3C3SA

Role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWAHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 64
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3c3sA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3c3sA02
1ZSPA 1BT8A 1WB7A 1ZLZA 1GN6A 1Y67A 1WB8A 1EN6A 3MDSA 1XREA 3RN4A 4C7UA 4JYYA 1GN2A 1LUVA 3EVKA 3IC9A 4JZ2A 3KKYA 3C3SA 1EN5A 1IXBA 3K9SA 1AVMA 1JA8A 1I08A 2QKCA 2CE4A 1P7GA 5A9GA 1ZUQA 4X9QA 1N0NA 1LUWA 1AP5A 2P4KA 1GN4A 1MNGA 1MA1A 2GDSA 1KKCA 1SZXA 1ZTEA 2QKAA 1BSMA 1MSDA 1VARA 4GUNA 3CEIA 1D5NA 1XUQA 3DC5A 2RCVA 3DC6A 4FFKA 4E4EA 1N0JA 2CDYA 1XDCA 1JR9A 5AG2A 1PM9A 4BR6A 2ADQB 3AK3A 1QNMA 4YIPA 1AR4A 2AW9A 3AK2A 1EM1A 1IDSA 3TJTA 1AR5A 1IX9A 4F6EA 4JZGA 1PL4A 3QVNA 3AK1A 3OT7A 1I0HA 1BS3A 1VEWA 1EN4A 1MMMA 1AP6A 2ADPA 1B06A 3C3TA 3LSUA 4YIOA 1XILA 1GN3A 3BFRA
chains in the Genus database with same CATH superfamily
1J5EB 2EILC 1BT8A 1YHQV 1WB7A 2OCHA 1ZL8A 4PJ0Z 2ZCEA 5FNVA 3EVKA 4MTXA 4U7OA 3OMAB 4UXNA 5B1AB 1ROPA 3AG2B 3LNMB 2P5OA 2P06A 3QG5A 4X62B 4NXMB 3BA8A 2QM4A 1HNZB 1Y4MA 2EILB 2YXYA 5KHKA 1K4CC 4LNUB 1NTMH 2Z0AA 1VQ4V 4WCEV 1KD1W 4MVRA 2GTSA 5LGNA 3UQ8A 5D5PA 3TXQA 1MZFA 5BMVB 4E4EA 4J10A 2V7QG 2ATKC 5GTIZ 1RM1C 2UXDB 1W59A 3WB2A 1K33A 2QA4V 3FB8C 4P30A 1H2SB 4GKJO 1KECA 1R3IC 1GH6A 4QIWF 2QGNA 3H1JH 1XMOB 2EINC 3CSXA 1K5QA 1YZBA 1R6NA 2M7WA 4WF9V 3MHHC 1Q43A 2QWQB 4WFAV 4UB8Z 4D7SA 4WFBV 2X6BA 2IJJA 3W7TA 4TQFA 1BS3A 1IXMA 4JYAB 3D3QA 3RWRD 5JJNB 1RM1B 4IYHA 4LNUA 1NI8A 1KP2A 4MVSA 1IBKO 1PPJH 3ZHQA 3H9VA 1KYOF 1FYJA 1JFFA 2Q69A 2EJ7A 4JF3A 4I9QA 4UVAA 2EINB 3K06A 4MVZA 3HKCB 2Q67A 5BY1A 2UXBB 2JGDB 4JI7O 5F2VO 4J7ZA 1EN5A 1OHHG 1UJWB 5KHHA 3IFXA 1JX9A 3GWOA 3R65A 1KKDA 3SYCA 1N34O 2DOSA 3A8TA 3OUFA 4LF9B 1VQLV 1GN4A 2PGGA 2Q73A 3H1KH 5J9PC 3EFFK 2HJDA 4PD4F 4YXWG 1Q6IA 1U96A 1SQGA 2V1DA 1IJGA 4DV1O 1Q7YW 1HNXO 3AG4C 3T4DA 4HBNA 4DR1O 2ADQB 3C90A 4X20A 2JGDA 1NJIW 1M9NA 5KAFZ 3ZHRA 4LFAB 1THZA 2PUSA 1H2NA 4LF4O 2CTRA 1KQSU 2JEUA 1I94B 3SYPA 4ZKIA 5JVDA 3OEHG 5LA6B 4PDRA 4EEQA 2UUCB 3EHBB 1N32O 4HAMA 3AG4B 3I56V 3CRRA 1H8EG 1AP6A 1H2KA 4UV8A 5J2UA 1RFYA 3K0GA 3JAWB 3J80N 1LNQA 3CXHF 5LHIA 4JV5B 3E8BA 3ETQA 1TVKB 3JASB 4LFCB 1GRJA 2HLDG 3TCUA 1N8RW 1EN6A 1Q90D 1Z2GA 3PN1A 4FFBB 4JYYA 2QM8A 4ICGA 4CH4A 4LC1A 1XHXA 2Y4UA 1F4NA 1BL8A 4DV0O 4DV4B 1IXBA 1CEZA 4LFBB 1I08A 5DM6V 5H9CA 3K5MA 4O4HB 3APOA 2ZIOA 5KUKA 4U3FH 1NVPB 5LA6A 3FD9A 4FIPC 5GONA 2P4VA 4NTWA 3K5OA 1V9PA 2ZM6B 1SQBH 2P7TC 3JARB 2A3QA 5J2TB 1AI7A 2UUAB 1XNQO 4FLUA 3JASA 1OCOC 4J9YB 3UT5A 1N0JA 1DLBA 4PI2A 4FFBA 4TV9A 5FPRA 1SQVH 1PM9A 5FPOA 4ZOLB 2LJ2A 5LXTB 4XDLA 1GKFA 4WFHA 5LMNB 1YIJV 2QE7G 3L75H 4ZHQB 3CD6V 1GM7A 3ZN1A 3TJTA 5DECA 4B3SO 5EC1C 3FX7A 1V54C 4JI8B 4DR2B 4CH5A 2BTQB 3QO5A 1I0HA 1IVSA 3I5DA 3ZS8C 3G6EV 1OCOB 4LCUC 3H1LH 1WNSA 4DV4O 3BHPA 3CC4V 3N27A 1K5SA 3JARA 1YTFB 4TUYB 1GK9A 5JH7A 3ABUA 3OGIB 2W0XA 1YJNV 3JSLA 3JCZA 2HVKC 2YIDA 3CMAV 3F5WC 2Q9LA 4O4IB 1SKVA 1US6A 1V54B 1AI6A 4DO2A 3U11A 2AZ2A 4ZOLA 4A5UB 5KHIA 5LXTA 4J80A 2W6JG 3K9SA 2ZNIA 2VQEO 2ZR3A 1SQQH 2A0LA 4FLWA 4ZHQA 2UUBO 4NKGB 4OGQB 4IT5A 3WU2Z 2R9RB 1LUWA 1K3EA 2BTQA 4MW3A 1K8AW 3ZHTA 4B3TB 4QE9A 2RDCA 1PNKA 2QJ1A 1L1FA 3CCRV 4GX1A 2YC0A 5KAIZ 5TISZ 3GWKC 4KHPO 1WP7A 4TUYA 5KHGA 2Q5ZA 3K04A 1FPOA 5EBWC 3ZMSA 1YI2V 1HNWB 5L3GA 2Q0AA 1NT2B 5C8YB 3KDRA 3OD4A 4MTOA 4GYCB 4O4IA 4UUJC 4DR6B 3DTUB 4DV3B 3CRQA 3ZIAG 2IU0A 2ODMA 4YIPA 5IYCO 2EIMC 2QWNB 3ICXA 2RMKB 1QLEC 4RO2A 2BOBC 2KG7B 3ML0A 2N05A 1MOFA 4I4TB 4DV5B 3I55V 3ASNC 4UVCA 4NXNB 3ZBHA 3KZIZ 1GN3A 1QBZA 1XMQB 1JJOA 1JJ2U 4FLVA 2XAQA 4LF7B 4MTFA 4Z2WA 5C8YA 1RPRA 4MTGA 2EIMB 5JJJB 3JD0A 2PY5A 1VQ6V 1WJZA 1N4CA 2B9ZA 1QLEB 2FL4A 4CBCA 4TV8B 2WA3A 3BPZA 4O4JB 1EBOA 2XUMA 4CS2A 3ASNB 4EB6B 2YIAA 2WWWA 4R50A 1TUBB 1YTFD 4DR3O 4OPAA 3JD1A 2N04A 4I0XB 5KLVH 2KG7A 4WFEA 2EX3A 5IE9A 2OTJV 3SPIA 2DQ0A 4I4TA 4L8JA 5KHJA 3W7UA 1H8HG 3H1IH 2ZD9A 1PNMA 5BR8O 2RCVA 2Z5UA 2IW5A 1YEWA 1FS0G 3T1YO 2E3CA 4PDVA 4OX9B 4MW8A 5CBHA 2Y69C 3FYEB 2PF4E 5CBGA 1SA0B 3RYIA 4GLXA 3P30A 1JOYA 1AI5A 2F23A 3IGAC 1VIBA 1VMGA 4O4JA 4DYLA 1S76D 2YIBA 4GX0A 3F7YC 4F6EA 4EB6A 1RP3B 3ASOC 2ZT9B 4JI0B 1BE3H 1TUBA 4PA9A 1NTZH 3STLC 4LR3A 4JPRA 4I0XA 3FB5C 1JQ0A 4FZ0A 4P9PA 2Y69B 4J7KA 4PDMA 3ETDA 1H5WA 2UXCO 1Y66A 2GSMB 1AB3A 4JI3O 5IY5C 1AI4A 4H37A 4N21A 2HP8A 1VQ9V 3GB7C 5KA5A 1RSOB 1WB8A 2HHHO 3M99B 3QO8A 5LOVB 1ZAUA 1FXKC 2HR3A 1JCHA 2Q4PA 2ZXWC 1SA0A 5CMUA 4MVOA 4YHHB 3F5TA 3RVYA 1FJGB 1N36B 2K1EA 3CHXA 1XHZA 2JIZG 3A0HZ 3LSSA 5L3FA 2JGUA 4JI1O 4IL6Z 2CE4A 4F4LA 1K9MW 4K3AA 1YF2A 3EXAA 5IY5B 4NYKA 4LF8O 1YJ9V 3CXCU 4Q6GA 4DW1A 3CMEV 3RYCB 1QU7A 1BSMA 2B1GA 1BQZA 1COWG 1FXKB 2ZXWB 4JYBA 1KB9F 4PA6A 1NR7A 3HPLC 4RAIA 3HR0A 1RSOA 1JPXA 3ZMTA 3Q4HB 4JTCB 2A06H 4I7ZB 1JR9A 5LOVA 2F4VB 1QHTA 1P4RA 2YIBD 4GKKB 1IURA 3E86A 1VQMV 2DMXA 4DUZO 2OYQA 2UU9O 1H2GA 1R1BA 2ITCC 3CCQV 3K57A 2E5LO 4DV2O 4JI4O 1F7YA 1NTKH 4O4LB 1OCCC 1SETA 2D2CB 4AHCA 1FOUA 1Z5VA 3VOUA 1O9GA 3RYCA 3OUSA 2KQXA 3OGCC 1FXKA 2VWJA 2QR4A 4X66B 2EZOA 1J5EO 3LDCA 1G4YB 3QF7A 1Y67A 5JWPA 2F1MA 2WAMA 3MDSA 4C7UA 2Q7GA 1DF4A 4LH7A 3Q4HA 1VQ7V 3SYOA 1JVMA 4KL1A 2EIKC 4QPJA 3WB0A 4WFGA 3L74H 1R73A 1BCCH 1IBLB 1OCCB 2LFSA 4QPKA 1FFXB 4CC6A 4DRXB 3TK1A 2QKCA 3OMNB 4PI0A 1HR0B 4X62O 1OCZC 4NXMO 1M1KW 4RUEA 1PNLA 4X65B 5BMVA 1KU9A 1HNZO 1LR1A 2O57A 1S5LZ 1VF6C 1Y76B 2FMLA 1W0KG 4JASA 4O4LA 3IC7A 3SGIA 4LF5B 1BMFG 3GVMA 2WPDG 1SZXA 3UO2A 3OTFA 3DC5A 3CRMA 4JI6B 2EIKB 3RYHB 1YVWA 2GTAA 4J11A 3SPHA 4NVPA 2UXDO 2PTMA 3L73H 3HKEB 4KFMA 4MVMA 1HW7A 1VP7A 1VQ5V 4B3RB 2P22C 2NN4A 3W7SA 1OCZB 1UPGA 2MW2B 3FAVB 4J42A 4UVBA 3AK3A 1XMOO 3SYAA 1SRYA 4DRXA 1XNRB 1M4UA 2LFRA 5LMUB 1P84F 5L3EA 4J41A 4JZGA 4JYAO 1VEWA 3HKCA 2ZIMA 5EIBC 2ADPA 2EBOA 1Q86W 5FLXN 1ORQC 1VQNV 3C3TA 2JJ2G 2PYLA 1TAEA 4CC5A 3CC2V 2OIEA 4IHJB 2QDOA 1SC5B 1VF7A 3ABLC 3SJCC 2GUZB 4DV7B 4EKWA 3B77A 4X64B 3HKEA 2FYUH 2RQ6A 3X2QC 2RJZA 2UXBO 3NR7A 3FAVA 3KKYA 4WFFA 1SESA 1KBHA 2XAJA 2ZDIC 1QCEA 3ABKC 4LF9O 5CN0A 4K35A 2IH3C 4RUFA 2OTLV 1AJPA 1MNGA 1M56C 5IYZB 3ABLB 3P32A 2EIJC 2JDIG 2YDEA 2LGQA 4LWSB 3FB7C 4X1KB 3E8GA 4O2AB 3VQWA 3RGBA 3X2QB 3CEIA 5H2FZ 4XDJA 3FKSG 4KXRA 4O2BB 3ZRWB 2Q6AA 3L71H 1XOUA 4IHJA 1QVGU 1CPYA 2GUZA 3UCSC 3E22B 1G8MA 2Y0PA 2E76B 5C93A 3ABKB 3TGUH 3CJHB 4PELA 1M57C 4UB6Z 1S5JA 2AGAA 2XT9A 2JRIA 3M7MX 4LFAO 1T5EA 1M56B 2YICA 3HB3B 3OTOB 1QNMA 5JQGB 3AEIA 4JI2B 3H1HH 5LP6C 1H38A 2EIJB 1NR1A 2F66C 1I94O 3JAWA 1DTOA 1DF5A 1HP8A 2KKWA 1TVKA 2UUCO 3DXRB 3SJQC 3AK1A 1B3QA 1YJWV 5IYZA 3RT3C 1H2LA 4LBEC 4LWSA 4K0KB 1IBMB 1SZTA 1MABG 1TUEB 1XL6A 2B1IA 4JV5O 2XOKG 3CRCA 4LFCO 4DUYB 1VQKV 2R9IA 4O2BA 3ZRWA 1H2MA 4O4HA 3L70H 5LP6B 2XAGA 3E22A 2ZINA 1R3KC 4FJCC 2ZDIA 2EJRA 2H94A 2AHZA 3T1HB 2AZ0A 1HDJA 3QO7A 4ASUG 1S72V 3OMIB 1URFA 1Q5OA 4LFBO 1EFRG 3U10A 4W4KA 5JQGA 1JNBA 5J2TA 3P3PA 1VQ8V 2W6IG 1U97A 4NB5A 1AR1B 4U7NA 2G38A 5A9GA 3O65A 2DE0X 4CH3A 2Q0OC 1FFTB 5CA3A 2WLMA 2ZM6O 4U3JB 1KKCA 5CA1B 2LW1A 4YY3B 1ENVA 2QSAA 5L3BA 2ZQMA 5BXZA 1SF9A 5JCOC 4DV6B 3WFVA 1Z5WA 2UUAO 2P67A 2QEXV 2YI8A 4QJFB 4MVQA 1QLNA 4JAAA 5LP6A 4HNAB 3ZJZA 4X1IB 3B40A 4IYIA 3APQA 1Q81W 2DWEC 5EIBD 4I5SA 3B09A 4FM0A 4P2ZA 3O9OA 5CBFA 2QM7A 5LMNO 4JGSA 4BWAA 2H8PC 3ZX6A 3K5LA 4JI8O 4DR2O 5DN6G 4LF6B 4BAYA 3LNNA 3VBBA 1AJNA 3STZC 4I50B 4FZ1A 4U3JA 5CA1A 5H5NA 3SR2C 3ETGA 1NVPD 3J7AU 4UCOA 2JJ1G 3W7XA 1UFIA 5EZYB 4E2LA 1NS1A 4RQFA 1ZSPA 5JJEB 1GN6A 1SQXH 1WPBA 5E1AC 1P7BA 4HNAA 4X1IA 2WLLB 4CS3A 1GN2A 1MSWD 2GHYA 3ZRXA 4FMTA 1NH2B 4DV6O 1ZWIC 4OPHA 2P6JA 5LL6Y 1JA8A 2AXTZ 5A2QN 5D5QA 4FM1A 2VQFB 5JCOA 2M6YA 1N0NA 1KP3A 1MA1A 5K1PA 3ZN0A 1SQPH 3SPCA 4B3TO 1GMGA 4FLYA 3JALB 2F93B 1ZTEA 4DR7B 4MS2A 3B8NA 2GBOA 4AQYB 4PDLA 1DK1A 3CCSV 1WN7A 2ARHA 2JK5C 5EBLC 4H13B 5IWAB 3CCLV 3LDDA 1HNWO 4BIZA 3HKBB 1S5HC 5HFLA 2WLIB 2WLLA 1VQPV 1RPOA 4QE7A 4DR6O 4DV3O 5IYDO 4B08A 2IM9A 2EZPA 1WAZA 1FXVA 1Y74B 4DR4B 3OFNG 3CCEV 2AW9A 3D36C 3FB6C 1IDSA 2XNDG 4B3MB 4B7KA 3CE2A 1I5YA 1MZEA 1OZ0A 2OIGA 4BW9A 3QVNA 3FFQA 3UKMA 4EFBA 2YI9A 4CS4A 1KMIZ 3K58A 4IGGA 2FB5A 3RVZA 2YEVB 4DK1A 3JALA 4DV5O 4QNHB 1WPXA 1PKXA 1PL0A 2PZSA 4NXNO 4FK5C 4YIOA 4TV8A 1XMQO 1N33B 5IDJA 3JAKB 1BHAA 4LF7O 1KUQA 3AG1C 3L72H 3HKBA 3RN4A 4BW5A 1GTOA 2WLIA 1YSCA 4Z1MG 3JD2A 4JZ2A 3BAAA 1I5XA 4IIJB 2HEPA 1Y74A 3KCYA 1AVMA 2IJHA 3R66A 2YXLA 1EZVH 3K0DA 3LSQA 2QWPB 3K79A 1OV9A 1PV0A 1K4DC 5LGTA 3IAYA 5FNVB 2E75B 1F23A 1R3JC 3AG1B 2YEVA 3JCUZ 2QKSA 1B04A 3ASOB 1PP9H 1VQOV 1V55C 4ABMA 5GW7A 4PHZA 2DYSC 1P49A 5BZBA 1NH2D 3JAKA 2NNUA 4OX9O 1AROP 2CDYA 3D36A 5E79Z 3SPGA 4GKJB 5AG2A 4BR6A 3IJ4A 3ETEA 3VQYA 2QTOA 2IU3A 4F6RB 2X0LA 3SJBC 5EC2C 3CB2A 1MG1A 2ILMA 4JAVA 1V55B 4JI0O 1Q6HA 2DYSB 4LH6A 3CX5F 3KCXA 2AHYA 3RFRA 1QR8A 2A7WA 3OR6C 2JEXA 4DR5B 2BE3A 1IBKB 2UXNA 1NZ6A 3CCUV 3T1CA 4X1YB 2CTWA 4H33A 5H6RA 4TWKA 2Q68A 4FPPA 3ZHVA 2HKOA 5KA6A 5CB4B 1F51A 1GAXA 4YHHO 3IC9A 3ZMVA 5LBQA 4JI7B 3K3WA 2MK3A 1FJGO 1N36O 3JYCA 1XL4A 2CH7B 4F6RA 1JFFB 2IJKA 1N34B 3E8HA 3N2KB 4HZ3A 4ZI7B 1B6QA 1YITV 3OAAG 1ZUQA 4X9QA 2P4KA 2ZKOA 2PI4A 3H01A 4Z1VA 3BVOA 4TT3G 1E1QG 4JTAB 2LP7A 4RQEA 1L0NH 2IBZH 2XAHA 4D7TA 1SS3A 4DV1B 1HNXB 4YJ2B 4FFKA 4PA4A 2XASA 4X1YA 4DR1B 2F4VO 3SYQA 4GKKO 5CB4A 1PD3A 4DR5O 4UCTA 4CZZA 2V4DA 2CH7A 2IH1C 4LF4B 3N2KA 4ZI7A 1AILA 2H3OA 5LYJB 1L0LH 1PL4A 1GO3F 1W2BU 1N32B 3ZMUA 4X20B 3N2GB 4R6ZA 2DYRC 4YJ3B 3OEEG 3LSUA 4X66O 1WP8A 5FL7G 1FFXA 5KX5B 5JVDB 3E35A 4YJ2A 2CUGA 1HWYA 1E79G 2B5UA 5B1NA 2WLJA 1BGYH 3U0ZA 4UCVA 4UCSA 1Y76A 5LGUA 2RNBA 2LO1A 5J2UB 2K9PA 3CCJV 2BTOA 3C3SA 1IBLO 4DV0B 3L9DA 3MD0A 4QGPA 2ZE6A 3AG3C 1BZKA 2D3OW 1FAFA 2Y48A 1HR0O 2HG5C 1P7GA 2DYRB 4X65O 3RYHA 1AP5A 5LYJA 3B8MA 2X6CA 3ZHUA 3CS5A 3ZRSA 2JS5A 2P90A 2ZE7A 4JAUA 4KUMA 1D2DA 4LF5O 4UCRA 2OWOA 2QWOB 3JD4A 4FVMA 4UV9A 2WLNA 3N2GA 2Q7HA 4ZIBA 1VARA 4YJ3A 1VF6A 1CP9A 2CTQA 1QQCA 4JI6O 5LHHA 2XHBA 4NTXA 5B1OA 5EBMC 1W0JG 5KX5A 1XNQB 1TA8A 2VS0A 2ZE5A 4GZRB 5GONB 2ZE8A 3AG3B 3QTCA 4B3RO 2NR5A 1A32A 5KUMA 3DSQA 1JMKC 1NKDA 1R3LC 2CGNA 2YS8A 3D8CA 2A9HA 4J7JA 3DGEA 1XNRO 5LMUO 2YUAA 5L3CA 3A0RA 1WA8B 4I9WA 3UT5B 3CP1A 4Q20A 4WBNB 4B3SB 3F7VC 2WA4A 1Q6UA 4DW0A 4NR1A 4TV9B 3CC7V 3M8AA 4W4LA 3OT7A 4K8ZA 4NTYA 4MVUA 3K9AA 3CRAA 4PV1B 2OT5A 3BFRA 2DWDC 1S0VA 2N74A 4DV7O 2KB1A 3A2FA 3MAQA 2Y4TA 4X64O 3FYIB 4GT1A 5B1BC 1XREA 5B66Z 1X59A 3OW2U 5LHGA 1Y6XA 2L35A 4X1KA 1M57B 4O2AA 4JI5B 3ZMZA 5JH7B 2VQEB 2DQ3A 3TXSA 1WA8A 2DW4A 3HKDB 2UUBB 5IYBO 5B3SC 4WBNA 5KMGB 2ZR2A 4AILC 3BABA 3QNEA 3CJHA 1K97A 4DK0A 3K59A 2BSKB 3G80A 4K8XA 4FLTA 1E1RG 4BIUA 5B1BB 1IZ3A 3ABMC 3RYFB 1D5NA 4KHPB 1XUQA 3OM3B 2A79B 2HJFC 5DEDA 2X7RB 1M5IA 2Q7EA 5L3DA 4XDKA 1K73W 4XBFA 3DXRA 3SDLA 1XDCA 3G4SV 2PI5A 1S77D 4I55B 5B3SB 3ZCCA 5IJ0B 3OTOO 2HFEC 4JI2O 1NBMG 1BHBA 2DJVA 2ZNJA 2RN9A 3K08A 3OR7C 2QWRB 3K03A 4X88A 3ABMB 3S3WA 2IJIA 3HKDA 1IX9A 3E89A 5KMGA 4JYCA 3E8FA 4B7EA 3B4SA 5EK0A 1G1XB 3BRCA 1MMMA 5K1XA 3ZRVA 2BSKA 4K0KO 4G27B 1IBMO 4GCZA 4JI5O 2Y0IA 3P3NA 1XQ8A 1OCRC 3RYFA 1XI1A 3VQVA 4DUYO 5EYPB 2Q8VA 2DN9A 3D3IA 4TQDA 1ZLZA 2F95B 2XAFA 2JVDA 3T1HO 2XTAA 2CAZC 3T2MA 1KC8W 1LUVA 3CWBH 3PJSK 4J9ZB 4I55A 1Q8IA 2PYJA 1WLEA 2CTPA 3G67A 2JS3A 3SPJA 5IJ0A 2BCCH 3BY6A 5ITZB 4DXWA 1GM9A 1Q82W 1EZJA 3BEHA 4PA7A 2QTSA 3NXSA 4CH6A 2WLKA 3CCVV 1F4MA 1OCRB 4BIOA 4G2KA 4AI8A 4DR3B 4RWUA 4YY3O 2GDSA 3E83A 1TGOA 2QKAA 3G71V 4FM2A 5HFMA 1D5AA 5IT9N 4GX2A 4ZBMA 1NQTA 5EYPA 5BR8B 3DC6A 3JSNA 1NU1H 2WSSG 1FXHA 3T1YB 4H0LB 3T4ZA 1K92A 3J81N 3UM7A 3UO3A 4I50A 3A0BZ 1I7FA 1SERA 1FKAO 4JTDB 5ITZA 1AR4A 2YSUB 4R8CA 3W7WA 1AR5A 5EZYA 1GM8A 4LF6O 2FTKA 2F43G 1R6TA 4H44B 5GTHZ 3AG7A 3RYIB 4MT8A 1R6KA 1YCIA 2C2AA 3CYOA 3JD3A 1S3JA 2UXCB 1J95A 5H6QA 5IJ9B 1SQFA 1G6UA 2CGOA 1XILA 4JI3B 4R7CA 2OCCC 3ZEDA 1QVFU 2HHHB 2KSDA 2HVJC 3RW0A 2BOCC 4OXSA 2LQTA 2NLJC 2UXXA 4FLXA 1OJHA 3CPWU 4HYOA 4MSWC 3JATB 4D6TH 3G6BA 4X8AA 4FLZA 1K7DA 3SJAC 4KP4A 2VQFO 4JI1B 5CA0B 2Z3YA 1YXBA 3S3XA 1M93A 2FKXA 2VWKA 2YXHA 4TOIA 1VF5B 1K34A 2R70A 4PA3A 4G28B 3TETA 1ZX3A 3CCMV 3VQXA 1O9HA 2OCCB 4LF8B 2GV9A 4DR7O 2WLHA 1MSDA 4AQYO 4GX5A 3WG7C 4GUNA 4TSFG 5IJ9A 4UCUA 4UFZA 1X4TA 3ZHSA 5IWAO 2X6AA 2ITDC 2LGWA 3B2EE 3WB1A 3ABTA 1ZL8B 2CK3G 2W0FC 4X89A 4L87A 2LW7A 4EFEA 3RBZA 2E74B 1FD9A 3JAMN 3LDEA 3E2EA 4N23A 4DR4O 2R9AA 2R72A 3JATA 5B5EZ 3BCCH 4DUZB 1BQ0A 1YDXA 3AK2A 1EM1A 4B3MO 2UU9B 1L8DA 1CXZB 1Q3EA 5CA0A 3WG7B 1QR9A 4LP8A 2EULA 2E5LB 4DV2B 3LUTB 4JI4B 2L6LA 1EN4A 5B1AC 3THOA 1XEQA 3AG2C 1B06A 2VRZA 1DGSA 3MHSC 2ETNA 3OE7G 4IIJA 1XBLA 3KG2A 4P9OA 1N33O 1AJQA 3K5NA 1M90W 3BA9A
chains in the Genus database with same CATH topology
1ZSPA 1BT8A 1WB7A 1ZLZA 1GN6A 1Y67A 1WB8A 1EN6A 3MDSA 1XREA 3RN4A 4C7UA 4JYYA 1GN2A 1LUVA 3EVKA 3IC9A 4JZ2A 3KKYA 3C3SA 1EN5A 1IXBA 3K9SA 1AVMA 1JA8A 1I08A 2QKCA 2CE4A 1P7GA 5A9GA 1ZUQA 4X9QA 1N0NA 1LUWA 1AP5A 2P4KA 1GN4A 1MNGA 1MA1A 2GDSA 1KKCA 1SZXA 1ZTEA 2QKAA 1BSMA 1MSDA 1VARA 4GUNA 3CEIA 1D5NA 1XUQA 3DC5A 2RCVA 3DC6A 4FFKA 4E4EA 1N0JA 2CDYA 3KDRA 1XDCA 1JR9A 5AG2A 1PM9A 4BR6A 2ADQB 3AK3A 1QNMA 4YIPA 1AR4A 2AW9A 3AK2A 1EM1A 1IDSA 3TJTA 1AR5A 1IX9A 4F6EA 4JZGA 1PL4A 3QVNA 3AK1A 3OT7A 1I0HA 1BS3A 1VEWA 1EN4A 1MMMA 1AP6A 2ADPA 1B06A 3C3TA 3LSUA 4YIOA 1XILA 1GN3A 3BFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSP A;  1BT8 A;  1WB7 A;  1ZLZ A;  1GN6 A;  1Y67 A;  1WB8 A;  1EN6 A;  3MDS A;  1XRE A;  3RN4 A;  4C7U A;  4JYY A;  1GN2 A;  1LUV A;  3EVK A;  3IC9 A;  4JZ2 A;  3KKY A;  3C3S A;  1EN5 A;  1IXB A;  3K9S A;  1AVM A;  1JA8 A;  1I08 A;  2QKC A;  2CE4 A;  1P7G A;  5A9G A;  1ZUQ A;  4X9Q A;  1N0N A;  1LUW A;  1AP5 A;  2P4K A;  1GN4 A;  1MNG A;  1MA1 A;  2GDS A;  1KKC A;  1SZX A;  1ZTE A;  2QKA A;  1BSM A;  1MSD A;  1VAR A;  4GUN A;  3CEI A;  1D5N A;  1XUQ A;  3DC5 A;  2RCV A;  3DC6 A;  4FFK A;  4E4E A;  1N0J A;  2CDY A;  1XDC A;  1JR9 A;  5AG2 A;  1PM9 A;  4BR6 A;  2ADQ B;  3AK3 A;  1QNM A;  4YIP A;  1AR4 A;  2AW9 A;  3AK2 A;  1EM1 A;  1IDS A;  3TJT A;  1AR5 A;  1IX9 A;  4F6E A;  4JZG A;  1PL4 A;  3QVN A;  3AK1 A;  3OT7 A;  1I0H A;  1BS3 A;  1VEW A;  1EN4 A;  1MMM A;  1AP6 A;  2ADP A;  1B06 A;  3C3T A;  3LSU A;  4YIO A;  1XIL A;  1GN3 A;  3BFR A; 
#chains in the Genus database with same CATH topology
 1J5E B;  2EIL C;  1BT8 A;  1YHQ V;  1WB7 A;  2OCH A;  1ZL8 A;  4PJ0 Z;  2ZCE A;  5FNV A;  3EVK A;  4MTX A;  4U7O A;  3OMA B;  4UXN A;  5B1A B;  1ROP A;  3AG2 B;  3LNM B;  2P5O A;  2P06 A;  3QG5 A;  4X62 B;  4NXM B;  3BA8 A;  2QM4 A;  1HNZ B;  1Y4M A;  2EIL B;  2YXY A;  5KHK A;  1K4C C;  4LNU B;  1NTM H;  2Z0A A;  1VQ4 V;  4WCE V;  1KD1 W;  4MVR A;  2GTS A;  5LGN A;  3UQ8 A;  5D5P A;  3TXQ A;  1MZF A;  5BMV B;  4E4E A;  4J10 A;  2V7Q G;  2ATK C;  5GTI Z;  1RM1 C;  2UXD B;  1W59 A;  3WB2 A;  1K33 A;  2QA4 V;  3FB8 C;  4P30 A;  1H2S B;  4GKJ O;  1KEC A;  1R3I C;  1GH6 A;  4QIW F;  2QGN A;  3H1J H;  1XMO B;  2EIN C;  3CSX A;  1K5Q A;  1YZB A;  1R6N A;  2M7W A;  4WF9 V;  3MHH C;  1Q43 A;  2QWQ B;  4WFA V;  4UB8 Z;  4D7S A;  4WFB V;  2X6B A;  2IJJ A;  3W7T A;  4TQF A;  1BS3 A;  1IXM A;  4JYA B;  3D3Q A;  3RWR D;  5JJN B;  1RM1 B;  4IYH A;  4LNU A;  1NI8 A;  1KP2 A;  4MVS A;  1IBK O;  1PPJ H;  3ZHQ A;  3H9V A;  1KYO F;  1FYJ A;  1JFF A;  2Q69 A;  2EJ7 A;  4JF3 A;  4I9Q A;  4UVA A;  2EIN B;  3K06 A;  4MVZ A;  3HKC B;  2Q67 A;  5BY1 A;  2UXB B;  2JGD B;  4JI7 O;  5F2V O;  4J7Z A;  1EN5 A;  1OHH G;  1UJW B;  5KHH A;  3IFX A;  1JX9 A;  3GWO A;  3R65 A;  1KKD A;  3SYC A;  1N34 O;  2DOS A;  3A8T A;  3OUF A;  4LF9 B;  1VQL V;  1GN4 A;  2PGG A;  2Q73 A;  3H1K H;  5J9P C;  3EFF K;  2HJD A;  4PD4 F;  4YXW G;  1Q6I A;  1U96 A;  1SQG A;  2V1D A;  1IJG A;  4DV1 O;  1Q7Y W;  1HNX O;  3AG4 C;  3T4D A;  4HBN A;  4DR1 O;  2ADQ B;  3C90 A;  4X20 A;  2JGD A;  1NJI W;  1M9N A;  5KAF Z;  3ZHR A;  4LFA B;  1THZ A;  2PUS A;  1H2N A;  4LF4 O;  2CTR A;  1KQS U;  2JEU A;  1I94 B;  3SYP A;  4ZKI A;  5JVD A;  3OEH G;  5LA6 B;  4PDR A;  4EEQ A;  2UUC B;  3EHB B;  1N32 O;  4HAM A;  3AG4 B;  3I56 V;  3CRR A;  1H8E G;  1AP6 A;  1H2K A;  4UV8 A;  5J2U A;  1RFY A;  3K0G A;  3JAW B;  3J80 N;  1LNQ A;  3CXH F;  5LHI A;  4JV5 B;  3E8B A;  3ETQ A;  1TVK B;  3JAS B;  4LFC B;  1GRJ A;  2HLD G;  3TCU A;  1N8R W;  1EN6 A;  1Q90 D;  1Z2G A;  3PN1 A;  4FFB B;  4JYY A;  2QM8 A;  4ICG A;  4CH4 A;  4LC1 A;  1XHX A;  2Y4U A;  1F4N A;  1BL8 A;  4DV0 O;  4DV4 B;  1IXB A;  1CEZ A;  4LFB B;  1I08 A;  5DM6 V;  5H9C A;  3K5M A;  4O4H B;  3APO A;  2ZIO A;  5KUK A;  4U3F H;  1NVP B;  5LA6 A;  3FD9 A;  4FIP C;  5GON A;  2P4V A;  4NTW A;  3K5O A;  1V9P A;  2ZM6 B;  1SQB H;  2P7T C;  3JAR B;  2A3Q A;  5J2T B;  1AI7 A;  2UUA B;  1XNQ O;  4FLU A;  3JAS A;  1OCO C;  4J9Y B;  3UT5 A;  1N0J A;  1DLB A;  4PI2 A;  4FFB A;  4TV9 A;  5FPR A;  1SQV H;  1PM9 A;  5FPO A;  4ZOL B;  2LJ2 A;  5LXT B;  4XDL A;  1GKF A;  4WFH A;  5LMN B;  1YIJ V;  2QE7 G;  3L75 H;  4ZHQ B;  3CD6 V;  1GM7 A;  3ZN1 A;  3TJT A;  5DEC A;  4B3S O;  5EC1 C;  3FX7 A;  1V54 C;  4JI8 B;  4DR2 B;  4CH5 A;  2BTQ B;  3QO5 A;  1I0H A;  1IVS A;  3I5D A;  3ZS8 C;  3G6E V;  1OCO B;  4LCU C;  3H1L H;  1WNS A;  4DV4 O;  3BHP A;  3CC4 V;  3N27 A;  1K5S A;  3JAR A;  1YTF B;  4TUY B;  1GK9 A;  5JH7 A;  3ABU A;  3OGI B;  2W0X A;  1YJN V;  3JSL A;  3JCZ A;  2HVK C;  2YID A;  3CMA V;  3F5W C;  2Q9L A;  4O4I B;  1SKV A;  1US6 A;  1V54 B;  1AI6 A;  4DO2 A;  3U11 A;  2AZ2 A;  4ZOL A;  4A5U B;  5KHI A;  5LXT A;  4J80 A;  2W6J G;  3K9S A;  2ZNI A;  2VQE O;  2ZR3 A;  1SQQ H;  2A0L A;  4FLW A;  4ZHQ A;  2UUB O;  4NKG B;  4OGQ B;  4IT5 A;  3WU2 Z;  2R9R B;  1LUW A;  1K3E A;  2BTQ A;  4MW3 A;  1K8A W;  3ZHT A;  4B3T B;  4QE9 A;  2RDC A;  1PNK A;  2QJ1 A;  1L1F A;  3CCR V;  4GX1 A;  2YC0 A;  5KAI Z;  5TIS Z;  3GWK C;  4KHP O;  1WP7 A;  4TUY A;  5KHG A;  2Q5Z A;  3K04 A;  1FPO A;  5EBW C;  3ZMS A;  1YI2 V;  1HNW B;  5L3G A;  2Q0A A;  1NT2 B;  5C8Y B;  3KDR A;  3OD4 A;  4MTO A;  4GYC B;  4O4I A;  4UUJ C;  4DR6 B;  3DTU B;  4DV3 B;  3CRQ A;  3ZIA G;  2IU0 A;  2ODM A;  4YIP A;  5IYC O;  2EIM C;  2QWN B;  3ICX A;  2RMK B;  1QLE C;  4RO2 A;  2BOB C;  2KG7 B;  3ML0 A;  2N05 A;  1MOF A;  4I4T B;  4DV5 B;  3I55 V;  3ASN C;  4UVC A;  4NXN B;  3ZBH A;  3KZI Z;  1GN3 A;  1QBZ A;  1XMQ B;  1JJO A;  1JJ2 U;  4FLV A;  2XAQ A;  4LF7 B;  4MTF A;  4Z2W A;  5C8Y A;  1RPR A;  4MTG A;  2EIM B;  5JJJ B;  3JD0 A;  2PY5 A;  1VQ6 V;  1WJZ A;  1N4C A;  2B9Z A;  1QLE B;  2FL4 A;  4CBC A;  4TV8 B;  2WA3 A;  3BPZ A;  4O4J B;  1EBO A;  2XUM A;  4CS2 A;  3ASN B;  4EB6 B;  2YIA A;  2WWW A;  4R50 A;  1TUB B;  1YTF D;  4DR3 O;  4OPA A;  3JD1 A;  2N04 A;  4I0X B;  5KLV H;  2KG7 A;  4WFE A;  2EX3 A;  5IE9 A;  2OTJ V;  3SPI A;  2DQ0 A;  4I4T A;  4L8J A;  5KHJ A;  3W7U A;  1H8H G;  3H1I H;  2ZD9 A;  1PNM A;  5BR8 O;  2RCV A;  2Z5U A;  2IW5 A;  1YEW A;  1FS0 G;  3T1Y O;  2E3C A;  4PDV A;  4OX9 B;  4MW8 A;  5CBH A;  2Y69 C;  3FYE B;  2PF4 E;  5CBG A;  1SA0 B;  3RYI A;  4GLX A;  3P30 A;  1JOY A;  1AI5 A;  2F23 A;  3IGA C;  1VIB A;  1VMG A;  4O4J A;  4DYL A;  1S76 D;  2YIB A;  4GX0 A;  3F7Y C;  4F6E A;  4EB6 A;  1RP3 B;  3ASO C;  2ZT9 B;  4JI0 B;  1BE3 H;  1TUB A;  4PA9 A;  1NTZ H;  3STL C;  4LR3 A;  4JPR A;  4I0X A;  3FB5 C;  1JQ0 A;  4FZ0 A;  4P9P A;  2Y69 B;  4J7K A;  4PDM A;  3ETD A;  1H5W A;  2UXC O;  1Y66 A;  2GSM B;  1AB3 A;  4JI3 O;  5IY5 C;  1AI4 A;  4H37 A;  4N21 A;  2HP8 A;  1VQ9 V;  3GB7 C;  5KA5 A;  1RSO B;  1WB8 A;  2HHH O;  3M99 B;  3QO8 A;  5LOV B;  1ZAU A;  1FXK C;  2HR3 A;  1JCH A;  2Q4P A;  2ZXW C;  1SA0 A;  5CMU A;  4MVO A;  4YHH B;  3F5T A;  3RVY A;  1FJG B;  1N36 B;  2K1E A;  3CHX A;  1XHZ A;  2JIZ G;  3A0H Z;  3LSS A;  5L3F A;  2JGU A;  4JI1 O;  4IL6 Z;  2CE4 A;  4F4L A;  1K9M W;  4K3A A;  1YF2 A;  3EXA A;  5IY5 B;  4NYK A;  4LF8 O;  1YJ9 V;  3CXC U;  4Q6G A;  4DW1 A;  3CME V;  3RYC B;  1QU7 A;  1BSM A;  2B1G A;  1BQZ A;  1COW G;  1FXK B;  2ZXW B;  4JYB A;  1KB9 F;  4PA6 A;  1NR7 A;  3HPL C;  4RAI A;  3HR0 A;  1RSO A;  1JPX A;  3ZMT A;  3Q4H B;  4JTC B;  2A06 H;  4I7Z B;  1JR9 A;  5LOV A;  2F4V B;  1QHT A;  1P4R A;  2YIB D;  4GKK B;  1IUR A;  3E86 A;  1VQM V;  2DMX A;  4DUZ O;  2OYQ A;  2UU9 O;  1H2G A;  1R1B A;  2ITC C;  3CCQ V;  3K57 A;  2E5L O;  4DV2 O;  4JI4 O;  1F7Y A;  1NTK H;  4O4L B;  1OCC C;  1SET A;  2D2C B;  4AHC A;  1FOU A;  1Z5V A;  3VOU A;  1O9G A;  3RYC A;  3OUS A;  2KQX A;  3OGC C;  1FXK A;  2VWJ A;  2QR4 A;  4X66 B;  2EZO A;  1J5E O;  3LDC A;  1G4Y B;  3QF7 A;  1Y67 A;  5JWP A;  2F1M A;  2WAM A;  3MDS A;  4C7U A;  2Q7G A;  1DF4 A;  4LH7 A;  3Q4H A;  1VQ7 V;  3SYO A;  1JVM A;  4KL1 A;  2EIK C;  4QPJ A;  3WB0 A;  4WFG A;  3L74 H;  1R73 A;  1BCC H;  1IBL B;  1OCC B;  2LFS A;  4QPK A;  1FFX B;  4CC6 A;  4DRX B;  3TK1 A;  2QKC A;  3OMN B;  4PI0 A;  1HR0 B;  4X62 O;  1OCZ C;  4NXM O;  1M1K W;  4RUE A;  1PNL A;  4X65 B;  5BMV A;  1KU9 A;  1HNZ O;  1LR1 A;  2O57 A;  1S5L Z;  1VF6 C;  1Y76 B;  2FML A;  1W0K G;  4JAS A;  4O4L A;  3IC7 A;  3SGI A;  4LF5 B;  1BMF G;  3GVM A;  2WPD G;  1SZX A;  3UO2 A;  3OTF A;  3DC5 A;  3CRM A;  4JI6 B;  2EIK B;  3RYH B;  1YVW A;  2GTA A;  4J11 A;  3SPH A;  4NVP A;  2UXD O;  2PTM A;  3L73 H;  3HKE B;  4KFM A;  4MVM A;  1HW7 A;  1VP7 A;  1VQ5 V;  4B3R B;  2P22 C;  2NN4 A;  3W7S A;  1OCZ B;  1UPG A;  2MW2 B;  3FAV B;  4J42 A;  4UVB A;  3AK3 A;  1XMO O;  3SYA A;  1SRY A;  4DRX A;  1XNR B;  1M4U A;  2LFR A;  5LMU B;  1P84 F;  5L3E A;  4J41 A;  4JZG A;  4JYA O;  1VEW A;  3HKC A;  2ZIM A;  5EIB C;  2ADP A;  2EBO A;  1Q86 W;  5FLX N;  1ORQ C;  1VQN V;  3C3T A;  2JJ2 G;  2PYL A;  1TAE A;  4CC5 A;  3CC2 V;  2OIE A;  4IHJ B;  2QDO A;  1SC5 B;  1VF7 A;  3ABL C;  3SJC C;  2GUZ B;  4DV7 B;  4EKW A;  3B77 A;  4X64 B;  3HKE A;  2FYU H;  2RQ6 A;  3X2Q C;  2RJZ A;  2UXB O;  3NR7 A;  3FAV A;  3KKY A;  4WFF A;  1SES A;  1KBH A;  2XAJ A;  2ZDI C;  1QCE A;  3ABK C;  4LF9 O;  5CN0 A;  4K35 A;  2IH3 C;  4RUF A;  2OTL V;  1AJP A;  1MNG A;  1M56 C;  5IYZ B;  3ABL B;  3P32 A;  2EIJ C;  2JDI G;  2YDE A;  2LGQ A;  4LWS B;  3FB7 C;  4X1K B;  3E8G A;  4O2A B;  3VQW A;  3RGB A;  3X2Q B;  3CEI A;  5H2F Z;  4XDJ A;  3FKS G;  4KXR A;  4O2B B;  3ZRW B;  2Q6A A;  3L71 H;  1XOU A;  4IHJ A;  1QVG U;  1CPY A;  2GUZ A;  3UCS C;  3E22 B;  1G8M A;  2Y0P A;  2E76 B;  5C93 A;  3ABK B;  3TGU H;  3CJH B;  4PEL A;  1M57 C;  4UB6 Z;  1S5J A;  2AGA A;  2XT9 A;  2JRI A;  3M7M X;  4LFA O;  1T5E A;  1M56 B;  2YIC A;  3HB3 B;  3OTO B;  1QNM A;  5JQG B;  3AEI A;  4JI2 B;  3H1H H;  5LP6 C;  1H38 A;  2EIJ B;  1NR1 A;  2F66 C;  1I94 O;  3JAW A;  1DTO A;  1DF5 A;  1HP8 A;  2KKW A;  1TVK A;  2UUC O;  3DXR B;  3SJQ C;  3AK1 A;  1B3Q A;  1YJW V;  5IYZ A;  3RT3 C;  1H2L A;  4LBE C;  4LWS A;  4K0K B;  1IBM B;  1SZT A;  1MAB G;  1TUE B;  1XL6 A;  2B1I A;  4JV5 O;  2XOK G;  3CRC A;  4LFC O;  4DUY B;  1VQK V;  2R9I A;  4O2B A;  3ZRW A;  1H2M A;  4O4H A;  3L70 H;  5LP6 B;  2XAG A;  3E22 A;  2ZIN A;  1R3K C;  4FJC C;  2ZDI A;  2EJR A;  2H94 A;  2AHZ A;  3T1H B;  2AZ0 A;  1HDJ A;  3QO7 A;  4ASU G;  1S72 V;  3OMI B;  1URF A;  1Q5O A;  4LFB O;  1EFR G;  3U10 A;  4W4K A;  5JQG A;  1JNB A;  5J2T A;  3P3P A;  1VQ8 V;  2W6I G;  1U97 A;  4NB5 A;  1AR1 B;  4U7N A;  2G38 A;  5A9G A;  3O65 A;  2DE0 X;  4CH3 A;  2Q0O C;  1FFT B;  5CA3 A;  2WLM A;  2ZM6 O;  4U3J B;  1KKC A;  5CA1 B;  2LW1 A;  4YY3 B;  1ENV A;  2QSA A;  5L3B A;  2ZQM A;  5BXZ A;  1SF9 A;  5JCO C;  4DV6 B;  3WFV A;  1Z5W A;  2UUA O;  2P67 A;  2QEX V;  2YI8 A;  4QJF B;  4MVQ A;  1QLN A;  4JAA A;  5LP6 A;  4HNA B;  3ZJZ A;  4X1I B;  3B40 A;  4IYI A;  3APQ A;  1Q81 W;  2DWE C;  5EIB D;  4I5S A;  3B09 A;  4FM0 A;  4P2Z A;  3O9O A;  5CBF A;  2QM7 A;  5LMN O;  4JGS A;  4BWA A;  2H8P C;  3ZX6 A;  3K5L A;  4JI8 O;  4DR2 O;  5DN6 G;  4LF6 B;  4BAY A;  3LNN A;  3VBB A;  1AJN A;  3STZ C;  4I50 B;  4FZ1 A;  4U3J A;  5CA1 A;  5H5N A;  3SR2 C;  3ETG A;  1NVP D;  3J7A U;  4UCO A;  2JJ1 G;  3W7X A;  1UFI A;  5EZY B;  4E2L A;  1NS1 A;  4RQF A;  1ZSP A;  5JJE B;  1GN6 A;  1SQX H;  1WPB A;  5E1A C;  1P7B A;  4HNA A;  4X1I A;  2WLL B;  4CS3 A;  1GN2 A;  1MSW D;  2GHY A;  3ZRX A;  4FMT A;  1NH2 B;  4DV6 O;  1ZWI C;  4OPH A;  2P6J A;  5LL6 Y;  1JA8 A;  2AXT Z;  5A2Q N;  5D5Q A;  4FM1 A;  2VQF B;  5JCO A;  2M6Y A;  1N0N A;  1KP3 A;  1MA1 A;  5K1P A;  3ZN0 A;  1SQP H;  3SPC A;  4B3T O;  1GMG A;  4FLY A;  3JAL B;  2F93 B;  1ZTE A;  4DR7 B;  4MS2 A;  3B8N A;  2GBO A;  4AQY B;  4PDL A;  1DK1 A;  3CCS V;  1WN7 A;  2ARH A;  2JK5 C;  5EBL C;  4H13 B;  5IWA B;  3CCL V;  3LDD A;  1HNW O;  4BIZ A;  3HKB B;  1S5H C;  5HFL A;  2WLI B;  2WLL A;  1VQP V;  1RPO A;  4QE7 A;  4DR6 O;  4DV3 O;  5IYD O;  4B08 A;  2IM9 A;  2EZP A;  1WAZ A;  1FXV A;  1Y74 B;  4DR4 B;  3OFN G;  3CCE V;  2AW9 A;  3D36 C;  3FB6 C;  1IDS A;  2XND G;  4B3M B;  4B7K A;  3CE2 A;  1I5Y A;  1MZE A;  1OZ0 A;  2OIG A;  4BW9 A;  3QVN A;  3FFQ A;  3UKM A;  4EFB A;  2YI9 A;  4CS4 A;  1KMI Z;  3K58 A;  4IGG A;  2FB5 A;  3RVZ A;  2YEV B;  4DK1 A;  3JAL A;  4DV5 O;  4QNH B;  1WPX A;  1PKX A;  1PL0 A;  2PZS A;  4NXN O;  4FK5 C;  4YIO A;  4TV8 A;  1XMQ O;  1N33 B;  5IDJ A;  3JAK B;  1BHA A;  4LF7 O;  1KUQ A;  3AG1 C;  3L72 H;  3HKB A;  3RN4 A;  4BW5 A;  1GTO A;  2WLI A;  1YSC A;  4Z1M G;  3JD2 A;  4JZ2 A;  3BAA A;  1I5X A;  4IIJ B;  2HEP A;  1Y74 A;  3KCY A;  1AVM A;  2IJH A;  3R66 A;  2YXL A;  1EZV H;  3K0D A;  3LSQ A;  2QWP B;  3K79 A;  1OV9 A;  1PV0 A;  1K4D C;  5LGT A;  3IAY A;  5FNV B;  2E75 B;  1F23 A;  1R3J C;  3AG1 B;  2YEV A;  3JCU Z;  2QKS A;  1B04 A;  3ASO B;  1PP9 H;  1VQO V;  1V55 C;  4ABM A;  5GW7 A;  4PHZ A;  2DYS C;  1P49 A;  5BZB A;  1NH2 D;  3JAK A;  2NNU A;  4OX9 O;  1ARO P;  2CDY A;  3D36 A;  5E79 Z;  3SPG A;  4GKJ B;  5AG2 A;  4BR6 A;  3IJ4 A;  3ETE A;  3VQY A;  2QTO A;  2IU3 A;  4F6R B;  2X0L A;  3SJB C;  5EC2 C;  3CB2 A;  1MG1 A;  2ILM A;  4JAV A;  1V55 B;  4JI0 O;  1Q6H A;  2DYS B;  4LH6 A;  3CX5 F;  3KCX A;  2AHY A;  3RFR A;  1QR8 A;  2A7W A;  3OR6 C;  2JEX A;  4DR5 B;  2BE3 A;  1IBK B;  2UXN A;  1NZ6 A;  3CCU V;  3T1C A;  4X1Y B;  2CTW A;  4H33 A;  5H6R A;  4TWK A;  2Q68 A;  4FPP A;  3ZHV A;  2HKO A;  5KA6 A;  5CB4 B;  1F51 A;  1GAX A;  4YHH O;  3IC9 A;  3ZMV A;  5LBQ A;  4JI7 B;  3K3W A;  2MK3 A;  1FJG O;  1N36 O;  3JYC A;  1XL4 A;  2CH7 B;  4F6R A;  1JFF B;  2IJK A;  1N34 B;  3E8H A;  3N2K B;  4HZ3 A;  4ZI7 B;  1B6Q A;  1YIT V;  3OAA G;  1ZUQ A;  4X9Q A;  2P4K A;  2ZKO A;  2PI4 A;  3H01 A;  4Z1V A;  3BVO A;  4TT3 G;  1E1Q G;  4JTA B;  2LP7 A;  4RQE A;  1L0N H;  2IBZ H;  2XAH A;  4D7T A;  1SS3 A;  4DV1 B;  1HNX B;  4YJ2 B;  4FFK A;  4PA4 A;  2XAS A;  4X1Y A;  4DR1 B;  2F4V O;  3SYQ A;  4GKK O;  5CB4 A;  1PD3 A;  4DR5 O;  4UCT A;  4CZZ A;  2V4D A;  2CH7 A;  2IH1 C;  4LF4 B;  3N2K A;  4ZI7 A;  1AIL A;  2H3O A;  5LYJ B;  1L0L H;  1PL4 A;  1GO3 F;  1W2B U;  1N32 B;  3ZMU A;  4X20 B;  3N2G B;  4R6Z A;  2DYR C;  4YJ3 B;  3OEE G;  3LSU A;  4X66 O;  1WP8 A;  5FL7 G;  1FFX A;  5KX5 B;  5JVD B;  3E35 A;  4YJ2 A;  2CUG A;  1HWY A;  1E79 G;  2B5U A;  5B1N A;  2WLJ A;  1BGY H;  3U0Z A;  4UCV A;  4UCS A;  1Y76 A;  5LGU A;  2RNB A;  2LO1 A;  5J2U B;  2K9P A;  3CCJ V;  2BTO A;  3C3S A;  1IBL O;  4DV0 B;  3L9D A;  3MD0 A;  4QGP A;  2ZE6 A;  3AG3 C;  1BZK A;  2D3O W;  1FAF A;  2Y48 A;  1HR0 O;  2HG5 C;  1P7G A;  2DYR B;  4X65 O;  3RYH A;  1AP5 A;  5LYJ A;  3B8M A;  2X6C A;  3ZHU A;  3CS5 A;  3ZRS A;  2JS5 A;  2P90 A;  2ZE7 A;  4JAU A;  4KUM A;  1D2D A;  4LF5 O;  4UCR A;  2OWO A;  2QWO B;  3JD4 A;  4FVM A;  4UV9 A;  2WLN A;  3N2G A;  2Q7H A;  4ZIB A;  1VAR A;  4YJ3 A;  1VF6 A;  1CP9 A;  2CTQ A;  1QQC A;  4JI6 O;  5LHH A;  2XHB A;  4NTX A;  5B1O A;  5EBM C;  1W0J G;  5KX5 A;  1XNQ B;  1TA8 A;  2VS0 A;  2ZE5 A;  4GZR B;  5GON B;  2ZE8 A;  3AG3 B;  3QTC A;  4B3R O;  2NR5 A;  1A32 A;  5KUM A;  3DSQ A;  1JMK C;  1NKD A;  1R3L C;  2CGN A;  2YS8 A;  3D8C A;  2A9H A;  4J7J A;  3DGE A;  1XNR O;  5LMU O;  2YUA A;  5L3C A;  3A0R A;  1WA8 B;  4I9W A;  3UT5 B;  3CP1 A;  4Q20 A;  4WBN B;  4B3S B;  3F7V C;  2WA4 A;  1Q6U A;  4DW0 A;  4NR1 A;  4TV9 B;  3CC7 V;  3M8A A;  4W4L A;  3OT7 A;  4K8Z A;  4NTY A;  4MVU A;  3K9A A;  3CRA A;  4PV1 B;  2OT5 A;  3BFR A;  2DWD C;  1S0V A;  2N74 A;  4DV7 O;  2KB1 A;  3A2F A;  3MAQ A;  2Y4T A;  4X64 O;  3FYI B;  4GT1 A;  5B1B C;  1XRE A;  5B66 Z;  1X59 A;  3OW2 U;  5LHG A;  1Y6X A;  2L35 A;  4X1K A;  1M57 B;  4O2A A;  4JI5 B;  3ZMZ A;  5JH7 B;  2VQE B;  2DQ3 A;  3TXS A;  1WA8 A;  2DW4 A;  3HKD B;  2UUB B;  5IYB O;  5B3S C;  4WBN A;  5KMG B;  2ZR2 A;  4AIL C;  3BAB A;  3QNE A;  3CJH A;  1K97 A;  4DK0 A;  3K59 A;  2BSK B;  3G80 A;  4K8X A;  4FLT A;  1E1R G;  4BIU A;  5B1B B;  1IZ3 A;  3ABM C;  3RYF B;  1D5N A;  4KHP B;  1XUQ A;  3OM3 B;  2A79 B;  2HJF C;  5DED A;  2X7R B;  1M5I A;  2Q7E A;  5L3D A;  4XDK A;  1K73 W;  4XBF A;  3DXR A;  3SDL A;  1XDC A;  3G4S V;  2PI5 A;  1S77 D;  4I55 B;  5B3S B;  3ZCC A;  5IJ0 B;  3OTO O;  2HFE C;  4JI2 O;  1NBM G;  1BHB A;  2DJV A;  2ZNJ A;  2RN9 A;  3K08 A;  3OR7 C;  2QWR B;  3K03 A;  4X88 A;  3ABM B;  3S3W A;  2IJI A;  3HKD A;  1IX9 A;  3E89 A;  5KMG A;  4JYC A;  3E8F A;  4B7E A;  3B4S A;  5EK0 A;  1G1X B;  3BRC A;  1MMM A;  5K1X A;  3ZRV A;  2BSK A;  4K0K O;  4G27 B;  1IBM O;  4GCZ A;  4JI5 O;  2Y0I A;  3P3N A;  1XQ8 A;  1OCR C;  3RYF A;  1XI1 A;  3VQV A;  4DUY O;  5EYP B;  2Q8V A;  2DN9 A;  3D3I A;  4TQD A;  1ZLZ A;  2F95 B;  2XAF A;  2JVD A;  3T1H O;  2XTA A;  2CAZ C;  3T2M A;  1KC8 W;  1LUV A;  3CWB H;  3PJS K;  4J9Z B;  4I55 A;  1Q8I A;  2PYJ A;  1WLE A;  2CTP A;  3G67 A;  2JS3 A;  3SPJ A;  5IJ0 A;  2BCC H;  3BY6 A;  5ITZ B;  4DXW A;  1GM9 A;  1Q82 W;  1EZJ A;  3BEH A;  4PA7 A;  2QTS A;  3NXS A;  4CH6 A;  2WLK A;  3CCV V;  1F4M A;  1OCR B;  4BIO A;  4G2K A;  4AI8 A;  4DR3 B;  4RWU A;  4YY3 O;  2GDS A;  3E83 A;  1TGO A;  2QKA A;  3G71 V;  4FM2 A;  5HFM A;  1D5A A;  5IT9 N;  4GX2 A;  4ZBM A;  1NQT A;  5EYP A;  5BR8 B;  3DC6 A;  3JSN A;  1NU1 H;  2WSS G;  1FXH A;  3T1Y B;  4H0L B;  3T4Z A;  1K92 A;  3J81 N;  3UM7 A;  3UO3 A;  4I50 A;  3A0B Z;  1I7F A;  1SER A;  1FKA O;  4JTD B;  5ITZ A;  1AR4 A;  2YSU B;  4R8C A;  3W7W A;  1AR5 A;  5EZY A;  1GM8 A;  4LF6 O;  2FTK A;  2F43 G;  1R6T A;  4H44 B;  5GTH Z;  3AG7 A;  3RYI B;  4MT8 A;  1R6K A;  1YCI A;  2C2A A;  3CYO A;  3JD3 A;  1S3J A;  2UXC B;  1J95 A;  5H6Q A;  5IJ9 B;  1SQF A;  1G6U A;  2CGO A;  1XIL A;  4JI3 B;  4R7C A;  2OCC C;  3ZED A;  1QVF U;  2HHH B;  2KSD A;  2HVJ C;  3RW0 A;  2BOC C;  4OXS A;  2LQT A;  2NLJ C;  2UXX A;  4FLX A;  1OJH A;  3CPW U;  4HYO A;  4MSW C;  3JAT B;  4D6T H;  3G6B A;  4X8A A;  4FLZ A;  1K7D A;  3SJA C;  4KP4 A;  2VQF O;  4JI1 B;  5CA0 B;  2Z3Y A;  1YXB A;  3S3X A;  1M93 A;  2FKX A;  2VWK A;  2YXH A;  4TOI A;  1VF5 B;  1K34 A;  2R70 A;  4PA3 A;  4G28 B;  3TET A;  1ZX3 A;  3CCM V;  3VQX A;  1O9H A;  2OCC B;  4LF8 B;  2GV9 A;  4DR7 O;  2WLH A;  1MSD A;  4AQY O;  4GX5 A;  3WG7 C;  4GUN A;  4TSF G;  5IJ9 A;  4UCU A;  4UFZ A;  1X4T A;  3ZHS A;  5IWA O;  2X6A A;  2ITD C;  2LGW A;  3B2E E;  3WB1 A;  3ABT A;  1ZL8 B;  2CK3 G;  2W0F C;  4X89 A;  4L87 A;  2LW7 A;  4EFE A;  3RBZ A;  2E74 B;  1FD9 A;  3JAM N;  3LDE A;  3E2E A;  4N23 A;  4DR4 O;  2R9A A;  2R72 A;  3JAT A;  5B5E Z;  3BCC H;  4DUZ B;  1BQ0 A;  1YDX A;  3AK2 A;  1EM1 A;  4B3M O;  2UU9 B;  1L8D A;  1CXZ B;  1Q3E A;  5CA0 A;  3WG7 B;  1QR9 A;  4LP8 A;  2EUL A;  2E5L B;  4DV2 B;  3LUT B;  4JI4 B;  2L6L A;  1EN4 A;  5B1A C;  3THO A;  1XEQ A;  3AG2 C;  1B06 A;  2VRZ A;  1DGS A;  3MHS C;  2ETN A;  3OE7 G;  4IIJ A;  1XBL A;  3KG2 A;  4P9O A;  1N33 O;  1AJQ A;  3K5N A;  1M90 W;  3BA9 A; 
#chains in the Genus database with same CATH homology
 1ZSP A;  1BT8 A;  1WB7 A;  1ZLZ A;  1GN6 A;  1Y67 A;  1WB8 A;  1EN6 A;  3MDS A;  1XRE A;  3RN4 A;  4C7U A;  4JYY A;  1GN2 A;  1LUV A;  3EVK A;  3IC9 A;  4JZ2 A;  3KKY A;  3C3S A;  1EN5 A;  1IXB A;  3K9S A;  1AVM A;  1JA8 A;  1I08 A;  2QKC A;  2CE4 A;  1P7G A;  5A9G A;  1ZUQ A;  4X9Q A;  1N0N A;  1LUW A;  1AP5 A;  2P4K A;  1GN4 A;  1MNG A;  1MA1 A;  2GDS A;  1KKC A;  1SZX A;  1ZTE A;  2QKA A;  1BSM A;  1MSD A;  1VAR A;  4GUN A;  3CEI A;  1D5N A;  1XUQ A;  3DC5 A;  2RCV A;  3DC6 A;  4FFK A;  4E4E A;  1N0J A;  2CDY A;  3KDR A;  1XDC A;  1JR9 A;  5AG2 A;  1PM9 A;  4BR6 A;  2ADQ B;  3AK3 A;  1QNM A;  4YIP A;  1AR4 A;  2AW9 A;  3AK2 A;  1EM1 A;  1IDS A;  3TJT A;  1AR5 A;  1IX9 A;  4F6E A;  4JZG A;  1PL4 A;  3QVN A;  3AK1 A;  3OT7 A;  1I0H A;  1BS3 A;  1VEW A;  1EN4 A;  1MMM A;  1AP6 A;  2ADP A;  1B06 A;  3C3T A;  3LSU A;  4YIO A;  1XIL A;  1GN3 A;  3BFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...