3C3WA

Crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the response regulator DosR from Mycobacterium tuberculosis suggest a helix rearrangement mechanism for phosphorylation activation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN DEVR
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c3wA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3wA01
3CZCA 1EV7A 1FX7A 2Q5CA 1TNSA 2ADUA 4ETNA 4OBBA 4UV9A 4RGRA 5IUNC 1T38A 3LKVA 3O75A 1KQ9A 4Y15A 3UUGA 1TVMA 4JBAA 1F51E 2P5VA 1I1SA 3GFLA 3A10A 3ZP5A 3KYJB 3NNSA 2CYYA 3OLXA 4YR7A 3FZVA 4NV3A 1B00A 2ID7A 3C3MA 1HW1A 3KZYA 4NB5A 1XGSA 5AONA 1HBXG 2ESHA 1U8TA 4IILA 2W84A 4RK6A 5KC8A 2G9WA 1JHHA 5HLHA 4RKQA 3QRFF 3MWMA 2FRHA 3IP7A 3CRNA 3D02A 5TQ2B 1USGA 5IUKC 3QX9A 3FXUA 2JPBA 3KEOA 1HW5A 3HSEA 1QZZA 5K1YA 1Z25A 4HAMA 5DTEA 1Y0UA 3GYBA 1Z6TA 2V1XA 4MQ9F 5HM6A 1BOAA 4HNRA 1P92A 2Q0OA 2L54A 1R5HA 2RV8A 1G3SA 2TMYA 1XSVA 2HZTA 1UB9A 2CFXA 2K4BA 3H5TA 3I58A 4R8HA 2MYNA 3QEMB 1NXOA 4RY9A 2PLNA 2ZMEA 3RVJA 1S7OA 1RXEA 5ABPA 4LD5A 1EH7A 1YMVA 1JFSA 1ZG3A 4LLNA 3MYYA 5DCMB 2M1ZA 1U2PA 2QU7A 3WU1B 4HQEA 3Q7RA 1KYZA 1BIBA 2EFOA 4LB5A 4NHJA 4D74A 1FQWA 4EVQA 6ABPA 2XAFA 2A68F 5FBKA 3MFKA 1RPJA 5HVQC 3F8BA 1U3EM 4MLDA 3GF2A 5JNRA 4FE4A 1RXIA 3L00A 3QOPA 1ZRCA 5JNUA 4UUVA 1D5WA 4BNCA 2MYUA 1YTUA 4IRGA 4MS3A 1NXSA 2KIFA 4OIOF 3QAHA 2LKPA 2VBYA 3GO5A 4L4UA 4MR8A 4YIIA 2GZWA 2F2EA 1JFTA 3LKBA 2XVCA 5LGUA 3HVRA 3JSPA 4JP1A 2YX4A 5IT9K 3GLXA 1IRFA 1Z05A 2LSOA 2R7FA 5FWYB 1Z17A 3BJ6A 2IOYA 4RZSA 1LBIA 2CWEA 1B59A 4ZYDA 3SQNA 3ECHA 3QELB 2VODA 3H3UA 2MH2A 5CNKA 1KU3A 3EDCA 1O3QA 3LAPA 3WE2A 3FFWA 1ZH2A 3H1GA 2HSGA 3TO9A 1U5TB 4OATA 4RK5A 2FU4A 4U7DA 2XIGA 1E2BA 3T8TA 5DLEA 5L3FA 3NRVA 1J9IA 1ZAOA 1SXHA 3E97A 3KG2A 1NATA 1IIBA 3GV0A 4N9HA 5FD5A 3U2RA 5BQTA 2HOEA 3KP3A 2ELHA 4LGWA 4WUTA 2QVGA 2E4UA 5CNJA 1V4RA 5K5RA 3LUDA 3T6KA 1TNTA 2LF7A 1I1GA 2HYGD 5L3DA 1U5TC 1FBSA 4KDPA 3ZN0A 5HLGA 3HS3A 3LMKA 9ABPA 3FDFA 1WWXA 1R7JA 4F7ZA 2IA0A 2OA4A 2Z5UA 1ZLKA 2FLWA 3MZHA 3MM4A 4UV8A 3RVMA 1BI3A 4LK0F 1HKSA 4HLYA 1ODDA 4ZYHA 5T7BA 5F64A 2ZAYA 1G3YA 4UVCA 5EWLB 1ZGZA 1QP7A 4M6XA 3H5VA 3BPXA 4FT8A 1B9MA 2YU3A 4LK1F 1PUEE 3BDDA 1TJYA 2FEWB 3G85A 1A2OA 4CICA 5TPZA 3SZTA 3CTAA 5PNTA 4Z4IA 3RYPA 2OENG 2HQNA 3HIFA 3KP5A 3EETA 2GIVA 4UNOA 1B1BA 5HKOA 3HOTA 2NAZA 3KFWX 3N4MA 3RVQA 2IVMA 2XKPA 1QKKA 3NQOA 5IULC 5FGMA 1L5ZA 1CEYA 5CVVA 1GUDA 5KQMA 5D6EA 3CUQA 4ESBA 1ZN2A 3R0AA 1JHZA 1PNRA 2XAQA 4H3HB 1STZA 1JDPA 3OO1A 1VKRA 1RIOH 3GX4X 3HV2A 4OINF 5EWJB 5EEGA 4XASA 3H5LA 3IWZA 1YK1A 5BRAA 3ZMSA 5BMZA 2J5OA 2OQRA 3BY6A 4I02A 3C3KA 3HDVA 1FFGA 4RAYA 1K79A 3M1EA 2PE5A 5BPDA 4NQWA 1GUBA 3C97A 1CF7A 2MSWA 4HX8A 1JHFA 3CDHA 3D8UA 2AYZA 3EGCA 2BEOA 4EJVA 5FB2A 4WWHA 2K02A 4M9XA 2FMYA 4HLXA 5DV5A 4G0ZA 1O3RA 5ED4A 3LUJA 5D8LB 1ZLJA 1GCGA 2STWA 1XSDA 4LE2A 5J8CA 4M9SA 4RWEA 3MAJA 3IHUA 3OM0A 2N9UA 2ESNA 4NCAA 1EH8A 3RKYA 2EWNA 4IJAA 4HF0A 4AWXB 3A0UA 2UXNA 4MEXF 3GFIA 3C7JA 4HA8A 3BJOA 3BZ6A 1ZAYA 3FMSA 1K68A 1G3TA 1B9NA 1IN6A 4KFCA 1SD4A 3JVDA 3VEPA 3CHYA 2OQGA 3IPAA 1D4ZA 4L5IA 1U5TA 2VUIB 2BYVE 2DTRA 2A07F 2XKOA 2FMIA 3QP5A 5L3EA 2XAJA 2K27A 4EV0A 3IP6A 2IPAB 4M74A 2FQ3A 2QBYB 1FFSA 1E17A 2CD7A 4XLPF 4HV5A 4PICA 3QELA 2H0AA 1XDUA 5FLXK 4RV5A 4NCBA 2R48A 1FSEA 4G0XA 4QYMA 1NHAA 5AIQA 1LBHA 1JX6A 1AWCA 3HTSB 3GRCA 1E6KA 2J5PA 5F1RA 4Q47A 4ZZDA 1DC7A 4A0XA 2A69F 3HXMA 4G9YA 3ERED 4LJZF 5A2QK 2P9HA 2YSRA 2P4WA 3GYHX 1BI0A 5LHGA 2L3DA 1I3CA 5ILUA 3SFZA 1IRGA 3H6HA 2JTVA 2PBIA 1Z2EA 3L6UA 1RNLA 1Z91A 2F5CA 2CHEA 1PP8F 2A9PA 1BAPA 1R8JA 2PL1A 2PMUA 3HCWA 1P2FA 5DUIA 3CG0A 2WJAA 3ROUA 1L5YA 3I54A 2RDMA 1JLKA 1GXQA 3O2JA 1USIA 5EWJA 4OOIA 3M8EA 4YIFA 4IPAA 4G0PA 1O3SA 1IXCA 1M5TA 4IMIB 3D5LA 4LDZA 2QZ8A 3T95A 1ONVA 3LUKA 2XAGA 1P4AA 2ZKZA 1NXTA 2MC3A 4KQ9A 2PUCA 1RI7A 4RB0A 4FHTA 3F21A 2QQAA 3FF5A 4P9UA 1XGOA 2NRAC 4FE7A 3JPYA 3K1PA 1G4DA 3F22A 5D5WB 3KEQA 2P7CB 3O1IC 4XFKA 2Q8KA 4EYQA 3P9IA 4M72A 4ESJA 2FSWA 4Y17A 2HJ9A 1A04A 5E1ZB 1YMUA 1EWTA 3J80K 4H60A 2JT1A 2P8TA 4BHBA 5HS7A 1TQIA 1SXGA 1BDIA 1NXVA 2PUFA 4MR7A 5HS8A 3IKTA 4N76A 5TQ2A 3I64A 4L5JA 4LRQA 1TW3A 5TPZD 3VODA 3BWGA 1P4WA 2EV6A 4KVFA 1KQ0A 3KE2A 5KI6A 3Q5FA 2KIMA 3OLWA 1PP7U 1FBQA 2IPNA 2Q2EA 2FW0A 3P7NA 2V79A 4LLGF 4WXEA 2E4ZA 2PQ8A 4HX4A 2C6YA 2HQRA 4OLAA 4KN7X 5CVUA 5HS9A 5KK1A 4RU1A 1H9CA 3BREA 3L7WA 1YK0A 1KU2A 2DPDA 4KMUX 3BBLA 3DLBA 3IC7A 5JR3A 2L01A 4LMYA 2E7XA 2L17A 1JDNA 2GBPA 5JI6A 2PUBA 5HQJA 3HK2A 4LX8A 1ZYRF 2ZNYA 4LFUA 4K2EA 2VXZA 2FMFA 1XHFA 3QLTA 4MS1A 3KHTA 1GLGA 3H75A 3ZMVA 2JB9A 3V7SA 1XN7A 4MS4B 3E61A 2KKOA 2X4HA 3E5UA 2JRLA 2IRFG 5JNVA 1VPWA 3ZPLA 4G97A 1R1UA 4YFNF 2FXIA 2UWMA 4WCGA 3EYYA 2PAFA 2VUHB 2EFWA 2WJWA 1Z13A 5DCLA 1MB3A 4PZJA 2ZO4A 2RQPA 1D8KA 4MR8B 2FBHA 4HNQA 3MF4A 4KT5C 4MS3B 4TLMB 3WG9A 3VFZA 2JRTA 2KJCA 3ILHA 2QLZA 1F4VA 1XCBA 2PL9A 5FWXB 2DQLA 4W5OA 5L3GA 3I59A 3WTVC 1MB0A 3KCCA 2XUBA 1HSJA 5LEKA 1LJ9A 3ML6A 2QVCA 3NEUA 3KLOA 4ZYGA 1ZGAA 3E5QA 2P6SA 5HOOA 4RAZA 5TJJA 3TO7A 4EVIA 2Z9OA 3ABUA 1WKMA 2JK1A 5L3BA 1OMIA 3CO6C 4IHTA 4Z4GA 2EV0A 4ZH4F 2NNNA 4OLBA 4Z4EA 3FM3A 3BP8A 1UCRA 3LQQA 2J48A 4OIPF 1ISRA 4O3MA 1FPQA 5E1WA 4L0ZB 4EJTA 4G7HF 2K4JA 4RGSA 4QLCU 4HZFA 3EULA 3QK7A 2VBZA 3T38A 5DDGA 1DPUA 1CGPA 1K7AA 3I5AA 4NQRA 4YGXB 4JK1X 2GQQA 4UVAA 4U0WA 4L18B 2A5YB 2IPQX 1TBXA 3MQ0A 3DXJF 5CVJA 1ABEA 3DKWA 2D1VA 2EFPA 1YLFA 3J7AO 4QICA 5E8GA 2QENA 3I59B 1U04A 3O21A 4M73A 3RDIA 5FWXA 3CJNA 1M5UA 3EJWA 1MJBA 4XSXF 3AAFA 2HFHA 3QPHA 4RY0A 1FP2A 5E3JA 1Z1DA 3CZ5A 4GGGA 4RGUA 1FSPA 2ZWMA 2PMHA 2F8SA 2STTA 2FEZA 4EUKA 1NXXA 3RJPA 4MQEB 3EQ2A 2Y0MA 3NNDA 3MEXA 3B02A 3SXYA 4EYKA 4I98B 3N53A 2ZXJA 1WETA 1D3YA 2UXXA 4R1HA 1DRJA 3TB6A 3T8RA 4DN6A 1ZREA 4U0VA 3RTRA 2FNPA 1PEAA 2XROA 4Q5SF 3CUQC 2O3FA 1D1QA 1U6GA 1S29A 2IPMA 3EYIA 5LHHA 1YFHA 5TRDA 1CYEA 3VNAA 1FYLA 2X7XA 2W85A 1IXSB 3EUHA 3K2ZA 3UK0A 1K78A 3EODA 3IPCA 2R25B 4RSMA 1H9GA 1YG2A 4EJUA 1QNLA 3HRMA 1BBYA 1SFXA 2CG4A 2JZYA 4KICA 1OKRA 4G0QA 1XHEA 5KC9A 2DLLA 1SFEA 4I0AA 1MGTA 4KA4A 3FWEA 4E7OA 2DO7A 3GZ6A 5IT9Z 5H6QA 6PAXA 2AYXA 4CO8A 1QQBA 3GT7A 2VC1A 2XDYA 2R3SA 3T0YA 1QO0D 2MLKA 2YHBA 3EAFA 4DADA 4N0QA 4CDGA 4AVPA 4B8XA 2HGCA 1PEYA 2H27A 2F8TA 1CF7B 3RPQA 2HQBA 3ZQ7A 1KYWA 3QU6A 1MIHA 1W4MA 3RPUA 2F5EA 1R36A 3HRUA 1IAWA 4A0ZA 3LTEA 2DT5A 3BRQA 3P9YA 2PUGA 1VRVA 5JNWA 4RXUA 4L9VA 3I0TA 4XAQA 2ETHA 2VK2A 4Q6BA 3WTZA 3V4GA 1XB4A 4BXUA 1BIAA 2COMA 4NICA 1ZDMA 5D5UB 1QQAA 1EWKA 2H6BA 5DEQA 2FQXA 3G73A 4Q48A 2H09A 1DP4A 4PE5B 2PEXA 3W6JB 3SZPA 2M30A 2CW0F 1K6OA 2FNAA 2OZUA 4JASB 5I4CA 2PLYA 1YO5C 4XSZF 1T2KA 2XGXA 3R0JA 1W7PD 2GWRA 2M98A 2EA2A 1EWVA 3D0SA 1PHRA 1TMYA 3N0RA 1RZRA 2ZCWA 3WODF 2FMLA 4UHTA 5FBHA 3WTXC 1XDSA 3WTYC 3Q15C 3IWFA 3LUAA 4JQFA 3QLUA 4YRZA 3H5WA 4U0YA 4EVSA 2L02A 4L85A 1TLFA 1HKQA 1IN8A 1ZESA 4PYRA 3BJAA 3R6SA 3KETA 2Z3YA 1JE8A 5F6FA 3IRRA 5C5EA 3VB2A 3JAMK 2RKHA 2VN2A 2DPUA 4EQQA 1YS6A 2DU9A 4MQFA 2HTSA 3NHMA 1Z7UA 2FQYA 2NYXA 2IPLA 3E5XA 4Q6WA 3M9WA 1P8AA 2CHFA 3HHGA 4E70A 1GCAA 2PMCA 5J8FA 2FE3A 4QWQA 2IP2A 3LQRA 4TV7A 1F5TA 4TLLB 3CTPA 1IW7F 1DCMA 3OO0A 4N03A 1F4KA 3WGGA 1YVUA 1T34A 4MS1B 1O7LA 2JSCA 5FO5A 2Y48A 1GHCA 2W24A 4U7BA 5CNMA 3NNNA 3F3XA 3RVPA 5ILSA 3KP7A 4ETMA 4LE0A 3KTOA 3MMNA 4EYGA 1IUYA 4ON0A 2D45A 1YS7A 4F06A 3K1NA 3RVNA 2O61A 1PDNC 3HHHA 4KPYA 4BYYA 3FMVA 3GW2A 2IJLA 3HSRA 1OXBB 5LRSA 1U2QA 4PGHA 1LDJA 4A6DA 2CGPA 4WF2A 5DGCA 1Z15A 4GYIA 2E1NA 2JCGA 3M7GA 1E2XA 1OYYA 4PDKA 1QGPA 4MAAA 1FP1D 2DQRA 1BC7C 2Z99A 4JB0A 3CNBA 2L4MA 3HRTA 1EAYA 2WB4A 4XBFA 4O5VA 4Z2YA 5DD8A 3SHFA 4IRHA 5ICGA 3DQVC 3ZN1A 2MD5A 1R00A 3I4PA 4YFXF 2JVIA 4ZPJA 1JBEA 4UHKA 3O3KA 1R58A 4WZZA 5E8IA 1O57A 4MTEA 2ISZA 3O1HB 2ZMEB 1HKTA 3LFTA 4Y9TA 4H0EA 2HQOA 3I45A 4XARA 3QLVC 3ISPA 1B4AA 1USKA 2A9OA 3OLYA 1ZGGA 3KZZA 3WGHA 3L2CA 5LLQA 1KRWA 3SNKA 4HBLA 3MZYA 1IN7A 1JYFA 5C5CA 4EMSA 3T5XA 4YFKF 4KRFA 4RXMA 2VBXA 4RB2C 2IT0A 2NS0A 3FM5A 5BOXA 4KK3A 2DK5A 5IUJC 1KQ8A 1APBA 3EQZA 1XSXA 2YX7A 3JTHA 3LA2A 1RZRD 3P9KA 1C0WA 1MJAA 2QVOA 1CHNA 4KYWA 1JF8A 2CO5A 4G8XA 3GFJA 1J0RA 4HX7A 3E3MA 2HDCA 1KU9A 3LSTA 5E1XA 3HYIA 2VOPA 2M1BA 1C4WA 4BAYA 1SXIA 3SAJA 2L19A 3S2WA 3LOPA 2PN6A 1I27A 2JVKA 4Z4CA 2RC4A 3LWFA 1ZRFA 3G1WA 2EFNA 3K0LA 4ESFA 4HYEA 2FQWA 1IN5A 2G7UA 3QU3A 3Q41A 4G7ZF 5TQ0B 2GA1A 1OR7A 1LNWA 2WV0A 5JNSA 4HV6A 4MNUA 3N0XA 3HTUA 5D5XB 5CNIA 5FD6A 5IEBA 2R4QA 4L0YB 3OLVA 4LDAA 4BH9A 3Q9SA 2LF8A 1SAXA 3PQKA 3F23A 2QYOA 4WXDA 1BN5A 1OYIA 1P6RA 5DCFA 2HS5A 3ZMTA 4PEVA 2B0LA 2B4AA 4OIRF 2EB7A 1AB5A 4FB4A 3GFMA 1M2FA 4WXCA 1B6AA 3DEUA 1MKMA 3N75A 3OMXA 1J75A 4P96A 3J80Z 2TDXA 5GOTA 3HEBA 5IX8A 5LEJA 2LBPA 2LIVA 3QPTA 5DYMA 3KYIB 1DDNA 4EGSA 1SD6A 2KJBA 3FFTA 4CBVA 3CO7C 2R47A 2O8XA 5BS6A 4D6YA 4OTZA 2ACJA 4I01A 2AS5F 3R4KA 2DW4A 3P9CA 4N0BA 4ENKA 5KWSA 5FWYA 1ULYA 2EFQA 3IRQA 2FBIA 4O6JA 3L9FA 3R60A 3Q7SA 2QW1A 3K69A 4S05A 3TDUC 1ISSA 1BJAA 2HPHA 2HYFA 1X3UA 4GYGA 3M8FA 1W5SA 3RVKA 3CU5A 5D2CA 4BHPA 5K5OA 2FVYA 3U1DA 3KJXA 3JPWA 3URMA 4P98A 3O1JC 1DJMA 2WRZA 4Z4HA 3HSFA 3LA3A 1MAVA 1QMPA 1BM9A 4LB6B 4QYWA 4LE1A 4D0PA 4PCQA 1JYEA 3Q9VA 1W9HA 1ZHFA 4WXMA 1SD7A 3A0RB 3H1FA 3DBIA 3RYRA 4EM1A 1Z6RA 3IDOA 4WT7A 5DCMA 4UVBA 1UHWA 4W5NA 1UHMA 3OV8A 4ZYLA 4LG0B 4HF1A 4MR9B 1D1PA 1S7AA 3V8JA 3HUGA 3GWZA 4ETSA 2GXBA 2QM3A 2FKAA 4MEYF 5B3JC 1KU7A 5T3YA 3CLKA 2FOKA 2LPMA 4W5QA 2M87A 5E17F 1Y1LA 1FFWA 4YLEA 6CHYA 5CLSA 3QEMA 2GXGA 3DF8A 5IBQA 3LAJA 4RY8A 4F12A 3CFYA 2G7HA 1KMIY 3F72A 4OMYA 2FA5A 3PFIA 2JPCA 5D6FA 3A3KA 3W6KB 4G7OF 1REPC 1EHCA 5CVIA 4A5MA 4I7HA 3IP9A 3I09A 2XRNA 5DD4A 3OQOA 4WXHA 3V7RA 3OQNA 1DBQA 4U88A 1BDHA 5CVRA 1XGNA 4EGYA 5EWLA 1FC3A 4RKRA 3F8CA 1VTNC 4OU0A 4P1ZA 1JXSA 4G0YA 4A5NA 2H3HA 1H0MA 4IRIA 3CUOA 3TOAA 3TDZC 1RZ4A 3WU0A 2F5DA 2NT3A 4GXOA 4ASNA 5IC5A 3GXOA 5KVRA 3WTWC 4H3KB 5A2QZ 3DZDA 1FOKA 4HF2A 5JNTA 2MSLA 2OD5A 4IRXA 4I2OA 2NZUG 5LGTA 2VC0A 5HDGA 1K66A 2A9QA 2WMYA 5L3CA 2BE5F 3H5IA 3H6GA 3IP5A 4KMRA 3BOQA 4MPTA 1QO0A 2VBWA 4M6YA 4CZZA 4ZMRA 2VOOA 4PZ0A 4KUMA 2QQBA 3E6DA 4Z4FA 4LLLA 3VNBA 3I71A 2V9VA 3L09A 4MS4A 3K9TA 2BGGA 2GX6A 4MR9A 1SRRA 1T98A 1IF1A 4N41A 3PQJA 4EM0B 2MYPA 1ZH4A 4EM2A 3LUGA 1D8JA 4CYDA 3DGEC 4WK8F 4YCSA 4A12A 4KREA 1IZ1A 4Z99A 1U2WA 5KQGA 4WX9A 1J7KA 1FBUA 3TQNA 4Z9AA 4FX4A 3HUTA 5ICEA 2RGVA 2A3SA 1AOYA 4UXNA 1LQ1A 1DC8A 3RVLA 4QPJC 3H92A 4MQEA 2LUOA 3L49A 5HSGA 4F3TA 1ZG5A 5LBQA 4Y13A 3B73A 4HNSA 3S99A 4G0OA 4LZLA 1QZYA 2AXLA 2VYCA 2PJUA 2BGCA 5KQLA 4GCVA 4MRMB 1FT9A 1W7PA 1BI2A 3J81K 2H6CA 3KLNA 1DP7P 2E1CA 3K1MA 2QXYA 2ZNZA 2PI0A 2FEKA 2LNBA 3ECOA 3TGNA 2WC2A 3B2NA 4MR7B 1R1TA 1HQCA 2QV0A 2ZJ2A 1J59A 1LB2A 2ZBKA 5BRJA 2RJNA 3MIZA 8ABPA 3N6VA 2MH9A 5D8KB 5FFZA 1P6QA 4Z0NA 4JOQA 4KMFA 1W5TA 1ZY2A 4ZYEA 1YIOA 1KRXA 4P9FA 3IL2A 2I6FA 2A9RA 5LRRA 4GO1A 2QQ9A 2M5WA 5EWMB 3F8NA 3NHZA 3JVIA 1O3TA 1HSTA 2W57A 1E6MA 5BQ3A 1QNTA 4MQVA 1MD0A 4AIJA 3RKWA 1HXDA 4RK0A 3E6BA 3V8KA 5TQ0A 4KK4A 4G94A 3FMQA 1GXPA 3DV8A 4G6DA 1QQIA 2PUAA 3WTUC 1WI9A 1YW7A 3CLOA 1Z12A 1R5GA 2DI3A 2DFIA 1BI1A 3Q7TA 2XHKA 2V0NA 3GZ5A 3O2PE 1J5YA 2M45A 2V1UA 1DG9A 1V3FA 3BRSA 1F1ZA 2V1DA 1ZITA 1MZBA 3OM1A 3J81Z 2FN8A 2FMHA 3GA5A 3QEKA 1URPA 1NY5A 4BHCA 3BILA 2FMKA 4O5AA 3HRSA 4ENJA 1USTA 4TMYA 3QLVA 1DRKA 1EFAA 1C0EA 1Z16A 4L9JA 3F8FA 2A6EF 2LP4Y 2W42A 1P6UA 2HWVA 3V7CA 1WSUA 3M9XA 4E7PA 1XMKA 4BQAA 3F8MA 3W9SA 2RN7A 4A0YA 3GBVA 4A2UA 3RVOA 2Y75A 3LUHA 3GVAA 2L2QA 2CSOA 4KIGA 1YTYA 5JS2A 5CHYA 3FHZA 2OZ6A 3ULQB 4WWCA 1JH9A 3ABTA 3KP2A 4MLCA 3ROFA 1O7FA 1S8NA 3JAMZ 2ISYA 1LEAA 3H5OA 5HLIA 4TN5A 2WWYA 3COAC 2KRFA 4Q4ZF 1S6LA 2O20A 1JWLA 4ZMSA 1KA8A 1YYVA 3FX3A 2MBFA 1JGSA 2VT3A 4CGZA 1TW2A 2KIUA 1U78A 2E7WA 2HKOA 3R61A 5H20A 3GUDA 2O6GE 4RGXA 3JTEA 3CKMA 2FN9A 3TD9A 2EK5A 2DRIA 2IW5A 4CHUA 3HM9A 2W25A 2IDMA 5LHIA 1WQ2A 1XCVA 1SMTA 2GAUA 4RB3C 3RQIA 3C3WA 4W5RA 4N47A 2K7LA 3TOBA 3QP6A 4XRFA 4OMZA 1VLZA 5GQSA 2L18A 4YWHA 1LDDA 1MJ9A 2MLGA 5TE9A 4EJOA 3FXRA 1ZRDA 4EYOA 4N0PA 1QPZA 2OBPA 4EGZA 4MGEA 5CJ9A 2EV5A 5TPWB 2EA4A 3VOEA 3I5UA 4PGGA 2P6TA 3RH0A 1S3JA 1OPCA 1G6NA 4HDVA 3M6MD 3N0WA 1J2XA 2DBBA 3IKVA 2CQKA 3C6QA 4RS8A 4MYRA 2PFBA 4HW0A 1RUNA 1IN4A 4EY3A 2JVJA 1BVHA 2WTEA 3I53A 4MTDA 2A61A 1AB6A 2NT4A 3DPTA 3F6VA 5D5VB 4OIQF 2E4YA 4L9TA 3O74A 2R7DA 1A0OA 1GVJA 1JFVA 1ZG1A 3EQLF 3EDPA 1NXPA 3F7NA 2L4AA 3CG4A 3E6CC 2HEOA 4RK4A 1XMAA 3ILYA 3H3ZA 3KP4A 1FYKA 3N97A 3JSOA 3ROTA 2UZKA 3TX6A 2FSPA 3M9AA 1ZHHA 3ZMZA 3MA0A 2RDPA 2EJRA 3OMWA 5IT3A 1SMYF 2MA3A 3F6CA 2P7VB 4N9IA 2E4WA 2X0LA 1YW9A 3FXQA 1UDRA 3WTTC 1M2EA 5CYVA 2LDUA 1TLHB 2PUEA 3FMRA 5FLXZ 4IMJB 1QPMA 4ETIA 1NTRA 3LUCA 3GEZA 5J6XA 1RUOA 3JS5A 1PUXA 1UFMA 3I42A 5ERIA 3BROA 3T1BA 1SD5A 1FY7A 2JBAA 3HOSA 5TQJA 4HOBA 3OLZA 3QX8A 3MCZA 4YV7A 3N8IA 1FYMA 2DK8A 3F6OA 3CS3A 4RXTA 2YHAA 1DBWA 2ID9A 3E6MA 5JVTA 1YQAA 3DFGA 2NUBA 4O1IA 3E3VA 3HUUA 2QBYA 4M88A 4ZZLA 3TO6A 3TMYA 3O6BB 4RK7A 3LFKA 1DPRA 1EH6A 1LJUA 1XGMA 1SFUA 4KZKA 5HDKA 4AIHA 2P5KA 2QWWA 3GWGA 1Z18A 3RIRA 4O1HA 4MGRA 3WGIA 2QSJA 4I0BA 5TPWA 3SG0A 3KCNA 4JB2A 3TO5A 2OU2A 4MHGA 1D2AA 2XV4S 1LVAA 4ZJPA 2VE9A 2YPRA 5AIPA 4XLNF 1USSA 2FBKA 2FLKA 2E4VA 3LUFA 3SY8A 1W7PB 3HDGA 5H6RA 3GBPA 4G86A 2XASA 2XAHA 1ZARA 4RS3A 1D5VA 1LJLA 3C18A 1DUXC 2H94A 2V6CA 1XD7A 1WRJA 2D2WA 4DNCA 4KQCA 1DZ3A 4Q7EA 4F8JA 4JA2A 3FFXA 4I09A 3OQMA 3JTGA 4W5TA 3KSMA 4IHSA 1U0SY 4IXAA 3ELKA 4KNYA 2Z33A 1I6XA 1QP4A 5EEHA 4ENMA 4R79A 3QLUC 2PJPA 1DBPA 1KGSA 4IGAA 3RKXA 1H9TA 3NBMA 2QZJA 3RVRA 4GNRA 5KQPA 2P4UA 2K86A 4M9ZA 4F11A 1FLIA 4CXFA 4YS6A 3UKJA 4L9NA 3CUQB 2FF4A 2E4XA 3KP6A 4EJWA 4M71A 3KS9A 4HDUA 3JY6A 5DUKA 1W25A 1ZGJA 3C1DA 5LGNA 1ZH5A 5JHUA 2QR3A 5D4SA 3H1EA 2JBAB 1Z9CA 2HKXA 2RVCA 2ZFWA 1BA2A 2BBYA 2IA2A 4MQFB 3DPLC 4YO7A 1FSHA 2KYRA 4B09A 4IVNA 2BV6A 1TTYA 2DAOA 1TQPA 2WY2D 5ICFA 2MYTA 3O2SB 3GL9A 1QBJA 3DGFC 4KIBA 4FX0A 5FFXA 4ENNA 1LDKB 3WE3A 3F6PA 2B1JA 4HQMA 4RB1A 3HJFA 1T0FA 4S04A 2PKXA 2IA1A 1F9NA 5JFRA 1QP0A 3RVSA 5ICCA 2YR2A 5BPIA 4EVRA 1FNNA 1L0OC 5HDNA 2NNYA 3O2QB 2PG4A 5DKFA 3T8YA 5B3JA 2O03A 3HO1A 3SM9A 2FXAA 2VONA 2NZVG 3KKEA 1T39A 2HTJA 5BR1A 3ZMUA 1Z26A 3MQ4A 2IYNA 1R23A 4YP9A 2RGYA 1L3LA 3FGZA 5EWMA 2CWDA 2HR3A 1G3WA 7ABPA 4ML3A 2FTKE 2QUFA 1NXWA 1U8RA 2WWVD 3RI4A 1Z2DA 5K5QA 4G0MA 2RJOA 1R22A 4OG2A 2GI4A 2OAZA 1DCFA 1OXKB 4D6XA 4LG0A 4AIKA 5E18F 4KIFA 5JS1A 3BPVA 4P55A 2FEPA 3LA7A 4IF4A 2IKSA 2F5FA 1BDJA 3K9CA 2O0YA 1ON2A 1R1VA 1LEBA 4XLTA 3DLHA 4KN4X 1T6SA 3HZHA 1P4XA 4XXHA 2P5LC 2MSKA 4JAVC 4DQDA 4Z9BA 4MRMA 1IXRC 3F73A 1J56A 1ON1A 2D1HA 1TQMA 1OYWA 3U9GA 1FZPB 1MVOA 2PUDA 5ILVA 1FWZA 3WTSC 1HW2A 2RNJA 2GA2A 5D4RA 1MDMA 3DP7A 1MDMB 1DCKA 2A6HF 4DQ2A 1PNTA 1ZVVA 3V8LA 3HSYA 1YW8A 1JL3A 1ABFA 4UHJA 4AD9A 3TKYA 1E6LA 3ZMDA 3REOA 1TM2A 1HEYA 1K78B 2M8EA 3OOPA 3K4HA 2VT2A 1XWWA 4KV7A 1LK0A 5E20A 1BC8C 3G3ZA 2GKGA 5IEJA 4YG2F 2VE8A 1Q1HA 4GPAA 4RK1A 4P5OA 4RDCA 3JW4A 4A6EA 4G6QA 1I5ZA
chains in the Genus database with same CATH superfamily
4C4PA 1NJSA 1GRQA 2VP6A 3EZLA 3OBIA 1N1EA 1QGUB 4J0EA 4QUBA 3UTDA 3ZHOA 4CUJA 3HCAA 4IHQA 5K3AA 4PO1A 3GARA 4QA9A 3GJZA 5NLLA 5IUNC 3SFTA 3FTPA 1MQSA 3QXGA 3BH6A 2HM7A 1VPLA 2FSGA 4FI3C 4KXXA 3BMNA 4ADSG 1ABBA 3EHDA 3WLMA 1NXQA 3G0OA 3GPIA 1UMDA 4XK4A 1KBOA 5EY5B 5F78A 3HVRA 3DBRB 1WU8A 1CR6A 2CKDA 3RUIA 1OW3B 1GR0A 1TVMA 3FISA 4FR0A 4UTOA 3E9NA 1F51E 3WGMA 2QVBA 1TM5E 4RFSB 5E7QA 1I1SA 2XAUA 1Q20A 2QRMA 4CMIA 3EY9A 4ZVOA 3VR5H 1YASA 1OCEA 2HT6A 3AVVA 4RTSA 1IBRA 3A10A 3N59A 3ZP5A 1QF6A 1OILA 1NMEA 1PJ2A 5AW9A 3OA2A 2XCUA 4FS8A 3IUMA 3V8QA 3GH3A 3S1RJ 2RGRA 3WSTA 2A9JA 2MIIA 4RD1A 1W4LA 1N6HA 1YB5A 1ZLXA 3BE8A 3LA6A 2Y2ZA 4PYOA 2HSEA 5I8ZA 2DBZA 1BZYA 3VV3A 2XB2A 1HW1A 5EOVA 2IHJA 3K8ZA 4OK5A 1XGSA 4Q4LA 4ZVPA 3KLPX 3TK1A 3ZU4A 4ARVA 1L7OA 3JAKA 4Y98A 3RUHA 2G9WA 1JXMA 1Y6QA 4TXMA 4EW1A 5KC8A 3UATA 5EGOB 3W2FA 5BQFA 4WGGA 5BQOA 2OZLA 2GEDA 2IXGA 2JBWA 1AHPA 2ZXIA 2FRHA 1I1NA 3WDMA 5MGBA 2C5BA 3AY7A 1UPFA 5BNWA 2ZULA 5TQ2B 3A1WA 4NENB 2UXCB 1USGA 4DOMA 2HT1A 2PVCA 4EYSA 4AJIA 1N9ZA 2K5CA 1DRWA 2V7QD 1R0KA 1HW5A 4IVQA 4UVGA 4F4HA 3GIDA 3EVDA 4N01A 4D92A 4K03A 2NZ2A 4HAMA 2FN7A 4UDYX 1YIJI 3U0BA 2BYTA 1XTKA 2O8NA 2QMUA 4GPD1 1V8FA 1EVEA 1G98A 1K6YA 4MQ9F 2YWGA 3DOOA 3E7DA 4BNMA 5HM6A 4XONA 1P92A 2Q0OA 1OPRA 2JLSA 3BF8A 3EIWA 1CX9B 2EGUA 2L54A 2J3HA 3D4PA 3QEJA 4AECA 3DDCA 4R1OA 2RV8A 5F4ZA 5LZ2A 1X3WB 2HZTA 1TDJA 2PCJA 4UBIA 1UB9A 5IZCC 1LNZA 4D9FA 3ZS9A 4JN6B 3QUAA 3H0DA 1SXJD 2FJ1A 4N9WA 2MABA 4NK5A 1ZM3A 4Y2RA 1WQ3A 1QZUA 2K4BA 4OMFG 3I58A 3NHFA 3PWTA 2Z3ZA 2H5EA 1AF4A 4LRXA 1NXOA 1VPEA 2KQRA 2X4IA 4LZPA 1NM5A 4XKJA 4FC7A 1RYYA 2ZMEA 1IPHA 1EE9A 1G3IA 4IKOA 4KR9A 3EWAA 4Q1AA 2DTXA 4XN0A 2A0FA 2HWXA 2PM8A 3A9WA 1QGUA 2NYAA 3R7AA 5JW6A 3OURA 2A0UA 3ESWB 1E5DA 1QIJA 4A03A 1Z5UA 4WPGA 3SMVA 4AKIA 1A95A 3NGXA 1IOWA 3E23A 2ZSBA 2PO7A 1PQYA 3BL6A 3NBXX 1PQPA 1NVFA 1FP4A 2Z30A 3BS4A 3I3SR 2VKHA 1JR3A 3IUYA 4H77A 5DCMB 4OA8A 1NR7A 4FFBA 3PUIA 3UWPA 5HIAA 5CFRA 2O0HA 1RFGE 2JMWA 3HCRA 2C77A 1CVRA 5AM4A 3ZLUA 3C41J 3EH2A 3L8CA 2QU7A 2W2OA 4QSMA 3V2UA 3WU1B 1KYQA 5DRTA 5FKKA 1Y8CA 3EVZA 4DIQA 5FWDA 1BIBA 1G8PA 4C4XA 3VPBA 2LDXA 3DD1A 4YLGA 5IYCJ 1VE3A 3I1FA 1OBVA 1A71A 1DRUA 3THXB 3BR1A 3MFKA 4C2UA 1IHYA 1MTZA 1U3EM 1RPJA 3EGDA 3Q4GA 3OEED 4M0PA 1ZCAA 4MLDA 2Y66A 2HCTA 3RVBA 3SS7X 5I7RA 2OBBA 2TRTA 1L4YA 1ZC4A 4PPYA 2CMFA 3L4KA 3L00A 5A7FA 1LEHA 4IOAF 2DYRH 1AT1A 1PFYA 2V5VA 3AFGA 3EWSA 4BXFA 5JNUA 3N7UA 2AK2A 4UHEA 1YTUA 3FUUA 4COOA 1Q2UA 4PFQA 3L79A 1MDFA 4XWTA 2Z8YM 1W44A 2RCYA 4MS3A 5A4IS 3RC1A 4QQFA 4BMXA 4OIOF 4JKYA 3K6KA 1IDN1 1ZRMA 1W1WA 3IVXA 1QK3A 4L4UA 1HYQA 1GKKA 3TD6A 2QGNA 3KD3A 2NZJA 3JCZA 2F2EA 4TYWA 2RH8A 3LKBA 2HW8A 2XVCA 1EQUA 1KFJB 5EESA 1P9QC 4O4LB 3GUZA 1RWMA 4PO3X 3JSPA 2BFFB 3DOUA 3OPVA 4R3NA 2M0CA 1INLA 2X6RA 1IRFA 1Z05A 2LSOA 2B4YA 3B8EA 4NH4A 1ZUWA 2JH9A 4DSTA 1JAHA 1QH1A 2NXNB 3K09C 4BJ3A 3VZDA 2P2CA 1OAAA 4JZYA 3U7HB 4A10A 2OUMA 1B16A 4MDHA 4NONA 4R1UA 2WSLA 3PITA 1ISIA 3UNXA 5BW6B 3SQNA 2H31A 3LM8A 3VPXA 2P9GA 3WFJA 5H82A 3VO1A 5BSKA 4X45A 1S1MA 4X85A 3QODA 2I2CA 3TEDA 1VBFA 3ONFA 1JJIA 1NQXA 1T4BA 3LH5A 1OPXA 3H3UA 4UUSB 4YRGA 1SHKA 2I78A 4ZQHA 1I7PA 2YIMA 3GLGA 3HOYJ 3LAPA 5IP6A 3WE2A 3KPUA 2HBQA 1EHIA 4I4IA 4KKVA 4YDHB 4AVZA 2AEMA 2X9NA 3QFFA 4HNGA 2P65A 3ROZA 2JSPA 1MEOA 1OH8A 9MHTA 3K32A 3HCOA 4C89A 4JYAB 3WRYC 4U7DA 4LK3A 2XIGA 4YR9A 1YQEA 3T8TA 4MYSA 5DLEA 3RREA 3S0JA 5J9FA 1Z0KA 2KS6A 1J9IA 4KR2A 1I3AA 1H2AS 1SXHA 4F06A 3ICEA 1YJCA 4JV5B 1GPMA 4N9HA 2A59A 4U2FA 1RRVA 1I5EA 4RW0A 1Y8ZA 2HOEA 1GRCA 3KP3A 3BH7A 1NVXQ 2ZBEA 4N0EA 5ALFA 2ELHA 3JD1A 3PJRA 1C3OA 1JQ3A 2HQAA 1SG0A 2Z83A 3USES 4A8JA 4DTCA 5DNCA 2AQEA 4WLEA 5BP7A 2JKZA 1XTBA 3LUDA 1REQB 2XIJA 1QOQB 1G1MA 2AJBA 2FSUA 4P58A 3P4UA 1I1GA 1VHTA 4DZZA 4KJZA 2NUAA 2DBRA 4LXTA 1OAOA 2HYGD 5L3DA 2JJ2A 4FNGA 4R69A 4F4IA 2Z4RA 4G26A 4GMGA 4U7PB 1WXQA 4NBTA 4UD6A 5LC1A 1FBSA 2HOTA 1QAMA 1USUA 2FU5C 2NUPA 3OF2A 4RE6A 1R74A 3ZN0A 1LS1A 4YGXB 3VKUA 5B4TA 1QHHB 3ON5A 1RRGA 4KMMA 2ENUA 2Z9BA 1P81A 3AIKA 2OA4A 4D79A 2JAPA 3H4VA 4TTTS 1N9GA 2C04A 3PUYA 2Q4TA 4J7UA 1G9XA 3MPOA 2K40A 4RA2A 3OZVA 4LY0A 5ECYA 4DCCA 4OKSA 1E3HA 1BI3A 3S28A 2C5AA 2RBGA 2PWZA 4ZAGA 1JALA 1HKSA 1ODDA 2WJHA 1IHPA 4LFCB 2R7RA 2ZAYA 2B8JA 3T54A 4BKMA 1A97A 1YR7A 3E9MA 4DLXA 4LW8A 3A6LA 4PC7A 1TWHJ 2LLKA 1AHHA 1Z6YA 2NO7A 4QAQA 3VDMA 1GPUA 2K87A 3ZY3A 4A0GA 2B9VA 1PZEA 1I4EB 5JY1A 1LWOA 5HCNA 3CW2A 3BDDA 3BXXA 1TJYA 5T4BA 2VDPB 3G85A 4N5IX 3UENA 3K4JA 2AOUA 1MRNA 2QJWA 4PJMA 2IDZA 3AR6A 3R3SA 5AVKA 5TSDA 1O5TA 2WU8A 3I2GA 3QH4A 3BA1A 3GJRA 1YE5A 3A05A 3C74A 4RHUA 1XJQA 3SHOA 3WBFA 3ZE7A 1KTIA 3RYPA 3G1UA 2AFHA 5B58T 3HIFA 3PS9A 4ZI7B 1S9HA 3OICA 2P2ZA 1N75A 4GR4A 2ET6A 1RPTA 2BEVB 4QYIA 3FHJA 2GIVA 3F6YA 1I5RA 4CM4A 1A8PA 2DFFA 4UNOA 2A1UA 5KSZA 5IMSA 5HKOA 5T41A 3N2EA 1RLJA 4NZPA 4FM9A 3LGXA 4OWRB 4B34A 5AM1A 3EUHC 1I7LA 4M1QA 4JR2A 1KZYC 1T6XA 4HQFA 4YRIA 1QKKA 3NQOA 2OMKA 2M2IA 4O3FA 4HSRA 1CQIA 2J4DA 3H2KA 1PR5A 4I6GA 4L2IB 4LHEA 4M8IA 5CVVA 1OCRH 4CKXA 1ZWLA 3DAGA 3CUQA 1H0RA 4AW9A 4ESBA 2HYIC 4I1PA 1L9KA 1PNVA 2WIKA 5ESRA 5JAQA 4KX5A 3PXBA 3QJYA 4B74A 5CEJA 1Z2AA 3UJAA 4Y1GA 2HRZA 1DFGA 3KT8A 4EHNA 1STZA 3GFRA 5F2KA 5MN4A 3OO1A 3H9JA 4MW9A 4Z3KA 3EF3A 1N2JA 1NUUA 1TI7A 4ZDWA 3AILA 4YUXA 3EDMA 5EWJB 4LXXA 5EEGA 4E31A 1V5IA 1E5QA 2QUZA 2VNJA 4XORA 2P0WA 3ZMSA 5BMZA 3BK2A 5CFMA 3IMKA 4UDXX 1F4LA 4I02A 1NVEA 1Q50A 1RMTA 3C3KA 2BP7A 2OOKA 1MMSA 2Y93A 1YDEA 2HIGA 1K79A 1VJ1A 4MRVA 4Z4QA 3ERMA 4CIYA 2HADA 4BRZA 1E8DA 1QPGA 1C9JA 1GUBA 1UK7A 2C92A 4IG9A 1LFDB 2ZVJA 3AL2A 2WSIA 2LKSA 4EF4A 5EXSA 4AO7A 2HLPA 4HX8A 1B2RA 4P4SB 5E0OA 3QVOA 5DNWA 4HGYA 4OMUA 1ZN8A 2ZWIA 1MMNA 2HV9A 3INYA 4WKPA 3NOOA 2PFGA 2CEKA 4WWHA 3CVYA 1PS9A 4P5EA 5AYVA 3KIPA 2K02A 2AXEA 3TDKA 2D0IA 1GAQA 4LQ4A 1O3RA 3TQTA 2F17A 5DGXA 3E1GA 3QIAA 4R1QA 5JQWA 1T2NA 1BEEA 3K20A 3DVSX 4MRNA 3TAXA 2G25A 1OB2A 1SUFA 4RAOA 4KTTE 4N4NB 1A9TA 2JGRA 2Z43A 3ESXA 4KWIA 4OB8A 2JDID 2Q5FA 5B2ZA 4DEVA 3GDOA 3KZCA 3IHUA 3QPVA 4PSAA 1F06A 4ZZ2A 5AW2A 2EBHX 5I3CA 3PRJA 5EE1A 4A1OA 4EG6A 1RQGA 3TSYA 4EY7A 2DBYA 2QTVB 2PZBA 3RKYA 2R8EA 3OYNA 4YELA 1U90A 1UCFA 3V8EA 3WYDA 3IUBA 3G1OA 2UXNA 4F92B 1G7TA 4XTRA 1L1FA 1BWQA 3NJRA 2A6TA 1P39A 2LC2A 2NQ2C 1FLDA 3IH4A 4XMYA 1H23A 1UEJA 2VOEA 2XYVA 3IEPA 5CBPB 4KFCA 3FPBA 1U0RA 1K7XB 3JVDA 3L77A 3CHYA 3CJTA 5HNKA 4EY6A 1D4ZA 4YMVA 4HB3A 1U5TA 1M83A 2QTFA 4Y4RA 2BYVE 3K1AA 2ZZMA 3B2QA 4PYKA 5H3CA 3ED1A 5ARCA 2X1EA 2X9DA 2VSYA 1LPPA 1U2EA 5IJAA 3AJEA 1SQSA 2EZLA 2XAJA 4PAQA 1N8KA 2QAJA 4JIMA 2FQ3A 1ZVKA 2A7QA 3K71B 4UZFA 1FMFA 4RPJA 1NUTA 4HTAA 1OCCH 1V8PA 4ITRC 5K3SA 1GGJA 3BTJA 1V6CA 2DFKB 3KV1A 3HWRA 1VL0A 2R48A 1FSEA 3D5TA 4UPEA 2XBLA 1T13A 4CLDA 1PL6A 3H0KA 3SKXA 2H4FA 4DAOA 2OHIA 4JI4B 2QTVA 1NHAA 1E7MA 4H7EA 1LBHA 1JX6A 3AB7A 5EE3A 3T5TA 5IWCA 2PZKA 1VZ0A 3HTSB 2A1IA 2PCLA 1FQJA 3JQ6A 4TSFA 3TZKA 1W5AA 5AR1A 3LC7O 4HDMB 1O9GA 3F5DA 4J2HA 3LX4A 3V34A 4B8YA 1KWGA 1FS5A 3HBAA 4NOJA 5F73A 4PNHA 3HXMA 3ZZNA 3ERED 4AYXA 2WYHA 4WTOA 4P3OA 2M7BA 2P9HA 1GSOA 4ZV9A 1F9EA 2P4WA 1QU3A 1K8RA 1NY6A 1RZUA 1VTKA 3DP9A 3O8NA 1XWFA 2L3DA 1FSSA 1I3CA 2O3TA 2F4MB 4IJQA 5E7IA 4D3FA 5B2FA 3NUGA 3DE2X 4DIKA 2EP8A 3H6HA 4KPUA 3L2UA 4YGYA 5HK8A 1Y4ZA 2CHEA 2YXLA 2A9PA 4CKEA 2VJOA 4P2BA 1NJ2A 4JJKA 5DUIA 4CT4B 1IVSA 4L5BA 1HE5A 2R97A 1KK3A 1MIJA 1HSZA 2O8DA 4ND8B 4YPFA 3KQHA 1E2IA 4NU0A 5DLDA 3T7EA 2EQ5A 2EFEB 1BGXT 1CSEE 1IAVA 3L8GA 4U0KA 4Y67A 3RYFA 3KUCA 1B8IB 4QU8A 4BNWA 2OZKA 2GVZC 5EWJA 3KVYA 1JEAA 3UNGC 1ODJA 2VDMB 3F49S 3JD4A 3K73O 2OUKA 3HADA 3QWAA 4TV8F 1GARA 5F1PA 3VRHA 3WJ1A 1T33A 2QN6A 1VJRA 2QIPA 2ZJ0A 5HF9A 3QHPA 5EP3A 1HQDA 3VGJA 1IXCA 2FEMA 3UKDA 1H2EA 4MYTA 5BNGA 3QFHA 2VVTA 1VLLA 1Z7BA 2VHVA 4XVUA 3VZQA 2IQ5A 1XWIA 3LUKA 3VMFA 4J19A 4LN1A 3SIWA 4IL5A 4ENWA 2QJOA 4DQ0A 4UC0A 4QTXA 3DCIA 4RMHA 3MTJA 4JLDA 4MW7A 4C6TA 1NXTA 4ER0A 2BZTA 2MC3A 1EA5A 1XMIA 3AH8A 2D4HA 5CGZA 1S7CA 2COKA 2N1MA 4FHTA 4P9UA 3GJ4A 1UXHA 4CEIA 4EUSA 1LDGA 3AT1A 3SJMA 5I8PA 1GM5A 4Z3OA 4CEJB 3FXLA 3ZJ5A 4BEHA 3BD6A 1G4DA 4MV9A 2EJVA 4FYJA 2P7CB 4GX0A 4CL8A 5LVAA 1O89A 4JC0A 3PFWO 1R6TA 2UV8A 3O38A 3P9IA 1OFIA 4ESJA 2WD7B 2FSWA 5FLMJ 1Q17A 3OOHA 1GGHA 2Q3CA 1YMUA 1SBYA 2HXIA 2NO4A 2ODBA 2R00A 4QXPA 4ZO8A 1LLDA 2P3OA 1QFYA 3GA0A 4BNIA 3PUFA 1X2BA 2WUFA 2JJMA 2ZTVA 1TQIA 2ZWPA 3AGQA 3D4NA 3FGPA 1R0SA 4RIEA 5JDIC 4AQ7A 2X8AA 2YJTD 4MKZA 2DFTA 2MOKA 4I08A 5I8WA 4NMMA 3HYCA 1US8A 4R2LA 5HS8A 4S2UA 4XSHA 4YH1A 2GEJA 2VJ5A 1ZNYA 2O50A 2E2JJ 3AXSA 2BEUB 5JSYA 2C2OA 1ZM4A 2OCDA 2GSDA 3I64A 3DZIA 2QA4I 1QGAA 2I87A 4YP6A 4DPKA 4OYYA 3PNTA 4HGQA 4HNVA 3EIHA 4HRXA 5GZ6A 5TPZD 3VODA 3E3NA 4MVJH 5JJKA 4BDZA 4KLAA 2HVQA 3KLMX 4XR4A 4Y6OA 5DZSA 5BUCA 3E5NA 4A5OA 4UTVA 2RHGB 5KI6A 1P91A 1ERDA 2QMZA 2VP4A 4OIMA 4HS9A 4WMLA 3UPDA 4GVPA 1U8BA 2VLAA 1UMCB 1B41A 2C97A 1M5RA 3WSWA 1UKYA 3EEIA 5GAEJ 2NUAB 4F1KA 3SF8B 1WOYA 2V79A 3ISVA 3PPIA 1CC1S 1HDOA 1YULA 3QJGA 4LYDA 1KAQA 2Y3IA 3FNBA 2IIQA 3UWOA 1VBMA 4I8DA 4EY8A 4IRUB 2C6YA 2HQRA 4KN7X 1XKTA 1QVVA 4RU1A 4A8JB 5IAOA 1H9CA 5IAJA 2D7CA 4FFVA 4TKVA 4ZVRA 1WS6A 3FDIA 2E5ZA 4Q9LA 1DQZA 4X1KA 1KU2A 5E3HA 5KYKA 3PXXA 2ZLBA 4HL6A 1W7AA 2PFSA 1DEHA 2HEGA 3LVRE 4Q1BA 1H6BA 1ZOLA 1Q0ZA 2AEJA 2B7LA 1GTZA 4DB4A 3A2KA 4EUNA 1VKZA 3VPGA 2C57A 1OASA 1VXOA 4FNMA 4MMXB 5LOVF 3L41A 1P19A 2FX2A 2L17A 2Z58A 1RXYA 1JIUA 2GYVA 2HQSA 1LSJA 1WDLA 2JJ1A 3OIVA 4YEDA 3FB1A 3FLMA 2BHNA 1RE0A 4LX8A 3RARA 2Z3WA 5KOHB 3IB3A 1AQLA 4BO3A 4G56A 2FMFA 1A9RA 1U9CA 2UVPA 1BFUA 3HUFA 1R12A 1S01A 3EGEA 3PP8A 4MS1A 2X6TA 4ZFNA 1SH7A 4TMKA 3BGSA 2XDVA 3H75A 1GQQA 3T7CA 3CZ6A 1CQTA 2QUIA 13PKA 3V7SA 3O0DA 1DXQA 4JC5A 1TFRA 4MS4B 1ND5A 3RTBA 3R24A 1HDPA 2KKOA 1KH2A 3MTGA 2X4HA 1EX9A 4REOA 1RHUA 5CXSA 3X1MA 2IRFG 2AHOA 3CZMA 2VTKA 1NK3P 3O3OB 3FOFC 3NANA 1FTWA 5I7AA 3CUTA 4HF7A 1R1UA 4YFNF 2F7SA 4B3HA 4G4SP 4LYAA 2VUHB 5C8YB 1EXVA 2Y1WA 2ZIGA 2IELA 1N2CB 1C8LA 2D3WA 4X20B 1MB3A 2H0RA 3NVMB 4W63A 2ZO4A 4L9WA 1G2HA 1NQTA 3JU3A 1U0GA 2DCMA 4IHJA 4JLPA 4YECA 2GCNA 3DYVA 3O8HA 2G3YA 3GQVA 4G23A 3WYBA 5BSVA 2XWSA 3SC4A 4KT5C 1GLVA 4MS3B 2JA2A 3NVDA 4YAKA 1M2OB 4KQHA 2XTJA 2L7FP 3OZIA 2EARA 4GLFA 4JT9A 5EG0B 1M2WA 3EFHA 5IJ0B 4L6CA 7REQB 4ALKA 2DKFA 2C9YA 4R5HA 4BZQA 2JRTA 4CTOA 4YDQA 1P73A 1EHYA 1N4DA 1H5NA 3HVHA 3T5CA 3WE7A 3M4ZA 1OQAA 2KJCA 2VBIA 5F35A 3ILHA 1YO6A 2DYKA 1XCBA 4IS2A 3G8DA 2GPJA 1PKEA 2OC4A 1IMOA 2VF5X 2DQLA 5E3IA 3V2GA 3I59A 1W4RA 5JLWA 4DJEC 3WTVC 5EMJA 1PD1A 5AI4A 2I6TA 3KCCA 4BO1A 2XUBA 4OKNA 2WU3A 1N2XA 3PEFA 1V48A 4ZI2A 3IP1A 4FQ8A 1TTTA 4FIZA 2FPMA 1LZLA 3B1WA 2WJVA 3VR6H 2XNHA 3E5QA 3DDZX 2I6XA 4GP9A 1VYHA 5TJJA 1O4XA 4ZI3A 2PJDA 5CVCA 5EZQA 2H2WA 2Z9OA 2R62A 4I4TA 3DYIA 3UMFA 3V4LA 1SAUA 1L8XA 1L7QA 5C8VA 3GUHA 1QA6A 3NEPX 2V74B 3DBLB 4NFYA 3G0HA 2JK1A 1I4LD 1JRLA 3G7UA 4ZC1A 4HVAA 1ZMTA 4F04A 1OMIA 1S4MA 3CUWA 1VKJA 3TUIC 1ISGA 5B3AA 3F5FA 2H65A 3ADKA 3VYTB 1NFFA 5M5YJ 1RWWA 4KBYA 2EV0A 3DE1X 3ZVMA 2GBCA 3LQYA 1DLJA 2Q1TA 1KJNA 5AHRA 5TMPA 4Z4EA 5H4GA 4PX9A 5L40A 2AI1A 4HX5A 5JXGA 4IX7A 1XF1A 3I9V1 4D9BA 2J48A 4OIPF 4XEHA 3HABA 4MUXA 4E2FA 1ISRA 4KGZA 2OLEA 3HA5A 2K9LA 5B3LA 2VYNA 3IR5A 2C7QA 3UV6A 4C08A 4PCUA 1VMDA 2W0SA 3DT8A 4RD0A 4FHDA 5A4MS 4EJTA 3VNQA 4C6HA 3OU6A 2E1MC 4G7HF 4RGSA 4LVOA 4XD7A 5DM4A 1IG3A 2QNBA 2JIOA 4I55A 3U3MA 4HZFA 5BMVA 2YS6A 1KIMA 4DEXA 2R87A 3OYBA 1XMPA 3W2HA 1E92A 4LYHA 5DDGA 4JZKA 4ZO6A 1DPUA 1CGPA 1FRZA 2RKBA 1K7AA 1QDUA 2HFKA 4HFJA 3S2IA 1JA9A 1WQ1R 4IS3A 2VATA 4XB2A 1DRVA 4FLFA 4J0JA 1ZWKA 2R1UA 2FZ5A 3TZBA 3ZWKA 4EENA 1YB7A 3K2QA 3IBGA 2VPQA 5E7JA 3VAZA 3VYUB 5HDQA 4OM7A 4CUKA 3NBYC 3WIBA 4YMWA 4J07A 1ZGBA 1TBXA 4BN0A 3MQ0A 3OOUA 1NW9B 3KT3A 1AS2A 1K8ZB 3BBPA 2FPIA 5C80A 3J7AO 3FYDA 3OTQA 5IG2A 2C2XA 4Q05A 4F6CA 5EGOA 2GDJA 1ODSA 1IFXA 2O2SA 2XVMA 3HN6A 3P96A 4TMWA 1AUVA 3I59B 1GSIA 1KI8A 1U04A 4M73A 3AUFA 1WJGA 5FWXA 5K0NA 4CQLB 4I99A 5DF1A 1RKBA 2C5FA 3EMDA 4KWCA 4ZT2A 1X4OA 3RDPA 3PQEA 3WGVA 1WHTB 3BERA 4D82A 2FPSA 1FP2A 3EG5A 3ANMA 4DFDA 1ZKGA 1UBNA 2RGNC 3OKFA 4OFXA 1KY4A 1F38A 1XZAA 4G4SO 3OIDA 1K92A 4MRRA 1HZJA 1P9RA 3CWQA 3QOEA 2CB0A 3DL7A 4IIJA 4Q3DA 2PMHA 5IKOA 1LRJA 4AWAA 4QOJA 2STTA 1Z67A 3WL7A 2QL6A 3NHLA 4QGAA 2KZVA 4U3JA 4MQEB 1S5LC 3NM6B 1AQIA 3EPKA 1YFJA 5FROA 3UAVA 1N2CA 4BO7A 4KSBA 4MFEA 3VSLA 4LNAA 1GN8A 4L27A 2A92A 4EYKA 2E82A 1T9CA 4PZEA 1D3YA 2UXXA 4DYQA 1RACA 2GA9A 4PR3A 1XXLA 2FUCA 2Y76A 2FFJA 4WCDA 3UB4A 1DRJA 3TB6A 1H5UA 3T8RA 1X74A 1D1BA 1GZVA 3ABLH 3D6FA 3FRHA 4U0VA 4I19A 2FNPA 4LJKA 2OYCA 3FX2A 4Q5SF 4JOMA 5BN1A 3L0OA 1ZP6A 2J6BA 3JQ7A 4ENSA 3T5PA 1VBNA 1OREA 4IKPA 4U7JA 4IWYA 4HC4A 2OWEA 3D4IA 1P1HA 3LDFA 4RVOA 5TRDA 2YV3A 4LDJA 1H66A 4Q18A 4QBIA 2BVMA 2YINC 3VNAA 5A6VA 5KOHA 5LKRA 2M6RA 3K15A 1I1HA 5HKKD 1XUOA 2ID6A 3MUEA 1HSOA 3V46A 2UVPB 4XIDA 1SUAA 2HTEA 2SBTA 3EUHA 2Y71A 1UDWA 3DL2A 3WKAA 3CF5F 3JZDA 2C82A 1V54H 3EVAA 2IS1A 1WCYA 3PFHA 4BEJA 3KFXA 3QXSA 2CCJA 4YFYA 1FRFS 4EWLA 5K51A 2DY1A 1DKOA 3EODA 4K1XA 5TF4A 2R25B 4EJUA 1QNLA 4H08A 4PHCA 4QPZA 1JKOC 1ZIPA 2IJGX 2AE2A 3CEAA 1UJNA 4IQ8A 1G8HA 2CE2X 4G0QA 3QWHA 4A1FA 1PFWA 4IM7A 4DLVA 1Y4SA 3PEYA 2E5NA 1V7QA 2FRXA 3I0NA 4MIYA 2DCEA 1D0IA 1G6HA 3A4VA 1ZQ9A 3MCTA 4RTKA 1WU7A 4I0AA 2YOFA 5AOCA 1DEKA 4K6HA 1AZTA 3R0IA 5GJCA 5HIJA 1O03A 4AP6A 4KA4A 3VO2A 2OAEA 3BR5A 1OR8A 4D4JA 3QZUA 1WJFA 4H27A 2X0NA 2XUIA 3B2EA 4RV4A 2V1NA 2NVTJ 1UMCA 3IXQA 3L7LA 4E6PA 3A27A 4MKIA 3RT9A 2WOJA 2NO9A 4E3ZA 2VAVA 3NH6A 1QVWA 4CO8A 1QQBA 2HF8A 4PY2A 4QFMA 1OCTC 2ZXEA 1TA9A 2XDYA 2DPXA 3T0YA 3C70A 3DVAB 3PTAA 2H1CA 1QO0D 3EAFA 3IT3A 2CVOA 4OMDA 4DDWA 1Y82A 1N2ZA 2H9IA 2YICA 5IYZB 1PEYA 3PQ7A 4JFRA 1N5LA 1XOIA 1CF7B 4M87A 3RIEA 5HUQA 1Z62A 4R4JA 4HSGA 1D8TA 1R8YA 1LPQA 1LI7A 1NLMA 2COEA 4XQEA 3OYGA 1MIHA 1P2BA 3ZHSA 2X5NA 1FFXB 3GT3A 1PI3A 2OPHA 1EX7A 1F2UA 1GFSA 1R36A 1GPKA 3ITEA 4BJ1A 3BRQA 2YC2C 3IAM1 2PUGA 2FCRA 1CD5A 4AUMA 5KBYA 2RH5A 2BRUC 1VRVA 4GU5A 3RSCA 4YMIA 1UFKA 1EFKA 4HAWA 1RRPA 5EXPA 2DHEA 2PSHA 1TM4E 3LVFO 5B1BH 1RRJA 1APLC 1DQSA 3I0TA 4UHDA 1NG9A 2WTMA 4WOCA 1OX4A 3DE7X 4Q6BA 2QUBA 1ETOA 1X8LA 4NYIQ 4AAYA 4F5DA 1XU7A 3DAPA 3C3XA 1LLCA 1TL8A 3TZQA 2JFYA 2GZ2A 3UT5A 1VIAA 4DQXA 4QJBA 2B92A 3QX7A 1SCIA 3JARB 2H48A 4GR5A 4HX2A 1X80A 2SCUA 3FETA 2VA8A 3NT2A 1V5GA 4AM3A 4JR1A 4NJMA 1MGOA 4A3KJ 2V58A 3F98A 1YU9A 3DC2A 2WD8A 3L7MA 2C4UA 2GFQA 4LOJA 1KBQA 2QIOA 3QKWA 3H7AA 5A3SA 2WB1A 1JKQC 4GWKA 4F6LA 3G73A 3DUWA 3T61A 2UVQA 2DKNA 5CFNA 5JYBA 4PE5B 4YJFA 2PEXA 4H3SA 4LJAA 5E9WA 3RUFA 3S1LA 4DWWA 2XF6A 3SZPA 1YVRA 2EIKH 3V55A 3CC8A 1G16A 1XP5A 3JRHA 2WWIA 4FDMA 2BFEB 3ILVA 4MEBA 3RU9A 2ZJBA 3EPHA 1PR9A 3LCUA 1W19A 4FJ2A 4YXWA 4YUWA 4HDKB 2XMZA 4XSZF 1QYIA 3MXOA 3R0JA 3B5EA 5ALLA 3W6OA 1VG8A 2CF6A 4IOLA 3L92A 3ZE1B 1T9KA 3CGWA 2EA2A 1X9GA 2GJ9A 3L6OO 4Q1EA 4PZPA 4R41A 1ODKA 3IERA 2DPHA 1JP7A 3D0SA 1T4GA 1TMYA 1QVAA 3ESQA 4DLNA 5KQRA 3BTIA 3FRIA 1AZSC 3L7DA 2X3YA 5FBHA 3WTYC 3AVUA 2EZ9A 3IWFA 2YJ4A 4MVJA 4PYNA 5FYQA 4B2YA 4YRZA 3TMOA 3AHGA 5BQ5A 3WG7H 1NWHA 4A8PA 2OGZA 3PEUA 1A9OA 3G8CA 3O8QA 2L02A 1CQZA 5FJJA 2QP3A 2XMQA 3RCBA 3VR2A 2CY0A 5FA6A 4ETWA 1N57A 3KOWA 2IXFA 1ULBA 1ZESA 3IT0A 4OLHA 2NO0A 2V6MA 2QZPA 3V7NA 3S3NA 3MAGA 3IRRA 4AUNA 1FOEB 2G8NA 2DT7B 1UDXA 3HSKA 4B81A 2YOHA 1FVXA 3CW9A 4BO2A 3BC8A 2A33A 1VLVA 3PFKA 1TEZA 4MQFA 2ALJA 4KAFA 5GWXA 2GCOB 1JHPA 2YCLA 3LVQE 4X71A 4YJ3F 2D2IA 3P0RA 2GCEA 4RGQA 2Q28A 1N0IA 1L3BA 4NPAA 3IAS6 2BH9A 2QX7A 3AHEA 1D5CA 4Q6WA 3QPUA 1P8AA 1E3PA 3HHGA 1XTRA 3WI7A 5J8FA 3D31A 5E6SA 4H2DA 2DOEA 4MO2A 4PBTA 4RANA 1B74A 3HJEA 2WWFA 4QWQA 2MYSA 1KQOA 2J3DA 4E33A 4UU1A 2XH8A 3TRDA 4DZTA 3F7OA 4CUZA 2G82A 2EYQA 3CTPA 1IW7F 3IAEA 4FCVA 1DCMA 4II7A 1EA7A 4RORA 4OHPA 5H3HA 2NS7A 4DRZA 2MU1A 2AHQA 4YAOA 2Q8NA 1T34A 5K3OA 1JHQA 4JGBA 4Y8VA 1O7LA 3QEBZ 5LOVB 1XLTC 5F7OA 2JSCA 5F98A 1F1JA 4AG3A 3PK0A 2PMBA 1NI4A 2R7XA 3OJWA 5GOZA 5ARBA 1JFFB 2WTNA 5JISA 1BR2A 3KZXA 4YJ2F 4WZAE 1X2MA 5F7JA 1HLPA 1E96A 2NTEA 2JCXA 4HXEB 5ILSA 5CKTA 3KP7A 1LI5A 4XKCA 1F17A 1XTIA 1YB4A 2Y1EA 2YWBA 3MJSA 4YAWA 5ESWA 3WL8A 3ZC3A 2P1RA 1AS0A 4NNPA 5IWAB 1ECBA 5LQAA 3C1OA 3TI7A 4ZJZA 1WLYA 3H04A 3HXKA 4HY3A 4OXIA 3CCVI 3LC1O 3MJRA 5FKJA 4M1KA 4EB6A 3RVNA 3GJTA 3DWIA 1K0UA 1QJ4A 1WEKA 1PDNC 2Q3FA 1U9YA 3CLSD 4PC1A 1GGNA 2VP2A 1QORA 2VZLA 1UINA 3VU3A 4I5FA 1HYBA 2D1RA 3P9RA 5B37A 4PQYA 1MVLA 3HCCA 4EH1A 3GW2A 3RRBA 1CUYA 1R8QA 4ZZ1A 4IX1A 5C53B 5LRSA 1U2QA 1GQFA 3MRSA 1IUPA 2DA7A 2HHAA 5D3ZA 1MW8X 3FPKA 4A6DA 2W8BB 1BMTA 2W6QA 1JKMA 2AB0A 2H85A 3GEIA 3GK3A 3HEMA 4NBNA 1NOJA 2HGZA 2V26A 2E19A 1TVKA 2D5CA 5JBNA 3KR9A 2E1NA 1KQFA 4MIOA 3GAMA 3SYMA 4YRAA 1U3GA 5HGJA 4IH4A 3QKRB 3RS4A 4MUFA 4LIVA 2IYOA 3T15A 5FBVB 1MT0A 5EMNA 1L7PA 1ARZA 5FPPA 3FPHA 2QR5A 3IAAA 3A02A 2Y9ZA 2FOLA 2XOKA 3C45A 3EUWA 4BFZA 4F45A 1K2VN 2GXQA 1BC7C 1GKYA 1MJGA 4ZQFA 2Z99A 1RWQA 4FMDB 5JNLA 1MC5A 2AN3A 2BP7B 2PL3A 2PRSA 5AD1A 3O90A 1YZYA 2ZTLA 3L0SA 4AYWA 5LP6A 6AT1A 3KXKA 3OWOA 3RGGA 4DUGD 3IR7A 3P7MA 3ENVA 3FVWA 2V9KA 4Z2YA 4J7AA 1WIWA 2PEZA 3D1LA 3SHFA 4UVDA 3S5UA 5J4YA 1RR7A 4IRHA 4AX4A 3H9QA 1XRLA 4FZRA 4L6IA 3DQVC 3D8BA 4FYXA 1C8BA 1XSEA 4Q7KA 2X0DA 4NDAA 4WZBA 3FROA 1O9HA 3LXUX 2IIPA 2I3BA 2NXWA 4MKGA 2RG7A 3QPSA 1TWGJ 1R58A 3K0KA 1UAYA 1HA3A 4G41A 2YNMC 3TLGB 4EDFA 2Z6QA 1HZZA 1DU6A 2VXYA 4R01A 3W7AA 5E8IA 4PCAA 4TKUA 4D4IA 5AVZA 1SBTA 2IZ1A 2YY5A 4MUKA 5HG0A 4MTEA 4QPQA 2ISZA 2QTMA 2SICE 3O1HB 4HH0A 1N1MA 4K9MA 4MLZA 4M0MA 5IP5A 5LCXA 3LFTA 1V9LA 1TZJA 4H0EA 1U8AA 1GZHB 2D2XA 2G09A 3MN2A 5DXJA 4CM4B 1VPDA 1HNWB 1CHDA 3ISPA 1I01A 1ZGGA 5C3EJ 4O2AF 4UCWA 4UU8A 2IQIA 2N0SA 3FCOA 4X7BA 5DIFA 2ZM6B 3QEAZ 3DEIA 3FLEA 3SEQA 1R7RA 3Q5DA 3H1BA 1Q7EA 1RI2A 3V4OA 3CDLA 3V1MA 1AKNA 2OV1A 3MZYA 3HZZA 3RS8A 4WINA 1BMFD 3CE9A 1GWNA 1V1RB 3PJGA 4YIHA 5ISMA 2YXPX 3DC7A 5C5CA 3QITA 2A58A 4YQZA 1UC9A 2FW8A 1E63A 4LDRA 3HO6A 1AKWA 3D2CA 4KYUA 3UMBA 1AMUA 2AOUB 1VXRA 4Z49A 4QVIA 3INGA 3FM5A 4KK3A 3VH1A 4HPXB 4M1MA 3L43A 3D5QA 4DLLA 2I2BA 3TW4A 2WJ4A 5IUJC 4QL3A 1TECE 5MDHA 4Q66C 2FPPA 1XSXA 1P7ZA 5DE3A 1DO0A 1GQYA 1QE0A 4P7JA 1I2BA 5LU8A 2P6NA 1D1CA 1FRNA 3LA2A 4Y6SA 3ZYCA 1RZRD 2WPDD 4WOBA 5HOEA 2P2YA 1MJAA 1F43A 4K8RB 4G0NA 1CHNA 4KYWA 1PX2A 4G8XA 3I83A 4GFBA 5JLJA 1J0RA 5BYKA 3GLIA 1HT0A 1RQRA 2HDCA 1KU9A 2HJRA 2ISSD 1RABA 4CA0A 1XU4A 3LQ4A 4HN4B 1Y63A 1ZMBA 4P92A 3D7NA 3DTKA 4XOPA 4IJMA 3W06A 1FMVA 4Z4CA 1E9CA 3DTYA 1CDOA 1EI9A 2ZW9A 2C9ZA 3WGTA 3ICOA 3Q5EA 5DPMA 2R5ZB 2ATIA 2IOFA 5FX2A 3QU3A 2GZ1A 2QN8A 4G7ZF 3B1KA 5TQ0B 1WY5A 1QHHA 2ZWOA 3ESRA 3C1AA 3HB1A 1QHXA 5GPBA 3TLYA 2GPSA 4B87A 1GTRA 4HV6A 3DMTA 2VC2B 2BY2A 1J07A 3IQFA 2PX3A 4WLOA 4DMRA 2ZB3A 3HDHA 4QOIA 5CXQA 2FVXA 3ESZA 4L0YB 4N7BA 2OK8A 3OLVA 2Q4RA 2QTLA 3TCXB 4GD3Q 4FW8A 3TN7A 5CDFE 1N7HA 1NW5A 1XI2A 1PNOA 2GAIA 4JLMA 3B3GA 4UD2A 2WIGA 1XYGA 3N6XA 2QYOA 2VQCA 3Q85A 3RZDJ 2JEZA 3NJ4A 3FD8A 3SYNA 3X1DA 4XCQA 5E3MA 2J5BA 3GP8A 3JVEA 2AFIE 3PD0A 2B0LA 2XUFA 4MV4A 1QH8A 1PTKA 1V39A 4UM9B 2NZYA 2VCEA 4OIRF 4WFJA 1RWVA 2C3PA 3AEYA 4EZEA 3GFMA 4ZCIA 1W0UA 2GD1O 4UJ5A 1D07A 3LOUA 4JLAA 5SZJA 3DEUA 3RYIA 5F0CA 1YRWA 1N7GA 4RO0A 2VYVA 5AXDA 1E0JA 1I3MA 1RM0A 2Z2KA 3KTFA 5JANA 4UB8C 2B21A 3G4SI 2TDXA 1LTHR 3UPTA 4ENRA 1DELA 2DMNA 3AFNA 5CUQA 4KOEC 2IL1A 1DL5A 2LBPA 3F67A 5ETJA 1Z6QA 1J42A 2FUG6 4J0KA 2MHCA 3RRXA 2EG9A 5DYMA 3NUZA 2OO5C 2Q9AA 2G8LA 4FX5A 4URZR 3R8FA 3BIFA 4G81A 1J9ZA 1T8WA 2V7BA 3F7MA 4UUSA 3CO7C 5K0TA 5BS6A 4NARA 1ETWA 3PIDA 2WDPA 1S89A 5FL3A 2JJ2D 3F8TA 3KL4A 3VPAA 3H2YA 1PAUA 4MVWA 3R4KA 5B30A 4XH9B 3B6EA 4DQLA 2O7QA 3IAM2 1VQNI 3GAAA 5B1SA 4J0IA 2G80A 4MROA 2AFHE 3WIVA 1ZZEA 4JOCA 3LY9A 4L8LA 4POAA 4Q01A 4UTRA 3IRQA 4C30A 1OFUX 4DT1B 4MWCA 4LBYA 1AU9A 2JFUA 2JF0A 2QW1A 4ZVTA 3FVQA 2SKDA 3O9VA 1ZONA 1PGJA 3NPMA 2J9ZB 1WJAA 3HL2A 3S1MJ 3PJFA 4W7IA 3V8NA 4ARIA 3F2VA 2HYFA 1ZK2A 4AURA 1W5SA 2KPOA 2KDOA 2J6CA 1OC2A 2IBDA 1HE8B 1KMHA 3BEDA 1LBSA 2ZT8A 2HF9A 2FVYA 4J7XA 4BFTA 3O8OA 2P9JA 3URMA 5JPCA 1Z7GA 1RM5A 2V5AA 4GMKA 4PAWA 3VR5D 5EIBC 4D7NA 1VYVA 3ZI4A 2B8NA 1OISA 2VN8A 3CZRA 4RVHA 4PSVA 2GPWA 3LA3A 3KU4A 1VSBA 2FHSA 5ELMA 3UJ8A 4TSFD 2CMKA 1EINA 3ADOA 2FB9A 4XGQA 3UQZA 4LB6B 2YJ5A 2WV7A 2F4VB 1G63A 3DZCA 3JQ8A 1JYEA 3MZ8A 3Q9VA 5KNBH 1DT3A 1K08A 1ZHFA 3THXA 1BVRA 4J6FA 2XUQA 3AF3A 3CGGA 2EJTA 1DIHA 3PDJA 3DBIA 4RLSA 3RYRA 1WA5A 2FEAA 2WYOA 4CTKA 1Z6RA 1G5TA 5DCMA 3GJ5A 4JWKA 1O97C 1Z2OX 1GXSB 1KEUA 4PLFA 1EVLA 8ATCA 1MO2A 4KGVA 2YS7A 3RROA 1HXHA 2IH2A 3ZWXA 5JVDF 2RARA 1FDSA 1BR1A 3RC9A 5FTKA 5LMUB 2HBYA 1Z2NX 4U7HA 5E8JA 2PMZN 3RS7A 4BV3A 2QM3A 4XDZA 3TLMA 4ARSA 4RTNA 2ZSFA 1DBRA 2FKAA 3FCUB 4HUQA 3GZ4A 5FUXA 1KU7A 2RIRA 1B0ZA 2GBLA 1G5QA 2WAOA 4IICA 1VSTA 1Y3AA 5T3YA 2X9LA 4AJ4A 4P36A 1TEVA 5CM9C 4W5QA 3KC2A 3T99A 1Y1LA 3NYIA 2WNHA 4IIDA 4E88A 4YLEA 6CHYA 5CLSA 2EJBA 3QEMA 2GXGA 5AESA 4P22A 2XYRA 2JG3A 1XKLA 3C7CB 1TRKA 2JPDA 1DTEA 3GEPA 3Q8WA 1UIRA 2GN9A 4G2TA 1DI0A 1KMIY 3COPA 3H2ZA 3IFSA 5U4XA 3N2NA 2FA5A 5KX5A 4O4JA 3DMGA 1JDJA 1NJGA 2JPCA 5KEIA 3A3KA 1P0CA 2I8CA 4DGQA 4FW9A 1N2GA 2XB0X 4UHBA 5FBLB 2ZCJA 4A5MA 1D9ZA 1Z5PA 3LD9A 1LQ2A 4BFVA 3I09A 1P2VA 4D9CA 4WY5A 3QNUA 5AO9A 5M34A 3BCAA 2GAJA 5EKDA 2PG3A 1NSFA 2C8LA 2HU7A 1KMQA 2XNCA 3A9CA 4YRDA 4WXHA 3V7RA 1G7SA 1ZM2A 1XC5A 4JOBA 3IOCA 2FK8A 1BDHA 1RXUA 4CFYA 1UQUA 4XCVA 5EWLA 3HXOA 1VTNC 2HCJB 4YCLA 1JXSA 1CUSA 1JGGA 3GTGJ 1YUBA 3DDWA 3JWGA 5DEOA 3W9BA 2W6JD 2H3HA 5BSFA 1BU8A 1NRIA 3PC7A 3LPLA 2XVAA 1EQAA 1Y3CE 3CCMI 1IL0A 2G28A 1FXSA 1WBJB 3IRVA 4HADA 4NPHA 4Y1FA 2NT3A 3ASVA 1KK1A 5JWRA 2GK4A 2P0AA 1ITZA 1SZJG 3E5HA 2WUWE 4AC0A 1ML3A 2X41A 3TBFA 3TM5A 4HF2A 3WZ2A 4DCGA 3L7NA 1Z0UA 1SXJB 4PHGA 9LDBA 4U2EA 1U28A 3CRRA 1SU8A 4QELA 4YO8A 1WUYA 2BGWA 2ZAIA 4LJ4A 5AK3A 1M2OA 5LD2C 1TJPB 3ZWWA 3T1TA 1L1EA 2PRIA 3DFFA 5BUZA 3UWKA 3WFZA 4WOJA 2PMZA 1T1IA 4CMIB 4EHJA 5IDWA 2J0QA 3AY3A 3W5CA 2GD2A 2AOTA 3EGIA 3UWSA 4CMKA 4DR4B 4RDIA 3LBIA 3QV1A 4OQMA 2QX8A 4MQBA 3BOQA 4MPTA 3IAM6 1SCUA 3R0VA 2NP6A 3LRPA 4M6YA 3HEFA 3P1JA 1EP9A 1IRIA 4PYIA 5A3JA 3TNLA 1PVOA 3C5EA 2GGSA 2QYHA 1HO3A 5AW6A 4C3IJ 2CF5A 3L0DA 3V8RA 1TAGA 4PG5A 1UC5B 2YNMD 4Q12A 4PZ0A 3S2GA 3VOBA 1J5EB 4GI1A 4O4IF 1JKJA 2M34A 1XDBA 3W7VA 4AWBA 3OYFA 1Y1RA 1ENHA 3RNOA 2V9VA 1HM5A 3RG8A 3W6PA 4OQPA 4Z1OA 1SQ5A 4RLHA 3W3AD 3IEXA 2MD0A 1VLHA 1I4OA 1N34B 4W7SA 4LJ7A 5DCWA 3VZPA 1GR1A 3PQJA 4EM0B 1OOEA 1Q0HA 5JO0A 4U8HA 4RA9A 4CR6A 1UJBA 4D8XA 2P9ZA 4DYRA 3DYBA 4U9HS 4AYBN 1HC7A 5KX5F 4IQFA 2NVBA 4E1VA 1W5EA 5BWCA 3CF4G 1OJLA 1K4SA 4A12A 2I71A 3L9XA 3OHPA 4FBGA 2LVSA 2BFDA 4RTMA 1XEWX 5EIXA 2B7BA 5HF8A 3TPZA 1FXWF 1IC8A 2DECA 3U1TA 3OQNA 3ENKA 3WLEA 5FLXA 3GTKJ 3GFGA 4F9EA 1O77A 4CJXA 3HXQA 3TQNA 1EDOA 2QORA 3M6XA 4XYLA 4L9SA 2QSGX 1QFMA 3C2QA 2LXNA 3EE6A 3NZEA 4J2TA 5H7XA 5CA0F 2G1PA 2UZ1B 3NWPA 1A7KA 4ESVA 2XB6A 3GFSA 4HWRA 2NX2A 2NVYJ 2VPPA 1ZUHA 2C9BA 1CZUA 1X86B 2IXAA 3O8OB 4XRRA 3RU2A 1SKBA 2QLJA 4E4RA 5JHGB 2E55A 2GM4A 4D25A 4F3TA 2DMQA 1PTJC 3FH0A 3JQGA 3PNOA 3QPDA 1P4JA 1A8IA 3JR7A 4Y13A 3S99A 3WNBA 2QRQA 5ULLA 3VAAA 2QJTA 4H9GA 1EB9A 1FNDA 1UT8A 2YNMA 4FUQA 4AY3A 2ZSHB 4M83A 4Z0TA 5M29A 5MN5A 4BASA 2UUAB 4B9EA 2VYCA 2WZCA 5DW3A 4ZDLA 3WNQA 2PJUA 1L8QA 2QX4A 2BGCA 3OETA 4B83A 1IZ9A 4GCVA 5DM70 1E2UA 5L7YA 1WULS 4BFWA 3QVXA 1W7PA 3A1VA 3AR2A 2CXRA 3ZWMA 1X94A 1EAMA 2H6CA 3KBOA 1NMQA 5JCJA 5ALDA 4FNAA 3L7AA 2E1CA 3HVJA 3BJRA 3LZDA 1T4CA 4OLFA 4C3HJ 1MPTA 4OJKA 3BXFA 4O2RA 1NNEA 2ZNZA 3JQQA 4FFLA 1DP3A 2X3FA 1IDOA 5DK6A 2DWOA 2X19A 3FKSD 1XNGA 2WC2A 1QLWA 3UJDA 5F1KA 2GAOA 4MR7B 1IG7A 1PJLA 1HQCA 2QMYA 4Z3DA 2IV2X 3R6GA 3RHFA 3R23A 4HDRB 5U1PA 3ZHTA 2R4UA 2EFYA 1A4IA 1PUJA 3AZOA 4F5WA 3FWYA 4R9VA 4LJYA 3RWOA 1QHGA 2BF7A 2O3UA 1S4QA 2XMSA 2C54A 5D8KB 1NVUQ 2VPYA 3JVVA 3NV7A 4BV9A 5AW1A 5L45A 5FDFA 1ORHA 1RKQA 2W2LD 4G5QA 2WV9A 3B3AA 4M9QA 4ZAYA 3ZCVA 2JKVA 4BMNA 2QG6A 1SHLA 1CRQA 4BJ6A 1E94E 4N8SA 4OP2A 1Z56C 3RK4A 1V47A 3IL2A 2LG4A 1Y9ZA 4DXAA 3A3OA 2I6FA 3COVA 3E48A 4IUYA 2EEZA 4F4FA 2OFFA 4L6AA 1NJ1A 2A9RA 4XRSA 2E5FA 2FSVC 5EWMB 5C3UA 4CIXA 4EA8A 1JDTA 5K0BA 3QYFA 3P9XA 3EXAA 3MJHA 1HSTA 3TOCA 3NPAA 1FYVA 1E6MA 3GRRA 2EBIA 1YAHA 1S7GA 1YJ8A 1PSDA 3B1YA 3HDTA 1JEYB 4JI8B 5BV7A 2DH5A 4MQVA 3IIIA 3R6DA 2WK1A 1U9OA 2X6YA 5JCJD 5J5CA 2RI0A 1Z4PX 4DJDC 1RWNA 3VC3A 3RKWA 3GTPJ 1YUMA 2VYFA 1R88A 1JT9A 2BKXA 2QUKA 1LFUP 2PKQO 4XPIB 2P78A 3KXPA 3HKDB 2GCIA 4XQGA 3V8KA 1QG0A 3OPYA 1R6BX 3QVGB 4IXWA 4KK4A 2YFKA 5HKBA 2BOVA 3Q6IA 2FZWA 1Q7GA 1JUMA 1GXPA 1Z08A 4ZDPA 2CJYA 2QN2A 4MEJA 2YUSA 1QQIA 3BR3A 2I2DA 2I7XA 4MO9A 4OK6A 1KHTA 4D41A 2GVDC 4BY1J 2O0MA 4E21A 2WC1A 3PTLA 3UOWA 5FUQA 4BDSA 2PUAA 2BUCA 3HNPA 3F96A 3KT6A 3WTUC 5LR6A 3TJZA 2FX0A 3A1NA 2RKOA 3CLOA 3O4GA 4R8MA 3DFMA 3GELA 1IC6A 3FF4A 1I6HJ 3JQ9C 3IVMA 4G1UC 1XU9A 3GPCA 3WHKA 1RLMA 3CNOA 3HLYA 1HLGA 1NASA 2CHUA 2J8ZA 3B38A 3FZQA 3JQAA 4HFNA 4FYVA 1ZD8A 3I4LA 3AEUA 2ZIZA 1XZHA 4M7RA 4OJQA 1R9JA 1T5BA 4XD7D 4DARA 4EFKA 3WAJA 2BHSA 1DG9A 3FVVA 2V1UA 2EQAA 1KH1A 4O29A 5P8WA 1SR8A 1KSGA 3LBNA 1W29A 1YNOA 4PTZA 2CDAA 3L9WA 4H15A 4DV5B 1F1ZA 1UOQA 2BJVA 3EDRA 4AM8A 2I2XB 2V1DA 2ZUCA 4P82A 1ESNA 1SCJA 3ETEA 3OM1A 3JRBA 5SY6A 4O33A 2XYQA 1WL8A 5DWQA 1I6KA 1PWYE 3C8HA 4F72A 2JHAA 3R5KA 1R0XA 3ELYA 3GXBA 4H7DA 4X6LA 3W8NA 5K0ZA 3WIDA 1JXAA 2E9SA 3BILA 5AJTA 2E71A 1TZ2A 1JLSA 3IUEA 4KVZA 4MDFA 3IAHA 2L9NA 2XXBA 4J49A 2TYSB 5EZYB 3NAMA 5KYYA 1RIIA 2F55A 2ES4A 2I54A 2GM9A 4ZJYA 2O9LA 2YWXA 3IXLA 1USTA 2LYCA 3DBHA 2JL1A 2XPWA 3QLVA 2VSQA 5CJ2A 4BVFA 3WZLA 1EFAA 1RLTA 1Z16A 1C0KA 3PXUA 5J40A 2CNOA 2J67A 4FMBB 2AZDA 2D6FA 1COWD