  4DV6 O;  3DC5 A;  1K9M W;  5EYP A;  2PUS A;  5GTH Z;  3W7W A;  3HKD B;  3T1C A;  4NTW A;  2F93 B;  2HLD G;  1IBL B;  4I0X A;  4GYC B;  2E5L B;  3T1Y O;  3FYE B;  4B3S O;  2QM7 A;  4X1I A;  1ZSP A;  3ASO C;  3K0D A;  2QKS A;  3RWR D;  3CRA A;  3THO A;  4LF6 O;  1N8R W;  3K9A A;  4TV8 B;  3ABT A;  1P84 F;  1XMO O;  5GON B;  3CXC U;  1GM9 A;  2XAH A;  3K08 A;  3KG2 A;  1YI2 V;  1US6 A;  1RM1 C;  4GX5 A;  3OM3 B;  2OCH A;  4YJ3 A;  1NT2 B;  4MVZ A;  1BT8 A;  5IY5 C;  2F43 G;  4LF9 B;  3DGE A;  5B1A C;  3L72 H;  2YIB A;  2AW9 A;  4AIL C;  2EX3 A;  1YEW A;  2IW5 A;  2P06 A;  2JGU A;  3IFX A;  3U10 A;  4FFB A;  4IT5 A;  2KB1 A;  1W2B U;  2ZE8 A;  4FLX A;  4TT3 G;  1OCO C;  3B77 A;  2BOC C;  1NTK H;  5JVD B;  3JAM N;  3SPH A;  1NR7 A;  5GON A;  4J7K A;  2W6I G;  1TA8 A;  4NTY A;  1XMO B;  1ZTE A;  1M93 A;  5LMU O;  4J80 A;  1M1K W;  1XNQ B;  5JWP A;  3RYH B;  4NR1 A;  2ZM6 O;  3ABM B;  4CS4 A;  5EIB C;  5KX5 A;  3AG3 B;  5J2T B;  4P9O A;  3DSQ A;  2PYL A;  1QLE B;  1I0H A;  2BSK A;  3BAA A;  4JPR A;  4JAS A;  1Q90 D;  2WLJ A;  1IBK B;  1IX9 A;  1EM1 A;  1AIL A;  3SPG A;  1OZ0 A;  2CK3 G;  2X0L A;  5KAF Z;  3WG7 B;  3UO2 A;  1FS0 G;  1SF9 A;  1ZWI C;  2ITD C;  2ILM A;  1HWY A;  3JD3 A;  3K3W A;  3L73 H;  3WFV A;  3HKB A;  3HKE A;  2Z0A A;  2WLH A;  1GN4 A;  3MHH C;  4LF7 B;  3JAW B;  4JI4 O;  4EB6 B;  1VF7 A;  5H5N A;  2JJ2 G;  1VF5 B;  2F23 A;  4PA3 A;  3T2M A;  4MVU A;  1ZL8 A;  2ATK C;  2K9P A;  2Q0O C;  2A0L A;  3HKC B;  4U3F H;  3AK3 A;  3ZBH A;  2Q8V A;  3JAL A;  3F7V C;  4P9P A;  4IIJ B;  1Q81 W;  1CXZ B;  4MW8 A;  3B40 A;  3OT7 A;  1KC8 W;  1K5S A;  1J95 A;  2IJH A;  3K0G A;  2WWW A;  4DK1 A;  1ROP A;  3K5O A;  3B09 A;  1HW7 A;  5KAI Z;  1FD9 A;  1FAF A;  2JGD A;  1NH2 D;  4O2B A;  3ML0 A;  5JJJ B;  4UB6 Z;  4LF7 O;  2AHZ A;  4MTG A;  1YF2 A;  3M7M X;  3ICX A;  1SES A;  4B3T O;  4H0L B;  5TIS Z;  2PZS A;  2RNB A;  3H01 A;  2EBO A;  2EJ7 A;  4F6R B;  3LNM B;  4FLV A;  4DRX A;  1K5Q A;  1OCR B;  2RMK B;  3D36 A;  4A5U B;  4FLW A;  4LFB O;  2A3Q A;  2ADP A;  5IDJ A;  3SPC A;  4JI8 B;  4K0K O;  1BZK A;  2WPD G;  3J81 N;  3KCX A;  5LBQ A;  1R3I C;  2GUZ B;  3DXR B;  1YZB A;  2ZR3 A;  4UUJ C;  5GW7 A;  1XNR B;  1VQP V;  4K8Z A;  1OCZ C;  4MVO A;  1YJW V;  5A2Q N;  5CB4 A;  3LNN A;  1NU1 H;  3JAW A;  4D7S A;  3TK1 A;  5HFM A;  2R9I A;  1RP3 B;  4U3J A;  4QPJ A;  1M5I A;  3HKD A;  4LF4 B;  4I7Z B;  2CAZ C;  2P22 C;  2N04 A;  4FLT A;  1FOU A;  4B3R B;  1HNX O;  3CE2 A;  1BCC H;  1LNQ A;  5K1P A;  2VRZ A;  1I5Y A;  2Z3Y A;  4I55 B;  1K92 A;  1QBZ A;  1X4T A;  3M8A A;  3ASN B;  4MSW C;  3K57 A;  4O4H B;  4ZI7 B;  2A9H A;  5L3E A;  3W7T A;  2EIN C;  2LW1 A;  3JAR B;  3H9V A;  1DLB A;  3CB2 A;  3OGC C;  1DK1 A;  1OCZ B;  3F7Y C;  3ZRX A;  1BHB A;  3D3I A;  1GRJ A;  3IJ4 A;  3ABK C;  1S5H C;  2WSS G;  5LP6 A;  1SZT A;  4TUY A;  3RBZ A;  4IYI A;  1HNX B;  1H8H G;  4MTO A;  3FD9 A;  4LFA O;  3K5M A;  2WAM A;  2EIN B;  3M99 B;  5ITZ B;  1I08 A;  3JD0 A;  5J2U B;  1XQ8 A;  1KKC A;  2NLJ C;  1IZ3 A;  5E79 Z;  5B3S B;  2QWN B;  3AG4 C;  1EN4 A;  2Q7H A;  3ETG A;  1NTZ H;  1F4N A;  1KUQ A;  4KHP O;  4PA7 A;  3B8M A;  3GVM A;  3T1H O;  3OUS A;  2VWJ A;  5LP6 B;  1N34 B;  3JAK A;  1HNW O;  2HJD A;  1R73 A;  4TUY B;  2UXB B;  5CA1 B;  3CCE V;  4GUN A;  3H1J H;  2GV9 A;  2L6L A;  4PJ0 Z;  1P4R A;  2LGQ A;  3SYP A;  1H2L A;  3P3P A;  1KB9 F;  3AG2 B;  2E3C A;  4JI6 O;  2N05 A;  2XAG A;  1AB3 A;  2OIG A;  5IT9 N;  3P3N A;  1UFI A;  4JI1 O;  1S77 D;  1WN7 A;  2WLN A;  4KP4 A;  2EIJ B;  4NTX A;  5IYC O;  1S3J A;  1P7B A;  2OWO A;  3S3X A;  1W59 A;  3QTC A;  1K34 A;  2BTQ B;  1PNM A;  1OCC B;  1IXB A;  1Y76 B;  4JI5 B;  1FXK A;  2B5U A;  1R3J C;  1THZ A;  2IJI A;  1H2G A;  4MS2 A;  5CA3 A;  4DR1 B;  2YI9 A;  4B3R O;  2UXB O;  1K73 W;  3APO A;  4FLY A;  2DW4 A;  3FB7 C;  3X2Q C;  3JAS A;  4JV5 O;  1PNK A;  4JYB A;  1VAR A;  2EIJ C;  5B5E Z;  4Z1M G;  2WLI B;  1H2M A;  2XT9 A;  1Q7Y W;  4JI0 O;  3CSX A;  2P7T C;  4K3A A;  3HR0 A;  3VQY A;  1IXM A;  4LWS A;  1BS3 A;  5CBH A;  2QA4 V;  1EZV H;  4CH4 A;  1AI4 A;  5IJ9 B;  2DJV A;  3JD1 A;  5DEC A;  1BE3 H;  1MMM A;  4Z1V A;  3G6E V;  1WPX A;  1KP2 A;  4ZOL A;  4DR2 O;  4WCE V;  4DR1 O;  2FL4 A;  2VWK A;  3ZRW B;  2CTQ A;  2Y0P A;  1WP7 A;  2P5O A;  2ZNJ A;  2ITC C;  2UXN A;  5KHI A;  2VQE B;  3E8F A;  5CBF A;  1NVP B;  2RN9 A;  4GT1 A;  3ZMU A;  1VQM V;  4MTF A;  3N2G B;  4DR4 B;  2UUC O;  1AR1 B;  1Z5V A;  5LYJ B;  1R3L C;  3WG7 C;  5KHH A;  5D5Q A;  4K0K B;  4B7E A;  3CC7 V;  3K59 A;  3HKC A;  2DQ3 A;  2X6C A;  3JAT B;  1NH2 B;  4RQF A;  4CC6 A;  2UU9 B;  2CE4 A;  3G80 A;  1B3Q A;  4JF3 A;  5J2U A;  2X6B A;  3CCS V;  2IBZ H;  1V54 B;  2ZT9 B;  1G4Y B;  5B1N A;  2R9A A;  3AG1 C;  2C2A A;  3Q4H A;  4H44 B;  2EZO A;  2EIM B;  2KG7 A;  2EIL B;  1JMK C;  1JFF A;  1AJP A;  4ZKI A;  4GKK B;  2PI5 A;  2UXC O;  3VBB A;  4DV5 B;  5JCO C;  3ZHR A;  3ZRS A;  4NB5 A;  1T5E A;  5B1O A;  3E22 B;  3OUF A;  3HKB B;  2QGN A;  4UCT A;  4HYO A;  1KU9 A;  1VQ9 V;  1DF4 A;  4PDL A;  3ZRW A;  1MA1 A;  1PNL A;  3K9S A;  3QNE A;  1PL0 A;  2B9Z A;  1RSO B;  5LOV B;  3CCR V;  1SQF A;  2QTS A;  1U97 A;  3OR7 C;  2F4V B;  5DN6 G;  5D5P A;  1IBM B;  2XAF A;  2DMX A;  2DN9 A;  3ZN0 A;  1M57 C;  5KA5 A;  1S5L Z;  2RCV A;  4DW0 A;  3FYI B;  5E1A C;  4U7N A;  3RYC A;  5GTI Z;  1Q43 A;  2LGW A;  4X64 O;  1M57 B;  1JVM A;  4F6R A;  2BTO A;  1ZAU A;  4BR6 A;  3CC4 V;  1YJN V;  5JQG B;  4X1K B;  2E74 B;  1GN2 A;  2UUA O;  1BMF G;  5EZY A;  2ZE7 A;  3JCZ A;  4IHJ B;  3QVN A;  3AG3 C;  1N34 O;  1VQK V;  3ZMV A;  2Q0A A;  4O4H A;  4ZI7 A;  1VQL V;  4DUZ O;  2BE3 A;  3E83 A;  4DO2 A;  2CTR A;  1IVS A;  5EC1 C;  3ETE A;  1J5E B;  4J42 A;  4CH3 A;  3W7X A;  2IU3 A;  2OTJ V;  1GM7 A;  4JI6 B;  1PKX A;  3A0B Z;  1NS1 A;  1OJH A;  2R9R B;  3T4Z A;  2UU9 O;  4YY3 B;  4NXM O;  2IJJ A;  1K8A W;  1FXV A;  1W0K G;  4B3M O;  1FXH A;  3U11 A;  4X65 B;  2HHH B;  4X20 A;  1NR1 A;  4JAA A;  5CA0 A;  4EFE A;  4LF9 O;  4JI2 B;  2JRI A;  2Q9L A;  5LP6 C;  3IAY A;  2M6Y A;  4OPH A;  4LFC O;  1OHH G;  1JOY A;  2JK5 C;  4BIZ A;  3UCS C;  1WB7 A;  2GTA A;  4CS2 A;  1J5E O;  4JI3 B;  5LGU A;  4C7U A;  1KYO F;  2NN4 A;  3CC2 V;  1CEZ A;  4UVB A;  4FIP C;  1NZ6 A;  3F5T A;  3CCJ V;  2XAQ A;  3SJQ C;  5B3S C;  5FL7 G;  2YUA A;  2PYJ A;  3AK2 A;  3NXS A;  4O4I B;  2ETN A;  3P32 A;  1A32 A;  4AI8 A;  5H6Q A;  2HKO A;  2QWP B;  1K33 A;  3GWO A;  4JI2 O;  2D2C B;  3B8N A;  4BW5 A;  1YVW A;  2PGG A;  4E2L A;  4K8X A;  4X1Y B;  2H94 A;  4FJC C;  3FB5 C;  5K1X A;  4I4T B;  2BTQ A;  4RWU A;  3R66 A;  5LMN B;  4DV4 O;  2AHY A;  1AI7 A;  5J2T A;  1V9P A;  1PL4 A;  3BA9 A;  4FVM A;  5CMU A;  1F23 A;  2ZIM A;  5FPR A;  2GTS A;  5FNV B;  3CRC A;  1YIT V;  1LUV A;  2JVD A;  1FPO A;  3JD2 A;  1EN5 A;  1FJG O;  2JEU A;  2Y4T A;  4JI5 O;  3AG1 B;  2EIK C;  5H9C A;  1YTF D;  3KCY A;  4DRX B;  1TGO A;  1PD3 A;  4W4L A;  1FFX B;  5KMG B;  3T4D A;  4BIO A;  3UT5 B;  1XL4 A;  4PI0 A;  1Q6I A;  3JCU Z;  4O2A B;  4YJ2 B;  5C8Y A;  4LF5 B;  2GSM B;  4PA4 A;  2DYR C;  5JVD A;  3RW0 A;  4ZOL B;  1S76 D;  1L8D A;  1IDS A;  4IIJ A;  2DYS C;  1RPR A;  5BMV A;  1K3E A;  1H5W A;  1QLE C;  1N33 O;  4RAI A;  3LSS A;  3I5D A;  1KBH A;  5KX5 B;  2B1G A;  1WPB A;  2QSA A;  4X66 B;  1N0N A;  1Y74 A;  2HEP A;  1FFX A;  3LSU A;  4FK5 C;  2EIM C;  3JD4 A;  3OEH G;  4PD4 F;  4GKK O;  4JYY A;  1R6T A;  1VQ4 V;  3UKM A;  1O9H A;  3ABM C;  2WLL B;  4FPP A;  4O4J A;  4R7C A;  5C8Y B;  1H38 A;  1R6K A;  4CBC A;  4DV1 B;  3ZRV A;  1HR0 O;  1Y67 A;  1SA0 A;  3HKE B;  3JAR A;  4WF9 V;  4B3S B;  1XL6 A;  2QKA A;  1JQ0 A;  3U0Z A;  4J41 A;  3D3Q A;  1Q5O A;  5FPO A;  3EFF K;  3ZX6 A;  3EVK A;  2O57 A;  3KDR A;  2GUZ A;  3SJC C;  3PN1 A;  4UB8 Z;  4FLU A;  3ZMZ A;  4DV2 B;  2QTO A;  3H1K H;  4ZIB A;  1KP3 A;  1MOF A;  1LUW A;  3KKY A;  1VQO V;  4RUF A;  2FKX A;  2DWD C;  4UXN A;  4DYL A;  2JEX A;  1KKD A;  3JSL A;  3UT5 A;  4ZHQ B;  3K04 A;  3OR6 C;  1XMQ B;  4U3J B;  5EIB D;  1YDX A;  2XAJ A;  2AZ2 A;  1SC5 B;  2Q5Z A;  2ZQM A;  2XUM A;  1FJG B;  4B3T B;  3NR7 A;  4KUM A;  4DV7 B;  2UXC B;  2ZDI C;  2ZIN A;  1KMI Z;  1Y6X A;  3HB3 B;  4JYA B;  2QKC A;  3APQ A;  3CEI A;  5CA1 A;  1IJG A;  2LQT A;  1FKA O;  4PDR A;  3BA8 A;  5KHJ A;  4NXM B;  1SER A;  1XI1 A;  2ZR2 A;  1VQ8 V;  3RT3 C;  4FFB B;  3E8G A;  3WU2 Z;  4O4J B;  3LSQ A;  4XDK A;  3UQ8 A;  1TUB A;  3ETD A;  3Q4H B;  4KFM A;  4BAY A;  1VP7 A;  4D7T A;  1OCC C;  5CBG A;  2GHY A;  1VQ5 V;  4JYC A;  3A0H Z;  4E4E A;  1CPY A;  1KEC A;  2WA3 A;  4X8A A;  1GM8 A;  1SS3 A;  2B1I A;  4DV0 O;  5KLV H;  1Q6U A;  1GKF A;  1OCR C;  3SYC A;  4J9Y B;  4MTX A;  3JYC A;  2IJK A;  3I56 V;  3CP1 A;  1DTO A;  1SQX H;  4JTC B;  5KMG A;  2Z5U A;  4AHC A;  4PHZ A;  2M7W A;  4MVM A;  3ZMS A;  2V1D A;  5B1B C;  1EN6 A;  3K5N A;  1XRE A;  5BXZ A;  1M56 B;  2A7W A;  1TUE B;  1H2K A;  3D8C A;  4X9Q A;  5LXT B;  1AP6 A;  3STZ C;  1EZJ A;  1SQV H;  1WLE A;  3RVZ A;  4G27 B;  2Y48 A;  2UUB B;  4OGQ B;  2QDO A;  4J10 A;  3K5L A;  4GX1 A;  4FM2 A;  4PA6 A;  3G71 V;  2OIE A;  4EB6 A;  1R1B A;  3BPZ A;  1F4M A;  3CHX A;  3CCV V;  3F5W C;  1N4C A;  4BWA A;  3AG2 C;  1TVK B;  4I0X B;  2KKW A;  2XHB A;  2OTL V;  3K03 A;  4G28 B;  3CYO A;  1EFR G;  4ASU G;  4OXS A;  1HDJ A;  1IBL O;  2FYU H;  2GDS A;  2ZXW C;  2OCC B;  4RO2 A;  4JAU A;  5KHK A;  4YXW G;  1MSD A;  2ARH A;  2CTW A;  4IHJ A;  2IU0 A;  1L1F A;  1D5N A;  3CCU V;  3VQX A;  1YIJ V;  4JYA O;  1YJ9 V;  5IYB O;  5J9P C;  3JAK B;  4L8J A;  1TVK A;  2XAS A;  1EBO A;  1AJN A;  3E35 A;  5IYZ B;  4JI4 B;  1VMG A;  2X7R B;  4KL1 A;  3UM7 A;  3MDS A;  3SJA C;  4IL6 Z;  1HP8 A;  2DE0 X;  4CZZ A;  2JS3 A;  4X66 O;  1WA8 B;  4LR3 A;  4WFB V;  3E89 A;  4QIW F;  4XDJ A;  5EK0 A;  4MVS A;  3L9D A;  2F1M A;  2WLL A;  5IJ0 B;  1QLN A;  1BL8 A;  1SKV A;  2WLM A;  3C90 A;  2IH1 C;  2DWE C;  2Q68 A;  1OCO B;  2Q73 A;  4LBE C;  3HPL C;  3QF7 A;  4CH5 A;  4OX9 O;  3ZIA G;  3E22 A;  4DR5 B;  3RYI A;  4NVP A;  5LHI A;  5KHG A;  3CD6 V;  4O4L A;  1K4C C;  3LDE A;  1N36 B;  3SPJ A;  4GLX A;  4YJ2 A;  1AR5 A;  1R3K C;  2Y69 C;  1COW G;  3L74 H;  5L3G A;  1BQ0 A;  4TQD A;  1GMG A;  2H8P C;  2ZE6 A;  5C93 A;  1IBK O;  2QE7 G;  4LF6 B;  4DV2 O;  5LGN A;  2EIL C;  1QQC A;  2ADQ B;  3VQV A;  3MAQ A;  3ZHT A;  2XND G;  3WB0 A;  2RQ6 A;  5BR8 B;  3E8H A;  4I9W A;  4IGG A;  5KA6 A;  4UVC A;  1SQQ H;  3QO8 A;  2PY5 A;  1N32 O;  1HNZ O;  4DR7 B;  1RFY A;  2GBO A;  1ZUQ A;  4UVA A;  1NKD A;  1B04 A;  4X1K A;  2PF4 E;  3J7A U;  2RJZ A;  3RYH A;  3T1H B;  2BOB C;  2Y4U A;  4B08 A;  1V55 B;  4HAM A;  3PJS K;  4J7J A;  3GB7 C;  1DF5 A;  4TV9 A;  3QO7 A;  2MK3 A;  2K1E A;  5EC2 C;  5LYJ A;  4FLZ A;  1K97 A;  4PDV A;  2X6A A;  2ZCE A;  5H2F Z;  1PV0 A;  3DTU B;  2YXH A;  5BR8 O;  1K7D A;  5B1B B;  3CX5 F;  4ABM A;  3TXQ A;  2F66 C;  3ASN C;  1QR8 A;  2FB5 A;  2CGN A;  5EYP B;  3OTO O;  4U7O A;  3IC7 A;  4DR3 B;  4ZBM A;  4RQE A;  3A2F A;  4DUZ B;  1Z2G A;  1V55 C;  5L3D A;  1ZX3 A;  3OD4 A;  4QNH B;  3B4S A;  4XBF A;  2FML A;  3SR2 C;  4PEL A;  4YHH O;  4LF8 B;  5IYZ A;  2MW2 B;  4X1I B;  1XNR O;  1Y76 A;  3ABL C;  4O4I A;  3TJT A;  3MHS C;  5IE9 A;  3E86 A;  2UUB O;  4KHP B;  3EXA A;  4DV7 O;  3ASO B;  4X62 B;  1WA8 A;  3G6B A;  3SDL A;  3LUT B;  5H6R A;  2P4V A;  2Q67 A;  2LFR A;  2Y0I A;  3DC6 A;  4LF4 O;  1LR1 A;  2ZE5 A;  2WLI A;  4R6Z A;  3CPW U;  4LFC B;  1MZE A;  1GN6 A;  3UO3 A;  1W0J G;  4I9Q A;  2Y69 B;  1GN3 A;  2QM4 A;  4MW3 A;  4TV9 B;  5LHH A;  4YHH B;  1G1X B;  4ZHQ A;  2VS0 A;  4EFB A;  4DK0 A;  2KSD A;  1D2D A;  1XEQ A;  3BVO A;  3I55 V;  4GX0 A;  3SYO A;  4AQY B;  1JJO A;  3OAA G;  1UJW B;  1VEW A;  2UXX A;  5LXT A;  1B6Q A;  1FXK B;  1I7F A;  1WJZ A;  4PV1 B;  1QCE A;  3EHB B;  2CH7 B;  3QO5 A;  3SGI A;  4PA9 A;  3RYF A;  2N74 A;  1XDC A;  1QVF U;  2AXT Z;  3IGA C;  1QVG U;  2E5L O;  4QE9 A;  4JI0 B;  1I5X A;  5KUK A;  1ENV A;  2ZKO A;  4X89 A;  1MG1 A;  2PTM A;  3X2Q B;  3AG7 A;  4XDL A;  4X1Y A;  4PI2 A;  5L3F A;  4X65 O;  3L70 H;  4LH7 A;  2EUL A;  2P90 A;  5LL6 Y;  2V4D A;  3AG4 B;  3OTO B;  1DGS A;  2G38 A;  5CA0 B;  1NTM H;  2RDC A;  1XUQ A;  4K35 A;  2P4K A;  1VIB A;  4X20 B;  3OE7 G;  4DR5 O;  4DV3 B;  3ABK B;  1H2N A;  3BRC A;  4FMT A;  1NJI W;  3OMI B;  2LJ2 A;  3N27 A;  5AG2 A;  3S3W A;  1F7Y A;  2YIA A;  1ZL8 B;  1NBM G;  2H3O A;  3ZJZ A;  1CP9 A;  1AR4 A;  3OTF A;  2HVK C;  2YSU B;  5CN0 A;  4J9Z B;  4I5S A;  5JJE B;  2KQX A;  5FLX N;  5B1A B;  1F51 A;  3GWK C;  4O2B B;  2FTK A;  1H2S B;  1IBM O;  2Q7E A;  2YI8 A;  4YIP A;  3CCL V;  3ZHV A;  3OGI B;  3JAS B;  1XNQ O;  1QR9 A;  1YSC A;  5IJ0 A;  3RN4 A;  5BMV B;  4LP8 A;  3C3T A;  2QWO B;  4DR7 O;  2ZDI A;  4MVQ A;  2V7Q G;  5F2V O;  3TGU H;  3CRQ A;  4ICG A;  1HR0 B;  2NNU A;  3CRM A;  2W6J G;  1ARO P;  4LFB B;  4AQY O;  1HNW B;  4LNU B;  4WBN B;  4DR2 B;  3D36 C;  3O9O A;  3RFR A;  3FAV B;  2BCC H;  2F95 B;  4N21 A;  1U96 A;  4TQF A;  2JJ1 G;  3MD0 A;  3K79 A;  5CB4 B;  4H37 A;  4LC1 A;  4JAV A;  2YIC A;  2CTP A;  1VQN V;  5LHG A;  4DXW A;  1M56 C;  2Q69 A;  3BFR A;  2W0X A;  3OMN B;  2LFS A;  4CC5 A;  2YEV B;  4I55 A;  1Y74 B;  3SYQ A;  3AEI A;  1D5A A;  3CS5 A;  4FZ1 A;  4RUE A;  5IY5 B;  4DV3 O;  1K4D C;  5HFL A;  2YID A;  5IWA B;  4R50 A;  1N32 B;  2JDI G;  1SET A;  3RYI B;  2AZ0 A;  4H13 B;  1RM1 B;  1P49 A;  4X64 B;  4JV5 B;  3L75 H;  5BZB A;  2QWQ B;  1Q8I A;  2WA4 A;  3CCQ V;  1KD1 W;  1M4U A;  4O4L B;  1FXK C;  4N23 A;  4CS3 A;  1WB8 A;  2YS8 A;  1S0V A;  5JH7 A;  3ZED A;  5LA6 B;  3A0R A;  2VQF B;  1BQZ A;  4FM0 A;  2A79 B;  1YCI A;  2YEV A;  1XHZ A;  4BW9 A;  1OV9 A;  2CGO A;  2HJF C;  4B7K A;  4WFG A;  1E79 G;  1SQG A;  4HNA A;  2Q6A A;  4LFA B;  1WNS A;  3TET A;  5LMN O;  4W4K A;  4CH6 A;  3CMA V;  3A8T A;  4FM1 A;  3H1H H;  4GKJ B;  3FKS G;  4JGS A;  1G6U A;  1VQ7 V;  4Q20 A;  5IWA O;  3QG5 A;  3OW2 U;  3CJH B;  4B3M B;  2XOK G;  1JJ2 U;  2VQE O;  4TOI A;  3CCM V;  3ABU A;  1R6N A;  5EBM C;  2JIZ G;  1Q86 W;  4JTA B;  1SQB H;  3J80 N;  2HG5 C;  4DR3 O;  2P67 A;  1JCH A;  3BCC H;  1RPO A;  3RYF B;  4UCU A;  3ZHQ A;  1E1Q G;  2ZIO A;  5IJ9 A;  4JZ2 A;  1L0L H;  3ZCC A;  2QJ1 A;  1NI8 A;  4NXN B;  4GZR B;  2F4V O;  3BHP A;  2UXD B;  4JI3 O;  1NQT A;  1XIL A;  4LF8 O;  2LW7 A;  3RYC B;  1Y66 A;  4LH6 A;  1AVM A;  3C3S A;  1BGY H;  4WFH A;  1SA0 B;  1UPG A;  1JFF B;  4JI1 B;  1O9G A;  2HP8 A;  1Q82 W;  5IYD O;  1VF6 A;  1N33 B;  4TV8 A;  4G2K A;  4I50 B;  2YXL A;  2Q7G A;  4HZ3 A;  3RGB A;  4LCU C;  3WB1 A;  5JJN B;  2ODM A;  4YIO A;  3ZN1 A;  3BAB A;  4R8C A;  3ZHS A;  2IH3 C;  3RVY A;  1RSO A;  1YXB A;  5L3C A;  4F4L A;  1GH6 A;  4Q6G A;  2A06 H;  3E2E A;  4X88 A;  4DV1 O;  4DV6 B;  4H33 A;  1L0N H;  3E8B A;  4YY3 O;  3OFN G;  1AI6 A;  3FB6 C;  4FZ0 A;  4MVR A;  1JA8 A;  5DM6 V;  2OT5 A;  4MT8 A;  2YC0 A;  1VF6 C;  3LDD A;  3CXH F;  2EJR A;  2VQF O;  1TAE A;  2OYQ A;  4FFK A;  1SRY A;  2AGA A;  5LGT A;  5JQG A;  4DUY B;  3K06 A;  5EBW C;  1BSM A;  1I94 B;  2P6J A;  4GX2 A;  4GKJ O;  4O2A A;  4P30 A;  1PPJ H;  2LO1 A;  2WLK A;  4UCO A;  3G4S V;  4DR6 B;  2JGD B;  1X59 A;  3FX7 A;  1JR9 A;  2UUC B;  1ZLZ A;  2HFE C;  3IC9 A;  1PM9 A;  1WP8 A;  2JS5 A;  5KUM A;  1N36 O;  4IYH A;  1E1R G;  5LOV A;  2QWR B;  4LWS B;  1URF A;  3O65 A;  4WBN A;  4I4T A;  4JI7 O;  3N2K B;  2HVJ C;  4NXN O;  3FAV A;  5A9G A;  1QU7 A;  2DYR B;  3ZMT A;  2YXY A;  3B2E E;  2D3O W;  3FB8 C;  4DV4 B;  1JPX A;  3R65 A;  1MNG A;  4TSF G;  3SYA A;  4DW1 A;  3TCU A;  3W7S A;  1GAX A;  1S5J A;  2L35 A;  3CME V;  1MAB G;  3CRR A;  3BEH A;  4WFA V;  1IUR A;  1M9N A;  1M90 W;  3KZI Z;  3CJH A;  1KQS U;  5EBL C;  1SZX A;  2HHH O;  3WB2 A;  4KXR A;  3P30 A;  1N0J A;  1FYJ A;  4PDM A;  1JX9 A;  5DED A;  4QGP A;  2PI4 A;  4QE7 A;  4Z2W A;  1H8E G;  2R70 A;  1Z5W A;  3FFQ A;  2DOS A;  4DV5 O;  2CUG A;  2EIK B;  2ZD9 A;  1G8M A;  4JI7 B;  4NYK A;  2BSK B;  1MSW D;  1WAZ A;  5JCO A;  4WFF A;  2CDY A;  5LA6 A;  2IM9 A;  4UV9 A;  2XTA A;  4JI8 O;  1YHQ V;  4OX9 B;  2LP7 A;  1Y4M A;  4GCZ A;  3H1L H;  3JAT A;  3LDC A;  3T1Y B;  4DR4 O;  3OMA B;  4QJF B; 
#chains in the Genus database with same CATH homology
 1EN6 A;  4BR6 A;  1PL4 A;  3KDR A;  1GN2 A;  1XRE A;  1B06 A;  3QVN A;  4X9Q A;  1AP6 A;  1ZSP A;  1QNM A;  1GN4 A;  1LUV A;  4JZ2 A;  1JR9 A;  1LUW A;  3KKY A;  1ZLZ A;  3IC9 A;  1EN5 A;  2CE4 A;  1PM9 A;  1IXB A;  1XIL A;  1AR5 A;  4JZG A;  1XUQ A;  3AK3 A;  2P4K A;  3AK1 A;  1AVM A;  3C3S A;  3BFR A;  5A9G A;  3OT7 A;  1BT8 A;  3TJT A;  1VAR A;  1BSM A;  5AG2 A;  2ADQ B;  2GDS A;  1MNG A;  2AW9 A;  1P7G A;  2QKC A;  1IDS A;  3CEI A;  1MSD A;  4YIO A;  1BS3 A;  1AP5 A;  3DC6 A;  1AR4 A;  1SZX A;  1GN6 A;  1D5N A;  1GN3 A;  1ZUQ A;  1N0J A;  1WB7 A;  4F6E A;  1I08 A;  1WB8 A;  1N0N A;  1KKC A;  1MMM A;  1MA1 A;  4C7U A;  4YIP A;  3LSU A;  1ZTE A;  3K9S A;  4JYY A;  3RN4 A;  3C3T A;  4E4E A;  1EN4 A;  3AK2 A;  2CDY A;  2ADP A;  3MDS A;  1JA8 A;  1I0H A;  1VEW A;  1Y67 A;  4FFK A;  1IX9 A;  1EM1 A;  2RCV A;  3DC5 A;  4GUN A;  2QKA A;  1XDC A;  3EVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...