3C3WA

Crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
b'MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN DEVR
publication title Crystal structures of the response regulator DosR from Mycobacterium tuberculosis suggest a helix rearrangement mechanism for phosphorylation activation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c3wA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3wA01
1BM9A 2L3DA 2ZXJA 4RK7A 1DPUA 1S7OA 1C0WA 1Z17A 4RXTA 5TPWB 2HQRA 3I64A 4RY9A 2VT3A 1IIBA 3LA2A 1VRVA 2FA5A 3FXQA 3HOSA 5CVIA 1FC3A 5DGCA 1ZHHA 4EGYA 2OA4A 4XLNF 1R23A 5F6FA 4EM0B 1C0EA 4P9UA 1T34A 2WJWA 3LAJA 3CDHA 4KN7X 4RGXA 2M98A 1USIA 3QEKA 1B1BA 2NNYA 3RYPA 3MQ4A 3SHFA 4ON0A 2Z33A 2DAOA 2NZVG 3FXRA 3RPUA 1USTA 2LSOA 3GZ6A 2DK5A 1ZARA 1D1PA 3QLVC 1MJAA 1TLFA 1QP4A 4BNCA 2QXYA 2BBYA 3ULQB 1U78A 2QBYB 1KQ9A 3VEPA 4I98B 1KQ0A 3T1BA 1U5TB 1DRJA 1NXWA 4HX8A 4XASA 3P7NA 1QBJA 3Q5FA 2FQWA 2NAZA 3H5VA 3EYIA 3H5IA 4JBAA 2IT0A 3ABTA 3U1DA 3EULA 2L18A 1OR7A 3ROUA 2QSJA 5BQ3A 5T3YA 4R8HA 1GHCA 4PDKA 4EYGA 4WXDA 3L09A 2PI0A 3WG9A 2IKSA 4HF0A 3WODF 3JSOA 1DBQA 5DTEA 2V79A 4L5JA 2VE8A 1CF7B 1DC8A 3FFWA 3GX4X 3M9XA 4JK1X 1OMIA 3JAMK 4UHJA 4JQFA 1JYEA 5H6QA 3W6KB 3J80K 2FMIA 2QQAA 3N97A 2P4WA 4KN4X 4QLCU 1D1QA 4WK8F 1ZREA 2H27A 1J56A 1CEYA 2MBFA 1P6QA 1QNTA 3O2SB 3WGIA 2VONA 2M87A 4M6YA 2MYUA 4G0QA 2IPLA 4MHGA 3V8JA 2ZJ2A 3E3VA 3O6BB 1RXIA 4E7PA 1MJ9A 5IUKC 4L9JA 1IXRC 5JHUA 3T8RA 5D8LB 4LGWA 5D5UB 2J5PA 4WWCA 5E1XA 2H3HA 3WTTC 4TLMB 4NV3A 1OPCA 1W5SA 5DCMB 2DT5A 3JTHA 4HDUA 2JRLA 1U2PA 1JHHA 1MGTA 4RB2C 1VPWA 4OMYA 3A3KA 2BGCA 2H0AA 3LUKA 2QM3A 3Q9VA 2CSOA 3GWZA 5JNUA 2IP2A 4NCAA 1UHMA 4WT7A 1IN6A 2Q2EA 2NUBA 4EUKA 3ROTA 4A0XA 2O8XA 3UUGA 4RK4A 1J2XA 3QLUC 3HHGA 4ENMA 3O1HB 2XRNA 1ZVVA 2KJCA 1FYKA 3CUQB 3ELKA 3OV8A 2FMHA 4EJWA 3DV8A 1UCRA 1Z15A 1RNLA 2CQKA 2G9WA 4D0PA 1GUDA 2MSWA 4A0YA 3SY8A 4CYDA 4Q5SF 2PUEA 1O57A 4KDPA 1SXGA 4LDZA 4YWHA 4LE1A 1G4DA 4N9IA 4TN5A 2JSCA 5DEQA 3HUGA 1ZH5A 3I0TA 1SXIA 4KIBA 3NHMA 1P8AA 5B3JA 2DU9A 1O3SA 3KJXA 4P55A 1FFWA 5F1RA 1GUBA 4D6YA 3H5OA 2HTJA 2ZO4A 4UXNA 3H5TA 1JXSA 4XSZF 4EJVA 2LF7A 3H6HA 5TQ2B 2WMYA 3S99A 4CDGA 2B0LA 4NB5A 1DC7A 1K7AA 4OIOF 2FN9A 5LEJA 4Z4FA 3LUHA 4U0WA 3HSRA 1B4AA 2FQYA 3ERED 1I6XA 5LGNA 3LTEA 4KZKA 3K1NA 4JAVC 2M8EA 4KQ9A 2X4HA 3PQJA 3NBMA 2IA0A 2KIUA 1K66A 1QQIA 4P98A 4LG0A 4WWHA 1SD6A 1JBEA 1BA2A 2PUGA 1T39A 2KJBA 2NNNA 2R3SA 4YFNF 3BJOA 4DQDA 3CUQC 2P5VA 1NXTA 5EEGA 3DEUA 1R8JA 1JX6A 1SD5A 2G7UA 4Y13A 3SZTA 2A69F 2JK1A 2FRHA 4DADA 5EEHA 5EWMB 3GF2A 3DZDA 5HLIA 1LDKB 1K79A 1FNNA 1R5HA 2VC1A 5J6XA 3H5WA 3C3KA 4EGZA 2PUAA 3FX3A 2UXXA 2P6SA 2HEOA 3GYBA 2UZKA 3QP5A 2IPNA 2ADUA 4I01A 5KVRA 4MQ9F 5EWJA 1EAYA 3GEZA 4YG2F 4HLYA 4U7DA 1BC7C 3T6KA 1QO0A 3D0SA 2NT3A 2VN2A 2JPBA 5L3GA 5IC5A 4B09A 1KRXA 3MZHA 3IKTA 4RY0A 1EWKA 2V1UA 3J81K 5CNIA 2PUBA 1A2OA 2PL9A 2DFIA 2FMFA 1I27A 3QPTA 4WXHA 2GXBA 3HS3A 1PNRA 1K68A 3M9AA 3KKEA 3C7JA 2IDMA 2HQOA 3O74A 1J0RA 1XDSA 3FF5A 3ZMUA 3NNNA 5JNWA 3RQIA 5ICCA 1ULYA 4HBLA 2O61A 2DPUA 3N75A 2OENG 1OYWA 4G0XA 3I42A 1O3QA 4LFUA 4IMIB 4FB4A 4OU0A 1L5YA 2FLWA 1FP1D 1XGMA 4MR7B 3Q15C 2CHFA 2XAFA 1LBIA 1JDPA 1ZDMA 1IUYA 3RVMA 3WTSC 2PLYA 4CXFA 5ED4A 3LFTA 3WTWC 3LQRA 1Z05A 1TQMA 4RXUA 4MPTA 3LSTA 1UDRA 4HW0A 3KG2A 3ROFA 5T7BA 2K27A 1S8NA 4S04A 2FMYA 4H3HB 3CLOA 3GYHX 3LUCA 4KK4A 4RKQA 2BE5F 3CO6C 2QZJA 1S29A 4ZYEA 4HV6A 4IHSA 2QV0A 4G97A 4IPAA 1U2QA 3MFKA 4I7HA 3GFMA 2IA2A 2PUCA 3LUGA 2K7LA 3H75A 2HKOA 3I5UA 5FBKA 1BI2A 3QU6A 2GWRA 4A5MA 4GO1A 2HFHA 4KUMA 3GWGA 1LDDA 4O5VA 4JOQA 2EB7A 2QVGA 4UNOA 4G8XA 4RAYA 4A0ZA 1AB5A 1BAPA 4JP1A 3H3ZA 3GUDA 4G7HF 2NYXA 3F6CA 3DLHA 3K69A 1DUXC 2JVJA 3MIZA 1RI7A 2FEZA 1DP4A 2ETHA 1YO5C 3QK7A 1FY7A 1P92A 4WXCA 2HGCA 1BDJA 1WWXA 5TPZA 3E61A 1NY5A 5TPWA 4ESJA 3V4GA 2MYTA 1B9MA 1ABEA 2L2QA 3IP6A 4CZZA 3GT7A 2P6TA 1FYMA 3FM5A 4MAAA 3N0XA 1K78A 5TQJA 3FMSA 1D3YA 3RDIA 3OLYA 1L5ZA 1C4WA 1KGSA 2F5DA 2MLKA 3D5LA 3R4KA 2PAFA 4RK5A 4OTZA 2M5WA 1UB9A 5IULC 2OD5A 2CWDA 3F22A 3B73A 4IRGA 1DRKA 1OKRA 3FDFA 2V9VA 3TO6A 5K5OA 3OMWA 1USKA 1U2WA 3E5XA 2NZUG 1FX7A 1ZN2A 3RKXA 1G3TA 5LHIA 2RV8A 1RIOH 1E6LA 1PP8F 4ZYGA 2Z99A 2FSPA 4ZYLA 1ZGJA 4RS8A 3HZHA 3OQMA 1KRWA 1ISRA 3R0JA 5LEKA 1Z1DA 1HW5A 2X0LA 1U5TA 1ZLKA 1R00A 5B3JC 4D74A 4RB3C 2QZ8A 2YX7A 3KP6A 1HEYA 1QGPA 3BWGA 2A9OA 4HLXA 2IPQX 2FMKA 3GZ5A 4KV7A 2ZMEB 1Q1HA 3F6VA 3H92A 1REPC 4R1HA 1XHFA 4L0ZB 3TKYA 3GFLA 4M9SA 1CF7A 4F06A 4MLCA 1SD7A 2HDCA 2XKOA 1LJ9A 4AIJA 4GPAA 2ZWMA 2XAGA 4RK1A 2VXZA 4PGHA 3FGZA 1FWZA 1NATA 3I54A 3BBLA 2D1HA 3KTOA 1PUEE 4W5QA 1KMIY 5D4RA 3WTUC 2BGGA 3K9TA 4PEVA 1Z9CA 2CWEA 3HXMA 2GKGA 1HQCA 4Z4IA 4YFXF 2PJUA 3SG0A 4O3MA 4RGSA 2CO5A 3BOQA 5CVVA 3L9FA 1RZRA 2HQNA 4UVBA 1APBA 1LVAA 1E2XA 2LDUA 2IOYA 3JPWA 3SM9A 4RZSA 5DCMA 3JTEA 4GNRA 3BPXA 1SFUA 2KYRA 2NS0A 3N53A 1R22A 5HQJA 2WY2D 3GL9A 1JFSA 4M88A 1E2BA 2QWWA 4AIHA 3IKVA 1J9IA 3ZMVA 2EJRA 4F3TA 4MR8B 3O3KA 1YVUA 2WJAA 2O20A 4MYRA 1R36A 2PMHA 3O21A 1XSDA 1XB4A 3A0UA 2PQ8A 2O6GE 2UWMA 2P5KA 1MJBA 1W25A 4YLEA 3CUQA 2GBPA 5IT3A 1WETA 3I53A 4HV5A 3SQNA 3KLNA 4YGXB 1S3JA 1HKQA 4MS3B 3BRSA 4RK0A 4ML3A 3N6VA 4OLBA 2YPRA 4MQEB 3KP7A 1BI1A 2YR2A 5IEBA 4NICA 3WGHA 4OIPF 2A9QA 1ZAYA 4FX4A 1XD7A 3HSYA 3IP5A 3CHYA 4BHBA 3EQZA 4PZ0A 1B00A 2AXLA 3F8NA 3KCNA 5IBQA 3F21A 1EFAA 7ABPA 4LMYA 1QQAA 1G3YA 2PN6A 3WTXC 4HX7A 2A61A 4Z9AA 4WXMA 1IRFA 4YS6A 1OXBB 3OMXA 4WF2A 3RVOA 2MYNA 3CU5A 2QR3A 5EWLA 1YFHA 2R4QA 2WWYA 5A2QK 2XAQA 3A0RB 3LUAA 2D45A 4F12A 2H6BA 4N0QA 4MEYF 4HNQA 5TJJA 4IRXA 2OU2A 2QW1A 3BRQA 3W6JB 1KQ8A 3GA5A 4LB6B 1GXPA 1BIBA 3G73A 3C1DA 4L9VA 3HM9A 5E17F 3KP3A 3MYYA 5KK1A 1ON2A 3KE2A 3GFIA 4QPJC 2XUBA 1TNTA 2L01A 3I71A 3HO1A 2CHEA 5D5XB 5EWMA 5ERIA 3O75A 1NXPA 1T6SA 1RUOA 2CGPA 1O3TA 1FP2A 4ETIA 4G0OA 2FMLA 4EV0A 2ZAYA 2A9RA 3R0AA 3MEXA 1EHCA 2AYXA 2YHAA 4PICA 5LLQA 1ZH4A 4G94A 1ZRCA 1ZG1A 3T95A 4ENKA 4GYIA 4GYGA 2DK8A 2Z5UA 3NQOA 3RKWA 1IN8A 3HSFA 3RKYA 4RY8A 4A12A 2FEKA 4E70A 1DCFA 4UV8A 5L3CA 5CJ9A 5BOXA 1ZYRF 1OXKB 2YHBA 1LBHA 1F1ZA 1XDUA 5HDKA 3ML6A 4EJOA 1IAWA 3RVLA 1KA8A 5E3JA 1J59A 1P4WA 4Y17A 4OINF 1AWCA 1BJAA 1KYZA 4Q47A 2PE5A 2A6EF 1MDMB 1Z6RA 2D2WA 3CS3A 3RH0A 3OM0A 3MCZA 4D6XA 2XASA 4H60A 4HA8A 3ZN0A 1BI0A 3DLBA 3EYYA 3IWFA 4A2UA 3V7CA 1EH7A 3F72A 5KQGA 1HKSA 2EWNA 3CJNA 4KYWA 1HBXG 2H94A 5J8FA 1WQ2A 4OG2A 3MWMA 4AWXB 1R58A 2A5YB 1BIAA 4MR7A 5CNKA 4IMJB 1U5TC 5FFXA 1MB3A 2P5LC 3ZPLA 3OO1A 5HSGA 4EVIA 3DKWA 4HX4A 3C97A 2GAUA 2QVOA 2XHKA 4IXAA 5AIQA 1JFTA 1FPQA 5K5RA 4L0YB 5CHYA 1IN7A 2VE9A 4F7ZA 3TO7A 4BHPA 1W7PD 4BQAA 2COMA 1LEAA 1ZESA 4LDAA 1U3EM 1W9HA 3T5XA 4Q4ZF 3I59B 4EJUA 2XVCA 1PEAA 2FSWA 2G7HA 3F23A 3WE3A 4Z0NA 4G9YA 2R7DA 3O2QB 2A68F 3PFIA 4Y15A 3CTPA 3MMNA 1I1GA 2B1JA 4LX8A 2E7WA 2CW0F 1TBXA 3DBIA 5J8CA 3T8YA 3RYRA 1QNLA 2HPHA 1RPJA 3FZVA 3F8BA 4ZYHA 3L6UA 2Q5CA 3HOTA 4YR7A 1LJUA 2PMUA 2HWVA 3RVKA 2RJNA 1DJMA 4P96A 3TGNA 1FBUA 1P2FA 1FOKA 4EYOA 4BXUA 1EV7A 2PKXA 4YFKF 1G3SA 3LOPA 2FTKE 1LJLA 4ENNA 5CVRA 3CKMA 3ILYA 2FN8A 2ID7A 1YS6A 3KP4A 4RXMA 1EWTA 4G0YA 2N9UA 4M9ZA 4Q48A 3QX8A 1QPMA 2DTRA 3BP8A 4MTDA 3N0WA 5FGMA 4MQFB 1D5WA 2FXIA 1QQBA 2EV6A 1LEBA 4OIRF 1BDIA 1ZLJA 5HLHA 4RGUA 3CZ5A 1JH9A 5HS7A 1I3CA 3BROA 5AONA 1I1SA 1JWLA 2DPDA 3QEMB 9ABPA 5E18F 1BC8C 2ZFWA 1ZY2A 4RGRA 2H6CA 3E6CC 3KETA 3E3MA 1BDHA 3KS9A 1LDJA 5K5QA 3QRFF 1H9TA 3OQNA 4EYQA 2EFOA 4L85A 4KMFA 4FT8A 4UV9A 3DPLC 2GA1A 2MH9A 4BHCA 1P6UA 4NCBA 2D1VA 3QPHA 5FB2A 2GZWA 1GCAA 2KIMA 2YU3A 3O1JC 4XFKA 1DCMA 3IL2A 2ZMEA 2JT1A 3E5QA 2A3SA 1R7JA 4DNCA 4LB5A 4CICA 3EUHA 2EFWA 3V8KA 3LUDA 1NXOA 5FWYB 2QQ9A 1ZGAA 2OZ6A 2XROA 3I4PA 3G3ZA 1WRJA 1MKMA 2XAHA 1J7KA 1HSJA 5D5WB 2PG4A 3B02A 3CLKA 3M9WA 1HW1A 4EMSA 4KK3A 2PBIA 1CYEA 4HAMA 5HVQC 5KI6A 2M45A 3CRNA 1NHAA 5DKFA 1YW9A 1JGSA 5JNSA 4L18B 2FVYA 2OQGA 1IXCA 3GW2A 1J5YA 2QVCA 3E6DA 4IGAA 4NQWA 4EVSA 2DRIA 2C6YA 3HTUA 5BPIA 1DBPA 3G1WA 2EK5A 2Z9OA 4HDVA 4ASNA 2FXAA 2RDPA 3IHUA 5L3BA 2FKAA 3E6MA 5IEJA 3JTGA 3VNBA 3RPQA 2L02A 1ZAOA 5LRRA 2W24A 4OATA 5IUJC 4I09A 5ILVA 3CZCA 3TD9A 1P6RA 4RK6A 3FHZA 2LBPA 1EWVA 3TDZC 3VNAA 3TDUC 1CHNA 4ETSA 1NXVA 3RVSA 1QZZA 1IW7F 2JPCA 2V6CA 1JLKA 4TLLB 1PP7U 6CHYA 1F4KA 5CLSA 1M2EA 1TJYA 4FE7A 3IDOA 4KNYA 2ZKZA 4IJAA 3VFZA 2HZTA 3Q7SA 5FO5A 3DQVC 2K86A 4MQEA 5FWXA 4GCVA 2OZUA 1MVOA 1XSVA 2P9HA 3OOPA 4BH9A 4G7OF 1RUNA 5BRJA 2K4JA 1YYVA 2VBYA 1JL3A 4NHJA 2MC3A 4RSMA 4PYRA 2QYOA 2WWVD 4KVFA 2RKHA 2O3FA 4I2OA 3R60A 3QP6A 3HCWA 3IC7A 3MM4A 4GXOA 3O2PE 1ZITA 3AAFA 1SD4A 2KKOA 4HNRA 5DDGA 1KU9A 5TQ0B 2FLKA 3T38A 3L2CA 4G0PA 3BILA 4KPYA 3KFWX 2JB9A 3K1MA 4WUTA 1YW8A 4XXHA 1T2KA 4Z99A 3WGGA 1IN4A 4R79A 5JNTA 2LPMA 2F5CA 5E1WA 4M71A 1O7LA 4JASB 5L3EA 2QBYA 2E4VA 3HRUA 2RGVA 4Z2YA 4N76A 2W85A 3C6QA 5JFRA 2AYZA 4A6EA 2RGYA 3NEUA 2IRFG 3A10A 4I0AA 2VT2A 4HNSA 1VTNC 2JTVA 1TW3A 1QO0D 2GX6A 4RKRA 4LK1F 4Z4EA 2ZCWA 1IRGA 5ILUA 3D02A 4RS3A 1R5GA 3HHHA 1AB6A 1E6MA 5L3FA 4N03A 2HR3A 1ZRFA 1LB2A 2QENA 3BDDA 2V0NA 3KCCA 3H1FA 1SMTA 2KIFA 2EFQA 1YMUA 3FXUA 3NHZA 1OYYA 4P9FA 1JDNA 1MZBA 2DI3A 2R25B 1U04A 1FLIA 1W7PB 2MH2A 1ODDA 2IW5A 1TVMA 1Z25A 1STZA 1XMAA 2XGXA 4L9TA 1TQPA 2PLNA 1PUXA 5IT9Z 1MDMA 4H0EA 3V8LA 3OLWA 5CNMA 3FMVA 3IRRA 1SFXA 2TDXA 5BR1A 4RDCA 3HJFA 1TM2A 3HUUA 4LLNA 4UVAA 3VB2A 2NT4A 5FD6A 1HXDA 5KQLA 5AIPA 2FBHA 3RVNA 4EM2A 2XKPA 4EVQA 2K4BA 4MR9B 2J5OA 1PNTA 2RN7A 2IA1A 3LFKA 2X7XA 6ABPA 1O3RA 2HS5A 4KIGA 1R1UA 3H5LA 3P9CA 4OLAA 3O1IC 1ON1A 3CTAA 5F64A 1XGSA 1EH6A 2HTSA 1OYIA 4IHTA 5HOOA 4ZYDA 1U8RA 1D5VA 1MD0A 3EQLF 1MAVA 4IF4A 2EA2A 3COAC 3BPVA 3F3XA 2BV6A 3IPAA 4U0YA 1G3WA 4ESFA 3I59A 3I58A 1UFMA 2VUHB 1JHZA 1F51E 3GBPA 2BEOA 4ETNA 3Q9SA 5FLXZ 2VUIB 4QYWA 2RQPA 2M30A 3VOEA 4MGRA 2STWA 5JS1A 1J75A 4PCQA 3KLOA 1T98A 1Z6TA 1XCVA 1LNWA 2Q0OA 5JS2A 1E17A 1Z91A 2ACJA 1KU7A 4KICA 5D5VB 4OIQF 1EH8A 2R47A 1L3LA 3KEQA 4KRFA 3JAMZ 3Q7TA 2ID9A 4PGGA 4ENJA 3J80Z 4HF1A 4ZMSA 2O03A 3G85A 5TQ2A 2PUFA 4Q6BA 2K02A 2GQQA 1R1VA 3E97A 2L19A 3WU1B 1XMKA 2HYFA 3M1EA 1Z2EA 2JVIA 1A0OA 4JB0A 2P7VB 3EODA 2FU4A 1QP7A 1I5ZA 5IT9K 4TV7A 3OO0A 4B8XA 3KEOA 3I09A 4MQFA 4QICA 3JW4A 3LUJA 2TMYA 4ZPJA 5PNTA 1QKKA 3I45A 1K78B 3C18A 1F4VA 2F5FA 3LKBA 4LJZF 2XV4S 2HSGA 3FM3A 5DUKA 4HOBA 3JSPA 1NXSA 4MTEA 1ZGZA 1BN5A 3OQOA 4IRIA 3QEMA 2ESNA 5LHHA 4RU1A 1A04A 2XDYA 4MQVA 3LWFA 3GVAA 3LKVA 4G86A 3TX6A 3SAJA 5DCLA 4XLTA 3WE2A 3TO5A 1XGNA 1H9GA 2BYVE 2MD5A 2CFXA 3PQKA 2RNJA 3L49A 2GA2A 4ETMA 4RWEA 4L5IA 1PDNC 4YCSA 3BJ6A 1FSEA 5DLEA 1ZH2A 4G0ZA 1BOAA 2WC2A 5FLXK 3F7NA 1ISSA 1Z7UA 3EGCA 4O1IA 4FX0A 5CVJA 1B59A 3EJWA 1VLZA 2FQXA 4W5TA 3J7AO 2FNAA 2FEWB 3HSEA 3GV0A 3QX9A 3CNBA 3C3MA 3QU3A 4O6JA 3MAJA 2L54A 4MNUA 5FWYA 3EDPA 1ZRDA 3CFYA 2F8TA 1SMYF 1O7FA 4M72A 5BMZA 3KZZA 3NRVA 5LGUA 2CYYA 2QLZA 3TOAA 1SXHA 3JVIA 3VODA 4XARA 2Y75A 2I6FA 1BI3A 5L3DA 3K1PA 5D8KB 1TMYA 2CG4A 3SXYA 5C5EA 3L00A 3WTZA 4LE2A 2F8SA 3HK2A 4IILA 4M6XA 2B4AA 3HRTA 5LBQA 1DPRA 3N0RA 4CHUA 2XIGA 1YK0A 4L4UA 3QELB 3ZQ7A 5KC8A 2VBZA 3EDCA 1BVHA 4YO7A 1WKMA 2ZBKA 4OBBA 1CGPA 1Y1LA 2XAJA 3E6BA 4EYKA 1TNSA 4F8JA 3RTRA 4Z9BA 4RB1A 1Y0UA 5HM6A 2IYNA 4ZZDA 2STTA 5KQMA 4W5NA 5IUNC 3ZMZA 4P1ZA 2GXGA 1YMVA 1JF8A 5E1ZB 4MS1B 3RJPA 3K2ZA 2E4ZA 1YIOA 4LE0A 3GRCA 1AOYA 1WI9A 2VBXA 1K6OA 2V1DA 3F8FA 3WTVC 4YV7A 2GI4A 3ZMDA 1FBSA 2ELHA 3F6OA 5TRDA 1F9NA 4A5NA 1NTRA 4MGEA 2PJPA 2W84A 1G6NA 1P4XA 2ZNZA 4RB0A 3P9IA 4MLDA 1USSA 4N0BA 3SFZA 3WTYC 3H1GA 4UHKA 2EFPA 1X3UA 3FMRA 2IJLA 3U2RA 4UUVA 5HKOA 4YP9A 3ZN1A 3FWEA 3CO7C 3H1EA 4UVCA 1FT9A 3IP7A 3DF8A 2QUFA 4MS4B 2UXNA 1HSTA 1YS7A 1MIHA 5D6FA 2EV0A 3J81Z 2VK2A 3M8EA 3DP7A 1U0SY 5ABPA 3M8FA 4Q7EA 2W42A 2JBAB 4F11A 5IX8A 4MRMB 2L4MA 3QAHA 3V7SA 4XSXF 2O0YA 1BBYA 5DV5A 2HYGD 1U8TA 3CG4A 4ZMRA 3KYIB 1DCKA 2Y48A 4CGZA 2LF8A 5TQ0A 3OLZA 4LZLA 2J48A 3JVDA 1YTUA 3O2JA 3JY6A 2LUOA 2RC4A 3NNSA 4KA4A 1FFGA 4A6DA 3FMQA 3KHTA 3F6PA 4N0PA 1JYFA 5BPDA 5EWLB 2FNPA 5JI6A 3C3WA 4BAYA 4Z4GA 2NRAC 2HKXA 2Z3YA 3D8UA 3P9YA 2AS5F 2P7CB 3KP5A 3ZMTA 2W25A 4RV5A 5D2CA 5HDGA 3EQ2A 4TMYA 2LP4Y 1YTYA 3IRQA 2E4YA 3HRSA 4Q6WA 2DO7A 3FFTA 2VYCA 4XLPF 2A6HF 5E20A 2E4WA 2A9PA 5TPZD 3NNDA 1PEYA 3RVQA 2HQBA 4HQMA 3LQQA 5ICFA 2MYPA 3HUTA 2F5EA 1KU2A 1YG2A 2EA4A 1M2FA 2VC0A 4ZZLA 2GIVA 1T38A 1LK0A 2MSKA 3SZPA 4KQCA 5CNJA 1R1TA 1RXEA 4G6DA 1JHFA 1GLGA 3R6SA 1W7PA 4YIFA 1LQ1A 6PAXA 3MF4A 5ILSA 2H09A 2R48A 2MSLA 4N41A 2RVCA 1DP7P 1XWWA 2QQBA 4XRFA 2PMCA 3ZMSA 5BRAA 4Z4CA 3EETA 1IXSB 3GLXA 1Z18A 4PE5B 4OOIA 3L7WA 4MEXF 1QMPA 3JS5A 4KMRA 4XAQA 3OM1A 3OLVA 4U88A 5JVTA 5DD8A 3KP2A 2FQ3A 1Z2DA 4MR9A 2E4UA 5LGTA 4JA2A 4FHTA 2OBPA 3LA3A 3CG0A 4M73A 4E7OA 2JZYA 1ABFA 2PUDA 1W4MA 2ZNYA 2YX4A 3ZP5A 5JNVA 3HDGA 4Y9TA 4YRZA 4MR8A 1WSUA 4NQRA 4UHTA 1KYWA 1YK1A 4HZFA 4L9NA 5I4CA 1S7AA 1E6KA 3N8IA 2JVKA 2E7XA 1DZ3A 5H6RA 2FF4A 4AVPA 1T0FA 2P4UA 3MA0A 2WTEA 4LD5A 1YLFA 2WV0A 4ESBA 1DBWA 1DG9A 5GQSA 2FE3A 3IPCA 5D4SA 2ISYA 4MS3A 1QZYA 1NXXA 1URPA 1B6AA 1D8KA 3I5AA 3BJAA 2M1ZA 4I02A 1XSXA 1ZG5A 1RZRD 5H20A 4CBVA 3TB6A 3QLVA 3TOBA 1ZG3A 2JCGA 2EFNA 3H6GA 2DQRA 1HW2A 2W57A 2VOOA 1GVJA 4LRQA 1Z16A 3S2WA 3R61A 4G7ZF 5HDNA 2KRFA 4W5RA 5DYMA 3RI4A 2Q8KA 4KREA 3HTSB 3RVPA 2JRTA 3M7GA 2A07F 3F8CA 3ISPA 4EGSA 5BQTA 3HYIA 2HJ9A 3GFJA 1ZGGA 3V7RA 4WZZA 3F8MA 3OLXA 2DQLA 4XBFA 4HYEA 1FSHA 2E4XA 1XCBA 4AD9A 3MZYA 4S05A 2FBIA 3LUFA 1SAXA 4M74A 4EY3A 5DUIA 1XHEA 1TQIA 2LNBA 5LHGA 2FOKA 4EM1A 1P4AA 3LAPA 4H3KB 3HIFA 2LIVA 1D4ZA 5CYVA 4EQQA 1FYLA 3T8TA 1JFVA 2E1CA 1FQWA 3K9CA 2F2EA 3WU0A 2VOPA 3N4MA 2RJOA 4GGGA 3LA7A 1FSPA 4KFCA 4KIFA 4LG0B 3RVJA 4ZH4F 1RZ4A 4WXEA 2DBBA 1DDNA 2PL1A 4BYYA 2FBKA 4QYMA 3B2NA 5FFZA 2PEXA 4KMUX 4JB2A 2R7FA 3HEBA 5C5CA 5JR3A 1ONVA 4IVNA 1IN5A 1ZHFA 3DGFC 3QLTA 4RAZA 3H3UA 2L4AA 4CO8A 1H9CA 3IWZA 3REOA 4LK0F 2FW0A 2EV5A 4G0MA 4N47A 3KZYA 3DGEC 3JPYA 2LKPA 3RIRA 2OAZA 4LLLA 1FFSA 5K1YA 2MA3A 5D6EA 2HOEA 5EWJB 2YSRA 1QP0A 3W9SA 2PFBA 2IPAB 5TE9A 3DXJF 1UHWA 1SRRA 5DD4A 4PZJA 3ECOA 3QLUA 3URMA 1GXQA 2DLLA 2OQRA 1B9NA 5E8IA 3HDVA 5JNRA 1TTYA 2P8TA 2ESHA 4HQEA 4OMZA 2MLGA 1JE8A 1PHRA 1TW2A 4WX9A 1IZ1A 4U7BA 1S6LA 1Z26A 1L0OC 5BS6A 2M1BA 3E5UA 3HV2A 2VODA 1FZPB 5GOTA 3MQ0A 2FEPA 2ISZA 5ICGA 4EJTA 4N9HA 4LLGF 4IRHA 3BY6A 5LRSA 3QOPA 3DFGA 2Y0MA 4DQ2A 2QU7A 3QELA 5KWSA 2IPMA 2WRZA 3GBVA 4K2EA 5KQPA 1W5TA 4O1HA 5A2QZ 4AIKA 1U6GA 1M5TA 3ABUA 4I0BA 3BREA 4EVRA 3LMKA 3ILHA 3Q7RA 1SFEA 4YIIA 3TMYA 3HRMA 3HVRA 3Q41A 3EAFA 1KU3A 8ABPA 3ECHA 4MS1A 5DCFA 5HS9A 1M5UA 2E1NA 4KT5C 3TQNA 3UKJA 4FE4A 4Z4HA 5FD5A 3IP9A 3UK0A 1XGOA 2VBWA 3BZ6A 4QWQA 4P5OA 1MB0A 5E8GA 5ICEA 1IF1A 1D8JA 3RVRA 5CVUA 4O5AA 1VKRA 2WB4A 3U9GA 3KYJB 3K0LA 3F73A 4U0VA 2RDMA 3T0YA 4DN6A 1F5TA 4G6QA 1H0MA 5KC9A 5HS8A 5HLGA 3GO5A 2CD7A 3M6MD 3DPTA 2V1XA 1QPZA 4W5OA 4HF2A 1Z12A 4ZJPA 5FBHA 1Z13A 2L17A 1XN7A 3FFXA 4MS4A 1D2AA 1GCGA 1FBQA 1HKTA 5FWXB 1YQAA 1TLHB 1V4RA 1V3FA 2IVMA 3TO9A 1USGA 3KSMA 3SNKA 1YW7A 2JBAA 4MRMA 4M9XA 3K4HA 2DW4A 3P9KA 3CUOA 3GXOA 4WCGA
chains in the Genus database with same CATH superfamily
3ISVA 5IZCA 2ZXJA 4NFYA 3OU2A 3OZRA 4YMTA 4HAXA 2R8BA 3KSRA 1VIVA 2VT3A 4QATA 2W6IA 2WICA 1SFOJ 2VFAA 2HDNB 4K28A 3FUUA 1F17A 3RGGA 5AW0A 2M6RA 2O2EA 4JLBA 4DVGA 5EN4A 4YTEA 3BT7A 3PUYA 2VDPB 2DAOA 4BE0A 1ZH8A 1M5RA 2WMNB 3EEOA 1UBFA 4IKOA 2R11A 1IDN1 2GFIA 5IDXA 3KKMA 1NBAA 3Q5FA 2CC2A 2D1RA 2NAZA 2YJ3A 3K10A 1QBGA 1U0JA 3ROUA 5T3YA 2O0KA 3GEHA 1RYYA 2VF4X 3DJYA 2IKSA 1ADBA 2ZYTX 3HB5X 1Z3YA 1I9CA 1DBQA 1WX1A 2V79A 4DG9A 5ADUS 3VPBA 3GGOA 1MX1A 3LL7A 4UHJA 3HADA 5H4HA 1U7TA 2QKMB 3C6MA 4HJXA 2H27A 3QKRA 4BIMA 2LH9A 2VONA 2FZ5A 3DF9A 3VDMA 2IPLA 3GVHA 4FKBA 1E7WA 1QIJA 1WXIA 5JHUA 4K03A 5D5UB 3OJLA 4KW7A 2I9PA 1HM5A 4I50F 2DT5A 1H8HA 1W0JD 1DXHA 4ZEWA 3D7KA 3FKSD 1CUUA 5MHTA 1KF0A 4BRSA 3BSFA 3FI9A 1SBQA 2JUCA 4NBRA 4WBXC 3A1YA 4HQRA 4RK4A 3FBIB 3K1ZA 1YB6A 1O6ZA 4HCJA 3NUGA 1CLUA 4AIRA 1LTHR 3ETHA 1K8ZB 1A5ZA 2DYKA 4TMFA 3ZR4B 3MD0A 1ZINA 2PUEA 4RENA 4XDHA 3EOZA 1KFCB 3VR3D 3H7AA 1WDKA 3VOBA 4Y30A 1JHRA 5I7SA 1MRNA 4KMMA 5B6JA 1BOFA 1QUFA 3LCVB 5ITVA 3MJ4A 4WK4B 1NPTO 2IS6A 1O6CA 4UXNA 2QM8A 4QO8A 4JI0B 1W75A 1DC7A 3TMOA 3PNPA 4CKEA 4QGAA 4HXYA 1YQGA 4B31A 4CM6A 4ID9A 1L4HA 4JAVC 1NSYA 1FUYB 3OZDA 1N2SA 1YCHA 4P98A 1I36A 1SD6A 2PUGA 1B14A 1EWRA 5HF8A 3OYEA 5EEGA 1T43A 1DJOA 3ZHCA 1R4MB 3SDBA 2DH6A 3KOUA 5AD1A 4CHTA 1UAYA 2VJMB 3DP9A 3V8MA 4NIMA 3MVEA 5F1KA 1KJJA 1ETQA 4X6YA 1MIJA 3VV3A 1SUFA 5F23A 2QN2A 1TD9A 2ZI6A 2WSIA 3G9XA 4P4LA 2D8MA 2JLWA 1I27A 2C1EA 3M9AA 2IDMA 4JJGA 2R7QA 3EWAA 4FW9A 2MGQA 4KKXB 4PR3A 3AGQA 5JASA 4RPCA 3DZ8A 4GKKB 2F3TA 7MHTA 4B3DA 2DUMA 1CZOA 1O3QA 4LFUA 4IMIB 3STHA 5CFQA 1FUKA 4EATA 1ZD1A 1P62B 2B98A 4PLTA 3YASA 1NQTA 1UDRA 1EVKA 3IE0A 1BW9B 1Q7GA 1TB4A 5IJ0A 4OUDB 1NBHA 1W6UA 4OSPA 5E1DA 1HOTA 3K5PA 4BKPA 1YDHA 4OXQA 4CSWA 1CIVA 3ROZA 3MFKA 3GFMA 3C1OA 4MUBA 2XYRA 3DB1A 1J00A 5A7HA 2A33A 5EIBC 1Q17A 4O5VA 1ZGCA 5KPJA 3WHIA 4A0ZA 5DXJA 3FNEA 4LRTB 2OTJI 3TEFA 1YI1A 2OBXA 3K69A 5HZKA 4NKRA 5IANA 3OICA 3AG3H 4Z7NB 2CJWA 1CQJA 1DJPA 4TPKA 3TUZC 4GYKA 4YRAA 3TI9A 1EJ2A 3IIEA 3OE7A 5TPWA 3GCXA 1XA0A 1FYMA 1Z2AA 1VJRA 1O87A 2JFWA 4ARIA 1ETXA 1WB4A 3ESCA 2PT7A 1OT5A 2KB0A 2LIPA 1ZN2A 2K40A 1SZCA 4V0ME 1NUHA 3OQMA 5HF9A 4O4HB 3PPVA 2CLLB 4A8JB 5L51A 1A31A 3D1LA 1EI9A 3MS4A 1W76A 2O2JA 3DOHA 3W9BA 2BEVB 3C5CA 4EHJA 1XE3A 1GRQA 4IVPA 1B23P 1QPGA 3KQHA 3PA6A 4P34A 5K0GA 5F35A 1LJ9A 4AIJA 2FWBA 4MV4A 2X8BA 4L8VA 2HCRA 4IR7A 3BBLA 3A4NA 1Y7IA 3BORA 3T06B 1CP2A 2J3EA 4MKHA 2SICE 3FPSA 5FKKA 2OCXA 1NFFA 3PNVA 4LIVA 3BCBA 1AQYA 4V02A 3L7BA 2PGIA 4OIMA 2FYTA 2QMEA 1B72A 1YULA 1GJRA 4YAEA 2I4TA 4BFWA 5DCMA 3ZVLA 2MABA 3NXKA 3H1PA 2KYRA 4GICA 3X43A 2WY2D 2DTZA 3ZMVA 3M1AA 4R6XA 2QS9A 4V3CA 2GDJA 1GV2A 2ZIVB 4DDWA 1M33A 1FUEA 4IIFA 1R36A 2XC7A 4WXPA 1N6HA 4CYCA 1MOSA 2Y67A 3PUZA 5GV8A 5BMVB 1EIZA 1I30A 3KLNA 4G4JA 4RIEA 1MP0A 3UF0A 2ZQ5A 2D1FA 2YPRA 3KP7A 1RM0A 1B2LA 1K7EB 1QLHA 4IGFA 3PGMA 4A3SA 3NM6B 4LZNA 2EEZA 4FN5A 2C58A 3SFVA 4BHBA 5JLAA 3ZTWA 5I7HA 1T5HX 2FHSA 2UYQA 2NV2B 4UTXA 1UOEA 3AEZA 3DVAB 4UBLA 3KJZA 3IQZA 1GEGA 2DCUA 3DWIA 2X8AA 4YO8A 4J3NA 1RHRA 4TWZA 5DHFA 3FF4A 1PNQA 5C1IA 5AKHA 2P5UA 2FE1A 3KAQA 4MUFA 1U6IA 4XORA 5E17F 3H2GA 3MYYA 5ADVA 3GFIA 1CVRA 2FUEA 1XIVA 3HO1A 2K4MA 2O3TA 4QG3A 4M87A 3ABKH 2O8NA 2O0HA 1XVIA 4BC1A 4IUCS 2C2YA 4MX8A 4MK4A 2YHAA 2GCIA 3SE7A 4CLRB 4AF6A 4GBMA 3IO3A 4EPRA 5AI4A 4NR0A 4CKXA 2OBMA 4M7RA 3FKJA 4Q39A 3IX7A 4ANJA 4HS9A 1VE7A 4H2DA 5HS6A 1DTWB 2ZKIA 3RVLA 1M34E 5KOJA 4B3HA 1KNQA 5CH8A 3NCTA 1AXEA 2CU7A 3CS3A 3R3YA 4R2KA 2AOUB 5B55A 1KOJA 3L82B 5F33A 2ZREA 4K6FA 4HXGA 4LWQA 4D5GA 2ZTVA 5L95A 4NRDA 3UENA 1QFZA 2C2BA 5TLSA 3JWEA 4BQIA 3COWA 4YRDA 1FOEB 4EVIA 1TPZA 3DKWA 2XBUA 5MDHA 2J6IA 2BM8A 4L0YB 5H81A 1SHKA 5F27A 1HEUA 2ZVDA 4DA9A 4BQAA 1XF9A 2JKZA 2REOA 3DAFA 3U7HB 2IZ5A 1ILEA 3CMCO 4MDYA 2G7HA 2WR8A 3GAFA 2VTEA 1C1XA 1GQ2A 2X1HA 5HRCA 2QK4A 1SXPA 5SYMA 3VPGA 4DMKA 1BDBA 3DULA 1W6RA 3BC1A 3V00A 1H4TA 2VSFA 1Y1WJ 2ZKLA 4NZZA 3QFHA 2Q4BA 2Q5CA 2VS1A 2EILH 2IGKA 2Y1OA 1W5CC 2A14A 3TSCA 1Y0BA 3O84A 1OROA 1I3LA 1T4MA 1SPBS 4ZAXA 3DEHA 3NTLA 3BOSA 2XGDA 3KP4A 1W5BA 4G0YA 4FC7A 3I55I 2J3IA 2ZIXB 3I0ZA 3DDHA 3A11A 2VJCA 3G79A 1D2NA 2GYUA 4HZUB 4BLPA 2JIOA 3WDMA 4LG1A 1O9GA 4RGUA 3BROA 2QZPA 4ZDOA 3A2MA 5LBTA 3AR9A 3WIOA 2Q9UA 1TAHA 1E3HA 9ABPA 5L6LB 2W98A 2ZFWA 2AFHA 1VCHA 2F3RA 1MFPA 3KSAC 2OB2A 4OGLA 3LLSA 5GVRA 1RRPA 1B26A 3AM1A 5G1OA 5DYIA 3Q7QA 1Z0UA 1G3RA 1RR6A 2A0FA 2DGDA 3LSHA 2L7FP 2H9AA 2WLSA 2CUEA 3GBGA 3E5QA 2HQ1A 3BGOS 4PU0A 1CZHA 3IUJA 5C52B 3WGZA 1DUVG 1WRJA 2J67A 3CDLA 1IG3A 5CH5A 2HV8A 3EWNA 3EGXB 3HCBA 2XMQA 4RAGA 4MA4A 4I5DA 4HEA1 4IV8A 2XSJC 3OETA 4EKDA 2GDZA 2J3MA 5LLSA 3ITDA 2LV8A 3LT5A 1N34B 2JJ1D 2OGTA 3OI7A 1ULAA 2PAAA 2VPIA 1Y1KE 1DINA 1U8XX 4DR4B 3PJFA 5L3BA 1R5OA 3R9XA 3EGWA 3WQSB 4RZIA 5LRRA 2ZT5A 4NCXA 1U8AA 3VKUA 1EVZA 4NAVA 4NPAA 1V5GA 2ZSBA 2A0WA 6CHYA 1LTKA 4EZEA 2I4LA 2VPWA 2F8MA 3Q7SA 5HKKD 3DQVC 4TQUS 1O7JA 1UMCA 3UT5A 4BWGA 1Q6ZA 4OK3A 5IJWA 4BH9A 2VJNA 1QXSA 1B0AA 4NHJA 2ET6A 1RWMA 1RC0A 2FW6A 2VUSA 3KELA 3AHEA 2AXEA 3A4IA 3OZSA 4PYNA 4CTMA 4UZEA 1SD4A 3WKEA 1AZLA 4M3BA 4JOSA 1S72I 421PA 3ZE6A 1BFUA 5JSYA 4FISA 1HQYE 2XZTA 1TEZA 3U1KA 1WUIS 3KBBA 4BNMA 4LFBB 4PZUA 4N54A 4C7BA 2CMHA 4JASB 4A2PA 1CPYA 1FDWA 4UZSA 3A10A 1DTSA 2BMVA 2NWQA 3Q4GA 4DWWA 3W34A 3ZWYA 1T8SA 1L7RA 4J0DA 1UEJA 4OFXA 2EFYA 3RJ5A 4S0HB 4URUR 2HD4A 3SHVA 3FNQA 4ZVVA 4MVXA 1GPKA 1W7PB 2MH2A 2A0UA 1SULA 1OQYA 3JYHA 3PQFA 3RPUD 5L4NA 2KX7A 1JHYA 5E38A 5EZSA 4MCHA 3K0CC 1BD4A 2OORA 1EZ4A 3E9YA 3HPGA 4DRZA 5CNMA 2ZJOA 4QUHA 3JARB 1YCDA 1NW7A 2R87A 4UVAA 2RHGB 1NKVA 3E3NA 3L02A 4Z6KA 3JVVA 2BHZA 2P4SA 1YUMA 4M49A 5JXHA 3BFVA 1TFUA 1FL9A 3QBVA 4WACA 1E3QA 4DCTA 5AJTA 1X1DA 1XGSA 4MP3A 4KWTA 3EQLF 5HODA 1BD3A 1LQUA 2IS2A 3GEIA 3OMLA 1PJQA 2PX6A 2VQ3A 5KNDA 2I3BA 3LCJA 3V8VA 3RVDA 2I71A 1YRYE 4MUIA 2YDXA 3VO8A 3VVCA 2WF8A 1ZUWA 4RMIA 3DZJA 3BZUA 2I33A 1T8UA 3OUUA 3IGFA 4AD8A 2X58A 1YX3A 4ZMSA 2IYSA 4Q6BA 2GQQA 4XW2A 1POXA 3JD1A 4JB0A 4MWDA 4YJ3F 4TV7A 5LR6A 3SIRA 3JW4A 2UUBB 1TRHA 3L4KA 4EHIA 1C4OA 2HRCA 4MGKR 4YXWA 4ARSA 1S7EA 1OX4B 3JYLA 2O3UA 3NFRA 3VTZA 2D5AA 4R5HA 1PZMA 5D3ZA 3E27A 4G86A 2VP0A 4HAOA 3K9BA 1CUZA 1IWPB 1RTTA 1AU9A 2ZWIA 3QE3A 4G1CA 4HNUA 4OJQA 2QTHA 1GQRA 4P08A 2I2CA 2RHBA 5CLLA 4JD5A 2MINA 3PD1A 3NAZA 4BUZA 3EGCA 1L7QA 2BKUA 1YAJA 4O8ZA 4AQDA 3UMSA 3G1MA 4W5TA 3DHYA 3LO8A 3QFTA 2C8KA 3EARA 1PFYA 4HUQA 1IVYA 2QQFA 2YHIB 3KZZA 2H1IA 3CH4B 3WWOA 2EQAA 2I22A 2B1IA 4US0R 3WTZA 4LE2A 3PU6A 2WWXA 1JZQA 5JQGA 1MJ5A 3N0RA 3LH5A 3L79A 3SE0A 2C83A 4BPBA 5KJ1A 1QVWA 1OTXA 4YJGA 5F0CA 3CESA 3HU3A 2K7ZA 3KNZA 4Z9BA 1UBLS 4YP7A 3BH7A 4OI4A 1I3MA 1UP7A 2B2CA 3FAKA 4H7EA 1BMFD 1V8ZA 5BSGA 2FX0A 2EARA 3LRPA 4JN6B 1KJNA 4WKCA 1F9NA 5IOYA 4A5NA 1SVOA 2HVRA 1T2VA 1KH1A 4FGKA 3H1GA 1YF3A 2Y8EA 3V42A 3GJ3A 1VTKA 5CIYA 2E18A 3CE9A 1Q5PA 2AQFA 5ILGA 4DIKA 2PZJA 3W5JA 2BFBB 2UXNA 3ZW7A 2XRYA 4ABYA 3OKFA 1U0SY 2G70A 2CKDA 3QW2A 4EMBA 1ISJA 1LPMA 3V8BA 5ELLA 2E60A 3E23A 3IALA 4MRMB 3BZBA 1T3HA 1XS9A 4BQNA 3LYLA 2J48A 3FNHA 3AONB 1SBNE 3OYJA 1E9AA 1OCOH 4UM7A 4DA6A 1MA0A 1BWQA 1J0AA 4X65B 4X3OA 5FOUA 1PR2A 1CUVA 3OYHA 4BUPA 4RGQA 4A6PA 3CB4A 2HL6A 3MCWA 1XPOA 1QDLB 1ZUNB 3MWDB 3W6NA 1YTYA 4DR7B 2IEKA 3ZZ0A 4HWKA 3CCFA 4U0JA 3JQ9A 2DO7A 1OFGA 3K35A 3TDNA 1NVUQ 3CEAA 1YVPA 2AH5A 4HQMA 1GN8A 3FBNB 3C16C 5E6SA 1Z5ZA 4YRLA 2VF2A 5M34A 2HNBA 1T3LA 2IYLD 3RQSA 4HS4A 2YN0A 5DDIP 2B7BA 2CXOA 5FL7A 4LV5B 4PRYA 4ZAFA 3U3KA 1TCUA 5KIAA 2BMWA 4N41A 1BVUA 4XRFA 1I5OA 1S2NA 5BRAA 1Z18A 1ZK3A 1KK2A 1XCOA 4KO8A 1DOHA 2JD2A 1R6DA 3PEWA 1IPHA 5E0OA 2SBTA 4M73A 2JJYA 1MW7A 3KKZA 4R2XA 1HGXA 1WHSB 1H65A 1QHNA 4OH1A 4Y6PA 3ASNH 5BV8A 3LZDA 1RXSA 4NP6A 3OKAA 4KJXA 5CYPA 5DSXA 2V0CA 1Y48E 4ZFNA 4K1XA 1T4BA 1HDPA 2Y4NA 3MA0A 3SDSA 4IVQA 3K4NA 1AH2A 2FZKA 4OSOA 5GQSA 3HR8A 2ISYA 3RAJA 1KI6A 1L1QA 1ZG5A 1RZRD 5BNGA 4I2NA 4JLOA 2Y9ZA 4HADA 1UK9A 4N5HX 4LRQA 1KEKA 3RT7A 1OCZH 3CH7A 1SVIA 2GN2A 1E6UA 3LLVA 3RYIA 1NI5A 2ZU0C 5JCPA 3DD1A 3D0RA 3D3KA 5KOHA 5K0TA 3CNHA 4ALKA 3GH3A 4FFNA 3KE8A 4EY3A 1XHEA 1GV1A 2M7BA 1QQ5A 1U1EA 3OUTA 1R64A 1K6MA 1J9ZA 1BFDA 5FORA 2PKEA 1S89A 1T4CA 1LC3A 5KNBH 3K6SB 1YIAA 4MW0A 4WXEA 2DBBA 5GPBA 3QEAZ 5H3HA 3WKBA 1SKMA 4JB2A 1HQDA 3A1NA 5JR3A 4R84A 2E5LB 3I9V6 3BA1A 1I39A 4L5CA 2UKDA 3RJMA 3OIPA 4BNVA 1MKYA 4B6RA 4M3FA 2C4UA 4FNOA 3Q9LA 1G9TA 1G41A 1MIOB 3AFIA 3D6JA 5D6EA 5FTNA 1DJQA 5HYVA 3PJGA 2XCUA 1P5FA 3NRBA 1B9NA 4E7ZA 4GPZA 1HT3A 4HQEA 3E0XA 4LCEA 3TEJA 1IZ1A 2F2TA 1ODLA 3HP7A 1CZUA 1NPYA 1WD5A 4LXGA 2NUTB 3FW1A 5DLQC 5F2OA 4C5CA 4EBFA 4JBNA 3B51X 1ZD9A 4DSUA 2WSYB 1PZNA 1S5LC 2ZG6A 4G1VA 4RPHA 5FBLB 3VR6D 2BBOA 4C6SA 2GZ3A 2ODEA 1YL6A 2Q4TA 1L2TA 4EJ6A 5KVCA 5HIJA 3TMYA 4S2EA 1YZ3A 3P9ZA 3OYFA 1RI5A 8ABPA 4FE4A 3GGDA 3LUPA 3UMRA 1B0ZA 4DDUA 5K7HA 4OJTA 3H2BA 1YRAA 5HS8A 4LJ8A 3EEBA 3LWNA 4DPLA 1U7XA 1OHHA 2OOSA 3A1DA 5IKEA 3ZJVA 2BFNA 5DHAA 5IYDJ 1INLA 1EVIA 4EA6A 1ZHOA 4A93J 2VTDA 1JXQA 5KJEA 2C9YA 1V26A 4AURA 3GXOA 4O2LA 4YUAA 1YB5A 3FHNA 4WNCA 2AUMA 2G06A 1AQNA 1H85A 3CNEA 3FXQA 5DGCA 3OSUA 1RWVA 3LX6A 1ONSA 2HO4A 2ZWAA 3H3FA 3ZZUA 3SLGA 2WJWA 4F9FA 3MINB 2M98A 1Z9BA 5JXIA 2XPWA 1TQHA 4IV5A 1PW7A 3ONWA 3OD5A 2QXYA 2IZ7A 4RCZA 2QBYB 5HJ2A 3T1BA 3EUFA 2F1IA 4RMGA 2JHFA 2HBQA 4BPRA 3E7PA 4PAQA 3CCBA 3OC0A 3JSOA 4KXFB 1WQ4A 5A62A 4EGQA 4HWGA 1LW6E 4KIJA 4BWYA 3SS9X 1EWYA 4GPEA 3E9CA 4S1TA 1BCSB 2YXPX 3MJDA 2X41A 2NXNA 2KRCA 2I0FA 3WGIA 5IP7J 2GM4A 3I9FA 4G0QA 2VPTA 3P26A 3O90A 3Q6NA 5JUWA 5IUKC 3H0EA 1P2UA 1FQKA 3DMNA 3ORRA 4N12A 1W5SA 3SJAA 4R8SA 5KHOC 3JZFA 4OMYA 2IS1A 4TLAA 3NYWA 4ZKEA 1P5JA 1VQ6I 4NWIA 1NMEA 4BNTA 3OIQA 1R1DA 4HDSA 4PBTA 2WD7B 5B3KA 3GVXA 4BBPA 2DHEA 4Q5SF 5G0TA 3SXPA 5D5PA 2CSXA 1G4DA 4UHEA 1BRMA 1KJWA 4DHEA 1H66A 3DZIA 1CUCA 5CG1A 1YBHA 4ZEXA 2I7VA 3KZ1E 2GILA 2QP3A 5DNDA 3ETGA 3ICWA 3W8NA 1YA6A 3TLEA 3U49A 1G0OA 2HX1A 5HQ3A 3AJAA 1C30B 3BMXA 3LQKA 4XM1A 2JVGA 4ZCLA 3PLAE 5JRDS 3WDKA 2H1OA 5GTDA 2H29A 1T1RA 5KYGA 4KBFA 4MRAA 2JANA 2K5UA 3QUTA 1R8JA 4XEHA 2AFRA 1UM8A 1U3TA 5M04A 3WAKA 3AL0C 2C88A 1EDBA 3KEMA 2P7HA 1QZEA 2XADA 3FR8A 4P83A 4FIZA 3SBOA 2P6SA 1S4MA 2L0KA 5DI3B 4RO0A 1UFRA 1NJFA 1X77A 2D5CA 1QRYA 2CLOB 4D8WA 4C0AC 1SOVA 1G9XA 1JPNA 1MTOA 1MNDA 5CBKA 1PNRA 4V0KA 3FZEA 1HTWA 1KVTA 3QU7A 4C07A 4MQUA 3S3NA 3PE4A 2IXBA 4C2UA 3U4AA 2XUQA 3U1BA 5DYTA 4OU0A 3JRBA 1QJ4A 1T29A 5FKLA 4ABZA 3T15A 2EINH 1MO4A 3U4QB 1QIHA 4F5YA 4M37A 2DPLA 4E33A 4C0WA 3KIPA 4RDUA 1R6TA 1KZYC 2VBIA 1BGVA 3WE7A 4AU7A 2XUOA 2YDYA 1K0FA 4TKMA 3DG9A 4RKQA 2JVHA 5IJ9A 3DAPA 3I1FA 3KQUA 2DG2A 1LLUA 3OOEA 3R3UA 3EF0A 3U09A 2PUCA 4LSGA 1PL7A 4QJIA 2WFMA 3DOEA 1QOZA 1PGJA 1V16B 2EB7A 4G8XA 3QGMA 4YR9A 2HGZA 3ECAA 2GZDA 2EBWA 4X1YB 3OF2A 1W85B 5HGXA 2JDID 4C3UA 3GLHA 3CN9A 3U16A 2O2IA 4ZOLF 3C1TA 2HGCA 2IBMA 1QYVA 4B8WA 1I50J 4OHBA 3V1LA 4QVIA 3ZW9A 4MAAA 4Q03A 1NA5A 4COKA 2QLTA 4U2KA 3JU3A 1I3QJ 3F22A 4IOMA 3W4KA 3P94A 4KQWA 2DULA 4XOIA 3AF6A 2J3QA 1FMTA 2NZUG 2O8BB 3IXQA 1G3TA 5C2JB 4WESA 2CQXA 4UU1A 3QWBA 2F3QA 1WZCA 1HW5A 2W43A 3GFQA 2PZMA 2PKRA 1TQDA 2Y1WA 2YJ6A 1O97C 5E9QA 1S7GA 2WWHA 1PF7E 3QP9A 2ZMEB 3OEHA 3ZQ6A 1B41A 5FLXA 4GBED 4L78A 3FDYA 1T0PA 3JZMA 2VXZA 5CDFA 2DFEA 1SHJA 3I54A 1R49A 2D1HA 3CLUD 1Y1VJ 3KTOA 3X1DA 3MWEA 4RHCA 5BUCA 1JBKA 4LIUA 1Z9CA 4YI3A 4B4CA 5A06A 1QWSA 2VDLB 3THWB 1IHPA 2ACWA 1CIJA 1GUYA 4FFLA 2Z1DA 3ESAA 3EDYA 4CKCB 1O96B 1WY5A 4MHOA 1XRRA 5C3EJ 1Z67A 3MOSA 4PJLA 1USUA 3N53A 3FXAA 2Q49A 5ALPA 1EBBA 4BKRA 5B4TA 1NT4A 3IKVA 4DLZA 1XMJA 2E35A 4RTOA 1MZPA 4A27A 3UAZA 1FS4A 4UTRA 2PMHA 4JUBA 1PFVA 1BRTA 2R86A 4ED9A 2DF8A 4QIHA 2UWMA 4UUAA 2KISA 5DN6D 2QRJA 2Y69H 1H9BA 3THYB 3VR0A 5E9WA 4E22A 3SQNA 4WZAA 1P4RA 4MS3B 3DMDA 2FWIA 2OHFA 3S32A 2IKQA 3R5XA 4URFA 4RLFA 4OLBA 4MQEB 3IPRA 3SVTA 3MWFA 4FXOA 4HB3A 2PKQP 4QKQA 2FH5B 4RBOA 1E9VA 1RMQA 3BPSA 2ZRKA 1QE0A 4EJSC 1ZRHA 2POCA 4CLHA 4PSAA 1CQPA 1CWUA 1AS2A 5E6RB 1LVUA 4H59A 4QRHA 1ZMRA 4MMYB 1IBRA 1X42A 1WJDA 2H2FA 3IOYA 2WIGA 1N8SA 1WBDA 2YXDA 4KN6A 2F55A 2H6BA 1TVKB 2OU2A 1JFLA 2QW1A 4MYTA 3TLCA 4J6EA 2WIKA 3A25A 1E0KA 4R9SA 1XQVA 2E87A 4KEAA 4O63O 4X91A 4E2XA 3NOXA 3HM9A 3GPLA 5BVHA 3DLLF 3I71A 5F9MA 5EINA 5A4IS 2R7UA 3L6BA 3QH4A 1RJEA 4DA4A 3D8TA 1RAAA 4ZVLA 3CC2I 3EZNA 2VKQA 4AP9A 1JT0A 1H8EA 2O2GA 3UHFA 2YV3A 1JFFB 4I3HA 2XDWA 2PU5A 2VG8A 5L3CA 2H5EA 3I4FA 1BQEA 4R0NA 1MOZA 4YMGA 4B17A 4AX4A 1WUJS 5JVDB 2FMUA 4OAOA 1Z2PX 2ISSD 3PLRA 3QJ5A 5H80A 5I7OA 2XT0A 2PE5A 3QU5A 3LECA 2E2JJ 3RH0A 4D6XA 3WLPA 4E21A 3EYYA 1IZ0A 4M8KA 2Z09A 1LPBB 1SIBE 4I55A 4YGYA 2B99A 4Q19A 2H8GA 4AWXB 3LBYA 4TRRA 2CJPA 4OP1A 3WL7A 1E2KA 1YS1X 3O7MA 5IAKA 1F36A 3F6YA 1Z6XA 3HLYA 4BNDB 2WADA 4XLHA 3KQPA 4AJPA 1Z0FA 3VHXA 4UD6A 1XF1A 2CK3D 4L51A 2EW8A 2COMA 1QVAA 2V4ZA 1N3LA 5FBZA 4QNMA 3FPCA 2EX4A 2QA5A 1PU2A 2ZT7A 3DUFA 1AA6A 3FFAA 1R0XA 3KJFA 1TT5A 1QRRA 4MITA 2XE4A 4KIUA 3KKOA 2JZOA 4WXRA 2A1UA 4BJHB 2E7WA 2ZGVA 2IODA 1E3MA 3O3NB 1F0NA 4M1MA 3CA8A 5DNVA 1U7PA 4WKOA 1MMDA 1HURA 5CFNA 4CM4A 3ZQ4A 4P96A 3DV0B 1CDZA 2ATCA 4GEGA 4QYSA 4K26A 4YFKF 2O1EA 1PR4A 2WV7A 3TQSA 3RBAA 4PLGA 1TJNA 4ZYVA 2N1BA 1X70A 1TYZA 3ZE0B 4KI7A 3HN7A 4UW9A 4S0XA 1SM4A 3IEUA 5EGOA 3MXTA 4Y2PA 3CZ5A 3DMFA 3BRWA 5LOVF 3RREA 4L7QA 3EYAA 3CGGA 1KR2A 4ECEA 4HNAA 3KETA 4Y3OA 3PNQA 1H9TA 4A3BJ 1W36B 1Z6AA 3BG9A 2ZYIA 3ZZ1A 2D1VA 4C1NA 4CQMB 4DR1B 1N57A 3ADPA 2HU8A 2XNKA 3FNBA 2FHPA 4LB5A 1LVHA 4MVJI 2DEUA 3V8KA 1RAGA 1M54A 4C0QC 5FWYB 2QQ9A 4LF4B 3G3ZA 7GPBA 3EN0A 4WLVA 4OQPA 4HRYA 4D4GA 1JSCA 4Q00A 3A6KA 4KDRA 5DKFA 4QXMA 2NXEA 5HM8A 1SU7A 1C7ZA 3PNYA 4RYDA 5CK4A 3BERA 4AJ2A 2ZQZA 3HN6A 5CFLA 4DRXB 5AO9A 4RHUA 4ER6A 2R00A 1D2CA 2EK5A 1J1IA 1JS1X 1MENA 3KC2A 3ZGOA 3T4XA 3B6MA 1NBEA 4JIGA 4D79A 1WUTA 3INGA 2HW8A 3VR4D 4G85A 1ZBQA 1P6RA 4RK6A 1W34A 3BXPA 3IP8A 3NG1A 5ALZA 3K70C 1PP7U 4TLEA 1TJYA 2XVYA 1I7PA 4CTNA 4GL4A 1YFKA 1E9SA 1XR3A 1J9GA 1VXOA 3TLGA 1RXCA 1WXFA 1A36A 4W8OA 5IABA 2JD0A 2C9BA 2MC3A 1LNQA 3H99A 1N2ZA 4FQGA 4K9LA 2Q3LA 3D4OA 5H7XA 1A4IA 1CF2O 1PR1A 3PJDA 4QHYA 3RAGA 2XNJA 1KARA 1FDIA 5TQ0B 2A1TS 2ZJ6A 4WKGA 2N47A 5FI0B 3RRZA 2QAIA 4KUGA 4LZZA 3KZMA 1T2KA 3PWTA 3WGGA 3W1EA 3HNPA 1WM1A 5JNTA 5T8KA 1OUMA 2QX9A 3MTGA 5ALSA 3P9SA 4G37A 1O7LA 4N76A 1TM1E 3LCRA 1G6KA 1GSIA 3AYXB 3MZ8A 1YRWA 1AUQA 5JFOA 4N03A 4IWXA 2FSUA 3M6AA 1PE0A 3U56A 1T2NA 4DF3A 3AH8A 1T9BA 3C24A 4K0RA 2PKQO 4ZRNA 4QAQA 3M1LA 2PX5A 4N8EA 3FF1A 3G2IA 1MA3A 5DZSA 2IYVA 4ZQBA 4KGZA 3HJUA 4WN9B 4KQHA 2CGEA 2QF7A 4OJYA 1HXDA 4IGEA 1CTQA 1G291 3HWSA 4MR9B 1HDZA 1NNLA 1ZOLA 5EAIA 4KLNA 3G1OA 1XU4A 2HS5A 1R37A 2PGOA 1XC5A 4KO1S 4OREX 4BNWA 4DUGD 5B1EA 5FO0A 3FCAA 2AJCA 3WK9A 4FM9A 2OILA 2PZBA 3I58A 3LOUA 5I9TA 2ZJ8A 4NU5A 3BT9A 4D7MA 1KYTA 4D8UA 2VXYA 1T98A 1XZQA 4IIEA 4BL0B 3RJ9A 1EF4A 1NV9A 5D5VB 1MAWA 1JIUA 5FOXA 4ENJA 2GN0A 3D2AA 4EPWA 3WLIA 1XMKA 1A0OA 4ZMBA 1RM5A 4A3JJ 3UGQA 2PD6A 2RMKA 4I6GA 2V6JA 5G1NA 2H92A 5H16A 2I2FA 1I2ZA 1JA0A 4Q16A 1T0FC 2XPCA 4OHVA 2ZWVA 3O91A 4HOBA 3CUVA 1ZGZA 4FYMA 3GVAA 4YX9A 2QMYA 5HUHA 2O7NA 3SZLA 2Q7XA 3RUDA 3TIFA 4A92A 2QTWB 4ZKDA 3LPLA 2Y30A 1J24A 3ZRGA 2GZAA 3C2GA 2JIZD 2HOTA 3VJMA 2E1MB 1K86A 1E3IA 2J08A 2I4MA 3WA6A 3GP8A 4HH4A 3DF7A 2A0YA 2OTLI 1VHLA 2W6ZA 1SMYF 2X51A 1O7FA 2EZTA 3W2IA 5JMPA 4YA6A 4G5QA 4EDHA 1HNXB 1I6WA 1M8JA 2WSBA 2R8PA 5GMOA 1ZCAA 2ZYSA 4NCNA 4DJTA 4DIQA 1DPRA 1B42A 4L4UA 3QELB 2QRNA 4HSTA 5J1YA 5HJ5A 1X80B 3RFXA 4U2BA 2NSJA 2PBRA 4XB2A 4JP5A 1T9DA 2XWBF 4F8JA 5L3QA 2FW9A 3IVXA 1TUIA 2RAVA 5E1ZB 4BBSJ 3ML1A 1VZ3A 4TS3A 1WI9A 1WABA 2Q6TA 2EWWA 3GLHE 1EKEA 3F6OA 2OPHA 1XRPA 4ZOAA 3TZ6A 1LDEA 2BGNA 2QV7A 5I4KA 1WIWA 3U2RA 1KJYA 3BD6A 3VZSA 4ZT2A 2ZVJA 3MN1A 4JUDX 1U1CA 3BQ9A 2Z56A 5D6FA 1TECE 3AOEC 4LHEA 2C3UA 1GLNA 1R6XA 2W71A 3G2BA 4GM4A 1KFKB 1DTEA 3NBFA 2AEMA 4C6RA 3I4LA 3KYIB 1IMOA 1VHTA 1YQUA 2LF8A 3H35A 4MFEA 4PZDA 1YTUA 4G5FA 4U7PB 1G5QA 2XW6A 2GRAA 1Y3FE 4INOA 4DNXA 1SBHA 1MX9A 3WIEA 2Z3YA 3GN1A 4V1CA 4LXQA 1KSJA 2VRCA 1KU6A 3QE2A 1EYZA 3FDXA 1KZ6A 3ZHUA 5T4BA 1Z0AA 1WKVA 1SVWA 2HA4A 1EM6A 3DBRB 2H2IA 1E32A 2JLBA 1E9RA 3IBFA 1QF6A 3MWJA 2HQBA 5ICFA 4BBJA 3HUTA 1VL5A 1WHTB 2BBWA 2VUUA 5JQGF 1AX9A 4P9NA 1T38A 3TR6A 5EIWA 3ZCRA 3M70A 4RAFA 4WCFA 4M0FA 3EK2A 3LDHA 2GR9A 1G8JA 3PUIA 1JFRA 4B5KA 3ETDA 2YJGA 5B4VA 2PFSA 2QQBA 1HMPA 1JU4A 2GPBA 5TMEA 4FINA 1GU0A 3DQQA 3LSJA 3KP2A 2HMSA 1PN3A 5E3NA 4BAGA 5JJLA 2B34A 4WZAE 2JZYA 1RCUA 5KHAA 2UYOA 3MMYB 3I39X 3NTUA 3K1YA 2CLSA 4RJLA 2JQ7A 1GR0A 2PRIA 2QTZA 4ZO8A 2WV0A 3STWA 1NVEA 2X6WA 3IPCA 4MAFA 2LCQA 3AR8A 4JKYA 4DQKA 3BJAA 5JD5A 3KZVA 2DR3A 3VPSA 5HBGA 3QLVA 3PIPF 1BE0A 3R2JA 3ZH2A 5BP7A 2J5QA 4V0RA 3BAZA 5IT4A 2IUUA 4X8HA 2W57A 4W99A 1C9MA 3UQZA 3K0AA 1RSZA 2A07F 3R1IA 4Y2XA 1QH9A 5FA5A 3S2EA 1MVLA 4MUMA 1C1YA 4KYIB 3ZCOA 4DIDA 3RAPR 3T54A 2J6BA 3IAS1 5CMLA 3MZYA 2WLTA 4CIBA 3K96A 3BF7A 5KU7A 4XGRA 5DASA 4U7GA 4DC9A 4B3XA 3N4MA 4GGGA 1SH7A 1FSPA 2NM0A 1DNPA 2XB9A 3SK0A 2PUHA 4JUAA 3QPWA 4JL5A 2R97A 4G84A 1TIBA 4ENWA 4HY3A 4KZPA 4S1PA 4B6JA 5FOVA 4C6HA 1BX1A 2FPKA 4UQPA 1TO2E 4CU2A 4HAUA 1Z6ZA 3T5MA 3U3RA 5EHZA 1FFSA 5K1YA 4XTRA 1QP0A 1F6DA 3H3XA 1U7UA 3URMA 4DMMA 2HZ7A 4HLQB 2ZUTA 4HMPA 1M8FA 5FI1B 3R7BA 2FW8A 2QRPA 1AQIA 1L1RA 3E5UA 2AOXA 3HV2A 2YWDA 5BUSA 4H4KC 4G09A 1A9YA 3MSCA 4IRHA 1Z3CA 3D43A 2BEUB 2Y0MA 1OCPA 2YIJA 4WOPA 3A31A 2EC5A 4D3YA 1ECLA 2IUYA 4UEKA 1JVBA 5JD3A 1SFEA 4YASA 4UVEA 2XQIA 1E1CA 3CVWA 4MUHA 1KI1A 2J3KA 1XI2A 1X9GA 4KXNA 1F14A 4O5AA 1VKRA 5E7MA 3PP8A 3QKSB 3F73A 3ER9A 1E4EB 4PNPA 4TV9A 1I2MA 1YI8A 4ZVMA 1TZCA 5AI0A 1X1PA 1TGVA 3BB4A 1FU4A 5AIBA 4MS4A 1FBQA 3WBJA 3AP1A 1NI4B 1TLHB 4BKUA 1USGA 3AXSA 1ZP6A 3M5PA 1KP2A 1XJ0A 3EZXA 3NBUA 1EK5A 1CS0B 5DHRA 4RZ3A 3IJ5A 2BUBA 2ZXWH 5K7ZA 1U9OA 4XIYA 2JATA 4RIGA 1M1YA 4KN7X 1Z4KA 1ZD5A 3P71T 1H8AC 2CJYA 5CFMA 4E7IA 4NBQA 2QUJA 4AXXA 4YRVA 3NU1A 2LK2A 3H0GJ 1Y1RA 3GLTA 3CZMA 2HUPA 2H06A 4OUKX 3NRJA 3E3OA 4KGVA 2LZ0A 1XVUA 3RF6A 5KX5B 1BEEA 3CKKA 1NVXQ 4JBAA 4LOJA 1YZTA 1VNDA 3RT9A 1QZ3A 2QSJA 3WNBA 4JHLA 4CCYB 3L09A 3WG9A 5K0SA 4FOLA 1MQ8B 4PN7A 2WJIA 3T3NA 1HQKA 1QIFA 5HHTA 5FD8A 1J97A 5GAEJ 4NX2A 3EEQA 5CU7A 3OT1A 3MUNA 4F3KA 10MHA 4V3BA 1XLWA 2CFTA 5IC6A 5DHTA 4QT4A 1I10A 3UFBA 5TXGA 3K4CA 1UQUA 4A2QA 3IKLA 2JI7A 5GGXA 2QD5A 3OZIA 2DDAA 4LGWA 3B6EA 1JGTA 5CURA 2Q5LA 4OA8A 1U2PA 5A4AA 5DMXA 3GRPA 3DKKA 4RB2C 3T5GA 5C7YA 1VF9A 2IP2A 2Q3BA 3PL1A 2EJWA 3L4BA 1RPAA 2WAAA 1GNRA 2KHZA 3G2NA 2Q6LA 5BR8B 4GVXA 3HGGA 1VMDA 4N3GA 3VU9A 3C7CB 4MIKA 1NKTA 3G13A 4IHQA 3EIEA 1FLAA 1YBMA 4RA9A 3RZOJ 3OX4A 3QXGA 3RUHA 3SY8A 1BFKA 3F3MA 1FNCA 4P5DA 1VZ2A 3ZZTA 4YWHA 3OPYB 1KP9A 4A5OA 3WRXC 2I6TA 5A5EA 3I4NJ 1Z21A 3DMHA 3X3HA 1RQGA 3A7DA 5B3JA 4R3NA 3K09A 5FP0A 1K1EA 1FFWA 4OPMA 3DXYA 5JCOC 4EJVA 3L0YA 2GLTA 2FFJA 4NB5A 4Z7QB 1YV9A 2WZDA 3IUEA 1IG0A 1KJQA 3T0FA 2DBQA 4GXQA 2PIAA 5JAHA 3WHBA 4YNBA 1JKRC 1Q1BA 3B2QA 1J70A 4I1VA 1JLLB 1BA2A 2MT9A 1MHPA 3L77A 3BJOA 4PSXA 1Y63A 1QHYA 1A27A 1NXTA 2G4VA 2BVLA 2QEXI 4IDAA 3SZTA 4JDPA 2W4MA 3GZ4A 2UZ4A 3JZDA 3OQPA 3WGOA 2JARA 4E2WA 1RJFA 4Q7LA 3OR1C 3IVGA 1N9GB 2HEOA 2JBHA 1M2HA 2QZSA 1YHNA 1PW5A 3ENNA 4URVR 4ARZA 4UU0A 4UXJA 4WQMA 1KRXA 5FT9A 4RY0A 3QHAA 3AKZA 2IIBA 1OIWA 2OHJA 1Z6YA 2W2QA 2QTCA 3EF3A 2WG2A 2ERYA 2XGEA 5AUPB 3IDFA 1KEEA 4AM8A 2J0UB 1R0BA 1J0BA 3QHPA 2K7FA 3I42A 2Q4OA 3WFJA 3CC7I 5A9TA 3MVPA 4O33A 2XAFA 4XJTA 4I6EA 3RVMA 2PLYA 1A7AA 3LQRA 4RXUA 4X1IB 4WOJA 2EIHA 4HW0A 3KG2A 3AVVA 4BLRA 4O4IB 3LC1O 1RWWA 1X15A 1XEWY 2QNBA 3U4CA 2FSIA 2O8EA 2FB9A 4ZT5A 4ESHA 1WFXA 4FJ0A 4EKGA 1WHUA 2Z3WA 4URXR 3C7AA 4QHSA 3UK7A 4GP7A 3PFNA 5I6DA 4XIIA 1OKKD 3V1YA 4BB9A 4F3RA 3OURA 1DUXC 1NONA 5HIMA 1SN7A 4R1SA 2BVNA 1QHXA 1COWD 3FIUA 3UNGC 1NG1A 1SELA 1BDJA 3W5SA 2MYTA 3IP6A 3N0XA 2ABWA 2AD5A 3VZCA 2CUNA 3T35A 5FUVA 1ZWKA 2G83A 2X5KO 5DT2A 3B73A 4CM3A 1OKRA 4E88A 2V9VA 1XCPA 4CIYA 1QIEA 4HT3B 4RA2A 2PWBA 3VHRA 1FX7A 1JMYA 1QZUA 5M5WJ 4KQGA 4DLXA 1T33A 1D04A 3KCQA 2IX9A 1GG8A 4AMZA 3BL5A 1N1EA 5EESA 2O50A 5JWOA 3WMXA 1EKXA 1KVQA 4Y6QA 5AW4A 4XLZA 3E9MA 3GRAA 3H92A 2DBRA 2XUGA 1FFYA 1L5HA 2LGJA 3KXLA 3VRHA 4AZVA 5HF6A 3DMTC 4Z3KA 4GZLA 1A4RA 4YMIA 5AVYA 2G63A 2ZP1A 2Y1FA 4RTLA 3TGPA 4L9WA 4B73A 4ZJUA 2XKAA 1RQXA 2Q3FA 2J0QA 2DWUA 1OWNA 1S2IA 3TMKA 1F48A 3TP0A 4IOKA 1O8BA 2CNDA 3EASA 2XHEA 2QXTA 1GT0C 2XMZA 3QMVA 3R3WA 3GI1A 4TL6A 1XB4A 4NYMQ 1LNZA 3HOWJ 1L8LA 3O8HA 5BW6B 3JRFA 5I51A 5EI5A 4Z0PA 3CRVA 2YJ4A 3PLNA 1VLQA 1G2HA 3UICA 1QGUA 4D41A 2EFGA 1JTYA 2OYSA 3NIGB 4EG1A 2XQVA 3WBBA 3H0CA 3NBXX 4N49A 3DBOB 4L02A 5IM5A 3CINA 4D3ZA 2VHEA 3TG8A 3WKDA 5FPQA 3BZKA 3QV2A 3G5UA 1L4MA 3HWX1 2EATA 3HJHA 2L42A 1G98A 3QUSA 4LC9A 2PUTA 4PSVA 9ANTA 1NSTA 1YFHA 1SFRA 4Y0NA 2ZRMA 3H5AA 1S0UA 1IUKA 4YCLA 2YCLA 2CT8A 4MJLA 3WLKX 1YZVA 3KB2A 2CL6X 3VSAA 5BQXA 3VUFA 1EFVB 4G63A 2DMTA 1L5KA 1JAXA 3TFWA 4GYGA 2IVFA 3IR5A 2JEZA 2NADA 1EJBA 2J5BA 5CGQB 2XCQA 4BX2A 2I5PO 3UXMA 1F1ZA 4M86A 2ZAOA 2G08A 1IAWA 3GJTA 5LMUB 2VHZA 4KVGA 2XY4A 3HKEB 3DDNA 1AWCA 2M7AA 4RJJA 2D2WA 5IBPA 3IPXA 3M3DA 4XQ9A 4ER7A 4Q4LA 5KQGA 2EWNA 1WMBA 2QMHA 2O59A 3WK5A 3B5JA 5F2KA 2FPSA 3IEVA 3U7JA 3JASB 1SCAA 3ED5A 4Z54A 4LITA 3HDHA 1JFTA 1Q0LA 2ZT8A 3PTAA 1UP4A 4IDDA 5ITSA 3O8RA 2M6LA 2OEPA 2XVCA 2WYHA 3GGSA 3ZCPA 1E2MA 1U02A 2I55A 4JFRA 1R0ZA 4Y15A 3CTPA 4OQZA 2NU6A 3ERCA 1DJNA 1QNLA 3T7IA 1E66A 4RHEA 5H4GA 4N5IX 1GAJA 1JAYA 1LJUA 2QIPA 1VKJA 3IA2A 1DJMA 1NU6A 3P5JA 2EG9A 3O4FA 2AC4A 2F90A 5HX7A 3M33A 1G3SA 1ECCA 2HXOA 3K16A 5K8UA 2YN4A 2VPZA 3HN2A 2EFHB 3EZ6A 4L8GA 2YWBA 2Z0MA 3L9XA 3DTNA 4CWAA 3FVWA 4PTYA 5IPFA 1V7ZA 1ZLJA 2OGWA 1ZKMA 1LX7A 1TADA 2NU9B 1HF3A 1FTGA 4HFRA 4BRUA 1BDHA 5K5QA 3AF2A 3OQNA 2OMEA 3W9YA 5D01A 2VCEA 4PX2A 2PV0A 4CMEC 1M6WA 4KFTA 2G28A 2IELA 5CCEA 4QPQA 3U17A 4GQIA 4CLOA 4H08A 2WJPA 2NUPB 4I9GA 3BMOB 2XROA 4N0MA 1AKHB 1EXDA 1GTJ1 4DZRA 4AFNA 5D5WB 1IJFA 5A0FA 1NWCA 4AT1A 1LS1A 4IL6C 3EHDA 4X3PA 4H1WA 3UMFA 5DM2A 5JNSA 5AM3A 5T5QA 1IBCA 1YB1A 3IB6A 2BW3B 4B81A 2D5BA 2J9ZB 3P45A 4M6WB 4OQDA 4MW2A 3PG5A 5DP1A 4B47A 2WWTA 3IHUA 2PEYA 2X19A 2HSDA 2OAQ1 4JENA 3FVRA 1DARA 3ZBUA 3VBCA 4L28A 3KZNA 1UDWA 1DX9A 4A1FA 1Q15A 4CFYA 2EQ5A 4XIFA 3VNAA 2XUKA 1CHNA 2OO7A 4CCMA 5FRNA 3WLNA 1U4SA 1J21A 4N4OB 5CLSA 4MWTA 1R6RA 2OG1A 4KNYA 1UWKA 1AHHA 2OZKA 1M1YE 4XQFA 2H63A 4ZQCB 3VOTA 4YWJA 4M21A 5LD2C 2WWVD 3TW8B 5C51B 1ZCFA 3QP6A 1AKYA 3MM4A 4JBHA 2ZXHA 1CJBA 3U7QA 3T9CA 1V95A 4UTNA 4YRPA 2GUGA 4I99C 3ZDZB 3ZV4A 1QGYA 5FNVF 2QM7A 4LYEA 1IOLA 3KHKA 4Z99A 4GM0A 3DL2A 4MO9A 1I5RA 4OY3A 4JV5B 1V0JA 4E15A 4EAQA 1XDBA 1Y42X 5E1WA 3HCEA 5A2QA 5L3EA 1SU6A 4D0GA 4A6EA 3NEUA 4JYKA 4I5FA 4TUYB 3AEKB 3R7SA 3RU9A 5J23A 4Z4EA 3RTBA 3HHHA 5TF0A 4BMVA 4PCLA 4CPDA 3TECE 3BXOA 3ZD7A 3S1NJ 4GMGA 1P72A 3FKQA 2HGSA 4B43A 4IOCF 2H00A 1UXOA 1TVMA 1Z25A 1DUSA 3ROQA 2AN1A 3K0FA 3TGWA 3AF4A 1WBBA 3PE6A 5E3OA 1C3EA 1KQFA 4RX1A 3VYTB 1IC6A 3HUUA 3TLZA 1MPTA 3TNJA 2NT4A 3C7TA 4Y33A 1C7QA 4QXQA 3F97A 3HOUJ 3LQFA 5C44J 2PGAA 2XVZA 1E0DA 5FCDA 3G5AA 1YT5A 4EEZA 4KH0A 1KAEA 1SU4A 3EUHC 1FXWF 2PIDA 3AZOA 3PPXA 3NVMB 2M30A 3VOEA 3L6DA 3N0TA 2HI3A 3HMKA 2Y99A 2HDHA 2YCBA 2AOTA 1L7VC 4BEHB 1M1NA 1TVEA 1XD2A 2VAPA 4GZ3A 3NGXA 4XVUA 1YJ5A 5GM2A 1N75A 3PICA 1EJ0A 2J9FB 2IH4A 1CFJA 5FLYA 3CE6A 2HPIA 4JLUA 1EFPB 3EMDA 2RCYA 4D4KA 2P7VB 4RVSA 1EH5A 2FU4A 4J0KA 2AFHE 1RYNA 1PWZA 4OEHA 3I09A 2YBDA 3KB1A 4PC7A 2NZYA 1YBVA 1Z28A 1KY2A 5D51S 4B71A 3LKBA 4IYRA 3G6KA 2J4FA 3NC0C 1NX9A 3JWIA 1EXVA 1VKHA 4M54A 1WXQA 1RRJA 4FWTA 4GSKA 2PX8A 2OKGA 2MD5A 2RHRA 4ZHQA 2NYVA 5DV9A 2DFNA 3FYUB 4XVRA 2B37A 2Q8QA 4FI3C 4YJ2A 2JGIA 2P79A 1H0RA 2E71A 5A5VA 4Y1RA 5FI5A 5CLJA 2BOLA 1XMPA 1A8HA 3VYSB 3QQ5A 2R7OA 3R5FA 4UUSB 2WJYA 1ZBDA 4YMLA 4B9AA 5BMZA 2VKDA 4OWRB 3L06A 4F6CA 3KJQA 4XARA 2FW7A 4LGYA 2B7CA 1MD9A 2AVNA 4PPFA 1F1BA 4PNHA 3N1UA 1ZONA 4GKAA 3FCEA 2G5GX 5EMLA 4F4HA 2Q0XA 2YXEA 3F3YA 4RFLA 1KBZA 2R8RA 1TNSA 4KN9S 3M34A 4QWMA 3HFJA 4QUJA 1OFTA 4ZZDA 1PS8A 3ZHTA 1LSSA 4WNIA 3K2ZA 1CHDA 3EIHA 2VBXA 5KNCD 4AWBA 1L7DA 4JR2A 1RFLA 4RHYA 3OA0A 2CXPA 3AIMA 3OLCX 4IX9A 3SHOA 3OOSA 2ZNZA 2OXRA 1F6WA 4YK7A 5I8PA 4N0BA 5JY6A 3DDWA 2B25A 1NI3A 1L4KA 3HJCA 4G1UC 2A94A 5I48A 3PK0A 1GM5A 3FWEA 5FULA 3ON5A 3F4BA 2M9HA 2R4GA 3S55A 1E2JA 4X85A 2GXUA 2ZOSA 1CRPA 3AF3A 4ER0A 3CCVI 2O3SA 1UPTA 3U62A 5IY5H 2HYGD 3ZU4A 4ZMRA 2PLAA 2NV6A 4B4VA 4W9NA 1FX0B 2RCNA 5EIHA 1E1RD 3SIXA 3PHJA 2Z4RA 4DJFC 4KAFA 2FNPA 1MMFB 1RABA 5JI6A 1ZD3A 3I4MJ 1GL7A 1KDTA 1I0IA 1YUBA 5HDGA 4RACA 3OTHA 1AHDP 5K0BA 1EINA 4O4HA 2VI6A 3G17A 5LYJB 1NUQA 1D8TA 4DM4A 2XGMA 4C6TB 3RVQA 1RQNA 2MYPA 2NQTA 4YRRA 4RV9A 1NPDA 2EA4A 5ER9A 2IA5A 4I1RA 3IMFA 2AR7A 3EUAA 5CVEA 2QWXA 5CJJA 4Z3OA 5T6MA 3ZCQA 1YKSA 3T1NA 1FMLA 5A9SB 3I28A 1EUQA 1D2HA 1NAIA 2REBA 2G9NA 1AN0A 1XTUA 1X2NA 4WOKA 4FCTA 2KBEA 1Y98A 5TVGA 2XMGA 1N5IA 3UK1A 4U88A 5JVTA 1N5LA 1Z2DA 1VQ8I 3LA3A 1AMUA 2R0QC 3HG7A 5J2TB 2PUDA 2W7TA 4D1QA 1VQLI 4FEYA 5LP6A 3QPCA 3C3BA 3O83A 3ETCA 1I3KA 2WM2A 4DR6B 1WEKA 1NM5C 1J8QA 3KSDO 2W6PA 1RJ9B 3AHIA 3M3YJ 3AKCA 2ZRJA 4MTLA 1N8TA 1KO8A 1QZYA 1UZMA 1EG2A 3U0BA 2ATVA 3CWCA 4YHHB 1XSXA 2F6RA 3H2IA 2WOJA 3RRJA 6Q21A 5P8WA 2X3UA 2JCGA 4M1TA 2YVKA 4C05A 3NUQA 1CCWA 4RF3A 1FNBA 3UH1A 3F8CA 2EFCB 4JXKA 2NXJA 3N39C 2VXOA 2D4AA 3ORSA 2KL4A 4JIMA 2QE7A 4WZZA 4XX0A 4Z0HO 2WSLA 3TRIA 2QGFA 2XWQA 1LA2A 5LHGA 1P4AA 3S44A 5AW5A 3T8TA 4G9EA 2XUJA 4N3AA 4ZH4F 2GBLA 2PL1A 4BYYA 1AKWA 3A9WA 3BR6A 1X7ZB 4GXRA 1RRFA 1B4DA 5KQSA 3FNGA 1Y34E 2ISCA 1JDTA 2WFLA 2QROA 1K4SA 2WM3A 2L4AA 4BLWA 1JHQA 5HG0A 3U7RA 1ZSYA 2HREA 3HR4A 2ORIA 3WKCA 4YDRA 2ZSKA