3C4MA

Structure of human parathyroid hormone in complex with the extracellular domain of its g-protein-coupled receptor (pth1r)
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
519
structure length
469
Chain Sequence
AKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFDDVMTKEEQIFLLHRAQAQCEKRLKEVRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion protein of Maltose-binding periplasmic protein and Pa
publication title Molecular recognition of parathyroid hormone by its G protein-coupled receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 154
structure length 469
sequence length 519
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF02793 HRM Hormone receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3c4mA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3c4mA01
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 3c4mA03
1YTVA 2Y84A 3VDFA 5FHMA 5IAIA 4THIA 3UORA 3FV1A 2HAUA 3C34A 4JXIA 1MS7A 4XKNA 4ZDMA 4JDFA 4YMAA 3QYTA 4OZ9A 2AL4A 2R6GE 1B51A 3KOTA 3MVWA 2Z23A 4U1OA 3O6HA 5CM6A 3KSXA 1MY1A 1B2HA 4H8JA 1EZOA 4ZEKA 1UTBB 2ZMBA 1IXCA 2ZYKA 2NVUB 3GZGA 4HS7A 4OXVA 4OFOA 3KJ7A 4YZZA 1P1NA 5K2XA 2YJPA 2QMXA 3VLUA 1M5DA 3O9PA 1S7YA 3Q25A 5TP9B 2Y7WA 1PB9A 2QRYA 1KWHA 3OO7A 3RGYA 3CI8A 4KFQA 5TU0A 4LVQA 4LQ5A 3VXBA 4ESXA 1D9YA 2F7BA 3UGWA 3C33A 4EQ9A 3DLNA 1BP5A 1LCTA 2F7AA 1QUIA 3K6UA 4Q0CA 3PMXA 4Q30B 3V5AA 5KCJB 5JTYB 4RYAA 3RT8A 4EUOA 1LSTA 5JEIA 1I6BA 5LOMA 3ECRA 5JK4A 4R6KA 3UN6A 4G68B 1N7XA 2IEEA 2AIXA 2I58A 3MWBA 4WXJA 3K4UA 3TZAA 1IZ1A 3FZVA 2UYFA 3Q29A 2QJEA 2OBGA 1XOCA 1B5JA 3EHUA 3PGFA 1BIYA 4RK9A 2V3UA 4QSEA 3K6VA 1BKAA 5DEXB 5AE4A 2O6AA 4PFUA 1IXGA 4POXA 3TMGA 3SETA 5A5XB 1D4NA 3RN8A 3K02A 4NF8A 3OD7A 2ZNSA 2PMSA 3S9NC 3A3CA 2X7PA 1FQDA 3OEKA 1SW4A 3PPQA 1SI0A 1SQYA 1A7LA 3K00A 1Y20A 3LSLA 3FJGA 3U92A 2D21A 4E0WA 5I59A 4OFLA 1USYE 2A5TA 1B1HA 1US5A 4OEVA 4LATA 3TYHA 1UIVA 1HSLA 3U1OA 4X1DA 2F34A 2XXIA 2THIA 3EQ1A 2HZLA 1SW2A 2R71A 1ATGA 2AYSA 2F36A 1XHYA 3PMVA 3TTKA 2O84X 4TLMB 4KYEA 2QSXA 3K1NA 2P1SA 2HAVA 4BDRA 4C1TA 3T9HB 1FW0A 3GXAA 2QS4A 4IGTA 3U93A 2FNCA 3VVDA 2OWTA 1O7TA 1OLCA 1ZJLA 2Q2AA 4JSOA 3C31A 2RC8A 4MLVA 4GL0A 4QFPA 2E1SA 1LGBC 2DE3A 4BDQA 4MH5A 2I3VA 1ZBMA 3HN0A 5I2KB 1DPEA 3LR1A 4PFYA 3OSRA 1NNPA 1SYIA 1VFEA 4ZEDA 3N7PA 2UVIA 1MXZA 3FVGA 1USYH 5EHMA 1YAEA 1JQFA 1NNFA 2ONKE 2YLNA 1EH3A 3TQLA 3ZKKA 2GHAA 5H8HA 3G3GA 2HQ0A 4QFLA 1LBBA 4I62A 3DP8A 4FIMA 4BDOA 2O69A 1Q1KA 1MQIA 2REGA 4KYSA 4BDMA 1FQFA 1QKAA 4F31B 1IEJA 3T66A 4F3GA 3FUZA 1LAXA 5F7VA 1TT1A 3TTNA 3E13X 4WEDA 4K3FA 1LCFA 5H8QB 1AIVA 3R6UA 3FVNA 3H03A 1SBPA 1B3GA 1NH7A 1B7HA 1ZTYA 3DP6A 1H43A 4F3BA 4PFWA 2DWIA 2XHDA 1B4ZA 2Q88A 3V8XB 2I49A 3IB1A 2UXAA 3UA8A 4G77A 4C0RA 3EN3A 5DVFA 4GXSB 4OWDA 4DXUA 3T9VA 4LUBA 4I1DA 2X26A 1FQEA 3SEYA 1URDA 3OO6A 4QHQA 5CI5A 1NNTA 3IJOB 4NF4A 4EQBA 3DP4A 1URGA 4LONB 3P7IA 2DWJA 3SEXA 3HCQA 5I57A 3G7WA 3SDFA 4GFRA 2F97A 3KZGA 4NWDA 1MG1A 2Q89A 3CFZA 4G8NA 5AA4B 3TCHA 2XX8A 1JVYA 2RCBA 1OQGA 3C9HA 4YICA 1M5BA 1DPPA 3G3KA 3A09A 4GOTA 2YPNA 1O64A 1NH8A 1JW5A 2DE2A 2P0SA 2H4IA 4NF5B 1JVXA 5AA2D 3BBRA 1A8FA 2XXYA 2ZYOA 3VVEA 2ONRA 3USDA 4Q8RA 1I6AA 3K01A 3U94A 4F2QA 3D4CA 4OESA 4H67A 4H0WA 3ZKLA 1S9TA 1B40A 2CMOA 2W7YA 1H44A 4ELOA 1A8EA 1JW4A 5HM4B 2BJJX 2FA7A 3TAJA 3PU5A 2V25A 1RKMA 3LSXA 4ISUA 1LFGA 1P1WA 3LBSA 4HCWA 1PEBA 3HHFA 3O97A 5DVIA 4ECFA 4OQOA 1QKBA 4ZS9A 3CFXA 2PVUA 2XXRA 3PPPA 2NOOA 3K1MA 2HXWA 2QKHA 1JEUA 3L2JA 4FORA 3RTWB 2PT2A 3O6GA 2Y7PA 2ZNTA 3LSFB 3IOLA 3O29A 4P0IA 3S4UA 1UTBA 1MY3A 4UA8A 3THIA 4JSDA 1R1NA 2UVHA 5DT6A 1ZLQA 3I5OA 2DWAA 2QL3A 2H98A 5J1DA 3S2VA 4X9TA 2PYYA 3AQFB 1MPDA 3QK6A 1M5FA 2UYEA 2NXOA 4LF3C 2XXQA 2F7CA 4P0GA 1UTHB 1GGGA 3JYRA 2XXXA 4DE8A 1N76A 4IY6A 1AL3A 1MY0A 1I69A 2Q8JA 3TTLA 4U21A 4RPOA 4EF2A 1DMBA 2Y7KA 3H6TA 3IORA 3H3GA 3G3FA 4HCYA 1B05A 3IB0A 5JTYA 1MXWA 1XT8A 4NTLA 5H8FB 3VVFA 3KFMA 4AB5A 2G93A 3MPKA 4G68A 3U8QA 2H9BA 1B52A 2XXVA 3TDJA 4F1UA 4GF8A 4QFKA 3N26A 1R6ZA 5BUUA 2H5YA 1MM7A 5AA1A 3OOAA 4XKRA 4F3PA 1EU8A 1AMFA 5DEXA 4C1UA 3FVOA 1LBCA 1MDP1 1LAHE 4FAJA 2X7QA 1T0KA 4AQ4A 3FV2A 2XX9A 1HSEA 4ONYA 1Y3PA 2O7UA 3N94A 5CRYA 1MXUA 5A5XA 3TCFA 1FTMA 1M5CA 4XTCQ 1B3EA 4DXCA 4OERA 1MY4A 4KHZE 1OLAA 1NMUA 1BTJA 1Y9UA 4GL8A 5TPAA 2VD3A 5DTBA 3G3IA 3G3HA 3MP1A 2G29A 4NE4A 1I6QA 4UACA 1YPNA 3C35A 2R9JA 3I3VA 4LQ2A 1PDAA 2LAOA 4XXUA 1LB9A 5CMKA 3FD3A 2XX7A 4DLQA 1MH4A 4NF6A 3M8UA 2GH9A 3KSJA 5ICTA 3OMBA 5K2YA 4XIGQ 3FIRA 3H06B 2OJTA 2RF1A 4N13A 2L27A 3ODBA 1NKXA 1A55A 3Q26A 1J1NA 1MQHA 1SW1A 5FHNA 4HJ0A 5H8NB 2ZXTA 2Q9TA 2F6PA 2Z22A 2Z8EA 4JBZA 2CZLA 3MZ1A 1B0HA 3PPOA 4ZZAA 4AB6A 3MW0A 5L9SA 3V89B 2HFBA 2ANJA 3B6WA 4RXLA 4U1ZA 3RNNA 5I2KA 4RA1A 3ILTB 3K2DA 1TFAA 2I6EA 4OVJA 2XXUA 4EXKA 2GFEA 1ZKBA 3VXCA 2A5TB 5ICQA 3DELB 1QUJA 4IY5A 2I0BA 5EHSA 4O3AA 1OIBA 5ISUA 1WVJA 3FASA 4PQJA 4N07A 3N7SA 1MDQA 1A40A 3FJMA 2RINA 1SYHA 4KQPA 3KBRA 3LUYA 1B7UA 1NNKA 4R2FA 4KI0E 4H65A 1UIUA 3N6UA 4EXLA 5FHOA 3F11A 4R6YA 4PETA 2REJA 4G8MA 3MQ9A 1FTOA 2DE4A 2RKMA 2O51A 2XXHA 4R6HA 3QAXA 3VFJA 2F35A 3IAZA 1VE4A 1RYXA 2DVZA 1MXYA 1SI1A 3L6HA 4GIZA 3W9WA 3PV0E 3GBAA 3MP8A 2I4CA 2DXYA 4F22A 4ZGMA 4WKMA 2UVGA 3BKIB 3CIJA 5AA2B 5II0A 3SEUA 4PP0A 1AOVA 5H8QA 1S50A 1L5TA 4IO2A 2V93A 3CG1A 4U22A 4WEPA 3VV5A 3MVXA 4TQUQ 4XKQA 1O63A 2ONSA 1VR5A 3RLFE 3Q27A 3KOSA 2HCAA 5CBSA 1N0TA 3TELA 4QFNA 2DXRA 2XXPA 1N3WA 3CFLA 1LB8A 4HTGA 3IOTA 3MP6A 2QPQA 5L9MA 4LZ8A 3VLWA 3HV1A 4FECA 4RJZA 2DYXA 1IXIA 3QIMA 2ABHA 4MFIA 1ZIUA 2DS9A 1POY1 4PE5B 4Q5TA 3PUWE 1ELJA 1JW1A 4KCCA 2VP1A 4U23A 2I3WA 5AA4A 3MAMA 4QSCA 1MQGA 1FTKA 4ZEBA 1SD3A 1YCJA 2ZNUA 4DCYA 1OQHA 3HSTA 3TCGA 3N6TA 1IIWA 1LAGE 5DVJA 4EQ7A 2VHAA 1Y3NA 4U2RA 1N84A 3T22A 3IJXB 3TODA 2RCAA 3HHGA 1EZ9A 2D3IA 2H99A 2DVCA 3N5LA 2F8DA 4F39A 4E0XA 5CBRA 1B4HA 3BFTA 1SVXB 4ZEFA 4F2OA 4ESWA 3MZBA 4RPNA 1FQAA 4ELRA 4KR5A 2XXWA 4M1VA 4I9DA 1CE2A 1LLSA 3TQWA 1PBPA 2XXTA 3KG2A 3T96B 1VFDA 3RY3A 3RT6B 5I56A 1OVTA 4KD5A 1B3FA 4QF9A 5I57B 2DOJA 3OSQA 1Y4CA 3LC8A 5BWJA 1B0LA 3CG3A 1Y1ZA 2D5WA 4MBPA 3K6XA 2XD2A 3SERA 4M4GA 4LP2B 4GLIA 2B3BA 1PB7A 3SESA 4H8IA 4KCDA 2ALUA 1B3LA 3OELA 2Y7IA 2NWJA 3E3KA 1DOTA 4F1VA 2DP8A 3JV9A 4GVOA 2JODA 2Q2CA 3HO7A 3C59A 3IB2A 4YMBA 3IO6A 2OWSA 5F1QA 1PC3A 3CSBA 5KDTB 3I6VA 4H5FA 4IO6A 4GWOA 4QFOA 1B3HA 4IO4A 4NMYA 1TXFA 4OETA 1D3KA 4JB7A 4G4PA 4O3BA 4G2ZA 2P2AA 4R9GA 4BLAA 1FQBA 4DCXA 3WAEA 3EHTA 4GXAA 5I2NB 5L9OA 3CVGA 3O2AA 4OENA 5I58B 1GTKA 2V3QA 4IO5A 3KEIA 5ITOA 1MQDA 4OTEA 1UTHA 3FXUA 4H5GA 2XD3A 3EPEA 2ESNA 3H6WA 4U4SA 3IL1B 2VOZA 3PUYE 1WODA 1NFTA 4ELPA 2I0CA 3PUXE 1GVCA 1H76A 4JWYA 1OMPA 2I48A 3FXRA 5TP9A 1SDXA 1IXHA 4KYDA 1POTA 3SEVA 5H8FA 1JETA 3M3KA 1PB8A 4JWXA 3TUSA 3VE1B 1QULA 2VGQA 5CMBA 3O66A 4GD5A 1QVSA 3CR9A 4F29A 4LA9A 4OHNA 3FATA 4DDDA 3FXQA 5CC2A 3T9UA 4YAHX 3OENA 2M8CA 4MF3A 4F1YA 2F5XA 3FGSA 1ANFA 5KCJA 1MPCA 3Q28A 3A3UA 5EYFA 3C4MA 4NEDA 4O3CA 4FE8A 1Y3QA 3LSWA 2OLBA 4Z0IA 2IA4A 5ELVA 1FQCA 3PPNA 2OCUA 2PBWA 3QSLA 4IB2A 3TTRA 1N04A 3TKDA 2DQVA 3OO8A 1H45A 1JNFA 4H6DA 3H6VA 2UVJA 3OO9A 2F6GA 4BDLA 1UQWA 1QW0A 4YU0A 3IX1A 1NL5A 3S9EA 4NWCA 1Z7ME 3EF7A 4KPTA 1QJMA 4QRZA 4F18A 1LFHA 3OXNA 4OEUA 4L17A 4R73A 4IGRA 1B5HA 1FCKA 1VSOA 3TEPA 3S9LC 5HPQA 1B7ZA 3MVZA 4ZE8A 4F19A 3MVYA 3C36A 2PT1A 1XVYA 3SEWA 3BFUA 1H3DA 3PPRA 2F78A 1P99A 1MQJA 1N7WA 1AH5A 5H8NA 4GQOA 2WKYA 3EHSA 4I8CA 2OK2A 4TLLB 2RC7A 1A99A 4ZZEA 3QUJA 1M5EA 3MBPA 3M3FA 3RUMA 5TPAB 3QUFA 1R9LA 4YKPA 4YKJA 1TFDA 2ZYMA 4YKKA 2AL5A 2DWHA 3MC2A 2QS1A 4NF8B 4ZEIA 4R75A 3PD8A 2H25A 3MUQA 4GRKA 2O7IA 1N3XA 1XS5A 5AA3A 3FVKA 2GHBA 3IK6B 3G3JA 4NF6B 1MH3A 1XC1A 1DTGA 4R2BA 4DIGA 4Z7EA 4R72A 1II5A 3C32A 3O28A 3IOUA 5H8SA 4ZE9A 5B70A 3O6IA 2XDGA 3FJ7A 5I59B 1FTLA 3KN7A 4P11A 3ZS6A 4XKPA 3E4RA 1QUKA 4IO3A 4JWOA 2DSFA 1SW5A 3SKPA 4RK2A 4OFJA 3ZSFA 4FATA 1GV8A 3B6QA 4G68C 3L6GA 4ELQA 3B7DA 1WDNA 4POWA 4YB6A 3PUVE 1MPBA 3U72A 1ZU0A 3GLBA 4MLQA 1B9JA 4TOZA 4U4XA 5DYHA 1Z7NE 4BDNA 5AA2A 3HPIA 3MPLA 5KZTA 1FTJA 1IQ7A 4ZECA 4R74A 1B5IA 3R7XA 4X48A 3W15C 3K6WA 3H4ZA 3IOVA 1OVBA 4FEDA 4FJPA 5FTIA 3E9XA 3PMWA 1P1QA 1ZMGA 4DLDA 5IKBA 2JNCA 3GBBA 4X1BA 4QSDA 3S9MC 1D9VA 5I84A 3WAFA 3DM0A 1U34A 2I4BA 1Q35A 3C5TA 4EF1A 3ONMA 3MJNA 1URSA 1P1UA 3M3LA 5H8HB 1DSNA 2FYIA 3N7RA 3UP9A 3D4GA 3KGCA 2O1LA 3KN8A 4DZ1A 2HZKA 1B6HA 1P1OA 3R26A 4ND9A 5ITPA 2O68A 4PFTA 1IUDA 4F3SA 3VLVA 1PBQA 3V83A 2B3FA 1TWYA 5CMMA 1MXXA 2QS3A 1XVXA 4H1XA 2E0SA 2RC9A 1MRPA 2V3TA 3IO4A 1B32A 1LFIA 4G8HA 5HBCA 2OZZA 4OYVA 1B58A 3UK4A 4R9FA 2Y7RA 1R9QA 3RQTA 1B1XA 2ZYNA 4EDPA 2B65A 1F9BA 3RTFB 3K0VA 4HW8A 5M2VA 3H7MA 3CSGA 4YKIA 2HEUA 5L8DA 4NF5A 4N6PA 3CRBA 4FEBA 1MY2A 2JNDA 1Y1MA 2GRVA 4YB5A 1DTZA 1IITA 3ILUB 4RNSA 1MM6A 3T9XB 5FTHA 3OEMA 3AXFA 3W9VA 3H6UA 3IR1A 2Z8FA 4NF4B 1MXVA 4IO7A 4DXBA 3KJTA 4LZ7A 1CB6A 2V84A 4YB7A 3K1PA 3MZ9A 3IOWA 3KN3A 4ERSA 3T93B 2QMWA 3PD9A 1LAFE 4RY1A 4LZ5A 2KLFA 1JEVA 1EZPA 5KDTA 1HSJA 3TFLA 3TPAA 1BLFA 3QXMA 1RYOA 3B6TA 2O1MA 3UIFA 2VD2A 3TTMA 5I56B 3JZJA 3RPWA 1GR2A 2PX1A 1B46A 5I2NA 3PUZE 1A54A 1Y4TA 2NUVA 5I58A 5CMCA 2QS2A 2A5SA 5B7DA 4OMBA 4DLOA 2Z8DA 1US4A
chains in the Genus database with same CATH superfamily
2MKZA 1YTVA 4OANA 2Y84A 3VDFA 5FHMA 5IAIA 4THIA 4O8MA 3FV1A 3UORA 2HAUA 3C34A 4JXIA 1MS7A 4XKNA 4ZDMA 4JDFA 4YMAA 3QYTA 4OZ9A 2AL4A 4I3EA 2R6GE 1B51A 3KOTA 3MVWA 2Z23A 4U1OA 3O6HA 5CM6A 3KSXA 1EYKA 1MY1A 1IMEA 1B2HA 4H8JA 4JVIA 1LBZA 1EZOA 1QGXA 4ZEKA 1UTBB 3BIHA 4OVRA 2ZMBA 1IXCA 2ZYKA 2NVUB 3GZGA 4HS7A 4OXVA 4OFOA 3KJ7A 4N17A 2WEFA 4PF8A 1K9ZA 4YZZA 1P1NA 5K2XA 4PC9A 2YJPA 2QMXA 4PE3A 3VLUA 1M5DA 3O9PA 1S7YA 3SZPA 3Q25A 5FBPA 5TP9B 2Y7WA 3GYYA 1PB9A 4MNPA 2QRYA 1KWHA 3OO7A 4GBVA 4AS5A 3RGYA 4PFRA 3CI8A 4KFQA 5TU0A 4LVQA 4LQ5A 3VXBA 4ESXA 1D9YA 2F7BA 3UGWA 3C33A 4EQ9A 3DLNA 1BP5A 1LCTA 2F7AA 1QUIA 1FJ6A 3K6UA 4Q0CA 3PMXA 4Q30B 3V5AA 2XA5A 5KCJB 5JTYB 4RYAA 3RT8A 4EUOA 1LSTA 5JEIA 1I6BA 5LOMA 3ECRA 5JK4A 4R6KA 3UN6A 4G68B 1N7XA 2IEEA 2AIXA 2I58A 3MWBA 4DI4B 4WXJA 3K4UA 3TZAA 1IZ1A 3FZVA 2UYFA 3Q29A 1FBCA 2QJEA 2OBGA 1XOCA 1B5JA 3EHUA 3PGFA 1BIYA 4RK9A 2V3UA 4QSEA 3K6VA 1BKAA 5DEXB 5AE4A 2O6AA 3A29A 4PFUA 4NN3A 1IXGA 2Q74A 4POXA 3TMGA 3SETA 5A5XB 1D4NA 3RN8A 3K02A 4NF8A 3OD7A 2ZNSA 2PMSA 3S9NC 3A3CA 2X7PA 1FQDA 1NUWA 3OEKA 1SW4A 3PPQA 1SI0A 1SQYA 1A7LA 3K00A 1Y20A 1NV1A 4HXVA 4HE2A 4JVDA 3LSLA 2QFLA 3FJGA 3U92A 4PDHA 2D21A 4E0WA 5I59A 4OFLA 1USYE 2A5TA 1B1HA 5EQ8A 2B4MA 1US5A 1KA0A 4OEVA 3EKIA 4LATA 3TYHA 1UIVA 4GBWA 1HSLA 3U1OA 1NUYA 4X1DA 2F34A 2XXIA 2THIA 3EQ1A 3B8BA 2HZLA 4XEQA 1SW2A 2R71A 1ATGA 2AYSA 2F36A 1XHYA 5J16A 3PMVA 4N4UA 3TTKA 4O94A 2O84X 4TLMB 4KYEA 2QSXA 3K1NA 2P1SA 2HAVA 4BDRA 4C1TA 3T9HB 1FW0A 3GXAA 1IMAA 2QS4A 4IGTA 3U93A 2FNCA 3VVDA 2OWTA 1O7TA 1OLCA 1ZJLA 2Q2AA 2DDKA 4JSOA 3C31A 2RC8A 3IFCA 4MLVA 4GL0A 4QFPA 2E1SA 1LGBC 2DE3A 4BDQA 4MH5A 2I3VA 1ZBMA 3HN0A 5I2KB 1DPEA 3LR1A 4PFYA 3OSRA 1NNPA 1SYIA 1VFEA 4ZEDA 3N7PA 1FSAA 2UVIA 1MXZA 4X04A 3FVGA 1USYH 2FIEA 5EHMA 1YAEA 4I40A 1JQFA 2B4LA 1NNFA 1NV0A 2ONKE 2YLNA 1EH3A 3TQLA 4H46A 3ZKKA 2GHAA 5H8HA 3G3GA 1RDYA 2HQ0A 4QFLA 1LBBA 4I62A 3DP8A 4FIMA 4BDOA 2O69A 1Q1KA 1MQIA 2REGA 4KYSA 1NI9A 4BDMA 4AS4A 1FQFA 1QKAA 4F31B 1IEJA 3T66A 4F3GA 3FUZA 3MSTA 4MMPA 1LAXA 5F7VA 1TT1A 3TTNA 3E13X 5DW8A 4PF6A 4WEDA 4K3FA 1LCFA 3RPLA 5H8QB 1AIVA 2HHMA 3R6UA 3FVNA 3H03A 1SBPA 1B3GA 1NH7A 1B7HA 1ZTYA 2Y5KA 3DP6A 1H43A 4F3BA 4PFWA 2DWIA 4OVTA 2XHDA 3ROJA 1B4ZA 2Q88A 3V8XB 2I49A 3IB1A 2UXAA 3UA8A 4G77A 3KC0A 4C0RA 3EN3A 5DVFA 4GXSB 4OWDA 4DXUA 3T9VA 1RDXA 4LUBA 4I1DA 2X26A 2OX3A 1FQEA 3SEYA 3CHGA 1URDA 3OO6A 4QHQA 5CI5A 1NNTA 3IJOB 4NF4A 4EQBA 3DP4A 1URGA 4LONB 3P7IA 2DWJA 3SEXA 3HCQA 5I57A 3G7WA 3SDFA 4GFRA 2F97A 3KZGA 4NWDA 1MG1A 5I7IA 2Q89A 3CFZA 4G8NA 5AA4B 2ZZXA 2P3NA 3TCHA 2XX8A 4MNCA 1JVYA 2PCRA 1OQGA 2RCBA 3C9HA 4YICA 1M5BA 1DPPA 3G3KA 2OWZA 3A09A 4PFIA 1FBPA 4GOTA 4GWXA 4MNIA 2YPNA 1O64A 1NH8A 1JW5A 2DE2A 2P0SA 4GX3A 2H4IA 4NF5B 5EYGA 1JVXA 5AA2D 3BBRA 1A8FA 2XXYA 2ZYOA 3VVEA 2ONRA 2L5VA 3USDA 4GWWA 4Q8RA 1I6AA 3K01A 3U94A 4F2QA 3D4CA 4OESA 4H67A 4H0WA 3ZKLA 1S9TA 1B40A 2CMOA 1FPLA 1FRPA 2W7YA 1H44A 4ELOA 1A8EA 1JW4A 5HM4B 2VT5A 2CZHA 2BJJX 2FA7A 3TAJA 1SPIA 3PU5A 1KA1A 2V25A 1RKMA 3LSXA 4PAFA 4ISUA 1LFGA 1P1WA 3LBSA 4HCWA 1PEBA 3HHFA 3O97A 5DVIA 4ECFA 4OQOA 1QKBA 4ZS9A 1NUXA 3CFXA 4OVQA 2PVUA 2XXRA 3PPPA 2NOOA 3K1MA 2HXWA 2QKHA 1JEUA 3L2JA 3HFUA 4FORA 3RTWB 2PT2A 1G0IA 5I3SA 3O6GA 2Y7PA 2ZNTA 1IMDA 3LSFB 3IOLA 3O29A 4P0IA 3S4UA 1UTBA 1MY3A 4UA8A 2HPGA 3THIA 4JSDA 1R1NA 2UVHA 5DT6A 1IMCA 1ZLQA 3I5OA 2DWAA 2QL3A 4MX6A 2H98A 5J1DA 3S2VA 1DBZA 4X9TA 2PYYA 3AQFB 1MPDA 3QK6A 1M5FA 2UYEA 2NXOA 4LF3C 2XXQA 2R8TA 2F7CA 4P0GA 1UTHB 1GGGA 3JYRA 4KXPA 2XXXA 4DE8A 1N76A 4IY6A 1AL3A 3T0JA 1MY0A 5EQAA 1I69A 2Q8JA 3TTLA 4U21A 4RPOA 4EF2A 1DMBA 2Y7KA 3H6TA 3IORA 3H3GA 3G3FA 4HCYA 4H45A 1B05A 3IB0A 5JTYA 1MXWA 1XT8A 4NTLA 5H8FB 1YZ0A 1CNQA 3VVFA 3KFMA 4AB5A 2G93A 3MPKA 1AWBA 1NV5A 3ISPA 4G68A 3U8QA 2H9BA 1B52A 2XXVA 3TDJA 4F1UA 4GF8A 4QFKA 2VPNA 3N26A 1R6ZA 2CZKA 5BUUA 4XFEA 2H5YA 1MM7A 5AA1A 3OOAA 4XKRA 4F3PA 1EU8A 1AMFA 5DEXA 4UABA 4C1UA 3FVOA 1LBCA 1MDP1 1LAHE 4FAJA 1FPBA 2X7QA 1RDZA 1T0KA 4AQ4A 3FV2A 2XX9A 1HSEA 4ONYA 1Y3PA 2O7UA 3N94A 2PFZA 5CRYA 1MXUA 5A5XA 3TCFA 1FTMA 1M5CA 4XTCQ 1B3EA 4DXCA 4OERA 1MY4A 4KHZE 1OLAA 1NMUA 1BTJA 1Y9UA 4GL8A 2VPOA 5TPAA 2VD3A 5DTBA 2QVRA 3G3IA 3G3HA 3MP1A 2G29A 4NE4A 1I6QA 4UACA 1YPNA 3C35A 2R9JA 5IM2A 2PFYA 3I3VA 3T1BA 4LQ2A 1PDAA 2LAOA 3RYDA 4XXUA 1DK4A 1LB9A 5CMKA 3FD3A 2XX7A 4DLQA 1MH4A 4NF6A 3M8UA 4HE0A 2GH9A 3KSJA 5ICTA 3OMBA 5K2YA 4XIGQ 3FIRA 4N91A 3H06B 5ESYA 2OJTA 2RF1A 4N13A 2L27A 3ODBA 1NKXA 1A55A 3Q26A 1J1NA 1MQHA 1SW1A 5IZZA 5FHNA 4HJ0A 5H8NB 2ZXTA 2Q9TA 1NV7A 5LDZA 1FPKA 2F6PA 2Z22A 2Z8EA 4JBZA 2CZLA 3MZ1A 1B0HA 3PPOA 4ZZAA 4AB6A 3MW0A 4GWYA 5L9SA 3V89B 4NGUA 2HFBA 2ANJA 3B6WA 4RXLA 4U1ZA 3RNNA 5I2KA 4RA1A 3ILTB 3K2DA 1TFAA 2I6EA 4OVJA 2XXUA 5EYHA 2GFEA 1ZKBA 4EXKA 3VXCA 2A5TB 5ICQA 3DELB 1QUJA 4IY5A 2I0BA 5EHSA 4O3AA 1OIBA 5ISUA 1FPDA 1FPJA 1WVJA 3FASA 4GX6A 4PQJA 4N07A 3N7SA 1MDQA 1A40A 3FJMA 2RINA 1SYHA 4KQPA 3MYUA 3KBRA 3LUYA 1B7UA 1NNKA 1FTAA 5A5LA 4R2FA 4KI0E 1FPEA 4H65A 1UIUA 3N6UA 4EXLA 5FHOA 3F11A 4R6YA 4PETA 2REJA 2ZZWA 3B50A 4G8MA 3MQ9A 1FTOA 2DE4A 2RKMA 2O51A 2XXHA 4R6HA 3QAXA 3VFJA 2F35A 3IAZA 1VE4A 1RYXA 2DVZA 1MXYA 5EQ9A 2HXRA 1SI1A 3FXBA 3L6HA 4GIZA 3W9WA 5ET7A 3PV0E 3GBAA 3MP8A 2I4CA 2WBBA 1NV3A 2DXYA 4JVCA 4F22A 4ZGMA 4WKMA 1VDWA 2UVGA 3BKIB 3CIJA 5AA2B 4N15A 5II0A 3SEUA 4PP0A 1AOVA 1YYZA 5H8QA 1S50A 1L5TA 4IO2A 1NV2A 2V93A 3CG1A 4U22A 4WEPA 3VV5A 3MVXA 4TQUQ 4XKQA 1O63A 2ONSA 4MEVA 1VR5A 3RLFE 3Q27A 3KOSA 2HCAA 5CBSA 1N0TA 3TELA 4QFNA 2DXRA 2XXPA 1N3WA 3CFLA 1LB8A 4HTGA 3IOTA 4O7IA 3MP6A 2QPQA 5L9MA 4LZ8A 3VLWA 3HV1A 4MHFA 4FECA 4RJZA 2DYXA 1IXIA 3QIMA 2ABHA 4MFIA 1ZIUA 2DS9A 1POY1 4PE5B 2F3DA 2WX9A 4Q5TA 3PUWE 1YXIA 1ELJA 1JW1A 4KCCA 2WBDA 2VP1A 4U23A 2I3WA 4P47A 5AA4A 3MAMA 4QSCA 1MQGA 1FTKA 4ZEBA 1SD3A 1YCJA 2ZNUA 4DCYA 1OQHA 3HSTA 2Q8MA 3TCGA 3N6TA 1IIWA 1LAGE 5DVJA 4EQ7A 2VHAA 1Y3NA 4U2RA 4PFBA 1N84A 3T22A 3IJXB 2FHYA 3TODA 2RCAA 4PBHA 3HHGA 1EZ9A 4MIJA 2D3IA 2H99A 2DVCA 4N6DA 3N5LA 3QMFA 2F8DA 4F39A 4E0XA 5CBRA 1B4HA 1LBYA 3BFTA 1SVXB 4GWUA 4ZEFA 4F2OA 4NQ8A 3MZBA 4ESWA 4RPNA 1FQAA 4ELRA 3D1RA 4KR5A 2XXWA 4O7MA 4M1VA 4I9DA 1CE2A 1LLSA 3TQWA 1PBPA 2XXTA 3KG2A 4X8RA 3T96B 1VFDA 3RY3A 3RT6B 5I56A 1OVTA 4KD5A 5IZ3B 5IGAA 4GWSA 1B3FA 4QF9A 5I57B 2DOJA 3OSQA 1Y4CA 3LC8A 5BWJA 1B0LA 3CG3A 1Y1ZA 2D5WA 1DCUA 4MBPA 3K6XA 1LBVA 2XWIA 2XD2A 3SERA 2ZZVA 4M4GA 1IMFA 4LP2B 4GLIA 4FBPA 1EYJA 4PBQA 3E78A 1FBDA 1FJ9A 2B3BA 1PB7A 3SESA 2BJIA 3FBPA 4H8IA 4KCDA 1D9QA 2ALUA 1B3LA 3OELA 2Y7IA 2NWJA 4PAIA 3E3KA 1DOTA 4F1VA 2DP8A 3JV9A 4GVOA 2JODA 2Q2CA 3HO7A 3C59A 4QXDA 4PAKA 3IB2A 4YMBA 3IO6A 2OWSA 5F1QA 1PC3A 3CSBA 5KDTB 1KZ8A 2XWVA 3I6VA 4H5FA 4IO6A 4GWOA 4QFOA 1B3HA 4IO4A 4NMYA 1TXFA 4OETA 3LUZA 4P3LA 2CZIA 1D3KA 4JB7A 5T3JA 4G4PA 4O3BA 4PGNA 2WYKA 3KBZA 4G2ZA 2P2AA 4R9GA 4BLAA 1FQBA 4DCXA 3WAEA 3EHTA 4GXAA 5I2NB 2QVVA 5L9OA 3CVGA 3O2AA 4OENA 5I58B 1GTKA 2V3QA 2CEYA 3KC1A 4IO5A 3KEIA 5ITOA 1MQDA 4OTEA 1UTHA 1LBXA 3FXUA 4H5GA 2XD3A 1FBGA 3EPEA 2ESNA 3H6WA 4U4SA 4N81A 3IL1B 2VOZA 2FVZA 4OVSA 3PUYE 1WODA 1NFTA 4ELPA 2I0CA 3PUXE 2V4CA 1GVCA 1H76A 4JWYA 1OMPA 2I48A 3FXRA 5TP9A 1SDXA 5ET6A 1IXHA 4NHBA 4KYDA 1POTA 3SEVA 5H8FA 1JETA 3M3KA 1PB8A 3E79A 4JWXA 3TUSA 3VE1B 1QULA 2VGQA 5ET8A 5CMBA 3O66A 4GD5A 1QVSA 3CR9A 4F29A 4LA9A 4OHNA 3FATA 4DDDA 3FXQA 5CC2A 3T9UA 4YAHX 4MAGA 3OENA 2M8CA 4MF3A 4F1YA 2F3BA 2F5XA 3FGSA 5F24A 1ANFA 5KCJA 1MPCA 3Q28A 3A3UA 5EYFA 3C4MA 4NEDA 1FBHA 4O3CA 4FE8A 1Y3QA 3LSWA 2OLBA 4Z0IA 2IA4A 5ELVA 1FQCA 2Y5LA 3PPNA 2OCUA 2PBWA 3QSLA 4IB2A 3TTRA 1N04A 3TKDA 2DQVA 3OO8A 1H45A 4LN5A 1JNFA 4H6DA 3H6VA 4P1LA 2UVJA 3OO9A 2F6GA 4BDLA 1UQWA 1QW0A 4G61A 4YU0A 3IX1A 1NL5A 2JJKA 1JP4A 1NUZA 3S9EA 4NWCA 1Z7ME 3EF7A 4KPTA 4HE1A 1QJMA 4QRZA 4F18A 1LFHA 3OXNA 4NG7A 4P56A 4NX1A 4OEUA 4L17A 4R73A 4IGRA 1B5HA 1FCKA 1VSOA 3TEPA 3S9LC 4XF5A 5HPQA 1B7ZA 3MVZA 4ZE8A 4F19A 3MVYA 4QBAA 4P9KA 3C36A 2PT1A 1XVYA 3SEWA 3BFUA 1FBFA 4DI3D 1H3DA 3PPRA 4NF0A 1LBWA 2F78A 1P99A 1MQJA 1N7WA 1FPFA 1AH5A 5H8NA 4GQOA 2WKYA 3EHSA 5LTCA 4I8CA 2OK2A 4TLLB 2RC7A 1A99A 4ZZEA 3QUJA 1M5EA 3MBPA 3M3FA 3RUMA 5TPAB 1G0HA 3QUFA 1R9LA 4YKPA 4YKJA 1TFDA 1BK4A 2ZYMA 4YKKA 2AL5A 2DWHA 4P8BA 3MC2A 2QS1A 4NF8B 4ZEIA 4R75A 3PD8A 2WYPA 2H25A 3MUQA 4GRKA 2O7IA 1N3XA 1XS5A 5AA3A 3FVKA 2GHBA 3IK6B 3G3JA 4NF6B 1MH3A 1XC1A 1DTGA 4R2BA 4DIGA 4Z7EA 1Q9DA 4R72A 1II5A 3C32A 3O28A 3IOUA 5EQ7A 5H8SA 4ZE9A 4PTKA 5B70A 3O6IA 2FIXA 2XDGA 3FJ7A 5I59B 1FTLA 3KN7A 4N6KA 4P11A 2XWKA 3ZS6A 4XKPA 3E4RA 1NV6A 1QUKA 4IO3A 4JWOA 2DSFA 1SW5A 3SKPA 4RK2A 4OFJA 3ZSFA 4FATA 1GV8A 3B6QA 4G68C 3L6GA 4ELQA 3B7DA 1WDNA 4POWA 4YB6A 2FBPA 3PUVE 1MPBA 2XWOA 3U72A 2CEXA 1ZU0A 3GLBA 4MLQA 1B9JA 4N8YA 4OA4A 1LEVA 4TOZA 4U4XA 5DYHA 1Z7NE 4BDNA 5AA2A 3HPIA 3MPLA 5KZTA 1FTJA 1IQ7A 4ZECA 2GQ1A 4R74A 1B5IA 3R7XA 4X48A 3W15C 3K6WA 3H4ZA 2XXKA 4IR8A 4OVPA 3IOVA 1OVBA 4FEDA 4FJPA 4PDDA 5FTIA 3E9XA 3PMWA 1P1QA 1ZMGA 4MJOA 4DLDA 5IKBA 3PTYA 1XI6A 2JNCA 3GBBA 4X1BA 5IZ1A 3LV0A 4QSDA 3S9MC 1D9VA 5I84A 3WAFA 3DM0A 4P1EA 1U34A 2I4BA 4PGPA 1Q35A 1FBEA 4I3YA 3C5TA 4EF1A 3ONMA 3MJNA 1URSA 1P1UA 5I5PA 3M3LA 5H8HB 1DSNA 2FYIA 1FPGA 2KR0A 3N7RA 3UP9A 3D4GA 3KGCA 2O1LA 3KN8A 1IMBA 4DZ1A 2HZKA 1B6HA 1P1OA 1INPA 4NAPA 3R26A 4ND9A 3U65A 5ITPA 2O68A 4PFTA 1IUDA 4F3SA 3VLVA 3BIGA 1PBQA 3V83A 2B3FA 1TWYA 4N8GA 5CMMA 1MXXA 2QS3A 1XVXA 4H1XA 2QVUA 2E0SA 2RC9A 1MRPA 2V3TA 3IO4A 1B32A 1LFIA 4G8HA 2P3VA 2OZZA 5HBCA 3RPLB 2KQZA 4OYVA 1B58A 3UK4A 4R9FA 2Y7RA 1R9QA 3RQTA 1B1XA 2ZYNA 4EDPA 2B65A 1F9BA 3RTFB 4GWZA 3K0VA 4HW8A 5M2VA 3H7MA 3CSGA 4YKIA 2HEUA 5L8DA 5ET5A 4NF5A 4N6PA 3CRBA 4FEBA 1MY2A 4PCDA 2JNDA 1Y1MA 2GRVA 5IZ3A 4YB5A 1DTZA 1IITA 3ILUB 4RNSA 1MM6A 4GX4A 3T9XB 5FTHA 3OEMA 3AXFA 3W9VA 3H6UA 3IR1A 2Z8FA 4NF4B 1MXVA 4IO7A 4DXBA 3KJTA 4LZ7A 1CB6A 2V84A 4YB7A 3K1PA 3MZ9A 3IOWA 3KN3A 4ERSA 4MCOA 3T93B 1FPIA 2QMWA 3PD9A 1LAFE 4RY1A 4LZ5A 2KLFA 1JEVA 1EZPA 1NV4A 1HSJA 5KDTA 1K9YA 3TFLA 3TPAA 3IFAA 1BLFA 3QXMA 1RYOA 3B6TA 2O1MA 3UIFA 2VD2A 3NOHA 3TTMA 5I56B 3JZJA 3RPWA 1GR2A 2PX1A 1B46A 5I2NA 1EYIA 3PUZE 1A54A 1Y4TA 2NUVA 5I58A 5CMCA 2QS2A 2A5SA 5B7DA 4OMBA 4DLOA 2Z8DA 1US4A
chains in the Genus database with same CATH topology
1YTVA 2Y84A 3VDFA 5FHMA 5IAIA 4THIA 3UORA 3FV1A 2HAUA 3C34A 4JXIA 1MS7A 4XKNA 4ZDMA 4JDFA 4YMAA 3QYTA 4OZ9A 2AL4A 2R6GE 1B51A 3KOTA 3MVWA 2Z23A 4U1OA 3O6HA 5CM6A 3KSXA 1MY1A 1B2HA 4H8JA 1EZOA 4ZEKA 1UTBB 2ZMBA 1IXCA 2ZYKA 2NVUB 3GZGA 4HS7A 4OXVA 4OFOA 3KJ7A 4YZZA 1P1NA 5K2XA 2YJPA 2QMXA 3VLUA 1M5DA 3O9PA 1S7YA 3Q25A 5TP9B 2Y7WA 1PB9A 2QRYA 1KWHA 3OO7A 3RGYA 3CI8A 4KFQA 5TU0A 4LVQA 4LQ5A 3VXBA 4ESXA 1D9YA 2F7BA 3UGWA 3C33A 4EQ9A 3DLNA 1BP5A 1LCTA 2F7AA 1QUIA 3K6UA 4Q0CA 3PMXA 4Q30B 3V5AA 5KCJB 5JTYB 4RYAA 3RT8A 4EUOA 1LSTA 5JEIA 1I6BA 5LOMA 3ECRA 5JK4A 4R6KA 3UN6A 4G68B 1N7XA 2IEEA 2AIXA 2I58A 3MWBA 4WXJA 3K4UA 3TZAA 1IZ1A 3FZVA 2UYFA 3Q29A 2QJEA 2OBGA 1XOCA 1B5JA 3EHUA 3PGFA 1BIYA 4RK9A 2V3UA 4QSEA 3K6VA 1BKAA 5DEXB 5AE4A 2O6AA 4PFUA 1IXGA 4POXA 3TMGA 3SETA 5A5XB 1D4NA 3RN8A 3K02A 4NF8A 3OD7A 2ZNSA 2PMSA 3S9NC 3A3CA 2X7PA 1FQDA 3OEKA 1SW4A 3PPQA 1SI0A 1SQYA 1A7LA 3K00A 1Y20A 3LSLA 3FJGA 3U92A 2D21A 4E0WA 5I59A 4OFLA 1USYE 2A5TA 1B1HA 1US5A 4OEVA 4LATA 3TYHA 1UIVA 1HSLA 3U1OA 4X1DA 2F34A 2XXIA 2THIA 3EQ1A 2HZLA 1SW2A 2R71A 1ATGA 2AYSA 2F36A 1XHYA 3PMVA 3TTKA 2O84X 4TLMB 4KYEA 2QSXA 3K1NA 2P1SA 2HAVA 4BDRA 4C1TA 3T9HB 1FW0A 3GXAA 2QS4A 4IGTA 3U93A 2FNCA 3VVDA 2OWTA 1O7TA 1OLCA 1ZJLA 2Q2AA 4JSOA 3C31A 2RC8A 4MLVA 4GL0A 4QFPA 2E1SA 1LGBC 2DE3A 4BDQA 4MH5A 2I3VA 1ZBMA 3HN0A 5I2KB 1DPEA 3LR1A 4PFYA 3OSRA 1NNPA 1SYIA 1VFEA 4ZEDA 3N7PA 2UVIA 1MXZA 3FVGA 1USYH 5EHMA 1YAEA 1JQFA 1NNFA 2ONKE 2YLNA 1EH3A 3TQLA 3ZKKA 2GHAA 5H8HA 3G3GA 2HQ0A 4QFLA 1LBBA 4I62A 3DP8A 4FIMA 4BDOA 2O69A 1Q1KA 1MQIA 2REGA 4KYSA 4BDMA 1FQFA 1QKAA 4F31B 1IEJA 3T66A 4F3GA 3FUZA 1LAXA 5F7VA 1TT1A 3TTNA 3E13X 4WEDA 4K3FA 1LCFA 5H8QB 1AIVA 3R6UA 3FVNA 3H03A 1SBPA 1B3GA 1NH7A 1B7HA 1ZTYA 3DP6A 1H43A 4F3BA 4PFWA 2DWIA 2XHDA 1B4ZA 2Q88A 3V8XB 2I49A 3IB1A 2UXAA 3UA8A 4G77A 4C0RA 3EN3A 5DVFA 4GXSB 4OWDA 4DXUA 3T9VA 4LUBA 4I1DA 2X26A 1FQEA 3SEYA 1URDA 3OO6A 4QHQA 5CI5A 1NNTA 3IJOB 4NF4A 4EQBA 3DP4A 1URGA 4LONB 3P7IA 2DWJA 3SEXA 3HCQA 5I57A 3G7WA 3SDFA 4GFRA 2F97A 3KZGA 4NWDA 1MG1A 2Q89A 3CFZA 4G8NA 5AA4B 3TCHA 2XX8A 1JVYA 2RCBA 1OQGA 3C9HA 4YICA 1M5BA 1DPPA 3G3KA 3A09A 4GOTA 2YPNA 1O64A 1NH8A 1JW5A 2DE2A 2P0SA 2H4IA 4NF5B 1JVXA 5AA2D 3BBRA 1A8FA 2XXYA 2ZYOA 3VVEA 2ONRA 3USDA 4Q8RA 1I6AA 3K01A 3U94A 4F2QA 3D4CA 4OESA 4H67A 4H0WA 3ZKLA 1S9TA 1B40A 2CMOA 2W7YA 1H44A 4ELOA 1A8EA 1JW4A 5HM4B 2BJJX 2FA7A 3TAJA 3PU5A 2V25A 1RKMA 3LSXA 4ISUA 1LFGA 1P1WA 3LBSA 4HCWA 1PEBA 3HHFA 3O97A 5DVIA 4ECFA 4OQOA 1QKBA 4ZS9A 3CFXA 2PVUA 2XXRA 3PPPA 2NOOA 3K1MA 2HXWA 2QKHA 1JEUA 3L2JA 4FORA 3RTWB 2PT2A 3O6GA 2Y7PA 2ZNTA 3LSFB 3IOLA 3O29A 4P0IA 3S4UA 1UTBA 1MY3A 4UA8A 3THIA 4JSDA 1R1NA 2UVHA 5DT6A 1ZLQA 3I5OA 2DWAA 2QL3A 2H98A 5J1DA 3S2VA 4X9TA 2PYYA 3AQFB 1MPDA 3QK6A 1M5FA 2UYEA 2NXOA 4LF3C 2XXQA 2F7CA 4P0GA 1UTHB 1GGGA 3JYRA 2XXXA 4DE8A 1N76A 4IY6A 1AL3A 1MY0A 1I69A 2Q8JA 3TTLA 4U21A 4RPOA 4EF2A 1DMBA 2Y7KA 3H6TA 3IORA 3H3GA 3G3FA 4HCYA 1B05A 3IB0A 5JTYA 1MXWA 1XT8A 4NTLA 5H8FB 3VVFA 3KFMA 4AB5A 2G93A 3MPKA 4G68A 3U8QA 2H9BA 1B52A 2XXVA 3TDJA 4F1UA 4GF8A 4QFKA 3N26A 1R6ZA 5BUUA 2H5YA 1MM7A 5AA1A 3OOAA 4XKRA 4F3PA 1EU8A 1AMFA 5DEXA 4C1UA 3FVOA 1LBCA 1MDP1 1LAHE 4FAJA 2X7QA 1T0KA 4AQ4A 3FV2A 2XX9A 1HSEA 4ONYA 1Y3PA 2O7UA 3N94A 5CRYA 1MXUA 5A5XA 3TCFA 1FTMA 1M5CA 4XTCQ 1B3EA 4DXCA 4OERA 1MY4A 4KHZE 1OLAA 1NMUA 1BTJA 1Y9UA 4GL8A 5TPAA 2VD3A 5DTBA 3G3IA 3G3HA 3MP1A 2G29A 4NE4A 1I6QA 4UACA 1YPNA 3C35A 2R9JA 3I3VA 4LQ2A 1PDAA 2LAOA 4XXUA 1LB9A 5CMKA 3FD3A 2XX7A 4DLQA 1MH4A 4NF6A 3M8UA 2GH9A 3KSJA 5ICTA 3OMBA 5K2YA 4XIGQ 3FIRA 3H06B 2OJTA 2RF1A 4N13A 2L27A 3ODBA 1NKXA 1A55A 3Q26A 1J1NA 1MQHA 1SW1A 5FHNA 4HJ0A 5H8NB 2ZXTA 2Q9TA 2F6PA 2Z22A 2Z8EA 4JBZA 2CZLA 3MZ1A 1B0HA 3PPOA 4ZZAA 4AB6A 3MW0A 5L9SA 3V89B 2HFBA 2ANJA 3B6WA 4RXLA 4U1ZA 3RNNA 5I2KA 4RA1A 3ILTB 3K2DA 1TFAA 2I6EA 4OVJA 2XXUA 4EXKA 2GFEA 1ZKBA 3VXCA 2A5TB 5ICQA 3DELB 1QUJA 4IY5A 2I0BA 5EHSA 4O3AA 1OIBA 5ISUA 1WVJA 3FASA 4PQJA 4N07A 3N7SA 1MDQA 1A40A 3FJMA 2RINA 1SYHA 4KQPA 3KBRA 3LUYA 1B7UA 1NNKA 4R2FA 4KI0E 4H65A 1UIUA 3N6UA 4EXLA 5FHOA 3F11A 4R6YA 4PETA 2REJA 4G8MA 3MQ9A 1FTOA 2DE4A 2RKMA 2O51A 2XXHA 4R6HA 3QAXA 3VFJA 2F35A 3IAZA 1VE4A 1RYXA 2DVZA 1MXYA 1SI1A 3L6HA 4GIZA 3W9WA 3PV0E 3GBAA 3MP8A 2I4CA 2DXYA 4F22A 4ZGMA 4WKMA 2UVGA 3BKIB 3CIJA 5AA2B 5II0A 3SEUA 4PP0A 1AOVA 5H8QA 1S50A 1L5TA 4IO2A 2V93A 3CG1A 4U22A 4WEPA 3VV5A 3MVXA 4TQUQ 4XKQA 1O63A 2ONSA 1VR5A 3RLFE 3Q27A 3KOSA 2HCAA 5CBSA 1N0TA 3TELA 4QFNA 2DXRA 2XXPA 1N3WA 3CFLA 1LB8A 4HTGA 3IOTA 3MP6A 2QPQA 5L9MA 4LZ8A 3VLWA 3HV1A 4FECA 4RJZA 2DYXA 1IXIA 3QIMA 2ABHA 4MFIA 1ZIUA 2DS9A 1POY1 4PE5B 4Q5TA 3PUWE 1ELJA 1JW1A 4KCCA 2VP1A 4U23A 2I3WA 5AA4A 3MAMA 4QSCA 1MQGA 1FTKA 4ZEBA 1SD3A 1YCJA 2ZNUA 4DCYA 1OQHA 3HSTA 3TCGA 3N6TA 1IIWA 1LAGE 5DVJA 4EQ7A 2VHAA 1Y3NA 4U2RA 1N84A 3T22A 3IJXB 3TODA 2RCAA 3HHGA 1EZ9A 2D3IA 2H99A 2DVCA 3N5LA 2F8DA 4F39A 4E0XA 5CBRA 1B4HA 3BFTA 1SVXB 4ZEFA 4F2OA 4ESWA 3MZBA 4RPNA 1FQAA 4ELRA 4KR5A 2XXWA 4M1VA 4I9DA 1CE2A 1LLSA 3TQWA 1PBPA 2XXTA 3KG2A 3T96B 1VFDA 3RY3A 3RT6B 5I56A 1OVTA 4KD5A 1B3FA 4QF9A 5I57B 2DOJA 3OSQA 1Y4CA 3LC8A 5BWJA 1B0LA 3CG3A 1Y1ZA 2D5WA 4MBPA 3K6XA 2XD2A 3SERA 4M4GA 4LP2B 4GLIA 2B3BA 1PB7A 3SESA 4H8IA 4KCDA 2ALUA 1B3LA 3OELA 2Y7IA 2NWJA 3E3KA 1DOTA 4F1VA 2DP8A 3JV9A 4GVOA 2JODA 2Q2CA 3HO7A 3C59A 3IB2A 4YMBA 3IO6A 2OWSA 5F1QA 1PC3A 3CSBA 5KDTB 3I6VA 4H5FA 4IO6A 4GWOA 4QFOA 1B3HA 4IO4A 4NMYA 1TXFA 4OETA 1D3KA 4JB7A 4G4PA 4O3BA 4G2ZA 2P2AA 4R9GA 4BLAA 1FQBA 4DCXA 3WAEA 3EHTA 4GXAA 5I2NB 5L9OA 3CVGA 3O2AA 4OENA 5I58B 1GTKA 2V3QA 4IO5A 3KEIA 5ITOA 1MQDA 4OTEA 1UTHA 3FXUA 4H5GA 2XD3A 3EPEA 2ESNA 3H6WA 4U4SA 3IL1B 2VOZA 3PUYE 1WODA 1NFTA 4ELPA 2I0CA 3PUXE 1GVCA 1H76A 4JWYA 1OMPA 2I48A 3FXRA 5TP9A 1SDXA 1IXHA 4KYDA 1POTA 3SEVA 5H8FA 1JETA 3M3KA 1PB8A 4JWXA 3TUSA 3VE1B 1QULA 2VGQA 5CMBA 3O66A 4GD5A 1QVSA 3CR9A 4F29A 4LA9A 4OHNA 3FATA 4DDDA 3FXQA 5CC2A 3T9UA 4YAHX 3OENA 2M8CA 4MF3A 4F1YA 2F5XA 3FGSA 1ANFA 5KCJA 1MPCA 3Q28A 3A3UA 5EYFA 3C4MA 4NEDA 4O3CA 4FE8A 1Y3QA 3LSWA 2OLBA 4Z0IA 2IA4A 5ELVA 1FQCA 3PPNA 2OCUA 2PBWA 3QSLA 4IB2A 3TTRA 1N04A 3TKDA 2DQVA 3OO8A 1H45A 1JNFA 4H6DA 3H6VA 2UVJA 3OO9A 2F6GA 4BDLA 1UQWA 1QW0A 4YU0A 3IX1A 1NL5A 3S9EA 4NWCA 1Z7ME 3EF7A 4KPTA 1QJMA 4QRZA 4F18A 1LFHA 3OXNA 4OEUA 4L17A 4R73A 4IGRA 1B5HA 1FCKA 1VSOA 3TEPA 3S9LC 5HPQA 1B7ZA 3MVZA 4ZE8A 4F19A 3MVYA 3C36A 2PT1A 1XVYA 3SEWA 3BFUA 1H3DA 3PPRA 2F78A 1P99A 1MQJA 1N7WA 1AH5A 5H8NA 4GQOA 2WKYA 3EHSA 4I8CA 2OK2A 4TLLB 2RC7A 1A99A 4ZZEA 3QUJA 1M5EA 3MBPA 3M3FA 3RUMA 5TPAB 3QUFA 1R9LA 4YKPA 4YKJA 1TFDA 2ZYMA 4YKKA 2AL5A 2DWHA 3MC2A 2QS1A 4NF8B 4ZEIA 4R75A 3PD8A 2H25A 3MUQA 4GRKA 2O7IA 1N3XA 1XS5A 5AA3A 3FVKA 2GHBA 3IK6B 3G3JA 4NF6B 1MH3A 1XC1A 1DTGA 4R2BA 4DIGA 4Z7EA 4R72A 1II5A 3C32A 3O28A 3IOUA 5H8SA 4ZE9A 5B70A 3O6IA 2XDGA 3FJ7A 5I59B 1FTLA 3KN7A 4P11A 3ZS6A 4XKPA 3E4RA 1QUKA 4IO3A 4JWOA 2DSFA 1SW5A 3SKPA 4RK2A 4OFJA 3ZSFA 4FATA 1GV8A 3B6QA 4G68C 3L6GA 4ELQA 3B7DA 1WDNA 4POWA 4YB6A 3PUVE 1MPBA 3U72A 1ZU0A 3GLBA 4MLQA 1B9JA 4TOZA 4U4XA 5DYHA 1Z7NE 4BDNA 5AA2A 3HPIA 3MPLA 5KZTA 1FTJA 1IQ7A 4ZECA 4R74A 1B5IA 3R7XA 4X48A 3W15C 3K6WA 3H4ZA 3IOVA 1OVBA 4FEDA 4FJPA 5FTIA 3E9XA 3PMWA 1P1QA 1ZMGA 4DLDA 5IKBA 2JNCA 3GBBA 4X1BA 4QSDA 3S9MC 1D9VA 5I84A 3WAFA 3DM0A 1U34A 2I4BA 1Q35A 3C5TA 4EF1A 3ONMA 3MJNA 1URSA 1P1UA 3M3LA 5H8HB 1DSNA 2FYIA 3N7RA 3UP9A 3D4GA 3KGCA 2O1LA 3KN8A 4DZ1A 2HZKA 1B6HA 1P1OA 3R26A 4ND9A 5ITPA 2O68A 4PFTA 1IUDA 4F3SA 3VLVA 1PBQA 3V83A 2B3FA 1TWYA 5CMMA 1MXXA 2QS3A 1XVXA 4H1XA 2E0SA 2RC9A 1MRPA 2V3TA 3IO4A 1B32A 1LFIA 4G8HA 5HBCA 2OZZA 4OYVA 1B58A 3UK4A 4R9FA 2Y7RA 1R9QA 3RQTA 1B1XA 2ZYNA 4EDPA 2B65A 1F9BA 3RTFB 3K0VA 4HW8A 5M2VA 3H7MA 3CSGA 4YKIA 2HEUA 5L8DA 4NF5A 4N6PA 3CRBA 4FEBA 1MY2A 2JNDA 1Y1MA 2GRVA 4YB5A 1DTZA 1IITA 3ILUB 4RNSA 1MM6A 3T9XB 5FTHA 3OEMA 3AXFA 3W9VA 3H6UA 3IR1A 2Z8FA 4NF4B 1MXVA 4IO7A 4DXBA 3KJTA 4LZ7A 1CB6A 2V84A 4YB7A 3K1PA 3MZ9A 3IOWA 3KN3A 4ERSA 3T93B 2QMWA 3PD9A 1LAFE 4RY1A 4LZ5A 2KLFA 1JEVA 1EZPA 5KDTA 1HSJA 3TFLA 3TPAA 1BLFA 3QXMA 1RYOA 3B6TA 2O1MA 3UIFA 2VD2A 3TTMA 5I56B 3JZJA 3RPWA 1GR2A 2PX1A 1B46A 5I2NA 3PUZE 1A54A 1Y4TA 2NUVA 5I58A 5CMCA 2QS2A 2A5SA 5B7DA 4OMBA 4DLOA 2Z8DA 1US4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTV A;  2Y84 A;  3VDF A;  5FHM A;  5IAI A;  4THI A;  3UOR A;  3FV1 A;  2HAU A;  3C34 A;  4JXI A;  1MS7 A;  4XKN A;  4ZDM A;  4JDF A;  4YMA A;  3QYT A;  4OZ9 A;  2AL4 A;  2R6G E;  1B51 A;  3KOT A;  3MVW A;  2Z23 A;  4U1O A;  3O6H A;  5CM6 A;  3KSX A;  1MY1 A;  1B2H A;  4H8J A;  1EZO A;  4ZEK A;  1UTB B;  2ZMB A;  1IXC A;  2ZYK A;  2NVU B;  3GZG A;  4HS7 A;  4OXV A;  4OFO A;  3KJ7 A;  4YZZ A;  1P1N A;  5K2X A;  2YJP A;  2QMX A;  3VLU A;  1M5D A;  3O9P A;  1S7Y A;  3Q25 A;  5TP9 B;  2Y7W A;  1PB9 A;  2QRY A;  1KWH A;  3OO7 A;  3RGY A;  3CI8 A;  4KFQ A;  5TU0 A;  4LVQ A;  4LQ5 A;  3VXB A;  4ESX A;  1D9Y A;  2F7B A;  3UGW A;  3C33 A;  4EQ9 A;  3DLN A;  1BP5 A;  1LCT A;  2F7A A;  1QUI A;  3K6U A;  4Q0C A;  3PMX A;  4Q30 B;  3V5A A;  5KCJ B;  5JTY B;  4RYA A;  3RT8 A;  4EUO A;  1LST A;  5JEI A;  1I6B A;  5LOM A;  3ECR A;  5JK4 A;  4R6K A;  3UN6 A;  4G68 B;  1N7X A;  2IEE A;  2AIX A;  2I58 A;  3MWB A;  4WXJ A;  3K4U A;  3TZA A;  1IZ1 A;  3FZV A;  2UYF A;  3Q29 A;  2QJE A;  2OBG A;  1XOC A;  1B5J A;  3EHU A;  3PGF A;  1BIY A;  4RK9 A;  2V3U A;  4QSE A;  3K6V A;  1BKA A;  5DEX B;  5AE4 A;  2O6A A;  4PFU A;  1IXG A;  4POX A;  3TMG A;  3SET A;  5A5X B;  1D4N A;  3RN8 A;  3K02 A;  4NF8 A;  3OD7 A;  2ZNS A;  2PMS A;  3S9N C;  3A3C A;  2X7P A;  1FQD A;  3OEK A;  1SW4 A;  3PPQ A;  1SI0 A;  1SQY A;  1A7L A;  3K00 A;  1Y20 A;  3LSL A;  3FJG A;  3U92 A;  2D21 A;  4E0W A;  5I59 A;  4OFL A;  1USY E;  2A5T A;  1B1H A;  1US5 A;  4OEV A;  4LAT A;  3TYH A;  1UIV A;  1HSL A;  3U1O A;  4X1D A;  2F34 A;  2XXI A;  2THI A;  3EQ1 A;  2HZL A;  1SW2 A;  2R71 A;  1ATG A;  2AYS A;  2F36 A;  1XHY A;  3PMV A;  3TTK A;  2O84 X;  4TLM B;  4KYE A;  2QSX A;  3K1N A;  2P1S A;  2HAV A;  4BDR A;  4C1T A;  3T9H B;  1FW0 A;  3GXA A;  2QS4 A;  4IGT A;  3U93 A;  2FNC A;  3VVD A;  2OWT A;  1O7T A;  1OLC A;  1ZJL A;  2Q2A A;  4JSO A;  3C31 A;  2RC8 A;  4MLV A;  4GL0 A;  4QFP A;  2E1S A;  1LGB C;  2DE3 A;  4BDQ A;  4MH5 A;  2I3V A;  1ZBM A;  3HN0 A;  5I2K B;  1DPE A;  3LR1 A;  4PFY A;  3OSR A;  1NNP A;  1SYI A;  1VFE A;  4ZED A;  3N7P A;  2UVI A;  1MXZ A;  3FVG A;  1USY H;  5EHM A;  1YAE A;  1JQF A;  1NNF A;  2ONK E;  2YLN A;  1EH3 A;  3TQL A;  3ZKK A;  2GHA A;  5H8H A;  3G3G A;  2HQ0 A;  4QFL A;  1LBB A;  4I62 A;  3DP8 A;  4FIM A;  4BDO A;  2O69 A;  1Q1K A;  1MQI A;  2REG A;  4KYS A;  4BDM A;  1FQF A;  1QKA A;  4F31 B;  1IEJ A;  3T66 A;  4F3G A;  3FUZ A;  1LAX A;  5F7V A;  1TT1 A;  3TTN A;  3E13 X;  4WED A;  4K3F A;  1LCF A;  5H8Q B;  1AIV A;  3R6U A;  3FVN A;  3H03 A;  1SBP A;  1B3G A;  1NH7 A;  1B7H A;  1ZTY A;  3DP6 A;  1H43 A;  4F3B A;  4PFW A;  2DWI A;  2XHD A;  1B4Z A;  2Q88 A;  3V8X B;  2I49 A;  3IB1 A;  2UXA A;  3UA8 A;  4G77 A;  4C0R A;  3EN3 A;  5DVF A;  4GXS B;  4OWD A;  4DXU A;  3T9V A;  4LUB A;  4I1D A;  2X26 A;  1FQE A;  3SEY A;  1URD A;  3OO6 A;  4QHQ A;  5CI5 A;  1NNT A;  3IJO B;  4NF4 A;  4EQB A;  3DP4 A;  1URG A;  4LON B;  3P7I A;  2DWJ A;  3SEX A;  3HCQ A;  5I57 A;  3G7W A;  3SDF A;  4GFR A;  2F97 A;  3KZG A;  4NWD A;  1MG1 A;  2Q89 A;  3CFZ A;  4G8N A;  5AA4 B;  3TCH A;  2XX8 A;  1JVY A;  2RCB A;  1OQG A;  3C9H A;  4YIC A;  1M5B A;  1DPP A;  3G3K A;  3A09 A;  4GOT A;  2YPN A;  1O64 A;  1NH8 A;  1JW5 A;  2DE2 A;  2P0S A;  2H4I A;  4NF5 B;  1JVX A;  5AA2 D;  3BBR A;  1A8F A;  2XXY A;  2ZYO A;  3VVE A;  2ONR A;  3USD A;  4Q8R A;  1I6A A;  3K01 A;  3U94 A;  4F2Q A;  3D4C A;  4OES A;  4H67 A;  4H0W A;  3ZKL A;  1S9T A;  1B40 A;  2CMO A;  2W7Y A;  1H44 A;  4ELO A;  1A8E A;  1JW4 A;  5HM4 B;  2BJJ X;  2FA7 A;  3TAJ A;  3PU5 A;  2V25 A;  1RKM A;  3LSX A;  4ISU A;  1LFG A;  1P1W A;  3LBS A;  4HCW A;  1PEB A;  3HHF A;  3O97 A;  5DVI A;  4ECF A;  4OQO A;  1QKB A;  4ZS9 A;  3CFX A;  2PVU A;  2XXR A;  3PPP A;  2NOO A;  3K1M A;  2HXW A;  2QKH A;  1JEU A;  3L2J A;  4FOR A;  3RTW B;  2PT2 A;  3O6G A;  2Y7P A;  2ZNT A;  3LSF B;  3IOL A;  3O29 A;  4P0I A;  3S4U A;  1UTB A;  1MY3 A;  4UA8 A;  3THI A;  4JSD A;  1R1N A;  2UVH A;  5DT6 A;  1ZLQ A;  3I5O A;  2DWA A;  2QL3 A;  2H98 A;  5J1D A;  3S2V A;  4X9T A;  2PYY A;  3AQF B;  1MPD A;  3QK6 A;  1M5F A;  2UYE A;  2NXO A;  4LF3 C;  2XXQ A;  2F7C A;  4P0G A;  1UTH B;  1GGG A;  3JYR A;  2XXX A;  4DE8 A;  1N76 A;  4IY6 A;  1AL3 A;  1MY0 A;  1I69 A;  2Q8J A;  3TTL A;  4U21 A;  4RPO A;  4EF2 A;  1DMB A;  2Y7K A;  3H6T A;  3IOR A;  3H3G A;  3G3F A;  4HCY A;  1B05 A;  3IB0 A;  5JTY A;  1MXW A;  1XT8 A;  4NTL A;  5H8F B;  3VVF A;  3KFM A;  4AB5 A;  2G93 A;  3MPK A;  4G68 A;  3U8Q A;  2H9B A;  1B52 A;  2XXV A;  3TDJ A;  4F1U A;  4GF8 A;  4QFK A;  3N26 A;  1R6Z A;  5BUU A;  2H5Y A;  1MM7 A;  5AA1 A;  3OOA A;  4XKR A;  4F3P A;  1EU8 A;  1AMF A;  5DEX A;  4C1U A;  3FVO A;  1LBC A;  1MDP 1;  1LAH E;  4FAJ A;  2X7Q A;  1T0K A;  4AQ4 A;  3FV2 A;  2XX9 A;  1HSE A;  4ONY A;  1Y3P A;  2O7U A;  3N94 A;  5CRY A;  1MXU A;  5A5X A;  3TCF A;  1FTM A;  1M5C A;  4XTC Q;  1B3E A;  4DXC A;  4OER A;  1MY4 A;  4KHZ E;  1OLA A;  1NMU A;  1BTJ A;  1Y9U A;  4GL8 A;  5TPA A;  2VD3 A;  5DTB A;  3G3I A;  3G3H A;  3MP1 A;  2G29 A;  4NE4 A;  1I6Q A;  4UAC A;  1YPN A;  3C35 A;  2R9J A;  3I3V A;  4LQ2 A;  1PDA A;  2LAO A;  4XXU A;  1LB9 A;  5CMK A;  3FD3 A;  2XX7 A;  4DLQ A;  1MH4 A;  4NF6 A;  3M8U A;  2GH9 A;  3KSJ A;  5ICT A;  3OMB A;  5K2Y A;  4XIG Q;  3FIR A;  3H06 B;  2OJT A;  2RF1 A;  4N13 A;  2L27 A;  3ODB A;  1NKX A;  1A55 A;  3Q26 A;  1J1N A;  1MQH A;  1SW1 A;  5FHN A;  4HJ0 A;  5H8N B;  2ZXT A;  2Q9T A;  2F6P A;  2Z22 A;  2Z8E A;  4JBZ A;  2CZL A;  3MZ1 A;  1B0H A;  3PPO A;  4ZZA A;  4AB6 A;  3MW0 A;  5L9S A;  3V89 B;  2HFB A;  2ANJ A;  3B6W A;  4RXL A;  4U1Z A;  3RNN A;  5I2K A;  4RA1 A;  3ILT B;  3K2D A;  1TFA A;  2I6E A;  4OVJ A;  2XXU A;  4EXK A;  2GFE A;  1ZKB A;  3VXC A;  2A5T B;  5ICQ A;  3DEL B;  1QUJ A;  4IY5 A;  2I0B A;  5EHS A;  4O3A A;  1OIB A;  5ISU A;  1WVJ A;  3FAS A;  4PQJ A;  4N07 A;  3N7S A;  1MDQ A;  1A40 A;  3FJM A;  2RIN A;  1SYH A;  4KQP A;  3KBR A;  3LUY A;  1B7U A;  1NNK A;  4R2F A;  4KI0 E;  4H65 A;  1UIU A;  3N6U A;  4EXL A;  5FHO A;  3F11 A;  4R6Y A;  4PET A;  2REJ A;  4G8M A;  3MQ9 A;  1FTO A;  2DE4 A;  2RKM A;  2O51 A;  2XXH A;  4R6H A;  3QAX A;  3VFJ A;  2F35 A;  3IAZ A;  1VE4 A;  1RYX A;  2DVZ A;  1MXY A;  1SI1 A;  3L6H A;  4GIZ A;  3W9W A;  3PV0 E;  3GBA A;  3MP8 A;  2I4C A;  2DXY A;  4F22 A;  4ZGM A;  4WKM A;  2UVG A;  3BKI B;  3CIJ A;  5AA2 B;  5II0 A;  3SEU A;  4PP0 A;  1AOV A;  5H8Q A;  1S50 A;  1L5T A;  4IO2 A;  2V93 A;  3CG1 A;  4U22 A;  4WEP A;  3VV5 A;  3MVX A;  4TQU Q;  4XKQ A;  1O63 A;  2ONS A;  1VR5 A;  3RLF E;  3Q27 A;  3KOS A;  2HCA A;  5CBS A;  1N0T A;  3TEL A;  4QFN A;  2DXR A;  2XXP A;  1N3W A;  3CFL A;  1LB8 A;  4HTG A;  3IOT A;  3MP6 A;  2QPQ A;  5L9M A;  4LZ8 A;  3VLW A;  3HV1 A;  4FEC A;  4RJZ A;  2DYX A;  1IXI A;  3QIM A;  2ABH A;  4MFI A;  1ZIU A;  2DS9 A;  1POY 1;  4PE5 B;  4Q5T A;  3PUW E;  1ELJ A;  1JW1 A;  4KCC A;  2VP1 A;  4U23 A;  2I3W A;  5AA4 A;  3MAM A;  4QSC A;  1MQG A;  1FTK A;  4ZEB A;  1SD3 A;  1YCJ A;  2ZNU A;  4DCY A;  1OQH A;  3HST A;  3TCG A;  3N6T A;  1IIW A;  1LAG E;  5DVJ A;  4EQ7 A;  2VHA A;  1Y3N A;  4U2R A;  1N84 A;  3T22 A;  3IJX B;  3TOD A;  2RCA A;  3HHG A;  1EZ9 A;  2D3I A;  2H99 A;  2DVC A;  3N5L A;  2F8D A;  4F39 A;  4E0X A;  5CBR A;  1B4H A;  3BFT A;  1SVX B;  4ZEF A;  4F2O A;  4ESW A;  3MZB A;  4RPN A;  1FQA A;  4ELR A;  4KR5 A;  2XXW A;  4M1V A;  4I9D A;  1CE2 A;  1LLS A;  3TQW A;  1PBP A;  2XXT A;  3KG2 A;  3T96 B;  1VFD A;  3RY3 A;  3RT6 B;  5I56 A;  1OVT A;  4KD5 A;  1B3F A;  4QF9 A;  5I57 B;  2DOJ A;  3OSQ A;  1Y4C A;  3LC8 A;  5BWJ A;  1B0L A;  3CG3 A;  1Y1Z A;  2D5W A;  4MBP A;  3K6X A;  2XD2 A;  3SER A;  4M4G A;  4LP2 B;  4GLI A;  2B3B A;  1PB7 A;  3SES A;  4H8I A;  4KCD A;  2ALU A;  1B3L A;  3OEL A;  2Y7I A;  2NWJ A;  3E3K A;  1DOT A;  4F1V A;  2DP8 A;  3JV9 A;  4GVO A;  2JOD A;  2Q2C A;  3HO7 A;  3C59 A;  3IB2 A;  4YMB A;  3IO6 A;  2OWS A;  5F1Q A;  1PC3 A;  3CSB A;  5KDT B;  3I6V A;  4H5F A;  4IO6 A;  4GWO A;  4QFO A;  1B3H A;  4IO4 A;  4NMY A;  1TXF A;  4OET A;  1D3K A;  4JB7 A;  4G4P A;  4O3B A;  4G2Z A;  2P2A A;  4R9G A;  4BLA A;  1FQB A;  4DCX A;  3WAE A;  3EHT A;  4GXA A;  5I2N B;  5L9O A;  3CVG A;  3O2A A;  4OEN A;  5I58 B;  1GTK A;  2V3Q A;  4IO5 A;  3KEI A;  5ITO A;  1MQD A;  4OTE A;  1UTH A;  3FXU A;  4H5G A;  2XD3 A;  3EPE A;  2ESN A;  3H6W A;  4U4S A;  3IL1 B;  2VOZ A;  3PUY E;  1WOD A;  1NFT A;  4ELP A;  2I0C A;  3PUX E;  1GVC A;  1H76 A;  4JWY A;  1OMP A;  2I48 A;  3FXR A;  5TP9 A;  1SDX A;  1IXH A;  4KYD A;  1POT A;  3SEV A;  5H8F A;  1JET A;  3M3K A;  1PB8 A;  4JWX A;  3TUS A;  3VE1 B;  1QUL A;  2VGQ A;  5CMB A;  3O66 A;  4GD5 A;  1QVS A;  3CR9 A;  4F29 A;  4LA9 A;  4OHN A;  3FAT A;  4DDD A;  3FXQ A;  5CC2 A;  3T9U A;  4YAH X;  3OEN A;  2M8C A;  4MF3 A;  4F1Y A;  2F5X A;  3FGS A;  1ANF A;  5KCJ A;  1MPC A;  3Q28 A;  3A3U A;  5EYF A;  3C4M A;  4NED A;  4O3C A;  4FE8 A;  1Y3Q A;  3LSW A;  2OLB A;  4Z0I A;  2IA4 A;  5ELV A;  1FQC A;  3PPN A;  2OCU A;  2PBW A;  3QSL A;  4IB2 A;  3TTR A;  1N04 A;  3TKD A;  2DQV A;  3OO8 A;  1H45 A;  1JNF A;  4H6D A;  3H6V A;  2UVJ A;  3OO9 A;  2F6G A;  4BDL A;  1UQW A;  1QW0 A;  4YU0 A;  3IX1 A;  1NL5 A;  3S9E A;  4NWC A;  1Z7M E;  3EF7 A;  4KPT A;  1QJM A;  4QRZ A;  4F18 A;  1LFH A;  3OXN A;  4OEU A;  4L17 A;  4R73 A;  4IGR A;  1B5H A;  1FCK A;  1VSO A;  3TEP A;  3S9L C;  5HPQ A;  1B7Z A;  3MVZ A;  4ZE8 A;  4F19 A;  3MVY A;  3C36 A;  2PT1 A;  1XVY A;  3SEW A;  3BFU A;  1H3D A;  3PPR A;  2F78 A;  1P99 A;  1MQJ A;  1N7W A;  1AH5 A;  5H8N A;  4GQO A;  2WKY A;  3EHS A;  4I8C A;  2OK2 A;  4TLL B;  2RC7 A;  1A99 A;  4ZZE A;  3QUJ A;  1M5E A;  3MBP A;  3M3F A;  3RUM A;  5TPA B;  3QUF A;  1R9L A;  4YKP A;  4YKJ A;  1TFD A;  2ZYM A;  4YKK A;  2AL5 A;  2DWH A;  3MC2 A;  2QS1 A;  4NF8 B;  4ZEI A;  4R75 A;  3PD8 A;  2H25 A;  3MUQ A;  4GRK A;  2O7I A;  1N3X A;  1XS5 A;  5AA3 A;  3FVK A;  2GHB A;  3IK6 B;  3G3J A;  4NF6 B;  1MH3 A;  1XC1 A;  1DTG A;  4R2B A;  4DIG A;  4Z7E A;  4R72 A;  1II5 A;  3C32 A;  3O28 A;  3IOU A;  5H8S A;  4ZE9 A;  5B70 A;  3O6I A;  2XDG A;  3FJ7 A;  5I59 B;  1FTL A;  3KN7 A;  4P11 A;  3ZS6 A;  4XKP A;  3E4R A;  1QUK A;  4IO3 A;  4JWO A;  2DSF A;  1SW5 A;  3SKP A;  4RK2 A;  4OFJ A;  3ZSF A;  4FAT A;  1GV8 A;  3B6Q A;  4G68 C;  3L6G A;  4ELQ A;  3B7D A;  1WDN A;  4POW A;  4YB6 A;  3PUV E;  1MPB A;  3U72 A;  1ZU0 A;  3GLB A;  4MLQ A;  1B9J A;  4TOZ A;  4U4X A;  5DYH A;  1Z7N E;  4BDN A;  5AA2 A;  3HPI A;  3MPL A;  5KZT A;  1FTJ A;  1IQ7 A;  4ZEC A;  4R74 A;  1B5I A;  3R7X A;  4X48 A;  3W15 C;  3K6W A;  3H4Z A;  3IOV A;  1OVB A;  4FED A;  4FJP A;  5FTI A;  3E9X A;  3PMW A;  1P1Q A;  1ZMG A;  4DLD A;  5IKB A;  2JNC A;  3GBB A;  4X1B A;  4QSD A;  3S9M C;  1D9V A;  5I84 A;  3WAF A;  3DM0 A;  1U34 A;  2I4B A;  1Q35 A;  3C5T A;  4EF1 A;  3ONM A;  3MJN A;  1URS A;  1P1U A;  3M3L A;  5H8H B;  1DSN A;  2FYI A;  3N7R A;  3UP9 A;  3D4G A;  3KGC A;  2O1L A;  3KN8 A;  4DZ1 A;  2HZK A;  1B6H A;  1P1O A;  3R26 A;  4ND9 A;  5ITP A;  2O68 A;  4PFT A;  1IUD A;  4F3S A;  3VLV A;  1PBQ A;  3V83 A;  2B3F A;  1TWY A;  5CMM A;  1MXX A;  2QS3 A;  1XVX A;  4H1X A;  2E0S A;  2RC9 A;  1MRP A;  2V3T A;  3IO4 A;  1B32 A;  1LFI A;  4G8H A;  5HBC A;  2OZZ A;  4OYV A;  1B58 A;  3UK4 A;  4R9F A;  2Y7R A;  1R9Q A;  3RQT A;  1B1X A;  2ZYN A;  4EDP A;  2B65 A;  1F9B A;  3RTF B;  3K0V A;  4HW8 A;  5M2V A;  3H7M A;  3CSG A;  4YKI A;  2HEU A;  5L8D A;  4NF5 A;  4N6P A;  3CRB A;  4FEB A;  1MY2 A;  2JND A;  1Y1M A;  2GRV A;  4YB5 A;  1DTZ A;  1IIT A;  3ILU B;  4RNS A;  1MM6 A;  3T9X B;  5FTH A;  3OEM A;  3AXF A;  3W9V A;  3H6U A;  3IR1 A;  2Z8F A;  4NF4 B;  1MXV A;  4IO7 A;  4DXB A;  3KJT A;  4LZ7 A;  1CB6 A;  2V84 A;  4YB7 A;  3K1P A;  3MZ9 A;  3IOW A;  3KN3 A;  4ERS A;  3T93 B;  2QMW A;  3PD9 A;  1LAF E;  4RY1 A;  4LZ5 A;  2KLF A;  1JEV A;  1EZP A;  5KDT A;  1HSJ A;  3TFL A;  3TPA A;  1BLF A;  3QXM A;  1RYO A;  3B6T A;  2O1M A;  3UIF A;  2VD2 A;  3TTM A;  5I56 B;  3JZJ A;  3RPW A;  1GR2 A;  2PX1 A;  1B46 A;  5I2N A;  3PUZ E;  1A54 A;  1Y4T A;  2NUV A;  5I58 A;  5CMC A;  2QS2 A;  2A5S A;  5B7D A;  4OMB A;  4DLO A;  2Z8D A;  1US4 A; 
#chains in the Genus database with same CATH topology
 2MKZ A;  1YTV A;  4OAN A;  2Y84 A;  3VDF A;  5FHM A;  5IAI A;  4THI A;  4O8M A;  3FV1 A;  3UOR A;  2HAU A;  3C34 A;  4JXI A;  1MS7 A;  4XKN A;  4ZDM A;  4JDF A;  4YMA A;  3QYT A;  4OZ9 A;  2AL4 A;  4I3E A;  2R6G E;  1B51 A;  3KOT A;  3MVW A;  2Z23 A;  4U1O A;  3O6H A;  5CM6 A;  3KSX A;  1EYK A;  1MY1 A;  1IME A;  1B2H A;  4H8J A;  4JVI A;  1LBZ A;  1EZO A;  1QGX A;  4ZEK A;  1UTB B;  3BIH A;  4OVR A;  2ZMB A;  1IXC A;  2ZYK A;  2NVU B;  3GZG A;  4HS7 A;  4OXV A;  4OFO A;  3KJ7 A;  4N17 A;  2WEF A;  4PF8 A;  1K9Z A;  4YZZ A;  1P1N A;  5K2X A;  4PC9 A;  2YJP A;  2QMX A;  4PE3 A;  3VLU A;  1M5D A;  3O9P A;  1S7Y A;  3SZP A;  3Q25 A;  5FBP A;  5TP9 B;  2Y7W A;  3GYY A;  1PB9 A;  4MNP A;  2QRY A;  1KWH A;  3OO7 A;  4GBV A;  4AS5 A;  3RGY A;  4PFR A;  3CI8 A;  4KFQ A;  5TU0 A;  4LVQ A;  4LQ5 A;  3VXB A;  4ESX A;  1D9Y A;  2F7B A;  3UGW A;  3C33 A;  4EQ9 A;  3DLN A;  1BP5 A;  1LCT A;  2F7A A;  1QUI A;  1FJ6 A;  3K6U A;  4Q0C A;  3PMX A;  4Q30 B;  3V5A A;  2XA5 A;  5KCJ B;  5JTY B;  4RYA A;  3RT8 A;  4EUO A;  1LST A;  5JEI A;  1I6B A;  5LOM A;  3ECR A;  5JK4 A;  4R6K A;  3UN6 A;  4G68 B;  1N7X A;  2IEE A;  2AIX A;  2I58 A;  3MWB A;  4DI4 B;  4WXJ A;  3K4U A;  3TZA A;  1IZ1 A;  3FZV A;  2UYF A;  3Q29 A;  1FBC A;  2QJE A;  2OBG A;  1XOC A;  1B5J A;  3EHU A;  3PGF A;  1BIY A;  4RK9 A;  2V3U A;  4QSE A;  3K6V A;  1BKA A;  5DEX B;  5AE4 A;  2O6A A;  3A29 A;  4PFU A;  4NN3 A;  1IXG A;  2Q74 A;  4POX A;  3TMG A;  3SET A;  5A5X B;  1D4N A;  3RN8 A;  3K02 A;  4NF8 A;  3OD7 A;  2ZNS A;  2PMS A;  3S9N C;  3A3C A;  2X7P A;  1FQD A;  1NUW A;  3OEK A;  1SW4 A;  3PPQ A;  1SI0 A;  1SQY A;  1A7L A;  3K00 A;  1Y20 A;  1NV1 A;  4HXV A;  4HE2 A;  4JVD A;  3LSL A;  2QFL A;  3FJG A;  3U92 A;  4PDH A;  2D21 A;  4E0W A;  5I59 A;  4OFL A;  1USY E;  2A5T A;  1B1H A;  5EQ8 A;  2B4M A;  1US5 A;  1KA0 A;  4OEV A;  3EKI A;  4LAT A;  3TYH A;  1UIV A;  4GBW A;  1HSL A;  3U1O A;  1NUY A;  4X1D A;  2F34 A;  2XXI A;  2THI A;  3EQ1 A;  3B8B A;  2HZL A;  4XEQ A;  1SW2 A;  2R71 A;  1ATG A;  2AYS A;  2F36 A;  1XHY A;  5J16 A;  3PMV A;  4N4U A;  3TTK A;  4O94 A;  2O84 X;  4TLM B;  4KYE A;  2QSX A;  3K1N A;  2P1S A;  2HAV A;  4BDR A;  4C1T A;  3T9H B;  1FW0 A;  3GXA A;  1IMA A;  2QS4 A;  4IGT A;  3U93 A;  2FNC A;  3VVD A;  2OWT A;  1O7T A;  1OLC A;  1ZJL A;  2Q2A A;  2DDK A;  4JSO A;  3C31 A;  2RC8 A;  3IFC A;  4MLV A;  4GL0 A;  4QFP A;  2E1S A;  1LGB C;  2DE3 A;  4BDQ A;  4MH5 A;  2I3V A;  1ZBM A;  3HN0 A;  5I2K B;  1DPE A;  3LR1 A;  4PFY A;  3OSR A;  1NNP A;  1SYI A;  1VFE A;  4ZED A;  3N7P A;  1FSA A;  2UVI A;  1MXZ A;  4X04 A;  3FVG A;  1USY H;  2FIE A;  5EHM A;  1YAE A;  4I40 A;  1JQF A;  2B4L A;  1NNF A;  1NV0 A;  2ONK E;  2YLN A;  1EH3 A;  3TQL A;  4H46 A;  3ZKK A;  2GHA A;  5H8H A;  3G3G A;  1RDY A;  2HQ0 A;  4QFL A;  1LBB A;  4I62 A;  3DP8 A;  4FIM A;  4BDO A;  2O69 A;  1Q1K A;  1MQI A;  2REG A;  4KYS A;  1NI9 A;  4BDM A;  4AS4 A;  1FQF A;  1QKA A;  4F31 B;  1IEJ A;  3T66 A;  4F3G A;  3FUZ A;  3MST A;  4MMP A;  1LAX A;  5F7V A;  1TT1 A;  3TTN A;  3E13 X;  5DW8 A;  4PF6 A;  4WED A;  4K3F A;  1LCF A;  3RPL A;  5H8Q B;  1AIV A;  2HHM A;  3R6U A;  3FVN A;  3H03 A;  1SBP A;  1B3G A;  1NH7 A;  1B7H A;  1ZTY A;  2Y5K A;  3DP6 A;  1H43 A;  4F3B A;  4PFW A;  2DWI A;  4OVT A;  2XHD A;  3ROJ A;  1B4Z A;  2Q88 A;  3V8X B;  2I49 A;  3IB1 A;  2UXA A;  3UA8 A;  4G77 A;  3KC0 A;  4C0R A;  3EN3 A;  5DVF A;  4GXS B;  4OWD A;  4DXU A;  3T9V A;  1RDX A;  4LUB A;  4I1D A;  2X26 A;  2OX3 A;  1FQE A;  3SEY A;  3CHG A;  1URD A;  3OO6 A;  4QHQ A;  5CI5 A;  1NNT A;  3IJO B;  4NF4 A;  4EQB A;  3DP4 A;  1URG A;  4LON B;  3P7I A;  2DWJ A;  3SEX A;  3HCQ A;  5I57 A;  3G7W A;  3SDF A;  4GFR A;  2F97 A;  3KZG A;  4NWD A;  1MG1 A;  5I7I A;  2Q89 A;  3CFZ A;  4G8N A;  5AA4 B;  2ZZX A;  2P3N A;  3TCH A;  2XX8 A;  4MNC A;  1JVY A;  2PCR A;  1OQG A;  2RCB A;  3C9H A;  4YIC A;  1M5B A;  1DPP A;  3G3K A;  2OWZ A;  3A09 A;  4PFI A;  1FBP A;  4GOT A;  4GWX A;  4MNI A;  2YPN A;  1O64 A;  1NH8 A;  1JW5 A;  2DE2 A;  2P0S A;  4GX3 A;  2H4I A;  4NF5 B;  5EYG A;  1JVX A;  5AA2 D;  3BBR A;  1A8F A;  2XXY A;  2ZYO A;  3VVE A;  2ONR A;  2L5V A;  3USD A;  4GWW A;  4Q8R A;  1I6A A;  3K01 A;  3U94 A;  4F2Q A;  3D4C A;  4OES A;  4H67 A;  4H0W A;  3ZKL A;  1S9T A;  1B40 A;  2CMO A;  1FPL A;  1FRP A;  2W7Y A;  1H44 A;  4ELO A;  1A8E A;  1JW4 A;  5HM4 B;  2VT5 A;  2CZH A;  2BJJ X;  2FA7 A;  3TAJ A;  1SPI A;  3PU5 A;  1KA1 A;  2V25 A;  1RKM A;  3LSX A;  4PAF A;  4ISU A;  1LFG A;  1P1W A;  3LBS A;  4HCW A;  1PEB A;  3HHF A;  3O97 A;  5DVI A;  4ECF A;  4OQO A;  1QKB A;  4ZS9 A;  1NUX A;  3CFX A;  4OVQ A;  2PVU A;  2XXR A;  3PPP A;  2NOO A;  3K1M A;  2HXW A;  2QKH A;  1JEU A;  3L2J A;  3HFU A;  4FOR A;  3RTW B;  2PT2 A;  1G0I A;  5I3S A;  3O6G A;  2Y7P A;  2ZNT A;  1IMD A;  3LSF B;  3IOL A;  3O29 A;  4P0I A;  3S4U A;  1UTB A;  1MY3 A;  4UA8 A;  2HPG A;  3THI A;  4JSD A;  1R1N A;  2UVH A;  5DT6 A;  1IMC A;  1ZLQ A;  3I5O A;  2DWA A;  2QL3 A;  4MX6 A;  2H98 A;  5J1D A;  3S2V A;  1DBZ A;  4X9T A;  2PYY A;  3AQF B;  1MPD A;  3QK6 A;  1M5F A;  2UYE A;  2NXO A;  4LF3 C;  2XXQ A;  2R8T A;  2F7C A;  4P0G A;  1UTH B;  1GGG A;  3JYR A;  4KXP A;  2XXX A;  4DE8 A;  1N76 A;  4IY6 A;  1AL3 A;  3T0J A;  1MY0 A;  5EQA A;  1I69 A;  2Q8J A;  3TTL A;  4U21 A;  4RPO A;  4EF2 A;  1DMB A;  2Y7K A;  3H6T A;  3IOR A;  3H3G A;  3G3F A;  4HCY A;  4H45 A;  1B05 A;  3IB0 A;  5JTY A;  1MXW A;  1XT8 A;  4NTL A;  5H8F B;  1YZ0 A;  1CNQ A;  3VVF A;  3KFM A;  4AB5 A;  2G93 A;  3MPK A;  1AWB A;  1NV5 A;  3ISP A;  4G68 A;  3U8Q A;  2H9B A;  1B52 A;  2XXV A;  3TDJ A;  4F1U A;  4GF8 A;  4QFK A;  2VPN A;  3N26 A;  1R6Z A;  2CZK A;  5BUU A;  4XFE A;  2H5Y A;  1MM7 A;  5AA1 A;  3OOA A;  4XKR A;  4F3P A;  1EU8 A;  1AMF A;  5DEX A;  4UAB A;  4C1U A;  3FVO A;  1LBC A;  1MDP 1;  1LAH E;  4FAJ A;  1FPB A;  2X7Q A;  1RDZ A;  1T0K A;  4AQ4 A;  3FV2 A;  2XX9 A;  1HSE A;  4ONY A;  1Y3P A;  2O7U A;  3N94 A;  2PFZ A;  5CRY A;  1MXU A;  5A5X A;  3TCF A;  1FTM A;  1M5C A;  4XTC Q;  1B3E A;  4DXC A;  4OER A;  1MY4 A;  4KHZ E;  1OLA A;  1NMU A;  1BTJ A;  1Y9U A;  4GL8 A;  2VPO A;  5TPA A;  2VD3 A;  5DTB A;  2QVR A;  3G3I A;  3G3H A;  3MP1 A;  2G29 A;  4NE4 A;  1I6Q A;  4UAC A;  1YPN A;  3C35 A;  2R9J A;  5IM2 A;  2PFY A;  3I3V A;  3T1B A;  4LQ2 A;  1PDA A;  2LAO A;  3RYD A;  4XXU A;  1DK4 A;  1LB9 A;  5CMK A;  3FD3 A;  2XX7 A;  4DLQ A;  1MH4 A;  4NF6 A;  3M8U A;  4HE0 A;  2GH9 A;  3KSJ A;  5ICT A;  3OMB A;  5K2Y A;  4XIG Q;  3FIR A;  4N91 A;  3H06 B;  5ESY A;  2OJT A;  2RF1 A;  4N13 A;  2L27 A;  3ODB A;  1NKX A;  1A55 A;  3Q26 A;  1J1N A;  1MQH A;  1SW1 A;  5IZZ A;  5FHN A;  4HJ0 A;  5H8N B;  2ZXT A;  2Q9T A;  1NV7 A;  5LDZ A;  1FPK A;  2F6P A;  2Z22 A;  2Z8E A;  4JBZ A;  2CZL A;  3MZ1 A;  1B0H A;  3PPO A;  4ZZA A;  4AB6 A;  3MW0 A;  4GWY A;  5L9S A;  3V89 B;  4NGU A;  2HFB A;  2ANJ A;  3B6W A;  4RXL A;  4U1Z A;  3RNN A;  5I2K A;  4RA1 A;  3ILT B;  3K2D A;  1TFA A;  2I6E A;  4OVJ A;  2XXU A;  5EYH A;  2GFE A;  1ZKB A;  4EXK A;  3VXC A;  2A5T B;  5ICQ A;  3DEL B;  1QUJ A;  4IY5 A;  2I0B A;  5EHS A;  4O3A A;  1OIB A;  5ISU A;  1FPD A;  1FPJ A;  1WVJ A;  3FAS A;  4GX6 A;  4PQJ A;  4N07 A;  3N7S A;  1MDQ A;  1A40 A;  3FJM A;  2RIN A;  1SYH A;  4KQP A;  3MYU A;  3KBR A;  3LUY A;  1B7U A;  1NNK A;  1FTA A;  5A5L A;  4R2F A;  4KI0 E;  1FPE A;  4H65 A;  1UIU A;  3N6U A;  4EXL A;  5FHO A;  3F11 A;  4R6Y A;  4PET A;  2REJ A;  2ZZW A;  3B50 A;  4G8M A;  3MQ9 A;  1FTO A;  2DE4 A;  2RKM A;  2O51 A;  2XXH A;  4R6H A;  3QAX A;  3VFJ A;  2F35 A;  3IAZ A;  1VE4 A;  1RYX A;  2DVZ A;  1MXY A;  5EQ9 A;  2HXR A;  1SI1 A;  3FXB A;  3L6H A;  4GIZ A;  3W9W A;  5ET7 A;  3PV0 E;  3GBA A;  3MP8 A;  2I4C A;  2WBB A;  1NV3 A;  2DXY A;  4JVC A;  4F22 A;  4ZGM A;  4WKM A;  1VDW A;  2UVG A;  3BKI B;  3CIJ A;  5AA2 B;  4N15 A;  5II0 A;  3SEU A;  4PP0 A;  1AOV A;  1YYZ A;  5H8Q A;  1S50 A;  1L5T A;  4IO2 A;  1NV2 A;  2V93 A;  3CG1 A;  4U22 A;  4WEP A;  3VV5 A;  3MVX A;  4TQU Q;  4XKQ A;  1O63 A;  2ONS A;  4MEV A;  1VR5 A;  3RLF E;  3Q27 A;  3KOS A;  2HCA A;  5CBS A;  1N0T A;  3TEL A;  4QFN A;  2DXR A;  2XXP A;  1N3W A;  3CFL A;  1LB8 A;  4HTG A;  3IOT A;  4O7I A;  3MP6 A;  2QPQ A;  5L9M A;  4LZ8 A;  3VLW A;  3HV1 A;  4MHF A;  4FEC A;  4RJZ A;  2DYX A;  1IXI A;  3QIM A;  2ABH A;  4MFI A;  1ZIU A;  2DS9 A;  1POY 1;  4PE5 B;  2F3D A;  2WX9 A;  4Q5T A;  3PUW E;  1YXI A;  1ELJ A;  1JW1 A;  4KCC A;  2WBD A;  2VP1 A;  4U23 A;  2I3W A;  4P47 A;  5AA4 A;  3MAM A;  4QSC A;  1MQG A;  1FTK A;  4ZEB A;  1SD3 A;  1YCJ A;  2ZNU A;  4DCY A;  1OQH A;  3HST A;  2Q8M A;  3TCG A;  3N6T A;  1IIW A;  1LAG E;  5DVJ A;  4EQ7 A;  2VHA A;  1Y3N A;  4U2R A;  4PFB A;  1N84 A;  3T22 A;  3IJX B;  2FHY A;  3TOD A;  2RCA A;  4PBH A;  3HHG A;  1EZ9 A;  4MIJ A;  2D3I A;  2H99 A;  2DVC A;  4N6D A;  3N5L A;  3QMF A;  2F8D A;  4F39 A;  4E0X A;  5CBR A;  1B4H A;  1LBY A;  3BFT A;  1SVX B;  4GWU A;  4ZEF A;  4F2O A;  4NQ8 A;  3MZB A;  4ESW A;  4RPN A;  1FQA A;  4ELR A;  3D1R A;  4KR5 A;  2XXW A;  4O7M A;  4M1V A;  4I9D A;  1CE2 A;  1LLS A;  3TQW A;  1PBP A;  2XXT A;  3KG2 A;  4X8R A;  3T96 B;  1VFD A;  3RY3 A;  3RT6 B;  5I56 A;  1OVT A;  4KD5 A;  5IZ3 B;  5IGA A;  4GWS A;  1B3F A;  4QF9 A;  5I57 B;  2DOJ A;  3OSQ A;  1Y4C A;  3LC8 A;  5BWJ A;  1B0L A;  3CG3 A;  1Y1Z A;  2D5W A;  1DCU A;  4MBP A;  3K6X A;  1LBV A;  2XWI A;  2XD2 A;  3SER A;  2ZZV A;  4M4G A;  1IMF A;  4LP2 B;  4GLI A;  4FBP A;  1EYJ A;  4PBQ A;  3E78 A;  1FBD A;  1FJ9 A;  2B3B A;  1PB7 A;  3SES A;  2BJI A;  3FBP A;  4H8I A;  4KCD A;  1D9Q A;  2ALU A;  1B3L A;  3OEL A;  2Y7I A;  2NWJ A;  4PAI A;  3E3K A;  1DOT A;  4F1V A;  2DP8 A;  3JV9 A;  4GVO A;  2JOD A;  2Q2C A;  3HO7 A;  3C59 A;  4QXD A;  4PAK A;  3IB2 A;  4YMB A;  3IO6 A;  2OWS A;  5F1Q A;  1PC3 A;  3CSB A;  5KDT B;  1KZ8 A;  2XWV A;  3I6V A;  4H5F A;  4IO6 A;  4GWO A;  4QFO A;  1B3H A;  4IO4 A;  4NMY A;  1TXF A;  4OET A;  3LUZ A;  4P3L A;  2CZI A;  1D3K A;  4JB7 A;  5T3J A;  4G4P A;  4O3B A;  4PGN A;  2WYK A;  3KBZ A;  4G2Z A;  2P2A A;  4R9G A;  4BLA A;  1FQB A;  4DCX A;  3WAE A;  3EHT A;  4GXA A;  5I2N B;  2QVV A;  5L9O A;  3CVG A;  3O2A A;  4OEN A;  5I58 B;  1GTK A;  2V3Q A;  2CEY A;  3KC1 A;  4IO5 A;  3KEI A;  5ITO A;  1MQD A;  4OTE A;  1UTH A;  1LBX A;  3FXU A;  4H5G A;  2XD3 A;  1FBG A;  3EPE A;  2ESN A;  3H6W A;  4U4S A;  4N81 A;  3IL1 B;  2VOZ A;  2FVZ A;  4OVS A;  3PUY E;  1WOD A;  1NFT A;  4ELP A;  2I0C A;  3PUX E;  2V4C A;  1GVC A;  1H76 A;  4JWY A;  1OMP A;  2I48 A;  3FXR A;  5TP9 A;  1SDX A;  5ET6 A;  1IXH A;  4NHB A;  4KYD A;  1POT A;  3SEV A;  5H8F A;  1JET A;  3M3K A;  1PB8 A;  3E79 A;  4JWX A;  3TUS A;  3VE1 B;  1QUL A;  2VGQ A;  5ET8 A;  5CMB A;  3O66 A;  4GD5 A;  1QVS A;  3CR9 A;  4F29 A;  4LA9 A;  4OHN A;  3FAT A;  4DDD A;  3FXQ A;  5CC2 A;  3T9U A;  4YAH X;  4MAG A;  3OEN A;  2M8C A;  4MF3 A;  4F1Y A;  2F3B A;  2F5X A;  3FGS A;  5F24 A;  1ANF A;  5KCJ A;  1MPC A;  3Q28 A;  3A3U A;  5EYF A;  3C4M A;  4NED A;  1FBH A;  4O3C A;  4FE8 A;  1Y3Q A;  3LSW A;  2OLB A;  4Z0I A;  2IA4 A;  5ELV A;  1FQC A;  2Y5L A;  3PPN A;  2OCU A;  2PBW A;  3QSL A;  4IB2 A;  3TTR A;  1N04 A;  3TKD A;  2DQV A;  3OO8 A;  1H45 A;  4LN5 A;  1JNF A;  4H6D A;  3H6V A;  4P1L A;  2UVJ A;  3OO9 A;  2F6G A;  4BDL A;  1UQW A;  1QW0 A;  4G61 A;  4YU0 A;  3IX1 A;  1NL5 A;  2JJK A;  1JP4 A;  1NUZ A;  3S9E A;  4NWC A;  1Z7M E;  3EF7 A;  4KPT A;  4HE1 A;  1QJM A;  4QRZ A;  4F18 A;  1LFH A;  3OXN A;  4NG7 A;  4P56 A;  4NX1 A;  4OEU A;  4L17 A;  4R73 A;  4IGR A;  1B5H A;  1FCK A;  1VSO A;  3TEP A;  3S9L C;  4XF5 A;  5HPQ A;  1B7Z A;  3MVZ A;  4ZE8 A;  4F19 A;  3MVY A;  4QBA A;  4P9K A;  3C36 A;  2PT1 A;  1XVY A;  3SEW A;  3BFU A;  1FBF A;  4DI3 D;  1H3D A;  3PPR A;  4NF0 A;  1LBW A;  2F78 A;  1P99 A;  1MQJ A;  1N7W A;  1FPF A;  1AH5 A;  5H8N A;  4GQO A;  2WKY A;  3EHS A;  5LTC A;  4I8C A;  2OK2 A;  4TLL B;  2RC7 A;  1A99 A;  4ZZE A;  3QUJ A;  1M5E A;  3MBP A;  3M3F A;  3RUM A;  5TPA B;  1G0H A;  3QUF A;  1R9L A;  4YKP A;  4YKJ A;  1TFD A;  1BK4 A;  2ZYM A;  4YKK A;  2AL5 A;  2DWH A;  4P8B A;  3MC2 A;  2QS1 A;  4NF8 B;  4ZEI A;  4R75 A;  3PD8 A;  2WYP A;  2H25 A;  3MUQ A;  4GRK A;  2O7I A;  1N3X A;  1XS5 A;  5AA3 A;  3FVK A;  2GHB A;  3IK6 B;  3G3J A;  4NF6 B;  1MH3 A;  1XC1 A;  1DTG A;  4R2B A;  4DIG A;  4Z7E A;  1Q9D A;  4R72 A;  1II5 A;  3C32 A;  3O28 A;  3IOU A;  5EQ7 A;  5H8S A;  4ZE9 A;  4PTK A;  5B70 A;  3O6I A;  2FIX A;  2XDG A;  3FJ7 A;  5I59 B;  1FTL A;  3KN7 A;  4N6K A;  4P11 A;  2XWK A;  3ZS6 A;  4XKP A;  3E4R A;  1NV6 A;  1QUK A;  4IO3 A;  4JWO A;  2DSF A;  1SW5 A;  3SKP A;  4RK2 A;  4OFJ A;  3ZSF A;  4FAT A;  1GV8 A;  3B6Q A;  4G68 C;  3L6G A;  4ELQ A;  3B7D A;  1WDN A;  4POW A;  4YB6 A;  2FBP A;  3PUV E;  1MPB A;  2XWO A;  3U72 A;  2CEX A;  1ZU0 A;  3GLB A;  4MLQ A;  1B9J A;  4N8Y A;  4OA4 A;  1LEV A;  4TOZ A;  4U4X A;  5DYH A;  1Z7N E;  4BDN A;  5AA2 A;  3HPI A;  3MPL A;  5KZT A;  1FTJ A;  1IQ7 A;  4ZEC A;  2GQ1 A;  4R74 A;  1B5I A;  3R7X A;  4X48 A;  3W15 C;  3K6W A;  3H4Z A;  2XXK A;  4IR8 A;  4OVP A;  3IOV A;  1OVB A;  4FED A;  4FJP A;  4PDD A;  5FTI A;  3E9X A;  3PMW A;  1P1Q A;  1ZMG A;  4MJO A;  4DLD A;  5IKB A;  3PTY A;  1XI6 A;  2JNC A;  3GBB A;  4X1B A;  5IZ1 A;  3LV0 A;  4QSD A;  3S9M C;  1D9V A;  5I84 A;  3WAF A;  3DM0 A;  4P1E A;  1U34 A;  2I4B A;  4PGP A;  1Q35 A;  1FBE A;  4I3Y A;  3C5T A;  4EF1 A;  3ONM A;  3MJN A;  1URS A;  1P1U A;  5I5P A;  3M3L A;  5H8H B;  1DSN A;  2FYI A;  1FPG A;  2KR0 A;  3N7R A;  3UP9 A;  3D4G A;  3KGC A;  2O1L A;  3KN8 A;  1IMB A;  4DZ1 A;  2HZK A;  1B6H A;  1P1O A;  1INP A;  4NAP A;  3R26 A;  4ND9 A;  3U65 A;  5ITP A;  2O68 A;  4PFT A;  1IUD A;  4F3S A;  3VLV A;  3BIG A;  1PBQ A;  3V83 A;  2B3F A;  1TWY A;  4N8G A;  5CMM A;  1MXX A;  2QS3 A;  1XVX A;  4H1X A;  2QVU A;  2E0S A;  2RC9 A;  1MRP A;  2V3T A;  3IO4 A;  1B32 A;  1LFI A;  4G8H A;  2P3V A;  2OZZ A;  5HBC A;  3RPL B;  2KQZ A;  4OYV A;  1B58 A;  3UK4 A;  4R9F A;  2Y7R A;  1R9Q A;  3RQT A;  1B1X A;  2ZYN A;  4EDP A;  2B65 A;  1F9B A;  3RTF B;  4GWZ A;  3K0V A;  4HW8 A;  5M2V A;  3H7M A;  3CSG A;  4YKI A;  2HEU A;  5L8D A;  5ET5 A;  4NF5 A;  4N6P A;  3CRB A;  4FEB A;  1MY2 A;  4PCD A;  2JND A;  1Y1M A;  2GRV A;  5IZ3 A;  4YB5 A;  1DTZ A;  1IIT A;  3ILU B;  4RNS A;  1MM6 A;  4GX4 A;  3T9X B;  5FTH A;  3OEM A;  3AXF A;  3W9V A;  3H6U A;  3IR1 A;  2Z8F A;  4NF4 B;  1MXV A;  4IO7 A;  4DXB A;  3KJT A;  4LZ7 A;  1CB6 A;  2V84 A;  4YB7 A;  3K1P A;  3MZ9 A;  3IOW A;  3KN3 A;  4ERS A;  4MCO A;  3T93 B;  1FPI A;  2QMW A;  3PD9 A;  1LAF E;  4RY1 A;  4LZ5 A;  2KLF A;  1JEV A;  1EZP A;  1NV4 A;  1HSJ A;  5KDT A;  1K9Y A;  3TFL A;  3TPA A;  3IFA A;  1BLF A;  3QXM A;  1RYO A;  3B6T A;  2O1M A;  3UIF A;  2VD2 A;  3NOH A;  3TTM A;  5I56 B;  3JZJ A;  3RPW A;  1GR2 A;  2PX1 A;  1B46 A;  5I2N A;  1EYI A;  3PUZ E;  1A54 A;  1Y4T A;  2NUV A;  5I58 A;  5CMC A;  2QS2 A;  2A5S A;  5B7D A;  4OMB A;  4DLO A;  2Z8D A;  1US4 A; 
#chains in the Genus database with same CATH homology
 1YTV A;  2Y84 A;  3VDF A;  5FHM A;  5IAI A;  4THI A;  3UOR A;  3FV1 A;  2HAU A;  3C34 A;  4JXI A;  1MS7 A;  4XKN A;  4ZDM A;  4JDF A;  4YMA A;  3QYT A;  4OZ9 A;  2AL4 A;  2R6G E;  1B51 A;  3KOT A;  3MVW A;  2Z23 A;  4U1O A;  3O6H A;  5CM6 A;  3KSX A;  1MY1 A;  1B2H A;  4H8J A;  1EZO A;  4ZEK A;  1UTB B;  2ZMB A;  1IXC A;  2ZYK A;  2NVU B;  3GZG A;  4HS7 A;  4OXV A;  4OFO A;  3KJ7 A;  4YZZ A;  1P1N A;  5K2X A;  2YJP A;  2QMX A;  3VLU A;  1M5D A;  3O9P A;  1S7Y A;  3Q25 A;  5TP9 B;  2Y7W A;  1PB9 A;  2QRY A;  1KWH A;  3OO7 A;  3RGY A;  3CI8 A;  4KFQ A;  5TU0 A;  4LVQ A;  4LQ5 A;  3VXB A;  4ESX A;  1D9Y A;  2F7B A;  3UGW A;  3C33 A;  4EQ9 A;  3DLN A;  1BP5 A;  1LCT A;  2F7A A;  1QUI A;  3K6U A;  4Q0C A;  3PMX A;  4Q30 B;  3V5A A;  5KCJ B;  5JTY B;  4RYA A;  3RT8 A;  4EUO A;  1LST A;  5JEI A;  1I6B A;  5LOM A;  3ECR A;  5JK4 A;  4R6K A;  3UN6 A;  4G68 B;  1N7X A;  2IEE A;  2AIX A;  2I58 A;  3MWB A;  4WXJ A;  3K4U A;  3TZA A;  1IZ1 A;  3FZV A;  2UYF A;  3Q29 A;  2QJE A;  2OBG A;  1XOC A;  1B5J A;  3EHU A;  3PGF A;  1BIY A;  4RK9 A;  2V3U A;  4QSE A;  3K6V A;  1BKA A;  5DEX B;  5AE4 A;  2O6A A;  4PFU A;  1IXG A;  4POX A;  3TMG A;  3SET A;  5A5X B;  1D4N A;  3RN8 A;  3K02 A;  4NF8 A;  3OD7 A;  2ZNS A;  2PMS A;  3S9N C;  3A3C A;  2X7P A;  1FQD A;  3OEK A;  1SW4 A;  3PPQ A;  1SI0 A;  1SQY A;  1A7L A;  3K00 A;  1Y20 A;  3LSL A;  3FJG A;  3U92 A;  2D21 A;  4E0W A;  5I59 A;  4OFL A;  1USY E;  2A5T A;  1B1H A;  1US5 A;  4OEV A;  4LAT A;  3TYH A;  1UIV A;  1HSL A;  3U1O A;  4X1D A;  2F34 A;  2XXI A;  2THI A;  3EQ1 A;  2HZL A;  1SW2 A;  2R71 A;  1ATG A;  2AYS A;  2F36 A;  1XHY A;  3PMV A;  3TTK A;  2O84 X;  4TLM B;  4KYE A;  2QSX A;  3K1N A;  2P1S A;  2HAV A;  4BDR A;  4C1T A;  3T9H B;  1FW0 A;  3GXA A;  2QS4 A;  4IGT A;  3U93 A;  2FNC A;  3VVD A;  2OWT A;  1O7T A;  1OLC A;  1ZJL A;  2Q2A A;  4JSO A;  3C31 A;  2RC8 A;  4MLV A;  4GL0 A;  4QFP A;  2E1S A;  1LGB C;  2DE3 A;  4BDQ A;  4MH5 A;  2I3V A;  1ZBM A;  3HN0 A;  5I2K B;  1DPE A;  3LR1 A;  4PFY A;  3OSR A;  1NNP A;  1SYI A;  1VFE A;  4ZED A;  3N7P A;  2UVI A;  1MXZ A;  3FVG A;  1USY H;  5EHM A;  1YAE A;  1JQF A;  1NNF A;  2ONK E;  2YLN A;  1EH3 A;  3TQL A;  3ZKK A;  2GHA A;  5H8H A;  3G3G A;  2HQ0 A;  4QFL A;  1LBB A;  4I62 A;  3DP8 A;  4FIM A;  4BDO A;  2O69 A;  1Q1K A;  1MQI A;  2REG A;  4KYS A;  4BDM A;  1FQF A;  1QKA A;  4F31 B;  1IEJ A;  3T66 A;  4F3G A;  3FUZ A;  1LAX A;  5F7V A;  1TT1 A;  3TTN A;  3E13 X;  4WED A;  4K3F A;  1LCF A;  5H8Q B;  1AIV A;  3R6U A;  3FVN A;  3H03 A;  1SBP A;  1B3G A;  1NH7 A;  1B7H A;  1ZTY A;  3DP6 A;  1H43 A;  4F3B A;  4PFW A;  2DWI A;  2XHD A;  1B4Z A;  2Q88 A;  3V8X B;  2I49 A;  3IB1 A;  2UXA A;  3UA8 A;  4G77 A;  4C0R A;  3EN3 A;  5DVF A;  4GXS B;  4OWD A;  4DXU A;  3T9V A;  4LUB A;  4I1D A;  2X26 A;  1FQE A;  3SEY A;  1URD A;  3OO6 A;  4QHQ A;  5CI5 A;  1NNT A;  3IJO B;  4NF4 A;  4EQB A;  3DP4 A;  1URG A;  4LON B;  3P7I A;  2DWJ A;  3SEX A;  3HCQ A;  5I57 A;  3G7W A;  3SDF A;  4GFR A;  2F97 A;  3KZG A;  4NWD A;  1MG1 A;  2Q89 A;  3CFZ A;  4G8N A;  5AA4 B;  3TCH A;  2XX8 A;  1JVY A;  2RCB A;  1OQG A;  3C9H A;  4YIC A;  1M5B A;  1DPP A;  3G3K A;  3A09 A;  4GOT A;  2YPN A;  1O64 A;  1NH8 A;  1JW5 A;  2DE2 A;  2P0S A;  2H4I A;  4NF5 B;  1JVX A;  5AA2 D;  3BBR A;  1A8F A;  2XXY A;  2ZYO A;  3VVE A;  2ONR A;  3USD A;  4Q8R A;  1I6A A;  3K01 A;  3U94 A;  4F2Q A;  3D4C A;  4OES A;  4H67 A;  4H0W A;  3ZKL A;  1S9T A;  1B40 A;  2CMO A;  2W7Y A;  1H44 A;  4ELO A;  1A8E A;  1JW4 A;  5HM4 B;  2BJJ X;  2FA7 A;  3TAJ A;  3PU5 A;  2V25 A;  1RKM A;  3LSX A;  4ISU A;  1LFG A;  1P1W A;  3LBS A;  4HCW A;  1PEB A;  3HHF A;  3O97 A;  5DVI A;  4ECF A;  4OQO A;  1QKB A;  4ZS9 A;  3CFX A;  2PVU A;  2XXR A;  3PPP A;  2NOO A;  3K1M A;  2HXW A;  2QKH A;  1JEU A;  3L2J A;  4FOR A;  3RTW B;  2PT2 A;  3O6G A;  2Y7P A;  2ZNT A;  3LSF B;  3IOL A;  3O29 A;  4P0I A;  3S4U A;  1UTB A;  1MY3 A;  4UA8 A;  3THI A;  4JSD A;  1R1N A;  2UVH A;  5DT6 A;  1ZLQ A;  3I5O A;  2DWA A;  2QL3 A;  2H98 A;  5J1D A;  3S2V A;  4X9T A;  2PYY A;  3AQF B;  1MPD A;  3QK6 A;  1M5F A;  2UYE A;  2NXO A;  4LF3 C;  2XXQ A;  2F7C A;  4P0G A;  1UTH B;  1GGG A;  3JYR A;  2XXX A;  4DE8 A;  1N76 A;  4IY6 A;  1AL3 A;  1MY0 A;  1I69 A;  2Q8J A;  3TTL A;  4U21 A;  4RPO A;  4EF2 A;  1DMB A;  2Y7K A;  3H6T A;  3IOR A;  3H3G A;  3G3F A;  4HCY A;  1B05 A;  3IB0 A;  5JTY A;  1MXW A;  1XT8 A;  4NTL A;  5H8F B;  3VVF A;  3KFM A;  4AB5 A;  2G93 A;  3MPK A;  4G68 A;  3U8Q A;  2H9B A;  1B52 A;  2XXV A;  3TDJ A;  4F1U A;  4GF8 A;  4QFK A;  3N26 A;  1R6Z A;  5BUU A;  2H5Y A;  1MM7 A;  5AA1 A;  3OOA A;  4XKR A;  4F3P A;  1EU8 A;  1AMF A;  5DEX A;  4C1U A;  3FVO A;  1LBC A;  1MDP 1;  1LAH E;  4FAJ A;  2X7Q A;  1T0K A;  4AQ4 A;  3FV2 A;  2XX9 A;  1HSE A;  4ONY A;  1Y3P A;  2O7U A;  3N94 A;  5CRY A;  1MXU A;  5A5X A;  3TCF A;  1FTM A;  1M5C A;  4XTC Q;  1B3E A;  4DXC A;  4OER A;  1MY4 A;  4KHZ E;  1OLA A;  1NMU A;  1BTJ A;  1Y9U A;  4GL8 A;  5TPA A;  2VD3 A;  5DTB A;  3G3I A;  3G3H A;  3MP1 A;  2G29 A;  4NE4 A;  1I6Q A;  4UAC A;  1YPN A;  3C35 A;  2R9J A;  3I3V A;  4LQ2 A;  1PDA A;  2LAO A;  4XXU A;  1LB9 A;  5CMK A;  3FD3 A;  2XX7 A;  4DLQ A;  1MH4 A;  4NF6 A;  3M8U A;  2GH9 A;  3KSJ A;  5ICT A;  3OMB A;  5K2Y A;  4XIG Q;  3FIR A;  3H06 B;  2OJT A;  2RF1 A;  4N13 A;  2L27 A;  3ODB A;  1NKX A;  1A55 A;  3Q26 A;  1J1N A;  1MQH A;  1SW1 A;  5FHN A;  4HJ0 A;  5H8N B;  2ZXT A;  2Q9T A;  2F6P A;  2Z22 A;  2Z8E A;  4JBZ A;  2CZL A;  3MZ1 A;  1B0H A;  3PPO A;  4ZZA A;  4AB6 A;  3MW0 A;  5L9S A;  3V89 B;  2HFB A;  2ANJ A;  3B6W A;  4RXL A;  4U1Z A;  3RNN A;  5I2K A;  4RA1 A;  3ILT B;  3K2D A;  1TFA A;  2I6E A;  4OVJ A;  2XXU A;  4EXK A;  2GFE A;  1ZKB A;  3VXC A;  2A5T B;  5ICQ A;  3DEL B;  1QUJ A;  4IY5 A;  2I0B A;  5EHS A;  4O3A A;  1OIB A;  5ISU A;  1WVJ A;  3FAS A;  4PQJ A;  4N07 A;  3N7S A;  1MDQ A;  1A40 A;  3FJM A;  2RIN A;  1SYH A;  4KQP A;  3KBR A;  3LUY A;  1B7U A;  1NNK A;  4R2F A;  4KI0 E;  4H65 A;  1UIU A;  3N6U A;  4EXL A;  5FHO A;  3F11 A;  4R6Y A;  4PET A;  2REJ A;  4G8M A;  3MQ9 A;  1FTO A;  2DE4 A;  2RKM A;  2O51 A;  2XXH A;  4R6H A;  3QAX A;  3VFJ A;  2F35 A;  3IAZ A;  1VE4 A;  1RYX A;  2DVZ A;  1MXY A;  1SI1 A;  3L6H A;  4GIZ A;  3W9W A;  3PV0 E;  3GBA A;  3MP8 A;  2I4C A;  2DXY A;  4F22 A;  4ZGM A;  4WKM A;  2UVG A;  3BKI B;  3CIJ A;  5AA2 B;  5II0 A;  3SEU A;  4PP0 A;  1AOV A;  5H8Q A;  1S50 A;  1L5T A;  4IO2 A;  2V93 A;  3CG1 A;  4U22 A;  4WEP A;  3VV5 A;  3MVX A;  4TQU Q;  4XKQ A;  1O63 A;  2ONS A;  1VR5 A;  3RLF E;  3Q27 A;  3KOS A;  2HCA A;  5CBS A;  1N0T A;  3TEL A;  4QFN A;  2DXR A;  2XXP A;  1N3W A;  3CFL A;  1LB8 A;  4HTG A;  3IOT A;  3MP6 A;  2QPQ A;  5L9M A;  4LZ8 A;  3VLW A;  3HV1 A;  4FEC A;  4RJZ A;  2DYX A;  1IXI A;  3QIM A;  2ABH A;  4MFI A;  1ZIU A;  2DS9 A;  1POY 1;  4PE5 B;  4Q5T A;  3PUW E;  1ELJ A;  1JW1 A;  4KCC A;  2VP1 A;  4U23 A;  2I3W A;  5AA4 A;  3MAM A;  4QSC A;  1MQG A;  1FTK A;  4ZEB A;  1SD3 A;  1YCJ A;  2ZNU A;  4DCY A;  1OQH A;  3HST A;  3TCG A;  3N6T A;  1IIW A;  1LAG E;  5DVJ A;  4EQ7 A;  2VHA A;  1Y3N A;  4U2R A;  1N84 A;  3T22 A;  3IJX B;  3TOD A;  2RCA A;  3HHG A;  1EZ9 A;  2D3I A;  2H99 A;  2DVC A;  3N5L A;  2F8D A;  4F39 A;  4E0X A;  5CBR A;  1B4H A;  3BFT A;  1SVX B;  4ZEF A;  4F2O A;  4ESW A;  3MZB A;  4RPN A;  1FQA A;  4ELR A;  4KR5 A;  2XXW A;  4M1V A;  4I9D A;  1CE2 A;  1LLS A;  3TQW A;  1PBP A;  2XXT A;  3KG2 A;  3T96 B;  1VFD A;  3RY3 A;  3RT6 B;  5I56 A;  1OVT A;  4KD5 A;  1B3F A;  4QF9 A;  5I57 B;  2DOJ A;  3OSQ A;  1Y4C A;  3LC8 A;  5BWJ A;  1B0L A;  3CG3 A;  1Y1Z A;  2D5W A;  4MBP A;  3K6X A;  2XD2 A;  3SER A;  4M4G A;  4LP2 B;  4GLI A;  2B3B A;  1PB7 A;  3SES A;  4H8I A;  4KCD A;  2ALU A;  1B3L A;  3OEL A;  2Y7I A;  2NWJ A;  3E3K A;  1DOT A;  4F1V A;  2DP8 A;  3JV9 A;  4GVO A;  2JOD A;  2Q2C A;  3HO7 A;  3C59 A;  3IB2 A;  4YMB A;  3IO6 A;  2OWS A;  5F1Q A;  1PC3 A;  3CSB A;  5KDT B;  3I6V A;  4H5F A;  4IO6 A;  4GWO A;  4QFO A;  1B3H A;  4IO4 A;  4NMY A;  1TXF A;  4OET A;  1D3K A;  4JB7 A;  4G4P A;  4O3B A;  4G2Z A;  2P2A A;  4R9G A;  4BLA A;  1FQB A;  4DCX A;  3WAE A;  3EHT A;  4GXA A;  5I2N B;  5L9O A;  3CVG A;  3O2A A;  4OEN A;  5I58 B;  1GTK A;  2V3Q A;  4IO5 A;  3KEI A;  5ITO A;  1MQD A;  4OTE A;  1UTH A;  3FXU A;  4H5G A;  2XD3 A;  3EPE A;  2ESN A;  3H6W A;  4U4S A;  3IL1 B;  2VOZ A;  3PUY E;  1WOD A;  1NFT A;  4ELP A;  2I0C A;  3PUX E;  1GVC A;  1H76 A;  4JWY A;  1OMP A;  2I48 A;  3FXR A;  5TP9 A;  1SDX A;  1IXH A;  4KYD A;  1POT A;  3SEV A;  5H8F A;  1JET A;  3M3K A;  1PB8 A;  4JWX A;  3TUS A;  3VE1 B;  1QUL A;  2VGQ A;  5CMB A;  3O66 A;  4GD5 A;  1QVS A;  3CR9 A;  4F29 A;  4LA9 A;  4OHN A;  3FAT A;  4DDD A;  3FXQ A;  5CC2 A;  3T9U A;  4YAH X;  3OEN A;  2M8C A;  4MF3 A;  4F1Y A;  2F5X A;  3FGS A;  1ANF A;  5KCJ A;  1MPC A;  3Q28 A;  3A3U A;  5EYF A;  3C4M A;  4NED A;  4O3C A;  4FE8 A;  1Y3Q A;  3LSW A;  2OLB A;  4Z0I A;  2IA4 A;  5ELV A;  1FQC A;  3PPN A;  2OCU A;  2PBW A;  3QSL A;  4IB2 A;  3TTR A;  1N04 A;  3TKD A;  2DQV A;  3OO8 A;  1H45 A;  1JNF A;  4H6D A;  3H6V A;  2UVJ A;  3OO9 A;  2F6G A;  4BDL A;  1UQW A;  1QW0 A;  4YU0 A;  3IX1 A;  1NL5 A;  3S9E A;  4NWC A;  1Z7M E;  3EF7 A;  4KPT A;  1QJM A;  4QRZ A;  4F18 A;  1LFH A;  3OXN A;  4OEU A;  4L17 A;  4R73 A;  4IGR A;  1B5H A;  1FCK A;  1VSO A;  3TEP A;  3S9L C;  5HPQ A;  1B7Z A;  3MVZ A;  4ZE8 A;  4F19 A;  3MVY A;  3C36 A;  2PT1 A;  1XVY A;  3SEW A;  3BFU A;  1H3D A;  3PPR A;  2F78 A;  1P99 A;  1MQJ A;  1N7W A;  1AH5 A;  5H8N A;  4GQO A;  2WKY A;  3EHS A;  4I8C A;  2OK2 A;  4TLL B;  2RC7 A;  1A99 A;  4ZZE A;  3QUJ A;  1M5E A;  3MBP A;  3M3F A;  3RUM A;  5TPA B;  3QUF A;  1R9L A;  4YKP A;  4YKJ A;  1TFD A;  2ZYM A;  4YKK A;  2AL5 A;  2DWH A;  3MC2 A;  2QS1 A;  4NF8 B;  4ZEI A;  4R75 A;  3PD8 A;  2H25 A;  3MUQ A;  4GRK A;  2O7I A;  1N3X A;  1XS5 A;  5AA3 A;  3FVK A;  2GHB A;  3IK6 B;  3G3J A;  4NF6 B;  1MH3 A;  1XC1 A;  1DTG A;  4R2B A;  4DIG A;  4Z7E A;  4R72 A;  1II5 A;  3C32 A;  3O28 A;  3IOU A;  5H8S A;  4ZE9 A;  5B70 A;  3O6I A;  2XDG A;  3FJ7 A;  5I59 B;  1FTL A;  3KN7 A;  4P11 A;  3ZS6 A;  4XKP A;  3E4R A;  1QUK A;  4IO3 A;  4JWO A;  2DSF A;  1SW5 A;  3SKP A;  4RK2 A;  4OFJ A;  3ZSF A;  4FAT A;  1GV8 A;  3B6Q A;  4G68 C;  3L6G A;  4ELQ A;  3B7D A;  1WDN A;  4POW A;  4YB6 A;  3PUV E;  1MPB A;  3U72 A;  1ZU0 A;  3GLB A;  4MLQ A;  1B9J A;  4TOZ A;  4U4X A;  5DYH A;  1Z7N E;  4BDN A;  5AA2 A;  3HPI A;  3MPL A;  5KZT A;  1FTJ A;  1IQ7 A;  4ZEC A;  4R74 A;  1B5I A;  3R7X A;  4X48 A;  3W15 C;  3K6W A;  3H4Z A;  3IOV A;  1OVB A;  4FED A;  4FJP A;  5FTI A;  3E9X A;  3PMW A;  1P1Q A;  1ZMG A;  4DLD A;  5IKB A;  2JNC A;  3GBB A;  4X1B A;  4QSD A;  3S9M C;  1D9V A;  5I84 A;  3WAF A;  3DM0 A;  1U34 A;  2I4B A;  1Q35 A;  3C5T A;  4EF1 A;  3ONM A;  3MJN A;  1URS A;  1P1U A;  3M3L A;  5H8H B;  1DSN A;  2FYI A;  3N7R A;  3UP9 A;  3D4G A;  3KGC A;  2O1L A;  3KN8 A;  4DZ1 A;  2HZK A;  1B6H A;  1P1O A;  3R26 A;  4ND9 A;  5ITP A;  2O68 A;  4PFT A;  1IUD A;  4F3S A;  3VLV A;  1PBQ A;  3V83 A;  2B3F A;  1TWY A;  5CMM A;  1MXX A;  2QS3 A;  1XVX A;  4H1X A;  2E0S A;  2RC9 A;  1MRP A;  2V3T A;  3IO4 A;  1B32 A;  1LFI A;  4G8H A;  5HBC A;  2OZZ A;  4OYV A;  1B58 A;  3UK4 A;  4R9F A;  2Y7R A;  1R9Q A;  3RQT A;  1B1X A;  2ZYN A;  4EDP A;  2B65 A;  1F9B A;  3RTF B;  3K0V A;  4HW8 A;  5M2V A;  3H7M A;  3CSG A;  4YKI A;  2HEU A;  5L8D A;  4NF5 A;  4N6P A;  3CRB A;  4FEB A;  1MY2 A;  2JND A;  1Y1M A;  2GRV A;  4YB5 A;  1DTZ A;  1IIT A;  3ILU B;  4RNS A;  1MM6 A;  3T9X B;  5FTH A;  3OEM A;  3AXF A;  3W9V A;  3H6U A;  3IR1 A;  2Z8F A;  4NF4 B;  1MXV A;  4IO7 A;  4DXB A;  3KJT A;  4LZ7 A;  1CB6 A;  2V84 A;  4YB7 A;  3K1P A;  3MZ9 A;  3IOW A;  3KN3 A;  4ERS A;  3T93 B;  2QMW A;  3PD9 A;  1LAF E;  4RY1 A;  4LZ5 A;  2KLF A;  1JEV A;  1EZP A;  5KDT A;  1HSJ A;  3TFL A;  3TPA A;  1BLF A;  3QXM A;  1RYO A;  3B6T A;  2O1M A;  3UIF A;  2VD2 A;  3TTM A;  5I56 B;  3JZJ A;  3RPW A;  1GR2 A;  2PX1 A;  1B46 A;  5I2N A;  3PUZ E;  1A54 A;  1Y4T A;  2NUV A;  5I58 A;  5CMC A;  2QS2 A;  2A5S A;  5B7D A;  4OMB A;  4DLO A;  2Z8D A;  1US4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...