3C3WA

Crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN DEVR
publication title Crystal structures of the response regulator DosR from Mycobacterium tuberculosis suggest a helix rearrangement mechanism for phosphorylation activation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c3wA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3wA01
1BVHA 2V1UA 5L3GA 2GWRA 2J5OA 4KN4X 3O74A 2CQKA 5DKFA 2Z33A 4RS8A 3G1WA 5ICFA 3ELKA 4MHGA 2LDUA 2HTSA 4TLLB 2F8SA 4PGHA 2B1JA 4NV3A 3I09A 1E17A 2FQYA 2QV0A 5ILVA 4BXUA 2L02A 1HW2A 5HSGA 4G0PA 4HAMA 3I5UA 2NZVG 3L49A 1YS6A 4QYMA 1G3YA 4PDKA 4MS1B 2ZXJA 2NYXA 2G7HA 4HF0A 3GFLA 1ZARA 1SRRA 3H5OA 4Z2YA 1GXPA 3QK7A 3MQ4A 1KU3A 1DCFA 1ZRCA 1KYZA 4UNOA 5GOTA 3RQIA 4Y9TA 3TO6A 3OLXA 1M2FA 2H6BA 1BIAA 1WKMA 3COAC 2W57A 2Z99A 4RGXA 5HDKA 3CUQA 5E8GA 1Z25A 2R48A 1TW3A 1STZA 2KIFA 1WWXA 3OM1A 1VPWA 5T3YA 1SXIA 2FMLA 4MS4A 3FHZA 2JBAA 4RU1A 1Q1HA 3CZCA 4NQWA 1XCBA 5FWYA 3V8JA 4M9XA 3LSTA 3IP9A 4YGXB 3DGEC 3AAFA 1HSJA 3P9YA 2VBXA 3BREA 1HSTA 4A5MA 4HA8A 3LTEA 4LDZA 1I27A 2NS0A 2O61A 1CF7A 3LOPA 4WUTA 1F1ZA 2RDPA 1E6KA 3BBLA 1YW8A 1ZVVA 3IDOA 4N76A 1HQCA 2PI0A 5DCMB 2FN8A 4IJAA 3RKYA 2W42A 3H75A 4XAQA 3H6GA 2EV5A 3F6CA 3GL9A 4WXCA 5JVTA 1S7OA 1ZHHA 2L17A 2L19A 5TPZD 3CUOA 4GNRA 1BN5A 1NXOA 5CVUA 3DBIA 4L4UA 2CO5A 2M1BA 4IHSA 2QENA 3OOPA 3GWGA 5KQMA 1DRKA 4EVRA 4HX7A 3O6BB 2M30A 5TRDA 1EH7A 2MH2A 4UV8A 3DPTA 2RQPA 3M9WA 5IUJC 2Y48A 3JAMK 3QEMA 3HRUA 4G0ZA 1QKKA 1KMIY 2HWVA 2GA2A 4LB6B 2A9OA 4G6QA 5A2QK 4HZFA 3QLVA 3URMA 5B3JA 2XASA 2RGYA 1DPUA 3RVNA 3BJAA 2HQBA 3RVKA 2XKOA 3S99A 3BOQA 4S05A 1JBEA 4WF2A 1BJAA 5D8KB 1QMPA 4ZMRA 4MQFB 3WU1B 1ISRA 2D45A 3MA0A 3TO7A 3ERED 4EMSA 1C4WA 5CVJA 1APBA 3BP8A 3UUGA 2DO7A 2XDYA 2EA2A 3N97A 1FC3A 1JHFA 3I42A 4Q7EA 2ADUA 4IMJB 3QELB 1IRFA 3CLOA 4R8HA 1AB5A 2ZJ2A 3KS9A 4LLNA 2XAJA 1YW9A 3N4MA 1ISSA 2ZBKA 3HDVA 1ZG1A 1R23A 4UUVA 2M45A 3C1DA 1UB9A 2A9RA 2Y0MA 1FSHA 4IXAA 3K4HA 3K69A 5BQTA 4KQ9A 4MR8B 1JLKA 2FRHA 3RKWA 4OLAA 2QVGA 1GLGA 4KNYA 2X7XA 1FBQA 3OV8A 1L5YA 1ZN2A 2G9WA 4LGWA 3FM3A 4M9SA 3JAMZ 4A6DA 2V1XA 5CNJA 4KMUX 2VBZA 2PMUA 4HW0A 5DUIA 3KG2A 1DRJA 3O2SB 4EJTA 3EQ2A 2BYVE 2STTA 5FLXZ 4KA4A 3F6OA 3NNSA 2PMCA 2NUBA 3GX4X 2FXIA 2FE3A 5BPIA 3IP7A 5KVRA 1BDIA 1M2EA 2FLKA 1IN8A 3GUDA 3I5AA 1WI9A 1IXSB 4ETMA 2ESNA 3CHYA 4QYWA 4XARA 4OIRF 4FE7A 4H3HB 2PUEA 2Q8KA 1TQPA 2WTEA 3FFWA 3RKXA 3HVRA 2WMYA 4B8XA 4HNSA 4K2EA 1EV7A 3J81Z 3OM0A 1XSXA 5TQ2A 1U2WA 1BC7C 3JPWA 3HM9A 4UVAA 1PEAA 2H3HA 1DG9A 1E2BA 4Z4FA 4MTEA 5AONA 1RI7A 2PKXA 4YP9A 3JS5A 4CICA 3QX9A 2PUFA 2CSOA 2K27A 1YVUA 2DLLA 3K1PA 2HKXA 3ROTA 4HBLA 4NICA 1EAYA 1H9GA 3WE3A 3JTHA 1FYLA 1B00A 5IULC 3E5UA 2QYOA 3SXYA 4WWCA 1D2AA 5ILUA 2VUIB 2FEZA 4MRMA 2E4VA 3NHMA 1M5TA 1NY5A 4JB2A 4M72A 3D02A 5FD6A 2FEWB 1ZH4A 3ZPLA 3VODA 2E7WA 2RJOA 1QP4A 5LEJA 4EVQA 5TE9A 2AXLA 2OZUA 2V9VA 2QWWA 2L4MA 3ECHA 4HX8A 2GXGA 1IIBA 3RI4A 3B2NA 5JNRA 1CHNA 1S7AA 1KQ9A 3R4KA 1MIHA 4F7ZA 3IPCA 5C5CA 1HKQA 1SXHA 4WK8F 1ZREA 3ULQB 4EUKA 3H92A 1LDDA 3H3UA 2OU2A 3JY6A 2D2WA 5H6QA 3NEUA 4ON0A 1J59A 4XBFA 1YW7A 2P5VA 3HRSA 4P96A 4LB5A 2VE8A 3I64A 1MB0A 5BRAA 5JNWA 1XGNA 3E6DA 4ZJPA 5KC8A 3DEUA 4XXHA 2LKPA 4XRFA 4KIBA 4MGEA 4OATA 1FT9A 1WRJA 3RVQA 2UXNA 1NTRA 5DLEA 3RVLA 3N8IA 5E1WA 1USTA 2LF8A 3TOAA 2VODA 3EDCA 2ETHA 3LUJA 4L5IA 3KP6A 3ZN1A 5FBKA 4PZ0A 3BZ6A 3LMKA 5L3FA 1IXRC 4DQ2A 2FQXA 3OO0A 3ROUA 4DADA 3M8EA 2P4UA 1U5TB 4RXTA 2MBFA 3FXQA 3KSMA 4YCSA 1QQIA 2LPMA 2MSWA 3F6PA 3RDIA 3UKJA 4YR7A 3LAPA 1T98A 3CLKA 2A5YB 3MM4A 1ZGJA 1R8JA 2N9UA 1ZGAA 5JNUA 2GQQA 1TQIA 4NB5A 3Q7SA 4OTZA 4KYWA 1PDNC 3BJ6A 4EY3A 3HK2A 5D5XB 3G73A 2EV0A 1T2KA 1DZ3A 2K4BA 1ZG3A 1GVJA 4MS3B 3FWEA 2P8TA 3LFTA 2H6CA 1L5ZA 2XAHA 1PP7U 2ELHA 4MS1A 2DTRA 1MDMB 3LQRA 1U8TA 2L18A 2MYNA 4G7OF 2E7XA 3ILHA 5FO5A 1NHAA 1D5VA 1P2FA 2B0LA 3WTZA 4MPTA 3K9CA 3H5TA 1K6OA 4CDGA 4XSZF 4FHTA 1JYFA 4LDAA 4MLDA 3EYYA 3WE2A 1YQAA 5LGTA 4YS6A 1XN7A 5F6FA 3QP5A 1SFEA 1Z91A 1U04A 4OIPF 4NCAA 4ML3A 1JHZA 2IRFG 3DV8A 2R25B 3NQOA 1PNRA 2OZ6A 2IOYA 2XVCA 1YK1A 2ZMEB 2W85A 3BWGA 1ON2A 4GO1A 4EJVA 1WETA 3DP7A 1LJLA 4LE2A 5IUKC 5DCFA 2MH9A 3QPHA 3HSFA 1ZGZA 3RTRA 3I4PA 1C0WA 3DGFC 2J5PA 3GXOA 3CUQC 2P7CB 3CFYA 1DP7P 2LP4Y 4AD9A 1GUBA 2WJWA 4ZYEA 1MJAA 4PGGA 1S29A 1O7FA 5JNTA 5DV5A 3A10A 2WJAA 1BI0A 3T8YA 4LK1F 5TPZA 1GHCA 4I09A 2EFWA 2BEOA 5LRSA 2VN2A 2K7LA 1JGSA 4RKQA 5D8LB 5DCMA 3HV2A 2JT1A 4G9YA 2GA1A 4UHJA 4OIOF 3MIZA 4M88A 3N0XA 1R7JA 1OYIA 1EFAA 3ZMSA 4W5QA 4HOBA 3EQZA 1ULYA 3A0RB 4RK1A 4UVBA 1CEYA 1QPMA 4HV5A 4W5NA 3TB6A 1U2PA 3E5XA 2L2QA 5KWSA 1R22A 1YK0A 3GBPA 3S2WA 4U7BA 4MQEB 4L85A 2JZYA 3HYIA 3N75A 3OMXA 3J80K 2K86A 2EV6A 1ON1A 2KIMA 4TV7A 2VOOA 2IPQX 2CHEA 1J75A 2PBIA 3TOBA 2PAFA 3GF2A 3R0JA 1FBSA 3I71A 3LUKA 4L9TA 4DQDA 4Y15A 3O75A 4RSMA 1H9CA 1J56A 3KFWX 4MQFA 4N0PA 4HF1A 1Z15A 2I6FA 5FGMA 4FE4A 3ZMUA 1Z2EA 1ZLJA 5EWLB 2HQOA 4OIQF 5EWMB 5J8FA 2WWYA 3QLVC 4AWXB 5B3JC 2FF4A 1R36A 3KCCA 3VNAA 4I01A 3CZ5A 3JPYA 4M73A 2FNPA 4LZLA 5KC9A 1OMIA 2FN9A 2M98A 4G7ZF 2YX4A 3DQVC 1XDSA 3QELA 1NXWA 3GV0A 3V7RA 4D74A 2LF7A 4A5NA 3IL2A 4A12A 2ZNZA 1OYWA 4MLCA 4RK6A 1KYWA 3LA7A 4MTDA 2HPHA 3VB2A 1B1BA 3WGHA 5CYVA 1KQ0A 1Z6RA 1LBHA 3O2QB 5JNVA 4MGRA 1ZITA 2FXAA 2KJCA 1RXIA 3DZDA 4MR8A 1XCVA 4MR9B 3IKTA 3F23A 4D6XA 1R5HA 1PNTA 1SD4A 1TM2A 3FMVA 5IT9Z 3T0YA 3NHZA 5BQ3A 4N47A 4CGZA 4CHUA 3C18A 2PUBA 5L3EA 5LGNA 4P55A 3D5LA 1OXBB 2L3DA 2XAGA 2PJUA 3F6VA 1U6GA 4H0EA 3WG9A 2HJ9A 3J80Z 3KYJB 1DCKA 4F06A 4LLLA 4EGZA 2E1CA 3DLBA 1J7KA 2HYGD 2L01A 1L0OC 3KCNA 4LRQA 4ETIA 1CGPA 4JK1X 1TW2A 4G94A 9ABPA 4Z9BA 2VK2A 3E6CC 2FMHA 3PQJA 3IWFA 2NT3A 2VC1A 2DRIA 3EQLF 1TNTA 4A0ZA 4NHJA 1A04A 1EWVA 3K0LA 1DC7A 1OPCA 2A9PA 4RB1A 2D1HA 4E7PA 1IN7A 1P4WA 3DF8A 3TD9A 3EGCA 2VT2A 4A6EA 4HQMA 1JDNA 4WT7A 2UWMA 2F8TA 3KZYA 2QM3A 3HSRA 3IRRA 4WWHA 3BDDA 2A9QA 5D4RA 8ABPA 4FT8A 4KVFA 2QQAA 2NZUG 5CLSA 4RS3A 2OQGA 1WQ2A 2QZJA 3M9AA 2FSPA 1FFGA 4BAYA 4PE5B 4G0MA 1V4RA 2OAZA 3QOPA 4GXOA 4I02A 4F12A 1URPA 1QQBA 5BS6A 2HEOA 2JK1A 1JYEA 2ZWMA 2IYNA 4ETSA 3O1JC 1W5SA 4KMRA 2DW4A 1TLFA 3QEKA 4Z0NA 3RIRA 5E18F 1XHEA 4N41A 1DBPA 1FBUA 3V8LA 1SAXA 1K7AA 4U7DA 4I0BA 3E61A 2E4ZA 2MYUA 5ABPA 3F8FA 3HXMA 4LE0A 2Q2EA 2QXYA 1O3QA 2HGCA 3GT7A 3WGGA 3FGZA 1IN6A 5LGUA 2IT0A 1PUXA 6PAXA 1XGMA 1USSA 4UVCA 1QBJA 1I1SA 3PQKA 1I3CA 2OA4A 2LSOA 1GXQA 3C3WA 5FLXK 2W84A 1IUYA 5FB2A 3T1BA 1BBYA 4ZZDA 3CDHA 1P6QA 1J0RA 1JFVA 4BHPA 1BDJA 2E1NA 4FB4A 2COMA 1QO0D 1YS7A 3DKWA 3P9IA 5BRJA 1QZYA 5LEKA 3T5XA 5DDGA 5DD4A 4KMFA 2ID7A 2QR3A 5BR1A 2JVKA 1BIBA 5AIPA 3J81K 3WTWC 4JBAA 3C97A 5K1YA 1FLIA 3GFMA 4WX9A 4TN5A 2DQLA 2CWDA 1PEYA 2WRZA 3M9XA 1NXTA 4M71A 2WB4A 2FSWA 1T38A 1RNLA 4PZJA 2J48A 1FP1D 4P9FA 4BNCA 2QUFA 2BBYA 4O1HA 4YO7A 1UDRA 5LLQA 3OLWA 1YYVA 4N9IA 4G8XA 4ESFA 2ID9A 1W9HA 3CO7C 5ICCA 1A0OA 3WU0A 3RVSA 1J9IA 4AIHA 5JR3A 3FZVA 4MS3A 3HUGA 1RZ4A 2FBKA 2V1DA 1Y1LA 5ED4A 3GRCA 3KP4A 1MDMA 3CTPA 4LE1A 1NXVA 2MSKA 3Q9VA 1ZESA 2DPDA 4BQAA 3IHUA 5FFZA 3HUTA 1E2XA 4KK3A 4MR7B 1BI1A 3RJPA 2R47A 5FWXB 2IW5A 3SQNA 1TJYA 3OQOA 4F3TA 5J8CA 4OOIA 1BM9A 5TJJA 2FKAA 3W6JB 2BGGA 3R0AA 3H1FA 4G0QA 2QVOA 3QRFF 5HOOA 1QGPA 5BOXA 3H5WA 2Z5UA 4LMYA 1ABEA 2ZMEA 3IP5A 2P7VB 3TQNA 4G0XA 4EQQA 4WZZA 3Q41A 4ZYHA 1IW7F 4Z9AA 3OMWA 2W25A 2FMKA 1LBIA 2QZ8A 3G85A 5PNTA 4LJZF 2PL1A 3QLTA 2E4WA 5ICGA 1MVOA 3ISPA 2E4YA 4XLTA 2GX6A 2LBPA 4O1IA 3F73A 2DQRA 2GBPA 3RVJA 1YTUA 5GQSA 1AWCA 4H60A 5L3BA 2P6TA 2GAUA 1U8RA 2ISZA 4KN7X 2IPNA 4YLEA 1XD7A 2X0LA 4L9NA 3TDUC 1JH9A 2M5WA 1FZPB 4EYGA 3U9GA 5LHHA 1TVMA 3F21A 1NXXA 4BYYA 4S04A 2PUAA 1F4VA 4OBBA 1JFTA 4OLBA 4ENKA 2F5FA 2EK5A 2C6YA 4WXHA 4KIFA 4BHBA 1YMVA 3OQNA 2IJLA 3JVDA 4RY8A 1XWWA 5KK1A 2FEKA 3UK0A 2HSGA 5LHIA 3FFXA 3BILA 5HDNA 2O8XA 1LQ1A 1QNTA 4XLNF 4D6YA 2QU7A 2RC4A 1TLHB 2JVIA 3MF4A 3KE2A 3K1NA 2QBYB 4JB0A 1LDJA 2IKSA 3RPQA 3Q9SA 1O3TA 4MQEA 2FVYA 4LK0F 1MB3A 3L6UA 2E4UA 4QWQA 2YU3A 4ESBA 4HDVA 5H6RA 1XB4A 5TPWB 1TNSA 3J7AO 2R4QA 1SXGA 5JS2A 2JRLA 5D6FA 4E70A 3CO6C 5IC5A 1Z12A 4HYEA 3HEBA 2Z9OA 2BE5F 2FOKA 3C6QA 1SMTA 3FXRA 3R60A 3K1MA 3T8TA 3H5VA 5KQLA 3T95A 1IF1A 3LUGA 4I98B 4IF4A 2ZCWA 4P1ZA 1W4MA 3ABTA 3SHFA 1JE8A 5EWLA 4G97A 3EULA 2WY2D 4EM0B 1G3WA 3SZPA 1H0MA 4BHCA 3C3MA 1D1PA 2DT5A 1M5UA 4A0YA 6CHYA 4BH9A 7ABPA 1ZH2A 1BA2A 2DFIA 1XGSA 1ZRFA 2MYPA 2DK5A 5HVQC 1NATA 3P7NA 2FBIA 4RB0A 1LVAA 2XGXA 1D8JA 2DU9A 3FM5A 1YO5C 4RK0A 5TQ0B 4JASB 4YRZA 1DPRA 2FQ3A 3LWFA 1K68A 4M6XA 2STWA 1PHRA 2H27A 3W9SA 5IEJA 4MR9A 1F5TA 3RVOA 1TQMA 4U0WA 3LQQA 1JWLA 1FFWA 3DFGA 4L9VA 2QLZA 2O6GE 2Q5CA 3K2ZA 4O5VA 2DK8A 2IA2A 4Q47A 5DUKA 1P6RA 2E4XA 3WTXC 3FF5A 5CNMA 4CO8A 2F2EA 1PUEE 4LG0B 1FX7A 2RN7A 1KRXA 3ZMDA 1I5ZA 3T8RA 1E6MA 1IAWA 2HQRA 2OQRA 1ZLKA 3A0UA 3F8CA 3HS3A 3GVAA 1O3SA 2CYYA 1ZYRF 5EEHA 2UZKA 4GYIA 4RY0A 2VONA 1Z18A 2DI3A 2IP2A 3GFIA 3ILYA 5FD5A 2XRNA 3WODF 3ABUA 1K78B 1O7LA 1R1UA 3GA5A 3N0RA 2BV6A 5HQJA 1IXCA 3ZP5A 1DBWA 3R61A 1JL3A 1KU7A 4IILA 1KGSA 4WXMA 3SG0A 2CW0F 3ZMTA 3EODA 1GUDA 2ZAYA 3GWZA 1BI2A 2P5LC 3D8UA 3L9FA 1B6AA 3I54A 1ZRDA 1UFMA 4ENMA 2GIVA 2MC3A 2VXZA 2BGCA 1K66A 4E7OA 5EWJB 3GO5A 2PE5A 2VBYA 3F8NA 4RXUA 4L0YB 2A07F 3E5QA 1ABFA 3LKBA 2UXXA 2MLGA 1I6XA 5F1RA 2PLNA 1ZY2A 2NNYA 4AVPA 1RZRD 1V3FA 5CJ9A 5BMZA 5CHYA 4RGRA 5LRRA 2ACJA 2IA0A 1EHCA 2EFPA 2H0AA 3HSEA 2D1VA 4GPAA 2MYTA 3E3MA 1F9NA 1YTYA 2MLKA 3OLVA 2PUDA 5IT9K 1FQWA 2O20A 3F7NA 2JTVA 1ZH5A 2ZNYA 2F5CA 2FMFA 2CGPA 1LEBA 1B9NA 1EH6A 2PUCA 1P4XA 4NQRA 5ICEA 1W7PB 3TMYA 3MWMA 3Q7RA 1LNWA 4RY9A 4Z4EA 1YIOA 3EUHA 3N53A 4D0PA 4Z4GA 5IT3A 4Z4CA 2P9HA 2XHKA 3QX8A 2JPCA 3BY6A 5K5OA 2K4JA 3LKVA 3O2JA 1P8AA 3GBVA 5IBQA 1Z1DA 1T39A 1W7PD 4MNUA 1SFUA 3B02A 3CG4A 3H1GA 1R5GA 2VT3A 4HX4A 1TMYA 3KYIB 2R7DA 3P9KA 4N03A 2IPMA 3EJWA 1MJ9A 5D5WB 4CBVA 4LFUA 3O21A 2TMYA 2F5DA 4RB2C 6ABPA 4Q6BA 5K5QA 1JXSA 2XV4S 1X3UA 3WTVC 2Y75A 3P9CA 2PJPA 4Y13A 2IVMA 1W5TA 1PP8F 3L7WA 1RXEA 1RUOA 1IN4A 4PEVA 4KDPA 4YFXF 3LA3A 4HDUA 1E6LA 3TO9A 4HLXA 3GFJA 1O3RA 2OD5A 1R00A 3IC7A 2KYRA 2XAFA 4ZPJA 1XDUA 1Y0UA 3KTOA 4MQ9F 2QW1A 2P6SA 3M1EA 3LUAA 4Q5SF 5DYMA 5D6EA 3H5IA 2YPRA 4EYQA 5CNKA 4ZMSA 4HLYA 3FXUA 3E6MA 4JAVC 2IDMA 4XFKA 1G6NA 4JP1A 1U5TC 1ONVA 3TKYA 1DUXC 2XUBA 4MYRA 3VFZA 3Q7TA 1XSDA 5C5EA 4FX0A 2MA3A 4P9UA 2ZKZA 4GCVA 2FU4A 3CJNA 2RNJA 3KEQA 1IRGA 4GGGA 2QVCA 3FDFA 3VNBA 3KLNA 2W24A 4MR7A 5FWXA 2CFXA 3DLHA 1UCRA 3BRSA 1SD6A 3QU3A 4N9HA 3JVIA 3MCZA 2JSCA 1G4DA 4YWHA 2VUHB 2IPLA 1F51E 2K02A 4AIKA 1RUNA 4RDCA 4EYOA 2PLYA 4R1HA 2HFHA 4P98A 3I59B 3TDZC 3OO1A 3JW4A 1T34A 4U88A 4OMYA 1BOAA 4XASA 4KIGA 2YR2A 4ZZLA 2V79A 2TDXA 2JCGA 4IRGA 2CHFA 5HLGA 3SY8A 1BAPA 1S3JA 5HM6A 2HZTA 4LLGF 1NXPA 4DN6A 2PUGA 1SD5A 2XKPA 1KA8A 2NRAC 4ZYGA 3KP3A 4N0QA 4PCQA 3BPXA 4RGSA 3PFIA 2AYXA 1FSPA 1MAVA 2EWNA 5FBHA 4UHTA 4RKRA 1R1TA 2VC0A 4TLMB 5JHUA 4RK7A 2RJNA 4MQVA 3HOSA 2WC2A 2GZWA 2F5EA 4G6DA 3GW2A 1H9TA 4MEXF 2GXBA 1EWTA 3DPLC 5E17F 2PL9A 4EM2A 4ZYLA 3A3KA 4RXMA 2IPAB 4HNRA 3F72A 3MQ0A 3LUFA 2QBYA 3KP7A 3HUUA 2R7FA 3ML6A 5D5VB 1HBXG 1ZAYA 3F22A 1BI3A 3C3KA 3QAHA 4EJUA 3GZ6A 1WSUA 3O2PE 1EH8A 4ESJA 3ZMZA 3L09A 3HHHA 5TPWA 1VKRA 1Z26A 4W5RA 2O0YA 5KI6A 4QICA 3O3KA 3HO1A 5BPDA 3I53A 3RYRA 5L3DA 1P6UA 3MZHA 4IHTA 3HRMA 1D3YA 5CVVA 2HQNA 4EM1A 5DCLA 2HS5A 4KZKA 4EVIA 4UV9A 2Z3YA 3WTUC 4AIJA 3EDPA 4G0YA 4W5OA 5HS9A 4L0ZB 2RVCA 3LA2A 1OXKB 4IRHA 4CXFA 4CYDA 4O5AA 2HDCA 4RK4A 4L5JA 2PN6A 1IZ1A 3TGNA 4OU0A 1NXSA 1HKSA 1D8KA 3M8FA 3KP2A 1U5TA 5D5UB 1LK0A 2O3FA 4IMIB 2A3SA 2HTJA 3SZTA 4Q48A 3CKMA 2ESHA 2XAQA 4YG2F 1R1VA 2YHAA 4RB3C 3MMNA 5TQ0A 2GI4A 2M87A 2WWVD 4JQFA 2CG4A 3RYPA 1QNLA 3LUCA 3MYYA 3BRQA 2RKHA 1CYEA 5HDGA 1RPJA 3IWZA 3KP5A 1IN5A 2VBWA 3E3VA 5AIQA 4L9JA 3WGIA 2QQ9A 1FSEA 3W6KB 1ZGGA 2QQBA 2A68F 2ZFWA 1LJ9A 1B59A 1FOKA 1TTYA 2H09A 2FBHA 1FWZA 1ZHFA 4DNCA 1C0EA 1DJMA 4ZH4F 2V6CA 3OQMA 3MFKA 4LG0A 3IPAA 1LDKB 4W5TA 3NBMA 1USKA 4O6JA 1REPC 2FW0A 3K9TA 4UXNA 3SFZA 2GKGA 1T6SA 4B09A 3LFKA 1B4AA 4Z4IA 1G3SA 2EB7A 5LHGA 3WTTC 3HOTA 1D4ZA 5E3JA 3VEPA 4F8JA 1DBQA 5A2QZ 4ASNA 1B9MA 1KU2A 1K78A 5KQGA 1R58A 3CUQB 1Z9CA 5J6XA 4EJWA 2XIGA 3NRVA 1U3EM 1MGTA 3BROA 1SMYF 4KREA 3JSPA 2M1ZA 4MS4B 1ODDA 2JBAB 5D4SA 1HKTA 1YMUA 4U0YA 5FWYB 2NAZA 4KUMA 4G0OA 3U1DA 1Z17A 1RZRA 5HS7A 3KHTA 3RVPA 3O1HB 2A6EF 3CU5A 3WTYC 4RGUA 2KRFA 5E20A 3U2RA 1JFSA 2HOEA 1CF7B 3C7JA 2R3SA 5JS1A 5EWJA 3HRTA 3N0WA 3LAJA 4KPYA 3Q5FA 1JDPA 1RIOH 1KU9A 1P92A 1HW5A 3E6BA 1MZBA 3ZQ7A 4KFCA 3HTSB 1JF8A 3IP6A 1OYYA 5ILSA 2O03A 3QPTA 4ETNA 2FMIA 1D5WA 1XHFA 2JPBA 1FY7A 1DCMA 3NNDA 4HV6A 3KEOA 2FMYA 2FEPA 4FX4A 5I4CA 1GCGA 3F8BA 4Y17A 3ECOA 1W7PA 3RVMA 1BC8C 3QP6A 1P4AA 4M6YA 3BPVA 3TO5A 4L18B 1MJBA 4IVNA 3FMSA 4Z4HA 1HXDA 3GLXA 5IX8A 2M8EA 2JRTA 3G3ZA 5HKOA 3QEMB 1FPQA 4M74A 2MSLA 3HTUA 2PEXA 4I7HA 2NT4A 3NNNA 2DAOA 2YHBA 2PMHA 4XLPF 2V0NA 4WCGA 1Z13A 1FYKA 3KJXA 2AYZA 1QP7A 2FLWA 3RPUA 1QZZA 3V7CA 3GZ5A 1Z6TA 3R6SA 4TMYA 5EWMA 4EGYA 1FP2A 4GYGA 4NCBA 4EVSA 1LEAA 5H20A 4YFNF 4CZZA 5D2CA 1VTNC 3CS3A 5DTEA 4OMZA 1ZG5A 2FTKE 3H1EA 2PFBA 3REOA 5DEQA 2B4AA 1DC8A 4JA2A 2P5KA 2EJRA 3FFTA 2HKOA 4ENNA 3LUHA 1J2XA 2AS5F 2KJBA 5CNIA 5JI6A 5IEBA 1QPZA 4IRIA 1W25A 4JOQA 1UHWA 2A61A 1G3TA 4ENJA 4I2OA 5FFXA 2X4HA 3T6KA 3GYBA 2HR3A 1VRVA 2KIUA 1HEYA 3E97A 1QP0A 4MAAA 2ISYA 1T0FA 3KKEA 4LD5A 3RH0A 3QLUC 4KICA 2EA4A 2LUOA 3ZN0A 1D1QA 4HQEA 3HDGA 3RVRA 4M9ZA 1F4KA 2Q0OA 4U0VA 1USGA 4KV7A 5T7BA 1MKMA 3HSYA 2A69F 2XROA 4LX8A 1SD7A 4I0AA 4KRFA 1TBXA 1DP4A 4HNQA 1O57A 2PQ8A 3EYIA 4R79A 3HJFA 3GEZA 2QSJA 4YIFA 4F11A 4QLCU 4O3MA 1JX6A 2WV0A 3MZYA 4P5OA 4IGAA 4Q6WA 3M6MD 1ZAOA 2EFOA 3GYHX 2VOPA 3FMRA 3B73A 2YSRA 3QU6A 3HIFA 3V7SA 1K79A 4IPAA 1XMAA 1FFSA 2NNNA 4G7HF 2L54A 2RV8A 3BJOA 1S6LA 1Z16A 1OR7A 3I0TA 1FNNA 1LB2A 3F8MA 3D0SA 4WXEA 5DGCA 3FMQA 4YV7A 5IUNC 2VE9A 4OG2A 2KKOA 3HHGA 5LBQA 3N6VA 4ZYDA 3I59A 3KETA 4YFKF 4RAZA 4A0XA 5ERIA 3JTGA 3I58A 1U2QA 2IA1A 3OLZA 3SNKA 4N0BA 3LUDA 1YFHA 1KRWA 1U78A 3JTEA 4EJOA 3SAJA 5TQ2B 4PICA 4Z99A 2FNAA 2MD5A 4RWEA 3V4GA 1J5YA 3KLOA 1Z2DA 2FQWA 5E1XA 2HYFA 4EGSA 4RK5A 3MAJA 4RV5A 3CRNA 2JB9A 1S8NA 2LNBA 3H5LA 5JNSA 1BDHA 2P4WA 5HLIA 1AB6A 3ZMVA 4A2UA 5E8IA 3MEXA 1Z05A 1Z7UA 1HW1A 1AOYA 2OBPA 3ROFA 1UHMA 5KQPA 2RDMA 2EFNA 3CTAA 5CVIA 2DBBA 1XSVA 1KQ8A 4HF2A 4RAYA 3F3XA 4MRMB 4PYRA 2H94A 2L4AA 3EAFA 4G86A 1VLZA 4RZSA 1USIA 1SFXA 2CWEA 3CNBA 1A2OA 2VYCA 2ZO4A 3M7GA 4WXDA 1FYMA 1LJUA 3WTSC 1QO0A 3L2CA 3IKVA 3OLYA 4KT5C 4XSXF 5JFRA 3KZZA 1U0SY 2G7UA 4YIIA 1XMKA 2JVJA 1XGOA 3DXJF 2DPUA 3H6HA 5HS8A 2FA5A 3IRQA 5DD8A 2CD7A 5L3CA 2PG4A 4UHKA 5K5RA 4KQCA 4EV0A 3I45A 3TX6A 4H3KB 2A6HF 2RGVA 3V8KA 2YX7A 3L00A 4QPJC 1OKRA 3SM9A 1DDNA 1EWKA 3HZHA 4OINF 4KK4A 5E1ZB 4Q4ZF 3O1IC 1YG2A 3VOEA 4EYKA 1MD0A 5HLHA 1I1GA 5CVRA 3JSOA 1ZDMA 2OENG 1YLFA 5F64A 3HCWA 3CG0A 4MEYF 5EEGA 3EETA 4IRXA 3FX3A 3QLUA 3H3ZA 3T38A 2LIVA 1L3LA 1GCAA 2EFQA 1QQAA 1JHHA 3Q15C 5TQJA
chains in the Genus database with same CATH superfamily
4J00A 2V1UA 4RTNA 1HORA 2R1VA 3CLTC 2CQKA 4IKEA 3DZ8A 3LSPA 5BO5A 5DKFA 4QJIA 2A5LA 5FPKA 3FWYA 2ZRGA 3Q8KA 5LM3A 1LDMA 5AXBA 4PGHA 3KKOA 3VNQA 3LA8A 4WLOA 4R9NA 2YZGA 2XZDA 3DKVA 4QPZA 4HAMA 3I6ZA 2I4NA 1G8JA 2TRSB 1RQNA 3TR6A 4PX3A 1VQOI 3NT5A 3IUNA 4B4DA 3TO6A 4CNQA 1M2FA 4U87A 4QL3A 1NUUA 5E8GA 2CH0A 3RHTA 3D0OA 1XMPA 2JKVA 5IJWA 2X6XA 5FWYA 4NJEA 2RD2A 2VXCA 5KTPA 3P9YA 3LTEA 3NWTA 3U4IA 4OKSA 3UEOA 3B1YA 1SCBA 1UDCA 3DZGA 5FLKA 1JECA 4YUYA 4IJAA 2W42A 5CA0F 4LMRA 3OP1A 3FBIB 5JVTA 4RHCA 1ZHHA 4U2EA 3UMMA 3DEYX 1FEXA 1BCRA 5TPZD 3IV5A 3RYIB 2CO5A 3CCFA 1K7EB 5B58C 2OHOA 3I9LA 1RVV1 1Q1GA 3GPLA 4UV8A 2H8RA 2XB5A 1X7DA 5CB4A 4RHEA 4X62B 2F4IA 1XEAA 4BV3A 1Z6YA 2H9YA 5FPPA 4RANA 4CF5A 4R1OA 4LJ7A 3QLVA 3A02A 1AZTA 1CJKC 3Q98A 2RHDA 4TUYB 3RVKA 4BACA 1BOFA 3CIFA 1RVDA 3A4NA 1DAMA 4X5OA 4MMXB 2ES4A 4LBVA 2XCIA 4TQAA 4IQJA 1Q0RA 3ZJTA 1RTTA 3QELB 4R8HA 4Q4LA 3QMVA 1NZDA 1DXHA 3IAS6 3SN6A 1ZG1A 2ZSKA 2ZWVA 3TMAA 1OV6A 5JVDF 4K28A 3FZYA 2I7DA 3K6RA 7REQB 3AJEA 4A93J 2XZOA 3FM3A 1P19A 1QIJA 1U7HA 4BQNA 3DFFA 2ET6A 3TQIA 4AMZA 5DUIA 3D3EA 1R5BA 4HDKA 3O2SB 4EABA 2YWRA 4MKIA 5B3SH 4FD2A 2BH9A 3M4OJ 4BNDB 1NJGA 2WY7Q 3SE0A 4B0OA 5DZSA 5AW9A 2VO1A 1I4EB 2VHWA 2YV5A 3K4PA 4F2DA 2A1UB 4TVOA 4QYWA 2WAXA 2FRDC 3OIVA 3R6GA 3DVSX 2G67A 2WNIA 3JSXA 5T5QA 3BMQB 5FRMA 5COBA 4KBGA 4R3WA 3QE0A 1MAUA 3TP0A 3LPNA 3I9V6 2A3NA 4XD7A 4ZA2A 1MT0A 2LNDA 2B61A 4JKYA 3K1PA 2GVNA 2R7WA 3H1AA 2W90A 5DCWA 1IH8A 2X22A 4PPYA 2NTNA 5C9ZA 2OCYC 5LMZA 1UC9A 5ILUA 3HR4A 4KO8A 1O1YA 3C14C 4GS5A 3RS5A 4XR4A 5GAGJ 2VKEA 2BY0A 1TQ4A 2LYCA 2DERA 3K0FB 1T9GR 1PJRA 4MA0A 4P5PA 3ED5A 3DCYA 4HMQA 1F7UA 4EUKA 3BRCA 1Y8CA 2RONA 4MJ7A 2VQFB 1J59A 3KALA 4DR7B 1SKMA 5TMPA 3E6DA 1UOEA 4NBUA 5TX7A 2Q3JA 4ZYTA 2FPPA 3FSGA 3RVQA 1L5HA 2YVAA 4QFMA 3WHPA 2PS9A 2II6A 3LMKA 3LT0A 2QR2A 2ASVA 4YCDA 3WICA 4ECEA 2EGGA 3IV7A 1T98A 3CLKA 2A5YB 3KQUA 2C31A 2IQ5A 5K0EA 5I9MA 3F6SA 2O23A 3HFRA 1GVJA 2GEKA 1HC7A 4CL2A 1WM1A 4OI1A 5TS2A 2J9GA 3I61A 1QHNA 4IDNA 4V3CA 3NXSA 3WTZA 5BSUA 3V7YA 3HZRA 4EJ6A 4D9EA 4J90A 3UJHA 3ANTA 3ZHXA 4OKIA 2AEMA 1Z91A 2PYIA 4ML3A 1JA1A 1RXSA 1NE7A 1Z38A 1IDN1 1AZWA 5I7VA 3P52A 2RNGA 3EZ6A 3VSKA 2KBFA 3RTRA 4P3OA 1AS0A 3R7FA 4RVOA 2OG1A 4GQAA 1Z5OA 2WJWA 2CYCA 2QX6A 4D0GA 4E08A 1BI0A 2WJJA 4PWYA 4CG1A 2FJ0A 3HO6A 4L0MA 2XXAB 1ETQA 3DCFA 3T4PA 1TNDA 2O06A 4PCLA 2LKXA 2BGNA 1CX9B 2IXDA 4HRVA 1ZP6A 1QWOA 1FRNA 1YO6A 1TPYA 4MCJA 4YALA 3MCUA 1YJQA 2XZPA 3H17A 4ZU1X 3TB6A 2ATXA 3PUVA 2XUZA 1FMLA 1QVRA 4QVKA 2O0MA 4BZZA 3KYLA 2Q2WA 5ARDA 3DVAB 3BZKA 1MKYA 4TUYA 5GVSA 1E1DA 4Y15A 3EC2A 3EVFA 1V8ZA 1J8FA 1GUUA 4XPIA 5FWNA 3N5KA 5JJIA 1TMKA 1DVRA 1RWQA 4Z53A 5AHWA 3VKWA 2OCCH 4I4TB 3F8TA 1JV2B 4BLOA 1O4WA 4CHGA 3DQVC 3QELA 2ZBVA 1ZYUA 4EEFG 5HHTA 3OPYI 3HCDA 3EGWA 1KQ0A 2QRNA 1WMBA 4UNNA 4BFVA 4MR9B 3TW6A 2XCUA 3BGIA 4KVZA 3TN7A 7REQA 1NG7A 3UTCA 3WBKA 1I2ZA 4EHLA 2C2GA 4YNBA 2CNNA 2VCYA 4CGZA 4X65B 3CZRA 3N07A 3TGWA 1PG5A 5CYOA 1FMCA 1LQ2A 4IGEA 1BHSA 4AQYB 1L0OC 2UZAA 4UXIA 4A0SA 5HUHA 4BNDA 2V7WA 1TNTA 3WYCA 1EAMA 1BXGB 4C5BA 2A1UA 5KYXB 4LWZA 6YASA 1J7JA 5L7WA 2PA0A 2WJZB 1E5VA 3NDPA 2XTMA 1WOYA 3V1UA 3BMQA 1XIVA 4O0LA 4MQ4A 4FHGA 1B1AA 4UFNA 4XB1A 4LCEA 1I24A 4Z7OB 3A4VA 2E21A 1CE8B 1Y39A 4R8RA 5B2EA 4DWWA 1E2JA 1OCRH 2VLIA 4N41A 4I0BA 4B82A 3QMMA 4GW3A 3K0FA 5ABPA 1KQPA 5LGUA 3ZVMA 2IHJA 3DULA 3EVAA 3CCJI 4PAMA 1H5QA 1UT8A 1LH0A 3N2GB 2NQ2C 1KE1A 1AF4A 4PTYA 1HDOA 3NGMA 3CCBA 3V8EA 1KR2A 3L93A 2ZUEA 2QW8A 1GV0A 3C97A 2HQAA 2ZYTX 3IXQA 2CWDA 3TKLA 2WRZA 4M71A 5BSMA 2WB4A 4YRMA 2C78A 4MCIA 4NUBA 3PPVA 1Y1TA 1JJ8C 1PT7A 3CA8A 4BVFA 4ESFA 4ZMBA 1SMKA 1GEGA 2ACWA 1TZMA 2B36A 1V7QA 4YAOA 2P0YA 3EUKL 3HB5X 4AIHA 1SHTX 1A9RA 3PJFA 1M54A 4J1TC 2X40A 3BN3A 2V1DA 1DC4A 1HE8B 1KOLA 3DV2A 2YZ7A 3EDMA 3AOEA 1TJYA 4KO2S 4IBOA 5K0GA 2VZ8A 4K6CA 3RRYA 3MKLA 2W98A 3W6PA 2CBXA 5TT1A 2ECFA 2KHZA 1UQRA 1DU0A 3DOJA 5KTTA 4DDHA 3ORSA 2E4WA 2E4YA 2BE9A 5HS4A 2I5UA 3EUAA 1YR9A 1P0PA 2OKCA 2V26A 1CRPA 3RHZA 2YTZA 5H9WA 1AM4D 2DWQA 2I22A 2ZTMA 1QYXA 3DT9A 2XXAA 4BJ6C 1QKJA 4F7DA 3HXOA 3VPBA 4UB6C 4DFDA 1LBEA 5TISC 1K89A 1G16A 3OS0A 4RYDA 4MA5A 3C2HA 1E60A 4NZOA 2P5UA 2F3UA 3WV4A 2RGNA 2RC4A 4PGFA 5GONF 5FNVB 2FWJA 4EFMA 4ALIA 2HYDA 3AC0A 4X7PA 4QYIB 1T3TA 2OYCA 5ILQA 2X15A 1JB9A 3O6VA 5JUWA 2E0IA 5LDGA 3CGGA 3UPDA 3DVAA 3VU8A 2C57A 3R3VA 2FOKA 3RRJA 1ZVJA 1OH8A 3N39C 2DPXA 1I32A 2QE7D 5EC8A 1YRHA 2I4MA 1Z34A 3EGOA 5HYVA 1DAFA 2IUYA 4I4TA 1TIPA 1D1SA 2W2PA 3MWGA 2HCRA 4X8OA 1DELA 2VC2B 3B6EA 1RC1A 5HS6A 3P32A 3G0IA 3JAKB 1WJDA 4RDXA 3HNOA 1FDRA 3W2WA 2AYYA 4RK0A 5TQ0B 1AA6A 3AM5A 2QKMB 1UIRA 1OC2A 3GELA 1XZNA 5DTJA 5C7IO 4MR9A 1TTTA 4AKGA 1CEEA 2VTVA 1L8XA 3OTQA 3PF8A 2AW5A 2GASA 4I6GA 4YEJA 4EA6A 4TV9B 2PLAA 1FJHA 2YOHA 3S3TA 5BSEA 1KRXA 1KBQA 1SXQA 2GZ2A 3LX4A 2E37A 1R0XA 5THQA 1BXGA 3K70B 5CX4A 2EG5A 5KYXA 5TB5A 2CKMA 3IEKA 1IVNA 4DDTA 4QOEA 4ZVUA 3N0RA 2VUUA 1F17A 1O08A 5LU8A 4JYBA 1WB5A 4MYTA 5EJIA 4JLOA 2VF5X 3F74A 1XCJA 3VUEA 5G1NA 2X9GA 1ZRDA 4JJAA 3THSA 1FSGA 3WK8A 1CE8A 4ZVSA 1AQLA 4JGBA 5EWJB 2PE5A 5B3KA 2P78A 4AJOA 3BWXA 3OBIA 2PMFA 3HPRA 3GCXA 3SDSA 3D0KA 1YBMA 4V0NA 4BO4A 1EUCB 4B7XA 1U31A 2JTVA 1ODIA 4DPLA 4DRYA 1EUDB 3TQSA 4TWBA 3DDNA 4CKEB 3OAAA 3FKJA 1R9GA 2IP4A 2Q5FA 5HOQA 2HIGA 3N53A 3TSWA 3UAZA 2RKBA 2WP8J 1UMQA 1BU8A 4K1XA 3N9IA 3BY6A 3URKA 2JFWA 5LQCA 4DR4B 3EVDA 3EXFB 3JQPA 5C4GB 1WXHA 2PANA 3ZQLA 3O4RA 3G2PA 3OYDA 4GECA 3S1AB 3RAGA 4RB2C 4URXR 3ZLUA 3VR5A 4HDQB 5HJEA 4DIEA 1UXIA 5DX1A 1JTFA 4Y13A 1ANKA 3OIWA 4PEVA 1FJ2A 2A88A 3ZK8A 3PXAA 1DAGA 3MAGA 1E9DA 1UMBB 4RIIA 2NTVA 1EJBA 1OSNA 4JSRA 1CC1S 1DAPA 4BJ5A 3CUYA 3IESA 3WGMA 4EYQA 3AMVA 4KMMA 2JW5A 2FFHA 3PZBA 3G2BA 2KI5A 5FOUA 1ERDA 2RNJA 3ESZA 2CFXA 1VLLA 5ADWA 4V0MA 1MBEA 1TYEB 3FWNA 3RSSA 4Y7NJ 3OH8A 5MGNA 3BJIC 4Y1RA 1RUNA 4CYCB 5F0CA 5AKXA 1GCUA 5FTKA 1FY2A 2WSSD 2OK7A 1WI3A 3ACBA 5CYGA 1GVNB 4PG4A 2WIDA 4PYJA 3CM0A 3C85A 4IVQA 3ZJYA 4IZIA 5A9SB 4DMLA 3PFIA 1J49A 4OUDA 2OAEA 2VC0A 2H8WA 2H08A 3FKSD 1IB0A 4B45A 4A03A 2ZDHA 1HOMA 2BGUA 2NOJB 2IZOA 2FZEA 5P8WA 5CB4F 1O6CA 5FNVA 5DNCA 3ZY5A 4QYIA 3ZWBA 1U02A 2ZUVA 2D5LA 2V98A 3D6FA 3ME5A 1N2HA 2XTAA 2YY6A 4DIDA 4G8BA 4IS2A 3RIMA 4PQYA 4IRHA 4CXFA 3DLIA 3RRNA 3TS1A 4BNYA 2PN6A 3VYSB 1AGYA 5JWOA 2QTMA 1T5LA 3AR6A 2QLLA 4EG6A 3GP8A 3ZLTA 4IMIB 2HTJA 2H0RA 3RT1A 4YCMA 4MWTA 1V16B 3JAKA 3GGSA 3R3WA 5TQ0A 2HZDA 2M87A 2YJTD 2WHXA 3IEMA 5HKKA 5JAHA 1QGYA 1QRSA 1WW3A 3KAPA 3I3OA 4CM5A 4YV0A 1CJMA 4MUYA 2ATVA 4IHQA 3FGPA 4MKXA 1R9MA 3G1LA 3MTGA 1ESMA 3KQQA 1TTYA 3PO3J 1E9BA 1ZW6A 1ZHFA 1F48A 5ANRB 6Q21A 4TV9A 1VQ7I 3ZDDA 4L22A 3ROQA 2WZQA 3WY9A 2GIZA 1JEYB 4DQVA 4D8XA 1WBJB 3FMGA 2GKGA 4H6PA 4R8LA 3HOTA 3HM5A 1ZBQA 4NCIA 1R6UA 4ZOBA 1C1DB 1B8IB 4RE6A 2YNMC 2C77A 3DF7A 1R5OA 5B5SA 2X3UA 1GNSA 2XGCA 4LGVA 1FBNA 3JQFC 2CMKA 2Q1WA 5D01A 1C0PA 5EWJA 1IHXA 5KKAA 4V24A 1P92A 1QVWA 4BMDA 4R1UA 1TCBA 3GEPA 5HOEA 1FY7A 1EUCA 4IH9A 2AQIA 3KT0A 2G1PA 3NHAA 3ZLBA 3W7BA 4G1BA 4M8SA 1EUDA 4GT1A 4CKEA 3ZWOA 4BNNA 4HF7A 1XL1A 1QBGA 1GYQA 5IX8A 3REGA 4FQ5A 1I0ZA 4JP5A 2R93J 4G23A 2BY3A 1NOIA 3CH7A 4L07A 1RC8A 3W3CA 2Z4SA 3EXFA 3LBNA 2VQHA 2AYZA 1LA2A 3FPJA 3PSAA 3S1AA 2NVWA 2AJBA 1Z6TA 2IRWA 4QZVA 2IBDA 4EVSA 5LZ9A 5I47A 2KP6A 4OO3A 4TS1A 1S2NA 1VYUA 1IHUA 1AUQA 1FYEA 1P9QC 2GN2A 1FIPA 4ENNA 3GOHA 1GR1A 2AS5F 2KJBA 5CNIA 1NQTA 4AO8A 1YBFA 2ERXA 3IPLA 4HPJB 4NCXA 5LFAA 1HEYA 3G2JA 5F52A 1CB0A 1M2HA 1T0FA 2CUFA 4LD5A 2IPXA 3Q87B 4JGIA 2DOKA 4M3FA 2PQMA 4MP8A 2BMVA 2A69F 4F4HA 1WEHA 1M2OB 2Z9CA 4R79A 2ENWA 1SC4A 1NX6A 4O3MA 4UPDA 2V7TA 1NP3A 3AKCA 1MC1A 3T99A 2WADA 3EEFA 4OX9Y 1Z7WA 4H59A 1FSFA 5HVNA 4G85A 1XMAA 2CLEB 3UKDA 1H65A 2RAVA 1TCVA 3S7ZA 4P0PB 4CYCA 2GN9A 4OMUA 3FMQA 2GPJA 4HY3A 3FXOA 4FFBB 2XVXA 4LMAA 3GVCA 1QH8B 3Q8WA 1GUAA 3WE7A 5EF6A 2HCFA 3OLZA 5A7FA 1WJEA 4A3MJ 2R79A 2F3PA 1TQ6A 1P4SA 3KLOA 2XPUA 3QE2A 3AOGA 4RV5A 5A9SA 3T54A 1IUOA 3ZMVA 1YI0A 2X0RA 1EWQA 5L4LA 3ZD7A 4I66A 3W2GA 1VYVA 3G0CA 2JJQA 5FUVA 1DRVA 1RHRA 5J1TB 3OYJA 4B3DA 1FFEA 5KYYA 1M34E 1WXFA 1LW7A 4ZCSA 1VCOA 2WFMA 1JILA 1F5SA 2P1RA 3H6HA 4BB0A 3EH2A 2DA4A 3L3BA 1QVTA 4TUYF 2FF7A 4DG5A 1IZ8A 2OPBA 2IGTA 4GM0A 4MIYA 4MV3A 3ZE2B 1TZ2A 3E7LA 2G71A 2C9ZA 2QROA 4W82A 1I1GA 3G02A 2DA1A 3BF8A 4MWZA 3G17A 5GTHC 1XRLA 5EQJB 1D0YA 1V16A 4OYYA 2OEPA 2DA6A 5EZHA 3VO8A 4QTTB 2XGOA 4UCQA 3G1WA 5I9TA 5HQTA 4E4TA 3V7WA 1UBNA 3JQBC 4G37A 1J2UA 1SGWA 5LC1A 2XUGA 3H04A 4RAFA 4NP6A 1KZHA 5JWHA 1Z0AA 1Y4AE 1SN7A 2W8ZA 4P08A 5CPRB 5A3RA 1L4MA 3KPYA 1YS6A 1JKQC 2H92A 1KTIA 2G7HA 2QN2A 3CNNA 2UYCA 1U2GA 4FQGA 4HGPA 3EUEA 5CLJA 3NBXX 3LOCA 4V02A 1U4SA 2W6CX 3R8XA 4C0XA 2NVYJ 4CZCA 3S1SA 1BIAA 5FFFA 4RGXA 2OO3A 1STZA 4RGQA 2J31A 1C1DA 6PFKA 1B8IA 1U7TA 4RU1A 1P0IA 1FDWA 4RTPA 5EGNA 2VJBA 2VSFA 5BWOA 4C7VA 3IEIA 4INOA 4QRHA 4BUJA 4QULA 4N7BA 4Z5XA 5JCPA 5JFGA 3UWSA 1HSTA 4HNVA 1UDWA 2QRGA 3DTKA 1AXRA 4M3GA 3LOPA 1OROA 5T3UA 3BBLA 2P9FA 1EJ6A 2P30A 2DFVA 4PC7A 5ITZA 1A35A 5H1YA 2DH6A 3T34A 4U0KA 4K8RB 3F6CA 1DU4A 2OZEA 2NV2B 3WJAA 2E6KA 4L4UA 5CVUA 1HE5A 5AOVA 4BBPA 3SS7X 2QDKA 3KZVA 2PX3A 4EVRA 3A01B 4DCPA 5JRZA 4ND5A 3MGGA 4ZI2A 2DUNA 3T3MB 4RTRA 1OLSB 3T5MA 3CEJA 5AP9A 3L8EA 1UM8A 4K03A 5LLDA 4NQZA 2A9OA 2KFDA 3MFYA 3NFYA 1CS4C 1DPUA 4Y2UA 1CW2B 1P1CA 2PT6A 3W78A 2VG8A 3WRVA 4DSTA 2WMOB 2R97A 3EMKA 4GEGA 1ZA1A 4MQFB 1WXIA 3JRNA 4YAIA 2OGUA 1O5IA 4MV4A 1PJ3A 2Y77A 4KVGA 1XXHA 4M76B 2BEKA 2WWGA 4EUSA 4N49A 3LBAA 3IDAA 5CCDA 1KL7A 2FFRA 4B6JA 2YX1A 1R23A 4E7SA 1PR0A 1WNTA 2QT0A 1XV5A 3NYQA 4RZXA 4AQDA 3VNSA 4HB2A 3FUTA 4CF4A 2X42A 4ZVNA 2OLEA 4PNZA 3OV8A 1YJXA 3LP5A 2CQXA 2CHUA 4M9SA 2Y67A 1QSGA 2OKGA 1WDTA 1RIIA 4OHBA 4MWEA 5DEOA 3MC1A 4CL8A 2JFGA 2XQVA 4D1YA 1BWPA 3OX3A 3GX4X 3SBEA 3F90A 1QPGA 3EIHA 3R3ZA 4I1SA 4FFBA 2PL5A 2W4MA 3DOHA 6AT1A 1QH8A 3O3MB 4M87A 4R1NA 2Q8KA 3HA2A 2N1BA 3QFHA 5FQOA 4CG2A 1XSXA 1KERA 1VLMA 3CRMA 4Z4FA 1F9EA 1FJGB 3VZQA 5FOWA 4CICA 2PUFA 1USVA 1YVUA 5EAIA 1JNXX 2HRBA 1HT1E 4P6VF 1RYNA 2UVPA 2XHZA 1QU2A 2XKJE 1UC5B 2GUGA 1SM4A 3AHHA 4ZRMA 5PGMA 3ZPLA 5K0ZA 4KLAA 4DLVA 2AXLA 2QTNA 2E34A 8ADHA 3ECHA 4HX8A 3GTQJ 2Q2EB 2I9PA 1T33A 2COBA 3H3UA 3MINB 2OU2A 3NEUA 3LYAA 4JS0A 1XGNA 1GAQA 4I4TF 3JREA 1Z29A 2JH3A 3EXG1 1FT9A 4ZRNA 5IJXA 2UXNA 1O0BA 2AOVA 2DMRA 2B4TO 5IVPA 4AKSA 2M0MA 2YV1A 1T9KA 1QAQA 3QPBA 2AG6A 1SKUA 3DTIA 4WKBA 2EFGA 3KSMA 5EPOA 4Y7DA 1QQIA 2A4KA 2E1PA 4FYMA 1ZAKA 4URYR 3WB1A 3RLFA 2PR7A 1V3QE 1H2EA 3FWEA 4Y2VA 4IJ5A 1ECLA 1P1BA 5K0BA 4OQMA 5G02A 2ELHA 4QECA 2Y3IA 1T1GA 1W52X 4MPTA 3OYCA 1RFGE 3PYMA 4XSZF 3M07A 4FHTA 3S70A 3EYYA 2GAFA 2WIFA 3TVTA 3JVEA 2J5BA 1HC8A 4KGZA 4JJ8A 3W9UA 3OZAA 2OZ6A 2EZUA 3AKDA 3WA7A 1E7QA 5IUKC 5DCFA 4AMGA 4L08A 2MH9A 3QPHA 1V5GA 1Q21A 4NEQA 3DGFC 1EFPB 4YRRA 3CFYA 4X64B 3OE4A 3O8OB 4KACA 3IPXA 2QPTA 1SPXA 1J06A 3LUBA 5IP5A 3G9UA 2I34A 4JUCA 4I5FA 3PXUA 4WLEA 4IUDS 3M81A 4UBMA 4LOHA 3ILVA 2KSQA 1JT2A 2IYWA 3KUUA 2R6GA 3RJTA 5FR2A 3GLFE 1Q11A 3A01A 2XMBA 4HV5A 1Q2UA 1N5OX 5H5JA 1P29A 1KYXA 1OLSA 2K86A 2EV6A 3FDXA 4B3RB 1Y4SA 2VOOA 4XONA 2CQQA 3F2VA 2OMEA 2PBIA 1NPDA 4FCYA 2K2WA 2ZIFA 5AKJA 2MCFA 4EP1A 4E6EA 2R6R1 4MQFA 1U81A 2LV8A 5ESDA 3J7AY 3LCMA 4NTZA 2IW1A 1V0JA 1WUJS 3IQFA 2AMJA 3OFNA 4I9NA 1JQ3A 5A4KA 1R36A 4TS3A 4RVUA 3P0IA 5KC9A 4P81A 5JFOA 2H52A 1XDSA 3GV0A 3FI0A 1SHZA 1CU1A 4F91B 1M2KA 2HPHA 1XZQA 3PFBA 3PIRA 4RLFA 4F8EA 2A7XA 2CHVA 3QIAA 1CQTA 4F6CA 4U2KA 4PBSA 2WHYA 3CCCA 1WQ1R 2HJ9A 3OKCA 5K3BA 1EWRA 2ZI9A 1M1NB 4QQNA 1LU9A 3IH4A 4ETIA 2X14A 4B1FA 4DV6B 2XUOA 2OO5A 3JRIA 3IWFA 2VC1A 2HXOA 1IG0A 1MQAA 1DC7A 3V8MA 4I4IA 2I4TA 2UWMA 4XTRA 2GLXA 1NI4B 1PFUA 3KIPA 5EJFA 5FIUA 4W63A 1E3QA 1PR5A 4CKWA 4C87A 3VMMA 1G7TA 3BFKA 5K7ZA 1DIAA 3PRYA 2M9HA 1QOQB 4ZGWA 1C9JA 4IEFB 3JD2A 3LX6A 4Q18A 5LQKA 1U2EA 5F9FA 2R5ZB 5JADA 1L7DA 3ZBUA 2H59A 2KPMA 1JR2A 3GRYA 4F12A 2MINA 5FNVF 4CLEA 2OA0A 1X9HA 3RIRA 3ITNA 3UG6A 2WV9A 1R7RA 3FHOA 3RUIA 4IJ6A 4OXKA 4WRRA 3FOCA 1DWQA 3IVRA 2BZ1A 3W06A 5B4TA 4PBTA 1DLJA 2Q2EA 4KXNA 5IPAA 2Q6IA 2NUTB 1NP6A 1F5NA 1XGMA 3VPHA 1Q7RA 2OA4A 3CMYA 2LVBA 4FKZA 3C3WA 2R86A 4LYYA 4U7PB 3KZXA 3WK7A 5IZCC 1I8TA 1FVXA 2KMUA 3KR9A 3GJ0A 4ZGGA 1V11B 1G1MA 3PPWA 4O0MA 1GGKA 4QBTA 1Z07A 4JUBA 1MBGA 1NV9A 4AMVA 4OK3A 1J0CA 2ZULA 4ZC8A 2OO7A 4P9FA 5A03A 4BNCA 1OWMA 2XXJA 1VQLI 1YYVA 3EZGA 4L9WA 3A2NA 5KSPA 2Q4DA 3L8GA 3PQFA 2QHXA 4E6KG 4TV9F 1B6RA 5J58A 3VOSA 4MW5A 2B78A 1PT6A 5CH5A 4UAGA 4GOND 2NACA 4WQMA 1V37A 2MSKA 2AS0A 2ZUSA 3L7AA 1HA3A 3K4NA 3TBKA 2I4IA 4KWCA 2G08A 1WW2A 3PXCX 4L4SA 3TTXA 4XUCA 3FNBA 4RDIA 5H4GA 4R51A 2CXNA 3I1JA 1T2DA 3TQNA 3QEOA 2C4UA 1L5MA 5FAXA 3PD7A 4HEHA 4NBWA 4LJZF 2LCQA 2I9KA 3KDPA 2W2LD 5DP1A 4Q19A 4TXLA 1EFPA 3HN2A 4KN7X 4Y6QA 3S2IA 4FZJA 4NJEB 2ONJA 1GPWB 4HUQB 5LHHA 1GG8A 4Z0PA 4BYYA 1GV2A 1T8IA 1DEXA 4YP0A 3WLMA 4E11A 4GP9A 1JPVA 4DEXA 4UAVA 2OORA 1XWWA 3AEYA 1P7WA 4YRLA 4LQDA 1A5TA 4BY7J 2HAEA 4PU0A 1L1EA 3IIMA 1RABA 3HJHA 2WF7A 2V03A 3WDSA 2FP4B 4D4LA 2HA7A 5JS2A 2VF4X 3VU3A 2C58A 4QSMA 2ME0A 2BE5F 2Z8YA 1H9BA 2JI6A 1NVGA 4WFKA 4HRXA 4Z9XA 1OT5A 5KQLA 3LUGA 2XB9A 1XVVA 3EUHC 2C8VA 3A14A 4N12A 4HNUA 4K6KA 1G3WA 5IKEA 2P27A 3PC7A 2DT5A 2IYQA 2KE5A 1ZH2A 5A5GA 1NSTA 3U13A 1YT5A 3AONB 1LVAA 2XGXA 5DWQA 1IJWC 1GPDG 3K3PA 3IBFA 4HDMB 3OYBA 2GCIA 1C8LA 3ZX4A 1MH1A 2STWA 1IFXA 4K81B 3G1TA 2B8EA 1QZEA 4FLMA 4C9YA 2G40A 2DR2A 3MIIA 1FFWA 5K0FA 3UF0A 4DLTA 1CTQA 1A82A 4QOJA 1EXDA 2AVNA 1EDDA 1QVUA 2ZRQA 2HQ5A 1M1NA 1I5ZA 1OB5A 4PJ0C 3DWFA 4CWAA 3AIOA 3T8RA 4G5FA 5GP9A 5HIAA 1BYIA 2IXAA 3GVAA 4CSWA 4IEJA 2PGOA 2WG2A 1IHPA 2DI3A 2QTTA 1T2UA 4NYIQ 3EBOA 5FPQA 2O8NA 2ZSFA 3ID6C 4B2YA 4D46A 2D5VA 4WXMA 2H7VA 1NH3A 4J3JA 5E9WA 4OQDA 2R5ZA 5K4AA 2VXZA 4C0BA 1JKFA 3BM5A 4YQFA 1RHMA 3AHFA 2GZ3A 3IDQA 4HL6A 4Y6RA 5CT6A 5J1UA 5CJ9A 2JC3A 2EJVA 2CS3A 2XT9A 1PW5A 3F7NA 4MI1A 1BJTA 3HKCB 3JARB 4J0IA 4UM9B 3WTCA 4NQRA 5ICEA 2JCYA 2NUTA 1DBVO 1G6KA 3V4VB 3PC8A 4UU1A 1NBOA 3KT3A 1VGQA 1HX7A 3EQ6A 4JC5A 3VWBA 5JYEA 1T39A 1V11A 3NIDB 2BLNA 4DA9A 3PDJA 4HX4A 1OPRA 1RACA 4CBVA 2ID4A 3CN9A 1YASA 3S4YA 1JTVA 5IP6A 3OUTA 4Q6BA 1H05A 3G7UA 2FSHA 4WH0A 3HQ4O 4LXGA 4O4HB 4X93A 2QD3A 5AHXA 2Y1KA 4BP3A 5BNIA 1FW8A 4U7HA 1PJ4A 4B85A 1G3QA 3GFJA 1FU8A 2GTHA 3CW2A 5ITVA 1T0HB 2NU7B 5FTWA 2YPRA 5CTAA 1HZZA 3W6VA 3SYLA 3ZE1B 3G6KA 1IG3A 5GZ1A 1UKYA 3OOSA 5D6NA 4ZT6A 5ALUA 4I99A 4IYJA 3VMFA 2XA9A 2OT3B 5E6SB 5L8VA 3NAQA 3NATA 1N36B 4YRJA 4XKJA 3BLYA 2FMUA 4N9HA 2ZJ6A 2BMDA 4IDGA 2P79A 1F51E 4KRGA 4HQ6A 2XBUA 4ILEA 4R1HA 3TUJC 2QW0X 3D6JA 2DC1A 1ZIPA 2WUVA 2DG2A 2KM1A 1T6XA 1MOQA 3EK2A 2DBQA 3T4XA 3WL8A 1G17A 1YHZA 1CULC 1U7DA 3QLJA 4U2GA 3S15J 5D3KA 5IXSA 5FJJA 2PUGA 2H51A 4EI9A 1RQLA 4TV8B 3DLTA 3ZC3A 1J0BA 2BDEA 4HUQA 3RREA 4PXYA 4PCQA 1QF7A 2HF2A 1XZGA 4W5WA 3IQXA 3JQ6A 1FSPA 3DEZA 4OA5A 1PBNA 5IJ9B 2G3YA 3O94A 3FIUA 1UKCA 3IILA 3L1UA 2Z5FA 1Z88A 3B1ZA 3NP7A 4ZTUB 5LJLA 1PR2A 4ZYLA 3KKLA 4JI0B 2HN9A 1BI3A 2FP4A 1WSUA 1XLTC 4D9GA 1NDUA 4YROA 3G2LA 2IXFA 5ULLA 3GPDG 3BTOA 1LX7A 2HS5A 3HBFA 5DCLA 4S24A 4KHPB 1GU0A 4G1FA 3B5EA 4Q21A 5BSHA 2LG4A 3VISA 3VH1A 4L5JA 1PEDA 2ZYIA 3ZE8A 2IEBA 2H31A 4GQBA 4XPIB 5I5EA 1RKUA 4YECA 2OAGA 1U5TA 4TM7A 1WJ5A 3ZCUA 2Q2NA 2QJTA 1J2YA 2NM0A 4ENTA 1WHTB 3TLZA 2ZWOA 4D5FA 4XL9A 1VL1A 4HDMA 1R27A 4IDBA 3K0AB 5EKUA 4NOKA 4B40A 1DL5A 3I1FA 3RFTA 1W2WB 4L9JA 1UP6A 4Q4HB 5AHRA 3OQ1A 1Z4IA 4AJ2A 5AI5A 1DJNA 2OWDA 3FAKA 2ZVJA 3OPXA 4MWCA 3I9OA 1QYVA 1YCGA 2UZ1B 5AKYA 1T4BA 3LSHA 5CCBA 1CZOA 1WJGA 2DPMA 3UBMA 4XA8A 3T7JA 3KZ1E 3TBIA 4J3NA 4DLAA 2PX4A 4RKEA 5B1SA 3SQDA 4F72A 2AFIE 1P1KA 3BWVA 1VHJA 4DOMA 3NVKI 4G5YA 4RA9B 1L7BA 4QQ8A 2ZPAA 1FS6A 4DYVA 4CGYA 1KU9A 2QTFA 4HXFB 3NO4A 3QVXA 2TSYB 5LBTA 5KNCD 4C3HJ 1FDSA 1C8BA 3N7UA 3HKCA 3JARA 3HYLA 1E3HA 3MEQA 3M3DA 5FWAA 4RZIA 1AZLA 1MJBA 1Y37A 1K9SA 1SURA 1YX5A 4Z4HA 1RRVA 2OAQ1 2VJIA 3G3ZA 4Q12A 2H2HA 5DOVA 2IPOA 1P0CA 1KI3A 5KDOA 3DA8A 2RBGA 2L0KA 3DMYA 1DB3A 4QQFA 4ZDLA 1OBFO 5SY4A 4TMYA 4NCBA 4L4YA 1KJWA 4OD0A 2B7LA 5KVVA 1JFLA 3I32A 2F9LA 4UUQA 5AOCA 5JAZA 4O4HA 4TYQA 4CQJA 1CUWA 2DLNA 4JA2A 1QE0A 1DUVG 1J2XA 4IRIA 4LOCA 1FNBA 4RA6B 3FUUA 1G3TA 4NBQA 2NU7A 1GNRA 4UDOA 2JKZA 1GITA 4R1QA 4PJNA 4D9KA 5CMLA 5IAOA 3G8AA 3QLUC 4NOLA 5CHEA 3CMEI 2YW2A 3T5GA 4UZFA 4DA4A 2XROA 4QXMA 1HE4A 2PZLA 1BJZA 3P2EA 4DA7A 2HI3A 1IULA 5JPCA 5E6SA 3CN7A 1FYWA 5E3HA 3IURA 2I3BA 4EI7A 4GPEA 1E3MA 2AE2A 2P41A 5D86A 3BJOA 1Z16A 3BR1A 4ID9A 3ZD6A 1P39A 2Y27A 1PUJA 2QSGX 4L9AA 4W7IA 3S14J 1QOZA 2FLVA 2WILA 1IMOA 3II6X 3B78A 3I58A 3QSGA 2WU0A 4DUGD 2Q3FA 2P2LA 1ISFA 2OV1A 5KAFC 2ZXHA 4XICA 4J1QA 4TV8A 5E7JA 3FW1A 1AV6A 2HVRA 1Z05A 5IJ9A 1Z5GA 3ROFA 3NC4A 1GL7A 2I6GA 3SZGA 3T0FA 4F55A 2V7XA 1XDZA 2UZ4A 3ZJ5A 4JMLA 5DLPA 1HDZA 1X8LA 3LHFA 2QNIA 4KMOA 4QTRA 2O50A 4DILA 1DV2A 5IP7J 1K6YA 4A2WA 4UD2A 4Q9KA 5BQPA 4HMOA 5JFRA 1FDUA 4HGRA 4C05A 2R8RA 2NP7A 3O8HA 3IMFA 3RF7A 1ECPA 4A0GA 3TZCA 1E0EA 4Q1AA 1J8MF 3ESWB 3L00A 1OKRA 3ZWVA 1ZGBA 3O1IC 3VOEA 3IXMA 5HLHA 2V6MA 4FFVA 1SXJC 3EETA 2AOWA 1U9NA 2BFFA 5A0FA 2EFEB 4PO8A 1WHTA 2G4VA 3V34A 4RVFA 4BOYA 3K0AA 2LDUA 3ND5A 1Z7LA 3VDNB 3VI4B 4J9UE 2PD3A 4Q4HA 4XGIA 5ILVA 5I51A 1HLGA 5HSGA 4JDUA 4WASA 3UJDA 4B74A 1RRGA 5K6AA 1K4KA 1Z33A 2A67A 2UZ1A 4XYLA 2QRZA 1XTPA 2QD4A 4I76A 3FPLA 2M4KA 4Z2YA 1GXPA 1W0CA 4QPQA 3ZY3A 1VJCA 2GEJA 1WH5A 4MV1A 1G6Q1 3ROXA 4XKCA 1X1CA 1VPWA 1M7HA 3T5TA 3LQ1A 3VH4A 4YXWA 2HLDD 4BTLA 1B6GA 1WXEA 1T2VA 5GPCA 4IZZA 4R2JA 2GMWA 4RA9A 4EFNA 3R9WA 4MVXA 4DKXA 2NXEA 3CX3A 1S9HA 2YN4A 5BPHA 4ROSA 1M66A 3ACCA 3LK6A 1X7GA 2BT4A 2VL8A 5B53A 3VOBA 1Y4DE 4V2UA 1NNEA 4CCMA 4BFSA 1KQ3A 3GL9A 2IX9A 4G9BA 3G49A 4K3VA 3H4IA 4YCNA 3M0EA 2IF2A 4GNRA 2IYVA 4DV1B 3OZIA 5H16A 4XI9A 3GWGA 4P9NA 2KLBA 1YL6A 4G0ZA 3NTRA 2G4LA 4JUDX 4MWGA 4EG8A 4TKMA 2Y9MB 2GA2A 4C0SA 4CFYA 1O94D 4HZFA 5HFJA 1CZKA 1FFCA 1XE3A 2RHCA 4UEJA 5GV7A 4Y2YA 3L82B 4RVGA 2O3JA 4YRQA 1JBEA 4NBTA 2OR3A 1F0YA 5F51A 3A1SA 1WVIA 3TO7A 1LSOA 1I1NA 2VVTA 3IB6A 4ILKA 4MVCA 4BVEA 1QA6A 4C4SA 1JHFA 4RA6A 2O48X 1JEOA 4B3CA 3C2BA 1E32A 1Z5WA 3NAMA 2W6JD 1YQXA 1KAGA 3MD0A 5IWAB 5J23A 1Z22A 4BQFA 4LQ4A 5KJFA 4XVQA 3WKBA 2QB5A 4Y2JA 1FSHA 2A59A 4WOBA 3A4LA 5DYNA 4D7AA 1GG2A 4UE2A 5AR1A 2J0EA 2GHIA 4KH1A 4OHVA 4Z2AA 5CG1A 3KSDO 2L7FP 2YYZA 1KK3A 3FBNB 3F7TA 3PEYA 5KTRA 5A2QA 5FLXZ 3EZ2A 1S01A 3CUSA 2H11A 3M4NA 3PIPF 4FGWA 1M2EA 4KQ6A 3WHBA 1HYHA 1IXSB 3RAFC 3NJRA 1QCZA 4Y1RB 1WW8A 2ORIA 1VRCA 2SKDA 4EPTA 2DMPA 1NBEA 3GG9A 1Z5VA 5F2EA 4K2HA 1BC7C 4EG4A 5AXAA 3K4MA 3T9CA 1E2BA 1LFDB 3VTKA 2J7KA 3IAS1 5KOIA 2CSOA 1R64A 3RSFA 1E3PA 3TL2A 1NK3P 1XZIA 3LSGA 3AWIA 3KFXA 1KQGA 4OQQA 4OUDB 1N6NA 4NU8X 3FUVA 4JB2A 4H4CA 1TM5E 1Q1ZA 3MTQA 1KOFA 4MROA 5TE9A 1FK8A 3F9IA 4JU8A 1CY2A 1M8PA 2QAGC 5CM8B 4EM6A 1L5OA 1BDMA 3W5CA 4F7ZA 4YBZA 3IERA 1NF8A 3OVMA 4X6AJ 3GGOA 3ND7A 3ESXA 4Z0HO 2GM9A 1TWHJ 4IEEA 5D00A 1LF5A 1YI1A 3KPHA 2FMXA 3H0KA 3KRTA 4FZVA 2ORYA 4FIZA 4BMCA 3PIIA 4AU7A 2Y0EA 1D0VA 1NTRA 1GZ6A 3RUAA 5E1WA 3I9V1 3RNOA 2VAWA 1IXRC 1O77A 1FLVA 1NONA 4TYNA 1F2DA 1G8YA 1IG7A 3OPNA 4HAZA 1ZWLA 2WAQA 3AVOA 3MM4A 4NB5A 4DMRA 4Y3UA 3PYXA 1U9YA 3PVZA 1LPMA 3LLCA 2GESA 2MOKA 4KYVA 2DWUA 1WR8A 3MRSA 3DZJA 3FLEA 1WO8A 1M75A 2FI1A 2HLPA 2H6CA 3WQBA 3GCDA 4V2IA 1WBBA 4LXXA 4AWAA 3BK2A 3L6EA 1Y9EA 1VZ0A 1SULA 2IEYA 4AJ9A 2OV4A 4XEHA 1VIYA 1VTKA 3PCTA 3WE2A 5HPYB 1XN7A 4KQWA 3LL4A 3C4QA 3JCZA 3VYRB 3HCPA 4MTCA 5D87A 4ZZ2A 1ON2A 1WETA 3WQSB 1OGJA 4LZWA 5EZYB 5KSZA 1UH5A 2LBFB 3PKIA 2P3LA 4QYSA 2J5PA 3BEDA 3GXOA 2CB9A 1OFCX 4XVCA 2ILVA 5CA1B 3WP0A 2EFCB 1USUA 2E36A 5DV5A 1TO6A 4BNFA 2CYBA 4KGDA 1D0ZA 1Y8RB 3H3XA 3B13B 1H9AA 3BA1A 1G7SA 1KJYA 4NMLA 5EP2A 3U1TA 3WFZA 4ZQHA 2X2FA 2CXSA 1XYYA 4G5RA 4EB0A 5HIJA 1US8B 4EY7A 2KHMA 4HH3C 1KY4A 3A0RB 1QPMA 4DCGA 2L2QA 5KWSA 4I1YA 3AUKA 2GJ9A 5E1DA 2ONKA 4DNOA 2VNIA 2Q3CA 1VQNI 3AHDA 2KIMA 3PS9A 2IPQX 1V3TA 5JS8A 1HDGO 4Z54A 1LI4A 1DC6A 3GRVA 4U02A 2ODTX 5JI2E 1X14A 1E9AA 4AG3A 3QLVC 2FF4A 3VNAA 1GNVA 1OCZH 2VBCA 1R71A 4ZCLA 4AG6A 3K8YA 2YZ2A 1FEZA 3FCCA 4ZHSA 3CC8A 1XTUA 4MGRA 1ZD4A 4GR9A 1BNCA 4IXNA 3I73A 4DQKA 1UKAA 2GJSA 3DVQX 1PV4A 4CHUA 4MQMA 3FD8A 4AKIA 1JSXA 2VWGA 4OQLA 1UXOA 3STHA 3KJNA 2EC5A 1NAIA 3KCNA 5K4GA 2B37A 2BI7A 2LD4A 4OH7A 1FZTA 4G01B 3GMIA 2RC6A 1A8SA 5JXGA 2VDNB 4QBFA 4J76A 4E7PA 3DF8A 3K1AB 4K8OA 1HWYA 2FUG1 5JQGB 3P9NA 2HA0A 4GEKA 1UPAA 1XU7A 2CNWD 3G9ZA 4KLZA 1X9GA 8ABPA 1HLPA 3TFQA 2ZRCA 3ZZTA 2HJRA 3NTQA 2OQGA 4LS3A 1EK1A 2PFSA 1OYVA 1WQ2A 1EX1A 3KR1A 1KEKA 2BRUC 3CH6A 4GZMA 4PE5B 3QOPA 1URPA 3AL2A 1JR3D 1O8BA 1J2JA 2JAUA 1PNOA 3QEKA 3W04A 1XHEA 3ZDZB 3GT0A 1E1CB 1KZYC 2C04A 2X1EA 3GYGA 1P7YA 1NVVR 4EUEA 1UPTA 3SFIA 4DBRA 3FDJA 3DVLA 4OFBA 2XGDA 3RC7A 5KYYB 2IV2X 5U4QA 3CQZJ 2DFDA 4AZ0A 1I1SA 3OPVA 4UUOA 1TC2A 4EO7A 3I28A 3DZHA 5AIBA 4YMUA 3OE5A 1P3Y1 1IUYA 3W3AD 3T1BA 3EDYA 1XVUA 1NN3A 3RU2A 4RJTA 3BJRA 1VDMA 5BRJA 1QZYA 1E0SA 1PV2A 4NBSA 5DDGA 5DD4A 5L51A 3MVEA 1WFXA 2BOVA 2I8DA 3C15C 5K20A 4WX9A 1RR7A 1NXTA 4AJPA 1T38A 3UGJA 3H2BA 2NIPA 1Y3HA 3RZOJ 3JW8A 1A31A 2IXSA 4UC0A 5K8UA 3I05A 1QIDA 3IVGA 4L6AA 3TG2A 1TXGA 5JR3A 1DBSA 2DULA 2FBKA 3IC5A 1U3DA 3KP4A 1GP2A 1RWPA 5BWLA 4TTPA 3KJZA 2X6RA 2FZ4A 3HRHA 4MUKA 3AHGA 3H3JA 2ECBA 1BI1A 1HOXA 1MO3A 3SQNA 3HL4A 3K94A 4L27A 5DYWA 7YASA 2BXZA 1G8SA 4AMUA 4ZJZA 4J8PA 2P7VB 2FF5A 2VB6A 3RR2A 3Q41A 4B48A 4OCZA 2W25A 5EZYA 2LBFA 4MULA 2CFTA 1KC1A 3ISPA 3L7DA 1WJFA 1GAJA 3RD5A 2WAEA 1OZAA 2GXQA 3GJ5A 4J2TA 2PX0A 2ZBRA 5CA1A 4H31A 1QQ5A 2XZTA 4EX7A 4OMFG 4JEIA 4F21A 5DBOA 4BVJA 1Y8RA 2G0AA 4PVDA 3BGDA 3AKEA 1ZR2A 3OZ7A 4I55B 2GS9A 5IC4A 3ONWA 4UUAA 1UBRS 5LZ8A 4JGGA 5ITZB 4PPQA 3WBBA 5C35A 5HDNA 3VU1A 1S3FA 1US8A 3LX5A 4PC2A 2JIMA 3OE7A 3MGAA 1NG9A 3VH3A 4FTHA 2ZIEA 2GJ8A 1YH3A 5IDWA 1HTTA 2AMVA 4BKQA 1KO5A 4GE3A 1H94A 3NOVA 4RD2A 3CD6I 3OESA 3TTSA 2Z9OA 1P3JA 1V7ZA 4O4HF 4RENA 3UW3A 1N7JA 1OA1A 3SHFA 3EULA 4F3CA 4Q00A 1HM5A 5C1OA 4BBSJ 2RIPA 1OXUA 4B2IA 4A2QA 4BH9A 2DFIA 5HVQC 1XXHB 2I1WA 2AMYA 2R5FA 4BEBA 1TQ2A 1AF7A 2VAXA 4R6WA 4RF2A 1Y9AA 4M6XA 4XCVA 2YC4C 2B1GA 3W90A 3NDJA 4U0WA 4BFTA 4CMKA 4LJRA 1QZTA 2IA2A 3MTJA 2R6AA 3NKLA 1REQB 1NM5A 2ZRHA 3L8DA 2PMBA 3WWYA 3L02A 4DJFC 5KAPA 1KPHA 2CMGA 1I6KA 3L4EA 3A0UA 3GDWA 2F1JA 2D6FA 2GYYA 3K1AA 2ZBDA 1K78B 3DEEA 1R1UA 4JR1A 1MJGM 5JQGA 3ZP5A 3QKIA 4KQEA 3OL4A 1J33A 4TV8F 1NR5A 3C6XA 3PLRA 4CTNA 1MO5A 2CW0F 3OM8A 3JYOA 1HYGA 4RELA 4EZIA 1IBCA 2Q29A 2DBVO 5K03A 4BFCA 3A1EA 1H8AC 2GIVA 3K0EA 2R1TB 4JI1B 1XNJA 2QJOA 1IHDA 1PJCA 3QVVA 4AO6A 4TXMA 4JLUA 3UM9A 4IKFA 2UVPB 4HVLA 5LRRA 1E1CA 2MYTA 3DE4X 4BVBA 4BVGA 5EHZA 4BU0A 1FQWA 2C99A 1SELA 3QVGA 4LJKA 1LEBA 1P4XA 2ZYVX 2B63J 3TMYA 1U5BA 1U2RA 4HK4A 4NH0A 4Z4EA 4EW6A 4RQBA 3K9WA 2P9HA 3RIYA 7ADHA 4EHBA 2R7AA 4L3VA 4ARAA 2OZVA 3QF4B 1WF6A 4MNUA 3U4AA 1SC9A 2G9ZA 3KYIB 5CT4A 1YE9A 1P61B 2E49A 3ZK7A 4LFUA 3BTUA 2PFGA 4HGZA 4CG0A 2ZS8A 2W2TA 5CVDA 3TLCA 1NBHA 4HQFA 1IN4A 2GO7A 3LA3A 4Y30A 4D4IA 2GEBA 1YDFA 2IBMA 3FTCA 2VPRA 4BNMA 3EDOA 3H5IA 5CPFA 3HMQA 4M7PA 4GC9A 5AK5A 1Q1AA 4XFKA 5TRTA 2PT9A 5H68A 5BWCA 1DUXC 2X2PA 2IGBA 4FYHA 1ONBA 3A03A 1I5OA 5FBQB 3OQHA 2V6FA 1XRJA 3AKZA 4P22A 4M1TA 3BK1A 2FU4A 1THGA 2XOKA 4MPRA 2VQEB 2XCRB 1XLVA 1LDEA 4KYUA 4UM5A 3WHKA 4RPKA 2FGKA 2CD9A 4BYMA 1KEVA 1KK1A 1WJAA 4LF7B 1D2RA 1EM8B 3P5SA 3AOEC 3LGXA 1EFUA 5KVQA 2ATEA 3FDIA 3VM6A 4U88A 1KZ6A 3O31A 3CMCO 4PX2A 1KMHB 5JNLA 1VKJA 3LMMA 4DCMA 4DN6A 4GZ3A 1TZCA 2BGTA 2P8JA 3VOAA 1D6SA 2HNHA 4NBVA 2QN8A 4I55A 1CUDA 4RK7A 1ZIDA 2FKNA 4IGFA 2F5EA 2OCAA 4KC0A 3F1LA 5E17F 3ZHTA 2PL9A 4NLLA 3KDAA 3MQ0A 2ZK7A 4JV5B 2R8BA 1YHQI 5LU9A 1U6IA 1Z26A 4I36A 4W5RA 5KOHA 3I53A 1WAMA 4IHTA 1MOSA 1ZOPA 2BGIA 5ALJA 2OGTA 3IAAA 3ZE7A 4LNAA 5TMBA 2Y1CA 2IL1A 4CMCA 3TVYA 5L7YA 1LI5A 4Q02A 2Z2XA 3A1NA 4FILA 5E3OA 1DU6A 2JDID 1NXSA 1W49A 2X8AA 5K3DA 3G71I 1SU8A 4QTXA 3ZCSA 2H1LA 2YS6A 1YQDA 2A3SA 2V6EA 1JIQA 4Q48A 4X3CA 3C5VA 2VQDA 3DDUA 2K6GA 3MMNA 3O4GA 2CLFB 5YASA 2PGJA 3D0RA 1FC0A 2C9YA 2CVOA 4UTOA 3AVXA 1EKEA 4OJTA 4ZCIA 4ZTFA 3SDBA 2QQBA 1KEWA 1B59A 1FOKA 2H09A 3NIBA 1REQA 2DU8A 3P19A 1Z5PA 3FWPA 4OFXA 5H9VA 2GKOA 4LHSA 1E79D 3TVDA 1K4MA 1ZJJA 2FEAA 4CIYA 221PA 4YTEA 2VKTA 4FFLA 4ASUD 1YQGA 1U0BB 1A8IA 3U80A 4A27A 1FNSA 4FFMA 1K78A 1IZ7A 4CQMB 4FDUA 2IZ0A 1BH2A 2XNDA 4ZDPA 2VWQA 1L7RA 4QTZA 1D04A 3U40A 1HKTA 4NQWB 4HAUA 3FVTA 1ZCZA 2XDVA 3QGMA 5HS7A 3WO1A 3S2FA 5IANA 3BR6A 4EL0A 1FA9A 4B7AA 4CKWB 4BC1A 4YMIA 2WQ7A 2W93A 1W76A 2R1TA 4JBIA 4LXIA 3UWPA 4E3ZA 3UENA 5JCJD 4AULA 4H7JA 1EXNA 5I7FA 3GXBA 2Y2UA 4LCJA 1H3NA 1IBKB 4E5NA 4HV6A 1ZD9A 1ULSA 2MINB 3KEOA 1B41A 3OR2C 1DFIA 2FMYA 5DM70 3OZSA 3R0IA 3HXQA 4ZOQI 4PPGA 2J3MA 1NQVA 4DYRA 5JJCA 5HZHA 2IGMA 1J2TA 2JSPA 4H7EA 1H42A 3KVYA 3D1VA 1K3FA 3N2IA 2EW8A 3QF4A 4KODA 4KLCA 4I7HA 4AN0A 4P0QB 4TS4A 4UEWA 4WCGA 2RGGA 5IF3A 3R5JA 4LYAA 3R6SA 5EWMA 2YS7A 4LYEA 1ZOIA 3JWJA 1ZX1A 1LEAA 2JHAA 2CVZA 1I6HJ 4UBKA 4EHDA 2N46A 2IYFA 3REOA 4G3XA 3ZHYA 4NFHA 3E5MA 1SQ0A 3U6KA 2B9SA 2IBTA 1EESA 4J7XA 3Q3VA 4TYYA 3ZN0A 3H6KA 1C7RA 4HXGA 5AUPB 4BGIA 5T7BA 4H6VA 1M3SA 1AMNA 3N3BC 1TU0A 4WKCA 3IR6A 1Z2AA 1L7EA 4IQ8A 2QVXX 2GLUA 1ESEA 3TZLA 2WV0A 1AHNA 2WPDA 4KIUA 3IPRA 1QZXA 4F3YA 2JFZA 1U0LA 3GRPA 4OUKX 1E98A 3PFCA 4OPMA 1FLNA 2YCBA 5J4VA 3FJOA 3ONFA 2ZZNA 2JK0A 5TARA 1EM8A 1JS1X 2WWHA 1T6YA 5I7AA 1VB3A 4BMOB 1S96A 2OGZA 5GGXA 1KMHA 4TLDA 1U78A 2CJWB 3KAKA 2P75A 2KDZA 4KQJA 5IVHA 3UV6A 4DCCA 2QMOA 3LV8A 3KWJA 3PDCA 3GARA 1R66A 1HEIA 5DMXA 1FU4A 4QHYA 1PX2A 1PJTA 2Q0XA 1YITI 4DY4A 1YULA 3FWZA 2XNCA 4LC1A 1XT6A 2JA8J 3CNBA 2X58A 3A9VA 1QGAA 1RZ3A