3C4MA

Structure of human parathyroid hormone in complex with the extracellular domain of its g-protein-coupled receptor (pth1r)
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
519
structure length
469
Chain Sequence
AKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNAAAEFDDVMTKEEQIFLLHRAQAQCEKRLKEVRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of parathyroid hormone by its G protein-coupled receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Fusion protein of Maltose-binding periplasmic protein and Pa
total genus 154
structure length 469
sequence length 519
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF02793 HRM Hormone receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3c4mA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3c4mA01
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 3c4mA03
1FQAA 3SKPA 1PBQA 2BJJX 3H4ZA 5CM6A 3K01A 3K1PA 3HHGA 3K2DA 4KYEA 4ZS9A 3R7XA 3KN8A 4X1BA 1PEBA 3QUFA 3T22A 4KCDA 1ZMGA 3IL1B 3HSTA 5FTHA 3U8QA 2ZNSA 1AH5A 2O7IA 3PMWA 4LATA 4IY6A 4FE8A 4Q30B 5EYFA 3UGWA 2ABHA 4ZE9A 3PPQA 3LSFB 2Z8EA 2Y7KA 3OMBA 4ZEKA 1N0TA 1QW0A 4IO5A 1B7UA 1MXUA 1SI0A 1S9TA 2CMOA 1I6AA 3ODBA 3TQLA 1QUKA 4EQ7A 2Q8JA 5ITOA 4QRZA 4OEVA 3RPWA 1XS5A 3DM0A 3C4MA 1AOVA 4H8JA 1B58A 4HCWA 4IO3A 3FV2A 4ZEBA 2DVCA 5HPQA 2D3IA 5J1DA 5JEIA 3KEIA 1JETA 2NOOA 2ONSA 2PVUA 2XHDA 1NNTA 1XC1A 4QSDA 3C31A 5TP9A 1B5IA 3TYHA 4E0WA 1FTOA 4F1YA 1MQIA 3N94A 5IAIA 5H8SA 3HPIA 3OO8A 4DXBA 3SERA 3H06B 4MH5A 3IOLA 3Q25A 1S50A 2DP8A 5H8HB 5K2YA 4TQUQ 3VVDA 4OWDA 1S7YA 4MBPA 5HBCA 1N04A 2A5TB 3KSXA 1CE2A 4OESA 1XT8A 4R74A 3FUZA 2DSFA 5II0A 1Q35A 3M3LA 3SEXA 1NH8A 3RQTA 4R6KA 1MG1A 5FTIA 1B3FA 1BKAA 2VOZA 1Y4TA 3K6UA 1N7WA 2I0BA 3MP8A 3MUQA 3Q29A 4Q5TA 4ZECA 3I6VA 4F1UA 1LBCA 4OQOA 2G93A 4RXLA 4H8IA 2ZYKA 2DWHA 5I57B 2DYXA 1BLFA 2Q88A 5ISUA 2RINA 3KG2A 4YKJA 4YZZA 3TTKA 1AIVA 1I6BA 1M5BA 3G3KA 3PUWE 3G3JA 1XOCA 4FECA 1US4A 4IO7A 4KPTA 4NF4B 3MQ9A 5CMKA 2V93A 3S4UA 3K1NA 2F36A 4GQOA 1OLCA 3UP9A 1O64A 1Y3NA 3L6GA 5CRYA 3N26A 2XXUA 1IXGA 1VFEA 2F7AA 1B0HA 2HXWA 2XXHA 3CR9A 3TZAA 1MXZA 5H8FA 2ALUA 2Q2AA 3G7WA 3FVKA 4H5GA 1B7ZA 1FW0A 1NL5A 1SD3A 4I1DA 3CSGA 3DLNA 3IOWA 2ESNA 3ECRA 3H6TA 4OMBA 2P2AA 1MY2A 3T9UA 3O97A 3M3FA 1B52A 1NMUA 3KGCA 5TPAB 1RYXA 3MPLA 4G77A 4LZ5A 3PMVA 2OZZA 1IXHA 2RCBA 1DTZA 4JWOA 5TU0A 3T93B 4YMBA 4F1VA 1O63A 1ZLQA 1URSA 2KLFA 4OFLA 4PFWA 4DZ1A 4FAJA 3K00A 4OTEA 1B40A 1JW1A 4BLAA 3PPNA 1SW1A 3ZKKA 5L9MA 3TUSA 3JV9A 3RGYA 1MQJA 1OLAA 2DWJA 3FVGA 2QMXA 3JZJA 3LSLA 3TQWA 1PB8A 1QKAA 4IGTA 4DCXA 2FNCA 1OVTA 3C36A 2DXRA 3MVYA 4ZZAA 5L9SA 5AA2D 1BIYA 3H7MA 3K0VA 2XXTA 3BFUA 1M5DA 2QS3A 3RNNA 3UA8A 3T66A 5I84A 4ZEDA 4DXUA 1FCKA 4M4GA 3TTRA 1LLSA 3PGFA 4Z7EA 4DDDA 1EZOA 1MH4A 3R6UA 3TTNA 4U22A 2DXYA 4JDFA 4ESXA 4ZGMA 5DVFA 1LGBC 4BDLA 1M5CA 1UTHA 4GXAA 3RTFB 3KOTA 1HSEA 2OLBA 4YKKA 2I6EA 4XIGQ 3GBAA 2F97A 4F19A 4H65A 1LAGE 3S9MC 2REJA 4P0IA 1POY1 1B5HA 2P1SA 2YPNA 2REGA 4OVJA 4POXA 4RK2A 5FHNA 4GIZA 1AMFA 1TT1A 3A3UA 3IO6A 1H3DA 2ZNTA 3IB1A 3LC8A 3QXMA 2HAVA 3PUZE 1B3GA 2XXVA 1D3KA 3TEPA 3V83A 3U92A 3GZGA 3TCHA 4NWDA 3CVGA 1IEJA 4Q0CA 1AL3A 3SDFA 2I48A 2RKMA 3I5OA 1A8FA 4OHNA 3H3GA 4OENA 4THIA 1QUIA 2A5TA 3FJGA 2DVZA 3KSJA 3QSLA 2I58A 3FVNA 3IJOB 3Q28A 4R2BA 3TTMA 3VLUA 1B3HA 4O3CA 4C0RA 1MM6A 2X7QA 4NF8A 4PE5B 1R9LA 1Z7NE 2E1SA 5AA2B 1JEUA 4N13A 4BDQA 2FYIA 1IQ7A 5I59A 1B5JA 4M1VA 4H5FA 3L6HA 3PPOA 4U23A 3O2AA 3DP8A 4LUBA 3PV0E 5DYHA 3ILUB 3L2JA 2THIA 2XXPA 1RYOA 4I8CA 1MH3A 1P99A 2O7UA 2ZNUA 4P0GA 5I58B 3DP4A 1DSNA 3MZBA 4OFOA 3TDJA 3K6WA 1F9BA 4OETA 1N76A 3FJ7A 4JWYA 2XX8A 3WAFA 4ELPA 2DWIA 4GOTA 1HSLA 1B4ZA 1ATGA 4GD5A 2I49A 4QSCA 3CFZA 3KN3A 4H6DA 1ELJA 3E3KA 3FD3A 1LB9A 4BDNA 5ICQA 3JYRA 1GGGA 3FZVA 4AQ4A 2OK2A 1Y20A 5JK4A 4JB7A 1D4NA 1I6QA 4ECFA 1URDA 5TP9B 1PBPA 3G3FA 4G4PA 1EZ9A 2AL4A 2F8DA 1FQDA 3DELB 2XXYA 3EF7A 1FTLA 4R73A 2PT1A 2Q89A 4U4XA 1MPCA 4AB5A 3HCQA 4MLVA 5AA3A 3FV1A 3IAZA 4KHZE 3KOSA 4NTLA 2V84A 2XD3A 2Z23A 2F78A 3H6UA 4H67A 4JWXA 4QFLA 5EHMA 3V8XB 1B3LA 4DLDA 5CC2A 3IO4A 1FTJA 2UYFA 4YICA 3RT8A 3T9VA 4F29A 1WODA 2I4BA 4GRKA 4G68C 4QFKA 4F31B 3R26A 3KJTA 2Q2CA 2X26A 3S9NC 1R6ZA 2CZLA 2XXXA 1MY4A 3LSXA 3MP1A 4NMYA 4HJ0A 2OBGA 1QKBA 1OMPA 2B3FA 3BBRA 3O29A 4NF5A 3LBSA 2QJEA 1B9JA 2QPQA 3ILTB 2DOJA 2ONKE 3CRBA 3Q26A 4I9DA 1BTJA 4K3FA 4WEDA 1MXVA 3K02A 4G8HA 4NEDA 1FQBA 1NFTA 3VV5A 2R6GE 4OFJA 5DVIA 1XHYA 3TODA 2PT2A 4ZE8A 5F1QA 5B70A 3FXRA 5CMCA 5H8QA 4EQBA 3U94A 1ZBMA 5CBSA 4GL0A 3VE1B 1P1WA 3SEUA 2QRYA 3EHSA 5A5XB 1P1UA 1LCFA 2QMWA 3IORA 2H99A 2R9JA 3KFMA 5H8HA 4ZDMA 5H8NA 1LCTA 1Z7ME 4KYDA 1GVCA 1B7HA 2AIXA 4F3PA 3S9LC 2H9BA 4NWCA 2XXQA 1R1NA 2I4CA 4QFPA 1LBBA 4EQ9A 5BWJA 4JSOA 5AA4A 5KDTB 4ERSA 3GBBA 1B1XA 1IUDA 1SYHA 1RKMA 3E9XA 3GLBA 2RF1A 3O9PA 3EHUA 1TXFA 3U93A 3PUVE 4LZ8A 1NH7A 4PP0A 4LQ5A 4EXKA 3KJ7A 2DWAA 3HHFA 4OERA 4ZZEA 2Y84A 1SW5A 2A5SA 3A3CA 4F39A 4LF3C 1DOTA 3PD9A 2M8CA 3K1MA 1H76A 3CFLA 2NWJA 3FVOA 1IZ1A 3KBRA 3FJMA 3OD7A 3OXNA 4RPOA 1JW5A 1DMBA 4GFRA 4RYAA 2F35A 1DTGA 4HS7A 3OO6A 1A55A 3UN6A 4G68A 2V3UA 3QAXA 4GLIA 4YKIA 5H8QB 5M2VA 3DP6A 3O66A 2WKYA 1IITA 1B6HA 4YU0A 1VFDA 3FATA 5I2NA 1MQHA 3C5TA 3W15C 1EZPA 1MS7A 2RC7A 4FEBA 4WKMA 4ZEIA 3TTLA 3VXBA 1I69A 2PMSA 2Y7WA 1LSTA 4XTCQ 3GXAA 3MC2A 4GWOA 5I2KA 5EHSA 1MY3A 1LB8A 1SW4A 3H03A 4DE8A 3AXFA 4IGRA 4IO4A 1NNFA 1MQGA 3O6HA 3TFLA 3U1OA 4F3SA 5JTYB 2QSXA 4Q8RA 4N07A 4XXUA 1CB6A 1GTKA 5HM4B 1A8EA 1FTMA 2Y7IA 4OYVA 1N3XA 1B51A 1EH3A 4ZEFA 1A40A 5H8FB 1HSJA 2I3WA 3VVFA 4DIGA 1P1NA 3TCGA 2XDGA 4YKPA 1ANFA 1SW2A 4G8MA 3IB2A 1WDNA 4RNSA 5I58A 2JNDA 2OWSA 5ELVA 3IOUA 1Y4CA 4KQPA 2RC8A 3ZS6A 2UXAA 3D4GA 3ZKLA 2QKHA 3K6VA 3USDA 1OVBA 3U72A 3MW0A 2Y7RA 1MRPA 4U21A 4KCCA 4U1ZA 2F6GA 1P1OA 2H4IA 1ZIUA 1VE4A 3BKIB 4X9TA 3W9WA 1MXXA 1B1HA 3OSRA 3I3VA 3PUXE 4R75A 4YAHX 4IY5A 3O6IA 2Y7PA 4PETA 3O28A 1MPBA 4WEPA 5CBRA 2ZYOA 3KZGA 3AQFB 2H5YA 4H0WA 2VHAA 3VLWA 4KYSA 1U34A 1IXCA 2Z8FA 2OJTA 3LR1A 3V5AA 4DLQA 3HN0A 3IOTA 3MZ1A 2YLNA 2QS4A 1JQFA 1USYE 4G8NA 4ONYA 2VD2A 2VD3A 4LONB 4NE4A 4BDMA 3IR1A 4EUOA 3E13X 2OCUA 1M5EA 3B6TA 3B7DA 3K6XA 3P7IA 1R9QA 1YPNA 1Y3PA 2HCAA 2PBWA 5KCJA 2O69A 1VSOA 3FASA 3PPPA 3RUMA 3VLVA 1PC3A 1POTA 3LSWA 4PFTA 4BDRA 3FXUA 4RY1A 3N6UA 1D9VA 4GF8A 1ZJLA 3CI8A 1PB7A 1SDXA 3UORA 1UTBB 4HTGA 3G3GA 4DXCA 4DLOA 5AE4A 1JNFA 3CG1A 3MPKA 1B2HA 4YB7A 1IIWA 1YTVA 2F6PA 4NF4A 4O3BA 3RTWB 5FHOA 4NF8B 2Q9TA 1Q1KA 3SEWA 3OO7A 1GV8A 2F34A 1A99A 4UA8A 4IB2A 2V3QA 3H6WA 5JTYA 3UK4A 1YCJA 4XKPA 1UIVA 1H43A 3C32A 2V3TA 2UVGA 1GR2A 1UQWA 2GFEA 3MAMA 3OEMA 1N3WA 3PD8A 1TFDA 1N7XA 4FORA 4R6HA 2DS9A 4F3GA 5A5XA 5AA4B 2L27A 1JW4A 5I59B 1FTKA 1UTBA 1OQGA 3E4RA 1II5A 4F2OA 3N7PA 4C1TA 4XKQA 4ELOA 1B3EA 4MF3A 2O84X 1DPPA 4G2ZA 1EU8A 2XD2A 3C59A 2V25A 4G68B 2DQVA 5CMMA 1B4HA 2VP1A 3MVZA 1OQHA 5IKBA 3M8UA 2G29A 4FATA 3QYTA 3CG3A 2VGQA 3CFXA 3FXQA 5ITPA 1NNPA 4LZ7A 4OEUA 4BDOA 3CIJA 4LVQA 3MP6A 2ZYMA 3CSBA 3W9VA 4N6PA 4GL8A 1LAHE 4XKNA 2ZYNA 2XXIA 3OENA 4RPNA 4NF5B 1MY1A 2DE2A 3D4CA 2NXOA 3TKDA 3IX1A 3OO9A 3PMXA 4ELRA 2W7YA 4JXIA 3H6VA 2GHAA 4FIMA 5K2XA 5L8DA 1Y1MA 2E0SA 3RLFE 1IXIA 2AYSA 2PX1A 1NNKA 4KD5A 4QHQA 2Z8DA 1SI1A 2Z22A 2ZXTA 2O51A 3OEKA 4GVOA 2GH9A 2NVUB 1QULA 1US5A 2HFBA 4ELQA 2XXWA 3RN8A 1MDP1 4OZ9A 1H45A 3QIMA 4PFYA 3SETA 4KFQA 3MBPA 4QSEA 3VDFA 4EF2A 3HO7A 3C35A 1Y3QA 3PPRA 4F22A 5KCJB 3FIRA 3OSQA 3WAEA 4JSDA 2QS2A 3TMGA 2PYYA 4E0XA 1B46A 1FQCA 1MDQA 1JEVA 4YMAA 5DTBA 2DE3A 1M5FA 3IB0A 3VXCA 1LFIA 5BUUA 2HAUA 5L9OA 2B3BA 5KZTA 3QUJA 4TLLB 4RA1A 2QL3A 3G3IA 1A54A 2LAOA 3PU5A 4L17A 3G3HA 5I56A 1PB9A 4PFUA 4UACA 4R6YA 3PUYE 4KR5A 4F3BA 3O6GA 4LP2B 5DEXA 1P1QA 5DT6A 4RK9A 2HZLA 2ONRA 1T0KA 2UVHA 1LFHA 1PDAA 3K4UA 1ZU0A 2O68A 3QK6A 1SYIA 5F7VA 3OOAA 4IO6A 2RC9A 4QF9A 2O6AA 4EF1A 1MPDA 2O1MA 2YJPA 2I3VA 1SVXB 4F2QA 1B32A 2HEUA 3THIA 1TFAA 2F5XA 3C34A 2D21A 2F7CA 2H98A 4LQ2A 4DCYA 3LUYA 1QVSA 1TWYA 4JBZA 3VVEA 4F18A 2OWTA 4P11A 1BP5A 3MVWA 4ESWA 5I57A 3VFJA 3ZSFA 1LAFE 2NUVA 2R71A 3UIFA 4TLMB 3SEVA 1ZKBA 4FEDA 4WXJA 4U4SA 1H44A 2DE4A 4X1DA 2XX7A 1Y1ZA 3N5LA 1Y9UA 2JODA 1MXWA 2UYEA 1DPEA 5KDTA 4U1OA 1MM7A 1XVXA 3OELA 1OIBA 2H25A 3C33A 1YAEA 4X48A 3MVXA 2GRVA 4LA9A 2IEEA 4R9GA 1L5TA 4C1UA 4EXLA 2X7PA 5H8NB 2I0CA 1N84A 3EN3A 2IA4A 2XX9A 3TPAA 3V89B 4OXVA 1UIUA 5I2NB 5I56B 3FGSA 2QS1A 1B0LA 4IO2A 4YB5A 5CMBA 3C9HA 2XXRA 3ONMA 4HCYA 5AA1A 4QFNA 3T96B 3TAJA 1QUJA 1VR5A 3EPEA 2P0SA 4EDPA 4MFIA 1JVXA 1LFGA 1O7TA 1KWHA 1UTHB 2O1LA 3T9XB 4XKRA 3N7SA 3S9EA 4I62A 4R9FA 3F11A 3S2VA 4YB6A 4KI0E 2F7BA 5LOMA 5AA2A 2UVJA 2D5WA 3BFTA 2AL5A 1J1NA 3B6WA 3SEYA 3EQ1A 5TPAA 3TCFA 3A09A 3KN7A 4ND9A 4FJPA 2ANJA 1JVYA 3HV1A 3Q27A 4Z0IA 3MWBA 3TELA 1NKXA 3EHTA 1B05A 3RT6B 3T9HB 3RY3A 2RCAA 3MZ9A 1A7LA 3N6TA 5FHMA 1LAXA 4PQJA 3IOVA 1MXYA 4HW8A 2HQ0A 1ZTYA 2JNCA 1XVYA 4GXSB 4U2RA 1SBPA 1MY0A 4NF6A 2FA7A 2B65A 4ISUA 1MQDA 4QFOA 4NF6B 4POWA 1FQFA 1FQEA 4RJZA 5CI5A 5DEXB 3N7RA 2ZMBA 3MJNA 4MLQA 1URGA 3B6QA 1QJMA 1SQYA 1USYH 2HZKA 4R72A 3IJXB 4TOZA 2UVIA 4O3AA 5DVJA 3SESA 5B7DA 3M3KA 4H1XA 5I2KB 4AB6A 3IK6B 1D9YA 1WVJA 2GHBA 4R2FA 5ICTA
chains in the Genus database with same CATH superfamily
1PBQA 3K01A 1EYKA 4X1BA 3QUFA 1ZMGA 3IL1B 3HSTA 5EYFA 2Z8EA 1B7UA 1S9TA 1QUKA 1XS5A 3DM0A 3C4MA 4H8JA 4HCWA 5J1DA 2NOOA 2PVUA 5TP9A 1IMBA 1MQIA 4DXBA 2JJKA 1S7YA 5HBCA 1CE2A 4OESA 3FUZA 3RQTA 4ZECA 3K6UA 4Q5TA 3MUQA 3I6VA 4OQOA 2Q88A 1LBZA 2WX9A 4YZZA 1AIVA 1I6BA 3RNNA 4NF4B 5CMKA 4FECA 3NOHA 4MIJA 3MQ9A 2V93A 4GQOA 2CEXA 3FVKA 4H5GA 1B7ZA 1NL5A 2PFYA 4JVIA 2ESNA 3T9UA 5TPAB 2OZZA 3ROJA 4MEVA 4OFLA 4GWSA 1JW1A 4BLAA 3TUSA 1MQJA 1OLAA 5EQ8A 5EQ9A 1OVTA 2DXRA 1D9QA 3MVYA 2OX3A 3PGFA 5DVFA 4BDLA 3KOTA 4F19A 1XI6A 2WBBA 5FHNA 4OVJA 4RK2A 2ZNTA 3QXMA 2HAVA 3PUZE 3U92A 3TCHA 2RKMA 4N8GA 3H3GA 4OENA 3QSLA 2I58A 3VLUA 4I3EA 5AA2B 4BDQA 3PPOA 4U23A 4PDDA 3L2JA 4LN5A 4I8CA 1P99A 4OETA 4GD5A 2I49A 4NGUA 4H6DA 1LB9A 1GGGA 5JK4A 5TP9B 2XXYA 1KA0A 3FV1A 3IAZA 3KOSA 2XD3A 2Z23A 2F78A 4DLDA 1B3LA 3IO4A 1FTJA 2I4BA 2X26A 1R6ZA 3MP1A 4NMYA 2B4MA 2B3FA 4NF5A 4GWXA 4I9DA 4WEDA 2Y5KA 2DOJA 2ONKE 3CRBA 3FBPA 1MXVA 3K02A 5DVIA 5F1QA 5H8QA 5CBSA 3VE1B 3SEUA 2QRYA 5A5XB 1DK4A 1IMAA 1LCTA 1Z7ME 4QFPA 2XXQA 1R1NA 4EQ9A 1NV1A 1IUDA 4MJOA 3PUVE 2CZHA 4EXKA 4F39A 1H76A 2NWJA 1IZ1A 3OD7A 3FJMA 3OXNA 3E79A 1JW5A 4XFEA 4HS7A 3OO6A 2WYKA 2V3UA 2P3NA 3O66A 1MQHA 3W15C 4FBPA 2RC7A 3VXBA 3KC0A 1G0HA 4XTCQ 5I2KA 2OWZA 1NNFA 4Q8RA 5LTCA 5JTYB 1CB6A 1GTKA 2Y7IA 1FTMA 1LBWA 4OYVA 1N3XA 1EH3A 4ZEFA 1A40A 2I3WA 3IOUA 2QKHA 3D4GA 3ZKLA 1OVBA 3U72A 3MW0A 2Y7RA 4KCCA 4U1ZA 1KZ8A 4R75A 4YAHX 5IGAA 3O6IA 1MPBA 3VLWA 3BIHA 4N6KA 3LR1A 2YLNA 1FPJA 2QS4A 3B8BA 4ONYA 4PAFA 2VD2A 4LONB 5EQAA 1EYIA 4NF6A 3P7IA 1R9QA 5KCJA 1Y3PA 3FASA 4PFTA 1UTBB 3MPKA 1IIWA 1FJ9A 4NF8B 1A99A 4IB2A 5EYHA 3H6WA 4XKPA 1H43A 1GR2A 3OEMA 1TFDA 4R6HA 2L27A 3E4RA 4MF3A 4NX1A 4G2ZA 4P1EA 2V25A 2DQVA 1OQHA 3M8UA 4FATA 3CFXA 1NNPA 3W9VA 4PFBA 2FBPA 4NF5B 3TKDA 2DE2A 4ZE9A 3OO9A 4JXIA 2GHAA 4FIMA 1IMEA 1IXIA 1NNKA 1SI1A 2GH9A 2NVUB 2VT5A 2HFBA 3RN8A 1H45A 3SETA 4KFQA 4EF2A 3C35A 3PPRA 3OSQA 1EYJA 1JEVA 5L9OA 2B3BA 4GWYA 3QUJA 4RA1A 4PFUA 4UACA 3O6GA 2ONRA 4PF6A 3K4UA 3QK6A 4IO6A 4QF9A 2YJPA 2HEUA 2F5XA 2D21A 3LUYA 1NUXA 2NUVA 2R71A 4PF8A 3UIFA 1ZKBA 4FEDA 1H44A 4X1DA 1Y1ZA 3N5LA 1LBVA 2UYEA 5KDTA 4U1OA 4H46A 1OIBA 2H25A 2GRVA 4R9GA 1L5TA 4C1UA 3EN3A 5I2NB 4OXVA 2QS1A 4YB5A 5CMBA 5AA1A 3EPEA 3T9XB 4I62A 3F11A 1YXIA 4KI0E 1K9YA 2F7BA 5LOMA 2D5WA 3BFTA 1J1NA 3EQ1A 3HV1A 3TELA 3MWBA 3MYUA 1B05A 3RT6B 1A7LA 3N6TA 4PQJA 1MXYA 4HW8A 5I7IA 2HQ0A 1ZTYA 1SBPA 4QFOA 4ISUA 1MQDA 1SQYA 4R72A 4TOZA 3SKPA 2BJJX 3K1PA 3R7XA 4O94A 4OVSA 2Q74A 1PEBA 3PMWA 4IY6A 3UGWA 5IZZA 4ZEKA 1N0TA 1QW0A 4DIGA 5I59B 4IO3A 4ZEBA 3TYHA 4E0WA 3N94A 3H06B 4MH5A 4TQUQ 4OWDA 1N04A 5A5LA 2DSFA 4P1LA 4GWZA 3SEXA 4R6KA 1MG1A 4PE3A 1B3FA 1BKAA 1Y4TA 4F1UA 4RXLA 5F24A 5ISUA 3G3KA 1M5BA 4KPTA 3K1NA 2F36A 1FBHA 1Y3NA 2XXUA 1B0HA 2HXWA 2XXHA 4PFIA 1KA1A 1MXZA 1FBEA 1FW0A 1MY2A 3O97A 3M3FA 1B52A 1NMUA 3MPLA 4PCDA 4LZ5A 3PMVA 4JWOA 5TU0A 4PC9A 4PFWA 4DZ1A 3K00A 4OTEA 3IFAA 3RYDA 1SW1A 3JV9A 3RPLA 3TQWA 3JZJA 1PB8A 2FNCA 4HE2A 3H7MA 3BFUA 3UA8A 4ZEDA 1IMFA 4Z7EA 1EZOA 1MH4A 4ESXA 4GXAA 1UTHA 1HSEA 2OLBA 4H65A 2REJA 2P1SA 5IZ1A 1TT1A 3A3UA 1H3DA 4X8RA 4NWDA 4XF5A 2BJIA 3I5OA 1A8FA 1QUIA 2A5TA 3FJGA 4PBQA 3IJOB 3TTMA 3Q28A 1B3HA 4O3CA 4C0RA 4NF8A 1Z7NE 4N13A 5I59A 1B5JA 3L6HA 3PV0E 3ILUB 1RYOA 1MH3A 4P0GA 4OFOA 3TDJA 1N76A 2XX8A 2DWIA 5IZ3A 1B4ZA 3CFZA 1LBYA 4AQ4A 4JB7A 1PBPA 3G3FA 1EZ9A 2WYPA 1FBPA 3DELB 1FQDA 1FTLA 1G0IA 2Q89A 1MPCA 5AA3A 4KHZE 1JP4A 4JWXA 4QFLA 3T9VA 1NV3A 4G68C 3R26A 2Q2CA 4PGPA 1IMDA 2XXXA 3LSXA 4HJ0A 1LEVA 1QKBA 1OMPA 3O29A 1FBFA 3LBSA 2QJEA 2QPQA 3ILTB 1NV0A 3Q26A 2KQZA 1BTJA 2PT2A 2R8TA 4ZE8A 3CHGA 3FXRA 4EQBA 4N81A 2QMWA 1LCFA 4ZDMA 3A29A 2H99A 5H8HA 1GVCA 5H8NA 4KYDA 1NUWA 2H9BA 5BWJA 2I4CA 1LBBA 4ERSA 1B1XA 1SYHA 4OVQA 3O9PA 3E9XA 3EHUA 3U93A 4LQ5A 3KJ7A 4LF3C 1DMBA 2L5VA 3QAXA 5H8QB 5M2VA 5FBPA 1IITA 1VFDA 4WKMA 1I69A 2PMSA 1LSTA 3GXAA 4GWOA 1LB8A 1SW4A 3H03A 4IO4A 4P3LA 1MQGA 4XXUA 3KC1A 2CEYA 5H8FB 1HSJA 3VVFA 1ANFA 1WDNA 2OWSA 2RC8A 3K6VA 1MRPA 2F6GA 4OVPA 4PAIA 2H4IA 4X9TA 4IY5A 2Y7PA 4PETA 3B50A 5CBRA 2ZYOA 2H5YA 4H0WA 4KYSA 1FPFA 1U34A 1FPGA 2Z8FA 4QXDA 4DLQA 4GX3A 3HN0A 3MZ1A 1JQFA 1USYE 4EUOA 3E13X 1M5EA 3K6XA 1YPNA 2O69A 1VSOA 3VLVA 4GF8A 4HTGA 3G3GA 1B2HA 2XXKA 4YB7A 2F6PA 4N91A 2V3QA 5JTYA 3UK4A 1UIVA 1UQWA 1N3WA 4ELOA 1FPEA 5CMMA 2ZZVA 2G29A 2VGQA 4O8MA 5ET7A 4UABA 2ZYNA 1FPIA 2NXOA 4G61A 3IX1A 3H6VA 2QVVA 1Y1MA 2PX1A 4I40A 4KD5A 2Z22A 2ZXTA 1US5A 4PFRA 4PFYA 4OZ9A 4QSEA 1VDWA 4F22A 2QS2A 4N17A 3TMGA 1B46A 1M5FA 1LFIA 3RPLB 2FVZA 3G3HA 1K9ZA 4F3BA 5DEXA 2HZLA 1T0KA 1LFHA 2O68A 1SYIA 2RC9A 4EF1A 1MPDA 3N7PA 1SVXB 2XA5A 3VVEA 1BP5A 3ZSFA 1LAFE 3SEVA 4U4SA 2JODA 1DPEA 3C33A 4LA9A 4GX6A 5H8NB 5KZTA 3V89B 3FGSA 2XXRA 2GQ1A 1JVXA 1KWHA 2O1LA 3N7SA 4JVCA 4YB6A 5AA2A 2UVJA 4N15A 3KN7A 1JVYA 3Q27A 4QBAA 4Z0IA 3IOVA 2JNCA 4GXSB 2FA7A 2B65A 4P47A 4NF6B 1FQFA 1FQEA 2ZMBA 3MJNA 1URGA 3B6QA 4GWWA 5EQ7A 4R2FA 5CM6A 3H4ZA 4KYEA 3KN8A 4MNCA 5FTHA 1AH5A 2O7IA 4LATA 4Q30B 4FE8A 3OMBA 3TQLA 1MXUA 2CMOA 2P3VA 5ITOA 4QRZA 3RPWA 1B58A 2D3IA 3KEIA 2XHDA 1NNTA 4QSDA 3C31A 1B5IA 1FTAA 5IAIA 3OO8A 4GBWA 3IOLA 1S50A 2F3BA 2XWOA 4MBPA 4NAPA 4P8BA 3KSXA 1FSAA 2A5TB 4R74A 1Q35A 5FTIA 3MP8A 3E78A 1N7WA 2I0BA 3SZPA 1LBCA 5I57B 3TTKA 4IO7A 1OLCA 3UP9A 1O64A 3L6GA 5CRYA 1VFEA 3G7WA 3CSGA 3DLNA 3IOWA 3H6TA 2P2AA 2QVUA 4G77A 3ISPA 2RCBA 1DTZA 3T93B 4YMBA 1O63A 1ZLQA 1URSA 5IM2A 4FAJA 5L9MA 3RGYA 2QMXA 1QKAA 4IGTA 1LBXA 4DCXA 1M5DA 3T66A 1FCKA 4M4GA 1LLSA 1RDZA 3R6UA 3TTNA 4JDFA 1M5CA 4YKKA 4XIGQ 3FXBA 3SERA 1POY1 2REGA 4GIZA 1AMFA 1B3GA 2XXVA 1D3KA 3V83A 3CVGA 3EKIA 2I48A 1Q9DA 4NF0A 3KSJA 4HE1A 3FVNA 4MCOA 2X7QA 4PE5B 3MSTA 2E1SA 1IQ7A 4O7MA 4MNIA 3O2AA 4NG7A 2XXPA 2O7UA 5EYGA 5I58B 1DSNA 3D1RA 3K6WA 3FJ7A 3WAFA 4ELPA 4GOTA 4OANA 4QSCA 3KN3A 3E3KA 3FD3A 4GX4A 5ICQA 3JYRA 3FZVA 2OK2A 2ZZXA 1NV6A 3U65A 1I6QA 4OA4A 4MX6A 2KR0A 2F8DA 3AQFB 4MLVA 4NTLA 5EHMA 2UYFA 4YICA 2CZKA 5ET5A 1NV2A 3IFCA 3S9NC 1MY4A 2OBGA 3BBRA 4K3FA 2FIEA 4G8HA 1FQBA 1NFTA 3VV5A 4OFJA 3U94A 1ZBMA 4GL0A 1P1WA 3KFMA 3S9MC 4F3PA 2AIXA 3S9LC 4NWCA 5KDTB 4JSOA 5AA4A 4X04A 5ET8A 1RKMA 3GLBA 1TXFA 4OERA 3HHFA 4ZZEA 2Y84A 1SW5A 1AWBA 2A5SA 3CFLA 3KBRA 4RPOA 1DTGA 1A55A 3UN6A 4GLIA 1B6HA 4YU0A 1INPA 4ZEIA 3TTLA 2Y7WA 3MC2A 2XWKA 5EHSA 1MY3A 3U1OA 4IGRA 3O6HA 4N07A 1A8EA 1B51A 5LDZA 4MAGA 1P1NA 3TCGA 4YKPA 1SW2A 5T3JA 4G8MA 3IB2A 5I58A 5ELVA 1Y4CA 4U21A 1ZIUA 3BKIB 3W9WA 1MXXA 3I3VA 4PTKA 3O28A 2QVRA 2B4LA 3KZGA 1IXCA 1YYZA 2OJTA 3IOTA 2VD3A 1FPDA 4NE4A 2OCUA 3B7DA 2PBWA 2XWIA 3LSWA 5DW8A 3UORA 4RY1A 3N6UA 1D9VA 5AE4A 1QGXA 1YTVA 4O3BA 5FHOA 2Q9TA 1Q1KA 3SEWA 3OO7A 2F34A 4UA8A 2V3TA 4NQ8A 3PD8A 5AA4B 4OVRA 1UTBA 4F2OA 4C1TA 4XKQA 2Y5LA 1B3EA 2O84X 2ZZWA 1EU8A 3LUZA 4G68B 2VP1A 4HE0A 3QYTA 3CG3A 5ITPA 4LZ7A 4OEUA 4BDOA 3CIJA 3MP6A 3CSBA 4N6PA 4GL8A 1LAHE 4XKNA 2XXIA 4GWUA 1MY1A 4ELRA 1CNQA 2W7YA 3T0JA 4DCYA 2AYSA 4QHQA 2O51A 4GVOA 4OVTA 1QULA 4ELQA 2XXWA 1MDP1 3VDFA 3QIMA 3MBPA 3HO7A 3FIRA 4E0XA 1FQCA 3QMFA 2DE3A 3IB0A 2HAUA 4TLLB 1A54A 2LAOA 4I3YA 5I56A 3GYYA 4MMPA 3PUYE 4KR5A 5DT6A 4RK9A 1ZU0A 5F7VA 3OOAA 3THIA 2F7CA 5H8FA 4F18A 2OWTA 4P11A 3MVWA 4WXJA 3HFUA 2DE4A 2XX7A 1MXWA 1MM7A 1XVXA 3OELA 1YAEA 4X48A 3MVXA 4EXLA 1N84A 2IA4A 3TPAA 4IO2A 3T1BA 3C9HA 3TAJA 4HCYA 4QFNA 4P9KA 1QUJA 1VR5A 4EDPA 4MFIA 1UTHB 1LFGA 3S9EA 4R9FA 3SEYA 5TPAA 3TCFA 3A09A 3EHTA 3MZ9A 5FHMA 1FPBA 1LAXA 4MHFA 2MKZA 4U2RA 1MY0A 4POWA 5DEXB 3N7RA 4O7IA 1QJMA 2VPOA 2UVIA 4O3AA 3M3KA 4H1XA 1FPKA 1NV4A 1D9YA 2GHBA 1FQAA 3K2DA 3HHGA 4ZS9A 2CZIA 3T22A 4KCDA 3U8QA 2ZNSA 1SPIA 2ABHA 3PPQA 3LSFB 2Y7KA 4IO5A 1FBCA 4EQ7A 1SI0A 3ODBA 1I6AA 2Q8JA 4OEVA 1AOVA 5HPQA 3FV2A 2DVCA 5JEIA 1JETA 2ONSA 1XC1A 5J16A 1FTOA 4F1YA 5H8SA 3HPIA 1FJ6A 3Q25A 4PBHA 2DP8A 5H8HB 5K2YA 3VVDA 1NV7A 1XT8A 5II0A 3M3LA 2V4CA 1NH8A 3Q29A 2VOZA 2HHMA 2G93A 4H8IA 2ZYKA 2DWHA 2DYXA 1BLFA 2RINA 3KG2A 4YKJA 3PUWE 3G3JA 1XOCA 1US4A 3S4UA 3N26A 1IXGA 2F7AA 3CR9A 3TZAA 2ALUA 2Q2AA 5BUUA 1SD3A 4I1DA 3ECRA 4OMBA 4NHBA 4H45A 3KGCA 1RYXA 1IXHA 4F1VA 2KLFA 1B40A 3PPNA 3ZKKA 3LSLA 2DWJA 3FVGA 3C36A 4ZZAA 5L9SA 5AA2D 1BIYA 3K0VA 2XXTA 5I84A 2QS3A 4DXUA 3TTRA 4DDDA 4U22A 2DXYA 1DCUA 4ZGMA 1LGBC 3RTFB 2I6EA 3GBAA 2F97A 1LAGE 4P0IA 1B5HA 2YPNA 4POXA 3LC8A 3IO6A 3IB1A 4N4UA 1DBZA 3GZGA 1NV5A 1IEJA 4Q0CA 1AL3A 3SDFA 4OHNA 4THIA 2DVZA 4R2BA 1MM6A 1R9LA 1JEUA 2FYIA 4M1VA 4H5FA 3DP8A 2HPGA 4LUBA 5DYHA 2THIA 2ZNUA 3DP4A 3MZBA 1F9BA 5I3SA 4JWYA 1HSLA 1ATGA 1ELJA 4BDNA 1Y20A 2F3DA 1D4NA 4ECFA 1URDA 4G4PA 2AL4A 3EF7A 4R73A 4AB5A 3TEPA 2PT1A 4U4XA 3C5TA 3HCQA 3S2VA 2V84A 3H6UA 4H67A 3V8XB 5CC2A 3RT8A 2XWVA 4F29A 1WODA 4GRKA 4QFKA 4F31B 4DI3D 3KJTA 2CZLA 1B9JA 4NEDA 2R6GE 1XHYA 3TODA 5ESYA 5B70A 5CMCA 5IZ3B 3EHSA 1P1UA 3IORA 2R9JA 5I5PA 1B7HA 1FRPA 3GBBA 2RF1A 4LZ8A 1NH7A 4PP0A 2DWAA 3A3CA 1NUYA 1DOTA 3PD9A 2M8CA 3K1MA 3FVOA 4RYAA 4GFRA 4HXVA 2F35A 4G68A 4YKIA 3DP6A 2WKYA 5I2NA 3FATA 1YZ0A 1EZPA 1MS7A 4FEBA 3KBZA 4DE8A 3AXFA 4F3SA 3TFLA 2QSXA 5HM4B 2XDGA 2JNDA 4RNSA 1FBDA 4KQPA 4N8YA 3ZS6A 2UXAA 3USDA 1P1OA 1VE4A 1B1HA 3OSRA 3PUXE 4AS4A 4AS5A 4WEPA 2VHAA 2PCRA 2DDKA 3V5AA 4IR8A 4G8NA 2QFLA 3IR1A 4BDMA 3B6TA 2HCAA 3PPPA 3RUMA 4BDRA 1PC3A 1POTA 3FXUA 1ZJLA 3CI8A 1PB7A 1SDXA 4DXCA 4JVDA 4DLOA 1JNFA 3CG1A 4NF4A 3RTWB 1GV8A 1NUZA 1YCJA 3C32A 2UVGA 2GFEA 3MAMA 4F3GA 1N7XA 4FORA 2DS9A 5A5XA 1NI9A 1JW4A 1FTKA 3BIGA 1OQGA 1II5A 3LV0A 1DPPA 2XD2A 3C59A 1B4HA 3MVZA 5IKBA 3FXQA 2FIXA 4LVQA 2ZYMA 2Q8MA 3OENA 4RPNA 3D4CA 3PMXA 5L8DA 5K2XA 3RLFE 2E0SA 1BK4A 2Z8DA 3OEKA 1FPLA 5ET6A 4PAKA 1Y3QA 1RDYA 5KCJB 3WAEA 4NN3A 4JSDA 2PYYA 1MDQA 4YMAA 5DTBA 3VXCA 1RDXA 1FBGA 2QL3A 3G3IA 3PU5A 4L17A 1PB9A 2VPNA 4R6YA 4LP2B 1P1QA 4MNPA 2HXRA 2UVHA 4KXPA 1PDAA 2O6AA 4P56A 2O1MA 2I3VA 4F2QA 1B32A 1TFAA 3C34A 4LQ2A 2H98A 4DI4B 1QVSA 1TWYA 4JBZA 2PFZA 4ESWA 5I57A 3VFJA 4TLMB 1Y9UA 3PTYA 2FHYA 2IEEA 2X7PA 2I0CA 2XX9A 1UIUA 5I56B 1B0LA 2WEFA 3ONMA 3T96B 2P0SA 1O7TA 4XKRA 2WBDA 1IMCA 4PDHA 2AL5A 3B6WA 4ND9A 4FJPA 2ANJA 4N6DA 1NKXA 3T9HB 3RY3A 2RCAA 1XVYA 4XEQA 5CI5A 4RJZA 4GBVA 4MLQA 2HZKA 1USYH 3IJXB 5DVJA 5B7DA 3SESA 5I2KB 4AB6A 3IK6B 4PGNA 1WVJA 5ICTA
chains in the Genus database with same CATH topology
1FQAA 3SKPA 1PBQA 2BJJX 3H4ZA 5CM6A 3K01A 3K1PA 3HHGA 3K2DA 4KYEA 4ZS9A 3R7XA 3KN8A 4X1BA 1PEBA 3QUFA 3T22A 4KCDA 1ZMGA 3IL1B 3HSTA 5FTHA 3U8QA 2ZNSA 1AH5A 2O7IA 3PMWA 4LATA 4IY6A 4FE8A 4Q30B 5EYFA 3UGWA 2ABHA 4ZE9A 3PPQA 3LSFB 2Z8EA 2Y7KA 3OMBA 4ZEKA 1N0TA 1QW0A 4IO5A 1B7UA 1MXUA 1SI0A 1S9TA 2CMOA 1I6AA 3ODBA 3TQLA 1QUKA 4EQ7A 2Q8JA 5ITOA 4QRZA 4OEVA 3RPWA 1XS5A 3DM0A 3C4MA 1AOVA 4H8JA 1B58A 4HCWA 4IO3A 3FV2A 4ZEBA 2DVCA 5HPQA 2D3IA 5J1DA 5JEIA 3KEIA 1JETA 2NOOA 2ONSA 2PVUA 2XHDA 1NNTA 1XC1A 4QSDA 3C31A 5TP9A 1B5IA 3TYHA 4E0WA 1FTOA 4F1YA 1MQIA 3N94A 5IAIA 5H8SA 3HPIA 3OO8A 4DXBA 3SERA 3H06B 4MH5A 3IOLA 3Q25A 1S50A 2DP8A 5H8HB 5K2YA 4TQUQ 3VVDA 4OWDA 1S7YA 4MBPA 5HBCA 1N04A 2A5TB 3KSXA 1CE2A 4OESA 1XT8A 4R74A 3FUZA 2DSFA 5II0A 1Q35A 3M3LA 3SEXA 1NH8A 3RQTA 4R6KA 1MG1A 5FTIA 1B3FA 1BKAA 2VOZA 1Y4TA 3K6UA 1N7WA 2I0BA 3MP8A 3MUQA 3Q29A 4Q5TA 4ZECA 3I6VA 4F1UA 1LBCA 4OQOA 2G93A 4RXLA 4H8IA 2ZYKA 2DWHA 5I57B 2DYXA 1BLFA 2Q88A 5ISUA 2RINA 3KG2A 4YKJA 4YZZA 3TTKA 1AIVA 1I6BA 1M5BA 3G3KA 3PUWE 3G3JA 1XOCA 4FECA 1US4A 4IO7A 4KPTA 4NF4B 3MQ9A 5CMKA 2V93A 3S4UA 3K1NA 2F36A 4GQOA 1OLCA 3UP9A 1O64A 1Y3NA 3L6GA 5CRYA 3N26A 2XXUA 1IXGA 1VFEA 2F7AA 1B0HA 2HXWA 2XXHA 3CR9A 3TZAA 1MXZA 5H8FA 2ALUA 2Q2AA 3G7WA 3FVKA 4H5GA 1B7ZA 1FW0A 1NL5A 1SD3A 4I1DA 3CSGA 3DLNA 3IOWA 2ESNA 3ECRA 3H6TA 4OMBA 2P2AA 1MY2A 3T9UA 3O97A 3M3FA 1B52A 1NMUA 3KGCA 5TPAB 1RYXA 3MPLA 4G77A 4LZ5A 3PMVA 2OZZA 1IXHA 2RCBA 1DTZA 4JWOA 5TU0A 3T93B 4YMBA 4F1VA 1O63A 1ZLQA 1URSA 2KLFA 4OFLA 4PFWA 4DZ1A 4FAJA 3K00A 4OTEA 1B40A 1JW1A 4BLAA 3PPNA 1SW1A 3ZKKA 5L9MA 3TUSA 3JV9A 3RGYA 1MQJA 1OLAA 2DWJA 3FVGA 2QMXA 3JZJA 3LSLA 3TQWA 1PB8A 1QKAA 4IGTA 4DCXA 2FNCA 1OVTA 3C36A 2DXRA 3MVYA 4ZZAA 5L9SA 5AA2D 1BIYA 3H7MA 3K0VA 2XXTA 3BFUA 1M5DA 2QS3A 3RNNA 3UA8A 3T66A 5I84A 4ZEDA 4DXUA 1FCKA 4M4GA 3TTRA 1LLSA 3PGFA 4Z7EA 4DDDA 1EZOA 1MH4A 3R6UA 3TTNA 4U22A 2DXYA 4JDFA 4ESXA 4ZGMA 5DVFA 1LGBC 4BDLA 1M5CA 1UTHA 4GXAA 3RTFB 3KOTA 1HSEA 2OLBA 4YKKA 2I6EA 4XIGQ 3GBAA 2F97A 4F19A 4H65A 1LAGE 3S9MC 2REJA 4P0IA 1POY1 1B5HA 2P1SA 2YPNA 2REGA 4OVJA 4POXA 4RK2A 5FHNA 4GIZA 1AMFA 1TT1A 3A3UA 3IO6A 1H3DA 2ZNTA 3IB1A 3LC8A 3QXMA 2HAVA 3PUZE 1B3GA 2XXVA 1D3KA 3TEPA 3V83A 3U92A 3GZGA 3TCHA 4NWDA 3CVGA 1IEJA 4Q0CA 1AL3A 3SDFA 2I48A 2RKMA 3I5OA 1A8FA 4OHNA 3H3GA 4OENA 4THIA 1QUIA 2A5TA 3FJGA 2DVZA 3KSJA 3QSLA 2I58A 3FVNA 3IJOB 3Q28A 4R2BA 3TTMA 3VLUA 1B3HA 4O3CA 4C0RA 1MM6A 2X7QA 4NF8A 4PE5B 1R9LA 1Z7NE 2E1SA 5AA2B 1JEUA 4N13A 4BDQA 2FYIA 1IQ7A 5I59A 1B5JA 4M1VA 4H5FA 3L6HA 3PPOA 4U23A 3O2AA 3DP8A 4LUBA 3PV0E 5DYHA 3ILUB 3L2JA 2THIA 2XXPA 1RYOA 4I8CA 1MH3A 1P99A 2O7UA 2ZNUA 4P0GA 5I58B 3DP4A 1DSNA 3MZBA 4OFOA 3TDJA 3K6WA 1F9BA 4OETA 1N76A 3FJ7A 4JWYA 2XX8A 3WAFA 4ELPA 2DWIA 4GOTA 1HSLA 1B4ZA 1ATGA 4GD5A 2I49A 4QSCA 3CFZA 3KN3A 4H6DA 1ELJA 3E3KA 3FD3A 1LB9A 4BDNA 5ICQA 3JYRA 1GGGA 3FZVA 4AQ4A 2OK2A 1Y20A 5JK4A 4JB7A 1D4NA 1I6QA 4ECFA 1URDA 5TP9B 1PBPA 3G3FA 4G4PA 1EZ9A 2AL4A 2F8DA 1FQDA 3DELB 2XXYA 3EF7A 1FTLA 4R73A 2PT1A 2Q89A 4U4XA 1MPCA 4AB5A 3HCQA 4MLVA 5AA3A 3FV1A 3IAZA 4KHZE 3KOSA 4NTLA 2V84A 2XD3A 2Z23A 2F78A 3H6UA 4H67A 4JWXA 4QFLA 5EHMA 3V8XB 1B3LA 4DLDA 5CC2A 3IO4A 1FTJA 2UYFA 4YICA 3RT8A 3T9VA 4F29A 1WODA 2I4BA 4GRKA 4G68C 4QFKA 4F31B 3R26A 3KJTA 2Q2CA 2X26A 3S9NC 1R6ZA 2CZLA 2XXXA 1MY4A 3LSXA 3MP1A 4NMYA 4HJ0A 2OBGA 1QKBA 1OMPA 2B3FA 3BBRA 3O29A 4NF5A 3LBSA 2QJEA 1B9JA 2QPQA 3ILTB 2DOJA 2ONKE 3CRBA 3Q26A 4I9DA 1BTJA 4K3FA 4WEDA 1MXVA 3K02A 4G8HA 4NEDA 1FQBA 1NFTA 3VV5A 2R6GE 4OFJA 5DVIA 1XHYA 3TODA 2PT2A 4ZE8A 5F1QA 5B70A 3FXRA 5CMCA 5H8QA 4EQBA 3U94A 1ZBMA 5CBSA 4GL0A 3VE1B 1P1WA 3SEUA 2QRYA 3EHSA 5A5XB 1P1UA 1LCFA 2QMWA 3IORA 2H99A 2R9JA 3KFMA 5H8HA 4ZDMA 5H8NA 1LCTA 1Z7ME 4KYDA 1GVCA 1B7HA 2AIXA 4F3PA 3S9LC 2H9BA 4NWCA 2XXQA 1R1NA 2I4CA 4QFPA 1LBBA 4EQ9A 5BWJA 4JSOA 5AA4A 5KDTB 4ERSA 3GBBA 1B1XA 1IUDA 1SYHA 1RKMA 3E9XA 3GLBA 2RF1A 3O9PA 3EHUA 1TXFA 3U93A 3PUVE 4LZ8A 1NH7A 4PP0A 4LQ5A 4EXKA 3KJ7A 2DWAA 3HHFA 4OERA 4ZZEA 2Y84A 1SW5A 2A5SA 3A3CA 4F39A 4LF3C 1DOTA 3PD9A 2M8CA 3K1MA 1H76A 3CFLA 2NWJA 3FVOA 1IZ1A 3KBRA 3FJMA 3OD7A 3OXNA 4RPOA 1JW5A 1DMBA 4GFRA 4RYAA 2F35A 1DTGA 4HS7A 3OO6A 1A55A 3UN6A 4G68A 2V3UA 3QAXA 4GLIA 4YKIA 5H8QB 5M2VA 3DP6A 3O66A 2WKYA 1IITA 1B6HA 4YU0A 1VFDA 3FATA 5I2NA 1MQHA 3C5TA 3W15C 1EZPA 1MS7A 2RC7A 4FEBA 4WKMA 4ZEIA 3TTLA 3VXBA 1I69A 2PMSA 2Y7WA 1LSTA 4XTCQ 3GXAA 3MC2A 4GWOA 5I2KA 5EHSA 1MY3A 1LB8A 1SW4A 3H03A 4DE8A 3AXFA 4IGRA 4IO4A 1NNFA 1MQGA 3O6HA 3TFLA 3U1OA 4F3SA 5JTYB 2QSXA 4Q8RA 4N07A 4XXUA 1CB6A 1GTKA 5HM4B 1A8EA 1FTMA 2Y7IA 4OYVA 1N3XA 1B51A 1EH3A 4ZEFA 1A40A 5H8FB 1HSJA 2I3WA 3VVFA 4DIGA 1P1NA 3TCGA 2XDGA 4YKPA 1ANFA 1SW2A 4G8MA 3IB2A 1WDNA 4RNSA 5I58A 2JNDA 2OWSA 5ELVA 3IOUA 1Y4CA 4KQPA 2RC8A 3ZS6A 2UXAA 3D4GA 3ZKLA 2QKHA 3K6VA 3USDA 1OVBA 3U72A 3MW0A 2Y7RA 1MRPA 4U21A 4KCCA 4U1ZA 2F6GA 1P1OA 2H4IA 1ZIUA 1VE4A 3BKIB 4X9TA 3W9WA 1MXXA 1B1HA 3OSRA 3I3VA 3PUXE 4R75A 4YAHX 4IY5A 3O6IA 2Y7PA 4PETA 3O28A 1MPBA 4WEPA 5CBRA 2ZYOA 3KZGA 3AQFB 2H5YA 4H0WA 2VHAA 3VLWA 4KYSA 1U34A 1IXCA 2Z8FA 2OJTA 3LR1A 3V5AA 4DLQA 3HN0A 3IOTA 3MZ1A 2YLNA 2QS4A 1JQFA 1USYE 4G8NA 4ONYA 2VD2A 2VD3A 4LONB 4NE4A 4BDMA 3IR1A 4EUOA 3E13X 2OCUA 1M5EA 3B6TA 3B7DA 3K6XA 3P7IA 1R9QA 1YPNA 1Y3PA 2HCAA 2PBWA 5KCJA 2O69A 1VSOA 3FASA 3PPPA 3RUMA 3VLVA 1PC3A 1POTA 3LSWA 4PFTA 4BDRA 3FXUA 4RY1A 3N6UA 1D9VA 4GF8A 1ZJLA 3CI8A 1PB7A 1SDXA 3UORA 1UTBB 4HTGA 3G3GA 4DXCA 4DLOA 5AE4A 1JNFA 3CG1A 3MPKA 1B2HA 4YB7A 1IIWA 1YTVA 2F6PA 4NF4A 4O3BA 3RTWB 5FHOA 4NF8B 2Q9TA 1Q1KA 3SEWA 3OO7A 1GV8A 2F34A 1A99A 4UA8A 4IB2A 2V3QA 3H6WA 5JTYA 3UK4A 1YCJA 4XKPA 1UIVA 1H43A 3C32A 2V3TA 2UVGA 1GR2A 1UQWA 2GFEA 3MAMA 3OEMA 1N3WA 3PD8A 1TFDA 1N7XA 4FORA 4R6HA 2DS9A 4F3GA 5A5XA 5AA4B 2L27A 1JW4A 5I59B 1FTKA 1UTBA 1OQGA 3E4RA 1II5A 4F2OA 3N7PA 4C1TA 4XKQA 4ELOA 1B3EA 4MF3A 2O84X 1DPPA 4G2ZA 1EU8A 2XD2A 3C59A 2V25A 4G68B 2DQVA 5CMMA 1B4HA 2VP1A 3MVZA 1OQHA 5IKBA 3M8UA 2G29A 4FATA 3QYTA 3CG3A 2VGQA 3CFXA 3FXQA 5ITPA 1NNPA 4LZ7A 4OEUA 4BDOA 3CIJA 4LVQA 3MP6A 2ZYMA 3CSBA 3W9VA 4N6PA 4GL8A 1LAHE 4XKNA 2ZYNA 2XXIA 3OENA 4RPNA 4NF5B 1MY1A 2DE2A 3D4CA 2NXOA 3TKDA 3IX1A 3OO9A 3PMXA 4ELRA 2W7YA 4JXIA 3H6VA 2GHAA 4FIMA 5K2XA 5L8DA 1Y1MA 2E0SA 3RLFE 1IXIA 2AYSA 2PX1A 1NNKA 4KD5A 4QHQA 2Z8DA 1SI1A 2Z22A 2ZXTA 2O51A 3OEKA 4GVOA 2GH9A 2NVUB 1QULA 1US5A 2HFBA 4ELQA 2XXWA 3RN8A 1MDP1 4OZ9A 1H45A 3QIMA 4PFYA 3SETA 4KFQA 3MBPA 4QSEA 3VDFA 4EF2A 3HO7A 3C35A 1Y3QA 3PPRA 4F22A 5KCJB 3FIRA 3OSQA 3WAEA 4JSDA 2QS2A 3TMGA 2PYYA 4E0XA 1B46A 1FQCA 1MDQA 1JEVA 4YMAA 5DTBA 2DE3A 1M5FA 3IB0A 3VXCA 1LFIA 5BUUA 2HAUA 5L9OA 2B3BA 5KZTA 3QUJA 4TLLB 4RA1A 2QL3A 3G3IA 1A54A 2LAOA 3PU5A 4L17A 3G3HA 5I56A 1PB9A 4PFUA 4UACA 4R6YA 3PUYE 4KR5A 4F3BA 3O6GA 4LP2B 5DEXA 1P1QA 5DT6A 4RK9A 2HZLA 2ONRA 1T0KA 2UVHA 1LFHA 1PDAA 3K4UA 1ZU0A 2O68A 3QK6A 1SYIA 5F7VA 3OOAA 4IO6A 2RC9A 4QF9A 2O6AA 4EF1A 1MPDA 2O1MA 2YJPA 2I3VA 1SVXB 4F2QA 1B32A 2HEUA 3THIA 1TFAA 2F5XA 3C34A 2D21A 2F7CA 2H98A 4LQ2A 4DCYA 3LUYA 1QVSA 1TWYA 4JBZA 3VVEA 4F18A 2OWTA 4P11A 1BP5A 3MVWA 4ESWA 5I57A 3VFJA 3ZSFA 1LAFE 2NUVA 2R71A 3UIFA 4TLMB 3SEVA 1ZKBA 4FEDA 4WXJA 4U4SA 1H44A 2DE4A 4X1DA 2XX7A 1Y1ZA 3N5LA 1Y9UA 2JODA 1MXWA 2UYEA 1DPEA 5KDTA 4U1OA 1MM7A 1XVXA 3OELA 1OIBA 2H25A 3C33A 1YAEA 4X48A 3MVXA 2GRVA 4LA9A 2IEEA 4R9GA 1L5TA 4C1UA 4EXLA 2X7PA 5H8NB 2I0CA 1N84A 3EN3A 2IA4A 2XX9A 3TPAA 3V89B 4OXVA 1UIUA 5I2NB 5I56B 3FGSA 2QS1A 1B0LA 4IO2A 4YB5A 5CMBA 3C9HA 2XXRA 3ONMA 4HCYA 5AA1A 4QFNA 3T96B 3TAJA 1QUJA 1VR5A 3EPEA 2P0SA 4EDPA 4MFIA 1JVXA 1LFGA 1O7TA 1KWHA 1UTHB 2O1LA 3T9XB 4XKRA 3N7SA 3S9EA 4I62A 4R9FA 3F11A 3S2VA 4YB6A 4KI0E 2F7BA 5LOMA 5AA2A 2UVJA 2D5WA 3BFTA 2AL5A 1J1NA 3B6WA 3SEYA 3EQ1A 5TPAA 3TCFA 3A09A 3KN7A 4ND9A 4FJPA 2ANJA 1JVYA 3HV1A 3Q27A 4Z0IA 3MWBA 3TELA 1NKXA 3EHTA 1B05A 3RT6B 3T9HB 3RY3A 2RCAA 3MZ9A 1A7LA 3N6TA 5FHMA 1LAXA 4PQJA 3IOVA 1MXYA 4HW8A 2HQ0A 1ZTYA 2JNCA 1XVYA 4GXSB 4U2RA 1SBPA 1MY0A 4NF6A 2FA7A 2B65A 4ISUA 1MQDA 4QFOA 4NF6B 4POWA 1FQFA 1FQEA 4RJZA 5CI5A 5DEXB 3N7RA 2ZMBA 3MJNA 4MLQA 1URGA 3B6QA 1QJMA 1SQYA 1USYH 2HZKA 4R72A 3IJXB 4TOZA 2UVIA 4O3AA 5DVJA 3SESA 5B7DA 3M3KA 4H1XA 5I2KB 4AB6A 3IK6B 1D9YA 1WVJA 2GHBA 4R2FA 5ICTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FQA A;  3SKP A;  1PBQ A;  2BJJ X;  3H4Z A;  5CM6 A;  3K01 A;  3K1P A;  3HHG A;  3K2D A;  4KYE A;  4ZS9 A;  3R7X A;  3KN8 A;  4X1B A;  1PEB A;  3QUF A;  3T22 A;  4KCD A;  1ZMG A;  3IL1 B;  3HST A;  5FTH A;  3U8Q A;  2ZNS A;  1AH5 A;  2O7I A;  3PMW A;  4LAT A;  4IY6 A;  4FE8 A;  4Q30 B;  5EYF A;  3UGW A;  2ABH A;  4ZE9 A;  3PPQ A;  3LSF B;  2Z8E A;  2Y7K A;  3OMB A;  4ZEK A;  1N0T A;  1QW0 A;  4IO5 A;  1B7U A;  1MXU A;  1SI0 A;  1S9T A;  2CMO A;  1I6A A;  3ODB A;  3TQL A;  1QUK A;  4EQ7 A;  2Q8J A;  5ITO A;  4QRZ A;  4OEV A;  3RPW A;  1XS5 A;  3DM0 A;  3C4M A;  1AOV A;  4H8J A;  1B58 A;  4HCW A;  4IO3 A;  3FV2 A;  4ZEB A;  2DVC A;  5HPQ A;  2D3I A;  5J1D A;  5JEI A;  3KEI A;  1JET A;  2NOO A;  2ONS A;  2PVU A;  2XHD A;  1NNT A;  1XC1 A;  4QSD A;  3C31 A;  5TP9 A;  1B5I A;  3TYH A;  4E0W A;  1FTO A;  4F1Y A;  1MQI A;  3N94 A;  5IAI A;  5H8S A;  3HPI A;  3OO8 A;  4DXB A;  3SER A;  3H06 B;  4MH5 A;  3IOL A;  3Q25 A;  1S50 A;  2DP8 A;  5H8H B;  5K2Y A;  4TQU Q;  3VVD A;  4OWD A;  1S7Y A;  4MBP A;  5HBC A;  1N04 A;  2A5T B;  3KSX A;  1CE2 A;  4OES A;  1XT8 A;  4R74 A;  3FUZ A;  2DSF A;  5II0 A;  1Q35 A;  3M3L A;  3SEX A;  1NH8 A;  3RQT A;  4R6K A;  1MG1 A;  5FTI A;  1B3F A;  1BKA A;  2VOZ A;  1Y4T A;  3K6U A;  1N7W A;  2I0B A;  3MP8 A;  3MUQ A;  3Q29 A;  4Q5T A;  4ZEC A;  3I6V A;  4F1U A;  1LBC A;  4OQO A;  2G93 A;  4RXL A;  4H8I A;  2ZYK A;  2DWH A;  5I57 B;  2DYX A;  1BLF A;  2Q88 A;  5ISU A;  2RIN A;  3KG2 A;  4YKJ A;  4YZZ A;  3TTK A;  1AIV A;  1I6B A;  1M5B A;  3G3K A;  3PUW E;  3G3J A;  1XOC A;  4FEC A;  1US4 A;  4IO7 A;  4KPT A;  4NF4 B;  3MQ9 A;  5CMK A;  2V93 A;  3S4U A;  3K1N A;  2F36 A;  4GQO A;  1OLC A;  3UP9 A;  1O64 A;  1Y3N A;  3L6G A;  5CRY A;  3N26 A;  2XXU A;  1IXG A;  1VFE A;  2F7A A;  1B0H A;  2HXW A;  2XXH A;  3CR9 A;  3TZA A;  1MXZ A;  5H8F A;  2ALU A;  2Q2A A;  3G7W A;  3FVK A;  4H5G A;  1B7Z A;  1FW0 A;  1NL5 A;  1SD3 A;  4I1D A;  3CSG A;  3DLN A;  3IOW A;  2ESN A;  3ECR A;  3H6T A;  4OMB A;  2P2A A;  1MY2 A;  3T9U A;  3O97 A;  3M3F A;  1B52 A;  1NMU A;  3KGC A;  5TPA B;  1RYX A;  3MPL A;  4G77 A;  4LZ5 A;  3PMV A;  2OZZ A;  1IXH A;  2RCB A;  1DTZ A;  4JWO A;  5TU0 A;  3T93 B;  4YMB A;  4F1V A;  1O63 A;  1ZLQ A;  1URS A;  2KLF A;  4OFL A;  4PFW A;  4DZ1 A;  4FAJ A;  3K00 A;  4OTE A;  1B40 A;  1JW1 A;  4BLA A;  3PPN A;  1SW1 A;  3ZKK A;  5L9M A;  3TUS A;  3JV9 A;  3RGY A;  1MQJ A;  1OLA A;  2DWJ A;  3FVG A;  2QMX A;  3JZJ A;  3LSL A;  3TQW A;  1PB8 A;  1QKA A;  4IGT A;  4DCX A;  2FNC A;  1OVT A;  3C36 A;  2DXR A;  3MVY A;  4ZZA A;  5L9S A;  5AA2 D;  1BIY A;  3H7M A;  3K0V A;  2XXT A;  3BFU A;  1M5D A;  2QS3 A;  3RNN A;  3UA8 A;  3T66 A;  5I84 A;  4ZED A;  4DXU A;  1FCK A;  4M4G A;  3TTR A;  1LLS A;  3PGF A;  4Z7E A;  4DDD A;  1EZO A;  1MH4 A;  3R6U A;  3TTN A;  4U22 A;  2DXY A;  4JDF A;  4ESX A;  4ZGM A;  5DVF A;  1LGB C;  4BDL A;  1M5C A;  1UTH A;  4GXA A;  3RTF B;  3KOT A;  1HSE A;  2OLB A;  4YKK A;  2I6E A;  4XIG Q;  3GBA A;  2F97 A;  4F19 A;  4H65 A;  1LAG E;  3S9M C;  2REJ A;  4P0I A;  1POY 1;  1B5H A;  2P1S A;  2YPN A;  2REG A;  4OVJ A;  4POX A;  4RK2 A;  5FHN A;  4GIZ A;  1AMF A;  1TT1 A;  3A3U A;  3IO6 A;  1H3D A;  2ZNT A;  3IB1 A;  3LC8 A;  3QXM A;  2HAV A;  3PUZ E;  1B3G A;  2XXV A;  1D3K A;  3TEP A;  3V83 A;  3U92 A;  3GZG A;  3TCH A;  4NWD A;  3CVG A;  1IEJ A;  4Q0C A;  1AL3 A;  3SDF A;  2I48 A;  2RKM A;  3I5O A;  1A8F A;  4OHN A;  3H3G A;  4OEN A;  4THI A;  1QUI A;  2A5T A;  3FJG A;  2DVZ A;  3KSJ A;  3QSL A;  2I58 A;  3FVN A;  3IJO B;  3Q28 A;  4R2B A;  3TTM A;  3VLU A;  1B3H A;  4O3C A;  4C0R A;  1MM6 A;  2X7Q A;  4NF8 A;  4PE5 B;  1R9L A;  1Z7N E;  2E1S A;  5AA2 B;  1JEU A;  4N13 A;  4BDQ A;  2FYI A;  1IQ7 A;  5I59 A;  1B5J A;  4M1V A;  4H5F A;  3L6H A;  3PPO A;  4U23 A;  3O2A A;  3DP8 A;  4LUB A;  3PV0 E;  5DYH A;  3ILU B;  3L2J A;  2THI A;  2XXP A;  1RYO A;  4I8C A;  1MH3 A;  1P99 A;  2O7U A;  2ZNU A;  4P0G A;  5I58 B;  3DP4 A;  1DSN A;  3MZB A;  4OFO A;  3TDJ A;  3K6W A;  1F9B A;  4OET A;  1N76 A;  3FJ7 A;  4JWY A;  2XX8 A;  3WAF A;  4ELP A;  2DWI A;  4GOT A;  1HSL A;  1B4Z A;  1ATG A;  4GD5 A;  2I49 A;  4QSC A;  3CFZ A;  3KN3 A;  4H6D A;  1ELJ A;  3E3K A;  3FD3 A;  1LB9 A;  4BDN A;  5ICQ A;  3JYR A;  1GGG A;  3FZV A;  4AQ4 A;  2OK2 A;  1Y20 A;  5JK4 A;  4JB7 A;  1D4N A;  1I6Q A;  4ECF A;  1URD A;  5TP9 B;  1PBP A;  3G3F A;  4G4P A;  1EZ9 A;  2AL4 A;  2F8D A;  1FQD A;  3DEL B;  2XXY A;  3EF7 A;  1FTL A;  4R73 A;  2PT1 A;  2Q89 A;  4U4X A;  1MPC A;  4AB5 A;  3HCQ A;  4MLV A;  5AA3 A;  3FV1 A;  3IAZ A;  4KHZ E;  3KOS A;  4NTL A;  2V84 A;  2XD3 A;  2Z23 A;  2F78 A;  3H6U A;  4H67 A;  4JWX A;  4QFL A;  5EHM A;  3V8X B;  1B3L A;  4DLD A;  5CC2 A;  3IO4 A;  1FTJ A;  2UYF A;  4YIC A;  3RT8 A;  3T9V A;  4F29 A;  1WOD A;  2I4B A;  4GRK A;  4G68 C;  4QFK A;  4F31 B;  3R26 A;  3KJT A;  2Q2C A;  2X26 A;  3S9N C;  1R6Z A;  2CZL A;  2XXX A;  1MY4 A;  3LSX A;  3MP1 A;  4NMY A;  4HJ0 A;  2OBG A;  1QKB A;  1OMP A;  2B3F A;  3BBR A;  3O29 A;  4NF5 A;  3LBS A;  2QJE A;  1B9J A;  2QPQ A;  3ILT B;  2DOJ A;  2ONK E;  3CRB A;  3Q26 A;  4I9D A;  1BTJ A;  4K3F A;  4WED A;  1MXV A;  3K02 A;  4G8H A;  4NED A;  1FQB A;  1NFT A;  3VV5 A;  2R6G E;  4OFJ A;  5DVI A;  1XHY A;  3TOD A;  2PT2 A;  4ZE8 A;  5F1Q A;  5B70 A;  3FXR A;  5CMC A;  5H8Q A;  4EQB A;  3U94 A;  1ZBM A;  5CBS A;  4GL0 A;  3VE1 B;  1P1W A;  3SEU A;  2QRY A;  3EHS A;  5A5X B;  1P1U A;  1LCF A;  2QMW A;  3IOR A;  2H99 A;  2R9J A;  3KFM A;  5H8H A;  4ZDM A;  5H8N A;  1LCT A;  1Z7M E;  4KYD A;  1GVC A;  1B7H A;  2AIX A;  4F3P A;  3S9L C;  2H9B A;  4NWC A;  2XXQ A;  1R1N A;  2I4C A;  4QFP A;  1LBB A;  4EQ9 A;  5BWJ A;  4JSO A;  5AA4 A;  5KDT B;  4ERS A;  3GBB A;  1B1X A;  1IUD A;  1SYH A;  1RKM A;  3E9X A;  3GLB A;  2RF1 A;  3O9P A;  3EHU A;  1TXF A;  3U93 A;  3PUV E;  4LZ8 A;  1NH7 A;  4PP0 A;  4LQ5 A;  4EXK A;  3KJ7 A;  2DWA A;  3HHF A;  4OER A;  4ZZE A;  2Y84 A;  1SW5 A;  2A5S A;  3A3C A;  4F39 A;  4LF3 C;  1DOT A;  3PD9 A;  2M8C A;  3K1M A;  1H76 A;  3CFL A;  2NWJ A;  3FVO A;  1IZ1 A;  3KBR A;  3FJM A;  3OD7 A;  3OXN A;  4RPO A;  1JW5 A;  1DMB A;  4GFR A;  4RYA A;  2F35 A;  1DTG A;  4HS7 A;  3OO6 A;  1A55 A;  3UN6 A;  4G68 A;  2V3U A;  3QAX A;  4GLI A;  4YKI A;  5H8Q B;  5M2V A;  3DP6 A;  3O66 A;  2WKY A;  1IIT A;  1B6H A;  4YU0 A;  1VFD A;  3FAT A;  5I2N A;  1MQH A;  3C5T A;  3W15 C;  1EZP A;  1MS7 A;  2RC7 A;  4FEB A;  4WKM A;  4ZEI A;  3TTL A;  3VXB A;  1I69 A;  2PMS A;  2Y7W A;  1LST A;  4XTC Q;  3GXA A;  3MC2 A;  4GWO A;  5I2K A;  5EHS A;  1MY3 A;  1LB8 A;  1SW4 A;  3H03 A;  4DE8 A;  3AXF A;  4IGR A;  4IO4 A;  1NNF A;  1MQG A;  3O6H A;  3TFL A;  3U1O A;  4F3S A;  5JTY B;  2QSX A;  4Q8R A;  4N07 A;  4XXU A;  1CB6 A;  1GTK A;  5HM4 B;  1A8E A;  1FTM A;  2Y7I A;  4OYV A;  1N3X A;  1B51 A;  1EH3 A;  4ZEF A;  1A40 A;  5H8F B;  1HSJ A;  2I3W A;  3VVF A;  4DIG A;  1P1N A;  3TCG A;  2XDG A;  4YKP A;  1ANF A;  1SW2 A;  4G8M A;  3IB2 A;  1WDN A;  4RNS A;  5I58 A;  2JND A;  2OWS A;  5ELV A;  3IOU A;  1Y4C A;  4KQP A;  2RC8 A;  3ZS6 A;  2UXA A;  3D4G A;  3ZKL A;  2QKH A;  3K6V A;  3USD A;  1OVB A;  3U72 A;  3MW0 A;  2Y7R A;  1MRP A;  4U21 A;  4KCC A;  4U1Z A;  2F6G A;  1P1O A;  2H4I A;  1ZIU A;  1VE4 A;  3BKI B;  4X9T A;  3W9W A;  1MXX A;  1B1H A;  3OSR A;  3I3V A;  3PUX E;  4R75 A;  4YAH X;  4IY5 A;  3O6I A;  2Y7P A;  4PET A;  3O28 A;  1MPB A;  4WEP A;  5CBR A;  2ZYO A;  3KZG A;  3AQF B;  2H5Y A;  4H0W A;  2VHA A;  3VLW A;  4KYS A;  1U34 A;  1IXC A;  2Z8F A;  2OJT A;  3LR1 A;  3V5A A;  4DLQ A;  3HN0 A;  3IOT A;  3MZ1 A;  2YLN A;  2QS4 A;  1JQF A;  1USY E;  4G8N A;  4ONY A;  2VD2 A;  2VD3 A;  4LON B;  4NE4 A;  4BDM A;  3IR1 A;  4EUO A;  3E13 X;  2OCU A;  1M5E A;  3B6T A;  3B7D A;  3K6X A;  3P7I A;  1R9Q A;  1YPN A;  1Y3P A;  2HCA A;  2PBW A;  5KCJ A;  2O69 A;  1VSO A;  3FAS A;  3PPP A;  3RUM A;  3VLV A;  1PC3 A;  1POT A;  3LSW A;  4PFT A;  4BDR A;  3FXU A;  4RY1 A;  3N6U A;  1D9V A;  4GF8 A;  1ZJL A;  3CI8 A;  1PB7 A;  1SDX A;  3UOR A;  1UTB B;  4HTG A;  3G3G A;  4DXC A;  4DLO A;  5AE4 A;  1JNF A;  3CG1 A;  3MPK A;  1B2H A;  4YB7 A;  1IIW A;  1YTV A;  2F6P A;  4NF4 A;  4O3B A;  3RTW B;  5FHO A;  4NF8 B;  2Q9T A;  1Q1K A;  3SEW A;  3OO7 A;  1GV8 A;  2F34 A;  1A99 A;  4UA8 A;  4IB2 A;  2V3Q A;  3H6W A;  5JTY A;  3UK4 A;  1YCJ A;  4XKP A;  1UIV A;  1H43 A;  3C32 A;  2V3T A;  2UVG A;  1GR2 A;  1UQW A;  2GFE A;  3MAM A;  3OEM A;  1N3W A;  3PD8 A;  1TFD A;  1N7X A;  4FOR A;  4R6H A;  2DS9 A;  4F3G A;  5A5X A;  5AA4 B;  2L27 A;  1JW4 A;  5I59 B;  1FTK A;  1UTB A;  1OQG A;  3E4R A;  1II5 A;  4F2O A;  3N7P A;  4C1T A;  4XKQ A;  4ELO A;  1B3E A;  4MF3 A;  2O84 X;  1DPP A;  4G2Z A;  1EU8 A;  2XD2 A;  3C59 A;  2V25 A;  4G68 B;  2DQV A;  5CMM A;  1B4H A;  2VP1 A;  3MVZ A;  1OQH A;  5IKB A;  3M8U A;  2G29 A;  4FAT A;  3QYT A;  3CG3 A;  2VGQ A;  3CFX A;  3FXQ A;  5ITP A;  1NNP A;  4LZ7 A;  4OEU A;  4BDO A;  3CIJ A;  4LVQ A;  3MP6 A;  2ZYM A;  3CSB A;  3W9V A;  4N6P A;  4GL8 A;  1LAH E;  4XKN A;  2ZYN A;  2XXI A;  3OEN A;  4RPN A;  4NF5 B;  1MY1 A;  2DE2 A;  3D4C A;  2NXO A;  3TKD A;  3IX1 A;  3OO9 A;  3PMX A;  4ELR A;  2W7Y A;  4JXI A;  3H6V A;  2GHA A;  4FIM A;  5K2X A;  5L8D A;  1Y1M A;  2E0S A;  3RLF E;  1IXI A;  2AYS A;  2PX1 A;  1NNK A;  4KD5 A;  4QHQ A;  2Z8D A;  1SI1 A;  2Z22 A;  2ZXT A;  2O51 A;  3OEK A;  4GVO A;  2GH9 A;  2NVU B;  1QUL A;  1US5 A;  2HFB A;  4ELQ A;  2XXW A;  3RN8 A;  1MDP 1;  4OZ9 A;  1H45 A;  3QIM A;  4PFY A;  3SET A;  4KFQ A;  3MBP A;  4QSE A;  3VDF A;  4EF2 A;  3HO7 A;  3C35 A;  1Y3Q A;  3PPR A;  4F22 A;  5KCJ B;  3FIR A;  3OSQ A;  3WAE A;  4JSD A;  2QS2 A;  3TMG A;  2PYY A;  4E0X A;  1B46 A;  1FQC A;  1MDQ A;  1JEV A;  4YMA A;  5DTB A;  2DE3 A;  1M5F A;  3IB0 A;  3VXC A;  1LFI A;  5BUU A;  2HAU A;  5L9O A;  2B3B A;  5KZT A;  3QUJ A;  4TLL B;  4RA1 A;  2QL3 A;  3G3I A;  1A54 A;  2LAO A;  3PU5 A;  4L17 A;  3G3H A;  5I56 A;  1PB9 A;  4PFU A;  4UAC A;  4R6Y A;  3PUY E;  4KR5 A;  4F3B A;  3O6G A;  4LP2 B;  5DEX A;  1P1Q A;  5DT6 A;  4RK9 A;  2HZL A;  2ONR A;  1T0K A;  2UVH A;  1LFH A;  1PDA A;  3K4U A;  1ZU0 A;  2O68 A;  3QK6 A;  1SYI A;  5F7V A;  3OOA A;  4IO6 A;  2RC9 A;  4QF9 A;  2O6A A;  4EF1 A;  1MPD A;  2O1M A;  2YJP A;  2I3V A;  1SVX B;  4F2Q A;  1B32 A;  2HEU A;  3THI A;  1TFA A;  2F5X A;  3C34 A;  2D21 A;  2F7C A;  2H98 A;  4LQ2 A;  4DCY A;  3LUY A;  1QVS A;  1TWY A;  4JBZ A;  3VVE A;  4F18 A;  2OWT A;  4P11 A;  1BP5 A;  3MVW A;  4ESW A;  5I57 A;  3VFJ A;  3ZSF A;  1LAF E;  2NUV A;  2R71 A;  3UIF A;  4TLM B;  3SEV A;  1ZKB A;  4FED A;  4WXJ A;  4U4S A;  1H44 A;  2DE4 A;  4X1D A;  2XX7 A;  1Y1Z A;  3N5L A;  1Y9U A;  2JOD A;  1MXW A;  2UYE A;  1DPE A;  5KDT A;  4U1O A;  1MM7 A;  1XVX A;  3OEL A;  1OIB A;  2H25 A;  3C33 A;  1YAE A;  4X48 A;  3MVX A;  2GRV A;  4LA9 A;  2IEE A;  4R9G A;  1L5T A;  4C1U A;  4EXL A;  2X7P A;  5H8N B;  2I0C A;  1N84 A;  3EN3 A;  2IA4 A;  2XX9 A;  3TPA A;  3V89 B;  4OXV A;  1UIU A;  5I2N B;  5I56 B;  3FGS A;  2QS1 A;  1B0L A;  4IO2 A;  4YB5 A;  5CMB A;  3C9H A;  2XXR A;  3ONM A;  4HCY A;  5AA1 A;  4QFN A;  3T96 B;  3TAJ A;  1QUJ A;  1VR5 A;  3EPE A;  2P0S A;  4EDP A;  4MFI A;  1JVX A;  1LFG A;  1O7T A;  1KWH A;  1UTH B;  2O1L A;  3T9X B;  4XKR A;  3N7S A;  3S9E A;  4I62 A;  4R9F A;  3F11 A;  3S2V A;  4YB6 A;  4KI0 E;  2F7B A;  5LOM A;  5AA2 A;  2UVJ A;  2D5W A;  3BFT A;  2AL5 A;  1J1N A;  3B6W A;  3SEY A;  3EQ1 A;  5TPA A;  3TCF A;  3A09 A;  3KN7 A;  4ND9 A;  4FJP A;  2ANJ A;  1JVY A;  3HV1 A;  3Q27 A;  4Z0I A;  3MWB A;  3TEL A;  1NKX A;  3EHT A;  1B05 A;  3RT6 B;  3T9H B;  3RY3 A;  2RCA A;  3MZ9 A;  1A7L A;  3N6T A;  5FHM A;  1LAX A;  4PQJ A;  3IOV A;  1MXY A;  4HW8 A;  2HQ0 A;  1ZTY A;  2JNC A;  1XVY A;  4GXS B;  4U2R A;  1SBP A;  1MY0 A;  4NF6 A;  2FA7 A;  2B65 A;  4ISU A;  1MQD A;  4QFO A;  4NF6 B;  4POW A;  1FQF A;  1FQE A;  4RJZ A;  5CI5 A;  5DEX B;  3N7R A;  2ZMB A;  3MJN A;  4MLQ A;  1URG A;  3B6Q A;  1QJM A;  1SQY A;  1USY H;  2HZK A;  4R72 A;  3IJX B;  4TOZ A;  2UVI A;  4O3A A;  5DVJ A;  3SES A;  5B7D A;  3M3K A;  4H1X A;  5I2K B;  4AB6 A;  3IK6 B;  1D9Y A;  1WVJ A;  2GHB A;  4R2F A;  5ICT A; 
#chains in the Genus database with same CATH topology
 1PBQ A;  3K01 A;  1EYK A;  4X1B A;  3QUF A;  1ZMG A;  3IL1 B;  3HST A;  5EYF A;  2Z8E A;  1B7U A;  1S9T A;  1QUK A;  1XS5 A;  3DM0 A;  3C4M A;  4H8J A;  4HCW A;  5J1D A;  2NOO A;  2PVU A;  5TP9 A;  1IMB A;  1MQI A;  4DXB A;  2JJK A;  1S7Y A;  5HBC A;  1CE2 A;  4OES A;  3FUZ A;  3RQT A;  4ZEC A;  3K6U A;  4Q5T A;  3MUQ A;  3I6V A;  4OQO A;  2Q88 A;  1LBZ A;  2WX9 A;  4YZZ A;  1AIV A;  1I6B A;  3RNN A;  4NF4 B;  5CMK A;  4FEC A;  3NOH A;  4MIJ A;  3MQ9 A;  2V93 A;  4GQO A;  2CEX A;  3FVK A;  4H5G A;  1B7Z A;  1NL5 A;  2PFY A;  4JVI A;  2ESN A;  3T9U A;  5TPA B;  2OZZ A;  3ROJ A;  4MEV A;  4OFL A;  4GWS A;  1JW1 A;  4BLA A;  3TUS A;  1MQJ A;  1OLA A;  5EQ8 A;  5EQ9 A;  1OVT A;  2DXR A;  1D9Q A;  3MVY A;  2OX3 A;  3PGF A;  5DVF A;  4BDL A;  3KOT A;  4F19 A;  1XI6 A;  2WBB A;  5FHN A;  4OVJ A;  4RK2 A;  2ZNT A;  3QXM A;  2HAV A;  3PUZ E;  3U92 A;  3TCH A;  2RKM A;  4N8G A;  3H3G A;  4OEN A;  3QSL A;  2I58 A;  3VLU A;  4I3E A;  5AA2 B;  4BDQ A;  3PPO A;  4U23 A;  4PDD A;  3L2J A;  4LN5 A;  4I8C A;  1P99 A;  4OET A;  4GD5 A;  2I49 A;  4NGU A;  4H6D A;  1LB9 A;  1GGG A;  5JK4 A;  5TP9 B;  2XXY A;  1KA0 A;  3FV1 A;  3IAZ A;  3KOS A;  2XD3 A;  2Z23 A;  2F78 A;  4DLD A;  1B3L A;  3IO4 A;  1FTJ A;  2I4B A;  2X26 A;  1R6Z A;  3MP1 A;  4NMY A;  2B4M A;  2B3F A;  4NF5 A;  4GWX A;  4I9D A;  4WED A;  2Y5K A;  2DOJ A;  2ONK E;  3CRB A;  3FBP A;  1MXV A;  3K02 A;  5DVI A;  5F1Q A;  5H8Q A;  5CBS A;  3VE1 B;  3SEU A;  2QRY A;  5A5X B;  1DK4 A;  1IMA A;  1LCT A;  1Z7M E;  4QFP A;  2XXQ A;  1R1N A;  4EQ9 A;  1NV1 A;  1IUD A;  4MJO A;  3PUV E;  2CZH A;  4EXK A;  4F39 A;  1H76 A;  2NWJ A;  1IZ1 A;  3OD7 A;  3FJM A;  3OXN A;  3E79 A;  1JW5 A;  4XFE A;  4HS7 A;  3OO6 A;  2WYK A;  2V3U A;  2P3N A;  3O66 A;  1MQH A;  3W15 C;  4FBP A;  2RC7 A;  3VXB A;  3KC0 A;  1G0H A;  4XTC Q;  5I2K A;  2OWZ A;  1NNF A;  4Q8R A;  5LTC A;  5JTY B;  1CB6 A;  1GTK A;  2Y7I A;  1FTM A;  1LBW A;  4OYV A;  1N3X A;  1EH3 A;  4ZEF A;  1A40 A;  2I3W A;  3IOU A;  2QKH A;  3D4G A;  3ZKL A;  1OVB A;  3U72 A;  3MW0 A;  2Y7R A;  4KCC A;  4U1Z A;  1KZ8 A;  4R75 A;  4YAH X;  5IGA A;  3O6I A;  1MPB A;  3VLW A;  3BIH A;  4N6K A;  3LR1 A;  2YLN A;  1FPJ A;  2QS4 A;  3B8B A;  4ONY A;  4PAF A;  2VD2 A;  4LON B;  5EQA A;  1EYI A;  4NF6 A;  3P7I A;  1R9Q A;  5KCJ A;  1Y3P A;  3FAS A;  4PFT A;  1UTB B;  3MPK A;  1IIW A;  1FJ9 A;  4NF8 B;  1A99 A;  4IB2 A;  5EYH A;  3H6W A;  4XKP A;  1H43 A;  1GR2 A;  3OEM A;  1TFD A;  4R6H A;  2L27 A;  3E4R A;  4MF3 A;  4NX1 A;  4G2Z A;  4P1E A;  2V25 A;  2DQV A;  1OQH A;  3M8U A;  4FAT A;  3CFX A;  1NNP A;  3W9V A;  4PFB A;  2FBP A;  4NF5 B;  3TKD A;  2DE2 A;  4ZE9 A;  3OO9 A;  4JXI A;  2GHA A;  4FIM A;  1IME A;  1IXI A;  1NNK A;  1SI1 A;  2GH9 A;  2NVU B;  2VT5 A;  2HFB A;  3RN8 A;  1H45 A;  3SET A;  4KFQ A;  4EF2 A;  3C35 A;  3PPR A;  3OSQ A;  1EYJ A;  1JEV A;  5L9O A;  2B3B A;  4GWY A;  3QUJ A;  4RA1 A;  4PFU A;  4UAC A;  3O6G A;  2ONR A;  4PF6 A;  3K4U A;  3QK6 A;  4IO6 A;  4QF9 A;  2YJP A;  2HEU A;  2F5X A;  2D21 A;  3LUY A;  1NUX A;  2NUV A;  2R71 A;  4PF8 A;  3UIF A;  1ZKB A;  4FED A;  1H44 A;  4X1D A;  1Y1Z A;  3N5L A;  1LBV A;  2UYE A;  5KDT A;  4U1O A;  4H46 A;  1OIB A;  2H25 A;  2GRV A;  4R9G A;  1L5T A;  4C1U A;  3EN3 A;  5I2N B;  4OXV A;  2QS1 A;  4YB5 A;  5CMB A;  5AA1 A;  3EPE A;  3T9X B;  4I62 A;  3F11 A;  1YXI A;  4KI0 E;  1K9Y A;  2F7B A;  5LOM A;  2D5W A;  3BFT A;  1J1N A;  3EQ1 A;  3HV1 A;  3TEL A;  3MWB A;  3MYU A;  1B05 A;  3RT6 B;  1A7L A;  3N6T A;  4PQJ A;  1MXY A;  4HW8 A;  5I7I A;  2HQ0 A;  1ZTY A;  1SBP A;  4QFO A;  4ISU A;  1MQD A;  1SQY A;  4R72 A;  4TOZ A;  3SKP A;  2BJJ X;  3K1P A;  3R7X A;  4O94 A;  4OVS A;  2Q74 A;  1PEB A;  3PMW A;  4IY6 A;  3UGW A;  5IZZ A;  4ZEK A;  1N0T A;  1QW0 A;  4DIG A;  5I59 B;  4IO3 A;  4ZEB A;  3TYH A;  4E0W A;  3N94 A;  3H06 B;  4MH5 A;  4TQU Q;  4OWD A;  1N04 A;  5A5L A;  2DSF A;  4P1L A;  4GWZ A;  3SEX A;  4R6K A;  1MG1 A;  4PE3 A;  1B3F A;  1BKA A;  1Y4T A;  4F1U A;  4RXL A;  5F24 A;  5ISU A;  3G3K A;  1M5B A;  4KPT A;  3K1N A;  2F36 A;  1FBH A;  1Y3N A;  2XXU A;  1B0H A;  2HXW A;  2XXH A;  4PFI A;  1KA1 A;  1MXZ A;  1FBE A;  1FW0 A;  1MY2 A;  3O97 A;  3M3F A;  1B52 A;  1NMU A;  3MPL A;  4PCD A;  4LZ5 A;  3PMV A;  4JWO A;  5TU0 A;  4PC9 A;  4PFW A;  4DZ1 A;  3K00 A;  4OTE A;  3IFA A;  3RYD A;  1SW1 A;  3JV9 A;  3RPL A;  3TQW A;  3JZJ A;  1PB8 A;  2FNC A;  4HE2 A;  3H7M A;  3BFU A;  3UA8 A;  4ZED A;  1IMF A;  4Z7E A;  1EZO A;  1MH4 A;  4ESX A;  4GXA A;  1UTH A;  1HSE A;  2OLB A;  4H65 A;  2REJ A;  2P1S A;  5IZ1 A;  1TT1 A;  3A3U A;  1H3D A;  4X8R A;  4NWD A;  4XF5 A;  2BJI A;  3I5O A;  1A8F A;  1QUI A;  2A5T A;  3FJG A;  4PBQ A;  3IJO B;  3TTM A;  3Q28 A;  1B3H A;  4O3C A;  4C0R A;  4NF8 A;  1Z7N E;  4N13 A;  5I59 A;  1B5J A;  3L6H A;  3PV0 E;  3ILU B;  1RYO A;  1MH3 A;  4P0G A;  4OFO A;  3TDJ A;  1N76 A;  2XX8 A;  2DWI A;  5IZ3 A;  1B4Z A;  3CFZ A;  1LBY A;  4AQ4 A;  4JB7 A;  1PBP A;  3G3F A;  1EZ9 A;  2WYP A;  1FBP A;  3DEL B;  1FQD A;  1FTL A;  1G0I A;  2Q89 A;  1MPC A;  5AA3 A;  4KHZ E;  1JP4 A;  4JWX A;  4QFL A;  3T9V A;  1NV3 A;  4G68 C;  3R26 A;  2Q2C A;  4PGP A;  1IMD A;  2XXX A;  3LSX A;  4HJ0 A;  1LEV A;  1QKB A;  1OMP A;  3O29 A;  1FBF A;  3LBS A;  2QJE A;  2QPQ A;  3ILT B;  1NV0 A;  3Q26 A;  2KQZ A;  1BTJ A;  2PT2 A;  2R8T A;  4ZE8 A;  3CHG A;  3FXR A;  4EQB A;  4N81 A;  2QMW A;  1LCF A;  4ZDM A;  3A29 A;  2H99 A;  5H8H A;  1GVC A;  5H8N A;  4KYD A;  1NUW A;  2H9B A;  5BWJ A;  2I4C A;  1LBB A;  4ERS A;  1B1X A;  1SYH A;  4OVQ A;  3O9P A;  3E9X A;  3EHU A;  3U93 A;  4LQ5 A;  3KJ7 A;  4LF3 C;  1DMB A;  2L5V A;  3QAX A;  5H8Q B;  5M2V A;  5FBP A;  1IIT A;  1VFD A;  4WKM A;  1I69 A;  2PMS A;  1LST A;  3GXA A;  4GWO A;  1LB8 A;  1SW4 A;  3H03 A;  4IO4 A;  4P3L A;  1MQG A;  4XXU A;  3KC1 A;  2CEY A;  5H8F B;  1HSJ A;  3VVF A;  1ANF A;  1WDN A;  2OWS A;  2RC8 A;  3K6V A;  1MRP A;  2F6G A;  4OVP A;  4PAI A;  2H4I A;  4X9T A;  4IY5 A;  2Y7P A;  4PET A;  3B50 A;  5CBR A;  2ZYO A;  2H5Y A;  4H0W A;  4KYS A;  1FPF A;  1U34 A;  1FPG A;  2Z8F A;  4QXD A;  4DLQ A;  4GX3 A;  3HN0 A;  3MZ1 A;  1JQF A;  1USY E;  4EUO A;  3E13 X;  1M5E A;  3K6X A;  1YPN A;  2O69 A;  1VSO A;  3VLV A;  4GF8 A;  4HTG A;  3G3G A;  1B2H A;  2XXK A;  4YB7 A;  2F6P A;  4N91 A;  2V3Q A;  5JTY A;  3UK4 A;  1UIV A;  1UQW A;  1N3W A;  4ELO A;  1FPE A;  5CMM A;  2ZZV A;  2G29 A;  2VGQ A;  4O8M A;  5ET7 A;  4UAB A;  2ZYN A;  1FPI A;  2NXO A;  4G61 A;  3IX1 A;  3H6V A;  2QVV A;  1Y1M A;  2PX1 A;  4I40 A;  4KD5 A;  2Z22 A;  2ZXT A;  1US5 A;  4PFR A;  4PFY A;  4OZ9 A;  4QSE A;  1VDW A;  4F22 A;  2QS2 A;  4N17 A;  3TMG A;  1B46 A;  1M5F A;  1LFI A;  3RPL B;  2FVZ A;  3G3H A;  1K9Z A;  4F3B A;  5DEX A;  2HZL A;  1T0K A;  1LFH A;  2O68 A;  1SYI A;  2RC9 A;  4EF1 A;  1MPD A;  3N7P A;  1SVX B;  2XA5 A;  3VVE A;  1BP5 A;  3ZSF A;  1LAF E;  3SEV A;  4U4S A;  2JOD A;  1DPE A;  3C33 A;  4LA9 A;  4GX6 A;  5H8N B;  5KZT A;  3V89 B;  3FGS A;  2XXR A;  2GQ1 A;  1JVX A;  1KWH A;  2O1L A;  3N7S A;  4JVC A;  4YB6 A;  5AA2 A;  2UVJ A;  4N15 A;  3KN7 A;  1JVY A;  3Q27 A;  4QBA A;  4Z0I A;  3IOV A;  2JNC A;  4GXS B;  2FA7 A;  2B65 A;  4P47 A;  4NF6 B;  1FQF A;  1FQE A;  2ZMB A;  3MJN A;  1URG A;  3B6Q A;  4GWW A;  5EQ7 A;  4R2F A;  5CM6 A;  3H4Z A;  4KYE A;  3KN8 A;  4MNC A;  5FTH A;  1AH5 A;  2O7I A;  4LAT A;  4Q30 B;  4FE8 A;  3OMB A;  3TQL A;  1MXU A;  2CMO A;  2P3V A;  5ITO A;  4QRZ A;  3RPW A;  1B58 A;  2D3I A;  3KEI A;  2XHD A;  1NNT A;  4QSD A;  3C31 A;  1B5I A;  1FTA A;  5IAI A;  3OO8 A;  4GBW A;  3IOL A;  1S50 A;  2F3B A;  2XWO A;  4MBP A;  4NAP A;  4P8B A;  3KSX A;  1FSA A;  2A5T B;  4R74 A;  1Q35 A;  5FTI A;  3MP8 A;  3E78 A;  1N7W A;  2I0B A;  3SZP A;  1LBC A;  5I57 B;  3TTK A;  4IO7 A;  1OLC A;  3UP9 A;  1O64 A;  3L6G A;  5CRY A;  1VFE A;  3G7W A;  3CSG A;  3DLN A;  3IOW A;  3H6T A;  2P2A A;  2QVU A;  4G77 A;  3ISP A;  2RCB A;  1DTZ A;  3T93 B;  4YMB A;  1O63 A;  1ZLQ A;  1URS A;  5IM2 A;  4FAJ A;  5L9M A;  3RGY A;  2QMX A;  1QKA A;  4IGT A;  1LBX A;  4DCX A;  1M5D A;  3T66 A;  1FCK A;  4M4G A;  1LLS A;  1RDZ A;  3R6U A;  3TTN A;  4JDF A;  1M5C A;  4YKK A;  4XIG Q;  3FXB A;  3SER A;  1POY 1;  2REG A;  4GIZ A;  1AMF A;  1B3G A;  2XXV A;  1D3K A;  3V83 A;  3CVG A;  3EKI A;  2I48 A;  1Q9D A;  4NF0 A;  3KSJ A;  4HE1 A;  3FVN A;  4MCO A;  2X7Q A;  4PE5 B;  3MST A;  2E1S A;  1IQ7 A;  4O7M A;  4MNI A;  3O2A A;  4NG7 A;  2XXP A;  2O7U A;  5EYG A;  5I58 B;  1DSN A;  3D1R A;  3K6W A;  3FJ7 A;  3WAF A;  4ELP A;  4GOT A;  4OAN A;  4QSC A;  3KN3 A;  3E3K A;  3FD3 A;  4GX4 A;  5ICQ A;  3JYR A;  3FZV A;  2OK2 A;  2ZZX A;  1NV6 A;  3U65 A;  1I6Q A;  4OA4 A;  4MX6 A;  2KR0 A;  2F8D A;  3AQF B;  4MLV A;  4NTL A;  5EHM A;  2UYF A;  4YIC A;  2CZK A;  5ET5 A;  1NV2 A;  3IFC A;  3S9N C;  1MY4 A;  2OBG A;  3BBR A;  4K3F A;  2FIE A;  4G8H A;  1FQB A;  1NFT A;  3VV5 A;  4OFJ A;  3U94 A;  1ZBM A;  4GL0 A;  1P1W A;  3KFM A;  3S9M C;  4F3P A;  2AIX A;  3S9L C;  4NWC A;  5KDT B;  4JSO A;  5AA4 A;  4X04 A;  5ET8 A;  1RKM A;  3GLB A;  1TXF A;  4OER A;  3HHF A;  4ZZE A;  2Y84 A;  1SW5 A;  1AWB A;  2A5S A;  3CFL A;  3KBR A;  4RPO A;  1DTG A;  1A55 A;  3UN6 A;  4GLI A;  1B6H A;  4YU0 A;  1INP A;  4ZEI A;  3TTL A;  2Y7W A;  3MC2 A;  2XWK A;  5EHS A;  1MY3 A;  3U1O A;  4IGR A;  3O6H A;  4N07 A;  1A8E A;  1B51 A;  5LDZ A;  4MAG A;  1P1N A;  3TCG A;  4YKP A;  1SW2 A;  5T3J A;  4G8M A;  3IB2 A;  5I58 A;  5ELV A;  1Y4C A;  4U21 A;  1ZIU A;  3BKI B;  3W9W A;  1MXX A;  3I3V A;  4PTK A;  3O28 A;  2QVR A;  2B4L A;  3KZG A;  1IXC A;  1YYZ A;  2OJT A;  3IOT A;  2VD3 A;  1FPD A;  4NE4 A;  2OCU A;  3B7D A;  2PBW A;  2XWI A;  3LSW A;  5DW8 A;  3UOR A;  4RY1 A;  3N6U A;  1D9V A;  5AE4 A;  1QGX A;  1YTV A;  4O3B A;  5FHO A;  2Q9T A;  1Q1K A;  3SEW A;  3OO7 A;  2F34 A;  4UA8 A;  2V3T A;  4NQ8 A;  3PD8 A;  5AA4 B;  4OVR A;  1UTB A;  4F2O A;  4C1T A;  4XKQ A;  2Y5L A;  1B3E A;  2O84 X;  2ZZW A;  1EU8 A;  3LUZ A;  4G68 B;  2VP1 A;  4HE0 A;  3QYT A;  3CG3 A;  5ITP A;  4LZ7 A;  4OEU A;  4BDO A;  3CIJ A;  3MP6 A;  3CSB A;  4N6P A;  4GL8 A;  1LAH E;  4XKN A;  2XXI A;  4GWU A;  1MY1 A;  4ELR A;  1CNQ A;  2W7Y A;  3T0J A;  4DCY A;  2AYS A;  4QHQ A;  2O51 A;  4GVO A;  4OVT A;  1QUL A;  4ELQ A;  2XXW A;  1MDP 1;  3VDF A;  3QIM A;  3MBP A;  3HO7 A;  3FIR A;  4E0X A;  1FQC A;  3QMF A;  2DE3 A;  3IB0 A;  2HAU A;  4TLL B;  1A54 A;  2LAO A;  4I3Y A;  5I56 A;  3GYY A;  4MMP A;  3PUY E;  4KR5 A;  5DT6 A;  4RK9 A;  1ZU0 A;  5F7V A;  3OOA A;  3THI A;  2F7C A;  5H8F A;  4F18 A;  2OWT A;  4P11 A;  3MVW A;  4WXJ A;  3HFU A;  2DE4 A;  2XX7 A;  1MXW A;  1MM7 A;  1XVX A;  3OEL A;  1YAE A;  4X48 A;  3MVX A;  4EXL A;  1N84 A;  2IA4 A;  3TPA A;  4IO2 A;  3T1B A;  3C9H A;  3TAJ A;  4HCY A;  4QFN A;  4P9K A;  1QUJ A;  1VR5 A;  4EDP A;  4MFI A;  1UTH B;  1LFG A;  3S9E A;  4R9F A;  3SEY A;  5TPA A;  3TCF A;  3A09 A;  3EHT A;  3MZ9 A;  5FHM A;  1FPB A;  1LAX A;  4MHF A;  2MKZ A;  4U2R A;  1MY0 A;  4POW A;  5DEX B;  3N7R A;  4O7I A;  1QJM A;  2VPO A;  2UVI A;  4O3A A;  3M3K A;  4H1X A;  1FPK A;  1NV4 A;  1D9Y A;  2GHB A;  1FQA A;  3K2D A;  3HHG A;  4ZS9 A;  2CZI A;  3T22 A;  4KCD A;  3U8Q A;  2ZNS A;  1SPI A;  2ABH A;  3PPQ A;  3LSF B;  2Y7K A;  4IO5 A;  1FBC A;  4EQ7 A;  1SI0 A;  3ODB A;  1I6A A;  2Q8J A;  4OEV A;  1AOV A;  5HPQ A;  3FV2 A;  2DVC A;  5JEI A;  1JET A;  2ONS A;  1XC1 A;  5J16 A;  1FTO A;  4F1Y A;  5H8S A;  3HPI A;  1FJ6 A;  3Q25 A;  4PBH A;  2DP8 A;  5H8H B;  5K2Y A;  3VVD A;  1NV7 A;  1XT8 A;  5II0 A;  3M3L A;  2V4C A;  1NH8 A;  3Q29 A;  2VOZ A;  2HHM A;  2G93 A;  4H8I A;  2ZYK A;  2DWH A;  2DYX A;  1BLF A;  2RIN A;  3KG2 A;  4YKJ A;  3PUW E;  3G3J A;  1XOC A;  1US4 A;  3S4U A;  3N26 A;  1IXG A;  2F7A A;  3CR9 A;  3TZA A;  2ALU A;  2Q2A A;  5BUU A;  1SD3 A;  4I1D A;  3ECR A;  4OMB A;  4NHB A;  4H45 A;  3KGC A;  1RYX A;  1IXH A;  4F1V A;  2KLF A;  1B40 A;  3PPN A;  3ZKK A;  3LSL A;  2DWJ A;  3FVG A;  3C36 A;  4ZZA A;  5L9S A;  5AA2 D;  1BIY A;  3K0V A;  2XXT A;  5I84 A;  2QS3 A;  4DXU A;  3TTR A;  4DDD A;  4U22 A;  2DXY A;  1DCU A;  4ZGM A;  1LGB C;  3RTF B;  2I6E A;  3GBA A;  2F97 A;  1LAG E;  4P0I A;  1B5H A;  2YPN A;  4POX A;  3LC8 A;  3IO6 A;  3IB1 A;  4N4U A;  1DBZ A;  3GZG A;  1NV5 A;  1IEJ A;  4Q0C A;  1AL3 A;  3SDF A;  4OHN A;  4THI A;  2DVZ A;  4R2B A;  1MM6 A;  1R9L A;  1JEU A;  2FYI A;  4M1V A;  4H5F A;  3DP8 A;  2HPG A;  4LUB A;  5DYH A;  2THI A;  2ZNU A;  3DP4 A;  3MZB A;  1F9B A;  5I3S A;  4JWY A;  1HSL A;  1ATG A;  1ELJ A;  4BDN A;  1Y20 A;  2F3D A;  1D4N A;  4ECF A;  1URD A;  4G4P A;  2AL4 A;  3EF7 A;  4R73 A;  4AB5 A;  3TEP A;  2PT1 A;  4U4X A;  3C5T A;  3HCQ A;  3S2V A;  2V84 A;  3H6U A;  4H67 A;  3V8X B;  5CC2 A;  3RT8 A;  2XWV A;  4F29 A;  1WOD A;  4GRK A;  4QFK A;  4F31 B;  4DI3 D;  3KJT A;  2CZL A;  1B9J A;  4NED A;  2R6G E;  1XHY A;  3TOD A;  5ESY A;  5B70 A;  5CMC A;  5IZ3 B;  3EHS A;  1P1U A;  3IOR A;  2R9J A;  5I5P A;  1B7H A;  1FRP A;  3GBB A;  2RF1 A;  4LZ8 A;  1NH7 A;  4PP0 A;  2DWA A;  3A3C A;  1NUY A;  1DOT A;  3PD9 A;  2M8C A;  3K1M A;  3FVO A;  4RYA A;  4GFR A;  4HXV A;  2F35 A;  4G68 A;  4YKI A;  3DP6 A;  2WKY A;  5I2N A;  3FAT A;  1YZ0 A;  1EZP A;  1MS7 A;  4FEB A;  3KBZ A;  4DE8 A;  3AXF A;  4F3S A;  3TFL A;  2QSX A;  5HM4 B;  2XDG A;  2JND A;  4RNS A;  1FBD A;  4KQP A;  4N8Y A;  3ZS6 A;  2UXA A;  3USD A;  1P1O A;  1VE4 A;  1B1H A;  3OSR A;  3PUX E;  4AS4 A;  4AS5 A;  4WEP A;  2VHA A;  2PCR A;  2DDK A;  3V5A A;  4IR8 A;  4G8N A;  2QFL A;  3IR1 A;  4BDM A;  3B6T A;  2HCA A;  3PPP A;  3RUM A;  4BDR A;  1PC3 A;  1POT A;  3FXU A;  1ZJL A;  3CI8 A;  1PB7 A;  1SDX A;  4DXC A;  4JVD A;  4DLO A;  1JNF A;  3CG1 A;  4NF4 A;  3RTW B;  1GV8 A;  1NUZ A;  1YCJ A;  3C32 A;  2UVG A;  2GFE A;  3MAM A;  4F3G A;  1N7X A;  4FOR A;  2DS9 A;  5A5X A;  1NI9 A;  1JW4 A;  1FTK A;  3BIG A;  1OQG A;  1II5 A;  3LV0 A;  1DPP A;  2XD2 A;  3C59 A;  1B4H A;  3MVZ A;  5IKB A;  3FXQ A;  2FIX A;  4LVQ A;  2ZYM A;  2Q8M A;  3OEN A;  4RPN A;  3D4C A;  3PMX A;  5L8D A;  5K2X A;  3RLF E;  2E0S A;  1BK4 A;  2Z8D A;  3OEK A;  1FPL A;  5ET6 A;  4PAK A;  1Y3Q A;  1RDY A;  5KCJ B;  3WAE A;  4NN3 A;  4JSD A;  2PYY A;  1MDQ A;  4YMA A;  5DTB A;  3VXC A;  1RDX A;  1FBG A;  2QL3 A;  3G3I A;  3PU5 A;  4L17 A;  1PB9 A;  2VPN A;  4R6Y A;  4LP2 B;  1P1Q A;  4MNP A;  2HXR A;  2UVH A;  4KXP A;  1PDA A;  2O6A A;  4P56 A;  2O1M A;  2I3V A;  4F2Q A;  1B32 A;  1TFA A;  3C34 A;  4LQ2 A;  2H98 A;  4DI4 B;  1QVS A;  1TWY A;  4JBZ A;  2PFZ A;  4ESW A;  5I57 A;  3VFJ A;  4TLM B;  1Y9U A;  3PTY A;  2FHY A;  2IEE A;  2X7P A;  2I0C A;  2XX9 A;  1UIU A;  5I56 B;  1B0L A;  2WEF A;  3ONM A;  3T96 B;  2P0S A;  1O7T A;  4XKR A;  2WBD A;  1IMC A;  4PDH A;  2AL5 A;  3B6W A;  4ND9 A;  4FJP A;  2ANJ A;  4N6D A;  1NKX A;  3T9H B;  3RY3 A;  2RCA A;  1XVY A;  4XEQ A;  5CI5 A;  4RJZ A;  4GBV A;  4MLQ A;  2HZK A;  1USY H;  3IJX B;  5DVJ A;  5B7D A;  3SES A;  5I2K B;  4AB6 A;  3IK6 B;  4PGN A;  1WVJ A;  5ICT A; 
#chains in the Genus database with same CATH homology
 1FQA A;  3SKP A;  1PBQ A;  2BJJ X;  3H4Z A;  5CM6 A;  3K01 A;  3K1P A;  3HHG A;  3K2D A;  4KYE A;  4ZS9 A;  3R7X A;  3KN8 A;  4X1B A;  1PEB A;  3QUF A;  3T22 A;  4KCD A;  1ZMG A;  3IL1 B;  3HST A;  5FTH A;  3U8Q A;  2ZNS A;  1AH5 A;  2O7I A;  3PMW A;  4LAT A;  4IY6 A;  4FE8 A;  4Q30 B;  5EYF A;  3UGW A;  2ABH A;  4ZE9 A;  3PPQ A;  3LSF B;  2Z8E A;  2Y7K A;  3OMB A;  4ZEK A;  1N0T A;  1QW0 A;  4IO5 A;  1B7U A;  1MXU A;  1SI0 A;  1S9T A;  2CMO A;  1I6A A;  3ODB A;  3TQL A;  1QUK A;  4EQ7 A;  2Q8J A;  5ITO A;  4QRZ A;  4OEV A;  3RPW A;  1XS5 A;  3DM0 A;  3C4M A;  1AOV A;  4H8J A;  1B58 A;  4HCW A;  4IO3 A;  3FV2 A;  4ZEB A;  2DVC A;  5HPQ A;  2D3I A;  5J1D A;  5JEI A;  3KEI A;  1JET A;  2NOO A;  2ONS A;  2PVU A;  2XHD A;  1NNT A;  1XC1 A;  4QSD A;  3C31 A;  5TP9 A;  1B5I A;  3TYH A;  4E0W A;  1FTO A;  4F1Y A;  1MQI A;  3N94 A;  5IAI A;  5H8S A;  3HPI A;  3OO8 A;  4DXB A;  3SER A;  3H06 B;  4MH5 A;  3IOL A;  3Q25 A;  1S50 A;  2DP8 A;  5H8H B;  5K2Y A;  4TQU Q;  3VVD A;  4OWD A;  1S7Y A;  4MBP A;  5HBC A;  1N04 A;  2A5T B;  3KSX A;  1CE2 A;  4OES A;  1XT8 A;  4R74 A;  3FUZ A;  2DSF A;  5II0 A;  1Q35 A;  3M3L A;  3SEX A;  1NH8 A;  3RQT A;  4R6K A;  1MG1 A;  5FTI A;  1B3F A;  1BKA A;  2VOZ A;  1Y4T A;  3K6U A;  1N7W A;  2I0B A;  3MP8 A;  3MUQ A;  3Q29 A;  4Q5T A;  4ZEC A;  3I6V A;  4F1U A;  1LBC A;  4OQO A;  2G93 A;  4RXL A;  4H8I A;  2ZYK A;  2DWH A;  5I57 B;  2DYX A;  1BLF A;  2Q88 A;  5ISU A;  2RIN A;  3KG2 A;  4YKJ A;  4YZZ A;  3TTK A;  1AIV A;  1I6B A;  1M5B A;  3G3K A;  3PUW E;  3G3J A;  1XOC A;  4FEC A;  1US4 A;  4IO7 A;  4KPT A;  4NF4 B;  3MQ9 A;  5CMK A;  2V93 A;  3S4U A;  3K1N A;  2F36 A;  4GQO A;  1OLC A;  3UP9 A;  1O64 A;  1Y3N A;  3L6G A;  5CRY A;  3N26 A;  2XXU A;  1IXG A;  1VFE A;  2F7A A;  1B0H A;  2HXW A;  2XXH A;  3CR9 A;  3TZA A;  1MXZ A;  5H8F A;  2ALU A;  2Q2A A;  3G7W A;  3FVK A;  4H5G A;  1B7Z A;  1FW0 A;  1NL5 A;  1SD3 A;  4I1D A;  3CSG A;  3DLN A;  3IOW A;  2ESN A;  3ECR A;  3H6T A;  4OMB A;  2P2A A;  1MY2 A;  3T9U A;  3O97 A;  3M3F A;  1B52 A;  1NMU A;  3KGC A;  5TPA B;  1RYX A;  3MPL A;  4G77 A;  4LZ5 A;  3PMV A;  2OZZ A;  1IXH A;  2RCB A;  1DTZ A;  4JWO A;  5TU0 A;  3T93 B;  4YMB A;  4F1V A;  1O63 A;  1ZLQ A;  1URS A;  2KLF A;  4OFL A;  4PFW A;  4DZ1 A;  4FAJ A;  3K00 A;  4OTE A;  1B40 A;  1JW1 A;  4BLA A;  3PPN A;  1SW1 A;  3ZKK A;  5L9M A;  3TUS A;  3JV9 A;  3RGY A;  1MQJ A;  1OLA A;  2DWJ A;  3FVG A;  2QMX A;  3JZJ A;  3LSL A;  3TQW A;  1PB8 A;  1QKA A;  4IGT A;  4DCX A;  2FNC A;  1OVT A;  3C36 A;  2DXR A;  3MVY A;  4ZZA A;  5L9S A;  5AA2 D;  1BIY A;  3H7M A;  3K0V A;  2XXT A;  3BFU A;  1M5D A;  2QS3 A;  3RNN A;  3UA8 A;  3T66 A;  5I84 A;  4ZED A;  4DXU A;  1FCK A;  4M4G A;  3TTR A;  1LLS A;  3PGF A;  4Z7E A;  4DDD A;  1EZO A;  1MH4 A;  3R6U A;  3TTN A;  4U22 A;  2DXY A;  4JDF A;  4ESX A;  4ZGM A;  5DVF A;  1LGB C;  4BDL A;  1M5C A;  1UTH A;  4GXA A;  3RTF B;  3KOT A;  1HSE A;  2OLB A;  4YKK A;  2I6E A;  4XIG Q;  3GBA A;  2F97 A;  4F19 A;  4H65 A;  1LAG E;  3S9M C;  2REJ A;  4P0I A;  1POY 1;  1B5H A;  2P1S A;  2YPN A;  2REG A;  4OVJ A;  4POX A;  4RK2 A;  5FHN A;  4GIZ A;  1AMF A;  1TT1 A;  3A3U A;  3IO6 A;  1H3D A;  2ZNT A;  3IB1 A;  3LC8 A;  3QXM A;  2HAV A;  3PUZ E;  1B3G A;  2XXV A;  1D3K A;  3TEP A;  3V83 A;  3U92 A;  3GZG A;  3TCH A;  4NWD A;  3CVG A;  1IEJ A;  4Q0C A;  1AL3 A;  3SDF A;  2I48 A;  2RKM A;  3I5O A;  1A8F A;  4OHN A;  3H3G A;  4OEN A;  4THI A;  1QUI A;  2A5T A;  3FJG A;  2DVZ A;  3KSJ A;  3QSL A;  2I58 A;  3FVN A;  3IJO B;  3Q28 A;  4R2B A;  3TTM A;  3VLU A;  1B3H A;  4O3C A;  4C0R A;  1MM6 A;  2X7Q A;  4NF8 A;  4PE5 B;  1R9L A;  1Z7N E;  2E1S A;  5AA2 B;  1JEU A;  4N13 A;  4BDQ A;  2FYI A;  1IQ7 A;  5I59 A;  1B5J A;  4M1V A;  4H5F A;  3L6H A;  3PPO A;  4U23 A;  3O2A A;  3DP8 A;  4LUB A;  3PV0 E;  5DYH A;  3ILU B;  3L2J A;  2THI A;  2XXP A;  1RYO A;  4I8C A;  1MH3 A;  1P99 A;  2O7U A;  2ZNU A;  4P0G A;  5I58 B;  3DP4 A;  1DSN A;  3MZB A;  4OFO A;  3TDJ A;  3K6W A;  1F9B A;  4OET A;  1N76 A;  3FJ7 A;  4JWY A;  2XX8 A;  3WAF A;  4ELP A;  2DWI A;  4GOT A;  1HSL A;  1B4Z A;  1ATG A;  4GD5 A;  2I49 A;  4QSC A;  3CFZ A;  3KN3 A;  4H6D A;  1ELJ A;  3E3K A;  3FD3 A;  1LB9 A;  4BDN A;  5ICQ A;  3JYR A;  1GGG A;  3FZV A;  4AQ4 A;  2OK2 A;  1Y20 A;  5JK4 A;  4JB7 A;  1D4N A;  1I6Q A;  4ECF A;  1URD A;  5TP9 B;  1PBP A;  3G3F A;  4G4P A;  1EZ9 A;  2AL4 A;  2F8D A;  1FQD A;  3DEL B;  2XXY A;  3EF7 A;  1FTL A;  4R73 A;  2PT1 A;  2Q89 A;  4U4X A;  1MPC A;  4AB5 A;  3HCQ A;  4MLV A;  5AA3 A;  3FV1 A;  3IAZ A;  4KHZ E;  3KOS A;  4NTL A;  2V84 A;  2XD3 A;  2Z23 A;  2F78 A;  3H6U A;  4H67 A;  4JWX A;  4QFL A;  5EHM A;  3V8X B;  1B3L A;  4DLD A;  5CC2 A;  3IO4 A;  1FTJ A;  2UYF A;  4YIC A;  3RT8 A;  3T9V A;  4F29 A;  1WOD A;  2I4B A;  4GRK A;  4G68 C;  4QFK A;  4F31 B;  3R26 A;  3KJT A;  2Q2C A;  2X26 A;  3S9N C;  1R6Z A;  2CZL A;  2XXX A;  1MY4 A;  3LSX A;  3MP1 A;  4NMY A;  4HJ0 A;  2OBG A;  1QKB A;  1OMP A;  2B3F A;  3BBR A;  3O29 A;  4NF5 A;  3LBS A;  2QJE A;  1B9J A;  2QPQ A;  3ILT B;  2DOJ A;  2ONK E;  3CRB A;  3Q26 A;  4I9D A;  1BTJ A;  4K3F A;  4WED A;  1MXV A;  3K02 A;  4G8H A;  4NED A;  1FQB A;  1NFT A;  3VV5 A;  2R6G E;  4OFJ A;  5DVI A;  1XHY A;  3TOD A;  2PT2 A;  4ZE8 A;  5F1Q A;  5B70 A;  3FXR A;  5CMC A;  5H8Q A;  4EQB A;  3U94 A;  1ZBM A;  5CBS A;  4GL0 A;  3VE1 B;  1P1W A;  3SEU A;  2QRY A;  3EHS A;  5A5X B;  1P1U A;  1LCF A;  2QMW A;  3IOR A;  2H99 A;  2R9J A;  3KFM A;  5H8H A;  4ZDM A;  5H8N A;  1LCT A;  1Z7M E;  4KYD A;  1GVC A;  1B7H A;  2AIX A;  4F3P A;  3S9L C;  2H9B A;  4NWC A;  2XXQ A;  1R1N A;  2I4C A;  4QFP A;  1LBB A;  4EQ9 A;  5BWJ A;  4JSO A;  5AA4 A;  5KDT B;  4ERS A;  3GBB A;  1B1X A;  1IUD A;  1SYH A;  1RKM A;  3E9X A;  3GLB A;  2RF1 A;  3O9P A;  3EHU A;  1TXF A;  3U93 A;  3PUV E;  4LZ8 A;  1NH7 A;  4PP0 A;  4LQ5 A;  4EXK A;  3KJ7 A;  2DWA A;  3HHF A;  4OER A;  4ZZE A;  2Y84 A;  1SW5 A;  2A5S A;  3A3C A;  4F39 A;  4LF3 C;  1DOT A;  3PD9 A;  2M8C A;  3K1M A;  1H76 A;  3CFL A;  2NWJ A;  3FVO A;  1IZ1 A;  3KBR A;  3FJM A;  3OD7 A;  3OXN A;  4RPO A;  1JW5 A;  1DMB A;  4GFR A;  4RYA A;  2F35 A;  1DTG A;  4HS7 A;  3OO6 A;  1A55 A;  3UN6 A;  4G68 A;  2V3U A;  3QAX A;  4GLI A;  4YKI A;  5H8Q B;  5M2V A;  3DP6 A;  3O66 A;  2WKY A;  1IIT A;  1B6H A;  4YU0 A;  1VFD A;  3FAT A;  5I2N A;  1MQH A;  3C5T A;  3W15 C;  1EZP A;  1MS7 A;  2RC7 A;  4FEB A;  4WKM A;  4ZEI A;  3TTL A;  3VXB A;  1I69 A;  2PMS A;  2Y7W A;  1LST A;  4XTC Q;  3GXA A;  3MC2 A;  4GWO A;  5I2K A;  5EHS A;  1MY3 A;  1LB8 A;  1SW4 A;  3H03 A;  4DE8 A;  3AXF A;  4IGR A;  4IO4 A;  1NNF A;  1MQG A;  3O6H A;  3TFL A;  3U1O A;  4F3S A;  5JTY B;  2QSX A;  4Q8R A;  4N07 A;  4XXU A;  1CB6 A;  1GTK A;  5HM4 B;  1A8E A;  1FTM A;  2Y7I A;  4OYV A;  1N3X A;  1B51 A;  1EH3 A;  4ZEF A;  1A40 A;  5H8F B;  1HSJ A;  2I3W A;  3VVF A;  4DIG A;  1P1N A;  3TCG A;  2XDG A;  4YKP A;  1ANF A;  1SW2 A;  4G8M A;  3IB2 A;  1WDN A;  4RNS A;  5I58 A;  2JND A;  2OWS A;  5ELV A;  3IOU A;  1Y4C A;  4KQP A;  2RC8 A;  3ZS6 A;  2UXA A;  3D4G A;  3ZKL A;  2QKH A;  3K6V A;  3USD A;  1OVB A;  3U72 A;  3MW0 A;  2Y7R A;  1MRP A;  4U21 A;  4KCC A;  4U1Z A;  2F6G A;  1P1O A;  2H4I A;  1ZIU A;  1VE4 A;  3BKI B;  4X9T A;  3W9W A;  1MXX A;  1B1H A;  3OSR A;  3I3V A;  3PUX E;  4R75 A;  4YAH X;  4IY5 A;  3O6I A;  2Y7P A;  4PET A;  3O28 A;  1MPB A;  4WEP A;  5CBR A;  2ZYO A;  3KZG A;  3AQF B;  2H5Y A;  4H0W A;  2VHA A;  3VLW A;  4KYS A;  1U34 A;  1IXC A;  2Z8F A;  2OJT A;  3LR1 A;  3V5A A;  4DLQ A;  3HN0 A;  3IOT A;  3MZ1 A;  2YLN A;  2QS4 A;  1JQF A;  1USY E;  4G8N A;  4ONY A;  2VD2 A;  2VD3 A;  4LON B;  4NE4 A;  4BDM A;  3IR1 A;  4EUO A;  3E13 X;  2OCU A;  1M5E A;  3B6T A;  3B7D A;  3K6X A;  3P7I A;  1R9Q A;  1YPN A;  1Y3P A;  2HCA A;  2PBW A;  5KCJ A;  2O69 A;  1VSO A;  3FAS A;  3PPP A;  3RUM A;  3VLV A;  1PC3 A;  1POT A;  3LSW A;  4PFT A;  4BDR A;  3FXU A;  4RY1 A;  3N6U A;  1D9V A;  4GF8 A;  1ZJL A;  3CI8 A;  1PB7 A;  1SDX A;  3UOR A;  1UTB B;  4HTG A;  3G3G A;  4DXC A;  4DLO A;  5AE4 A;  1JNF A;  3CG1 A;  3MPK A;  1B2H A;  4YB7 A;  1IIW A;  1YTV A;  2F6P A;  4NF4 A;  4O3B A;  3RTW B;  5FHO A;  4NF8 B;  2Q9T A;  1Q1K A;  3SEW A;  3OO7 A;  1GV8 A;  2F34 A;  1A99 A;  4UA8 A;  4IB2 A;  2V3Q A;  3H6W A;  5JTY A;  3UK4 A;  1YCJ A;  4XKP A;  1UIV A;  1H43 A;  3C32 A;  2V3T A;  2UVG A;  1GR2 A;  1UQW A;  2GFE A;  3MAM A;  3OEM A;  1N3W A;  3PD8 A;  1TFD A;  1N7X A;  4FOR A;  4R6H A;  2DS9 A;  4F3G A;  5A5X A;  5AA4 B;  2L27 A;  1JW4 A;  5I59 B;  1FTK A;  1UTB A;  1OQG A;  3E4R A;  1II5 A;  4F2O A;  3N7P A;  4C1T A;  4XKQ A;  4ELO A;  1B3E A;  4MF3 A;  2O84 X;  1DPP A;  4G2Z A;  1EU8 A;  2XD2 A;  3C59 A;  2V25 A;  4G68 B;  2DQV A;  5CMM A;  1B4H A;  2VP1 A;  3MVZ A;  1OQH A;  5IKB A;  3M8U A;  2G29 A;  4FAT A;  3QYT A;  3CG3 A;  2VGQ A;  3CFX A;  3FXQ A;  5ITP A;  1NNP A;  4LZ7 A;  4OEU A;  4BDO A;  3CIJ A;  4LVQ A;  3MP6 A;  2ZYM A;  3CSB A;  3W9V A;  4N6P A;  4GL8 A;  1LAH E;  4XKN A;  2ZYN A;  2XXI A;  3OEN A;  4RPN A;  4NF5 B;  1MY1 A;  2DE2 A;  3D4C A;  2NXO A;  3TKD A;  3IX1 A;  3OO9 A;  3PMX A;  4ELR A;  2W7Y A;  4JXI A;  3H6V A;  2GHA A;  4FIM A;  5K2X A;  5L8D A;  1Y1M A;  2E0S A;  3RLF E;  1IXI A;  2AYS A;  2PX1 A;  1NNK A;  4KD5 A;  4QHQ A;  2Z8D A;  1SI1 A;  2Z22 A;  2ZXT A;  2O51 A;  3OEK A;  4GVO A;  2GH9 A;  2NVU B;  1QUL A;  1US5 A;  2HFB A;  4ELQ A;  2XXW A;  3RN8 A;  1MDP 1;  4OZ9 A;  1H45 A;  3QIM A;  4PFY A;  3SET A;  4KFQ A;  3MBP A;  4QSE A;  3VDF A;  4EF2 A;  3HO7 A;  3C35 A;  1Y3Q A;  3PPR A;  4F22 A;  5KCJ B;  3FIR A;  3OSQ A;  3WAE A;  4JSD A;  2QS2 A;  3TMG A;  2PYY A;  4E0X A;  1B46 A;  1FQC A;  1MDQ A;  1JEV A;  4YMA A;  5DTB A;  2DE3 A;  1M5F A;  3IB0 A;  3VXC A;  1LFI A;  5BUU A;  2HAU A;  5L9O A;  2B3B A;  5KZT A;  3QUJ A;  4TLL B;  4RA1 A;  2QL3 A;  3G3I A;  1A54 A;  2LAO A;  3PU5 A;  4L17 A;  3G3H A;  5I56 A;  1PB9 A;  4PFU A;  4UAC A;  4R6Y A;  3PUY E;  4KR5 A;  4F3B A;  3O6G A;  4LP2 B;  5DEX A;  1P1Q A;  5DT6 A;  4RK9 A;  2HZL A;  2ONR A;  1T0K A;  2UVH A;  1LFH A;  1PDA A;  3K4U A;  1ZU0 A;  2O68 A;  3QK6 A;  1SYI A;  5F7V A;  3OOA A;  4IO6 A;  2RC9 A;  4QF9 A;  2O6A A;  4EF1 A;  1MPD A;  2O1M A;  2YJP A;  2I3V A;  1SVX B;  4F2Q A;  1B32 A;  2HEU A;  3THI A;  1TFA A;  2F5X A;  3C34 A;  2D21 A;  2F7C A;  2H98 A;  4LQ2 A;  4DCY A;  3LUY A;  1QVS A;  1TWY A;  4JBZ A;  3VVE A;  4F18 A;  2OWT A;  4P11 A;  1BP5 A;  3MVW A;  4ESW A;  5I57 A;  3VFJ A;  3ZSF A;  1LAF E;  2NUV A;  2R71 A;  3UIF A;  4TLM B;  3SEV A;  1ZKB A;  4FED A;  4WXJ A;  4U4S A;  1H44 A;  2DE4 A;  4X1D A;  2XX7 A;  1Y1Z A;  3N5L A;  1Y9U A;  2JOD A;  1MXW A;  2UYE A;  1DPE A;  5KDT A;  4U1O A;  1MM7 A;  1XVX A;  3OEL A;  1OIB A;  2H25 A;  3C33 A;  1YAE A;  4X48 A;  3MVX A;  2GRV A;  4LA9 A;  2IEE A;  4R9G A;  1L5T A;  4C1U A;  4EXL A;  2X7P A;  5H8N B;  2I0C A;  1N84 A;  3EN3 A;  2IA4 A;  2XX9 A;  3TPA A;  3V89 B;  4OXV A;  1UIU A;  5I2N B;  5I56 B;  3FGS A;  2QS1 A;  1B0L A;  4IO2 A;  4YB5 A;  5CMB A;  3C9H A;  2XXR A;  3ONM A;  4HCY A;  5AA1 A;  4QFN A;  3T96 B;  3TAJ A;  1QUJ A;  1VR5 A;  3EPE A;  2P0S A;  4EDP A;  4MFI A;  1JVX A;  1LFG A;  1O7T A;  1KWH A;  1UTH B;  2O1L A;  3T9X B;  4XKR A;  3N7S A;  3S9E A;  4I62 A;  4R9F A;  3F11 A;  3S2V A;  4YB6 A;  4KI0 E;  2F7B A;  5LOM A;  5AA2 A;  2UVJ A;  2D5W A;  3BFT A;  2AL5 A;  1J1N A;  3B6W A;  3SEY A;  3EQ1 A;  5TPA A;  3TCF A;  3A09 A;  3KN7 A;  4ND9 A;  4FJP A;  2ANJ A;  1JVY A;  3HV1 A;  3Q27 A;  4Z0I A;  3MWB A;  3TEL A;  1NKX A;  3EHT A;  1B05 A;  3RT6 B;  3T9H B;  3RY3 A;  2RCA A;  3MZ9 A;  1A7L A;  3N6T A;  5FHM A;  1LAX A;  4PQJ A;  3IOV A;  1MXY A;  4HW8 A;  2HQ0 A;  1ZTY A;  2JNC A;  1XVY A;  4GXS B;  4U2R A;  1SBP A;  1MY0 A;  4NF6 A;  2FA7 A;  2B65 A;  4ISU A;  1MQD A;  4QFO A;  4NF6 B;  4POW A;  1FQF A;  1FQE A;  4RJZ A;  5CI5 A;  5DEX B;  3N7R A;  2ZMB A;  3MJN A;  4MLQ A;  1URG A;  3B6Q A;  1QJM A;  1SQY A;  1USY H;  2HZK A;  4R72 A;  3IJX B;  4TOZ A;  2UVI A;  4O3A A;  5DVJ A;  3SES A;  5B7D A;  3M3K A;  4H1X A;  5I2K B;  4AB6 A;  3IK6 B;  1D9Y A;  1WVJ A;  2GHB A;  4R2F A;  5ICT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...