3C3WA

Crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQAAVFATELKRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN DEVR
publication title Crystal structures of the response regulator DosR from Mycobacterium tuberculosis suggest a helix rearrangement mechanism for phosphorylation activation
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3c3wA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3wA01
2BGCA 1U5TC 4U0VA 2E1CA 2ZMEB 3F7NA 3FFTA 1QO0D 2QQBA 1I1SA 3KJXA 1S7AA 1W7PD 1O3TA 1KRWA 2K27A 1ZITA 1U5TB 3TOAA 3TQNA 4LG0B 3SHFA 2D2WA 1ZARA 2YR2A 5LEKA 4O1HA 4ENNA 3K4HA 3KEQA 1F5TA 3QX9A 1FFWA 2ZXJA 1YTUA 3ZQ7A 5LBQA 4Q47A 2GI4A 4Z0NA 4Q48A 3RVMA 1J5YA 4KYWA 4M9SA 1D8JA 2HPHA 5CHYA 3TB6A 2R7DA 2F5EA 4DNCA 4LLNA 1I27A 2NYXA 3IKVA 1QP4A 5D5XB 2ZO4A 1Z6TA 3N4MA 4RSMA 3O1HB 1NXWA 1C4WA 4WZZA 2WV0A 5BOXA 1C0WA 1HW1A 4RB3C 3JS5A 3H1EA 1BIAA 3EODA 1HW5A 1B00A 1URPA 3LUFA 3T6KA 4H60A 1LVAA 4L9NA 3FDFA 4S05A 2D45A 4CO8A 4L85A 4ENKA 3GWGA 3GW2A 1AB6A 2JBAB 4MGRA 1YMUA 1LJ9A 3RKYA 2LBPA 3FMVA 4M73A 3MQ4A 4NICA 3RVKA 1BC7C 2ZNYA 1FT9A 5FWYA 4G9YA 3HXMA 1BI2A 1PEAA 3ABUA 1BM9A 5KC9A 1FLIA 5DUKA 2W25A 2GBPA 2E4WA 4DQDA 2QQ9A 1SD7A 1WRJA 3LA7A 2Z9OA 1PP7U 3WTTC 4YGXB 3TO6A 3BPXA 3RI4A 2WTEA 3L49A 3H1FA 3ISPA 2C6YA 1ON2A 3HOSA 2FNPA 5ILVA 4XLNF 3H75A 4AD9A 3DF8A 2DU9A 2PE5A 1Q1HA 3S99A 2E4YA 4LJZF 1BDHA 1L5ZA 1HKSA 3ILHA 3E5XA 4EGZA 2R48A 2BV6A 3GVAA 3RKXA 2QBYA 2ELHA 1JFTA 1TW3A 2G9WA 2QZJA 2XV4S 4Y13A 2NZUG 1MJ9A 2RV8A 5HDKA 3HV2A 1LBHA 3TDZC 2FMHA 3HSYA 2PL9A 4F3TA 1B59A 3MA0A 3NNNA 4MLDA 2M1ZA 5TQ0A 1B6AA 2JB9A 1U04A 1EH6A 3ECOA 3KS9A 4N0PA 4FX4A 1SAXA 4A12A 3DFGA 1NXSA 3G85A 3ZMSA 4EVQA 5D4RA 3IPAA 1GCGA 3FGZA 3MWMA 4PGHA 4U7BA 1D4ZA 1R1TA 5CVRA 1VKRA 2IPNA 3HIFA 5KQPA 3M9WA 2HWVA 2UXXA 3EUHA 2AYXA 1USIA 4RGRA 1OYIA 2P5VA 1XWWA 4NQWA 5H6QA 3HOTA 2JVKA 3LUKA 5EWJB 4WCGA 1HBXG 1P6UA 1P4XA 3BREA 3H5IA 3QLUC 2F2EA 2L01A 2L2QA 1VTNC 3CTAA 1U2QA 2DBBA 2LKPA 4EVIA 1JGSA 3O1JC 4A0ZA 3GFJA 4EJVA 3KP3A 1IN5A 4W5OA 2O8XA 4I09A 2PMCA 4EGSA 1RPJA 2ZWMA 2IP2A 2W24A 4YCSA 1WQ2A 3GFIA 4LB6B 4OG2A 5DKFA 4UHKA 4KK3A 3SXYA 2F5CA 2E4ZA 3MCZA 3RQIA 2PJPA 2M8EA 2L3DA 1SXIA 1YW9A 4HQEA 5TQ2B 2W85A 2RKHA 5FO5A 1EHCA 2WC2A 3UUGA 1Z26A 3VOEA 3C3WA 3KLNA 2Y0MA 2X7XA 3HRTA 2LF7A 2P4UA 3N75A 3KZZA 2HTSA 5E1WA 2TMYA 1TMYA 3HSEA 1K79A 1Z9CA 2XHKA 3C7JA 4ZH4F 4N76A 4O3MA 2V79A 2HS5A 2PBIA 4HAMA 5D5WB 1U0SY 3CZ5A 1EFAA 4LE1A 1R22A 1KYWA 1DP7P 4OATA 4LLGF 4LMYA 1BDIA 3LA3A 2JT1A 3A0RB 1ULYA 1RUNA 4LDZA 4RV5A 5TPWB 4YLEA 4Z4EA 2HQOA 4CYDA 3WU0A 2EJRA 5CVJA 3F8CA 4NCAA 2FMKA 2LNBA 4EJWA 5D5UB 1SD4A 2BBYA 6CHYA 5K5OA 3HSFA 4OMYA 1FBSA 3EULA 4MLCA 3ROTA 4HNRA 3KTOA 2HTJA 1PDNC 4AWXB 1GVJA 3CG0A 1AB5A 4UHTA 1ZRFA 4F06A 4E70A 2PUCA 2HDCA 4IPAA 2GAUA 1YG2A 4A0XA 2JSCA 1FYKA 1HEYA 2QSJA 4JOQA 4RZSA 2A61A 2EA2A 3U1DA 1HSJA 2B1JA 2QVOA 1NXTA 1B4AA 4MR9A 1BVHA 5D4SA 5TPZD 2K02A 1PNTA 2LUOA 3HHGA 4YV7A 1IN8A 1IN4A 2VXZA 1JYFA 5IEBA 3MMNA 2ADUA 3TGNA 1O57A 4ZMSA 5GOTA 3T0YA 3EQZA 2IA0A 2LIVA 2B4AA 1SFXA 3G73A 4G7HF 1XSXA 1UB9A 2WJWA 3GEZA 2MYPA 2R7FA 2ETHA 1QQAA 2OZUA 3QPTA 1Z05A 3ZMDA 5CJ9A 1ZG5A 3SAJA 1TW2A 4M88A 5L3EA 3MZHA 3WTVC 1EV7A 2EFQA 2Q8KA 2IDMA 3ZMUA 3H3UA 3KKEA 3N0RA 3LQQA 1TVMA 2DW4A 4PICA 3RVNA 2QUFA 3QOPA 2DLLA 4IHSA 3CS3A 4ZYHA 4RK4A 4HV5A 1PUEE 3R6SA 5H20A 2VE8A 2ESNA 1I5ZA 2Y75A 1NTRA 2IA2A 3HRSA 4MQEB 2R4QA 3F72A 5D8LB 4YIIA 3P9KA 5TE9A 3WTSC 5ABPA 1XD7A 3HO1A 5H6RA 3MEXA 4GCVA 3IP7A 5CNMA 1T0FA 4HDVA 3CZCA 2M1BA 2HFHA 4F7ZA 1TM2A 1T98A 2QM3A 3LAPA 4IRXA 1CHNA 2O20A 1XGSA 1FSEA 2M5WA 1F1ZA 2BE5F 4H3KB 4RS8A 1BN5A 1A04A 3MIZA 1KU2A 4KREA 5EEGA 2FXAA 3RVLA 2FQXA 3NHZA 1S29A 1I3CA 3CJNA 1IRFA 4XLPF 4I98B 2VBYA 4YFXF 1FNNA 3Q7TA 3T8RA 4N0QA 2KIUA 4ZMRA 3V7CA 5DLEA 1XSDA 2VUHB 5IBQA 5LHIA 2JPCA 2A68F 5JS1A 2XASA 2WRZA 4RK7A 1Z18A 2XDYA 1IF1A 2HSGA 3IHUA 1FP1D 3JPWA 3JTEA 5PNTA 1V4RA 2CW0F 3WE3A 3IP5A 3QEMB 6ABPA 3LTEA 5DCMA 3E3MA 2RGVA 1BI3A 4HX7A 1LDKB 4KQCA 3LA2A 3BJOA 3LUAA 3C1DA 3KCNA 4LGWA 4LX8A 4BH9A 1FYLA 3W6JB 4Z2YA 3DBIA 3JVDA 4UVAA 3KP6A 1Z2EA 3IRRA 2R3SA 3F6VA 5JNVA 3V7RA 1H0MA 5E8GA 1QO0A 3WTYC 3JTGA 4RK5A 5HQJA 3UKJA 1W7PA 4IJAA 4Q7EA 1JH9A 5FBKA 4MRMA 2MYTA 4P55A 4MR7A 5DEQA 1H9TA 4MS4A 4I01A 1J7KA 3QLVC 5CYVA 1HW2A 2FEZA 5K1YA 4G6QA 1ZGZA 2O03A 2ID7A 3LUJA 4YG2F 2XGXA 2V0NA 4Z4HA 1MD0A 2FQYA 4FE4A 3LQRA 3J81K 3QAHA 3D02A 3QK7A 1D1QA 1YK1A 1FC3A 1FQWA 2A9PA 2JPBA 1HSTA 1AOYA 1UHWA 3OMWA 3O2PE 4A0YA 4U88A 5HS8A 4N03A 2J5PA 1IUYA 1CF7B 3BP8A 4Z9AA 3CO6C 4DADA 2PUGA 2HKXA 4B8XA 3KEOA 5DYMA 3CTPA 3H5TA 5HSGA 1I6XA 2R47A 1IXRC 4UHJA 1USKA 4RGUA 1JL3A 3RVJA 2ZBKA 5EWLB 3BRQA 1W5TA 2FBKA 1XMKA 3PQKA 4QPJC 2HQRA 2VN2A 1E6LA 1Z13A 5FFZA 4Z99A 1F9NA 3LSTA 4Y17A 3J81Z 3GZ5A 4WWHA 4XLTA 1JFVA 2H94A 3F8MA 2PI0A 3N6VA 3NQOA 4W5RA 1FZPB 2H27A 4UVCA 3OLVA 5LGNA 4M6YA 4LD5A 3P9IA 4ETIA 2N9UA 3N8IA 5J8CA 3M8EA 1ZLKA 4KMFA 2ISZA 3L2CA 1JDNA 2CGPA 1DPUA 1J56A 4KDPA 2KIFA 3QELB 2A6HF 2FSWA 3CLOA 4L0YB 2FQ3A 1LJUA 1ZDMA 5BPDA 2FN8A 4Z9BA 2F8SA 1U6GA 2L4MA 1ZGAA 1APBA 3Q15C 5I4CA 1IN7A 4L5JA 4KK4A 1XCVA 8ABPA 1MB0A 3R4KA 1XDSA 4O6JA 2W84A 2COMA 3FMSA 4Y15A 3N0WA 1RZRD 1FBQA 5DD8A 1YK0A 2CG4A 3O2SB 2Q2EA 2VOOA 4ZJPA 3F6OA 1HQCA 1K78A 1DZ3A 1EAYA 4TV7A 3CFYA 1RXIA 4IMIB 3NEUA 4BHPA 3KP5A 4ESJA 2X4HA 1FSPA 2YU3A 1P4WA 4BAYA 2IKSA 3K69A 1YFHA 1WSUA 3O2QB 2QWWA 1MKMA 3M1EA 3MF4A 1T2KA 3SY8A 3M6MD 4EY3A 4YFKF 4DN6A 3HUUA 1OPCA 1IZ1A 1BAPA 3T95A 3OM1A 3CRNA 1USTA 1Y1LA 2GA2A 3HUTA 4M9XA 4G6DA 3RTRA 4JBAA 1NXXA 1IRGA 1IXSB 2L19A 5B3JC 4ETMA 3QPHA 1YS7A 5L3CA 5FBHA 3OQOA 1IAWA 2M98A 3A3KA 3MM4A 3I71A 3KSMA 4EJOA 4D0PA 3Q9SA 3ZN1A 4P1ZA 5ICGA 3HM9A 4JA2A 5F6FA 1R8JA 1R23A 2FLWA 4OIQF 4KICA 3ABTA 3VNBA 1KU3A 3E3VA 3RVPA 4ETNA 3KYJB 4P9FA 4XAQA 4PGGA 3LFTA 2P5LC 4AIKA 3H5OA 4D74A 2JTVA 5JS2A 1GUBA 4G0MA 3HUGA 1M2FA 2QVGA 3Q5FA 3FMRA 2STTA 3Q7RA 2DQLA 3URMA 1O3QA 1TQIA 1TJYA 3MAJA 5HVQC 4A6DA 3U9GA 2BYVE 3RJPA 1KQ0A 4P9UA 2DPDA 4G0OA 5D6EA 1RNLA 4G8XA 1K66A 3U2RA 2ZMEA 5T3YA 1U3EM 1G4DA 5IX8A 4UXNA 4M74A 1DBPA 1U5TA 4MPTA 4UV9A 4LG0A 3N97A 1DBQA 2OZ6A 3P9YA 1HKQA 2P6TA 2P7VB 3F8BA 2EV6A 3RH0A 5LRRA 2JVIA 3J80K 3KLOA 3KYIB 5K5QA 3KP7A 1RUOA 4EJTA 3O3KA 3RDIA 2PLNA 3OO1A 1KMIY 5FD5A 1Z15A 2IPLA 5DCFA 2CYYA 4IRIA 2MD5A 4G0XA 2WWYA 2PG4A 1YMVA 1U8TA 2PKXA 2FN9A 4RY0A 2FKAA 3T8YA 1QQBA 4TLMB 4MAAA 3HEBA 4OIOF 1USGA 3F23A 2A9OA 2Y48A 1V3FA 1OR7A 5LHGA 2RGYA 5TJJA 4RKQA 4MQFB 4LB5A 3CUQB 2H6BA 2ZJ2A 2UWMA 5KQGA 3ILYA 3CUOA 1W25A 1PUXA 3H1GA 4JASB 1DCKA 3EDCA 4WF2A 3IRQA 2JBAA 2F8TA 1UHMA 1ISSA 1XN7A 3PQJA 4HV6A 3T38A 3DP7A 3LKVA 1ZH2A 3J80Z 5TPZA 3O1IC 3FX3A 4LE0A 1W9HA 4W5TA 3WGIA 4BHBA 1DCMA 7ABPA 4P98A 1LNWA 3FM5A 1XB4A 1TQPA 2EFWA 4OLBA 2FW0A 2FMFA 3BBLA 3MYYA 1LDDA 3BWGA 1Z6RA 5LEJA 3LUGA 2XAQA 4HX4A 3W6KB 3KG2A 3B73A 3GUDA 4JQFA 4AIHA 1LB2A 2GIVA 2ESHA 2CSOA 3WTXC 1CGPA 5LHHA 3SZTA 2VBZA 2LP4Y 3E6DA 1ZESA 1Z7UA 5HS9A 2CQKA 3SG0A 2VC0A 1U2WA 2MBFA 4LK0F 1QKKA 3RVRA 3GO5A 1YTYA 1DPRA 1E6MA 2XUBA 1E6KA 4HX8A 1G3TA 4CDGA 4F12A 1G3SA 2E1NA 4YRZA 5FWXB 3B2NA 2KIMA 4KMUX 4P96A 5KWSA 4WT7A 2DQRA 3HJFA 2GKGA 3GL9A 5IUKC 2RNJA 1QPZA 4OINF 3Q7SA 4XBFA 1MVOA 4KIFA 4YP9A 1ZRDA 3OO0A 4MGEA 1JHHA 5LGTA 2O6GE 2QR3A 1B1BA 2PMHA 5AIQA 4LE2A 3QRFF 4A6EA 2MH9A 4RAYA 2MSKA 2L18A 2XROA 4OBBA 2B0LA 1SD5A 2OQRA 1GXPA 4MQVA 3GLXA 3L9FA 3ULQB 5EWMB 4RB1A 5CVIA 1YS6A 3LMKA 3O21A 4M71A 2MLGA 1ZREA 1Z12A 5EWJA 3R0AA 5KI6A 3SNKA 1MJAA 3ZN0A 3LUCA 1MDMB 1YW7A 4XARA 1X3UA 4ZZDA 2IPQX 2MLKA 2LPMA 2MH2A 2VC1A 2X0LA 3QLUA 1QPMA 4HF1A 1OMIA 4RS3A 4EVSA 4KFCA 3HZHA 4TMYA 2IPAB 2IW5A 4QYMA 5A2QK 4EV0A 1O3SA 1T34A 3JTHA 2HOEA 1D2AA 2E7XA 4WX9A 4YS6A 3GA5A 5TQ2A 3FZVA 3WODF 3I54A 1SFEA 5ED4A 4QICA 2DFIA 2E4VA 3ZP5A 2F5FA 4UV8A 3CG4A 1JLKA 2L17A 4EM0B 4MS1B 2XAHA 1DC8A 3M8FA 1MB3A 2QV0A 3V8KA 2NAZA 1OKRA 2LF8A 3CHYA 4KZKA 1SXGA 5HOOA 5JNRA 3L7WA 3OMXA 1ISRA 5JHUA 1U8RA 1LK0A 5TQJA 1MJBA 1A0OA 3I42A 2WY2D 3OLZA 1ZRCA 3GBPA 1RXEA 3TO5A 5HS7A 1HXDA 3F73A 1GHCA 5IUJC 5A2QZ 4MS3B 2ZKZA 5CNIA 4MR8B 1RI7A 1Z17A 3VB2A 4M6XA 3HSRA 4MHGA 4RXUA 4HLXA 3GRCA 3JSOA 5TPWA 4U7DA 3V8LA 4ML3A 1ZGJA 3MZYA 2FLKA 3NNSA 3BPVA 2EV0A 4G7OF 2O3FA 4RWEA 1DRJA 5L3GA 3BILA 2GZWA 3I59A 2IRFG 1JYEA 4I7HA 2DI3A 2FSPA 4Z4FA 2PMUA 2PN6A 4L0ZB 3J7AO 2Z99A 3K1MA 1EWTA 2WJAA 3E5QA 1ZG1A 3NBMA 4JB2A 1BOAA 4YO7A 2LDUA 3JW4A 3PFIA 4OMZA 4WXDA 1DUXC 4M9ZA 3EETA 3DLBA 2QQAA 3F8FA 4MEYF 3JPYA 1OYWA 3TO9A 2ZNZA 4N9HA 2JK1A 4KQ9A 4MRMB 4PEVA 3C3MA 3L00A 3ZPLA 3IPCA 1W4MA 1FSHA 3H6HA 4EQQA 2GX6A 1JWLA 3WTWC 2IPMA 4KA4A 4IXAA 4HQMA 4U0WA 5GQSA 4OIPF 4O1IA 4RGXA 3BJAA 4PZ0A 3H92A 4FT8A 1QP7A 5HM6A 2QZ8A 4OOIA 3C3KA 1P92A 1R1UA 5LGUA 4OU0A 2A9QA 3I53A 1JF8A 5HLIA 6PAXA 1D3YA 3I64A 4QYWA 5CVVA 4IMJB 2KJCA 5FGMA 2OA4A 3P7NA 2VYCA 2VOPA 3HDVA 4OIRF 2PUEA 4HZFA 3I45A 2V6CA 1SFUA 1YQAA 4Q6BA 4WUTA 4FB4A 2KRFA 4N41A 1Z16A 1NHAA 4G0YA 5EEHA 3G1WA 2Z3YA 1G3YA 4QLCU 1RZRA 2PEXA 1ZH5A 1D5VA 1Y0UA 4MQEA 4RK6A 3DGFC 1TNTA 1JX6A 4N47A 1NATA 3KFWX 2A5YB 3KP4A 5FFXA 1DJMA 4RXMA 1J0RA 1EH7A 1PHRA 1H9GA 3Q41A 2NNNA 3M7GA 5IC5A 3VEPA 2GWRA 4YIFA 2ZFWA 3SZPA 1YVUA 3QX8A 5ILUA 5IUNC 1ABFA 3GZ6A 3JAMK 3EYYA 1R58A 4GYGA 2OAZA 3K1NA 2RQPA 5D5VB 2AXLA 2V1XA 3GFLA 1KYZA 2GXBA 1D5WA 3JSPA 2ISYA 1DC7A 3I09A 3E5UA 1SRRA 3CU5A 3F6CA 4EYOA 3RYPA 3L6UA 2GXGA 5IULC 4RGSA 1USSA 2P7CB 4W5NA 4BQAA 3QLTA 1VPWA 2H09A 2JCGA 3JVIA 4Q4ZF 1GCAA 2MA3A 5L3BA 2PL1A 3K0LA 2CO5A 5K5RA 1DDNA 1HKTA 3TO7A 4BHCA 2DT5A 3E6BA 2NS0A 1R5GA 1FX7A 5IEJA 2WMYA 3V8JA 2RJOA 2WB4A 2FRHA 2YSRA 1QNLA 3QEMA 3H5WA 1F51E 3JAMZ 2P4WA 5E17F 4KRFA 5C5EA 4CBVA 3E6MA 3G3ZA 5E3JA 2YHBA 1BIBA 5T7BA 2V9VA 2DO7A 5L3FA 2PUDA 4WXEA 1FFSA 2A6EF 4BXUA 2CWDA 5DD4A 1STZA 3K9TA 3RIRA 1BBYA 1IXCA 3DXJF 4U0YA 5F1RA 2DK8A 2FF4A 3LWFA 3HRUA 4AIJA 4MYRA 2NNYA 3MQ0A 3QLVA 4N0BA 2RJNA 4R79A 2VODA 1DG9A 2EFOA 3QP5A 2FU4A 5FWYB 3S2WA 2Z33A 4G7ZF 4M72A 1TQMA 2NT4A 5HDNA 2K4BA 4KNYA 4NHJA 5J8FA 1MAVA 2JZYA 3BOQA 4IHTA 3HYIA 1CF7A 2DRIA 3OLXA 2M45A 2W57A 2JRTA 3OQMA 2VT3A 5AIPA 2P9HA 2A69F 4KMRA 2MYUA 1VRVA 2FEWB 2XAJA 3BRSA 4G0QA 2HYFA 1QZZA 3LUDA 1ZHHA 4XXHA 5EWLA 4UNOA 3R61A 3WE2A 3EJWA 2E4XA 3IWFA 2HKOA 2HZTA 1ZAYA 4IGAA 2CFXA 3WG9A 2Q0OA 3DPTA 5FB2A 4GXOA 1KU9A 2QBYB 1FBUA 2YPRA 3F8NA 3F6PA 1KQ8A 2HEOA 4CICA 1TLFA 2QXYA 2HYGD 2FMLA 2J5OA 4ASNA 4CZZA 5TQ0B 2FEPA 3GWZA 2DTRA 1PNRA 1D1PA 4HBLA 2CWEA 2EV5A 2AYZA 3D8UA 3IP9A 1NY5A 2YX7A 3K2ZA 4BYYA 1K68A 1QMPA 3QELA 4TN5A 3A10A 4ZPJA 1BI1A 3DKWA 1W5SA 3NRVA 4IF4A 5D2CA 4E7OA 1FP2A 1IN6A 4Y9TA 3T8TA 1CEYA 2XRNA 5C5CA 5FD6A 2STWA 1SMYF 3TOBA 2JRLA 2BEOA 4FX0A 1MIHA 3E97A 2VBWA 3KETA 1MGTA 3GXOA 1JHFA 3IC7A 2L02A 3OQNA 3T5XA 5BRAA 3FM3A 5L3DA 1J75A 1ZY2A 4O5VA 2FMIA 2BGGA 3ROUA 3GV0A 2XAFA 1XHFA 2UXNA 4LFUA 5JFRA 3O6BB 3F3XA 2G7UA 1NXPA 1D8KA 2LSOA 4PZJA 3HDGA 2IVMA 3TDUC 2IOYA 3RVSA 1XGMA 3HHHA 4ZYEA 2ZCWA 4L18B 1JFSA 2E7WA 3DGEC 1R7JA 4I02A 4FE7A 3AAFA 3JY6A 4D6YA 2W42A 1JXSA 1T38A 2VT2A 3TD9A 4EGYA 1OXBB 4EM1A 1REPC 1FPQA 2A07F 1T6SA 1M5TA 2PAFA 3NHMA 2P8TA 4PE5B 5D6FA 2EB7A 3RPUA 4RY8A 4LRQA 5LRSA 1NXVA 2Q5CA 2M30A 4P5OA 2TDXA 3CUQC 4L9JA 4Q5SF 3FFXA 3WGHA 9ABPA 3BDDA 1YO5C 4F11A 4W5QA 4YFNF 2M87A 3HTSB 4HNSA 5AONA 1KA8A 3LUHA 2KJBA 4MEXF 4KN4X 4A5MA 3H5LA 4O5AA 5B3JA 1TBXA 1R1VA 3GYHX 1ONVA 4MNUA 4GO1A 3LFKA 2A9RA 4RU1A 1PEYA 1FY7A 2VK2A 4N9IA 3O74A 1ZAOA 2WWVD 1XDUA 3N0XA 2FTKE 3FXRA 4K2EA 2YX4A 3FFWA 1XGNA 4EYGA 1YW8A 3VFZA 1ZG3A 4G0ZA 2RC4A 1GUDA 3OLWA 1QBJA 3F21A 4G0PA 1R36A 4HOBA 1JE8A 2FBHA 1L5YA 5IT9K 3BROA 3GFMA 2MYNA 3R0JA 2EFPA 3W9SA 1BI0A 3RVQA 4L5IA 5JR3A 5CLSA 2IT0A 3RPQA 2DAOA 1B9MA 2P5KA 4EUKA 3OV8A 5F64A 4RAZA 3H3ZA 5ILSA 5KQMA 5CNJA 4HF0A 2VBXA 3DQVC 2CD7A 1O7LA 1DRKA 4RY9A 3UK0A 2DK5A 3V7SA 5TRDA 2PLYA 2H3HA 4MR9B 3GF2A 3MFKA 1WKMA 4HLYA 2EFNA 1TLHB 3FMQA 4KV7A 4G94A 5ICEA 1YYVA 4AVPA 5J6XA 3K1PA 3V4GA 2QU7A 4JAVC 3HRMA 4PDKA 3EDPA 4DQ2A 3VODA 5IT9Z 1R5HA 2PUAA 4A2UA 4NB5A 3GBVA 4JB0A 3NNDA 4MQFA 1SMTA 1GLGA 3CUQA 1EWKA 2RN7A 1FYMA 4I0AA 1I1GA 2L4AA 3KZYA 2XKOA 3I58A 1Z91A 3K9CA 1LQ1A 4A5NA 1ZVVA 1L3LA 4B09A 2G7HA 1F4KA 1U2PA 1OYYA 3RVOA 1KU7A 1P6QA 5DDGA 2VUIB 4FHTA 4R8HA 5DGCA 4S04A 4GGGA 2FE3A 3KCCA 1JBEA 3GT7A 1QGPA 2KKOA 4EMSA 5HLGA 1B9NA 2XAGA 3B02A 4HYEA 3TX6A 2QVCA 4G97A 4KIBA 3A0UA 5CNKA 5JVTA 2D1VA 4KVFA 4EYKA 3C18A 4YR7A 2RDMA 3IKTA 1FWZA 1A2OA 1XHEA 3I59B 3FXUA 4WK8F 5DTEA 3DV8A 2P6SA 2CHFA 3BJ6A 1K6OA 4HDUA 1BA2A 5E20A 2MSWA 3H5VA 1CYEA 1O3RA 2DPUA 4GPAA 2K7LA 3COAC 2FQWA 1S7OA 4WWCA 5ICCA 3SFZA 1KRXA 2OQGA 1JHZA 4H0EA 2IJLA 2FA5A 3I4PA 1Z1DA 5E8IA 3EAFA 5FWXA 4ON0A 3ML6A 1ZHFA 2K4JA 1J59A 2IYNA 1ZLJA 1T39A 4ENJA 5BRJA 4RK0A 1VLZA 3CLKA 2ACJA 1ABEA 4KPYA 4PYRA 5JNUA 2QLZA 3HK2A 4Q6WA 2HR3A 3ELKA 3SM9A 5ICFA 4ENMA 2FBIA 3VNAA 5JNTA 3BZ6A 3OM0A 4G86A 2VONA 4MTEA 4RXTA 1QP0A 3KE2A 1LEBA 2QENA 2HGCA 4RB0A 1QZYA 1EH8A 2OENG 1TNSA 5LLQA 4KN7X 2MC3A 4XRFA 1QNTA 5EWMA 3N53A 2NUBA 4LLLA 4ZYGA 4WXCA 3TKYA 5E1ZB 5BS6A 4CXFA 1DBWA 1P2FA 4XFKA 1R00A 3EQ2A 4LDAA 1MDMA 3HTUA 2XKPA 1G3WA 3ERED 4KUMA 2JVJA 5DCMB 3WTUC 4RB2C 2PJUA 4L9TA 2EA4A 4CHUA 2I6FA 4TLLB 2OBPA 2Z5UA 3CO7C 5IT3A 1K7AA 3R60A 1QQIA 1Z25A 1U78A 3WGGA 1WI9A 2RDPA 3KP2A 5JNWA 4WXHA 2ID9A 1BC8C 1UDRA 1W7PB 4ZZLA 5DCLA 3F22A 4IVNA 4MR7B 4RKRA 4HA8A 4MS4B 1O7FA 1YIOA 2VE9A 4MS1A 4IRHA 4ESFA 5BPIA 1XGOA 3T1BA 4CGZA 1ODDA 3DLHA 2F5DA 1S3JA 3GYBA 2FVYA 2IA1A 2PQ8A 2HQNA 4NV3A 2XIGA 3WU1B 4IRGA 4HW0A 3I5UA 4MTDA 3IL2A 3TMYA 1E2BA 3ROFA 1LBIA 3FWEA 3SQNA 1UFMA 1FFGA 4MS3A 3EYIA 4MR8A 2OD5A 3ECHA 1J2XA 3LKBA 3RKWA 5E18F 3DPLC 1YLFA 2EK5A 5KQLA 4QWQA 4GYIA 1L0OC 3QU3A 1BJAA 4MQ9F 3REOA 1LDJA 1LJLA 3M9XA 2YHAA 3Q9VA 1MZBA 1KQ9A 3OOPA 4ETSA 3LOPA 1ON1A 2FXIA 1RZ4A 1DP4A 1ZH4A 3O75A 5DV5A 5FLXK 4R1HA 1S6LA 5BQ3A 1JDPA 4KT5C 2NZVG 1G6NA 4Z4CA 3QP6A 4EYQA 1NXOA 4LZLA 4JK1X 2PUBA 3O2JA 2AS5F 1TTYA 3I5AA 1XCBA 3BY6A 2MSLA 4H3HB 2CHEA 2PFBA 4NCBA 2V1DA 1XMAA 3FXQA 1GXQA 4Z4GA 1S8NA 1UCRA 5DUIA 3C6QA 4OTZA 3EGCA 2QYOA 4XSZF 4WXMA 2H6CA 1RIOH 3OLYA 2O61A 1M2EA 1SXHA 4NQRA 2FOKA 1BDJA 3HCWA 1C0EA 3WTZA 1J9IA 1XSVA 5BMZA 4BNCA 4D6XA 4RDCA 3HVRA 2KYRA 5ERIA 5KC8A 4EVRA 5E1XA 5JNSA 5BQTA 5FLXZ 2A3SA 3ZMTA 5KK1A 2V1UA 1ZGGA 3CNBA 2RVCA 3GX4X 4JP1A 3ZMZA 4ZYLA 4RK1A 1WWXA 3D0SA 4EJUA 3E61A 2QW1A 1P6RA 4LK1F 3FHZA 3D5LA 1M5UA 4ZYDA 4OLAA 1K78B 1P4AA 2FNAA 4UVBA 5JI6A 2PUFA 4IILA 3CDHA 2H0AA 4I0BA 5HLHA 1AWCA 3E6CC 4XASA 2NT3A 2ZAYA 2HJ9A 1DCFA 4UUVA 4ESBA 2R25B 3H6GA 4L4UA 3IP6A 2GQQA 1F4VA 3ZMVA 2HQBA 1LEAA 5HKOA 1P8AA 2D1HA 5CVUA 3P9CA 2L54A 3IWZA 3DZDA 5KVRA 3RYRA 1KGSA 2EWNA 4YWHA 2E4UA 1ZYRF 3M9AA 4EM2A 1H9CA 3C97A 2OU2A 3I0TA 1E17A 4HF2A 3QU6A 1WETA 4XSXF 4GNRA 3FF5A 3L09A 4KIGA 4F8JA 1Z2DA 1PP8F 4HNQA 3EQLF 5D8KB 1FOKA 4PCQA 2J48A 1E2XA 2UZKA 2XVCA 2NRAC 3IDOA 3CKMA 3DEUA 3LAJA 3QEKA 2FEKA 4L9VA 1OXKB 2FMYA 2GA1A 5BR1A 4I2OA 2O0YA 2K86A 5HDGA 1SD6A 4Z4IA 1IW7F 1IIBA 3HS3A 4E7PA 3KHTA 1ZN2A 1EWVA
chains in the Genus database with same CATH superfamily
2BGCA 3W6PA 4K81B 1U5TC 4U0VA 4G85A 2YY7A 1WXGA 3RIHA 3ZHXA 5IVDA 3WBBA 5DM70 3CNQS 2EFJA 3K4HA 4HAVA 4WOCA 4ZI3A 3KLPX 2B6HA 1TYAE 4DNCA 1Q0PA 2GF9A 2NXWA 3N4MA 1Z74A 4D7AA 1WV1A 3K4PA 5AIBA 2RBEA 5JANA 7MDHA 3GARA 5TDHA 3SYMA 1Y3DE 3DYBA 1B00A 1E8DA 3REFA 5GZ3A 4ENKA 2JBAB 2WNHA 4RVOA 2LWIA 3FMVA 3MQ4A 1XXHE 1V8ZA 1SC6A 4KBGA 4N9WA 4M7OA 3DVSX 1DHTA 2ET6A 1LK7A 3WDSA 5E8JA 1F0KA 2DA6A 1S8AA 3OS2A 3L49A 5JRJA 4JEUA 1G20B 2GCPA 2I2FA 4XLNF 1PT5A 1HBJA 4WKCA 3RTBA 1O5TA 2CJFA 2Y30A 2PD3A 3CVWA 1ZOPA 3VKWA 3WO0A 2HK9A 1MBEA 1JFTA 3IS3A 1S7EA 2QN7A 3R5HA 2VBIA 3D3JA 1F2UB 1YGPA 1FQKA 2QRGA 3E1GA 1XNJA 1JIXA 1IZ9A 4D4MA 4CQLA 4O2BB 4RNCA 1OXTA 1OF1A 5JD3A 3CBQA 4BKUA 4MUGA 4ZHQF 1CF4A 4DVJA 1USIA 1M6HA 2GH1A 3GRFA 1ZMRA 2C4KA 4JU9A 4RLHA 5FWAA 5F77A 2VJOA 2IYPA 3KP3A 1M1EB 2J9FA 1C8KA 4FLMA 4YP7A 3SF0A 5CH8A 3GFIA 3B6AA 3SDBA 3NPAA 3IAS1 4KK3A 1DFGA 1JP7A 3LL4A 2R7RA 4O2AB 2Y69H 2I5PO 3A4VA 1B72A 1BHQ1 4CYMA 2QEXI 1JDBC 1GG5A 3PPVA 1G16A 3ESQA 2JK3A 3EEOA 5I3CA 3WTCA 3N76A 3FY4A 3RD5A 2PRIA 1K89A 1XTBA 2DFLA 5B4UA 4N76A 4AKGA 2BM0A 2D6FA 2GPJA 4HB3A 2CXOA 3IOCA 3RADC 3OF3A 4DJ5X 1UKYA 4ZT7A 3K6SB 1BDIA 1JSXA 1N7HA 1W0KD 3N6RA 3OPYI 1DIHA 1SK8A 2ZRAA 1SPXA 4RV5A 1Z6ZA 3UPDA 6REQB 3IPLA 4F4UA 4ALNA 2PS1A 5EE5B 6CHYA 1FNSA 2WD7A 1Y39A 1XRQA 4J4HA 2VUSA 2QGUA 2QUKA 2J6CA 1SUAA 1SCDA 4KRGA 4RZSA 1ECPA 4JOQA 4V2GA 1YQXA 2PANA 2BHTA 4FCWA 3ZK9A 4ZVKA 3FTFA 1X2NA 4QEKA 2YRWA 1ZJWA 2CW8A 4GYWA 3R09A 1NU8A 5E3HA 4OHBA 2H2HA 5DGHA 1F12A 2C7OA 1UBOS 4LCEA 2BFWA 3UFXB 2QY9A 4LHEA 4ZVOA 3FLMA 1UWKA 2F3TA 4HWTA 1YNOA 4G0WA 2PJRB 1RWXA 1E18A 3TZEA 1QQAA 4R3NA 1ZRNA 3ZZNA 4I2VA 4V0KA 1LK5A 3GEHA 3O3CA 4H16A 4ZZ2A 1Z3IX 3VHQA 3DMFA 2QGNA 1CS0A 2JFWA 5DCYA 1L7XA 1WXDA 3SE7A 2LTPA 2YXBA 2P78A 3ZXXA 1TIKA 2B34A 2PRZA 3ESYA 1NTRA 2IA2A 5JCJD 4MQEB 2YUSA 2W2LA 3P9KA 2L7FP 2X40A 4GKVA 2F6RA 3MEXA 5F04A 4H18A 4EKYA 4KZPA 3TXYA 5A7FA 4M49A 3OZRA 3ROQA 2EKQA 2QQEA 2YFQA 1U3GA 3BXPA 4RX1A 2XE4A 4F7ZA 2IYUA 2Z09A 4O2BF 4DQKA 2MHCA 4DFDA 4IRXA 2B2CA 1E79D 5PGMA 2M5WA 1A9QA 1C0IA 4HAOA 1XWIA 1BN5A 3TLXA 4LF8B 4PSUA 4NC6A 4Y33A 3K35A 2XGSA 4D42A 3EH1A 3D8HA 1I3CA 3BQMB 4PO8A 2Q5IA 1V1RB 5DX8A 3ZWKA 4ZCQA 2VBYA 4W1QA 5HTOA 2QGFA 5IARA 3FOZA 1T5TA 3V7CA 1VBKA 4LZJA 2AMVA 3JR9A 1SVNA 2Q41A 3IHUA 1RIFA 2FRXA 4OLHA 3K0AA 3RYIA 1ZGBA 4NZPA 1MMDA 4O2AF 4H7FA 3FN4A 1H9AA 4EDFA 1R4AA 1MDBA 4NXNB 3EE6A 3CC8A 3EVCA 5D87A 3WTYC 5EERA 1C7QA 3PLRA 3CMEI 3AM1A 1DNPA 2PZJA 5CYVA 1HW2A 2FEZA 2RAFA 2G3YA 2XGXA 3E3OA 1I0LA 1NVVQ 3NOXA 3PIRA 3T7KA 2VDLB 4ZAFA 5B6JA 1RLTA 1SXJB 3MCVA 1T5SA 1R6RA 2ZJ7A 1XRJA 3OMWA 4GPBA 3A9WA 4IUYA 3IAM2 1Q6ZA 2J6IA 1LB1B 2CL6X 4QSMA 4AZ3B 2K3PA 2PUGA 2HKXA 3KEOA 2BY1A 4RQAA 2QRNA 1WSAA 3L2UA 5EWLB 1CDEA 4GVLA 1Y7TA 2PRKA 3J81Z 5EGOA 4XLTA 4JSRA 1UMCA 2ES4A 1P62B 5JFOA 4YUXA 4TLDA 2P2CA 4C1NA 1QVWA 4L8GA 1JJ6C 4D9HA 3FMFA 1ECCA 5BQ5A 2ZAOA 3BD8A 3ZX5A 1P2VA 5GTHC 5TIIA 3GRKA 3L2CA 4OSEA 4CYCB 1JIQA 3E7LA 3GFBA 1CUGA 3FHTA 1B3BA 2YWEA 2Z8YA 5G0SA 4Y15A 4MUYA 3WOHA 1R6TA 4MPPA 3ZJUA 4C0BA 4PN7A 1GUFA 1RXIA 4FFSA 2YC4C 4BNLA 2EFEB 1WBBA 1BN7A 3RYFA 3T5MA 2D0PB 1FW6A 2Q29A 4F3RA 2VF2A 3BC8A 1IRGA 3GGOA 4M0KA 3JAWA 1RKTA 4PUSA 3I71A 1CUXA 3U19A 5F6FA 1YKSA 5JCOA 2FLWA 4KICA 5LD2C 3ABTA 2V7TA 1MO2A 1FJXA 1MSEC 2G40A 1IQRA 3L7AA 4ETNA 3STHA 5IKMA 3H5OA 5REQB 4BNUA 4B4OA 3WRVA 1N5RA 4EG1A 3F1KA 1B8OA 3THXA 1X2EA 2VQHA 3URMA 3IP1A 5HVQC 1FU7A 1YA8A 1F6BA 2GJ9A 3I83A 1CUJA 3CCLI 2NU8B 2P69A 1DBPA 4HH0A 3H2HA 2QG6A 5EHZA 3RH0A 4GZ5A 3J80K 3G8YA 1W48A 5HYVA 4J16C 1BKYA 4V0ME 1WULS 3OO1A 1XZBA 3RSNA 1V11A 1UMDA 5DULA 2CNWD 2NXEA 1DEHA 4O3FA 4QGGA 1ECJA 1OAKA 2OFOA 4BVJA 2VHJA 2W83A 4OAYA 3W4IA 4LB5A 2NO9A 2YZMA 1MO3A 4GLOA 1CR2A 1XLWA 3S1AA 3ZLUA 1DCKA 3W2TA 4JLAA 1YIDA 1N6OA 1ISSA 2ZTLA 4Y2YA 3FX3A 1XNRB 2WG2A 1DCMA 4TMWA 1LEHA 2BN4A 3ZNQA 1RKWA 1EX9A 1Y8ZA 4D98A 3GUDA 2CXQA 2QU8A 1IEVA 2R1TA 2ZB7A 1SVLA 3G4SI 1IHYA 2JLYA 1X7YB 4CCJA 1Q2XA 1O95A 5E6UB 3D5QA 1KJWA 4H2DA 4LQ4A 1X7DA 1KYYA 1DPRA 2CHUA 1M34B 2XMDA 1GKKA 3NEYA 4YRZA 4PW0A 3O31A 3G1OA 4ND6A 2BGTA 4A36A 1RP7A 4HQLA 5LGTA 1YHNA 3QRFF 3WXBA 2V03A 4BY1J 2Y1KA 4PC3A 5CDHA 2F6CA 2Z6QA 4IEEA 3TGWA 1D2MA 1CK4A 4RSHA 3QOEA 2XWJI 3MSXA 5EWMB 3AUKA 4TX1A 1UM9A 3OC6A 3U1VA 3WL3A 4UCQA 1VB5A 4G12A 2GOYA 5HKKA 4TRJA 2ZI7A 2VDQB 3GLKA 4CJXA 1PD1A 3ZI0A 4MJLA 4QVKA 2RHLA 5D00A 5AICA 1EESA 4PHHA 1T34A 5HF8A 1NGSA 1JEEA 2FVXA 1NBIA 1E3EA 4TS4A 3H99A 4QICA 1PU2A 4MVJA 2VPIA 1DC8A 3GEPA 3V8KA 4JR2A 5LA6F 1OKRA 3THOA 2VPTA 2ABWA 1SXGA 3RQ4A 5AKGA 3LTNC 1RM0A 3WQQA 4GSLA 4MKXA 1S8FA 3ROZA 4LFAB 1A0OA 3Q3CA 3DC7A 4MWZA 1HZZC 1I6MA 1JSLA 1SD1A 1GNRA 3RYHA 4ZZIA 5HIKA 4OQMA 3ET4A 2FUG2 4MHGA 2PBLA 4U7DA 4DLUA 1RXCA 3X1YA 1E1KA 3OOUA 4B5LA 4GGOA 1AV6A 1KPIA 4Q9DA 5HG0A 1Q19A 5EIAA 5D3ZA 4BEHB 5KJEA 1Z7LA 3AILA 2LY1A 2GBGA 3L05A 3PJRA 1PS8A 1ISFA 4MEYF 3REQA 1ONOA 2OBNA 4DNXA 4IZIA 3P94A 1VA5A 5LWQA 4BLVA 3SS8A 3OMLA 4OGLA 2EZ9A 4IQJA 1R50A 2HFKA 1EXWA 1YOBA 4CCAA 3DVAA 2M4GA 4HRXA 3TIGA 4RKYA 1FS6A 4K9PA 2A35A 2IUFA 4TMZA 5LXTB 4I7EA 4BLQA 1OIVA 5HEKA 1FMVA 5E0OA 1MNEA 1LI4A 4R2KA 3I64A 2HGSA 4IMJB 4QPZA 4BZXA 1I1NA 2VPXA 4M0EA 1GILA 4MPDA 3HOWJ 1G3YA 1OT5A 4JLWA 1UKZA 2UUOA 5ITSA 1U4NA 3NTVA 5E7MA 4IQFA 2MABA 5T5QA 2I4MA 3DKIA 2LCQA 3FG9A 4UUPA 3KZIC 1J0RA 1C3JA 2ID8A 3QXJA 2C8LA 2DMPA 4BE9A 4GI2A 1Z47A 2P3SA 4UQPA 4IOAF 2EC5A 1SRRA 2ACVA 2DWOA 1USSA 2O50A 2VH2A 2W58A 4IGFA 2HMSA 3BWCA 5EKDA 1T15A 4Q3NA 1XTVA 3KKNA 4NFSA 3PXGA 3HE3A 3PJGA 3LCCA 3MHPA 4LDQA 4XX0B 2XUAA 2Z2YA 2YNMC 4YACA 1NRJB 1EFVB 3PX2A 3DU6A 5DD4A 3UH1A 1ZA2A 3QU2A 3R6LA 1ZJJA 3WS7A 2IOHA 2QVZX 3DBLA 3A8TA 2NNYA 2V3CC 2ZSBA 1KSJA 2WM2A 4MVYA 4LRWA 4ARAA 4RL6A 3DP9A 1DDGA 2QT0A 1QONA 4DQUA 4UVIA 3ROGA 3PXXA 1OBOA 1LVHA 2F43A 2IOFK 2YJZA 2YC2C 2W57A 3CA8A 4RMIA 2MYUA 4DABA 4E5MA 2XAJA 3ABKH 4JXZA 3FKSA 1W4LA 2VP5A 1M2WA 5DHAA 5BV8A 1M6YA 1N7GA 4MARA 2H2IA 4N3CA 4BY9E 1XAHA 5KHLB 5DFAA 2FZEA 4Y1RB 3A6DA 2CLFB 4RQTA 1W35A 3JVUA 2R8EA 3OOSA 2D7CA 2J5OA 5I48A 1VJGA 1O08A 1AK1A 3AKZA 5CB4F 4LS3A 2AYZA 5AXDA 2VKVA 5K7HA 3EBOA 4I1UA 5FCDA 1L7NA 5CURA 4UEQA 1YL6A 3CMMA 1FP2A 5CCXA 1GL7A 4KGDA 2PX3A 1SMYF 3TOBA 1TUGA 4BMNA 1DFHA 4AJNA 4XDYA 5L4SA 3OL3A 4FYIA 1QZXA 4DCTA 3MJFA 1BJZA 2DFHA 1DQNA 2E7WA 1T5HX 3U6BA 1E62A 2AQIA 1TMGE 1AKMA 5TMBA 1M5TA 4HGNA 2EB7A 3U0VA 2CZCA 2OHXA 1RQ2A 3X2QH 2EIXA 2H7YA 3CUQC 1Q0HA 2X4GA 3GLGE 3MYRA 4YCDA 5LQSA 2FZGA 5A4DA 3U5TA 4X1IB 1OCOH 4LK2A 1GGNA 3W0LB 4DCGA 4NU0A 1J0DA 1BNCA 4K2HA 1CT9A 3ND6A 5CA1B 1NJ6A 3QODA 4WESB 3QEBZ 1Q1EA 2AJCA 1EE9A 5L3ZA 3AXTA 4PBRA 1IDOA 5AKIA 1CEEA 5K6AC 2BW3B 4UPDA 2B8EA 2C2OA 5JR3A 1UPAA 4CI0B 4KO1S 2QG4A 3ITNA 3R0VA 1B9MA 5F64A 3TTWA 4IF6A 4AJ9A 4GOKA 4XYLA 4C3VA 1KVQA 2VBXA 2HPZA 3UK0A 5CD9A 4MR9B 4IKEA 1B7GO 3CPHA 1G3QA 1WD7A 3IGFA 3EVAA 3GT4A 4G94A 1JEOA 6GPBA 4JAVC 1TZBA 3K6JA 4YV2A 1L4EA 3V2IA 3NNDA 1U2DA 2M2EA 1SMTA 1D2GA 3U31A 2I5UA 2W48A 1FXSA 3BK2A 1Z91A 2G7HA 3O47A 1OYYA 4FDAA 2GF0A 4ZDWA 2CUJA 2VJMA 3GT7A 2JFUA 3A0UA 1QHYA 1YR3A 4O5OA 1R0XA 2HC9A 5DTEA 1EFRA 1RKVA 1WXEA 1ZLYA 3CVVA 2L0XA 4HDUA 5EHGA 1TZLA 2BKVA 3CPSA 2AFHA 3SKVA 2A2ZA 2AG1A 2REBA 5ILQA 4FEEA 3OCJA 3C7DB 2FJPA 1QF6A 1Z0SA 3ML6A 4R4JA 2ROQA 2DQZA 5EMHA 2IYNA 3HYLA 1CV2A 4OI1A 2FSHA 4ECAA 4LXHA 5JNUA 4HRAA 5HODA 4BUCA 4HX2A 4IXDA 1GGKA 1H2XA 3AI3A 4RHYA 1U5BB 2ECOA 4HSGA 3ZDDA 2GOXB 2NUAA 4NG4A 1LEBA 1VQ5I 4HDQB 4II7A 3A04A 5LLQA 1H8ED 4DSAA 1YE3A 1GNQA 2HA0A 3M0EA 4LYAA 2FWBA 4JFRA 3LSIA 3VC2A 4V3CA 1AKTA 1MDMA 2OV2A 1G3WA 1G6Q1 4PNEA 2IGMA 2ZYVX 4J94A 1K7AA 3C3JA 3TSZA 1OJLA 2P7IA 4D3DA 4L95C 3BMOB 4WXHA 4UUMA 1ES9A 1GFZA 2VHXA 4J7CA 2O1EA 4CKZA 1H5QA 3N74A 5A5DA 2XVXA 2RC6A 4PZYA 3UJNA 3Q9UA 4ESFA 2BBOA 4Q82A 4XE5A 4O4HF 2B94A 3IO5A 3UBTA 3WGKA 3DKKA 3GD7A 4C05A 2BSAA 1R5BA 2UXDB 3N59A 3SSNA 3ZV7A 1FFGA 1CJSA 3GR6A 1O0BA 2YS6A 4DXHA 1YLFA 4II3A 1LPSA 1B2LA 1J5EB 3H11B 4XM0A 2W6OA 3ESBA 3KQPA 4NG5A 5K0NA 1LSOA 1ORWA 1OFCX 1PFVA 5AVXA 3RKQA 4JVLA 4NOKA 1G18A 3CZPA 1TTYA 4YRSA 4O4IA 4B8WA 1YF3A 3NOVA 2CHEA 1FTGA 2V1DA 2JJ2A 4EKDA 3L43A 2X8AA 2HU9A 1TYZA 4U63A 4IV8A 4QXAA 4F72A 4Z5XA 5FOWA 4AY4A 2G09A 5I4BA 2R00A 4RNDB 4M6WA 3PGJA 4CG0A 3UAWA 4TQUS 4QJBA 3DDWA 1MFZA 1WWKA 3NPMA 5ALRA 3ZMTA 5KK1A 5B53A 3QFTA 3JQBA 4EJUA 1ULAA 3MK31 3U81A 2Q2EB 4NDAA 3KPJA 5JC1A 3Q40A 3OPXA 4M98A 4ESHA 3ZCOA 3HVHA 1Y4AE 1KO7A 1FTZA 8OHMA 3FAZA 2VDNB 1MXHA 4HB4A 1OI2A 4OFZA 1X58A 3ZMVA 4Z9FA 4MWTA 3RUIA 4LCJA 1SQFA 3P0RA 3GROA 5BT8A 2O4CA 1S89A 2EWNA 1WF3A 1W36D 2VRCD 2C2ZA 3BZUA 2O9LA 5AUOB 1ZRSA 2H7CA 4J3NA 1GPBA 4L15A 3FF5A 3LSPA 3ONVA 4WAUA 5FKNA 1VLMA 1RSZA 1GP2A 4Q5IA 2CWWA 4FGUA 4QYSA 3NM5A 4C5CA 4ER0A 1E1QD 3FDYA 1X1SA 1KVUA 3OYEA 3L2RA 2K86A 3BXFA 1VQ6I 2Q0QA 1NYLA 4E7PA 4NNPA 1C1HA 2E1CA 3BFKA 4TSFA 1O3TA 3EVBA 1AURA 4CT4B 3CONA 5LEKA 3SX4A 2I3ZA 1Q0QA 4URXR 3EUAA 3VPRA 3H05A 4DE5A 1H0SA 1D8JA 3LI2A 3EIXA 2NYXA 3EIHA 1E89A 4JB8A 1T26A 4A91A 1HW1A 2HEIA 4GGMX 3VKVA 3CVJA 1DJOA 2DHRA 1EP9A 2I4OA 1V4NA 3DG9A 3NAUA 3QHAA 2M6RA 2BISA 4QA9A 1XZIA 3GQVA 2XCQA 2GPBA 3L1PA 3CLHA 4QDZA 5J40A 3G71I 3IEKA 3LNCA 1FRQA 1F8UA 3G5MA 1Q92A 3T1TA 4AMBA 5IN4A 1SUWA 2IIQA 1CZUA 4CV2A 4QE3A 4JXKA 1OLOA 4F8YA 3MCWA 2FNPA 5K4AA 5ERXA 4XJSA 3U4IA 5B5SA 4KUEA 3B5JA 1GL6A 4EFKA 4ILKA 5AM1A 4RVCA 3HB1A 3D81A 5J9FA 1PJTA 1ZNYA 1G5QA 4PPNA 1FRVA 2NN3C 3NBXX 3R5XA 3NW9A 1GAQA 4F93B 5FBQB 4DCOA 5IAOA 1NVTA 2R86A 1MRZA 3QVSA 3CVOA 3HIFA 4RFVA 4D3FA 3S1SA 3T12A 4FCCA 3B6CA 4DA4A 5EL0A 2DJ5A 4RGRA 3H2IA 1VP9A 5DI3A 4TYYA 3FXJA 5KVCA 4WCGA 2XRZA 3BCBA 3MCTA 4Q3DA 4GOXA 1J42A 3LC0A 1JTEA 3PWZA 3GTQJ 2B4YA 4GS5A 5J59A 1RPJA 3R40A 1EG2A 5DPMA 3PL1A 3C8ZA 3KC2A 3MCZA 2FPXA 3FIWA 3RQIA 3K05A 1N25A 2WC2A 4DDKA 3X2SA 3DMNA 1UJCA 1WHUA 2P4UA 1YZLA 3ROXA 4A15A 1JLLA 4IBOA 4EUNA 3QVLA 4NYMQ 2WBLC 5EI5A 4DHEA 2P6RA 4NPAA 1R22A 3F9IA 2ODEA 1KO5A 1KI2A 2JT1A 2E5ZA 4LDZA 1B6SA 2Y9ZA 4YLEA 4Z4EA 4U7HA 4YMWA 2HSDA 1QHFA 1U7ZA 3B6KA 2V7BA 4E11A 3ABRB 4MDYA 1TI7A 4A26A 4FDUA 3CJTB 2DERA 1EDBA 1N6KA 4C3ZA 5IDQA 4H7PA 4O8ZA 2ZSKA 4AJHA 1VE7A 2HDCA 5I5EA 4OFXA 4KP7A 2N8GA 1FSFA 4X1YB 4NF2A 3GAZA 2GARA 4NI5A 1PNTA 1WG8A 2JIPA 2VKEA 1W8IA 1HC8A 1XKQA 5EJ7A 5IEBA 1QK4A 3WQHA 4GLJA 2IA0A 4ARBA 4REQB 3C39A 2DCMA 4MYTA 1O54A 4FHCA 2R7FA 4KXFB 4KXQA 3AI7A 1E2LA 3EZYA 3F6EX 4BMXA 1HE3A 2CVQA 4X3OA 1J6UA 2DP4E 1HKHA 1H6BA 2A1UA 3ZMUA 1Z4MA 3VJMA 2QSHX 3OCVA 4IHSA 3I4FA 3BJMA 4V0QA 5BO5A 4ZJYA 1HTWA 4MCJA 1DC3A 4DG5A 4YIIA 5AQ1A 1MMSA 1XI2A 2Y0EA 3HO1A 4AZ0A 4KISA 2O1WA 4BQQA 1CUDA 2YDXA 2YHIA 4IG4A 1D4FA 1T98A 1QGDA 4ZOBA 4QFDA 3AFGA 3HACA 2AI1A 3HXLA 2YZNA 3G2JA 4H3KB 3QKSA 1NMSA 4BO4A 1SCNE 1K7FB 3ESCA 4E88A 3K4KA 2G0TA 2NYUA 1S29A 1P72A 4A1FA 2BUAA 5CXQA 1RRPA 3BK7A 5LHIA 3RTGA 1Z22A 1P7PA 6ABPA 1Z8HA 2LLKA 5E9JA 1DGQA 4YECA 1LDKB 2IHJA 3K6RA 4KWHA 3B78A 1KZGB 1SA0B 3GEEA 1XROA 4OHCA 1NYTA 1QO0A 1X9IA 4I4TB 1O5OA 5A5EA 2NSLA 4EDHA 1BGXT 5DEQA 1W0JD 2F64A 2ASEA 4IDNA 5KVQA 4OCZA 4AU7A 2K85A 3B6EA 1E9DA 3D02A 1U9CA 4KWCA 2B2NA 3I1FA 4MDFA 1YVEI 3MLEA 2CYCA 3IXMA 4N7JA 2PY6A 2JFPA 2V0CA 1QVAA 2ZDQA 4ZQEA 5HS8A 4EEFG 5DK6A 2KJQA 1N0WA 4LXXA 1QBGA 2TRTA 1YBVA 3RSSA 2FUG1 1H4VB 2KLHA 4BBPA 1IM8A 4B40A 2P81A 1SC7A 5TRTA 1KDVA 3G0GA 4V24A 2EYQA 3KUUA 1F9NA 1WJBA 4DTCA 4J1TC 4WWHA 2K7ZA 3PK0A 1IB6A 2ZJPF 1GJRA 5LGNA 3Q8KA 5DWQA 4LD5A 1Q7EA 5GVSA 4IIVA 1D6JA 1QCCA 4BE1A 1J2UA 3JQGB 1DX4A 3K5PA 4KYIB 4V38A 2ISZA 4XDZA 1FA9A 2X1DA 2OSBA 1ZX1A 4Z9BA 4NONA 1FYEA 4Z54A 2HVQA 1MB0A 3FMSA 4NYIQ 1RYFA 3PUFA 1OPRA 1CUUA 1NSFA 1YE9A 2GCIA 3NEUA 3U2QA 2G67A 1CEQA 1CTQA 2OECA 3IODA 4RV4A 1Z4IA 4MYSA 1KFCB 4H7JA 2RG1A 5L7YA 3QYPA 1W96A 3M6MD 3BA6A 1D0SA 4E4TA 1G4AE 3F3SA 5JZMA 2DWUA 1MORA 3AWIA 3WADA 3LDUA 3OQOA 1HKUA 3A3KA 5EIOA 2ZBUA 5ICGA 1G2QA 2G8NA 4YAGA 8GPBA 1GV0A 3ZCTA 3Q0WA 1PZFA 5C52B 4JUBA 1BW6A 2SKCA 2R2GA 4WHMA 5EXDA 2O7NA 4M9QA 2COKA 4I4LA 3OE4A 1JDUA 4P4GA 3Q5FA 1O97D 4GU5A 4NBTA 5IBPA 4UM9B 3RJPA 2E87A 4F55A 4JQOA 2GRJA 3OQPA 4O59O 3SGLA 2HMUA 5LB4A 1CUYA 3HJCA 2ZU0C 3TSOA 5B66C 1A5JA 2ME6A 3DHEA 3DB2A 1PWXA 4IIFA 1MO5A 1DXYA 3LT0A 2P30A 3I76A 2C0PA 1Q2UA 5IFKA 1USGA 1GARA 1SU4A 4DF3A 1ZD2P 2ZT6A 4QIHA 3JQFC 3A1TA 3T4PA 3FCEA 1YONA 3H5NA 5CR9A 2QQ5A 1CUHA 5TPZA 1XVIA 3O1IC 3ESZA 4CLOB 3ND8A 3C4VA 4FNOA 5ALIA 3FM5A 5I9SA 1FFCA 4Q1CA 3S1LA 5SY4A 1LDBA 4AG6A 1QRTA 2ESHA 1CGPA 3ICPA 2BE7A 3VR5D 2CC2A 1OFGA 1G1MA 3E6DA 1V5FA 1Z7UA 1N9GA 3GJ7A 1T36A 1LDEA 5C8XA 2JCVA 3A36A 1E0AA 1NLMA 1FCJA 3S3NA 2X1LA 1Y81A 3FK7A 2XA2A 5SZHB 3NTRA 2FHSA 2KIMA 4KMUX 2FMUA 4NE7A 3QA9A 2ZROA 2GKGA 3VWBA 2EHJA 3AHFA 3I2KA 2OD2A 3EVFA 2C0CA 3TQOA 5DBEX 3A4IA 1JKXA 1B1BA 3I9JA 4HPQA 1P1RA 1OFUX 3G88A 3OESA 2C9BA 3IVMA 2JC3A 4YAOA 2OQRA 2O5EA 4Q4AA 1F0YA 2DPXA 1PSZA 1EUZA 1CNMA 1ZVQA 5EEAA 3HFSA 3R0AA 3WKCA 2MSDB 5M3BA 1MJAA 1OFVA 5HF6A 4UMVA 2ZE6A 1Z8FA 7REQA 4U2DA 2OXFA 1SQ0A 4LVOA 4MKFA 2PUWA 2BZTA 1K0UA 3WGLA 1KJZA 1RLMA 2QJRA 3JTHA 1OCEA 3T3DA 3NUQA 3FZVA 3WODF 4EJSA 1KP3A 2LYCA 3WWCA 2F5FA 4RGQA 3ON5A 2R5WA 3UK6A 4DR5B 2LF8A 5HFNA 4KZKA 1MVLA 2OP1A 1ZIYA 3OLZA 2ERYA 2V7XA 1N8NA 3TO5A 2B0JA 2P11A 2Q5JA 5TX7A 4UNIA 4JJ6A 4FUTA 1FB5A 2HBQA 3U6KA 2Z2JA 1UZMA 1YDFA 4G6TB 1PJZA 3H36A 2IQ5A 5ADVA 4BCCA 4AN4A 3CC4I 1GPJA 3Q1LA 4C5BA 1EWRA 2IEDA 3BDAA 3L7MA 1GRVA 4KTTE 3WK5A 4AWXA 2WABA 3OOYA 1MX1A 3NBMA 3QY0A 1GUYA 1L1RA 3ACDA 3TQRA 4MRMB 2QMOA 3WKDA 1CR6A 3EXEB 1MB4A 5CPBA 2V4ZA 3GRYA 2QX9A 4PZ0A 5FLYA 4YAIA 1E59A 4BX2A 2VIIA 2AZXA 5THXA 2WAMA 3GLGB 5BVGA 2DFVA 4R8VA 4E2WA 5D84A 3RJZA 4FB4A 1RYEA 1YKGA 3NVDA 5LOVA 2EHDA 3O93A 4KUHA 4WN3A 2ZE8A 4IV0A 1NDUA 4B6GA 1HX7A 1N33B 3PGXA 3BE4A 2F7SA 2DTDA 2VWQA 2WKQA 2WFMA 1JLRA 1H89C 3SKYA 4NZYA 4YIFA 1YVRA 3VYUB 1R58A 5IK2D 5BN5B 1MA3A 2VUTA 3ZJTA 5EE3A 1U90A 3KPVA 4DZJA 2IUTA 4R6WA 4NBSA 1WKVA 3DZIA 2DECA 3BD9A 2ICAA 3HCNA 5FOXA 2QYHA 4CF4A 3F5MA 4XIJA 4TLCA 1ZUHA 1LPNA 1P3DA 3M7IA 3FDZA 1SCBA 1A6QA 4I4CA 3VX4A 2DT5A 5IEJA 2OV8A 2RJOA 3PM1A 3K2QA 1VDMA 3GAAA 2FWNA 3BICA 1BIBA 3OQVA 2FSFA 2IEBA 4KDFA 3IVAA 2RGCA 4NDNE 5HK9A 2F1OA 1UP7A 1QE0A 3T7SA 1H1LA 2QNRA 2OKCA 1STZA 4UAUA 3CCSI 2PSDA 2Y76A 3DXJF 2BD0A 4IHJF 1NP7A 2CN1A 4BFSA 1AA6A 1OPXA 2GEDA 4P36A 3FB4A 1U8BA 3TXAA 1ZN7A 2BY4A 1WD5A 1PFYA 5A9SB 2J3QA 4YRNA 4LJ7A 2Z33A 4Q7LA 5KAMA 2FE4A 2PO5A 5A2GA 3EMKA 4G1UC 1MVNA 3X0DA 4FBGA 4OU5A 1VRVA 3H3XA 3O94A 4IOLA 3P19A 5AHWA 1AGYA 2WOJA 5KQRA 2HD4A 2R4GA 5IVHA 5I7UA 2QBYB 2ONCA 5GJWC 1C8VB 4ER3A 2YPRA 1G9SA 3M3HA 1TU0A 2G9QA 2W82A 1C81A 2DG2A 1PNRA 2WTAA 2XUPA 2YZKA 4TMVA 3DXXA 4P54A 4Q12A 3DV2A 3QELA 4I99C 1LDMA 1O7JA 2OTLI 3WJAA 1IN6A 1QWOA 5M3FJ 1H4SA 3LSGA 3C5EA 1JHFA 3IC7A 2R96A 4UNRA 2XAFA 2UXNA 2J3HA 2G7UA 4U8HA 1GGVA 4ZYEA 5J5CA 2O3SA 2LH9A 1FMJA 4FE7A 2V6EA 5JD6A 4WY5A 3L0PA 4YWJA 1B1AA 4EH1A 5I7AA 2IUSA 3V1MA 4QQRA 1NXVA 4PXSA 5JC8A 3Q12A 2XF7A 1QHHB 1KQNA 1P4SA 1DIOB 4GOJA 4IOKA 4HXFB 1JSZA 3JYOA 3ZLBA 5C1OA 4DR6B 3G49A 2C1EA 3H5LA 2I7TA 1J33A 3N6XA 1C3EA 2EBHX 2Q27A 5DRTA 1FY7A 1G5RA 2FWJA 5FPSA 4DMRA 2XD9A 3NU1A 1F17A 1YW8A 3OX1A 4LWQA 4PHFA 1GZ5A 4HOBA 3J7ZI 2PMKA 1JR3D 4BNYA 1HO3A 3ZDQA 3S44A 3G0BA 2EU8A 3U60B 1KY4A 1NLUA 4S1WA 3VNSA 5DNUA 3TK1A 1L5LA 3TXXA 4RY9A 2DK5A 1OTYA 3UMBA 2IHUA 1G59A 2ZZMA 4AVPA 1CQXA 2Q3BA 2VHWA 2HRQA 2IYYA 2G9RA 4KAFA 3VODA 3GJZA 4A2UA 5HM8A 1DLIA 1JJIA 3CC2I 4DLBA 2CK3A 5G40A 1QWSA 4I6ZA 2ZBQA 1X0VA 2KM1A 3D5RC 5DGCA 2OCDA 4QYTA 4XVHA 1I9GA 4HB2A 1YC2A 3M3PA 2ZYGA 2XAGA 1QGOA 2ECCA 2OESA 4WX2B 4DEXA 3C18A 1NI3A 1QF9A 3X44A 4HDNA 2X1HA 3S2YA 4FSXA 2JVGA 4A16A 1T1IA 1C8LA 3CT6A 3ZZUA 1RKUA 3VYTB 2FW1A 4CF6A 3RW9A 2JUGA 2WT4A 1T4CA 3OQ6A 2FPPB 5E8IA 3EAFA 1L4GA 3MWJA 4DLWA 2O19A 3MIIA 2HWXA 1Z63A 3FHJA 1XU7A 3RG8A 2JFXA 4BFZA 4MVWA 5EG0B 4LZAA 4JBNA 1NN0A 5BN3B 5LCXA 3H8VA 2REXB 2GNOA 4NIMA 1ACMA 3BDVA 3BZ6A 4U2EA 2DVMA 4IJMA 4YELA 4D26A 2C57A 1VCNA 1MTZA 1U2GC 4U2BA 3F8WA 1K6JA 2QEQA 5E1ZB 1JEJA 1U9IC 4EW2A 2NWQA 3Q9LA 3BWDD 2Z5UA 1FRFS 2C82A 4P7BA 4EY4A 4Q9AA 3QYAA 4CQMB 1OKKA 5KKNB 2IBMA 5LJLA 2OHIA 4KQ1A 1V39A 2NAPA 4MS1A 1E4YA 2AV6A 3AEXA 3LVFO 3QPVA 3ZZ1A 1M1YA 3DLHA 1QM5A 2XECA 1E6UA 1JHUA 4NPHA 2DMTA 1LBIA 4OI2A 4EKNB 5KINB 4MR8A 4JL6A 3ECHA 1GG8A 1BX0A 1JEQB 3LKBA 4UCWA 4BWFB 4OWRB 3HP4A 1VP3A 4GMXA 1Z33A 1D0IA 3DLIA 4US1R 3R7AA 1GCOA 1RLUA 4RPKA 2H1RA 1WMBA 4RTNA 3SZOA 1W5BA 4NH4A 1FZTA 4ID9A 3O2JA 1PZNA 2WJPA 4CODB 2H5EA 1UJ2A 2OM2A 5K3AA 2V7GA 3AP3A 3CCUI 3KXKA 4CEIA 3OZCA 1U5CA 5DUIA 5FI0B 4HEA2 2ZLBA 2QTHA 2B61A 1GQYA 3RRJA 3OJXA 4LF4B 1FJHA 2REOA 2NO0A 3HCWA 1UCFA 1N5IA 3N70A 3LWDA 1Y48E 1AUVA 1W0TA 3J81A 4CIAA 5BQTA 4PCAA 3SYLA 1GQ2A 4G5SA 1MT0A 1V2GA 2XJ9A 4FM9A 5JI6A 1GHTA 3F6RA 2LVSA 2Y4OA 2J4CA 2ZAYA 4LMRA 3CLUC 2HBZA 4OBEA 1TK3A 1NVWQ 2DMQA 4BWGA 3UYKA 5BSUA 4TTTS 1O1YA 4EYSA 3PDUA 2QTWB 3OE7D 5AM0A 1W2GA 3NCHA 4HI0E 4JYCA 1C5KA 1ZUD1 4DJEC 3IQZA 3PNLA 3W5IA 1YB1A 4DLYA 3AGPA 4JJ7A 1JG4A 4UEJA 1M2OA 2G17A 1JTXA 4JIMA 2AE2A 3ETLA 1FMFA 4EIWA 3EQLF 3WLTA 2J48A 1ACJA 1NMYA 4Y6SA 2K2QB 1RR8C 5BR1A 4I2OA 1ISHA 1RTKA 1IIBA 2BBTA 2RKWA 3K9BA 3HJEA 3COSA 4B74A 1FX1A 3ZVKA 5B3KA 1M2VB 5EJ2A 1T9CA 4PHGA 3SHFA 1P75A 3BVPA 3GNSA 4KO2S 4CZCA 4Q47A 1DKNA 4RF3A 2H1VA 4BJ1A 5DXFA 5H3LA 5EP4A 4UAGA 2OR3A 3ELYA 2PL5A 4XLAA 4O63O 1OR7C 1HOTA 1A5TA 5GADJ 2ZRJA 3AP2A 4MINA 3EXIB 5CIQA 1TF2A 3FNIA 3B3FA 3LUFA 1F1JA 3T6KA 4HP8A 5LA6B 3TX2A 2B3DA 4L9NA 2BJHA 1P7ZA 2CB0A 1PZMA 4IO0A 3HTXA 3PQ7A 1ZCBA 3HRHA 1CX9B 4E4YA 3PDJA 1FLIA 3S2GA 1SD7A 1VLQA 2YV4A 3PHGA 2PGIA 4NSNA 5A7HA 2SNIE 1XP8A 4QLBA 5LKAA 4AMZA 3NIGB 4YI3A 1MJNA 4CIYA 4F9TA 4GBGA 3FOEC 3ABSB 4EJ2A 3AEYA 1V71A 2BGKA 1PS9A 3Q3HA 2XYPA 4NBRA 2YVLA 1TVKB 1RJDA 3RS7A 3M9LA 1GPUA 5DNWA 2EARA 4P81A 5IAKA 1VSQA 1D4ZA 1VKRA 3EAQA 4PYKA 1HE5A 2UXXA 1QR2A 3H1PA 2VTDA 1GD1O 2FQQA 4ZRDA 1KDPA 3CLSC 1ESDA 2IHTA 3W2VA 2GT1A 4C3HJ 5JLXA 1Z88A 1VTNC 4J03A 1F2TB 2RMKA 1RZVA 4TVBA 3UW3A 2X4DA 1FVFA 3EIWA 3GFJA 4A0ZA 3C3YA 1R64A 1P4JA 5EJ9A 4KN6A 2VP9A 2W24A 621PA 1X1EA 1IOLA 2YYZA 3OU7A 4RFLA 1GGJA 3UB4A 1T3TA 2BGLA 1U1GA 2VJ4A 2WFZA 5FO5A 1CUEA 1NN5A 4HDOB 1AXGA 3ACCA 2BFCA 2EQAA 3PUZA 3GTOJ 1TK9A 2XHKA 1NX9A 4ZH4F 4BATA 4WNYA 5F0CA 5BYKA 3H0EA 2PBIA 2EKDA 5D5WB 4EARA 1GKIA 1WP9A 4RSGA 1JA0A 4WQMA 2C99A 4LMYA 4PGFA 2XSDC 4BU2A 1R4ZA 4M9RA 2HRDA 3RC8A 4FXPA 3K4CA 3FSGD 2Y9PB 4ER7A 4I1OA 4F9GA 5IJ9A 3MCAA 4CM6A 3BOSA 4C7OA 3CW2A 4DW6A 3G68A 2DMNA 3SR0A 5KCMA 1GQRA 4TYNA 2CXRA 2WFLA 3SC2B 1X80B 3E9NA 3FGPA 1P80A 2Q4TA 4E13A 1ZUIA 1DCTA 4LSZA 3MOSA 4P0QB 3PIDA 5C32A 1YZFA 1T9GS 4QFMA 4M3DA 4CH7A 1GAXA 1UC8A 2I65A 3D2CA 2RCYA 4F8EA 4CIWA 4P9NA 5FI1B 3F1LA 4K87A 1ZVMA 4M88A 2N1MA 2HXGA 5FTWA 2R4UA 4KO4S 3DQQA 1I10A 4LCBA 4QYIA 4OGWA 3N8NA 5BVHA 3SI7A 1QRRA 1P0PA 3L2OB 4CLRB 1JBKA 3PFYA 1L4NA 3IAAA 3LLMA 3PPIA 3PI6A 4Z0TA 2DYRH 4EBFA 3V1LA 1KY5A 5TE9A 4UTZA 5I47A 4LZNA 2BPOA 1KI4A 4W6QA 1G3IA 1Z2CA 5DHPA 4GNKA 3W1EA 1Z67A 2AA3A 4I50A 4C1BA 2Z3ZA 5AW5A 4QOFA 1KEUA 3RWMB 5CB4B 2PVPA 2WSSA 4HWGA 2BGMA 4FX5A 3OYMA 3C0KA 3RVLA 1IGNA 2RIPA 3V5NA 2HYJA 1TZ2A 5AHOA 2PTHA 2KIUA 5DLEA 4IIXA 4DYVA 1YTLA 2DDAA 3IP5A 3T99A 2YQZA 5CK5A 2HN9A 3RAGA 1UJ8A 3BIWA 1Z45A 4KW7A 3UW1A 2XRMA 3DKYA 3L7KA 1H0MA 3G2PA 1ENYA 1L7AA 3T9DA 4ZU3A 4P0TA 2P0WA 5BOSA 1U8CB 1WB5A 2EV9A 4JYZA 2ODTX 1USUA 2FOWA 4PV7A 1MZPA 4DPKA 4CTNA 3LQRA 1J0XO 4XVUA 2A9PA 1VI0A 3WIEA 4ZAWA 4M22A 3GJ0A 3CW9A 4MTLA 1XDWA 1WTAA 2ZI9A 3P32A 3MMPA 4DADA 5IC4A 4XPIA 1P5RA 2H5JA 4K9SA 2FF5A 1TA9A 4Y17A 3X1WA 2H94A 3TG2A 3NQOA 2XNCA 3I39X 1BS1A 4RH3A 1OLUA 2R7ZJ 2IS1A 1J8YF 3NKFA 3K09A 4JODA 2JD1A 3ICQB 2YWJA 2A6HF 4LC1A 3THWA 3DZBA 3H9GA 1E96A 5TSDA 2O7QA 5GPCA 2EIHA 4L5JA 4NENA 4UDOA 5IKXA 4JJGA 3G6WA 1DS6A 1X7ZA 4D46A 4BMCA 2VYVA 5ILOA 1DZ3A 4D6PA 2QX6A 5LLSA 2CL7X 1BEUB 1A76A 3NWJA 1TZJA 5LQJA 4I9GA 4CRWB 1FNDA 4EG6A 1UMBA 4PXYA 2F4IA 4RSRA 4L3OA 2QTVB 4YFKF 1WUJS 3HI6A 1OQAA 4G8BA 5C35A 3RROA 2QQFA 2GXSA 3PQ6A 3BH0A 4XR6A 3RAEC 3RIYA 4HN2A 3FNRA 4M1WA 5L3QB 3ZY6A 3BWVA 2GJ4A 2LC2A 4OQFA 4RGBA 1JG6A 3KYJB 4XAQA 1FQOA 3EVGA 3RLFA 1D4AA 4M0PA 5JS2A 2ZIEA 5FKKA 3CY6A 3W7AA 3HABA 5AIAA 4ZICA 1TJPB 4DBVO 1LS6A 1H4QA 4OD0A 2QUAA 3JATA 2RGXA 1PUIA 1U5TA 2C78A 4MRRA 4JENA 5IW8A 1G8AA 1NE7A 5DHTA 1WXXA 3DU5A 2P7VB 2ZSHB 2JVIA 5KTTA 2OG2A 1QHIA 2G0AA 4HMOA 2R97A 2HAEA 1UZAA 1G2HA 1NT2A 2CXHA 3A9VA 4F97A 4YMSA 5KQGA 1Y82A 4D82A 4O4HB 1OLSB 4JASB 5KAFC 1XZ8A 2P6PA 3LKVA 2OT3B 3R41A 2D74A 1UELB 2CW7A 1J22A 4ZXFA 2FW0A 3LPDA 3KG2A 5BPFA 2J5KA 3URKA 1X8LA 3E23A 3V46A 1H69A 1TYDE 4I5IA 1FJLA 1ZESA 3OZWA 2XKAA 2FR0A 3CE6A 3LHIA 3VOTA 3VPHA 3W2EA 1N1MA 4KI7A 4E7HA 1QIMA 1RLIA 4Q39A 4H7KA 3P0JA 3CSSA 3VX3A 1XLTC 3GELA 4ZDOA 1J2EA 1I2BA 1SAYA 3RFVA 4BBZA 5ALXA 2X4IA 3NFRA 3GL9A 3RTCA 5IUKC 5C3MA 1FF9A 1ZIPA 1TKCA 1YWGO 3IPYA 3C7TA 4F3CA 5ALLA 3FKIJ 3HBFA 3PUKA 1B43A 4ZKEA 5AIQA 1PYVA 1IC6A 2WPDA 2YIMA 1V26A 3E9ZA 1ZKMA 4HTAA 4OLJA 1NHGA 3P2YA 1SD5A 1GXPA 3LXRA 2Q3EA 2JAWA 1YS6A 5D5PA 1M10A 2MLGA 4PSDA 1YHZA 4JLKA 3IJRA 3IJPA 4XUGB 4ZYUA 1YW7A 2BP7B 1X3UA 4XD2A 2MLKA 5HILA 1ENHA 4RS3A 1LD3A 4GX1A 5DNEA 3RT7A 2N3ZA 1KAMA 2QQ0A 1BKDR 4WBNF 1H66A 1SBIA 3LBYA 5ERYA 2VBGA 4HV4A 2E7XA 3IAFA 5TT0A 1SKBA 5J4VA 1NVEA 2DU8A 3CF0A 5JVDA 3VKHA 3HKZA 5C8ZA 3M8FA 1OIXA 3ZE7A 4QUBA 4NOJA 1WXFA 3CHYA 3L7WA 1UM8A 3IQEA 4EPRA 1L4KA 1G8MA 2EIJH 1CFZA 3WQRA 4CKEA 2Z57A 1L5RA 1OX4B 2OFWA 2OZKA 3W2FA 1RAIA 2PUVA 3ZUPA 2XGOA 5JAOA 2QZZA 1T9BA 5CNIA 1K83J 1QGAA 4I1YA 3S2UA 4HAZA 3OCWA 4Z51A 1XYVA 1GUUA 5EZSA 3RKRA 3MMZA 1GG2A 3ZW8A 2O3FA 3W4KA 3TEJA 3Q0IA 2FDXA 3ECAA 2DI3A 5IPAA 4NAVA 4DTIA 1J8QA 4Z4FA 1PI3A 3AF3A 4DA6A 3STWA 1LQUA 2FI1A 2DETA 2IY8A 4R16A 1KJJA 3D59A 5HDQA 2JBHA 1XXHB 2QL6A 1RPZA 1R6UA 2YOFA 4KQ9A 1EA7A 5K20A 3IUSA 4ZCLA 5GQSA 1QP7A 5DVZA 3HU5A 2CJWB 1JECA 5AXCA 1Y7LA 3WV4A 3A6EA 4Y0VA 1EBFA 3KQMA 3JR3A 4L8WB 3TLYA 1ZR4A 1YQAA 2P41A 2EG5A 2EFGA 1FUEA 3PUYA 4CM5A 2QX8A 4V0OA 3TBIA 3HSSA 2X6OA 3G1WA 3RUFA 4QLCU 1DEKA 3P9SA 4UATA 1WHTA 5A03A 1X4OA 3KP4A 3UNGC 3QI7A 1PHRA 3FPHA 3LHDA 1K4SA 3OEEA 1JNYA 3FNQA 1E2QA 4HOYA 4XGNA 3L6CA 2V1XA 3GI1A 3NTQA 5CPFA 1II8A 1QGZA 1F7VA 1E2MA 4ZQHA 2QRJA 5LSAA 2FGKA 4RPGA 4EEZA 2P7CB 3P71T 4K9OA 2L2OA 2DH6A 1UPCA 4AY5A 4WH0A 3D0QA 5L3BA 3TH5A 3CUEF 1DDNA 1ECGA 3CN7A 2R7AA 1K7EB 3WQSB 5GPAA 5AJUA 3HPRA 4EITA 5KX5F 5C5EA 5JISA 4WZBA 2JCBA 2FR1A 2GK6A 1W6UA 2REQB 1K9SA 4WXEA 1KPGA 1L7EA 4J6EA 2GVDC 2GHRA 4NBNA 4OQYA 1J8VA 5DWDA 5CB8A 1W94A 3Q0VA 1OHHA 3C1UA 2P77A 3P5JA 1XS9A 2Q9BA 1O03A 3NM6B 5F7ZA 2J7PD 4BNTA 1U9JA 1I7LA 5DO9A 1RPTA 4AZWA 4NV0A 2BCEA 3HEMA 2ZJ8A 2YICA 3AK4A 2XKJE 5FWYB 2PZKA 2ZATA 2VNSA 3FXMA 2GXQA 2P6OA 2YYAA 5J8FA 1NZDA 2JZYA 1Y5IA 1IHXA 2DSTA 3HA7A 4F2DA 1EKXA 3DTVD 2FEWB 1EGVB 3C6ZA 2DKNA 4YQZA 2Y66A 2C7QA 2PVCA 2E71A 4EJFA 2CFXA 1WOYA 4EKIA 1I3KA 5DE3A 3ZD9A 5HFAA 2I0FA 2J9GA 4B4KA 3CH7A 3GWZA 2O2CA 3QVMA 1MX3A 4HEA1 4C0JA 3D8UA 1SBQA 5JAMA 4XVQA 3A10A 3E8MA 5CLQA 4YUZA 4AUMA 3KFXA 1X7XB 3G2NA 4M86A 3T8TA 4YUYA 2CMKA 3I0ZA 1JEAA 4F1JA 1EFUA 4EHFA 4EJ6A 4NQWB 4EATA 4YUAA 3FM3A 1AY0A 1YCDA 5KNLA 3I2GA 3IAM1 2GZAA 4QAQA 3RJMA 1VIMA 5DMXA 1IG7A 4RCYA 1GADO 1JFSA 4I02A 3JY6A 3PXAA 2ZUTA 1I3NA 2E34A 3PS9A 2XUQA 1M6EX 4YT8A 4EGCB 2C03A 3HZJA 2XMCA 1EUDA 4J3JA 1C3XA 3DXFA 5EJAA 1IJBA 3BHIA 3K0FB 4KFUA 4KFRA 1CUCA 4UASA 3O84A 1YO5C 2Z9DA 5E9QA 5FTJA 1KA8A 2W8ZA 5DYWA 3PPYA 4HWKA 1T3HA 1JAYA 2CFOA 1ECFA 3BR2A 1Q1ZA 3MSCA 4ILEA 1UAGA 4Q21A 3WL8A 1S4MA 3E35A 1PT8A 4A3IJ 1JRLA 2W6QA 1AKUA 3JARB 3L6EA 2FEMA 3FXLA 5LIRA 2FZVA 1L5YA 3BROA 5CTJA 4TSKA 3E0QA 2DWCA 3DD5A 3OZDA 2DA3A 4L5IA 3S6JA 5KNCD 1II9A 4IDAA 1UJ4A 2OHFA 4N40A 5KQMA 5CNJA 2H3HA 1V16A 4KIUA 4F7WA 4B85A 3WRYC 4L4RA 3PC6A 3W5CA 3EDPA 1EK0A 4MQUA 5IOZA 1QK3A 5HP4A 1N2CA 4RETA 1E6CA 1FYMA 3IEIA 4IDPA 4UHEA 1LQ1A 4B09A 1AS2A 2CUTA 4GKBA 1W46A 3EJ6A 3S68A 2ZXHA 2CQXA 2ADOA 4A8PA 2Z95A 5HLGA 1XVLA 3LDHA 3QE9Y 3GUVA 2AG6A 3YASA 3U7GA 4DCCA 2R6ZA 1IEQA 3DDHA 1DIBA 1T0FC 5DHFA 4ZPXA 1B3RA 3X1ZA 5ICCA 1KRXA 3ZBUA 5DXAA 2QTTA 2JF0A 1MABA 1ZLJA 2WWIA 4E0BA 4N5MA 1NP3A 1PNOA 3DCIA 4J0HA 2BGNA 4WKPA 5ICFA 4Q1VA 3C14C 4TM8A 4H6VA 4AS2A 2UZ3A 5KU1A 5CEJA 4G86A 4IY1A 4RB0A 1QZYA 1EH8A 3DDZX 3LVBA 2YXLA 2P2YA 3VR4D 3KQNA 4G8JA 3B6IA 4NX2A 4ZRNA 1GN9A 1OH5A 2JGIA 4CHUA 2B1RA 5ALOA 2X0NA 4L76A 1WY7A 2MSYA 3O3MB 2OCCH 3WGGA 4XGKA 3W6NA 3EXFA 2CMPA 5GIPE 1RJGA 1UMQA 3PUHA 3OPYA 4HA8A 3O1LA 9ATCA 5BYBA 1VRCA 5CAEA 5BPIA 5BYAA 3S8YA 5BR8B 3GTMJ 1H2EA 5JSZB 2G80A 5FA5A 3DAGA 2QQGA 1BHJA 4IZOA 1SO8A 3PEFA 1KXZA 3NBYC 3E58A 3D6VA 2QM7A 1M6VA 1QH1A 3O4JA 3CVYA 4XM3A 3DWIA 2KT0A 3D3KA 1HZZA 3EEQA 1N6IA 3BG9A 1KDRA 4MXDA 2FFQA 5EIFA 1KZ9A 1CUIA 3IE0A 4LRUA 3UT5A 2BE9A 2GN4A 2P1ZA 2QE7D 4LY0A 1S6LA 2ZCVA 2ZQYA 2A33A 2D00A 3R76A 3HGTA 1DAPA 1B8PA 2O61A 3PNSA 2FX5A 5BURA 4Y6RA 1XMPA 1L4YA 4UJ3A 2YQ5A 3TJRA 4KDCA 4RDCA 4Q93A 2KYRA 1KDTA 4MUFA 1EFLA 3CNBA 1PJ3A 2YU9J 1I4LD 4O4JB 4BMZA 4RK1A 4I1PA 2HQSA 4CM8B 1BIFA 3OOJA 4CV3A 3B82A 3L7JA 3EZGA 4A0GA 2VK4A 1G2PA 5ERGB 4XASA 1XMVA 2FX0A 2BLNA 2QLJA 5ALYA 5GZ6A 5G2OA 3LBFA 4NU6A 1XL1A 1CU1A 2J3JA 3PO3J 3SZMA 3QTLA 2D1HA 3Q5DA 4LSWA 4LY6A 5KVRA 3STYA 1UQTA 3O8LA 1JKJB 3H87A 4EM2A 4LYJA 5KKAA 4ZTBA 2ZRDA 2Q5HA 1DDIA 4Z1MA 1M0TA 1EWYA 3RAPR 3LQYA 4GNRA 2JDIA 1TJ5A 4R2WA 2EFHB 1IE3A 2OP0A 3HZZA 4HVCA 3GQBB 2WOOA 3O5AA 3L4BC 4E5UA 3P5SA 5IDVA 5HDGA 1ORTA 4J07A 6ADHA 2NIPA 1MOSA 5IP9J 4OQLA 3AJ9A 3TL6A 3ZCUA 4LG0B 2O07A 1V6SA 3AY3A 1FSSA 1SOAA 3C4JA 3IYLW 4U7JA 1SHLA 1RLJA 5K01A 2Y1CA 2A3RA 3QRWA 4U2CA 1QR6A 1TAGA 1OXVA 3TR6A 2HPHA 3AHGA 2RHRA 3G2IA 2ZO4A 5EIWA 5U4QA