3C3WA

Crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the response regulator DosR from Mycobacterium tuberculosis suggest a helix rearrangement mechanism for phosphorylation activation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN DEVR
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c3wA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3wA01
2EFPA 2OAZA 5FBKA 1LVAA 2P6SA 2IDMA 2KKOA 4MS4B 1WSUA 4ZYDA 1RPJA 3VOEA 3G85A 1LNWA 3KCCA 4OMZA 4RXUA 1Z16A 5CNMA 3GO5A 2RJOA 3F6OA 2ZJ2A 1SD5A 1S7AA 6PAXA 1D5VA 3HXMA 1U3EM 2DPDA 4YCSA 3F3XA 1YW8A 2BV6A 2WJWA 3CZ5A 1P2FA 3DPLC 4LK0F 3OQMA 1QBJA 3L09A 3E6DA 4EGZA 1HQCA 3F7NA 3OMWA 1OXKB 4L9NA 3DKWA 1IRFA 3I42A 3HYIA 2VC0A 2TDXA 5ILSA 5DV5A 3E5UA 4L9JA 4EJVA 4N41A 2PI0A 2FOKA 3L00A 4G0PA 3FMRA 1YIOA 4UV9A 2A3SA 2IJLA 4HLYA 2QQAA 4HZFA 2P6TA 3Q7RA 2KRFA 2HEOA 2EV6A 2EFQA 2V1XA 4MAAA 1USTA 1ZHHA 4M73A 5IX8A 1BBYA 4MS1B 4RKRA 3ABTA 2LSOA 3HHHA 1ZY2A 5EEHA 4P9FA 2IT0A 3GXOA 1D5WA 1ZYRF 1JDPA 3JTEA 1ZREA 2ADUA 1T34A 5FD6A 3KKEA 1ZRDA 5LBQA 1J0RA 1QQIA 3K2ZA 5ERIA 5FD5A 3WTWC 4RAZA 4PEVA 4ASNA 4LB6B 4LD5A 2W42A 2EFOA 2VYCA 4UVAA 3TO9A 4MEXF 4HOBA 2FEKA 4TN5A 2MSKA 2JRTA 2OA4A 1DJMA 1F1ZA 1YS7A 3ZMUA 1YQAA 2V0NA 4EGSA 4XBFA 5A2QZ 5KWSA 5F6FA 1NTRA 2DAOA 2Q8KA 1Z2EA 2LPMA 4A5NA 5DGCA 3LTEA 5LLQA 3VODA 1QP0A 4EJOA 1F4KA 3R60A 2PG4A 4Z99A 4N0PA 4R8HA 1XHEA 5TQ2A 3H6HA 3GZ6A 2P9HA 1HKSA 2EA4A 3WE2A 4KMRA 1T39A 4YGXB 4U0WA 1ABFA 4H0EA 4IF4A 2HTJA 1UHWA 2DW4A 1DCMA 3NRVA 4MQEB 2PN6A 4ON0A 1FLIA 2XHKA 5D6EA 1MZBA 4KNYA 3WTUC 2A68F 5BR1A 2DPUA 3JSPA 2DQRA 2IKSA 4AD9A 2O03A 2ID7A 1E17A 4OLAA 1KRWA 2EV0A 4F12A 3GFJA 4A5MA 1MB0A 1J9IA 5LHIA 2LKPA 1U04A 2AS5F 4Y13A 2MBFA 2RGYA 5HM6A 4XLNF 1IXCA 3WTXC 3KP4A 3H3UA 4AIKA 5BOXA 3VEPA 1E6MA 3GRCA 3OM0A 2NZUG 2K02A 1CF7A 4RY0A 1ZGZA 4N0QA 4EVQA 1XCVA 4YFNF 4UHKA 3A3KA 4CBVA 2PQ8A 3F8CA 1LJLA 4H3KB 1RXIA 5E20A 5ED4A 3KHTA 2Z9OA 1S29A 2FMFA 1ZGGA 1W4MA 3Q15C 2VT3A 2J48A 5C5EA 4RWEA 1IF1A 3H5IA 3WGIA 3NNNA 1IXSB 3HHGA 1LDKB 4Z4IA 2M5WA 2IPQX 1HSJA 3I71A 5BRAA 1TNSA 4HW0A 2FBIA 5DCMA 4KRFA 2FEPA 4S04A 2J5OA 2ZXJA 1E2XA 3EULA 1FFSA 3KP3A 2PL1A 2GWRA 3ZMDA 3MF4A 3QAHA 4OIPF 4HYEA 3FMVA 3C3WA 4FX0A 3TQNA 1YVUA 3EJWA 1SXGA 4RGRA 4MS3B 5BPDA 4MPTA 5K5OA 1KU3A 2GBPA 3LSTA 1PEYA 5FLXZ 3H5LA 1RNLA 1B1BA 2HYFA 3WODF 4GGGA 5HDKA 1JYEA 1P4XA 4WF2A 4OU0A 3F6PA 5AONA 4W5TA 4M9ZA 2JRLA 4XFKA 4IRHA 1JH9A 3QPHA 2RDMA 4PZ0A 4HV5A 3RVQA 3DBIA 3QLVA 2X7XA 1K6OA 4MRMA 4ETSA 4EV0A 4QYWA 4WXMA 4OATA 1I1GA 3GWZA 3LUFA 2MSLA 2IPNA 1YYVA 2DO7A 2V6CA 1TM2A 4HNRA 4PICA 2MLKA 3C3KA 2JT1A 3E5XA 4N9IA 1QPMA 3CO6C 1L5YA 1XGMA 4G0OA 3QLUA 3MMNA 4EVRA 1KRXA 3JAMK 2HKOA 2HKXA 2CD7A 3WGGA 3M6MD 3JS5A 1R1UA 3R0AA 2RGVA 4MQVA 3NEUA 3ZPLA 4ZPJA 2FVYA 3H75A 3DV8A 1YTYA 5TJJA 3D5LA 1Z17A 1M2EA 2M1ZA 1DBWA 2V1DA 3EQZA 2L3DA 4JOQA 5ICEA 4WXHA 3LFTA 3I0TA 1FC3A 3I64A 2PBIA 3QPTA 1MDMA 3V8KA 2CHEA 5FGMA 5HVQC 3J80K 2N9UA 1GXPA 4XRFA 2FN8A 2JCGA 5L3DA 3OV8A 4L9VA 5DD4A 2B0LA 1O3SA 1W5SA 4U88A 3HSEA 1YLFA 1BN5A 2P5KA 3CFYA 1EH8A 1FYMA 4G7ZF 4MR8B 1IN5A 2L4MA 3E61A 3H5TA 4TV7A 1NHAA 4HNQA 3GA5A 5E1XA 2IP2A 4A0YA 2VC1A 3IP5A 3MZHA 4LG0B 4EYGA 3CNBA 4MTEA 4EY3A 2XKPA 3EYYA 3NNSA 3G73A 3J7AO 5H6QA 4HA8A 2P5LC 3I5UA 1ZRCA 1R23A 5DUIA 2DFIA 1LEAA 3T95A 3BJAA 2PKXA 2LF7A 3QELA 1RZRA 2MLGA 2A5YB 3ISPA 4WWCA 1T0FA 2CWDA 3S99A 1T98A 1Y0UA 2LNBA 1P6UA 2GA2A 2STTA 2NAZA 3K1MA 2O61A 4GCVA 1R5GA 2XAGA 3MYYA 2HJ9A 4ZYEA 5DCFA 4YO7A 3SZPA 4S05A 2ZKZA 4N47A 3K1NA 4A12A 4Q7EA 1K78B 4BH9A 2GXGA 2ZFWA 2PLNA 2HDCA 2QV0A 2L18A 5KI6A 3CTPA 4P98A 4ENNA 4GNRA 1SMTA 1BIBA 3I58A 4UHTA 3QU3A 4NICA 2VBWA 3R6SA 3GYBA 1DC7A 1B6AA 3F72A 4RSMA 5FWYA 1VPWA 5LHGA 3H3ZA 5DEQA 5D5VB 4EGYA 3L2CA 3NNDA 4R1HA 2DLLA 3M8FA 1O7FA 1Z05A 3RVRA 4HF0A 3OLXA 2VE9A 5LEKA 3SFZA 2RV8A 5D2CA 2KIUA 3B2NA 3LUDA 4PE5B 3FF5A 4M72A 2CQKA 3QOPA 1GVJA 1HEYA 4LE1A 4RY8A 4AIJA 2O8XA 4WWHA 2XUBA 4ZMSA 3FMQA 2O3FA 4TLLB 3CUQC 5E18F 5GQSA 4ESBA 3LUCA 2WY2D 3W6KB 5LHHA 3IKVA 3O1JC 3H1FA 2FEZA 3DPTA 1M5TA 5TRDA 2EFNA 4MYRA 1PDNC 1BC8C 1LDJA 3L49A 4IJAA 1XHFA 4OTZA 4Z9AA 3MQ0A 2ISYA 5DDGA 2EV5A 1AOYA 3ABUA 1SAXA 3FM3A 4IVNA 4LB5A 4KN7X 3GFLA 3V7RA 1D1PA 1FNNA 2GIVA 2NNNA 5IUJC 3LKVA 3N4MA 4KA4A 4G0YA 1L5ZA 4D0PA 5FWXA 3CG4A 2GQQA 5J8CA 2OQRA 2ID9A 2Z3YA 3V7CA 4G0ZA 4L85A 3HSRA 1LDDA 3WE3A 2FMKA 3HTUA 1O3RA 2K86A 2XIGA 3BOQA 4FHTA 3N8IA 4YIIA 4G94A 3T8RA 5TQJA 5FFXA 3I54A 4MLCA 4EJWA 2H3HA 5IT9Z 1JL3A 2F2EA 3HDVA 2MH9A 2A9OA 3TOAA 5JNVA 3V4GA 2JBAB 3KFWX 4AWXB 4D6YA 3GX4X 3QEMA 5K5QA 4DQDA 3HRUA 2RKHA 4W5QA 3KP2A 5ABPA 4EJTA 1FP2A 4AVPA 1XMAA 1EWKA 3T38A 3RQIA 1FBUA 3RPUA 2DK8A 3MEXA 3RPQA 5D8KB 4PGGA 4KN4X 5JS1A 2FBHA 5T7BA 2EB7A 2JVKA 1XGOA 1C0WA 4RY9A 3F8BA 4CDGA 3KEOA 1P8AA 1MIHA 4P96A 4K2EA 5CNIA 3ML6A 4H3HB 1Z25A 4YRZA 2CGPA 3OMXA 2F5FA 1K78A 2XROA 1HXDA 3C7JA 2QW1A 2H6BA 1JX6A 2OENG 3LOPA 3N6VA 1V4RA 2FMLA 1T38A 3HUUA 4FT8A 1P6RA 5BQTA 3N0WA 2A61A 3KE2A 4UUVA 1DG9A 2PE5A 1UB9A 3LA2A 2FQWA 1QNTA 1IXRC 4KPYA 2FMHA 5IUNC 1QP4A 1I5ZA 4YWHA 1YW9A 3LAPA 3HOTA 3RVSA 3O1HB 4OOIA 2VXZA 3LKBA 1EFAA 5JNUA 3CLKA 3CU5A 3LUGA 4EM1A 3JPYA 2A9PA 3DGFC 1BI3A 1KMIY 4KT5C 3OO1A 1QPZA 2DTRA 1M2FA 3RVLA 4MGRA 3CRNA 5KC9A 2F8SA 4HX8A 4BXUA 4M74A 3I59B 2WWVD 1A2OA 4Q48A 2FF4A 2FE3A 4WCGA 2R7DA 3ULQB 1JFVA 3FDFA 3SNKA 2RNJA 4EJUA 4QPJC 4HAMA 2IVMA 2MYTA 3MM4A 1FYLA 4QLCU 2PUEA 2CG4A 3SHFA 5EWJA 4F06A 4EQQA 4UVCA 3TO6A 2NYXA 2CFXA 1P92A 3TX6A 2VOOA 4GYIA 2JVJA 5AIPA 3AAFA 4MR9B 1OKRA 4M9SA 5CJ9A 4FX4A 4L4UA 3GFMA 4O3MA 1EAYA 5DKFA 4ZYLA 2IA1A 2A9QA 1GLGA 4M9XA 3HRSA 5LGTA 3WTVC 2FSPA 2FRHA 2AYXA 1J75A 3CDHA 1Z6TA 4ZZDA 3U9GA 5ICFA 3BREA 4KVFA 4Z4FA 3ECHA 3GUDA 4PZJA 3QLUC 3F6CA 3IWFA 4Z4HA 1FBQA 5JNTA 1J7KA 1UHMA 1KQ9A 3COAC 4W5OA 2H94A 2PMCA 3TO5A 5HLHA 5L3CA 4YP9A 2QVCA 1R1VA 3LA3A 2A6EF 1G4DA 3JPWA 4NHJA 3OQNA 5JFRA 4XSXF 1NXVA 1IN4A 4ETIA 3C1DA 4LMYA 5ILVA 1JWLA 2ZO4A 2FSWA 4HNSA 2TMYA 4L5JA 4O5AA 2E4UA 5TE9A 1KU9A 3RH0A 2FQ3A 3ZQ7A 4Z2YA 1ZHFA 3MFKA 1XD7A 4NQRA 2XVCA 2JB9A 2JSCA 2RVCA 4MLDA 1FSPA 1F9NA 3KS9A 4RXMA 5E1ZB 4LFUA 1ZH4A 5TPZD 3SXYA 5LEJA 2R7FA 1F4VA 1P4AA 2OQGA 1J5YA 3JAMZ 4UV8A 1Z6RA 2STWA 1MJ9A 4G8XA 3KP6A 5HKOA 2LBPA 4KDPA 2QR3A 1URPA 3OLYA 3QP6A 4IHTA 3HUGA 1USKA 3K1PA 1U0SY 1OPCA 2O0YA 3E6BA 1ZLJA 4P9UA 2H27A 4RGXA 1ZESA 1KYZA 4ZYHA 4OIRF 1NXWA 3T5XA 4WXCA 3O2JA 3M8EA 3PFIA 5IT9K 2G7UA 3ZP5A 2FKAA 4MR7A 4HV6A 2P4WA 1DC8A 1G6NA 3MZYA 5LRRA 4OIQF 4RDCA 4IRXA 1MVOA 1WETA 2MA3A 1KYWA 2EA2A 5L3BA 2GX6A 5TPZA 2VUIB 3HV2A 2JK1A 6ABPA 1Z26A 3FZVA 1Z12A 2P8TA 4LDAA 1QP7A 4IPAA 3V7SA 1B4AA 2FU4A 3BRQA 4JQFA 2BE5F 1NY5A 2Y75A 1OYYA 4ETNA 1S8NA 2DRIA 3DFGA 2NT3A 3EYIA 2Y48A 1NXSA 5FWYB 2QBYA 1TVMA 3V8LA 2IPAB 2FA5A 4RK5A 3JTHA 1DRKA 1XGSA 1XN7A 5DUKA 3Q7TA 2FXIA 3G3ZA 2JVIA 2NRAC 2KYRA 3NBMA 4MNUA 1EH7A 5JR3A 4XLPF 4MTDA 4WZZA 2L4AA 1OMIA 2IOYA 3CJNA 4KQ9A 3VB2A 3ZMZA 4RV5A 2VBYA 1H9TA 3RVOA 4OIOF 5BMZA 5EWMA 5CVUA 4LX8A 4G9YA 5PNTA 5HLIA 3N0RA 1HKTA 4G0QA 4RK6A 2QQ9A 1YO5C 1JFTA 4DADA 3UKJA 2IA2A 1RXEA 4JASB 5E1WA 3LUHA 3FXQA 3RVNA 1FX7A 2XV4S 3RTRA 8ABPA 2GKGA 4RB2C 4BHPA 3TDZC 4BYYA 3IKTA 1U2QA 1SMYF 1J56A 1M5UA 3J81Z 3BZ6A 2E4XA 1R58A 2PMUA 4Z4EA 3WG9A 1FBSA 3ZMTA 3ECOA 1ZG5A 5IULC 3K9CA 2PUDA 3J80Z 3HZHA 4A0XA 1USSA 1K68A 4ESJA 5B3JC 4ETMA 4D6XA 3T8TA 4Y15A 1FFWA 2RJNA 3KLNA 4YS6A 4RB3C 3HJFA 3DXJF 2NT4A 1MJAA 1JHHA 2QM3A 2IPMA 2NZVG 1TW2A 2W24A 4EYOA 2HTSA 1FWZA 4IRIA 4LLGF 3QELB 5FBHA 1U78A 2QVGA 4MS1A 5DCLA 1APBA 1WRJA 2LDUA 1AB5A 1B9MA 2E4VA 2LP4Y 2FBKA 1DUXC 3GBPA 3LUJA 4F8JA 4LZLA 5JVTA 1R8JA 4O5VA 1U5TA 2G9WA 1GXQA 1T2KA 3H5WA 1U6GA 3CUQA 1J2XA 4MEYF 3JVIA 1SXIA 1RZRD 4LRQA 1ISRA 3PQKA 1BJAA 1ZG3A 3RKXA 4P1ZA 2NNYA 4AIHA 2VUHB 1DCKA 1RIOH 5H20A 2KJBA 1CEYA 3EGCA 2D45A 4XLTA 1ZH5A 2EK5A 3DF8A 1SD4A 4Q5SF 2XAFA 5J8FA 2GXBA 5HS8A 1JFSA 4L18B 4RAYA 1GCAA 3F21A 1PUEE 4XAQA 3HDGA 2E7WA 4WT7A 1XDUA 3Q9SA 2OU2A 3WU0A 2FN9A 1QQBA 3LQRA 1RZ4A 4FE4A 3HVRA 2NS0A 1QQAA 6CHYA 3IC7A 1IZ1A 1CGPA 1SRRA 4YR7A 4GO1A 2CSOA 3GL9A 5DLEA 4ZJPA 2RC4A 5TPWA 2VT2A 3FHZA 3QRFF 1RUOA 2V1UA 2JZYA 4PGHA 4ML3A 3N0XA 2JBAA 2W57A 3WTZA 3OOPA 4XARA 4Z0NA 2YR2A 5CHYA 3SQNA 2L17A 3EQLF 2VODA 5BRJA 4LE2A 3IHUA 4LLNA 3C3MA 1REPC 1AWCA 1R1TA 3R4KA 5E8GA 1ODDA 3HRTA 4I09A 1PP8F 3F8MA 1C4WA 3Q41A 4EUKA 4N0BA 2YPRA 1S6LA 1BDJA 1XGNA 4YV7A 1P6QA 4FB4A 2H0AA 5DCMB 1ZITA 4BNCA 3CO7C 1X3UA 4A2UA 4RK7A 2YX7A 3IWZA 1LEBA 1DP7P 3KSMA 3BPXA 2E4ZA 1DDNA 4MS3A 4NV3A 3RVKA 2DT5A 4IGAA 1E6KA 1D2AA 3H5VA 4FE7A 2A69F 1S7OA 3KEQA 4JB0A 4QWQA 1MJBA 1XWWA 3I45A 1CF7B 4IXAA 4M6YA 5D8LB 5FFZA 2M98A 2ZMEA 3D02A 2PUCA 5HSGA 2ZAYA 4NCAA 1ZLKA 2OBPA 3RJPA 4BAYA 1VTNC 3IP6A 2M8EA 5TQ0A 3E97A 2ZNZA 3GBVA 1TQPA 4BHCA 2XGXA 1FY7A 2QUFA 2UWMA 3CS3A 2ZWMA 3MIZA 4M88A 4DNCA 2F5CA 1JYFA 1IUYA 3CUOA 2R48A 3O6BB 2DBBA 4RGSA 4HF1A 1UFMA 1WQ2A 2W25A 3U2RA 1YG2A 5LRSA 2HS5A 5DTEA 3BBLA 5TPWB 3EAFA 3GLXA 4RK1A 3Q9VA 4KIBA 5L3EA 2ACJA 4H60A 2IW5A 5TQ2B 1Z13A 5IC5A 3LFKA 5BS6A 2QQBA 3RI4A 3C6QA 5EEGA 3HSFA 3WTSC 1U2PA 1K7AA 1BOAA 4RS8A 2MD5A 3LUAA 4EM0B 4Y9TA 1W25A 4L0YB 3NHZA 3E6CC 1I1SA 1VKRA 4YLEA 2ETHA 1U2WA 1I27A 2JPBA 4RB1A 4G97A 2QWWA 4KZKA 4NCBA 1Z15A 3OLWA 4MR9A 2X4HA 1FSEA 2M1BA 2P7CB 2QZJA 4RXTA 2FTKE 2IYNA 2RN7A 4ENJA 1MGTA 2L01A 4OINF 3E6MA 5EWJB 2CHFA 2XRNA 4A0ZA 2GI4A 1FSHA 4F7ZA 2XASA 4CGZA 1FT9A 1DZ3A 1MAVA 1W5TA 1QZZA 3CUQB 2BBYA 3ZN1A 4PDKA 4I2OA 3QX8A 4LLLA 1B00A 5L3FA 3VFZA 3D8UA 3C18A 3B02A 1XDSA 4PCQA 4A6EA 1O3QA 5D6FA 3H6GA 5K5RA 2X0LA 3TD9A 5CVIA 3M9XA 1XSXA 3QP5A 2E1CA 2PFBA 4ZH4F 4NB5A 4R79A 3O2PE 3MAJA 3ROUA 1TQMA 3KP5A 1ZAOA 3M7GA 1ON1A 4G7OF 4HX7A 1LK0A 1Y1LA 2LIVA 2O20A 4JAVC 4RK4A 2DU9A 2VE8A 1ZARA 2KIFA 3OQOA 2C6YA 2HQBA 2QVOA 3ERED 4IILA 1QMPA 3TMYA 3B73A 5HS7A 3TGNA 2GA1A 1T6SA 2QENA 3F8NA 4W5RA 2W84A 3KYIB 5HLGA 1UCRA 1L3LA 5D5WB 3IRQA 1O3TA 1O57A 4M71A 3P7NA 2ZBKA 5AIQA 4KMFA 2K7LA 5KK1A 2RQPA 2K4JA 1DP4A 3ROTA 3REOA 5F64A 4IHSA 4U0YA 2HWVA 1P4WA 4EM2A 1LJUA 1VLZA 5IEJA 2FMYA 3GWGA 2HFHA 1OYIA 2FLWA 2F8TA 4O6JA 5HDNA 2YHBA 1HKQA 1FQWA 3ZMVA 5EWMB 2HOEA 1OYWA 2D1HA 3JTGA 3KG2A 2GZWA 3QEMB 3T8YA 3VNAA 5CVVA 4JA2A 2YHAA 5KQPA 4Q4ZF 3BDDA 3HRMA 3L9FA 4KUMA 3MCZA 1IIBA 2PJUA 3K4HA 4LK1F 1EWTA 1IN7A 1USGA 4EYQA 2K4BA 2HQOA 1QNLA 2JTVA 4MRMB 3O1IC 2R3SA 1FZPB 2FQYA 3DQVC 2QBYB 3FFXA 4IMJB 1TMYA 4I7HA 1BAPA 4CHUA 2VK2A 4HQEA 4YFXF 3QLTA 1ONVA 1L0OC 4HX4A 3KZYA 3TDUC 5CNJA 2E4WA 2PL9A 4UHJA 3FGZA 3P9CA 1HW5A 3H1EA 2WTEA 4Z4GA 1YMVA 2XAJA 3JW4A 5HQJA 3K69A 1JHZA 3JSOA 4G6DA 1UDRA 5E3JA 1O7LA 3GYHX 7ABPA 5IUKC 2IRFG 3FFTA 1KQ0A 1NXPA 2Z99A 3G1WA 4ENMA 2FMIA 4M6XA 3O74A 3KLOA 1Z9CA 4UXNA 1D1QA 4YIFA 1FOKA 2VOPA 4L9TA 2YSRA 1YW7A 2ESHA 3ILHA 3FM5A 1FYKA 3FFWA 4G6QA 3I4PA 5D4RA 3OM1A 4UNOA 2A07F 1LQ1A 3E3MA 1E6LA 4JK1X 3O2QB 1H9CA 2P4UA 2D2WA 3M1EA 4KIGA 3RVPA 2AYZA 4WUTA 1YFHA 5GOTA 5D5UB 1JE8A 3BP8A 1Q1HA 3S2WA 2Q5CA 1YTUA 1NXTA 1ZVVA 3NQOA 4I0AA 3RKWA 3QU6A 5ICCA 1W7PA 4U7BA 2BGGA 2O6GE 3HIFA 1SD7A 1GCGA 2M45A 3R61A 1KQ8A 1HW1A 4KFCA 3BILA 5JNRA 2F5DA 3DZDA 2L54A 1KU7A 4EVSA 5DD8A 3QX9A 3QK7A 1B9NA 4MQEA 4HDUA 3KP7A 4Q47A 4CICA 3U1DA 4WK8F 1CHNA 4OBBA 2ESNA 2HZTA 1HBXG 5FLXK 2ZNYA 4YG2F 3ELKA 1EV7A 5FO5A 5IT3A 1WKMA 4CZZA 2MYUA 4Q6BA 2HR3A 4HBLA 3LA7A 1D8JA 2V9VA 1XB4A 2YX4A 1PNTA 3GFIA 5T3YA 4JB2A 3GT7A 3R0JA 5H6RA 5EWLB 4YFKF 2J5PA 3UUGA 1BI0A 3Q7SA 5D5XB 4G0MA 1IAWA 4XXHA 4RZSA 1AB6A 4CYDA 2HSGA 1A0OA 2UXNA 1KA8A 2VBXA 4KK3A 1QO0A 1ABEA 1ZG1A 1CYEA 5JS2A 4QICA 1LBHA 4N9HA 2QLZA 4I02A 3RYRA 2UZKA 4HDVA 3K9TA 4LG0A 3F6VA 5C5CA 2BEOA 4F11A 5KC8A 3FMSA 4Z9BA 2XAQA 2AXLA 4JP1A 2Z5UA 5ILUA 3N53A 4B09A 3BJOA 3HM9A 3O75A 2HQRA 1STZA 1BI2A 3HCWA 5KQGA 1TLFA 9ABPA 1R5HA 1W7PD 4UVBA 1MDMB 4I98B 1KGSA 2PUAA 5EWLA 3F22A 3I53A 4Y17A 2KJCA 1S3JA 1A04A 2F5EA 3CTAA 3IPAA 1ZRFA 2VONA 3EODA 1JHFA 1ZH2A 2WC2A 1TNTA 2ZCWA 1K79A 3Q5FA 1XSDA 1W9HA 1SD6A 4WXDA 5DYMA 4DQ2A 3BY6A 3QEKA 3T1BA 3HOSA 3HO1A 3BJ6A 1GHCA 4XSZF 1QKKA 5D4SA 4CO8A 3W9SA 4RGUA 1PHRA 3SY8A 2PLYA 4RS3A 3DGEC 2QZ8A 3HTSB 4U7DA 4KICA 3SM9A 4I0BA 1YMUA 3KTOA 2OZUA 4ZYGA 2P5VA 2I6FA 2DI3A 4MS4A 1MKMA 2QXYA 1BDHA 2H09A 2WV0A 4HF2A 2FQXA 2WMYA 5IBQA 4A6DA 2PUBA 4P55A 5I4CA 1C0EA 2D1VA 1D4ZA 3IP7A 2OD5A 4KQCA 1JF8A 1IW7F 2L02A 1OR7A 1TJYA 5JNWA 1BM9A 1ZDMA 1XSVA 3P9IA 3QLVC 3MWMA 3GZ5A 4E70A 4RKQA 4Z4CA 1F51E 5B3JA 1G3SA 2BGCA 2EJRA 2R25B 2XKOA 4OMYA 4I01A 3DLHA 1DBQA 3O2SB 3SZTA 1BC7C 4OLBA 5FWXB 4GPAA 1XMKA 2Y0MA 3GF2A 2XAHA 2MYNA 3BROA 3KETA 4W5NA 1SFUA 4EMSA 4G7HF 1FP1D 3H5OA 1JGSA 1YK0A 3HK2A 2K27A 4P5OA 4IMIB 1G3WA 3FXUA 3A0UA 2ELHA 2E4YA 1U8TA 4DN6A 1Z2DA 3I5AA 2BYVE 2ISZA 1HW2A 4RK0A 1ON2A 4MHGA 3A0RB 1Z1DA 2MC3A 5CLSA 2EFWA 1TBXA 3KYJB 4MQFA 2CWEA 4XASA 1ZGAA 2KIMA 3LMKA 4E7OA 1DPRA 3PQJA 1RI7A 4G86A 1WWXA 1ZN2A 3LUKA 2A6HF 2B1JA 3V8JA 4F3TA 2EWNA 2VN2A 3F8FA 5LGNA 3H1GA 1R00A 4EVIA 3WTYC 3WGHA 1FFGA 2QU7A 2PUFA 1QZYA 2R4QA 1H0MA 4GYGA 4KMUX 4N03A 1ULYA 5HS9A 5KQLA 1PP7U 1PNRA 1KU2A 1I3CA 3BRSA 3M9WA 3OO0A 3OLZA 2B4AA 4Q6WA 1YS6A 2YU3A 2M87A 2OZ6A 2CYYA 5JNSA 3N97A 4CXFA 3DP7A 5KQMA 4QYMA 5HOOA 2IA0A 5CYVA 1Z91A 2PUGA 2HYGD 2FEWB 1XCBA 2DQLA 3P9KA 2PJPA 3RIRA 1QO0D 1Z18A 4HLXA 1V3FA 1BA2A 1NATA 3C97A 3RYPA 2Q2EA 1U5TB 2XDYA 3CG0A 4WXEA 5KVRA 1TLHB 4KREA 1LJ9A 3I59A 1MB3A 2CO5A 1TW3A 4KIFA 1MD0A 3KJXA 3RKYA 3ZN0A 3J81K 5K1YA 2HPHA 1TQIA 3EETA 2HGCA 2A9RA 1RUNA 3A10A 2WRZA 2CW0F 1DBPA 3GW2A 4LGWA 1G3TA 4IRGA 5HDGA 3M9AA 3IP9A 3IRRA 4RU1A 3P9YA 3URMA 5IEBA 3JVDA 3I09A 1ZAYA 1D8KA 3JY6A 3IL2A 1IN6A 2M30A 1EWVA 4MR8A 2QSJA 4LDZA 3ILYA 4N76A 1K66A 3T6KA 3CKMA 1QGPA 2MYPA 2LF8A 4BQAA 1EHCA 4L0ZB 4KK4A 3WTTC 3FX3A 1FPQA 2QYOA 3CHYA 4LE0A 4ZZLA 1R22A 1B59A 2H6CA 2FW0A 2P7VB 5JHUA 1DRJA 1PUXA 1BIAA 5BQ3A 5CNKA 3DLBA 5BPIA 3IDOA 2PMHA 1E2BA 4KYWA 4O1IA 2L2QA 2RDPA 2WB4A 1YK1A 1GUBA 3H92A 1SFEA 4MGEA 2E7XA 3MA0A 1W7PB 2COMA 2WWYA 4D74A 2FNPA 3GEZA 2VBZA 3GVAA 1ISSA 3L7WA 4L5IA 4TMYA 3K0LA 5E8IA 5FB2A 3FXRA 4G0XA 1DPUA 4NQWA 4JBAA 3GV0A 1OXBB 1JDNA 3RVMA 3ZMSA 2WJAA 4B8XA 4ESFA 3E3VA 5J6XA 3L6UA 3BPVA 3VNBA 1VRVA 3UK0A 1USIA 2IPLA 3F73A 3MQ4A 3O21A 1H9GA 5CVRA 1LBIA 1J59A 3O3KA 1WI9A 4WX9A 3NHMA 1D3YA 2UXXA 4HQMA 1JXSA 4ZMRA 1F5TA 4MQFB 3SG0A 1SXHA 3RVJA 2PEXA 5TQ0B 4U0VA 3N75A 3EDPA 2V79A 2PAFA 2R47A 3TOBA 1IN8A 4RB0A 1HSTA 4ENKA 3EUHA 1EH6A 5CVJA 3HS3A 4E7PA 2ZMEB 1U5TC 2L19A 4KV7A 3BWGA 3EDCA 2JPCA 1IRGA 3E5QA 3TO7A 5JI6A 1LB2A 3CZCA 3ROFA 2MH2A 3W6JB 2Z33A 1JBEA 2HQNA 1I6XA 1JLKA 3WU1B 2DK5A 1PEAA 3KZZA 5ICGA 3HSYA 2MSWA 1NXOA 2FXAA 2E1NA 3OLVA 4MR7B 1BI1A 3RDIA 1BVHA 5E17F 2NUBA 4PYRA 1G3YA 3EQ2A 5L3GA 3KCNA 1NXXA 3HUTA 2W85A 3LAJA 4MQ9F 5A2QK 4O1HA 3F23A 1BDIA 4EYKA 3TB6A 3CLOA 1R7JA 3LWFA 1Z7UA 2FLKA 3HEBA 2G7HA 3IPCA 1R36A 3SAJA 2Q0OA 4GXOA 4TLMB 1U8RA 5F1RA 4LJZF 3D0SA 3DEUA 5LGUA 1DCFA 4OG2A 1GUDA 3TKYA 3FWEA 1SFXA 3T0YA 2LUOA 3LQQA 1ZGJA 2FNAA 1TTYA 2GAUA 4BHBA
chains in the Genus database with same CATH superfamily
4CKBA 4BNLA 4O33A 1SKBA 1Z5WA 3QHPA 5GGXA 3VZSA 4QFMA 2O8BA 4AKGA 2GEVA 3MUNA 3O9MA 5HKKD 1YZFA 4N54A 4XFJA 3L2OB 4M55A 2NVXJ 2LBFA 3FDYA 2SKDA 2HWKA 1YR3A 3FDJA 5K3AA 4KBFA 1WSUA 2QVLA 2R1TA 2SICE 4EHBA 1I14A 1J22A 1U9IC 1UT5A 5E1DA 2G8LA 1RJEA 3WU2C 3L6RA 1H0SA 4DA9A 2WSMA 3CT6A 4J2HA 5I01A 1AHDP 3D8RA 3EBLA 4LPSA 4G07A 4OMUA 3ZBTA 4Y2XA 3FOFC 4DABA 2KM1A 3M4YA 3F6OA 3OIUA 2H4JA 5FTNA 3RUHA 1UBEA 1YZQA 4WFQA 4FX5A 3K73O 3OZ7A 2JHFA 1S7AA 3AF5A 1ENPA 2RARA 2FYTA 1SHLA 3CEJA 1FUUA 4DBRA 3N2EA 3D8SA 2OC4A 1KJQA 2QLJA 4YCSA 5FPPA 3F3XA 4KISA 1YW8A 2AHQA 2DA4A 1YHYA 3CB2A 2I8LA 1B15A 2LR8A 3DPLC 3IILA 4FW9A 2O7SA 1EGVB 4M1YA 3OZBA 3OQMA 3EF0A 2GOYA 3DTVD 1I6LA 1H6CA 1ICIA 2CXPA 1IHOA 2WSIA 3GFVA 3T4PA 4L02A 1VGQA 3I42A 3F3SA 5JZ9A 4LJ9A 3TRIA 3ZCSA 4EG1A 3BIJA 3IERA 3BCBA 3F3MA 1Y63A 4NBWA 2LY2A 4TL7A 3RSCA 3VAAA 3WSTA 3GLGB 1FTZA 4EJVA 1GGHA 3M6WA 4RUKA 1CP2A 2MABA 4F5YA 4LTMA 1MEOA 3CUKA 4ZC3A 2EFDB 1OPXA 1RT9A 2HIMA 4CKWA 1YX3A 4LS3A 3WO1A 1UHSA 5B2FA 1QVWA 2Y0PA 4JZKA 5FBRB 2A3SA 4O4LB 1HWYA 5JD3A 4CCYB 1D9XA 4B3MB 3IAM6 4RZ2A 2ZJAA 1E99A 4BFXA 5C8XA 2P6TA 3AR4A 3J7YJ 2HEOA 1Z8DA 3W1WA 1B8UA 4P5PA 3BJEA 4KWTA 4PYIA 1GA4A 4WK4B 2IV3A 2ZLBA 4PX9A 2IH4A 2F4VB 1YRHA 1QCDA 3FNIA 2QF7A 4QYXA 4M8IA 1Y1WJ 1FSSA 2HJGA 4GU5A 3CDIA 3ML1A 2VL7A 3R5JA 4AS2A 4ACBA 4TZKA 1AUXA 2RGXA 3TJZA 4I4TF 2R84A 1TL7C 4FONA 3HJHA 2JQ7A 2LSOA 3GT3A 4X61A 3U9LA 1O6CA 3O4RA 4L50A 2IT0A 5K8UA 3NBUA 1JDPA 1Y48E 2IVFA 4HS9A 3CZ9A 3OSZA 3TBIA 1PZEA 1YQ9A 4FXPA 1WIWA 2HXSA 4YIHA 2FPXA 4ZVNA 3R7AA 2PQ0A 3P52A 1KA9H 4PQEA 5IP6A 1UC8A 1B16A 4HSGA 4OAYA 3CF5F 2OBXA 1XF1A 3PIRA 4MDYA 3IB6A 2QTTA 2OM6A 5FD5A 2DA2A 4OHWA 5E9JA 2GZ3A 3WTWC 3PRYA 4M1SA 3ZVLA 1M54A 1PJ8A 1EUDB 1NHWA 2WM8A 2ZAGA 4MWGA 3UKDA 1BRMA 3B2QA 1N2CB 2W42A 2EFOA 3A1TA 1RKBA 1G8SA 3FUVA 4ANJA 4OEHA 3URKA 5T6MA 3IYLW 4HXYA 1BJZA 1GZDA 3IXLA 4E03A 1TP4A 5K01A 1GPJA 2G63A 2V1NA 1MAWA 3W3AH 1AKRA 2XF8A 3GRFA 3M5CA 3NTRA 4FMPA 4I55A 3ZMUA 1P61B 2OB1A 4EGSA 1K3TA 2JFPA 4QC2A 3M4JA 3CCLI 2JW5A 3R3XA 4W1UA 3TLAA 2NPOA 3V1MA 3QU7A 3W1VA 5JXIA 1BU8A 3N2GB 3N8KA 3NEJA 1PG0A 2DAOA 2LPMA 4G4SP 2QVZX 3NIGB 3VR4D 2B7EA 1ZZEA 3IQFA 4ER7A 2WE8A 4IUYA 4KV9A 1MQ8B 3VODA 3NALA 1ZXLA 1SKYB 1QJ4A 1SANA 1GL9B 1M75A 1R6UA 1T2NA 1UFVA 3FZEA 3P5SA 1OTXA 3CEAA 4JYMA 4OXXA 1QP0A 3LE8A 5IG2A 4F91B 1EFDN 3BZUA 4K86A 2I22A 2QAIA 1HOTA 3U1TA 1K3FA 1XHEA 3PQ2A 1NY6A 2VXCA 3H8WA 2BY4A 3ENKA 3GEBA 3CRQA 3P9SA 4GZ3A 5TQ2A 1N34B 1ZJYA 1ZMOA 1ELOA 1XZKA 1GZVA 4IVQA 4PHFA 1IHPA 4OVKA 2HMUA 5BT8A 2Y0SA 3BT7A 3L4JA 1LV8A 3VNRA 4PLPA 4XW2A 4EGFA 5KWVA 3E48A 2HYJA 1XTVA 6AT1A 4I5GA 5IJ0A 1DO0A 3MC1A 1MMDA 2NGRA 3HVJA 2G5TA 1FZQA 3N87A 4WGFA 5AW1A 4IF4A 5JXGA 2HTJA 1F36A 2CYBA 3BOSA 4Q4AB 3ADCA 4KH0A 4QUKA 2DW4A 3TBKA 1JLLB 3UFXB 2PN6A 1E3WA 4JQSA 1NJ2A 2W2XA 2NVYJ 2XHKA 1MA3A 2YCLA 5AH0A 3ZI4A 1MZBA 2J3HA 1HDRA 3WTUC 2HCJB 4A6XA 2O8DA 5C4XJ 1E8DA 4Q39A 1A9OA 3G7SA 5CDFA 2Q41A 3DEJA 2IKSA 2V6MA 3BFJA 4TS9A 4B48A 1DMSA 2O8CA 2AH5A 2O03A 2ID7A 1GA1A 5I51A 1E17A 2NXWA 2WHXA 4IDPA 2EV0A 3FYUA 1ITYA 3BXPA 3PC3A 2PGLA 4J0KA 2LBFB 4N7MA 4JR1A 2B6NA 1L5KA 4J3NA 5EE1A 3W6PA 4GPZA 2QRHA 4TM7A 5AWFC 4BV3A 5LHIA 2WYUA 3OFSA 3AMVA 5KHDA 4Y13A 3IAS2 1HZJA 2MBFA 4HATA 4R1UA 3VBEA 3OPMA 2M1XA 4ZOLF 2GPWA 5D7BA 3FRIA 5J1UA 3TRHA 4UAUA 3W5IA 1IV6A 4QQRA 3WTXC 1L7OA 4V1CA 1POWA 4MXDA 3SBDA 1W73A 3HY4A 1GA6A 4ID3A 1YFLA 1P2TA 5KMGB 1WW3A 1BJTA 5AM0A 2WB2A 4N0QA 4EVQA 3CRRA 4DNPA 2XGCA 4CN9A 1R12A 4Z6KA 4RENA 4UHKA 3WMEA 4DYCA 4CBVA 2AR9A 3KB2A 1TZMA 1FUYB 3DZHA 3I9V2 5T4EA 4H3KB 1LJLA 4NDZA 4Q9DA 2KS6A 4NYMQ 4MQMA 4RA9B 1IG0A 4XCVA 1YDMA 2FKNA 2A6TA 4YWJA 5BSKA 5B4VA 2QG4A 1P5HA 2VT3A 2ZI5A 3CV3A 5EJ7A 2AT1A 3UAZA 4B3TB 1K9SA 3A6GA 1ML3A 5IC6A 3A3NA 1SCIA 3PC2A 3H5IA 3NNNA 1IXSB 4FYMA 1LDKB 4JB3A 2DXIA 1XQ1A 2XE6A 1VKNA 3B1JA 3OPQA 5AMXA 4EO4A 1U3DA 3NG1A 4UW9A 5KNBH 1NTCA 3S3MA 2JVGA 1EK6A 3I37X 1F9EA 3L0PA 3DDUA 4FYPA 1XG1A 1NM5A 5DCMA 1VG8A 2WHQA 3I0MA 3KL2A 4KE7A 3VO8A 3NIWA 1M67A 2OUIA 2UVPB 1XAJA 2A88A 4OGGA 1J9ZA 2YW9A 3DW1X 1YI0A 4UM7A 1JEOA 1AY0A 2J5OA 2C77A 3LZ6A 2ZXJA 1E2XA 1B0ZA 2ST1A 3ND7A 1SBYA 5EUMA 2EJVA 4CM9D 1E3HA 3ZMDA 4MKGA 3RSZA 3PQEA 5A3QA 2ZITA 5LZ7A 2R7RA 5A4MS 4B3RB 2OGZA 4U3JB 4FFWA 1UM9A 3IT2A 1SKYE 2A86A 1FVOA 3I05A 3NP7A 5DSTA 4LHYA 3C8MA 3AL2A 2JGDA 1ECBA 3VSKA 2D1FA 3NJ8A 4MITA 4U63A 1POXA 3W3AD 4Q7QA 2OTLI 1ESDA 3W05A 2WPDA 2GBPA 3X2SA 3ABOB 3IC5A 2HA6A 1KSJA 4B35A 5AKKA 1RNLA 3UAXA 1B1BA 3GTOJ 2R8RA 3WGZA 1U2GC 3H9BA 3IO5A 1NLMA 1JYEA 4MYCA 3DO5A 5JXHA 2AFHA 2WU3A 3IA7A 4LVOA 4OFXA 2VJBA 4M9ZA 1AUPA 1PQPA 1CX9B 1Z0SA 2JRLA 2O2DA 2QQGA 2WJGA 2VUMJ 4P82A 4U5QA 1JH9A 2GJ9A 2RDMA 4HV5A 3RVQA 5FTMA 3DBIA 2BTEA 4O4IF 4OHPA 1BDMA 1UC9A 1YE9A 1LU9A 2CHVA 4U4AA 4IG4A 4Q4HA 1QP8A 4B1RA 5AK5A 2ZBGA 2RHMA 3OTHA 4MRMA 4ZO9A 4EV0A 4RA6A 4QYWA 4CL0A 1F2VA 1NVTA 3NDJA 4OATA 3TIIA 5E4FA 1R4AA 3LBIA 4KIWA 2AI3A 2V6CA 2DO7A 2W2TA 3NXSA 3EGDA 4NAVA 4RTKA 1KZ4A 4KO8A 3LHKA 2W2MA 3MGBA 2A6PA 2CMFA 2YZGA 4OBEA 4MYUA 3RNOA 2EP8A 3RYFA 3GLHE 4PICA 2CFCA 1T4CA 1MV8A 3H13A 4PTZA 4DTCA 3TR5A 5SY6A 3VXKA 1RJ9B 1GZ7A 3C3KA 3VDNB 5JNSA 2UXCB 5DS9A 3S7ZA 1VL6A 3V34A 1PDWA 2YFKA 1L5YA 2QJFA 3ELUA 4C2BA 1WBDA 3BFKA 4UHCA 4A0GA 1HTWA 1PKXA 3V9AA 1CQTA 1UCFA 3MMNA 4JDUA 5BN3B 2PZJA 3NAZA 2VASA 1ADGA 4R69A 3KQPA 3GUZA 5ALFA 1UP7A 4UFOA 1QE5A 3T5TA 1XZAA 5LIRA 3ZVNA 4JXZA 2VKTA 4HRAA 4YJGB 1UK6A 2Y0BA 1CUBA 3E8XA 3JS5A 1EQUA 1H8EA 1ONPA 3OTWA 4QOGA 2RGVA 2H31A 3M4XA 3WWEA 2C9ZA 5A9SA 3FSEA 1X9GA 2H6EA 3IAFA 4ZPJA 4BFLA 4PPGA 2FVYA 5EXDA 2YJTD 2CW7A 3AF1A 2ACVA 1G9TA 1R0YA 3FPEA 3K7EA 4ME6A 5TJJA 2AMYA 2C57A 1Z17A 3SZGA 3HP4A 3L8EA 4FU0A 4UUOA 1K63A 1M2EA 4XR6A 2M1ZA 4G4SO 2FSVA 5EHXA 4EDHA 2V1DA 4R3NA 1DBVO 2L3DA 1HYGA 4QHYA 1K5HA 4AP6A 1EFCA 4CTKA 1SN7A 3C4JA 5T4FA 3I64A 1GNVA 1QB7A 2JLCA 4DGSA 4EMTA 3D8HA 2ACKA 3UCFA 2VWPA 3J80K 1LW7A 3BQ9A 3DZCA 3G5AA 1A5AB 2C5EA 3JQ9C 1JJIA 1YDEA 4BY9E 3K4CA 1YJNI 3DF7A 4ZAVA 4DAEA 3GEMA 5IASA 3LSRA 3SKXA 5AM3A 2PRIA 2JEYA 4BNDB 1LKZA 3FXJA 4JQOA 3ZWOA 3VYSB 2P5KA 4G7ZF 1FYMA 2OMEA 4D92A 4EHLA 5BW8A 4OHXA 4CEJB 2HZDA 4WOJA 1L1QA 2OG2A 2VAWA 4NJMA 2NMVA 1PLJA 4TV7A 4H31A 3WYNA 4EM6A 4RGYA 3ZNOA 1NHAA 1BCSB 1N8KA 5LYYA 2XBLA 3II6X 3RS7A 5CA0B 4P7JA 3GA5A 1U0EA 4YJ3B 2IP2A 3G9QA 2DDAA 2GXAA 3B6ZA 4O2BF 1B23P 1DOAA 1NBMD 3T3GA 4KOEC 1NQUA 1Y4DE 4MX8A 3NAGA 1XCGB 4Q02A 5DYTA 2VSYA 1C9JA 1CUUA 3NNSA 3UV7A 3J7AO 4GMFA 3RS4A 5CLHA 1FU8A 1II8B 2IYQA 1J07A 2H4FA 1P29A 1YZHA 4RAFA 1LBSA 2VPZA 3IRUA 4KQWA 4MVXA 2JJYA 5DUIA 3RUCA 1MH9A 1N1MA 4BLWA 5A5VA 1Y5NA 3SD7A 4BFUA 2PKXA 2ZW9A 3K16A 2LF7A 4JYCA 4XX0A 3ZJ5A 1JU4A 3HMKA 1DOHA 2MLGA 3EZ9A 3T0IA 3P26A 4P92A 4NYIQ 4DR7B 4JLVA 2XYQA 5SYMA 3WTBA 1NF9A 3A9CA 2FVXA 1RP1A 3NFYA 4N0DA 1T98A 1JALA 1SNYA 1Y98A 3ZHBA 4JWKA 4YECA 2HF9A 3LQ1A 2O7NA 3FHJA 4QO7A 1H88C 4DLTA 2Z3WA 3H7IA 3BHNA 3P97A 5E6SA 4URZR 2A4KA 3B7GA 2STTA 4WADA 2PT7A 5KKAA 5DTDA 1JLSA 5FI1B 3SICE 3OEWA 5CDTA 4OU5A 1OMOA 2BJHA 4WBSA 4LXUA 3U1VA 3WJ2A 5AI5A 2FN3A 3DMFA 4G5GA 4P80A 4MVJM 1QVUA 4XD2A 4ZO8A 2ZUWA 4D4MA 3H9QA 5BSVA 2JA6J 1SOUA 3D3WA 4YCAA 3TH5A 3SBXA 2G7ZA 1GZ6A 2IS1A 2HL6A 3GFPA 3HN7A 4IFBA 4IYJA 1NBOA 2FZ4A 5BSWA 3FTNA 3TLMA 1TZ2A 1XX6A 2GM5A 3K1NA 1RZUA 2JFNA 2OGUA 4MKZA 1M6YA 1RAEA 1Z5VA 2ZRLA 3NV9A 4BN4A 1Z6XA 2P68A 2SBTA 3QUTA 4I19A 5H3CA 3HL2A 3SC2A 3KJHA 3LTNC 2UZ1A 3KELA 1XZFA 4ZO6A 3GJ3A 3ACBA 3I9MA 4ZKDA 3C39A 121PA 3AJDA 3UNGC 2DAPA 3I58A 1J21A 1Q57A 4NMLA 1TYDE 3WBJA 3A1WA 2O7QA 2Q7OE 5BNTA 1MOPA 1WKBA 5E3OA 3NIDB 1P9LA 1OB5A 1X1QA 1GQFA 4MV5A 1AX9A 3I01M 4R9VA 3AIOA 1TX4B 2DMPA 1T0JB 3HZJA 1CR1A 1I6MA 1R0WA 2Q9AA 3CF4A 1B6AA 1SUEA 3EISA 3E1GA 5HNKA 5JU6A 3EQ6A 4RSMA 4YFVA 4RLQA 1EFLA 1Q7RA 3L1VA 3AOEA 3QUBA 4UASA 5IW8A 4BX2A 5LHGA 3U1KA 2IYFA 3PUXA 4GX2A 4KIJA 5DGHA 1LLCA 4FFDA 5D5VB 1JKJB 5IDVA 1M0EA 1ENHA 1FTQA 3BMNA 4NCXA 5BYJA 3MRXA 4R1HA 1Q16A 4D8WA 4PY2A 1RLIA 5CB8A 5AVXA 3K71B 2PBLA 5JQGF 5KAPA 4HF0A 2XB6A 3T99A 1JHVA 1PJQA 4MI3A 3OLXA 3OEED 4RH0A 4UNSA 3PD0A 3Q2OA 2VE9A 2EQ5A 1UKZA 1UH5A 3HCBA 5LEKA 4HY3A 3FBWA 4H18A 2SKEA 2WJ6A 2KIUA 2GUGA 3ND6A 5MF6A 4XLAA 2KMLA 4G67A 2WA0A 4MA0A 4BKRA 4EHDA 2BY1A 1AM4D 1XTIA 2HIGA 3B1VA 4HQRA 1V5GA 3GF4A 5MGBA 4IFTA 1ZIYA 1YFJA 3PPWA 4CE6A 1M8KA 2CQKA 3B9QA 4BLPA 3PK0A 1LH0A 3L7YA 3QOPA 1MXFA 1B8OA 5B37A 2ASVA 1ESMA 4Q3EA 5JCJA 3EVBA 2XYHA 4FQ8A 3UJPA 1KZYC 3ETHA 4J7XA 4CN8A 2UXDB 5J3JA 2C1EA 3PCTA 1SZDA 3T5MA 4JXKA 4CR8A 1NNSA 2OHVA 2O3FA 4F9TA 3BTOA 1X3ZB 1EGMB 1WOYA 3IELA 1I3LA 2AIRA 4HRVA 4QQFA 5GQSA 1JVNA 3G5LA 4R0NA 2NU9B 3EGOA 3SEAA 3CUTA 2FCAA 2WY2D 1BQ4A 2VHTA 4MV6A 4UCQA 4WD3A 4RTSA 3CVUA 3N5KA 1PFQA 4B75A 2PX9A 3DTYA 1C2TA 4X54A 4B73A 3KV3O 3CUEF 2EQAA 3CZAA 3MWKA 3NH9A 4WNYA 5FB3A 2BDTA 1JWAB 5ALZA 4B7UA 2XF6A 3J7AY 2I1LA 4MYRA 1BC8C 1JZTA 1A7AA 1VRWA 4DANA 5K2OA 2RGUA 1A2QA 5I7AA 1ZTRA 5EZYF 5CB4B 2XCRB 3MQ0A 3LWZA 1TYBE 3WP0A 4O8CA 5IJZA 3T7AA 1E2NA 2NN3C 2EV5A 4EF4A 1M72A 3ABUA 1SAXA 5EG0A 4IVNA 2DQSA 4IICA 4DCTA 2QMUA 1XZIA 2HYIC 1TCVA 1UK7A 5C8ZA 3U9SA 4BBPA 3UR3C 3PDJA 1IO2A 3QVWA 4H3SA 3IBFA 2D4HA 1FNNA 4DDKA 1MH4A 1FDUA 3S3TA 3SC4A 3I9JA 5DLDA 3LKVA 3N4MA 4A3KJ 5EG5A 4DCUA 2FFBA 1RZVA 3AJ8A 4AO6A 2WPDD 4KA4A 4V1CI 4F1JA 1W44A 2ZB4A 4FHZA 5BSEA 1WG8A 4JEHA 1KI6A 4F0JA 4ZCLA 2WLTA 4Y52J 3KSBC 3RLIA 2QD5A 5I7FA 2GKOA 3G71I 4CT5A 4ALMA 5JAZA 5D8DA 2XNJA 3PC4A 1R5JA 5FNVF 3QMWA 4EIWA 5K6TA 2AXPA 2O52A 4CM9A 3HKCA 4B43A 1QGOA 3W5BA 3J81k 5D86A 4URHA 1PCXA 5DGIA 4WA8A 4CDNA 2XIGA 3K6KA 3LECA 5AM1A 2VSQA 1V25A 4OQMA 5DU2A 1ODFA 4YP7A 4YIIA 4G94A 5DGTA 1Q0HA 4MGKR 3I54A 1ISFA 3V2UA 4PCAA 1VJ1A 4MLCA 2JGJA 1YONA 5IT9Z 4JU8A 1UBTS 2GUWA 1X1EA 1VQPI 2EC5A 3KJGA 2ZVJA 1UIRA 2Q4BA 3W9YA 3UB3A 2F2EA 2VF7A 2X8JA 2MH9A 3ED1A 2A9OA 1M1YE 4KYIB 5FFMA 4AMVA 3PFHA 2JBAB 3FR7A 3QGMA 4R8KA 1R8SA 1Y9AA 3DT8A 1WMDA 4P83A 1E63A 4UBJA 1GZ4A 1P7IA 1FDSA 3HRUA 3SEQA 3A11A 4DQDA 5A0TA 3MYRA 3Q3IA 3N2LA 5BOVA 4FEAA 4PZZA 3I8OA 5AUNB 2XZOA 3RTBA 5FIUA 4LFCB 4EJTA 1NWCA 5L7TA 1FP2A 2GFHA 1B8VA 4AVPA 4YLGA 4C04A 1XMAA 2O8CB 2I6UA 1K4YA 2JH3A 2PRZA 1ETYA 3RQIA 3O38A 3EIEA 4GI1A 4IH9A 1QK4A 3PQ6A 3PXCX 4M22A 4BAZA 2AQEA 3FXKA 4X60A 3UJBA 1R5ID 4KN4X 3OLCX 4KLNA 3I2JA 5IARA 2JCSA 4B76A 5T7BA 2DBYA 4QREA 3FHTA 2WYVA 4JYKA 1PDOA 3IQIX 5FORA 4EA8A 1C0WA 3UFXA 2ZM6B 3A9SA 3BB4A 2QL5A 3LAWA 2LDXA 3D3QA 2Y3IA 3GIWA 4XWWA 3S2DJ 1V43A 4HTFB 4RFLA 4X3OA 1BKSB 4YDQA 3T3EA 3FISA 1FTTA 3DOUA 1KDZA 2Y68A 3JRNA 4M38A 1T43A 4ZDPA 2NTNA 1LZLA 1Z25A 4H3HB 1CQJA 3JR7A 1T3HA 4Y1RB 2CGPA 3OMXA 3PKJA 3VOBA 3SIXA 4DC0A 2XROA 4EO9A 3PHLA 1K89A 1Z4LA 2BHNA 1MH3A 4ABTA 2HO4A 2H6BA 3INNA 2OENG 2ZB3A 4M0PA 5CAEA 3EGEA 4J29A 1G2OA 2FMLA 1SQFA 5FLMJ 2GCOB 4JLAA 3UANA 4LCBA 4BAGA 4AJ1A 2N75A 1JQLB 1C9NA 1EX7A 3KE2A 2HN9A 2PFSA 4Z53A 2G6TA 2C9YA 1NG7A 5L95A 3JQPA 4QJIA 1CETA 4PN7A 2FQWA 4GQAA 3PEUA 5E7JA 1RCUA 4CMJA 1X2MA 5M3BA 4B84A 3P2IA 3SXUA 5CBPA 1H4QA 2PHZA 3QKIA 1T29A 3UMBA 1O0CA 4YWHA 3N2GA 4ZTFA 4CEHA 2G67A 2XEXA 2Z1NA 2CKDA 5GTHC 4P3PA 2ZBQA 3EXEA 3ITEA 5CT8A 3VTZA 3H8JA 3LKBA 3QJGA 1YHNA 4O4JA 1WUHS 3EG9B 3GJ7A 3IDSA 1TFRA 2GETA 3AFIA 1VMEA 1O58A 1SOVA 2ZATA 3KQWA 4TYPA 2EAUA 1JPJA 3PUJA 3Q7QA 4EM1A 2O07A 4L4XA 4MKRA 2MR5A 1ZL2A 4TL6A 3UHJA 5IM4A 1EXDA 4CCKA 1W75A 2ABWA 3IMEA 3NTLA 1BI3A 3JWEA 3R44A 4MI1A 4N5IX 3SFTA 2XSZA 2X6WA 2IF2A 3GCZA 1FEZA 1HEUA 3TI9A 3WIUA 1T2VA 4ZARA 4B82A 1JPNA 4DHEA 5K8TA 4BE7B 1UMCA 1EUDA 4BXUA 4LWQA 1AHHA 1JQJC 2A9VA 1TIKA 1V95A 3I59B 2C00A 2GJKA 1A2OA 2ZSIA 1QIIA 4RF2A 2FF4A 3GBGA 3LSKA 4WCGA 4UNIA 1R0KA 2FGJA 4QBIA 3CCMI 4NJEB 3SNKA 5ICSA 2RNJA 1VJ0A 1NNUA 2IEDA 2YR0A 1YQTA 3PJGA 4IHJB 4HAMA 1HLPA 1VE5A 4QTUB 4DXAA 3ITNA 2MYTA 3H8SA 2WTBA 1WM1A 3MSCA 4YAGA 4JHLA 2W5UA 1U1CA 3ZTTA 3SS7X 3D6UA 1EQAA 4YELA 2L7ZA 4KI0A 1IBLB 2V5AA 5JPDA 2XZTA 2GD1O 3NHUA 4XVQA 1U3UA 1WBBA 4UVCA 2ZFUA 2EG9A 3C3PA 4KX5A 4CPDA 3OTGA 1E89A 2ZUSA 4BBZA 1IULA 4OSOA 4GIBA 3TX6A 1F2UA 4ZT5A 1RHJA 4DREA 2F1RA 3NWTA 1U6JA 4A3BJ 5FTLA 1DKUA 1WCIB 4FX4A 4HMQA 3EG9A 4QVGA 5D3QA 4ZYLA 1MGPA 3G0DA 2IA1A 3EXHA 3MRSA 1E9EA 2A9QA 3ZIDA 1GLGA 1TJ5A 3MWDA 4ZVPA 4Y6RA 1ONBA 2MMGA 4DDTA 3C6YA 5LGTA 5U9CA 1ULHA 1ADCA 1X2NA 3PNYA 1BOBA 3E5MA 4FYKA 2V7TA 4OYHA 4BJ5C 3WDMA 1W35A 1AQUA 4XKBA 2XGOA 2FZKA 1J5EB 1RHRA 1A95A 2VPPA 3UHFA 3NS7A 1IEXA 4ZEOA 2GSWA 4MLZA 2Y9ZA 4QFDA 4YRJA 1Y8CA 4PZJA 1QOQB 2R92J 5MN6A 3Q12A 4ERNA 1HNNA 3PFGA 4ZYWA 4MVJP 4UXJA 1R16A 1SCUB 1D6NA 4DLKA 2CU7A 3PNTA 1IY0A 1U11A 4Z4HA 5EESA 3M4ZA 1FBNA 3GP5A 4DW8A 4B31A 2DMRA 5TGZA 4KXQA 4ZYAA 3COAC 2GYYA 2FH5B 4MHOA 1GPH1 3D7LA 3LBYA 3X3HA 5HLHA 1ODLA 1C1XA 5G4KB 2YJ5A 4CF7A 1VJCA 2CSUA 3LA3A 2XGEA 2IZ6A 4FR2A 2VDRB 4NHJA 3PJFA 5A71A 4EGQA 2DKFA 2I4NA 5JWHA 1TA0A 3OWTA 4XKCA 1ZRMA 4FLFA 3PPVA 4C4RA 1RXWA 4XSXF 2YKGA 3WL7A 4PG5A 4YRQA 3KQKA 1IN4A 3I2YX 4YEJA 2P0AA 3JQ9A 4LMYA 5ILVA 4U2CA 5FI0B 2ZO4A 4CCMA 4HNSA 2TMYA 3D8BA 5HF9A 1JMVA 4CQLB 1KU9A 1CIVA 2R87A 1MAUA 5KNCD 3FMIA 4YDSA 5CLQA 3RH0A 1U0JA 2YDXA 3SF8A 1JT6A 1UOQA 3RFUA 3ANMA 3MJVA 4U9IS 2QLMA 4Z2YA 5FFFA 3LPCA 2BTOA 1YQGA 2AR0A 2XYRA 3W2AA 1PDVA 3MFKA 3AEYA 3M6UA 1BR1A 2ZYUX 2G1KA 2XMCA 3L1IA 5LQMA 5LCXA 3HLKA 1JBQA 4W9NC 2CD9A 3P4XA 4MLDA 2J8ZA 1OISA 3ECAA 4BU1A 1GQSA 3VKUA 1YI2I 3AM5A 3BD8A 5F3WB 1SAYA 3LK6A 2J7PD 3CKKA 4LFUA 2B4KA 1OKKA 1RM0A 2VXDA 1BEUB 1Z7LA 4XR9A 3K9QO 2YHIA 4IHKA 1YBMA 1ZGCA 4CKBB 4ALIA 1XD9A 2STWA 4LRYA 3ENWA 1KBOA 2HMSA 4DLUA 1ORHA 4YASA 1U2ZA 2PVPA 1XQXA 3A01A 3DSRA 2KP6A 1KP2A 2JIBA 3KP6A 3CP2A 3PD7A 4I1IA 4LTDA 4FHEA 3SYMA 5C3UA 2R5NA 1AKHA 2OC6A 2W6JD 3NJRA 3ZU3A 3C4QA 3WL3A 1AE1A 1HYQA 4EG8A 3GJ4A 4N9WA 1BS9A 2KX7A 3CCBA 2OCDA 2BGKA 3INRA 3OLYA 5DM60 4IHTA 4QODA 1E0SA 2XJ9A 3ZW7A 1YFZA 1ORVA 2FP3A 3DTNA 4WXPA 3UWSA 3HKCB 4ZC8A 4KDRA 3IVXA 2W37A 5ALMA 3ZWDA 2IP4A 1U3VA 5FX2A 3WIBA 4GD3Q 4KSBA 1QVZA 2ONYA 3CLUD 2XBMA 5KOJB 1K8ZB 2WABA 2Y69H 2D7JA 3AVWA 3WLSA 4X65B 3R7WA 5ILOA 1KI6B 2V9PA 5F2KA 4CEJA 1OCEA 1G16A 1SULA 1W2WB 2EF1A 3RU3A 3ETJA 1NXWA 5IJAA 1PG5A 3T5XA 1ZQ3P 1U0FA 1Z2OX 3KB1A 4FHGA 4J0FA 4UOZA 2HSJA 4B4OA 2NSHA 1AQJA 2EJUA 2J9FB 2QTVA 3WZMA 3ZP5A 4P4NA 4U5XA 2ZT8A 4OL9A 5ER6A 4AU1A 3FYHA 5KNBD 2RH8A 4GECA 4MVJH 3RC9A 4E08A 4C1NA 4JC0A 3WMGA 4EABA 4ARCA 1DQZA 1JLRA 1GRNA 1N2GA 2RB5A 5JHFA 2XVMA 2A0KA 4KQ2A 3RIHA 3KLBA 1JS1X 2JD1A 1H2FA 1KYWA 4TV9F 3CSSA 5AM5A 5FA8A 3V4VB 5L3SB 4CXMA 1E2KA 3TNDA 1OI3A 4GX0A 2R5ZB 1TE2A 5L3BA 2PV7A 2ALJA 1SC6A 5B53A 4P4GA 3G7UA 2Q7DA 3ZLTA 3HV2A 5C35A 5GPCA 3WK7A 1Z26A 3GEGA 4OXIA 4EI9A 4LN1A 1VQ6I 1C0LA 4LDAA 2ZRBA 1G3QA 4X1KB 4BVLA 2V5VA 1P4GA 4RZUA 1Z36A 1MFZA 3ERCA 2A67A 2NU9A 3FN4A 3ED5A 3C24A 3BR1A 2DERA 1XTBA 1H3FA 1YQEA 2VP2A 1DDOA 3ESBA 3WY9A 2QGFA 3IKLA 3EYIA 2F9MA 2FLVA 4P53A 1VPEA 3K09A 1KS2A 3V8LA 3HDQA 2FA5A 3N8NA 4WPGA 5FWYB 3PITA 4ZYUA 1AT1A 1EG2A 4QJ4A 1P80A 4YR9A 3SQLA 4GZMA 3RSLA 1XN7A 5DUKA 1B3RA 2FXIA 4IRUB 1MT0A 1T56A 1KETA 2DFDA 1GUUA 2XE8A 1RADA 2NRAC 2CXUA 3KLMX 1GNQA 4HOYA 3FTQA 2IE0A 4PC7A 5JPIA 1EF4A 3RSSA 4BFWA 4MNUA 4K28A 1EH7A 5JR3A 4YMWA 1LRKA 1QIKA 3A3PA 4IM7A 4R01A 2RGNC 4U8HA 4NNPA 1L3CA 1G7TA 1HFEL 1LVHA 3CX4A 3KPJA 3WWOA 5LA6A 1M1NB 5A5DA 3ZI0A 4JS0A 2QX6A 1TYEB 2DA3A 1DVRA 2A2ZA 4QSMA 4UTZA 4B6RA 4XM1A 3N6XA 1C0IA 5KAMA 4C6SA 4QVIA 3BMNB 2JA8J 2ADOA 3VSDA 2HU2A 1NYTA 2JI4A 2Q0SA 2I3AA 5LDHA 4L4ZA 1XLTA 4LYAA 1XJCA 3WDSA 1SXJD 1TIBA 1J5XA 2QUBA 5HGXA 4G0QA 3SIWA 5LP6B 2SHKA 1FS6A 2Q1SA 2W22A 4DSNA 5I47A 4HDSB 2RIRA 2Q3EA 3BWXA 4R6WA 5LFAA 3R74A 3Q98A 3ESZA 5E1WA 2FW9A 4FASD 4I4CA 1LE8B 3FXQA 2G6BA 3ABMH 1PNOA 3KOMA 1JDBC 1Z0IA 3HA7A 3OEEA 3Q5EA 4ZJUA 4BQQA 2FEMA 2Y99A 2G9NA 2WJYA 3DR5A 5GADl 3ASZA 8ABPA 3KOZA 4OH1A 3RS3A 2HW8A 4QUEA 2PTHA 4GEGA 4CKYA 1PL0A 2EU8A 3AUAA 1PJCA 2WINI 1SUDA 2Z95A 1PT6A 2C7QA 3HOYJ 5KNDH 1DKOA 1C41A 5IM4F 2QR2A 2ETXA 2NPIA 3GMDA 5K7FA 1R58A 2ICWG 3DBOB 2AS0A 2PUJA 4KQEA 4Y8VA 2ZJRF 3OYGA 1J0AA 1MG0A 1BX1A 2FPSA 2VDOB 4Z4EA 2DBZA 2JATA 4D9FA 3ECOA 3HWX1 4KUHA 4PZUA 3CH4B 3GR6A 4LJ7A 5J4KA 3EUFA 4NC9A 5FUWA 3J80Z 3HZHA 4PR3A 2GEJA 1H4VB 5EOVA 4A0XA 3AJ9A 4KXXA 1PJBA 3ZHSA 4OLAA 3EPKA 1EDZA 1I2DA 2AF3C 2CLSA 2XT0A 2XY4A 1WFXA 3BR6A 3GYGA 1QQ6A 4ZV7A 4BO0A 5LR6A 3NGMA 3RBZA 1KWGA 4E7HA 3FPGA 1V2GA 3L2RA 4R8VA 3GEEA 2WY7Q 3FK6A 1TT5A 4FYYA 4QATA 4A36A 2Q4OA 2GN6A 3BXHA 4FD2A 5EPUA 3DLAA 2FAXA 2YHUA 4KXYA 4TTQA 3DFZA 4YS6A 2PLFA 1K06A 2VJKA 4BQRA 3S1MJ 3AR6A 4N5MA 3ZHTA 1DQPA 3CLTC 4J19A 4TMVA 2NZVG 2HK6A 4Q7JB 3EYAA 3C3CA 1EEHA 3M6IA 2W24A 2AG1A 1I7LA 3CINA 2VWHA 5HFJA 3R3SA 5MN5A 5JD6A 1C1YA 3DNFA 4IOMA 3DEFA 5GOZA 2NV6A 4CNBA 2LMDA 1WCXA 5FLVA 2X58A 3EMVA 4LLGF 4FUQA 3SSNA 2H8RA 1XTTA 1C81A 2B1GA 3AUKA 1E66A 4FIDA 4K1LA 4MVWA 3PUHA 1NP7A 4XRMA 2FWJA 4CR6A 2RGNA 4Q37A 1JG2A 3DNPA 2Q0XA 2LDUA 4EJ6A 2E4VA 2LP4Y 4C76A 5CD1A 1YE5A 1II8A 4PZEA 2K6GA 5IAJA 5KEIA 3ZWMA 3LUJA 5A5GA 3A6LA 1Y7PA 3SBOA 3NARA 3N39C 5ERGB 5FI5A 3VU9B 5E1BA 2X1CA 5EJCA 5A4FS 5TIIA 4DYQA 1GRCA 2FPWA 4JSTA 3H65A 3R23A 4K8OA 2JDID 2WG2A 3ZWQA 1Q6YA 3ZDXB 1GXQA 2NSYA 4HTAA 4AMYA 4D7MA 4V38A 4CMGA 3HVRA 5F9HA 1SFKA 1JHAA 5AI0A 1NDQA 1UKVY 2P69A 3ZWWA 1JPUA 4LY9A 1G8JA 3Q1LA 1U1EA 4LRQA 2A78A 3ZN2A 1D0IA 3G8CA 4YUZA 5ITSA 1SCQA 2AXNA 3OF5A 4YV0A 3RKXA 4AIHA 2XKJE 4JBHA 4XM2A 4D0NA 4OYYA 1XJ5A 1Q50A 2PMDA 3R5TA 5I7WA 3AETA 4LY3A 1VSTA 4CCOA 4V0QA 4UPEA 5TLSA 1ZIPA 3K32A 1O95D 3EGCA 3QKWA 1JB1A 2I1QA 1M2JA 3LDUA 2ZOSA 4XWYA 2JHCA 3DBLA 4YBZA 1W5AA 1R4MB 4Q5SF 4RVDA 4OHMA 5J8FA 1QDUA 4IFIA 1W4LA 3R7BA 3OYDA 1NF3A 3VBCA 4RAYA 4OYRA 5FT9A 2C58A 3EMKA 1XPRA 2WAQN 1CS0B 2E7WA 4P4TA 1XDUA 4E11A 3Q9SA 2GBFA 2OU2A 4CV0A 3F0CA 1E3TA 3GLFE 2B61A 4BKXA 3A31A 1J2EA 1JWBB 1HM5A 1NLUA 1V8OA 2C4KA 2JHPA 3BX1A 1LQ2A 2JF0A 3C1TA 2YMQA 3KYBA 4INPA 3FJ1A 3BCRA 1QQBA 3HNRA 1DQNA 1G21E 1GYRA 1NKVA 2VCYA 3BJRA 5A9SB 3QXGA 2RHRA 1XQYA 3UUEA 3IC7A 1IZ1A 1CGPA 4NC6A 1U0TA 1T5TA 2BFAA 2IW3A 2VNIA 2WWTA 3O92A 3WHPA 3WL6A 4DM3A 5IYZB 4RH1A 1PRYA 1QFXA 3W2WA 1UC4B 4LOKA 1H2BA 2H54A 1ONNA 4QEZA 2Y1DA 2WAXA 1KI9A 1RI1A 2VS1A 4RD4A 3AOGA 3I5MA 1TYZA 2J6IA 3COZA 3MINB 5F52A 3SEFA 1UF9A 1O97C 4LRWA 3N0XA 3JQCA 4GI3A 5A6SB 2FRDA 3S2SA 3GEDA 3W2EA 4B6GA 4BO8A 4BCBA 3V80A 4PYJA 5LU8A 1Y3CE 3LCJA 4TSFD 3I34X 4PO1A 3S1SA 1F0NA 3VX4A 1YOVB 1ATIA 3IBCA 3O91A 1J23A 3OZDA 2VVTA 3GMTA 2ZULA 1Y6GA 1Y42X 3WGJA 1G5PA 1TQ8A 2JFYA 2NTEA 3PPXA 4UMVA 2IUYA 1M7HA 3IHUA 2PGIA 3B5IA 1M8PA 3MB5A 3MERA 3O93A 4GX5A 4KFSA 4KVGA 4LNUA 3U3DA 1E9AA 3BTJA 3FSRA 4XQ9A 2IGOA 1XLUA 2I2WA 3RKSA 3SU8A 1C4WA 1PP8F 1WTAA 2JI9A 2H7YA 1GNPA 3L7IA 1CE8A 5AI9A 1O9BA 4Q4HB 5D5QA 4EUKA 3HDYA 1ULSA 2CBXA 2YASA 3NHWA 4JHXA 4KG7A 4NONA 4Q18A 4AVYA 2BMVA 1EKEA 3VR4H 4TZ6A 4P2GA 2Z4SA 4YV7A 4Y2TA 5JSQA 3GVHA 3MCVA 1NJGA 1PR9A 5IWCA 3BGDA 5K5EA 4PZ9A 1GD1O 2AFHB 4Y2QA 3LA6A 3MLBA 1MRNA 2OFXA 1E60A 2J31A 3ETEA 4HWSA 1X3UA 4NAHA 4PC2A 3OECA 1UBJS 4FC7A 4BWVA 1E3QA 4F04A 1TI7A 4NMWA 4PZCA 4UHEA 2R6AA 4EJSB 4EY8A 2YQ4A 3FZQA 4V0OA 1M10A 5EIOA 4NE7A 5HEKA 4O2LA 1R0ZA 3A2NA 1MABA 3RVKA 3ZE8A 4KEAA 5CU7A 7GPBA 4QKQA 1YC2A 2N42A 2W71A 1YZUA 4RHXA 5CYFA 1EVEA 5F23A 1OZFA 1E6KA 1D2AA 1D2RA 3RODA 4YAUA 4V19K 4A3JJ 4R9NA 5JMPA 2IGMA 1ATZA 3HA5A 1B74A 4FD3A 4GX1A 3HXTA 2XMQA 4UUSA 5F27A 1PUFA 1X1TA 2PR2A 1AC5A 2RHBA 2YICA 3DF9A 3EOAI 4J1TC 3OX3A 4JB0A 5JSKA 5B7QA 2XW6A 5IPFA 3GTLJ 3LVFO 2J08A 1K5PA 2JIMA 5HUJA 2P40A 4FINA 2IPOA 3NXKA 2QSHX 3L04A 4K5QA 3NHJA 4AMUA 1NQVA 4U7JA 3HXOA 4D5CA 3ABZA 3EZLA 1XK6A 4RABA 3UT5A 1RR6A 5ICMA 3DMNA 1E9VA 4D45A 1BW6A 5EE0A 3LW7A 4NNJA 4N8EA 1O2DA 3GLRA 1GYQA 1C30A 3TPZA 2GEUA 2VLAA 3RJPA 1AQ6A 1ISMA 2EEPA 1CEQA 3E2IA 4W8GA 4EHFA 1PUJA 5TQ0A 2GEKA 4J6FA 4F2HA 3D6MA 5M5BA 1U6IA 1AGNA 2GRJA 1T1RA 1XRJA 4TWIA 2FW1A 3VVCA 4Q1FA 1QU3A 1SVSA 4RF5A 2OPTA 1L1FA 1TQPA 1G0NA 2FK7A 5AT1A 1MQAA 1G8YA 2BM8A 4RZXA 4K2HA 4AZ3A 2BFWA 4YJ2A 1DKRA 3AI1A 3CS3A 4DYHA 3EEOA 2KLOA 5H2FC 3NFRA 2GGSA 1Q22A 3EXIA 3L0ZA 5I8WA 1QHXA 2DOAA 4ND8A 4K9PA 1Q7TA 3L82B 1T9GS 2QUZA 5EVCA 1QG2A 2E2WA 4H6WA 2NXJA 4ZHQF 4CCNA 5K7ZA 4ZQHA 2RB4A 2SCUA 3NW9A 2ZJQF 3I2FA 2ZYHA 3NUZA 3UWKA 2E5ZA 4F6LA 3B8HA 3J80A 4TYWA 3RAFC 1YZGA 3LRTA 5ALHA 2QGUA 1YBAA 2QDXA 5IH3A 4GBED 1M6WA 5LZ8A 2W2VA 1RYEA 3EPRA 3I01A 4KGXA 3ZD6A 5I4IA 2MSYA 3GA0A 3JAWB 4X6XA 3GQBA 5TMEA 1X2BA 1CRQA 1GR0A 5L3EA 5BPHA 1NVKA 4H60A 3TZHA 3FYUB 4C78A 5JSYA 3I28A 2BEJA 1ESEA 3KVRA 5LKAA 2C5AA 2HM7A 2WR8A 2ZRQA 3AUYA 3AEKA 3B3AA 3LFKA 4WOCA 4YO8A 3R9IA 3N76A 3H0GJ 1R37A 3VC3A 2QQBA 5KZMB 4ITVA 1HLVA 3C6QA 1LX6A 2Q5JA 4B34A 4DLVA 4NG4A 3WTSC 4R2JA 3E8MA 1JAZA 1Q7CA 4BNNA 1BOAA 3OUZA 2OD9A 5KYWB 1GAQA 3ZGZA 2CLHB 4EM0B 2ODWA 1WULS 2Q4RA 3IKJA 4RYDA 3MHTA 1O95A 3NYWA 1RPAA 3RJTA 4L0YB 2CY0A 1V1MB 1YFKA 1I1SA 2HQ1A 2N1MA 5EF6A 2RI6A 2IHJA 4YLEA 3VX3A 4YMHA 4RETA 2C5FA 4BYMA 2JPBA 4RB1A 3COYA 3TL6A 3W5DA 3OKCA 4KZKA 1HDOA 1V55H 3F98A 3FSGA 2X4HA 2AX4A 3GC6A 2M1BA 1AGRA 1EM8A 4J9UE 4MR9A 4MV7A 4RH3A 3LLMA 4LZJA 5DTJA 1U0NA 2IXSA 3ZWCA 1I80A 2OPHA 2VRBA 4RXTA 4N7RA 1UPBA 1RRGA 3AVTA 3UG6A 3H9GA 4KLCA 2L01A 4Q4JB 4I36A 4XSVA 3V1KA 5JZOA 1OFHA 5J47A 1E3SA 1LLQA 2I4LA 3R40A 4V0LA 1RLTA 1XF9A 1LGYA 1S3FA 4A0ZA 1IB6A 2O4UX 3KRTA 4G25A 4NU8X 1CUCA 5K99A 1G7RA 3EIWA 4V3CA 4QGAA 1MAVA 1HYEA 4JL6A 2IWHA 2WIBA 3ZWVA 1PGPA 2VSXA 2EDAA 3DAPA 1PX2A 3ZN1A 2VDQB 4K1XA 3BQYA 4AY5A 1RM5A 5EJ4A 4ZAFA 1W94A 3PEVA 3UK1A 4UY8I 2CBZA 4YYEA 3UV3A 1ZIDA 3GTKJ 1M8GA 2PPLA 2FR0A 2XXBA 5H16A 2GF9A 4IMRA 5DHTA 1E2HA 4BNVA 1EQ2A 4F1KA 4WLFA 1KIFA 1E1CB 1PJ2A 4KBYA 3BMOA 4IS3A 3GNQA 4PYQA 4IJKA 3B02A 4I55B 2VP6A 1XIVA 1CSEE 1YKGA 4E5UA 1XDSA 2NU7A 4ZAYA 4GPIB 4LXHA 4KXVA 4Z1OA 4JKYA 4ZQCB 5EKTA 4O0LA 5FD8A 2HREA 4GLLA 1XSXA 4CL3A 3TLJA 1D5CA 1VL5A 3LI2A 5EJ9A 4ARSA 2VHEA 2PS3A 2CLEB 1P19A 2BKAA 2OGSA 5BN4B 2GXUA 3S70A 4D5EA 4DLBA 1Z35A 3VZPA 5A02A 4JI4B 4BECA 1V8PA 4DQLA 2QKMB 2PXHA 3L6CA 4O1MA 5K45A 2Z58A 3T5GA 3MAJA 3S3OA 5FBWB 2I4MA 3TNFA 3L0IB 1GUAA 1JSRA 4H2DA 1CVLA 4YBRA 5A3JA 3RAJA 5D5PA 4G7OF 1Y1LA 2FWMX 1D7AA 3STXA 3L1KA 1PYVA 2E2JJ 3MJ4A 3IQHX 5GJVC 2IV7A 1Q21A 1EP3B 2EBFX 1JEAA 3ZXUB 1ZARA 2HWYA 1XP5A 3O47A 3OQIB 4BU0A 3ZC3A 4JP8A 5DYYA 4NHOA 1GQ2A 4AZTA 5JC8A 4XUDA 3GLLA 3HOXJ 2O9LA 5M2QA 2WT4A 4OI0A 5HS7A 3Q87B 4CF5A 2WJIA 2QENA 2C5SA 4HGRA 4Q1BA 4ZJZA 2W84A 1KK0A 2GTIA 3PHBE 1ES9A 2DYSH 2Q1YA 2C3PA 4QO8A 1X8JA 5EXTA 2H1CA 3VSBA 2OESA 2PX4A 4M71A 1J9EA 1W76A 3QH4A 1YIJI 3SCZA 3Q6MA 4G5RA 2K7LA 5SZJA 2YJNA 1N5KA 4NBQA 3G9UA 1J0DA 2DE0X 5CFPA 1L6RA 3EPJA 2BJVA 1XMSA 4I2VA 5T4BA 2BE7A 4DUYB 1QTRA 2M4GA 2K4JA 2OWEA 2Z3VA 2M6LA 3REOA 5F64A 2HWVA 4EM2A 3H0CA 2WF8A 3EDMA 3H2IA 3W2HA 3OICA 4FLMA 3B6JA 2FMYA 4PPFA 1TWCJ 1K4KA 1AN0A 3BB3A 3QF4A 1D0ZA 3DWEX 2NSJA 4AUNA 4BRUA 5CT4A 4HVCA 3PWZA 2P5UA 1OYIA 5GPAA 1QA6A 2WJHA 2WT9A 2QTFA 3GZTB 2BDUA 3T4XA 4BJ3A 3S1NJ 1YACA 1LSSA 1A8PA 1S01A 1YZLA 2WA2A 2WIDA 3ZKWA 2RGRA 1FQWA 1T0IA 1TUGA 2NSLA 2FQQA 2Q0HA 4ZOAA 3BCHA 4DUPA 5CLGA 2HOEA 3ICOA 3DFMA 3EXFB 3CCQI 5DW0A 2L9SA 3PL8A 3I04A 4IJWA 1H5QA 4D02A 4HAZA 2PSEA 4QGSA 2GZWA 1CDDA 1OLXA 2POCA 1Q3TA 2OVBA 3L7CA 4ZU3A 3KX2A 5H3HA 2ZB7A 2NIPA 4AWXA 1QAOA 4C5CA 5C1OA 2W6MA 4RDUA 2PN1A 2M2IA 1G8MA 5LOVB 1LD3A 5JT1A 1YBFA 3A6FA 4JKIA 2ONJA 1QK3A 3ZDQA 1UFKA 2F4IA 1OE0A 4JA2A 4WECA 3DZJA 3HYCA 2NAPA 3Q10A 4IR7A 3BDDA 3W4KA 4KUMA 2O1WA 5CDYA 1TFUA 4FYJA 5J40A 5C2JB 2HYDA 3K4HA 3IEUA 1UEJA 1EWTA 2ATCA 1OYVA 2L42A 2ZU0C 4LXYA 1USGA 4XPIA 2ZBPA 3EHDA 1XFDA 4MHTA 4X44A 4MRNA 3ZZ0A 3QOYA 2HVSA 1W88B 3O1IC 4IGEA 5DCYA 2Q8PA 4FFPA 5L7WA 4FETA 2R1TB 4QOJA 2HJVA 1EEXB 3DQVC 3JATB 3S32A 4L2IA 3RRFA 3GJZA 1BN7A 4I7HA 4MFEA 1KZ7B 5AJHA 4YIKA 3LSIA 1P7CA 1WE2A 4LVUA 4HQEA 2IU6A 3L77A 4XCXA 1YT5A 1E6EA 3LRPA 2A8YA 1XRSB 2OD2A 1A9ZA 3MKLA 3KZYA 2H5LA 2Q6LA 3CO5A 3E4DA 5CNJA 4NZNA 1SO8A 2CHQA 4P0TA 1QLWA 1ZK4A 4J1NA 2LTPA 4R2IA 4ZI7A 5ENVA 2IEBA 1QH9A 2YVUA 1GILA 2YBEA 4QDOA 4RD1A 2KL4A 3LF1A 4UXHA 4Z4GA 2WOJA 3AWIA 4B3GA 1U0BB 4V0NA 3V4LA 4CVNA 3DYVA 2IOFA 1YR8A 3MFYA 4X1EA 2LOOA 1KYQA 1QIHA 1T8TA 3G3EA 3I2IA 4I50A 4OU4A 3NHFA 3U3RA 4G6DA 3OKAA 2Q1WA 5E3JA 1U8ZA 1P3JA 4TLEA 2XC7A 3VZDA 4Y4RA 1G5QA 7ABPA 2EERA 2IRFG 3C98A 3LNCA 2BGIA 5DSZA 3NHSA 2AJCA 1NXPA 4KUGA 4N5DA 1F0KA 4QYIA 5B5SA 2B2NA 3G1WA 1TOAA 2FMIA 3TP3A 2Z0MA 3HV0A 1GAJA 4YAFA 3L1UA 5DXAA 1HR0B 1F2DA 3U62A 4RJTA 3MJSA 3V4PB 5T8KA 3IIMA 3PFCA 1T08B 3GLHA 3I8XA 4UHFA 4MGYR 5BNIA 1JKRC 2NU8B 3N9IA 5AJZA 3PNSA 2NUTA 1DCTA 2YNMC 2ESHA 4OHOA 1C50A 1ZMRA 3EVTA 1IPFA 5CT6A 2H18A 4IQ0A 5BT9A 2B8TA 2JZNA 3V3TA 4NUBA 1NUPA 2VSNA 2WUWE 2ZT5A 3D7KA 3WLKX 3IRVA 4KXFB 2NZ8A 4RGQA 3TLGB 3OM1A 4KWEA 1V6AA 4UNOA 2HOQA 1Z8HA 4X00A 4KAFA 4X1YA 3CF2A 1NFQA 3TQOA 4MVJF 4F71A 1E6LA 4OOFA 3V1YA 1Q20A 2P6OA 4Q24A 2MHCA 2PJRA 1VYTA 3F6YA 3KKLA 4OB8A 1GADO 5D00A 3V9PA 4RTNA 3NMUF 2V7VA 2JA5J 3F6RA 3QXXA 4QOEA 1CKEA 2GPJA 2QRJA 1TQHA 2X5OA 1EB8A 3W5HA 3KAQA 3TSYA 1ORWA 3WNVA 1W36D 1ZONA 1U1DA 1YFHA 3DEAA 3KTDA 3KOXA 3FLAA 2X76A 2C78A 3BP8A 1RM3A 3AHCA 3AW9A 4BE4A 4YRGA 5JALA 1CEEA 2Q5CA 1LPSA 1XZDA 2O7VA 5L53A 3LLCA 3AG1H 1NXTA 1PT8A 2GD2A 4S1VA 1Z5UA 1UADA 4RMGA 3PC6A 4DOZA 1W8IA 3QU6A 3O8HA 1NV8A 1U7OA 2A9KA 3CO0S 4LIUA 1D09A 3AT1A 3AU8A 3OBIA 4Y1FA 5CYOA 1FQJA 5AKLA 4EW2A 1OU0A 1GCGA 1DO8A 3A1NA 1I3KA 4M49A 3ZZMA 2VXOA 3KD3A 2Z8ZA 1ZU5A 3AILA 3KU4A 4JUCA 4IO1A 4R7GA 5LBIA 4BKUA 1TF2A 2FFJA 1CQXA 3OCWA 1E5LA 2DA7A 1JEJA 1WXGA 4ZEWA 1E4EB 2E34A 1RYMA 3WIVA 4QGGA 5CPBA 3Q8LA 4M53A 3QX9A 2P9JA 3QK7A 4UM9D 1ODIA 4C88A 4CKXA 4IIXA 4B71A 2D5AA 1QKIA 3JD4A 3MJDA 4RFVA 4ZXPA 5JHHB 1Y5IA 4RW0A 3R5XA 4IKOA 3AY0A 3EC2A 2VTBA 4PSAA 3LQFA