3C4UA

Structure of class ii fructose-biphosphate aldolase from helicobacter pylori
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
292
Chain Sequence
MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
total genus 109
structure length 292
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c4uA00
3LHYA 3HQ1A 4LV4A 3N2MA 4IUOA 3LCWA 1YLVA 3JRKA 4TMCA 2TMDA 4IJBA 4A2RA 6TIMA 3NL6A 2E77A 4ZMGA 1DORA 4YCPA 4LS1A 5D32A 1EIXA 4DBEA 3P60A 2DZTA 2JK2A 1TQJA 4RCXA 3BW2A 3ANYA 3N9RA 5LKYA 4NXSA 3M7WA 4FNQA 4I7WA 4EF9A 1QWGA 2J88A 3GK0A 1U83A 1MEIA 3HGRA 3MW7A 5K3VA 2QCNA 4J9JA 3EX6A 5DCBA 3VFLA 4CNOA 1SW7A 3O06A 3EEGA 3LGEA 2VC6A 1Y0EA 3NR0A 3CB8A 4M5PA 4HN4A 3KVMA 4LS2A 3TIMA 4WD0A 1SW3A 2O7QA 4JTEA 3LLDA 1K7EA 4WJEA 1A53A 3TK7A 3C2FA 3NVTA 3PC0A 3LCHA 4LV9A 1AMKA 3PM6A 4ORMA 3W2UA 3G8RA 4RXGA 1SU5A 3WK3A 2ZRVA 2H8ZA 2QCCA 1HUVA 3C2EA 2O7SA 2E6YA 2BZNA 2D73A 1W5NA 3GDRA 3ATYA 4LVGA 1OX4B 4N6FA 3B04A 3R2GA 3M47A 4TMBA 1KFLA 1RQHA 2QCEA 1PIIA 2R8WA 3TC6A 1L6SA 2NV2A 1EUNA 4ZQPA 4K6AA 2QCLA 3ZR4A 5F4SA 3I7SA 3W7KA 4A21A 4N4QA 1ADOA 3PG9A 2YYTA 4Y96A 5AOUA 4JNMA 1SPQA 2OCZA 4OGZA 4CCDA 3NQVA 1VPXA 3G24A 4LUIA 2OJPA 4O52A 3W86A 3NYZA 2Q3RA 3LLFA 4GUHA 3NPWA 3KRZA 2DORA 1G69A 3H54A 1HL2A 3RU6A 1A5CA 2RDTA 3O6YX 2NXHA 1W3TA 4O4VA 4K7YA 3DFSA 1SZGA 2BSLA 2B4GA 4WY0B 3HO8A 1NFBA 3A22A 2WO5A 1UUMA 1K8ZA 1QR7A 1K03A 5KZDA 1H7WA 1AG1O 3MP5A 2GJLA 4UTKA 1KA9F 3E49A 1D3HA 1LBLA 4DEFA 1C29A 4O1BA 1WBJA 3W1AA 1WAUA 6ALDA 2QUUA 1U5JA 3HGSA 1TJPA 1FWSA 3S5NA 1BTMA 4GNJA 4Q33A 5D04C 5HR7A 1VGAA 2NWRA 3LXAA 1TPH1 4RXFA 3O1NA 2Q8ZA 4XZ9A 5D2YA 3P8JA 1GOXA 3S42A 1EP3A 4RZ6A 4ZQOA 3M0ZA 3NL5A 3BW4A 3FS2A 3U6WA 3MJYA 3LHUA 1P1XA 2H90A 1TTQA 1JQXA 3QSTA 3W1TA 2BLEA 3N34A 5LZLA 2NX9A 3GXPA 3LTSA 3R5EA 3DZ1A 5HR6A 1NF0A 4E2BA 3EX4A 1WA3A 3I7QA 2FPTA 1RQBA 2V0TA 3CU2A 3M5XA 3W7LA 5D30A 1XDLA 1I2OA 1OFRA 3NQ2A 3TXZA 1ZNNA 5SWUA 1ICSA 1VR6A 2DP3A 3UY8A 4JGDA 3EX2A 2J6XA 2PRHA 3ZFHA 3NPVA 4OV4A 5DCEA 3ZWSA 2B7NA 1FCVA 3L0NA 3P81A 4M6QA 3OIXA 4UFKA 1ME7A 3M5YA 5AHMA 2XN1A 3CM4A 4O16A 4O12A 2A5HA 2Y7DA 1ICPA 2HS6A 3W3OA 4JD4A 2BXVA 3QYQA 4GWEA 4H3DA 1JQVA 3HGOA 3GNNA 4DF1A 1ZJIA 3IIPA 2ALDA 1KBIA 5CSRA 1X7FA 4LVDA 2VFHA 1Q6LA 3LHZA 3E02A 5E0KA 1DVJA 4O57A 1W8SA 4WUIA 3OVQA 2YGYA 5D09A 5G2HA 2C3ZA 5LGXA 1JRCA 3W2MA 1W5OA 4AWUA 1SZNA 5HQEA 4MZ8A 4M7TA 3T7VA 2WV8A 1THFD 3LHTA 1ZCOA 3OVPA 2R91A 5K9DA 1FX6A 1LBMA 4IPJA 3STFA 1TTJA 1H63A 3NQFA 2WSRA 5KSWA 1K8XA 3A9IA 1F7BA 1W3IA 3SY5A 4RR4A 3I7RA 5KZEA 4UTTC 3Q94A 4MFEA 3CHVA 3A5VA 4AHQA 3NM3A 3B06A 5BMXA 1T96A 4Y8FA 3PBYA 1OYCA 5K4XA 2G97A 1H7XA 3B0VC 3M5VA 3QMTA 5CZSA 3B0UX 3L0KA 3KVJA 3LV5A 4PODA 3TQKA 2NXIA 4WX2A 3GLCA 1BKSA 4FXRA 1BEUA 4JIPA 2HTMA 5LNWA 1L6WA 3CLMA 4OT7A 3LI1A 3M41A 3QM3A 2EHHA 5G4EA 1LRNA 3GR8A 2A7NA 1S5WA 3CQ0A 3NGJA 4NZJA 4HT3A 3LI0A 3DFOA 4O13A 1R47A 3NG3A 1ICQA 3UPBA 1MZHA 3M9YA 3B4UA 5D2VA 1KM1A 1MO0A 3BLFA 4EIVA 2CZFA 4HNNA 1GVFA 1YXYA 5BMWA 3S6DA 3MP4A 3INPA 2B7QA 3UPWA 1VLIA 1XBZA 4E38A 5AHFA 2JBMA 3LCGA 5CKSA 3CEUA 2ZA2A 5D2WA 2J9YA 4JX4A 3IV3A 5D37A 3BG9A 4QM1A 3HJZA 3S5YA 3U2OA 1PHQA 1HTIA 3GXNA 2CZ5A 2FFCA 1AL8A 3NM1A 5HWJA 1OFOA 2EKCA 4OWGA 2Y7FA 4UTWC 2E68A 4KFPA 1VJIA 5FEXA 4PL2A 2FB2A 3EB2A 4YLWA 5HJLA 4JTJA 1EA0A 4IWWA 4DPQA 4GC4A 2C14A 3C2RA 4UFJA 1X8FA 3DKLA 3UNDA 1GPWA 4Z08A 3TJLA 4ADSA 3L67A 3G1VA 2QCMA 2QCDB 3VKJA 1HO4A 4I9AA 3FJ6A 1R2SA 5D2TA 4JTLA 1WV2A 1S5TA 3W1QA 1F73A 1FUYA 2CLFA 1JUEA 3NOEA 2B7PA 1JVNA 3O16A 5DLCA 4PH6A 2H3BA 4UNLA 1H1ZA 3NQEA 1UUOA 4HIBA 3HMJG 1QPOA 4Z1CA 3A5FA 3MO7A 3C56A 5C55A 4WOZA 3JS3A 4BK9A 4Q32A 3Q2DA 1PCKA 1QO5A 4PL1A 1GVSA 3W2NA 4TIMA 4JTGA 5F2GA 5BOOA 1I2RA 1TV7A 1OFEA 3FYPA 4K39A 3LRLA 3WJXA 4AAJA 1SW0A 1NVMA 1W1ZA 3HIJA 3QW4B 5CZ0A 4FEZA 1MEWA 1OFDA 5AC6A 1T8XA 2ZZ5A 3S5OA 1F74A 2J9ZA 3O07A 4O17A 1FCBA 3IRDA 1G4PA 4PA8A 1ONRA 5GVJA 3W74A 3TAKA 1B9BA 1FWTA 2GOUA 4JTFA 3HB9A 1W0MA 5BW6A 1KFEA 3W71A 3LERA 2YW4A 3NPXA 5TBOA 3N19B 4M6VA 2ABAA 1VCVA 3DI0A 3TH6A 1KM3A 1LLWA 5I3JA 4LT9A 1O94A 1B4EA 4BI6A 2VEMA 5KTLA 2HSAA 3TW7A 1OK4A 2Z2UA 5BRBA 1GG1A 2NUYA 1LOQA 3CWNA 3HG4A 4FX6M 5AC7A 3K30A 2FPVA 3CT7A 1TJRA 4DF0A 5AB3A 4NJIA 1KTNA 1O4UA 5AHIA 2CLMA 3YPIA 3FKKA 4YL2A 1EUAA 1TRIA 4JYDA 3IEBA 5IBXA 3G3MA 4K7VA 1O95A 1EEPA 1L2UA 5D02A 1SO5A 1VYPX 1PL9A 1XM3A 2QJIA 4QJ1A 1KM2A 4FF7A 3GXTA 5C54A 5K4ZA 3SJ3A 2WNQA 1L9WA 3MI3A 3LHWA 4WY0A 2FQIA 4FNUA 1FDYA 2E1DA 3MBFA 2DJXA 4HHPA 4A3UA 3C4UA 3WJZA 4IGHA 4O1DA 3P5ZA 3NNTA 2GQ8A 4KWVA 4O54A 4O50A 4N4PA 1YADA 4UCGA 1DV7A 2WSYA 4TO8A 2XN2A 3N73A 3UD6A 4DXVA 2H8XA 1LORA 2PE4A 3W7GA 4DPPA 3F03K 3DXIA 4I7UA 2ZZ6A 3W7IA 5CG7A 4WY0F 5EPDA 3W7RA 3VNDA 3W1RA 1QFEA 5EBUA 4YCOA 1QOPA 4XKYB 3GB6A 3O8AA 2VENA 2E5DA 3QRHA 2VELA 1RQEA 1TTIA 3GNDA 2NZLA 1K7FA 2TSYA 1HFBA 4LTSA 1OFAA 4CNNA 4ZL1A 1EX5A 2QCDA 3HPXA 3T44A 4RK8A 4UR7A 3F1QA 5TIMA 4WZHA 3AO0A 2NX3A 3ZS4A 3TE9A 4IX0A 3E12A 1KM6A 5FF4A 3W73A 2NXGA 3GVGA 2GQAA 1C8VA 4ZQNA 5DCDA 3W23A 3HG3A 3DFQA 4UTLA 3EWYA 4S2BA 4NQ1A 4GXMA 1VQTA 2LLEA 3FOKA 4OE7A 1JCLA 2DZWA 4FB7A 3NQDA 4CQAA 1QPQA 1ZAIA 1Q6OA 1L6YA 3WK0A 3C2VA 3V75A 4R53A 4LY8A 1K3UA 4GUJA 4LC6A 1SZEA 4S1FA 3B8DA 4NT0A 5I3FA 2G96A 3IGUA 5EKYA 1F2JA 4BI5A 4JYFA 5HINA 5A8GA 4JEQA 3KRSA 2Y88A 1WYIA 5C5YA 2VFGA 1WX0A 4N9EA 1TIMA 1M5WA 3UXAA 2ZRWA 4MPQA 1HO1A 3IIVA 4WXZA 3TQVA 3S1XA 4MVAA 2VFFA 1OX6A 5H2ZA 4GFSA 3W7CA 5AHLA 3V1PA 5HUPA 2Z1BA 2V30A 1UASA 3UWWA 5DXXA 4UFLA 3SGUA 2PCQA 4ZQCA 1QAPA 3FFSA 4JTTA 1ZAHA 3KVKA 3MYOA 2A6NA 3UZJA 3GDTA 1EB3A 4NX0A 1RR2A 2Y70A 1H62A 1KV5A 3F4NA 2RKXA 3VCRA 2WOQA 8TIMA 2E6FA 3CEPA 3TSDA 3T4CA 4HKPA 2A2IA 1IIGA 4YXGA 1GVOA 4AXKA 1GYLA 3RFAA 1TPWA 3BG5A 1T99A 3L0GA 3TKFA 4CNPA 1IXNA 2CU0A 2Z6JA 3TXVA 5T26A 1FXPA 1EWDA 4BR1A 4FNTA 1G4TA 2CLKA 2WKJA 2VEIA 3IIXA 3EWXA 3S5ZA 2QJGA 3STGA 4CQ8A 4JS3A 4POCA 3S1UA 1YDVA 5AYYA 5DELA 1DKWA 3IVTA 1GT8A 4UC5A 5AYZA 4ALDA 3G1SA 3G0UA 2A85A 3QFEA 3C61A 4S2CA 1C9DA 4QSHA 3ABSA 4O10A 1W3NA 2P10A 3B0PA 1KTCA 4NJHA 3NQGA 5J5RA 5HWMA 1TSIA 3TJXA 4NXKA 3IIZA 3W72A 3LTPA 2QAPA 3SIZA 3UWVA 4RZ5A 1VHCA 2C6QA 2Y89A 3NA8A 3H55A 5KZMA 4WOQA 4RX0A 4LVAA 3G1DA 1JUBA 3O6CA 2QCFA 3EXTA 3BV4A 3HBLA 4LOCA 1I4NA 2ZA3A 4E0CA 4HNUA 3I68A 4E2DA 4DQWA 3QC3A 5DY3A 5L9FA 2OT1A 2YR1A 1VCFA 5FEWA 1LOSA 1H7OA 5DY2A 3LX9A 3M44A 1N55A 4BWLA 4JDBA 5J5DA 4BWLC 1TPDA 4EOUA 1JJKA 4KKXA 1TO3A 4Z0JA 3KAOA 2A7PA 3PBUA 2YSWA 3LM7A 1EWEA 5BNKA 3P7YA 1KFJA 3TA6A 3FJLA 1SR9A 4MLRA 5D03A 1SSDA 1IGSA 3ABOA 4GBUA 5LSMA 1FQ0A 1A5SA 3O6DA 1A50A 4NNCA 2V8ZA 2Y61A 3G1FA 2Z0IA 2EF9A 2X30A 2HS8A 1XXXA 3NO5A 4AB4A 2QDHA 1FBAA 3FEMA 3W7QA 1GJPA 1H7PA 3NAVA 2WJZA 2RDWA 1QO2A 3DHDA 1CX9A 5F4WA 2X2GA 3WJSA 3W88A 3TFCA 3TSBA 1YPFA 1F5ZA 1XBYA 5LHFA 3D0CA 1G4EA 1W5QA 2ZBTA 4XTIA 4Z0SA 3HG5A 1YPIA 3QZEA 4N9BA 2A7RA 2IQTA 5LNVA 2UV8G 1TMHA 4X9SA 3NZ1A 1Z44A 1CW2A 3LCIA 2QJHA 5G5IA 1KLZA 1R2RA 1W5MA 4ZZ9A 4C1LA 4NNAA 3OA3A 4O1AA 3BK0A 4O4WA 2VKZG 3UZ5A 4K8HA 3VE7A 2PURA 3TX9A 5C6MA 2V82A 4U4MA 4HSNA 1XUZA 1GVQA 1H7RA 4JTHA 2RH9A 3LXCA 5EA9A 5EL1A 3RK8A 1OK6A 4LWWA 4HPXA 1A5BA 3CIXA 4I7VA 4N02A 1Q6QA 4ZQMA 4R34A 1M7PA 3PB0A 2DZPA 2ZYFA 3RLVA 3S1VA 2B0MA 1A5AA 2A21A 1JCMP 4XWUA 3W7JA 1VC4A 3BPWA 3TCEA 2QKFA 5CZTA 1WDWA 4N9DA 1VCGA 2WNNA 2ABBA 3A23A 2NUWA 1DBTA 1TPC1 1GTEA 3DAQA 1S5VA 3TW6A 3QQ0A 3SSJA 4WXYA 2ZCGA 1SUXA 3A21A 3W1LA 3W75A 3G18A 4L4LA 2CZDA 4N6EA 5G2WA 2AAMA 5E1QA 3LCFA 1MEHA 1AW1A 3NQ7A 2ISWA 3P84A 4Z1BA 4AF0A 2QCGA 3QJAA 3NQAA 4EVZA 1TPFA 4O8RA 1SFLA 4AWTA 4U28A 3H53A 4Z1DA 1LRQA 1AW5A 3S1WA 1UCWA 4P2VA 3NQMA 5AFDA 3B03A 4IMCA 4D2JA 3TC7A 2FIQA 5LGZA 1YXDA 4QQ3A 2NWSA 4MY9A 4YWIA 3LBMA 1TPVA 1SQ7A 4FIQA 1W37A 1ME8A 5I3IA 4MYXA 2R94A 1GEQA 1LOLA 2C16A 4OHQA 5FEZA 2ATSA 1W5PA 4Q4KA 2A4AA 3P5YA 4OU1A 2CLLA 1OJXA 3SGZA 2F7FA 2W79A 2FLIA 3ATZA 4NJJA 1XKYA 2H6RA 3I65A 3RLUA 3SECA 3EX1A 4CCEA 3W84A 1P4CA 4UIOA 2I14A 4XTDA 2XFWA 1GVRA 3R13A 4IMFA 3E96A 2QCHA 1RZMA 4UTMA 2EAWA 1H60A 1B57A 3L5LA 2YX0A 1XUUA 4QIUA 3WJWA 1VYRA 4JY9A 4KWWA 1RD5A 4FXSA 1RVGA 2C1HA 3MWAA 3L5MA 2TRSA 2ZFAA 4AH7A 4OV9A 2VFIA 3PSWA 5FF7A 2JGQA 1GG0A 4HSOA 3R89A 3FLUA 2WQPA 1VZWA 4MKNA 4ADTA 4UTUA 5K7JA 4JTIA 1J4EA 2CLHA 2YDAA 3GKFA 3DFNA 5CGQA 2FJKA 3S9YA 5D33A 4GUFA 3IGSA 3MBDA 3QPZA 4R7JA 1LDCA 1EP2A 3G1AA 4XKYA 3O05A 4O0ZA 1B3OA 1TQXA 3BARA 3G0XA 3M43A 1F76A 4LVBA 5DXYA 3VE9A 2C19A 4NZFA 5FESA 2VXNA 2G95A 3W83A 3DFTA 5G2IA 1D9EA 4AHPA 5HNRA 2JKEA 1SO3A 2FB3A 3PULA 1H7NA 4MZ1A 5G1TA 3LXBA 5K9CA 4JDYA 3THAA 1G4SA 3NDOA 2YXGA 3C0JA 3TR2A 3CTLA 1QOQA 3LV6A 4O0KA 1H5YA 2RDUA 3KVLA 2AQWA 3DGRA 2CWNA 1SO6A 5U4NA 1TYGA 3PVFA 4ORIA 3PUDA 3HOJA 1FCUA 3HPZA 4HNVA 5FF2A 2ZZ2A 5EYWA 3MUXA 2OX1A 4GRSA 2JKAA 5DN1A 1XBVA 3G1XA 1YTDA 3LCLA 2JKPA 1SO4A 5AHEA 3HG2A 4QITA 1F05A 4GJ1A 4TX9A 4FNSA 3TUUA 2X1TA 3EWUA 3RNDA 5DBUA 1OFPA 3U8GA 3LB0A 4MY8A 3HGJA 2ZTJA 5F4XA 1QPNA 1CI1A 2DZXA 2QR6A 3GIYA 4KFOA 2ZDRA 2J27A 5K9XA 4IOTA 2CLEA 5AC8A 1QMLA 1KLYA 3W7NA 3E0IA 3SI9A 3DFPA 5HULA 4B5NA 4PEKA 3WJYA 4ML9A 5LNUA 3BGJA 1I2NA 1SSGA 3Q37A 3G1HA 1ALDA 1XDMA 3EKZA 1OYAA 4XUGA 3W9ZA 1KFBA 2A0NA 4UFHA 4UUIA 2A1YA 1Q45A 4DF2A 3W6YA 4AEOA 3QPYA 1P5BA 1TTPA 3GZ3A 2P0OA 3TV8A 4O53A 3PY2A 3C3NA 1LCOA 4AHOA 4AWSA 2C15A 3USBA 2QEZA 3IVUA 4PTNA 1TV5A 2TPSA 2J9XA 1B4KA 3N2XA 2VOMA 4JX5A 3M16A 1ZFJA 1UJPA 4M6PA 2Y7GA 5F2IA 2OMAA 3EKLA 1KTBA 1JUKA 3PUEA 2ZZ3A 2BX7A 4LU0A 3O15A 2KZHA 3LDVA 3W07A 3CIWA 3GAYA 5HWNA 3MYPA 5L6UA 1H61A 1LZOA 3UQNA 3G22A 4O14A 1QDSA 1N7KA 3R12A 5IBXC 2X1SA 2H3DA 3PS7A 2B7OA 1P0NA 2C13A 2Q3OA 5D2XA 3OHIA 4K38A 5IM51 1OVDA 4G1KA 1I2QA 3PR2A 2E6DA 3BVJA 1K02A 1T0OA 1PVNA 5G4WA 1YXCA 4IMDA 2YZRA 1DL3A 2ZA1A 2W0UA 1OFQA 3G8EA 4UTIA 5FI8A 5F2MA 3N3MA 3LRKA 3NL2A 1TCDA 4O15A 4K36A 3UY7A 1OABA 3W70A 3TAOA 4KFNA 3GKAA 2G5WA 4NNBA 1K7XA 4ZVJA 2V2CA 4UMBA 2V5BA 1LP6A 1QNVA 1H51A 3STEA 1ML1A 1LRTA 1OHLA 3GX9A 3UXDA 1KW1A 1FCQA 3IVSA 3C2OA 2X1UA 1EPXA 1DOSA 3MHFA 3LCXA 2YFOA 4TR9A 1YDNA 1WBHA 1XC4A 2ZRYA 1FDJA 4EWND 3P82A 3DHFA 1ME9A 1PCWA 1JCYA 1D3GA 4LUJA 2RFGA 3NQCA 4LC8A 4NU7A 3P80A 1OX4A 4N9CA 3O63A 4JICA 2GQ9A 4A2SA 4NJKA 5AN7A 3TMLA 1OX5A 1OF8A 1AW2A 3MP3A 4ICNA 4QNWA 4AVFA 1F6KA 1H50A 4JTSA 5LHEA 4IPIA 1ZENA 2Y63A 2I9EA 3M5ZA 3MMTA 3M6YA 3F4WA 3NQ6A 1LYXA 2EGZA 1R30A 1GZGA 3NPUA 2J24A 4UTTA 5AYXA 3MHGA 3KXQA 4A29A 4R33A 1AK5A 4Y6GA 3KOFA 3DENA 1WXJA 2R14A 3DU0A 4OQVA 1KFCA 1S3HA 3P62A 3W7OA 4UNKA 4JY8A 4L4MA 1KFKA 2E5BA 1TB3A 1UB3A 5KITA 4QNEA 3FKRA 2ISVA 3TU9A 4FO4A 3RF9A 4CLMA 4O1CA 1LBFA 3LOTA 3NZRA 4JX6A 3SW6A 4DO6A 4P61A 2FTPA 1EP1A 4FNPA 1I2PA 4O11A 2DZSA 4FHAA 2XN0A 1ZY9A 1NF7A 3QQ1A 1IXQA 4AMAA 1ZAJA 3CC1A 3KX6A 3L5AA 4RZ4A 1VYSX 2NX1A 4M19A 4PCFA 4IMGA 5ABTA 4HNTA 2VEKA 1M7OA 4IMEA 1XFBA 2GPTA 4UTJA 1TPB1 3TROA 4M7SA 5CPLA 4UXDA 5CPOA 2PC4A 4C1KA 1W31A 3T55A 3BGGA 3BLEA 3L2IA 4K8EA 4MUZA 2V2HA 4MIMA 3EXRA 1DHPA 3HPSA 4RJEA 2A6LA 4DBDA 1P0KA 3W2KA 5EMUA 4ZQRA 1VHNA 2ZRUA 4DELA 2X1RA 3HF3A 1J2WA 5HUOA 2V9DA 1FWWA 1XL9A 4X3ZA 1PV8A 2ZRZA 4QISA 4JIQA 1TRDA 3CPRA 3NQ8A 2P1FA 2V2DA 1Z42A 3IIOA 1GQNA 5H91A 1FWNA 1YYAA 4X22A 4GE8A 3LTYA 1JULA 1R2TA 1G6CA 3PBWA 3TDFA 3LBCA 2FPYA 1V5XA 3NXFA 2C18A 5HMSA 3W7HA 2ZZ1A 3TMQA 3W1PA 5FF0A 1UBSA 1RV8A 1KBJA 1FY6A 4MZYA 3LRMA 2QAFA 2E6AA 2GVJA 4NUWA 3EWZA 3QSRA 1VS1A 3S8HA 1QPRA 3STCA 5KMYA 4UFIA 1I45A 2DU2A 2X16A 4UR8A 3W7EA 2WNZA 2ZZ7A 3SFKA 2TYSA 1PS9A 3A24A 1OFBA 1F6PA 3ELFA 4AF0B 1Z48A 3GDKA 3L65A 3THQA 3FIGA 1NSJA 3W1UA 5MHBA 4QAIA 3PAJA 2PRLA 1BWKA 4OBTA 1WOBA 2EPHA 2C0AA 1KM5A 3QH2A 3P61A 4UTWA 3L21A 1YTEA 3QF0A 2AGKA 3LHVA 3W7MA 3BO9A 2PRMA 2NUXA 3IGXA 5AHNA 1DJQA 1VH7A 4HPJA 2NLIA 2QF7A 4MOZA 1W54A 1IF2A 1K8YA 4BF9A 4PFMA 4LS0A 3RMJA 2V81A 4H6KA 3TFXA 1E51A 5TQLA 1ZALA 1IIHA 1G7VA 4CCCA 3KHJA 3G0SA 1O5XA 3PF3A 1OF6A 1J5TA 2OT0A 2HMCA 4UFMA 1QCWA 3P8IA 2CFFA 1BWLA 1FWRA 4XBKA 1FDZA 3BG3A 2ISSA 1WQ5A 4W9TA 1AL7A 1NEYA 4MY1A 5E93A 1VRDA 4UTHA 4NVTA 1OYBA 4DO5A 3TNOA 1IXPA 3MI2A 2YW3A 3W1NA 1LM1A 3R8RA 2Y6ZA 3T78A 3W2LA 3GDMA 2W6RA 2WSQA 5CPMA 5DBTA 5KINA 3W2JA 5U7SA 3NEVA 2OZ0A 3S0CA 1YTKA 3P67A 1O5KA 1MXSA 3OG3A 1Q6RA 4EF8A 2DZUA 4JYEA 3P74A 2GVLA 4TU1A 3WK1A 1DQWA 3I6RA 4MFDA 2DZVA 3W76A 1PHWA 4LNYA 1DJNA 4H4IA 3KFTA 4MJZA 3WK2A 3EX3A 3G1YA 3N9SA 3L66A 3GDLA 3W1MA 5I3KA 3T40A 2WPBA 3ABQA 3OBKA 2GUUA 2DJLA 4NJGA 3W87A 3AJXA 2CLIA 1NAL1 1GWJA 1KM4A 1LTDA 4IX2A 4RKAA 1TV8A 4ADUA 3ABRA 3CWOX 1V7YA 2ZZ4A 4DO4A 1I8JA 2F84A 2NV1A 2I1OA 1N8FA 5F1UA 3SZ8A 1DQXA 3W22A 5CPNA 3N14A 5LNRA 1TREA 3UWQA 4Z1AA 2ATMA 2YPIA 1Z41A 2V5LA 2E09A 5I3GA 3W85A 3C6CA 2Q8LA 4JN6A 2GVGA 3SR7A 1JCXA 4IQLA 3BW3A 3PSVA 4MJMA 4ONVA 1X6UA 1YDOA 4GUIA 2BTMA 3DKJA 5G1YA 2QUTA 2QDGA 1XCFA 5EY5A 3WFAA 1O60A 2ZRXA 1X1OA 4LRTA 1GTHA 2YCEA 3PG8A 4IXXA 4A22A 2CW6A 3E9AA 3M1ZA 3ZWTA 2ZTKA 3KRUA 4X2RA 3OVRA 3DI1A 3W7PA 1XBXA 1XI3A 3L9CA 3UYCA 4O28A 3UWYA 3QMRA 4N2YA 1IXOA 2ZQ0A 1G67A 4LW7A 2BWGA 3C8FA 3VI2A 5CSSA 3JR2A 2Z6IA 4LRSA 2QUVA 2VEPA 5LNSA 4RLIA 2VFDA 3MHUA 1LLZA 3UWUA 1VLWA 3GYEA 4BI7A 4JXCA 1H1YA 2FDSA 2JGYA 3FA5A 3Q58A 1Q3NA 2YYUA 1TPUA 4CQ9A 1WOAA 4PC8A 4LVFA 3MI6A 3PB2A 5A5WA 1JRBA 4WQ6A 3GAKA 3NL3A 3PUOA 1KV8A 1GYNA 4O19A 2Y62A 4BFAA 4UMCA 4RV8A 1OG0A 2GJNA 4IXHA 4K37A 3UWZA 3OEXA 4MYAA 1G7UA 3C52A 1MSSA 1TPEA 4Y9AA 4Y90A 2Y85A 3DH7A 3FYOA 3GR7A 3EWBX 4O18A 2CLOA 5D38A 1M6JA 4GUGA 4MLJA 1JCNA 2YFNA 1SZFA 1SFJA 1R46A 4YMZA 3W7DA 5FF3A 1JR1A 3QW3A 2RHGA 2E5CA 3L68A 5F2LA 3DBPA 3QEZA 4FX8A 4XQ6A 5CZJA 5FEPA 7TIMA 2Y7EA 1X1ZA 5K2ZA 3EXSA 5D05A 4FIRA 4JR5A 1W56A 3TQ0A 4FX7A 3EWWA 1PE1A 1RPXA 3G3DA 4FNRA 1HG3A 4JTUA 1FXQA 5C2XA 3PWAA 3PBVA 3W1XA 4JTKA 2CZEA 5I3HA 1LROA 3B05A 3TSMA 3QMSA 3BLIA 1ZHAA 1KM0A 1JCJA 2VFEA 4XBSA 4NX5A 5F1VA 4UMAA
chains in the Genus database with same CATH superfamily
3UT0A 1MW2A 3OYZA 2JIWA 4ERGA 2V38A 3TVAA 3JRKA 4TMCA 1TA3A 3W0KA 4ZMGA 1DORA 4LS1A 3WG6A 3ITLA 4DBEA 2JK2A 1TQJA 4XBJA 4ACYA 3WL1A 3Q67A 3M7WA 2AGTA 3MWCA 5M5DA 4JAWA 3MUY1 4JL1A 1MEIA 1V02E 3MW7A 3DYMA 4J9JA 4Q8OA 1SW7A 2XWEA 4XX6A 2J47A 1O12A 4DJEC 1RUSA 3ARYA 4PMNA 3J7HA 2CLPA 3TIMA 3U4FA 2DSZA 5XINA 4JTEA 2O4MA 4WJEA 4B90A 4MF4A 3PM6A 3D6NA 3F5JA 4ILSA 3EB4A 1SU5A 2H8ZA 3C2EA 1CEOA 2O7SA 2X40A 2D73A 4LVGA 3B04A 3R2GA 3M47A 4YTRA 1OZMA 1X7IA 3DOPA 4WSJA 6REQB 3TC6A 3W27A 1K6AA 3I3BA 2PDIA 4FLRA 7REQB 4H9XA 1EUNA 4ZQPA 4K6AA 1IV8A 4L6OA 3VKAA 3I7SA 4AIBA 1LQAA 3RGTA 3PG9A 2J25A 2YYTA 4Y96A 4G1NA 1XIJA 5H1WA 3GXIA 4TXEA 4BEUA 1PIGA 3AAMA 3KRZA 2DORA 4K7YA 2B4GA 1VKFA 1KRCC 3A22A 4OJYA 1UUMA 1K8ZA 1QR7A 1H7WA 1AG1O 2VZUA 4KBXA 3WLPA 5CC5A 1SZRA 1MMFA 1XRVA 5C9XA 1LBLA 2OU4A 4JFSA 3HGSA 4IFRA 3S2LA 1TJPA 1FWSA 3LM3A 5JIPA 2AL1A 4Q33A 3AJ7A 4AD3A 2ZUMA 3ES7A 4B3KA 1DXFA 1TPH1 1PKLA 4WSKA 4PZVA 2IPFA 7TAAA 3WQPA 3BAYA 3ITVA 4GA8A 3U6WA 3MJYA 4E3VA 3LTSA 3DZ1A 5MKGA 2BY3A 1RQBA 3M5XA 4HA4A 1XDLA 3N2CA 1ZNNA 4MWAA 2E9BA 1VR6A 2QMKA 3UY8A 3CL8A 4EXAA 1CXFA 1ITQA 3TONA 2HEJA 3TN5A 4M6QA 2ZDSA 4MG4A 4MWAE 4UFKA 3MC5A 5AHMA 4B5XA 3MVTA 4QRNA 2XN1A 1XLLA 4J2PA 2BOEX 1K6WA 4IICA 2EPMX 1O68A 5CSUA 4GWEA 5BU6A 1VIWA 2ZXBA 1E5NA 3W28A 4XB3A 2A79A 1ZJHA 4LVDA 3VOCA 2PGEA 5E0KA 3I6EA 4MPKA 1SGJA 5TD4A 2YGYA 3DERA 5G2HA 4E5TA 4KESA 2OQHA 1JRCA 3P2VA 1W5OA 4AWUA 4L9YA 3UPMA 3FJNA 4Q7IA 1ZCOA 5AVNA 3OVPA 5K9DA 3RRXA 1CT5A 5AY7A 1EA9C 4ZO7A 4H9MA 1QK2A 1XLMA 4PMVA 1VB9A 3A9BA 1UJQA 4A8NA 4NL1A 3UCCA 2PDUA 4CU8A 3SY5A 4AZGA 4MFEA 1EXBA 4PUEA 4UB9A 1XLAA 1MW3A 2V63A 2JEQA 5BMXA 3UZYA 1WUEA 3B4YA 3AMLA 1IZKA 3B0VC 4AW7A 2VR5A 2D69A 1NU5A 5A2BA 4XAZA 3NDZA 3TQKA 1A3XA 4U5KA 3GLCA 5ABEA 2W4XA 4CGTA 3TYEA 4GIYA 1FOBA 5CAKA 3MQTA 3R0KA 1C90A 3AIEA 1I6NA 3JVAA 3CQ0A 4NZJA 3DC0A 1XYLA 3F4CA 4NAFB 4O13A 1R47A 3AWNA 4AD5A 3UPBA 4KEUA 2R24A 2V3EA 1OGSA 1MO0A 3BLFA 4CNUA 4Q4SA 4QEEA 3LN3A 1XBZA 1J0ZA 4B9YA 2Z1WA 4LGXA 2EJ1A 1HKIA 1HNYA 3CEUA 3MA8A 3IV3A 4W8BA 3HJZA 3WENA 1PHQA 2PTDA 4R27A 1TCMA 3T0CA 2FFCA 4F66A 5HWJA 1PO9A 1J10A 1ADDA 4GGHA 5I79A 3UZXA 1EGMA 4UZUA 4FK9A 2E68A 4ROQA 1TIWA 5HJLA 4MKSA 3N6QA 1XIFA 3EOOA 4DPQA 2C14A 4AC1X 1SM9A 1X8FA 3DKLA 1GPWA 3VIPA 2VRQA 3UJFA 1PSCA 1TX0A 2JE8A 4JZ5A 3M46A 4QLKA 4Z08A 1FHUA 1SMDA 1V93A 1FP9A 4LSBA 4DXKA 5C70A 1FP8A 1FH7A 1BLIA 1KGUA 1ZBWA 3W6MA 1VEOA 4OUIA 3C0QA 3NQEA 2C71A 1SJBA 4KEMA 3LNPA 3MO7A 3B8SA 3C56A 2PC8A 5C55A 1Z7AA 1NDZA 3JS3A 4ICMA 4WCJA 3MJMA 4BK9A 4MWAB 3W2NA 1GVSA 3WY1A 1EGZA 3NJ3A 3GFZA 4KWSA 3UFYA 4IP5A 1KFWA 4DBUA 1I2RA 2YJQA 5MF5A 1QTWA 1OFEA 1DP0A 1H1NA 3T0BA 3DCPA 2VZVA 3LQGA 1NVMA 2FGZA 3QW4B 1OFDA 2WZEA 1RH9A 1T8XA 4O17A 3IRDA 5GVJA 4HTBA 2ZUWA 3TAKA 1GQIA 2I7GA 1OQFA 2HWGA 4H04A 1BXBA 4CCZA 3LERA 3M64A 1NOFA 2VX6A 2HRWA 4XVEA 3CBWA 3GDBA 1MW0A 1AMYA 3VKCA 5A8QA 3DX5A 5CPSA 2VEMA 4MNLA 1IWBA 4CD5A 4YYFA 4JQ3A 3CAVA 2FYMA 5BRBA 3KP1A 5D8WA 3HG4A 2FPVA 3CT7A 4DF0A 4NJIA 3KLLA 1W1TA 1R3YA 1O4UA 1K1DA 2ZOXA 3VKBA 2BVWA 4JYDA 4L7ZA 5IBXA 3SURA 1R38A 3LGDA 1VYPX 1XM3A 2GJXB 2OX4A 3ABXA 4GX9A 4PULA 4QJ1A 1WB0A 3SSZA 3GXTA 5K4ZA 4WY0A 3GHTA 4TTGA 2Y0FA 1TA3B 3L4UA 2PDFA 3KOYA 4HHPA 3PZVA 3NNTA 4FALA 3UZZA 2IKHA 1XV8A 4OZOA 1YADA 1RLDA 2D3NA 3IWPA 1BSIA 3N73A 2O9OA 3HPAA 1LORA 4BEQA 2PE4A 4PMZA 3W7GA 4DPPA 3F03K 4I7UA 3BTNA 1E6ZA 3W7IA 4HP5A 1XW8A 4AIUA 1OC6A 3BCDA 1JYVA 3ECQA 3KBJA 3WD0A 2PGWA 2E5DA 1HIZA 2VR2A 4PR4A 3GNDA 2NZLA 2TSYA 2OXNA 4G9PA 4CNNA 4ZL1A 1EX5A 1YNQA 5GJMA 2G3NA 2R82A 4ZTYA 3VGDA 3ZS4A 1UH4A 1NY1A 1J6PA 4D71A 3TE9A 3E12A 4KEZA 1I1XA 1C7TA 1B54A 2PDBA 1HX0A 4HCHA 5CSYA 2NT0A 5DCDA 3HG3A 2XWDA 4UTLA 3WLNA 2WMIB 4NQ1A 5C9UA 4GXMA 3FX4A 5HMEA 3WH7A 2DZWA 2DZBA 1QPQA 1ZAIA 3MU7A 1Q6OA 3KWSA 3V75A 4R53A 4NYYA 1GZJA 4UQAA 1S46A 3LS9A 4XZIA 4J2MA 2YIHA 1HGWA 5A8GA 5IDIA 3NO3A 1WX0A 5KEZA 2BASA 3HURA 4DLFA 1OCQA 1T5AA 1GYMA 5DT5A 1AH4A 3VOGA 1N8WA 4GMEA 1CYGA 3W7CA 2PDGA 1AVAA 1RP8A 3V1PA 4V1XA 1OEPA 2V30A 3B97A 1US3A 2PCQA 4K1GA 2D23A 1QAPA 3FFSA 1TE1A 4Q4OA 3UZJA 3EWCA 3GDTA 3C86A 1CGUA 1H62A 3S6TA 4NG3A 3VNKA 3MSGA 4GKTA 2ACQA 4QSFA 4ZFMA 2HCVA 3MB9A 5A8MA 2A2IA 4BF7A 1GQJA 4C6OA 4BQ5A 5D9MA 3BG5A 1T99A 2OEJA 3WUBA 4BR1A 4IFKB 2WKJA 3EWXA 1XRSA 3M0KA 3M07A 1K4GA 1GT8A 4V28A 2XSAA 1EJ7L 3G0UA 5A6KA 4AD2A 3V0SA 1DIDA 4QSHA 4S2CA 1PJ9A 1W3NA 4ZO8A 3NQGA 5HWMA 3TJXA 1JFXA 3LTPA 3EBVA 4A05A 3UWVA 2C6QA 1GUVA 3SCTA 1CCWB 4US5D 4WOQA 5HQMA 3L7RA 1CGXA 2CHOA 2KAUC 3EXTA 1W9PA 1YX1A 4HA1A 4KQNA 1L8PA 2GDUA 4YVVA 4AVOA 4PBFA 3RUBL 4DQWA 2YR1A 4ZB0A 2F38A 4PB4A 4R9OA 3T9PA 1J18A 3CUGA 4BWLA 4RNIA 1NDYA 3P3BA 2J62A 1JYWA 1V0LA 1RVKA 5J5DA 1JJKA 1GKRA 1TO3A 1R7AA 3KAOA 2YSWA 3CHCA 4F0KA 2AKZA 2WMJA 3LM7A 1EWEA 1Z8AA 4MMWA 1NM9A 4GY1A 3F2BA 3BJFA 1C9WA 3FJLA 1SSDA 4S38A 1XIHA 1FQ0A 1A5SA 2DT1A 3PFRA 2V8ZA 4QDPA 2PWHA 3RN6A 2Y61A 3APGA 2E8YA 2ZUVA 4GQ0A 1PTGA 4GYFA 2DT0A 2QDHA 1EOMA 2AAAA 3FA4A 2WZHA 4B5TA 1GKQA 4OFCA 5F4WA 4US5A 3WQCA 4IIFA 4NYUA 3TFCA 3TSBA 3EA2A 1YPFA 1F5ZA 3W00A 3HG5A 4JNYA 3ITOA 1Z89A 4N9BA 3QZEA 4AX7A 2RDXA 5LNVA 1RP9A 2UV8G 1PIFA 1YRRA 4QS6A 1CW2A 1JG9A 5G5IA 5ECVA 1E1EA 3R25A 3OA3A 2DSVA 3BK0A 4US6A 3VD5A 3TX9A 1BYCA 5EBAA 1KBBA 2BHZA 3GXFA 1IZJA 5EA9A 1OK6A 5J04A 2CXEA 1DYSA 3T8LA 1P0BA 3CPUA 4N02A 3R43A 4ZQMA 5HMDA 4QAWA 5DMMA 4R34A 4NASA 1RY0A 2V3FA 1JCMP 5BU9A 4IIBA 3BPWA 2WCSA 1G0CA 2MANA 4A8LA 2VNCA 4N9DA 3ANVA 1CLVA 2ABBA 2W9MA 1JCTA 2IUZA 1DBTA 1TPC1 3QQ0A 4KS0A 9XIAA 3WQDA 4WXYA 9CGTA 3OTRA 1KCZA 3I4EA 5FACA 2PTYA 3C8NA 4I5UA 3ZJ8A 1J12A 2NQHA 2QIIA 4W8LA 4M1RA 3RCYA 4AWTA 3H53A 4DJDD 3WLQA 1AW5A 3S1WA 2A3LA 5JIWA 3REQA 3KZSA 1E0WA 4H00A 3VIFA 1XF0A 1ZJAA 5LGZA 4U5IA 4REQB 5E0CA 4MY9A 3FDGA 1QJWA 4CU6A 1SQ7A 5H6HA 4OHQA 3MPGA 4Q4KA 2AOSA 4DB7A 2IQDA 4ZCWA 2A4AA 3B3DA 4JEJA 1AFSA 2NSOA 1OJXA 2W79A 5ABFB 3RU8X 3JW7A 3M0MA 2FLIA 3PZOA 3RLUA 3H2AA 4CCEA 4UIOA 3R13A 5FJPA 4IL0A 1B57A 5FJIA 1E6PA 4BQ3A 4QIUA 3WH9A 1VYRA 2GL5A 2GGHA 3MSYA 4NIRA 3VZYA 1ISWA 1YHTA 3RXZA 3R89A 1OCNA 1U30A 1E0UA 4UQBA 1TVLA 5K7JA 1J4EA 1PPIA 4R85A 3DFNA 3T0DA 1Q7MA 1US0A 3CL7A 1EOKA 3IGSA 4M80A 3WNNA 3O05A 1XIEA 2VP8A 4B4HA 1B3OA 1TQXA 3BARA 3G0XA 3M43A 3G6LA 2D2JA 4C1NB 2R1MA 1BG9A 1F76A 5DXYA 4XO6A 2WMIA 2DW6A 2G95A 4QQUA 1UOKA 1GOQA 4LAMA 2Z2BA 4PUKA 4LAZA 4PCTA 3H7UA 3B0XA 3WIJA 3THUA 3THAA 5A6AA 1CXKA 3GVWA 2HNHA 2WHJA 3FK4A 1JYXA 2YXGA 3RR4A 1NFGA 1JGIA 1H5YA 3KVLA 1CXHA 2X41A 2OGJA 2QGYA 1UWRA 1TYGA 5C7HA 2VX7A 3WZ0E 1FCUA 1XYMA 4JIIX 4IJCA 1GEHA 4PTXA 1PWLA 2JKAA 3CYVA 5DN1A 3TYZA 1PZ0A 1SO4A 5AHEA 2GUYA 2PD5A 3MKCA 5HPCA 2BHUA 4FNSA 1EEXA 3SQLA 4M0XA 1H4PA 3RNDA 1CGWA 5DBUA 2WHLA 3CV1A 4MY8A 2WM1A 5F4XA 1QPNA 3QY7A 3UETA 3BAIA 4BHYA 2CBIA 2J27A 5K9XA 3U7VA 3LPPA 3E0IA 4RNJA 3SI9A 5HULA 3WJYA 3PJXA 4ML9A 5LNUA 2DV0A 3BGJA 4MSSA 5AZ0A 3Q37A 3WEMA 4TV6A 3G1HA 4S23A 1UD4A 2Q01A 3W9ZA 5CEWA 4UUIA 1J01A 4I9TA 3UJSA 3N4AA 1OB0A 2PP3A 3GZ3A 3PY2A 3C3NA 1SFSA 4AHOA 1KXTA 4AWSA 2C15A 3USBA 1X96A 3IVUA 1UKQA 2GUBA 2EG6A 4DJFA 2TPSA 2J9XA 3WLKX 1UR0A 3N2XA 2I56A 2IS7A 4LPCA 4AZIA 3M16A 4Z1YA 4A3RA 4M6PA 3WYZA 5F2IA 3GQYA 4B2DD 2C0HA 4R3UA 3BAWA 2GZXA 3NZGA 1JUKA 4EKJA 2BX7A 2RAGA 4JKMA 3N6HA 2O55A 3RR1A 3LDVA 3EA1A 5L6UA 1R9XA 4UQCA 3Q4DA 3UQNA 2BBFA 2XIMA 2V3GA 4O14A 2WVTA 4N0RA 3VD9A 2E7FA 3EOSA 4KERA 3PS7A 2PDYA 2E0PA 1LL7A 2B7OA 5TF0A 3OGSA 1LWHA 4OBSA 1ECEA 1T0OA 4IMDA 2YZRA 1DL3A 1UUQA 3RX4A 1OFQA 4U10A 4LQ1A 5F2MA 3VU2A 3LRKA 1OADA 1HGYA 3NL2A 1NELA 3RDKA 2DEPA 3M4HA 3OODA 4H6RA 3HFTA 2OO6A 4I8DA 3W70A 4KFNA 4GVHA 1UKPA 3GH5A 4NNBA 3QLDA 2V2CA 1JDFA 1RY8A 2V5BA 3BLOA 1QNVA 4Q8UA 3GX9A 3KUMA 3SFWA 3RLGA 1KW1A 4FXFA 2R6OA 4DJFD 1FCQA 2DVTA 1EPXA 3IJQA 2GOKA 4C1NA 2XJ7A 4D6DA 2OB3A 1XC4A 2IPWA 1EJVC 1ME9A 1JCYA 4GACA 3NTYA 1D3GA 1A4MA 5A8OA 1OX4A 1Q6GA 3MSDA 2J78A 4QNWA 4AVFA 1H50A 1V6UA 4IPIA 4KIEA 3M5ZA 3MMTA 3F4WA 4LXFA 1WE5A 1GZGA 2YCIX 1XR2A 4J27A 4KRTA 3NPUA 2OVLA 3HQOA 4R33A 3DU0A 3P62A 3W7OA 5CJMA 4UNKA 3URBA 2WCGA 2NV9A 3URAA 1ITCA 1G01A 2OOGA 4WK9A 1DJGA 1XSKA 4EPDC 3IJDA 1LBFA 1QI2A 3SW6A 3FGCB 1C93A 1XH0A 1TUFA 5C0QA 1EP1A 3AMDA 4FNPA 3BXWA 3FAXA 1ZY9A 1GZ1A 1NF7A 3F4VA 1IXQA 3V16A 3U2ZA 3VIMA 3L5AA 3N13A 4TQTA 4PCFA 5ABTA 2VEKA 2X05A 2A3AA 4XD4A 3TROA 4M7SA 2BMBA 4J3WA 1NOWA 4D8LA 1QI4A 1A5KC 4MIMA 1X98A 3R6IA 3HPSA 2A6LA 2Y8VA 5EMUA 2REQA 3QLLA 2ZRUA 2DIEA 2X1RA 4DELA 2PPGA 3R0UA 2V9DA 1E70M 3GIQA 4QISA 2VQUA 4AISA 3NQ8A 1TJ2A 2BG5A 2GWGA 1JZ5A 3UG8A 1FWBC 3JZUA 3H8AA 1NDVA 4GE8A 2XH2A 1R2TA 2XVKA 4F0SA 2FPYA 1YNYA 4L6HA 1HKWA 2WWCA 4RPQA 4J3VA 2E9LA 1FFRA 3SDOA 4HZ6A 4P8XA 3CO4A 1U1HA 2VR4A 4Z2HA 1RV8A 1EJTC 4MB4A 1FTXA 2CEQA 5CPTA 4I5RA 1UR1A 3TN6A 3KDNA 4TOQA 3EWZA 4AZ6A 1QPRA 1MUWA 4UFIA 3M0LA 1I45A 4XK2A 3W7EA 3R7MA 4X63A 1J2BA 2TYSA 2QIWA 4DY1A 3MDUA 1Z48A 3MY9A 5CLTA 1JEZA 5A8PA 3K4WA 5CPQA 3ITTA 3NFUA 1O1ZA 4QAIA 3PAJA 1WKEA 4PMXA 1UD3A 3L21A 2C91A 4A4AA 2HPMA 3QF0A 3VGGA 3W7MA 2BHYA 2MNRA 3IGXA 5AHNA 1WDQA 2OYLA 4HPJA 3VX0A 2NLIA 4MOZA 3SO7A 1W54A 2P8CA 1UR9A 2G41A 1MZRA 4LS0A 1MUCA 3RMJA 2V81A 4I3GA 3MUZ1 1E51A 2QLYA 2GLKA 1W9BM 1U5VA 1ZALA 2CHNA 3WNOA 1AQMA 3G0SA 3FHAA 2W92A 3U0HA 1J5TA 3KOZA 1AH0A 4O1FA 4DZ5A 4Y2WA 4AG0A 2CFFA 1BWLA 1FWRA 4LUTA 1IT7A 4OBRA 1PTAA 1FDZA 2PAJA 3BG3A 3V0TA 3W82A 1YBQB 3EWDA 4CN1A 2OKTA 5E93A 4FLOA 3FV9A 1H3GA 3ITGA 1V03A 3SCVA 4PMDA 1J0IA 4QGCA 3GTIA 2OFJA 3HU7A 3VM5A 1O5KA 1L2QA 2XGIA 4ZA0A 1DQWA 4CN4A 3ID7A 3NOYA 1KKOA 1Q6EA 2WKGA 4G6CA 3MCOA 1ZLPA 4LNYA 2PF8A 1TE6A 4JOMA 4DWSA 3G1YA 2WC3A 3MO4A 3T09A 5D9OA 5C2CA 4FR6A 1QW7A 3CXOA 4ENLA 4NJGA 1JPKA 3AJXA 1R7OA 3AMGA 2PWVA 1IHIA 5FJJA 1EQCA 1GWJA 3NZPA 1KM4A 1LTDA 4TTUA 4IX2A 1TV8A 7REQA 2C1GA 1V7YA 3LA4A 4DO4A 1UH2A 2NV1A 3SZ8A 7PTDA 2FMNA 4WDWA 4NI3A 5CPNA 3VGEA 3GG0A 1V7AA 2OELA 3UWQA 2YL8A 3THCA 2ATMA 1Z41A 3QGKC 4FA3A 4P7LA 4GQQA 1YE4A 4AXNA 3HMCA 3TTEA 1ZPTA 3BW3A 1X6UA 1YDOA 4Y9OA 4KW2A 5I7GA 3WFAA 2JF6A 3SN0A 1GTHA 3PG8A 3MMUA 4IXXA 1Q8JA 4A22A 2GSEA 3ARUA 3WDPP 5D4YA 3DI1A 2DSKA 3W7PA 1XBXA 1OINA 3UWYA 3VA8A 2ZQ0A 3LU2A 2BWGA 3VK5A 3VI2A 3UVIA 5CSSA 2FZ8A 3B0YA 2VGBA 3CASA 3GTNA 3CJPA 1F3EA 4RLIA 2VFDA 5I24A 4LYQA 3UXLA 3Q58A 5FAGA 3M0IA 4NZ5A 1WDRA 3MI6A 3PB2A 4S3GA 5A5WA 3LENA 1JRBA 4G2DA 4AD0A 4UOJA 2WZTA 3THDA 1GNXA 1IR2A 1GYNA 1DXIA 3SCNA 3VDGA 3UWZA 3QPEA 3H7VA 2YDSA 1G7UA 1MSSA 4Y9AA 4Y90A 3WQOA 2Y4SA 3GR7A 5D38A 4GUGA 4MLJA 1LG2A 5BXSA 2RHGA 1FHDA 1A5MC 3ARTA 5F2LA 4FX8A 5CZJA 2ZX6A 2O56A 1XIGA 1MXDA 7A3HA 3GY1A 4H9UA 1L0PA 4QG8A 3G77A 1E6SM 2F6KA 5IFPA 2E25A 5JH2A 5T9BG 4C7GA 3VGHA 4B9ZA 5FJUA 3TSMA 1EDQA 1OD0A 1ZHAA 2GGJA 4MTVA 3E0FA 3EOEA 4IUOA 4BJHA 4GO8A 2Z7GA 1DWAM 4QE1A 4IJBA 3NL6A 4YCPA 1EIXA 3P60A 2BVDA 3BW2A 3ANYA 3CMGA 1RCOB 4D6HA 4I7WA 3ZT6A 4EF9A 2J88A 3WDHA 3C2YA 4CNOA 3WQGA 3LGEA 3S47A 3CB8A 1K70A 2EXOA 4M5PA 3M7SA 4HN4A 3ZR6A 4CD8A 4LS2A 3CGTA 1SW3A 3LLDA 1K7EA 4KF1A 3TK7A 3NVTA 1K9TA 4J5NA 2XSBA 3K4AA 3ARQA 4AYGA 4ORMA 4WVXA 1QPKA 1FH8A 4RXGA 1HVQA 2FTYA 2X8RA 1JZ6A 3SY1A 2IW0A 2QCCA 2OKOA 4GHRA 2CWXA 4GKLA 1OX4B 4N6FA 4TMBA 3A6OA 1R8LA 3GD6A 4HU8A 1PIIA 2R8WA 2JEPA 4M51A 1L6SA 1Q66A 2QCLA 3RPMA 2D20A 3SB0A 4E8CA 3LMYA 5AOUA 1NARA 3BLKA 3IJ8A 3NQVA 3VO0A 1HP5A 1W1VA 3LLFA 4GUHA 1MQRA 3H54A 5JUVA 2NXHA 2WMKA 1DXEA 4HK5A 1SZGA 2BSLA 3CB3A 1UC4A 4YVXA 1E3XA 4WY0B 3HO8A 3QZAA 4NP7A 3N17A 2HVOA 4IIGA 1K03A 4Z2KA 1Y5XA 3IPWA 4J7RA 1D3HA 3OB8A 4BCEA 3ALFA 3D3AA 4O1BA 1IT8A 3A3HA 3H22A 4GNJA 2D0GA 2IKGA 1IEQA 5HR7A 3PZQA 1VGAA 2ASHA 2OG9A 4OECA 2Q8ZA 4XZ9A 3EDJA 3P8JA 1K9DA 4RZ6A 3H70A 5E09A 4MJ2A 2DUZA 1BWVA 3FS2A 2CPUA 2X7WA 3WN6A 1TTQA 1RK5A 3W1TA 4NRSA 5M3WA 4IGSA 4Z2JA 3R5EA 4JCLA 4PUNA 1R3VA 4E2BA 2P0IA 1KWGA 3II1A 3EX4A 1PX8A 1XC6A 5CCZA 5LA2A 4KPLA 4NI8A 4CU7A 3OW1A 5H8UA 1OFRA 4DRSA 5BRPA 4B4FA 1AJZA 1REQA 4X61A 3VNMA 3UXIA 1V6TA 4JGDA 2BOFX 3EX2A 2J6XA 2PRHA 1NIUA 3NPVA 1FCVA 3PWGA 3GYCA 4Q8VA 2YBVA 4U2ZA 5EB8A 3OIXA 1RXOB 2VTFA 1CPUA 1MFUA 2HBXA 4IT1A 5AC5A 2HZGA 4LNCA 5D9NA 4O16A 4O12A 2HS6A 3ONCA 3PJTA 2VQTA 4XSMA 4QDWA 1Q13A 2WK2A 3HGOA 4DF1A 1JAKA 3IIPA 1E9IA 5CSRA 4B15A 4GNVA 1Q6LA 4H7CA 5I2UA 1J93A 4AWEA 3RO8A 1DVJA 3APYA 4O57A 3QR3A 4WUIA 1W8SA 3OVQA 1KB3A 3P93A 3W2MA 1XLDA 4IPPA 1SZNA 2PBOA 1ISVA 5HQEA 5JBDA 4MZ8A 2B31A 3RLHA 3GG1A 2R91A 4IP7A 4AY1A 3SADA 4A35A 4IPJA 1POJA 4P5UA 3STFA 4WDXA 2YXOA 5KSWA 3A9IA 4Y9MA 1ZB5A 1W3IA 2FZBA 3T81A 3I7RA 1UOZA 2Q6ZA 4UTTC 3KDOA 4EACA 3CHVA 3NM3A 3V18A 1T96A 3OVGA 3VOFA 3MS8A 2J66A 5K4XA 6XIMA 5HMFA 3M5VA 5CZSA 4U33A 2UWFA 5BWAA 4R88A 1QNOA 3LV5A 4PODA 1T40A 2PU1A 2VURA 3VTRA 2NXIA 3TTOA 7ODCA 4AZBA 1BKSA 4FXRA 3NEHA 3ZLGA 4GYPC 4IIEA 3G2GA 3CLMA 5JXQA 4OT7A 3W6LA 1Q7ZA 1S5WA 3AIQA 4HT3A 2ZWYA 3DFOA 4LB3A 3NG3A 4F9JA 3CL6A 4LEFA 3M9YA 2UY5A 5D2VA 3N3TA 4EIVA 2CZFA 1EL3A 2FH8A 1EJSC 3SBFA 1VAHA 2VT0A 1YXYA 1XJBA 1XG3A 2D24A 4NHVA 1MUMA 1CZ1A 2B7QA 3H23A 4M24A 3LCGA 2VEGA 1TMLA 1JZ4A 2ZA2A 1VD6A 3ZQ9A 3BG9A 2OSYA 3CQJA 1PX4A 3U2OA 3AMKA 1HTIA 3WDQA 5TAOA 1UP0A 1WKYA 2FVMA 5HNNA 4PMYA 2CZ5A 1AL8A 3AICA 3VOHA 4DNHA 2J7HA 4OWGA 1RA5A 1P43A 1FH9A 1BQCA 1BYAA 2YLLA 1M41A 3EB2A 5T8GA 4R9XA 5B7YA 4IWWA 1JF6A 1WDDA 4EANA 3C2RA 4AIEA 4UFJA 1WPCA 4F2UA 2ONEA 1UD2A 4ADSA 3L67A 3CZJA 3G1VA 2QCMA 4YN5A 2QCDB 1RD6A 1HO4A 3OA5A 5D2TA 1WV2A 2QW5A 2VGFA 3W1QA 1MRQA 1FUYA 3N04A 1JUEA 5CBIA 2BB0A 4AU0A 4UNLA 1H1ZA 4MAZA 4D6EA 3HMJG 4Z1CA 3A5FA 3TR9A 4S3FA 2GJPA 4Q32A 1QO5A 4RUBA 3WBXA 4JTGA 3RX3A 2OR2A 4HJWA 2ZX5A 4K39A 1W2VA 3LRLA 3LNMA 3W53A 3HIJA 2IKJA 3QKEA 2DPEA 4GG9A 1ADSA 3S5OA 1F74A 3AWOA 2FFIA 1O1HA 3CH9A 4LUSB 3K46A 3HB9A 1IE7C 4H8HA 2EPKX 4IM4A 2Y5EA 1AZ2A 4M6VA 3TOYA 3DI0A 4GINA 4DAIA 2ODOA 4LF1A 1LLWA 5I3JA 1AZ1A 2EKGA 3ITXA 3RPTA 5KTLA 1QW9A 1I9CB 3PK7A 3TW7A 4GZJA 1V08A 1GG1A 2PDPA 3QV9A 3NO1A 1Z32X 4FX6M 3K30A 2ZVRA 1JZ3A 5AB3A 4I9MA 2IPGA 3FKKA 4YL2A 4WIWA 3IEBA 1HN1A 1O95A 4LEQA 2ZUSA 1SO5A 4HMDA 1LUCA 4AEFA 2QZRA 3PHAA 5C54A 2E67A 1XQLA 4FNUA 2RGMA 3MBFA 4MWAD 2DJXA 3C4UA 2GQ8A 3MVIA 1V6YA 3LK6A 4O50A 1GVIA 1VENA 4Q8NA 1JNDA 3AC0A 4UCGA 1DV7A 3IRSA 1HW6A 2H8XA 3KM8A 1TVNA 2WANA 2AL2B 4GXWA 3TCSA 3OOQA 5A69A 5CG7A 4WY0F 5JMUA 4YCOA 1QOPA 3ZOAA 4IP4A 5LIYX 3VILA 4XKYB 3GB6A 2VENA 4LF2A 2VELA 1A80A 1K7FA 4AZ5A 2PUZA 1OFAA 1R86A 2FZNA 2QCDA 3DDMA 1JIBA 2B81A 1W1YA 4RK8A 1M03A 3F1QA 4UR7A 4WZHA 5DMYA 2NX3A 1JD7A 2PLKA 2QUNA 3I3DA 3ARVA 5FF4A 4ZXLA 3GVGA 5B7ZA 3DN5A 3VKKA 3L4YA 4HZMA 3DFQA 3L2MA 3XINA 3XISA 3EWYA 1VQTA 2LLEA 1UW9A 4OE7A 1JCLA 1CDGA 4C65A 4CQAA 5HANA 1ISZA 3BUVA 4LYKA 4WR3A 1DIOA 1KQYA 4LFYA 5AC4A 5I3FA 4BI5A 1F2JA 1FWGC 3AUJA 3MCMA 5HINA 4WJXA 3KRSA 1KCKA 1GORA 1WYIA 1AJ0A 5C5YA 2QMJA 2Z27A 4N9EA 5AECA 2OLSA 4MPQA 3IIVA 3S1XA 4MVAA 1O66A 1WO2A 2D3LA 1OX6A 2O9TA 4CUCA 1Q85A 1QI3A 3T07A 3WSUA 3SGUA 2I5QA 3URQA 5C2GA 1US2A 4CD7A 4M56A 3MUCA 2J4GA 3BOLA 3MYOA 2A6NA 1TMQA 3AU2A 2PA6A 1XSJA 6ENLA 4JN7A 3O3RA 4E8GA 3TLLA 2OYMA 3U3HA 1CECA 1K9FA 2IXVA 3FXGA 1XSIA 2RUSA 3LZ3A 2WOQA 8TIMA 2E6FA 1XYFA 3CEPA 2Y5SA 3TSDA 3CZGA 4HKPA 3RILA 1KRMA 4YXGA 2VWTA 2DDXA 4AXKA 1PWMA 5I03A 3L0GA 4L9XA 3TXVA 5T26A 3GH7A 1FXPA 1NWSA 1EWDA 3U5YA 2VEIA 4YU1A 3HZ3A 4JS3A 3T05A 4CQ8A 1UQZA 4PUJA 4PTMA 4UC5A 4H2HA 4L64A 4ALDA 3L4ZA 3CHFA 4I5XA 2A3BA 3QV7A 3FSUA 1B31A 1EZ2A 4F9DA 2AQVA 3W72A 3SIZA 1S1RA 3H55A 5XIMA 4W5ZA 3BZGA 3E5BA 4WDTA 4Q6XA 2HNEA 2E8ZA 3BV4A 3QVQA 3R11A 2GFTA 1W9XA 3LUTA 2ZA3A 3KOXA 4E2DA 4PTVA 3QC3A 5DY3A 2ESCA 2OT1A 3PBGA 5EFDA 3WBAA 3CMJA 3UG3A 1UBPC 2NSXA 4JDBA 2CHRA 3WNKA 4C90A 1R85A 3OU8A 1TPDA 4EOUA 6XIAA 1NWTA 2A7PA 5CJNA 3QV6A 3EMCA 3E0WA 1KFJA 1KR1A 3TA6A 3ABOA 3DYOA 2CNCA 1A50A 2VYOA 3WNMA 2UY2A 1QBBA 2VL4A 4DJFC 3B8UA 2Z0IA 2EF9A 3H2NA 3NO5A 4HPGA 1U22A 1XLJA 4P8VA 1GJPA 4Z2LA 3NAVA 2XFFA 4PMQA 3DHDA 4W7UA 4TVDA 1F3TA 1JL8A 3VOIA 2H9AB 4F0HA 3CWHA 3IGHX 5LHFA 5GPRA 3NUKA 1BYDA 1G4EA 1KCLA 4I9JA 3DG7A 3L12A 3ZZ1A 1TMHA 1D7FA 1P6CA 4X9SA 1GPFA 5I6SA 1DE6A 4MWAC 2WVVA 3RITA 3LCIA 3CIVA 5E0FA 1R2RA 4H01A 1W5MA 3ZSTA 1BSLA 1HKMA 4ZOAA 1TV2A 1LJYA 5C6MA 1RK6A 2V82A 3QKZA 1JDDA 2J7BA 1DWHM 3SAZA 2I16A 4DWSB 3N4EA 3RK8A 1XRTA 1FWCC 3DYPA 1XIMA 1Q6QA 1TG7A 4YTUA 1JXJA 4UQEA 5FL0A 2B0MA 1R9YA 5ENLA 5C71A 3PBMA 3ITYA 1XLBA 1ELSA 5CZTA 5I09A 4WGHA 2VMFA 1JPIA 1GTEA 3DAQA 5FJTA 1OWQA 1S5VA 3TW6A 4DWDA 1VPYA 3BL3A 3SQMA 3SSJA 3A21A 3O9NA 2J7EA 4ACZB 2E1WA 4Y7EA 1XICA 5E1QA 3LCFA 3NQ7A 1AW1A 2ISWA 3P84A 4BQ4A 3KWXA 4AF0A 2QCGA 4AZCB 1E40A 1YW1A 3MT1A 3NQAA 5C7VA 3ERPA 4EVZA 1TPFA 1JI1A 4O8RA 1SFLA 4U28A 1LWIA 3U4AA 3EEZA 3V7PA 3B03A 4IMCA 3CLWA 1IWAA 1TZ9A 3BSGA 1S2TA 2XM2A 4QQ3A 2NWSA 4YWIA 3LBMA 1TPVA 1W37A 2WZIA 4Q4QA 5I3IA 2R94A 3SRFA 1GEQA 2XPKA 3W29A 3QV8A 4GY0A 1A49A 2F7FA 4YPJA 2WVUA 4NAEB 5HOSA 3ATZA 3ZIZA 1XKYA 2H6RA 3I65A 3OYXA 3T08A 3IJ7A 1MDLA 1W17A 3IAPA 4GC3A 3W84A 4XTDA 4IMFA 2PWEA 1RZMA 3RIKA 1H60A 3L5LA 4UCFA 4CNSA 3PUGA 3GO2A 3W24A 3WJWA 4JY9A 1RD5A 3PTDA 4Q4MA 1IZCA 3TW9A 3L5MA 2A3CA 4H8UA 3BAJA 2UBPC 2ZFAA 4AH7A 1W1PA 4HZ8A 4PCPA 5FF7A 4IUGA 1W3KA 2JGQA 1MVYA 4HSOA 1VZWA 1NP2A 2FKPA 4MKNA 1WZKA 4UTUA 2NVCA 1VIZA 2CLHA 3WLJA 4PTDA 3GKFA 3T2OA 5CGQA 2FJKA 3FJ4A 1RSCA 4IGMA 5D33A 4GUFA 3GTFA 5A6MA 3MBDA 1BF2A 1LDCA 4XUYA 4O0ZA 4ATWA 1XLFA 4JKLA 1HJSA 3VE9A 2C19A 4YHGA 2QJJA 1A5OC 3W83A 3DFTA 4DX3A 1D9EA 5JBEA 3EPOA 3GE7A 2D2OA 4QE5A 2DW7A 2VDHA 4XZMX 3B8TA 2CETA 1VEPA 5E70A 4D8ZA 3TA9A 3BAKA 3VINA 4UR9A 3FSTA 4JQ1A 3H6OA 2Z1SA 1HJVA 4F48A 3S9IA 3AZRA 4DHGA 3NDOA 1QOQA 2BGQA 2RDUA 2GK1B 2FZMA 5IHRA 4ROPA 2YBTA 2OO0A 3CQHA 3A3XA 4ORIA 3HOJA 2Y8UA 4HNVA 3USZA 2OX1A 1ODZA 5GQBA 2WSPA 2JKPA 3S46A 4TX9A 2X1TA 3PAOA 4GVIA 3BLPX 2DZXA 3GIYA 3PZGA 1U1JA 4URIA 4KIRA 2CLEA 1QMLA 1E73M 2XFRA 5AVHA 1FWAC 3DFPA 3H2CA 2AQOA 4D6GA 3ZMRA 1D7KA 1AODA 3WMCA 1H49A 1OYAA 2GJRA 4MKVA 1UR3M 2A0NA 4UFHA 3RHGA 2FMOA 4JKKA 3CZKA 4YS1A 3W6YA 3QPYA 1TTPA 1RJRA 1XPGA 4O53A 2F8QA 1LCOA 3K5XA 2QEZA 2OEMA 1N8IA 2PMQA 1VF8A 1EX1A 1UJPA 3AYTA 1TFVA 2PDKA 4RV3A 1KTBA 3QR1A 3DEQA 1DJYA 4LU0A 1XPYA 3O15A 4DBSA 2HVMA 3W07A 3AXXA 3CIWA 1MW1A 1DIKA 1H61A 5EFFA 3OLEA 3G22A 4ZE5A 1POKA 3AIWA 4C5ZA 2X1SA 2H3DA 5IBXC 1P0NA 3OHIA 1I2QA 3Q45A 2E6DA 1EDTA 1PVNA 3IK2A 3EPMA 2Y2WA 1EPVA 2ZA1A 1EZWA 4QJ3B 3T42A 3G8EA 3C3UA 3N3MA 2J8GA 3EDDA 3VIJA 4K36A 1OABA 4MHBA 3A4XA 3M6DA 4IPLA 4ZVJA 1CTNA 4UMBA 5KZ6A 1ML1A 3UXDA 4CVWA 1UWAA 1RBAA 5LIUX 3C2OA 1R3SA 3AHTA 2X1UA 4UWMA 1DOSA 1KXVA 3O7UA 3LCXA 3RG6A 2YFOA 5I78A 4GIEA 3IJ6A 1YDNA 1BFNA 1FRBA 4WKAA 4EWND 3DHFA 3DESA 2RFGA 4LC8A 4HB7A 2NQZA 4U3CA 2GQ9A 4A2SA 1QHPA 4NJKA 2DT3A 4M81A 3WDIA 3C0LA 4CQBA 3B40A 4JTSA 2QJNA 5LHEA 3LD5A 3NSMA 3M6YA 4L65A 4JN8A 2EGZA 1QW8A 3OG2A 5FSEC 4Y6GA 4NZ1A 4RNFA 2R14A 4JFTA 2PWGA 2PWFA 3B9NA 3MSRA 2ISDA 2E5BA 4NAEA 3VD3A 5KITA 2G8ZA 3FKRA 4NSBA 3N18A 2C7FA 3GW3A 5HDRA 3RF9A 1PBGA 4CLMA 4O1CA 5BXRA 3SCPA 3IACA 4P61A 2FTPA 2ON3A 4FHAA 1E5JA 1FFQA 3GU2A 4AMAA 1UIPA 1ZAJA 1BF6A 1H0IA 2EPOA 3QHNA 4M19A 3C5QA 3SY8A 2FHCA 4HNTA 1B1YA 2HBVA 2FHFA 1TPB1 1ZP4A 4UXDA 4L1WA 4N42A 4KCVA 5BOFA 3LEPA 2PC4A 4C1KA 3HV9A 2VWSA 2V2HA 3GNOA 3A3WA 5A6JA 4XZLX 1P0KA 1V79A 2QVNA 4ZQRA 5FSDC 3CQIA 4D8AA 3HF3A 1J2WA 2OLAA 5BYWA 1PV8A 1QRQA 4QFUA 5DRCA 2CBJA 1I0DA 2XSXA 1E1CB 1OC7A 4PFHA 4E4FA 1FWIC 2YA2A 1XLCA 1BQGA 2PFHA 1GQNA 4ZO6A 4KGJA 2C18A 4D72A 5H8PA 2XVPA 2ZZ1A 2CCRA 4C6JA 5HPOA 4F3HA 1Z9AA 4ZGYA 3NSXA 1KBJA 3GM8A 1J0KA 3KZPA 3LRMA 5DANA 4HNOA 3GHSA 2CZVA 4HHLA 4NAFA 3DIPA 1NH6A 3WNPA 3PJUA 4GBDA 2FGLA 2WNZA 2NQ5A 2XH7A 2ZX9A 2ZZ7A 1PS9A 3AUOA 1E15A 3VCCA 3L65A 4HHMA 5MKGB 4Z17A 3OZYA 4JHZA 3AS0A 3W1UA 1MFVA 1BHGA 4B3ZA 1V4YA 2Z1XA 2C0AA 3UG5A 4UTWA 3LLXA 1Y5VA 2AGKA 3AIBA 1IT0A 1MI3A 3FY1A 5JVLA 3AALA 4W93A 4WSHA 2PRMA 1Q4WA 1O5QA 4PMJA 2RJGA 2PDMA 1XX1A 1WDSA 4XIMA 4BF9A 4HOZA 5TQLA 3LSCA 4Q7NA 2G3MA 8XIMA 1O5XA 3MV01 2WLZA 4LCQA 1OF6A 3VPLA 3LMZA 1RCQA 2OT0A 2NT1A 4UFMA 1QCWA 3CTTA 4ACZA 4FPSA 1SJAA 1I60A 3WQ6A 2V5JA 1ECQA 3MTWA 1NEYA 4MY1A 3T1GA 1VRDA 4YYCA 4EPBC 4CKQA 4UTHA 4QR6A 3TNOA 1IXPA 1LM1A 2XH0A 2ISFA 5CPMA 3OHMB 2HISA 3S0CA 2OODA 5BXPA 3OG3A 4X60A 3KL5A 1Q6RA 4GZ7A 1DJIA 2YB4A 2ANUA 4PRTA 2GVLA 3I6RA 5A94A 2PTXA 5TNVA 3HV8A 1E6NA 4Q8PA 1DJNA 1H5VA 4H4IA 1XGDA 5E6ZA 3WK2A 4HQVA 4XVDA 2PI6A 3BQ5A 3W1MA 2OWWA 2WXDM 2UZ9A 1IGWA 1TV4A 1TZZA 4GYJA 2PTZA 2WPBA 3ABQA 3OBKA 3WQVA 1BKHA 1FWFC 3BMWA 2DJLA 3DECA 3W87A 2OZ3A 1UH3A 2CLIA 1NAL1 1UD5A 3EMZA 4Q22A 5HA7A 2XIJA 2CC0A 1UG6A 2ZZ4A 5HK4A 5E5CA 1WP6A 5A8NA 5CH9A 4OUEA 1YNPA 1P1MA 5F1UA 1H11A 2QNEA 1F4HA 4GD0A 1SFTA 4GH3A 3DG6A 2PEVA 3IANA 3T8QA 3UERA 1E4IA 3CPGA 4DUVA 3LGGA 3OP2A 2XTKA 1Q65A 4IQLA 4GUIA 3E6EA 1ONEA 3PNZA 3KRBA 4H19A 1O60A 1UZ4A 4RE2A 4H7ZA 1KO0A 4FS9A 2INFA 2CW6A 2ZTKA 4H8NA 2EG8A 3OVRA 2XYLA 2FH6A 2HE8A 4QTGA 4PUMA 3UYCA 4O28A 1XIIA 4N2YA 1Q7QA 3UA4A 3O0FA 1IXOA 4QROA 3C8FA 1VJZA 3H2OA 2R1PA 4LRSA 1JZ8A 1UZHA 4IGNA 3ZJKA 1NJJA 2Y24A 3UWUA 3ZVIA 2W63A 3VGFA 2FDSA 3FA5A 4J3UA 1WOAA 4PC8A 5BWFA 3V35A 1B90A 1YKWA 1D8CA 4WQ6A 3GAKA 3KTXA 3NL3A 3R4IA 4O19A 3KOWA 2Y62A 5CQ1A 2GSJA 4HHHA 4RV8A 3AIVA 4IXHA 3B8IA 4S3BA 3OEXA 3C52A 3SUTA 3FYOA 4IISA 1UZDA 1JFHA 2YFNA 3FW6A 3UESA 7TIMA 5M03A 2Y7EA 5K2ZA 3QQWA 3BMVA 1DE5A 1U5HA 5D05A 4HGXA 4FIRA 2PP0A 4FX7A 4DI8A 4YVPA 1E6QM 2V5KA 1PE1A 1RPXA 5BXTA 4QG6A 1HG3A 4DJEA 5C2XA 3GZAA 1IR1A 1Q6DA 2YL5A 3PBVA 3W1XA 5GNYA 2CZEA 3AZSA 2W61A 1LQ2A 1B2YA 5AZ1A 3AS2A 4NX5A 3MZ2A 1PDYA 4UMAA 3TZNA 3LHYA 3HQ1A 4LV4A 5D8ZA 3T0AA 3POHA 4A2RA 6TIMA 4NKCA 2E77A 3EAUA 1KNWA 5D32A 3CZ8A 1A5LC 3EZ4A 4RCXA 5CZKA 4W8AA 5LKYA 2Z00A 4NXSA 2BXYA 3EB3A 3GK0A 5G1MA 1BD0A 1MXGA 3WEZA 1AJ2A 2Z26A 3VFLA 3W4RA 1ZBVA 4HPHA 4XZWA 3EEGA 2VC6A 1Y0EA 3NR0A 4JBRA 2Q71A 3KVMA 4EAYA 1C91A 4JNZA 3A12A 2TODA 3C2FA 2PS2A 4HMCA 4LV9A 2QJMA 1FVPA 5FKYA 1VFFA 2IKIA 3G8RA 4Q7BA 4QXIA 2A3EA 3WF4A 4DJED 3WK3A 4KCTA 2ZRVA 3I3EA 1RAKA 2E6YA 2FZDA 5A2AA 1W5NA 3GDRA 4ZBCA 5C9RA 1WZAA 4ZXOA 4C6EA 1ENUA 2QCEA 4QEHA 1IEVA 4GXPA 2PDLA 3NXLA 4KMQA 1LQ0A 3ZR4A 2AL2A 3A47A 4JHMA 5F4SA 3W7KA 4A21A 2PDNA 3DFHA 4GYKA 3GTXA 2CBUA 2DVXA 1QHOA 1F8MA 2Z29A 3R1ZA 1SPQA 4DZAA 4OGZA 3FGCA 1BYBA 1Z3NA 3G24A 2WBKA 3W86A 2Q3RA 5LXEA 3OBEA 5GNXA 3KL3A 1A5CA 2RDTA 1W3TA 1ZS2A 1SJCA 5HJYA 2OYKA 4HBKA 3WLRA 3GXMA 4PMUA 3VCNA 4WRHA 3MP5A 2OZTA 1KA9F 3E49A 1Q63A 4DEFA 1C29A 1WBJA 1WAUA 6ALDA 2QUUA 1U5JA 1DIEA 3N29A 3S5NA 4W7WA 1FA2A 1JPHA 3SCQA 2NWRA 3LXAA 4HCLA 4HMEA 1F3WA 2QQ6A 1B5TA 3L4VA 1A5NC 1GOXA 2BP1A 1EP3A 4ZQOA 4WEVX 3NL5A 3BW4A 2UY3A 1S39A 3LHUA 3KTSA 1P1XA 3QSTA 1G9HA 2BLEA 3HFYA 2WVSA 4R7WA 3R8GA 1AD4A 3BSMA 3WFLA 3GXPA 3MUIA 3TEVA 3LG3A 3W01A 2F2HA 1ZZMA 1WA3A 3I7QA 2FPTA 2V0TA 5D30A 1SJDA 4LAUA 3NQ2A 3B8WA 1OC5A 1DJHA 1S1PA 4JHOA 1WCGA 4RZBA 1XIDA 4R5EA 5SWUA 1ICSA 2DP3A 1GVEA 1V6WA 3A4AA 1XINA 4JCMA 2B7NA 2C8NA 1W9DM 4GZEA 3L0NA 1OT2A 1CB7B 4PMOA 3BURA 1W9UA 1ME7A 4YTQA 4DM2A 3CM4A 2A5HA 2FHBA 4L5ZA 3DHUA 1IEWA 3OIHA 1XS2A 1CLKA 3W3OA 4JD4A 4H3DA 3F5LA 2W62A 1KQZA 1A0CA 2WMHA 1X7FA 1QNPA 4IFKA 5FL1A 2VFHA 4GJJA 1LT8A 3E02A 3P6LA 1M9HA 5A6BD 1WDPA 3W81A 1PX3A 5LGXA 4G7EA 5FAJA 2G50A 1E1CA 4M7TA 1TWSA 2WV8A 1THFD 4IQEA 3SRDA 3VDHA 1CGVA 2GQ3A 4GLEA 2D0HA 1MQQA 3AHYA 1EC7A 1FX6A 1A4LA 1W3HA 1WUFA 4JTCA 1J0JA 1H63A 4QE4A 2BFGA 5GJNA 1F7BA 1H2JA 4RR4A 4GQGA 3Q94A 3LY0A 1JDAA 3A4WA 4INFA 2VI0A 3A5VA 4AHQA 4YIWA 3QFWA 1GQLA 3PBYA 3A4JA 2G97A 4XD6A 4HN8A 5A6TC 3B0UX 3L0KA 4GISA 1KCXA 1GONA 1R3WA 4XAPA 1PUDA 1OGGA 2WPGA 3CS2A 4RW5A 4ZTXA 1BEUA 4I90A 3D3FA 5LNWA 4HSHA 4TUFA 3LI1A 3M41A 4ZEPA 3GFXA 5G4EA 1LRNA 3GR8A 3NGJA 4IQDA 1XRFA 2FJUB 2ZX8A 4MJ4A 3LI0A 2ACRA 2G4FA 2VD9A 1CGTA 1ICQA 1S38A 4C6CA 3TTSA 3ARXA 3KCJA 3HN3A 4GGBA 4HNNA 1WZLA 3CAKA 1GVFA 3S6DA 4KETA 3MP4A 3INPA 3UPWA 4E38A 5AHFA 3ARZA 3TLQA 4IPNB 2VEFA 2J9YA 4JX4A 2Z24A 1DWFM 4QM1A 3S5YA 2P3EA 3WKZA 1ITUA 1MNZA 3WLOA 3PZIA 3NM1A 3WQ8A 1OFOA 2EKCA 2R1LA 2E40A 3E0VA 2Z1KA 3VZZA 1T6MA 4GCXA 4YTSA 3LPGA 4OIFA 4PL2A 4A8IA 1CNVA 3WF0A 1NWUA 4XZNX 2FB2A 3I6TA 4YLWA 4DZIA 4DAFA 4JTJA 4GC4A 4L56A 2J7FA 3UNDA 4YWSA 3TJLA 4ZOCA 1I0BA 5F7UA 1FWJC 2V5DA 4H6QA 3HA1A 1S5TA 3ZO9A 1F73A 4WLCA 1UQYA 3KHDA 2CLFA 3VIOA 2B7PA 1JVNA 3O16A 4NZ3A 4PH6A 1E71M 3CO8A 4HIBA 4D9PA 3VDCA 4HCDA 4MB5A 4WOZA 3Q2DA 4C6FA 3GHRA 4KRZA 5F2GA 2GYIA 5BOOA 1TV7A 5DX7A 3WJXA 2YCJA 2PTWA 2G37A 1W1ZA 2GVYA 5CZ0A 5HAOA 1MEWA 5CC3A 4B2DA 1U33A 2BXZA 2ZZ5A 1V3LA 2EG7A 1G4PA 3W74A 1B9BA 3T2QA 2GOUA 3GR4A 2WVVB 1KFEA 1RHCA 2YW4A 4H1ZA 5TBOA 3WF2A 2WJFA 4P7NA 5REQB 4IF2A 1QK0A 3TH6A 4XO7A 4LT9A 3SUVA 1O94A 4BI6A 1S2UA 2PF0A 1OK4A 2Z2UA 4XZHA 2NUYA 4L9ZA 3UJRA 3CWNA 2OWCA 4B3LA 1HJXA 1TWIA 1O6IA 3KLKA 4NRRA 4YTTA 5E9AA 1NOUA 1KTNA 2HQAA 5AHIA 3O0KA 3YPIA 3LBOA 5CGTA 1TRIA 3N11A 3G3MA 2W27A 4PGLA 3UGRA 1EEPA 1OM0A 5D02A 1Z6KA 1GJWA 4UOQA 1E4MM 4J3ZA 1NWRA 2QJIA 3VNYA 1KM2A 1XG4A 4AX6A 2WJDA 3QXBA 2PB1A 3BE7A 1DTNA 1EF2A 1M65A 4LUYA 1L9WA 1FDYA 4EX4A 4XISA 2W5FA 3P14A 1OGBA 3FVDA 1ZRQA 3GHUA 1RLCL 4O1DA 3GG7A 3K8LA 4KWVA 1PKMA 4O54A 1PB0A 1MYRA 4N4PA 2INEA 2Z2AA 2PODA 2XN2A 3UD6A 4DXVA 1A47A 3AI0A 2ZZ6A 1QBAA 5EPDA 3VNDA 1V02A 1UPMB 1QFEA 3B9DA 4LUTB 3AQUA 4TX6A 1WAWA 2XGBA 3O8AA 4FR1A 2G0WA 8CGTA 1ZBKA 1RQEA 1TTIA 2DUAA 2HK0A 2XH4A 3K13A 1HFBA 3A64A 4LTSA 2CERA 3TYDA 2XGZA 1R3TA 3HPXA 3NVDA 6TAAA 4P7RA 3T44A 2YBUA 3WH5A 2QUMA 2EBNA 3AO0A 2HK1A 3SIMA 1V3KA 4LANA 1AUSL 2PZ0A 4IX0A 1GW1A 1KM6A 3W73A 2NXGA 1QU4A 2GQAA 3SUSA 2W66A 3GNXA 3KBWA 4S2BA 1GOWA 3W02A 4ZB2A 2PDJA 4HU3A 2ZX7A 1CIUA 1I75A 4FB7A 7XIMA 3EDEA 3BMXA 1KRAC 1L6YA 4D1JA 4AYSA 4GUJA 1A3HA 4LC6A 1SZEA 4S1FA 1M04A 3QR0A 2HJPA 3IGUA 3F7JA 1E4NA 4JYFA 4DM1A 4JEQA 3IJ9A 1DPMA 2VFGA 1UP2A 3VX1A 2JQXA 1HO1A 3TQVA 4WXZA 2VFFA 3RJXA 5A95A 5HUPA 3I4KA 4OOZA 1EBHA 1V0MA 3U7BA 3L4WA 3L4XA 2WZMA 3ME3A 4DLMA 3U5UA 4QX4A 3FA3A 1EB3A 3H12A 1RR2A 2Y70A 3PZTA 3QOKA 1KV5A 3F4NA 3WUGA 4BQ2A 4F40A 3DG3A 1FWHC 1IIGA 4DIAA 1GVOA 3RFAA 4DJDA 1TPWA 4CNPA 2PDXA 2CU0A 3UA3A 5CJ5A 1W1IE 2CLKA 3VIHA 4QS5A 2QJGA 4ZFCA 3NIYA 1YDVA 1B3VA 4M3PA 5DELA 1DKWA 2NQLA 5AYZA 2NQJA 1ITXA 1JD9A 3QFEA 1PKNA 3C61A 1C9DA 3ABSA 3ES8A 4NJHA 2PGFA 1TSIA 3IIZA 1HJWA 2QAPA 4W85A 3U57A 2Y89A 3NA8A 3B9OA 5KZMA 4PCSA 3O6CA 4DI9A 3WQWA 4LALA 4DBWA 1XH1A 3TWBA 1I4NA 2F2KA 4HNUA 1UKTA 3I68A 1VFMA 4YNGA 1HF6A 5L9FA 3MKKA 2O9PA 5FEWA 1H7OA 1XP3A 3H4XA 4AZHA 5LIWX 5ECUA 3IS4A 3LX9A 3M44A 3E1F1 4K3ZA 4PSRA 4BWLC 4CEUC 3CUIA 2YZ5A 3B8VA 3PBUA 3WLTA 2YDQA 3ARPA 3M0XA 4L4PA 3UCDA 3U48A 1E6XM 2E3ZA 1SR9A 3V4BA 1IGSA 2V5CA 3L23A 1WXZA 1OD8A 5LSMA 2FVLA 1HL8A 3O6DA 1UR8A 2WMGA 4QCFA 4NNCA 1EC9A 3G1FA 2X30A 5J8LA 4KRUA 1C8YA 1XXXA 1VBGA 2E4TA 1W6TA 2ZICA 3FEMA 3W7QA 2CIPA 2ZWZA 1H7PA 3RM4A 1CX9A 3WJSA 4BS0A 3W88A 3CQKA 1EDGA 1G5AA 2DZAA 3WMSA