3C4UA

Structure of class ii fructose-biphosphate aldolase from helicobacter pylori
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
292
Chain Sequence
b'MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Synthesis and Biochemical Evaluation of Selective Inhibitors of Class II Fructose Bisphosphate Aldolases: Towards New Synthetic Antibiotics.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 109
structure length 292
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c4uA00
1G7UA 2NX1A 3I7QA 4EWND 2ZRVA 2YW4A 1LROA 1RD5A 2VEIA 5K9DA 1TYGA 3PR2A 4GNJA 4OU1A 1Q3NA 4JIQA 2JBMA 4NXKA 1DQWA 1JR1A 1W5MA 1W5PA 3W74A 4IX0A 3LDVA 4UR8A 2CZDA 2VFHA 3OVPA 1TMHA 3C0JA 2OZ0A 1FWRA 1WAUA 1XDLA 3HPSA 1YTDA 1LOQA 1N8FA 1MO0A 4NT0A 4O17A 4YXGA 5DY2A 3LM7A 3S1VA 2VEKA 1PHQA 2Y63A 3G18A 3OVQA 3GDKA 4HPJA 3NQMA 1LDCA 3TFCA 1SFJA 2AAMA 2ATMA 4I7UA 3NDOA 3W1RA 3TR2A 2CLIA 5EY5A 2BTMA 3TSMA 2H90A 1C8VA 1ICPA 1H51A 4FNSA 3S42A 5K3VA 1FDJA 5G2HA 1H7NA 1LCOA 3TQVA 3W7JA 5K9XA 2Y7DA 3JRKA 5AYXA 3QSRA 1H7OA 4JX6A 4K8EA 2X1SA 1IXPA 3F4NA 2QCNA 3M43A 1ADOA 1I2NA 1XUZA 2A85A 3MBDA 3B0PA 1TPUA 2E5DA 5D04C 5HWMA 1WA3A 5DLCA 1BWLA 2FTPA 4WQ6A 5D05A 1J5TA 1PCWA 4UNKA 1O5XA 3P80A 4YMZA 3NEVA 3NM1A 2YXGA 4LC6A 4UTKA 4POCA 3NPWA 4HPXA 4JTLA 1LBLA 1WBJA 4FEZA 1FWWA 3NPVA 1G69A 3PBYA 2H8ZA 3LRKA 4GUIA 2ZRZA 3IIVA 3U6WA 4IXXA 1OJXA 5F2GA 2C18A 1DVJA 5D2VA 3G0UA 3TK7A 2YZRA 4ORIA 1H61A 4JDBA 4R53A 1QOQA 2ZQ0A 4XZ9A 4ZMGA 2DORA 3L5LA 5F4SA 1HUVA 3FIGA 1VLWA 5HWNA 3UD6A 2HS6A 2ZCGA 3E9AA 3NVTA 5BOOA 1OFRA 4A3UA 1Q6LA 2X1UA 5DXXA 1GZGA 5G2IA 2E1DA 1VS1A 3P8JA 3Q58A 1XFBA 3HGJA 4HT3A 4O15A 1DOSA 5AHNA 4JN6A 3HJZA 4X3ZA 3I6RA 4O1BA 2TPSA 4O8RA 3S1WA 5KSWA 3NQGA 2GJLA 3EX6A 4O16A 3TJXA 5HUPA 2V8ZA 5CPMA 2FPTA 4FNTA 1JQXA 3I7SA 1UCWA 4UTIA 3EXTA 5EYWA 3C6CA 1OFOA 1PCKA 1JVNA 2A7RA 3ZWSA 4O19A 4ALDA 2WV8A 1JJKA 3O16A 3W2LA 3W1UA 5BRBA 2J9ZA 1XDMA 3R12A 1P5BA 1EEPA 2C16A 1X6UA 3UPWA 2OX1A 3LHVA 1MXSA 1KFCA 3O06A 4K6AA 3TFXA 3LXBA 2Z6IA 1DKWA 3UXAA 2PCQA 2WOQA 5H2ZA 1YDNA 2HTMA 1D9EA 3G8EA 1QNVA 5C5YA 1OK4A 1SR9A 1JCYA 4QJ1A 4UTWA 2WO5A 3BLIA 3S6DA 4IMCA 2FB3A 3N73A 3TW6A 3LTPA 4N9BA 3BGJA 1KFKA 3M7WA 1W3TA 4FXRA 4GE8A 3SR7A 3GXTA 3C4UA 4AEOA 5AN7A 3F1QA 5LNSA 3RFAA 4O10A 1ZFJA 4LY8A 2WNNA 2H8XA 5LNUA 1Q45A 1KFEA 4A2RA 3P5YA 3KRSA 4MLRA 1DQXA 3CTLA 5TIMA 1F2JA 2FPYA 3DGRA 3FJLA 3TX9A 4H4IA 4JD4A 3QQ0A 1AL8A 1IF2A 3KOFA 3P5ZA 5C55A 4AWTA 3QRHA 1KW1A 2I9EA 3B4UA 5C6MA 1G6CA 4M6QA 4LVFA 5FEZA 1R2TA 3B06A 2YW3A 4MY8A 3KX6A 3C2EA 2RDTA 4GUHA 1OFAA 2J27A 3B0VC 1PL9A 3TUUA 3RLVA 1FCQA 1TPEA 1LORA 3LI1A 2JKPA 3M41A 3RK8A 4UTWC 2B4GA 1KFLA 1KTNA 1SQ7A 2W79A 4TO8A 1ZAHA 3B04A 3GKFA 5H91A 3N19B 4CLMA 4XWUA 2RFGA 1DJQA 2QJIA 1YDOA 1VC4A 3W2UA 1KA9F 3UWUA 2ZFAA 1FXQA 2Q8LA 2OT0A 5G2WA 1VYRA 1UUMA 5DBTA 2VENA 2GPTA 3EX1A 4QNWA 4RX0A 4CQ9A 5CKSA 3EEGA 4BK9A 3C2FA 1OX4B 3F4WA 4WX2A 2BLEA 1T96A 2ALDA 3QYQA 2ZZ2A 4PODA 2ZRUA 1B4KA 3G1DA 1O5KA 3QW3A 4MYAA 4AHQA 1GTEA 2R14A 3A24A 4FIQA 4UUIA 2V30A 1MEIA 2TYSA 1YXDA 1K8ZA 4IPJA 4DO5A 3NQDA 2Y70A 4QNEA 4B5NA 1XKYA 2R94A 3SZ8A 5MHBA 2J6XA 4OBTA 3DU0A 4HNNA 3W7IA 3USBA 4AXKA 3E02A 4X22A 5I3JA 1NF7A 3TV8A 4FF7A 1LP6A 4XTIA 3M5VA 3EXRA 3PVFA 4PL1A 3LOTA 2CLKA 1ZJIA 5TQLA 5F2MA 2TSYA 4A22A 3KAOA 4CQAA 2E6YA 2DZWA 4P61A 1LRQA 4C1KA 1I8JA 4BF9A 4JTUA 4N2YA 2NWSA 4LVAA 4IOTA 2BWGA 1OYBA 3GDMA 4MKNA 4UTHA 4JXCA 5F4WA 3ZS4A 1PV8A 3NAVA 1QWGA 4OHQA 3BO9A 2CZFA 1EA0A 3TC7A 1H63A 3TH6A 3NZ1A 4JY9A 2R8WA 4O52A 4EIVA 3VI2A 3QPZA 3QMTA 1M7PA 3TSBA 5D02A 4WOZA 1YTEA 4HN4A 4YLWA 1GT8A 1FCBA 3CIWA 2ZRWA 2VXNA 3A5FA 3L2IA 2WSQA 5L9FA 1HG3A 2DZTA 2BZNA 3DFQA 2ZA3A 2HMCA 3W83A 3ATZA 4MY1A 4DQWA 3M16A 4HNVA 2VELA 1KM5A 2Y89A 2E68A 2CLEA 1FWTA 4ZL1A 1A5BA 3FKKA 3VE7A 1BKSA 3VE9A 1OHLA 3MBFA 4JY8A 4WXZA 5KTLA 4ZQOA 1R47A 1Y0EA 4MY9A 1MZHA 3GVGA 1GEQA 3PF3A 4OV9A 1QCWA 3TSDA 3LHYA 4O1DA 1OFPA 1GVRA 2C13A 3M1ZA 1XBVA 3NQEA 1W5QA 3IVSA 1ME8A 2RDUA 3UWZA 3TW7A 4LRSA 3ABOA 3PC0A 4ZQMA 3FJ6A 3BG5A 2V81A 2VEPA 3PSWA 4H6KA 4LNYA 3TQKA 3P61A 1ZNNA 3L9CA 4MOZA 4JTJA 4R33A 1ME7A 4N6FA 1KTCA 2JKEA 1SW7A 1TCDA 1JUEA 2ATSA 4DF0A 1VCVA 1GJPA 3W2JA 4NJJA 1ZAIA 1EWEA 1H5YA 4GUFA 3EX4A 3EB2A 2E6DA 1KV5A 3S1XA 2B7QA 3TC6A 1XM3A 4O57A 3CC1A 4JX5A 3W2MA 1WX0A 2X16A 3NNTA 2HSAA 4Z1AA 1QPQA 1ZENA 2DZUA 3O1NA 4LS1A 5LGXA 1A5SA 1ZALA 3W7PA 1X8FA 3VNDA 1OK6A 1S3HA 1TRDA 3OHIA 1MEHA 1ZHAA 1NAL1 3MI2A 5T26A 8TIMA 3PBUA 1FBAA 3MMTA 3LCWA 3QMRA 1OFQA 5D33A 4FNQA 1WQ5A 3PAJA 1JUBA 1KLYA 2W0UA 4Z1DA 5BMXA 4O12A 3PUDA 4QAIA 1Z41A 2GVJA 3TJLA 3DH7A 4UFHA 3C2RA 3GAYA 4NNCA 1J2WA 1JULA 4E2BA 2YSWA 3N2MA 5CZTA 3W1LA 3D0CA 3BLFA 2WKJA 3B0UX 4PFMA 3W72A 3W1PA 3TQ0A 4AAJA 3K30A 4IPIA 3R2GA 1W5OA 4IMFA 2ZZ1A 5DCBA 3EKLA 1LM1A 4PH6A 2ZTJA 3DBPA 2ZZ3A 2H3BA 3DFSA 3W76A 3IVUA 3N9SA 5AHLA 3L5MA 2V82A 4K38A 3W1TA 3UZ5A 2BXVA 1A53A 3LV5A 3WJXA 3G3DA 2XN1A 1FDYA 1PIIA 2AQWA 1UBSA 4RLIA 4E38A 3W7EA 3IGXA 4BR1A 3W3OA 5DCEA 4N4PA 3NQVA 2RDWA 5D2WA 2NUXA 1EX5A 3DAQA 1TSIA 5TBOA 1QMLA 3H53A 1WV2A 5E1QA 2Y61A 4LVDA 4RK8A 4Y8FA 4I9AA 4PCFA 4RZ5A 3B8DA 4NJGA 1M7OA 3W85A 1KM0A 2QCDB 2QJHA 2J9XA 3G24A 4DO6A 1A50A 1F7BA 5SWUA 1FY6A 3TNOA 3WK0A 1P1XA 4HSNA 2P10A 5KZMA 5BMWA 2CZEA 3THAA 1IXQA 4IMEA 1L6YA 2QCCA 4XBKA 2EAWA 4A29A 1TIMA 4OGZA 3RLUA 3W86A 3M5ZA 3SIZA 4ZQPA 5FEXA 2NX3A 4GUJA 2YX0A 5K4ZA 1JCNA 3BG3A 1TREA 5CGQA 4MJMA 3N2XA 2CLFA 3S9YA 3TCEA 1VJIA 2QCFA 5CZSA 1MSSA 1K7FA 4UFLA 1W37A 4UCGA 1GPWA 3HPZA 3I7RA 1OFDA 3GXNA 3CPRA 1H7PA 2Y88A 1EB3A 1IGSA 4KFOA 1TPVA 1X1OA 1EWDA 5LKYA 1IIHA 1CX9A 4MPQA 2GQAA 3THQA 4DBDA 2G95A 1TJPA 3I68A 1KM2A 1RQBA 2A1YA 2YDAA 5CG7A 3HG2A 3LCIA 4UFJA 3RU6A 3UPBA 5IBXA 3N3MA 2A5HA 1I2OA 3L21A 4U28A 3M5YA 3L65A 2B7PA 1YLVA 3WJSA 1H7RA 3GNDA 1JCJA 4J9JA 3OIXA 2EKCA 3IIOA 2QUVA 3R8RA 1AK5A 2VKZG 4JYFA 2J24A 2GUUA 3CEPA 1TRIA 1O4UA 2QR6A 1ZY9A 4CNPA 5LSMA 4UNLA 1VR6A 4LV4A 1UUOA 5AHEA 1RV8A 4K39A 1OABA 4MZ8A 1VH7A 3W7KA 5K2ZA 1TV8A 4HSOA 4MUZA 3AO0A 2ZZ4A 4M7SA 3W07A 2V5LA 4S2BA 3ZWTA 1RVGA 1QAPA 3E12A 5LHFA 4HHPA 1JCLA 2NUYA 5F1UA 4G1KA 2X2GA 3S0CA 2Z0IA 4PL2A 4KFNA 5HR7A 1PHWA 1RQEA 4MZ1A 3IGSA 1OX6A 4K37A 4O0ZA 1LOSA 2WSRA 2CLLA 3UY7A 3M6YA 3FOKA 5EKYA 3PUOA 5IBXC 3M47A 2O7QA 2ZYFA 3W7OA 4RR4A 3S1UA 3T7VA 3E0IA 3STCA 1SZEA 3NL5A 2Y7EA 3DKJA 4LC8A 3UYCA 3CEUA 5HQEA 4XQ6A 1TTPA 1TPFA 1K7EA 3ELFA 4Y90A 5IM51 1OFBA 1F6PA 1SFLA 5DCDA 1DORA 2E5CA 5CPLA 3HBLA 2FDSA 3UWVA 4M6PA 4QISA 2I1OA 1VLIA 3P8IA 5AHFA 4AHOA 4BWLA 3KXQA 1EP1A 2E6AA 1H60A 4ZQRA 4FX7A 2V9DA 3HGOA 2B0MA 5LHEA 1X7FA 4M7TA 3VKJA 1O60A 3FYPA 3N9RA 1RZMA 4Z08A 4BFAA 3NPUA 1JRCA 5FF7A 3GIYA 4IWWA 1EPXA 3S5YA 3HG4A 1I45A 3SSJA 1F5ZA 1G4TA 4HKPA 3PBVA 1LLWA 3TDFA 1H7WA 1EP2A 2V2HA 1LRNA 3TROA 3DZ1A 3SW6A 1TPH1 3O05A 3PBWA 1ML1A 3STEA 2VFIA 1W1ZA 3MO7A 4MIMA 3ABRA 2PE4A 3L0NA 4TR9A 3NA8A 3A23A 3W23A 1KM1A 3NZRA 4A21A 1P0KA 2A6NA 3QSTA 1YXYA 2A7PA 2FJKA 1QO5A 3GKAA 3MYOA 4NNAA 1AG1O 1G4EA 2QUTA 4O14A 3KHJA 3W71A 2QCDA 4ZQNA 1Q6RA 4BWLC 3CT7A 3LHUA 2FB2A 3HGSA 4XKYB 4FO4A 1JQVA 3DXIA 1KBJA 1V7YA 1FXPA 4NJHA 2G96A 2LLEA 3NO5A 3FKRA 3OG3A 4M19A 1OF8A 3W7LA 2A0NA 3QJAA 4RXGA 3PWAA 3W70A 4O4VA 3W6YA 4WUIA 1RPXA 1XBZA 5DXYA 3OEXA 4O1AA 3VFLA 4JS3A 3ZFHA 4Z1BA 3B05A 4GFSA 1FCVA 4K36A 1EP3A 1TPDA 4TX9A 3N14A 3UQNA 3SY5A 1XBXA 5AOUA 1Z44A 3DHFA 1LTDA 1VQTA 1OG0A 3SJ3A 2ZRXA 2C14A 2ZDRA 3CHVA 5EMUA 4EF9A 4N02A 1JCXA 1PVNA 1W31A 3NL3A 3P67A 5AYZA 1S5WA 3LV6A 5G4EA 3MP3A 2Q8ZA 4DF1A 1TV5A 2CU0A 3GR8A 2V2DA 3C8FA 1NSJA 4Z0JA 1HTIA 3EWWA 2C15A 4ZVJA 4LWWA 4NNBA 4AMAA 1WOBA 2QCLA 4WZHA 4GC4A 4N9EA 1W3IA 1N55A 1SUXA 1AL7A 1L2UA 2V5BA 3HF3A 4DBEA 5G1YA 4UFKA 4Y9AA 4AB4A 3Q37A 3DKLA 3TKFA 4X9SA 2WNZA 1KM6A 3MW7A 1GVOA 2FFCA 3UWYA 3WFAA 3BLEA 3G22A 2EF9A 2GQ9A 2QCGA 2WQPA 2B7OA 3L66A 1TJRA 2ZZ6A 3O15A 4NXSA 3KVKA 4NU7A 1VHCA 3W2KA 1KV8A 2YCEA 4RV8A 4YCOA 3KRUA 4MVAA 3G0XA 1L6WA 1HO4A 1LOLA 4WD0A 3NQFA 4O1CA 4IQLA 2NV2A 2QKFA 1SW3A 5AHMA 3PSVA 5CSSA 5LNWA 1ONRA 2QDHA 5LGZA 1QO2A 2FPVA 3S5OA 3S8HA 1YDVA 3HG5A 5CZJA 1XL9A 3G1FA 3NM3A 4S2CA 3ATYA 1BEUA 5HMSA 4WJEA 5AHIA 1OYAA 5DY3A 1SU5A 5FEWA 4JGDA 2Q3RA 1XI3A 3I65A 1QOPA 1W5NA 3M9YA 4JX4A 4KWVA 3EWXA 1I4NA 3PG8A 4LRTA 1DJNA 3DI0A 2NUWA 2YFOA 4UMAA 2VC6A 2PRMA 2GOUA 3NQAA 4AHPA 2NWRA 4WY0A 2EPHA 3O8AA 4RXFA 4ZQCA 1XCFA 3YPIA 5CZ0A 1XXXA 5KINA 5EL1A 4IJBA 1FCUA 2P0OA 5BNKA 4NZJA 3QH2A 4JICA 1EIXA 5D2TA 3BW4A 1GQNA 2NZLA 3W88A 1WDWA 3NG3A 4O54A 3OA3A 1D3GA 3IIPA 4JTTA 1K8YA 5DBUA 1H1YA 2VFGA 1TQXA 1FWNA 3WJWA 2W6RA 5G1TA 5HJLA 3A9IA 3M5XA 2ABAA 3IGUA 1CW2A 2ZBTA 1L9WA 3SGZA 2WJZA 1W54A 4JTEA 4UFIA 5C54A 3W7HA 4O53A 3PY2A 4UIOA 2E09A 4OQVA 3RNDA 3ABSA 3VCRA 1QDSA 1OX5A 3W7RA 1K8XA 2RH9A 1SZFA 1TQJA 5A8GA 3W73A 5K9CA 1BTMA 3STFA 2A4AA 3MHFA 4L4MA 3LXAA 2E5BA 2CLOA 3TXVA 5KMYA 1VRDA 3MUXA 1GTHA 1F73A 4FX6M 1GYLA 3CWOX 5KZEA 2QDGA 3FYOA 3W87A 3G8RA 3QW4B 4XKYA 4GRSA 1JRBA 3P82A 4MZYA 4LV9A 5LZLA 3LLFA 2TMDA 1F6KA 1TPB1 2WSYA 1THFD 4JTFA 4LU0A 3WJYA 2YR1A 4XBSA 2QCHA 3GDTA 4GWEA 3FA5A 2NV1A 1KFBA 4AWUA 2ABBA 3LHZA 1D3HA 1T99A 3C56A 3CWNA 2EGZA 5D30A 2GVGA 3HG3A 3INPA 4PA8A 2V2CA 2PURA 4BI5A 2I14A 3HPXA 2PC4A 5EA9A 3W1NA 5DN1A 3NR0A 5D38A 4IUOA 3R89A 2VFEA 3GX9A 1A5CA 2ISVA 1LYXA 3EX2A 2FQIA 2Y62A 2HS8A 1GYNA 3OVRA 3L0KA 4CCEA 5GVJA 4LOCA 4GJ1A 4K7YA 1WXJA 3GB6A 1SZGA 4MFDA 3QM3A 1DBTA 2RKXA 3LRLA 2A2IA 2V0TA 3W1XA 3WK3A 3QF0A 1T0OA 4TMBA 1LZOA 4E0CA 5J5DA 3LXCA 5HNRA 3P60A 4BI6A 4PTNA 3NPXA 2FLIA 3G1XA 3A22A 4XUGA 4HNUA 2H6RA 4IXHA 5BW6A 2NX9A 4JR5A 2ZA1A 4OWGA 4MJZA 3T55A 5CPNA 1XC4A 3UWQA 1B3OA 4RCXA 3T78A 3DENA 3Q94A 5I3FA 3ANYA 4EOUA 4P2VA 3HMJG 5F4XA 3L67A 3KFTA 4KFPA 4ZZ9A 3LGEA 5I3GA 3W1MA 4O50A 2OJPA 2JKAA 4PEKA 5D03A 1L6SA 3HOJA 1VGAA 4WOQA 1SO4A 5K7JA 4ADSA 4FX8A 1R46A 3LHWA 1SSDA 3R13A 2XFWA 3V75A 3W84A 4JYDA 2QAFA 2ZZ7A 1P4CA 2CLMA 1W8SA 2VFFA 1W0MA 2YPIA 4GXMA 1SPQA 2DZVA 3G0SA 3IEBA 4AWSA 2C19A 1W56A 1LBMA 3NQ7A 1GVSA 4O4WA 1SO5A 3E96A 3NYZA 3P74A 3P81A 3O6DA 2QJGA 1G67A 3HQ1A 7TIMA 3WK1A 3JS3A 4QM1A 1Q6QA 1M5WA 5FEPA 5A5WA 4CCCA 4LVBA 2E77A 4TIMA 4LS0A 5HINA 3IV3A 1R30A 3BARA 2ISWA 2PRHA 1FUYA 1U83A 3NXFA 3NQCA 1GVQA 3MJYA 4C1LA 1B4EA 5C2XA 4JNMA 2ZTKA 5D09A 2YYUA 3HIJA 2CW6A 1GG0A 3PG9A 4YCPA 3FFSA 4LUIA 4DF2A 4ML9A 3MWAA 4AH7A 3BW3A 4NUWA 1F05A 1J4EA 5AC6A 4DPQA 4NVTA 4ADUA 5FESA 4LVGA 3EWYA 4GBUA 3FLUA 2XN0A 4QITA 1FWSA 2VOMA 3CQ0A 3B03A 3EWUA 4LTSA 4N9DA 4I7WA 5I3IA 1QFEA 1ZCOA 1ZAJA 3M0ZA 5E93A 3BK0A 1X1ZA 1CI1A 4EF8A 2C1HA 3CLMA 1TTIA 1O94A 2F7FA 2CWNA 2QUUA 2QCMA 4ADTA 3PB2A 1YPFA 3LCLA 5D2XA 1I2RA 3O63A 4QQ3A 1K03A 1M6JA 3LCXA 1AW5A 1ICQA 1Z48A 1R2SA 3QEZA 4JTIA 4IX2A 3F03K 5EBUA 3T40A 2J88A 3Q2DA 4FNPA 3MYPA 3TAOA 1I2PA 4FNUA 3NL2A 4K7VA 1T8XA 3G1YA 2GQ8A 1OVDA 2DJXA 3W7NA 1C29A 3GXPA 3MP5A 3DHDA 4NX5A 3DFTA 4O0KA 2WPBA 3E49A 5L6UA 4ORMA 4LUJA 4MYXA 3M44A 3V1PA 3STGA 1XBYA 4KWWA 3RMJA 3KVLA 4MLJA 4UMBA 2F84A 5K4XA 5I3HA 3EX3A 1IXNA 2DJLA 5HULA 1VCGA 1KTBA 1KM4A 3LERA 3TXZA 3UY8A 2A21A 4WY0B 2DZSA 4LT9A 1KFJA 2TRSA 5LNRA 4NZFA 1K3UA 4CNNA 1K7XA 3LRMA 3W1AA 1IXOA 5DELA 1OF6A 2OT1A 3QC3A 3W7CA 3ZR4A 4R34A 1OYCA 2Y6ZA 2D73A 2C6QA 5LNVA 3TIMA 3R5EA 5FF2A 4FIRA 1B9BA 1GVFA 5E0KA 5J5RA 4IGHA 4GUGA 4OE7A 2ZZ5A 1HO1A 3UNDA 2ZA2A 3WK2A 3UWWA 4M5PA 1LRTA 5HR6A 4ONVA 4UTTA 4AF0A 4N6EA 2KZHA 3G1AA 3W7MA 3JR2A 3T4CA 4NX0A 5EPDA 3IIZA 1OFEA 4QIUA 4TMCA 4JYEA 2G5WA 3O6CA 4BI7A 2IQTA 1FDZA 2EHHA 4JTSA 2E6FA 3TE9A 5HWJA 1DL3A 5AC8A 4UTUA 5CPOA 3DFNA 1GG1A 3MI3A 4LW7A 3BPWA 4MFEA 2Q3OA 4UFMA 3G1SA 1GWJA 3PUEA 4PC8A 5KITA 3CIXA 1ALDA 3PULA 1TPWA 3NQ2A 3W7DA 3C52A 4ICNA 1H50A 1VHNA 4OT7A 2GVLA 3DI1A 3LCHA 1G4SA 1AW2A 5ABTA 4N9CA 4IMGA 4O28A 1YYAA 3U2OA 2NXHA 3GZ3A 1VYPX 1TTJA 3C2VA 4AVFA 1LBFA 1TO3A 2H3DA 1ME9A 1H7XA 3QPYA 4FNRA 3MHUA 3LB0A 3FS2A 4UTTC 5AYYA 1RR2A 5FF4A 4JDYA 4Z0SA 2CFFA 2JK2A 3C2OA 3LLDA 1QPRA 1E51A 1HFBA 1WOAA 4JTKA 2X1TA 3LI0A 4Y96A 3CM4A 3SI9A 5HUOA 2NXGA 4O13A 1KBIA 1HL2A 3G1HA 1KLZA 2UV8G 1SW0A 3W75A 3BVJA 1NEYA 3C3NA 3GYEA 5F2LA 1B57A 1YPIA 3GDRA 3HB9A 1QPOA 1YTKA 5AFDA 1YADA 4Y6GA 5U4NA 3UXDA 2JGYA 3T44A 1S5TA 3EWBX 1F76A 1DV7A 2CZ5A 3PM6A 4DXVA 2BX7A 4LS2A 5FF0A 1NFBA 4A2SA 3EKZA 5CSRA 1PE1A 3PB0A 3NGJA 1S5VA 3N34A 5F2IA 2OCZA 3BG9A 3GR7A 4H3DA 1KM3A 6TIMA 3MI6A 3W2NA 4JIPA 2Z1BA 3MP4A 2X1RA 2NXIA 3LBMA 1W3NA 2A7NA 2DU2A 3GK0A 4U4MA 3QFEA 5D37A 3RF9A 3H54A 1PS9A 1U5JA 1WBHA 2C3ZA 3FEMA 1I2QA 2R91A 1SO6A 2QEZA 3WJZA 2ZRYA 3UZJA 2ISSA 1C9DA 2QAPA 1G4PA 1R2RA 3GNNA 2Y7FA 2G97A 2J9YA 2Z2UA 1P0NA 3G1VA 3CU2A 3LTSA 4RZ6A 3P84A 4N4QA 4DELA 2A6LA 4HNTA 2O7SA 4R7JA 1TV7A 1G7VA 3LCGA 4NJIA 2YGYA 3GLCA 1WYIA 1A5AA 1O95A 4JTHA 4YL2A 5D32A 4JTGA 3OBKA 3TMLA 4FHAA 4HIBA 2C0AA 2VEMA 5FI8A 2NLIA 4TU1A 1VPXA 3QZEA 4O18A 1Q6OA 3CB8A 3W9ZA 3DFPA 1QR7A 4CCDA 3L0GA 2DZXA 4K8HA 2FIQA 2OMAA 4D2JA 4WXYA 4UR7A 5F1VA 4UTLA 1BWKA 2Y7GA 2AGKA 4UMCA 1JUKA 1TTQA 1YXCA 4IMDA 1FQ0A 5U7SA 4UXDA 3LBCA 3L5AA 2B7NA 1NF0A 4FXSA 3P7YA 3TU9A 3A5VA 2XN2A 4M6VA 4CQ8A 1TB3A 1IIGA 3G3MA 3P62A 4RKAA 4W9TA 4I7VA 3ABQA 1MEWA 4DO4A 1VCFA 3SGUA 1SSGA 3HO8A 4WY0F 3PS7A 4RJEA 1NVMA 5FF3A 1ICSA 2P1FA 1N7KA 1F74A 3IIXA 3O07A 4QSHA 2YFNA 2Y85A 3NQ6A 4DPPA 4E2DA 5I3KA 3HGRA 3H55A 1H1ZA 4YWIA 1FX6A 3SECA 3AJXA 3NL6A 2RHGA 3W7QA 5AC7A 2BSLA 3BV4A 3LCFA 1UJPA 6ALDA 3TAKA 2YYTA 1SZNA 2DP3A 4L4LA 3BGGA 4CNOA 3LTYA 4UTMA 3TMQA 3W1QA 3A21A 4Q4KA 3SFKA 4KKXA 3DFOA 4FB7A 2VFDA 3S5ZA 3U8GA 2Z6JA 4Q32A 2DZPA 5KZDA 1K02A 1VYSX 1UASA 1VZWA 2PRLA 3TA6A 1V5XA 3S5NA 3C61A 3GDLA 1LLZA 3QMSA 3KVMA 3IRDA 4OV4A 2QCEA 1AMKA 2WNQA 3O6YX 1XUUA 5AB3A 4Z1CA 1GOXA 1OX4A 1DHPA 4O11A 2QF7A 3EWZA 4EVZA 5D2YA 5G4WA 1AW1A 3BW2A 2CLHA 3NQ8A 2JGQA 3NOEA 1EUNA 1EUAA 4Q33A 1SO3A 4S1FA 4DEFA 4NQ1A 3W7GA 3LX9A 1TPC1 4JEQA 3W22A 1Z42A 3IVTA 1RQHA 4UTJA 4NJKA 3EXSA 5G5IA 3GAKA 1JCMP 4X2RA 4UC5A 1QPNA 4AF0B 4XTDA 3MHGA 1H62A 3LHTA 2GJNA 3KVJA 3KRZA 2X30A 1UB3A 4RZ4A 3QQ1A 3L68A
chains in the Genus database with same CATH superfamily
3RYSA 1XYFA 4GNJA 1AD1A 1DQWA 1JR1A 3CAVA 1WPCA 4EXBA 3EWDA 4AYSA 4PUUA 2DT1A 4V28A 2OZ0A 4DVOA 1QNSA 4O17A 1YTDA 1LOQA 1N8FA 1CB7B 3D46A 2NQ5A 1MQQA 2VEKA 3WIJA 1FHVA 2Y63A 1EJXC 2F38A 3OTRA 1JYXA 1RY0A 2Y8VA 5HJXA 5CSUA 3VOGA 1E56A 2BHYA 3LPPA 3GM8A 2CLIA 5EY5A 4TVUA 2H90A 4FNSA 5K3VA 1SFSA 4LF2A 1FDJA 2Z1WA 3TQVA 3W7JA 3ZLGA 4B15A 2Y7DA 3QSRA 2OOFA 2QUMA 4JX6A 4K8EA 2X1SA 3F4NA 3N9KA 2HEJA 1I2NA 1JCTA 2A85A 3TZFA 1TPUA 4GKTA 2FTPA 1J5TA 1IT0A 3N4FA 5CAHA 3T9PA 5BRPA 4FEZA 3VKBA 1VFHA 3C3UA 3NPVA 3PBYA 4B5XA 2ZRZA 3IIVA 3U6WA 1CDGA 3BL3A 5F2GA 4BF7A 2F2KA 3G0UA 1J0IA 4ORIA 1P7TB 2XSBA 1QOQA 4G7EA 4ZMGA 4C6BA 1OD0A 2Y1HA 2EEXA 3QR0A 1DE5A 4AD3A 5GPRA 3E9AA 1V77A 5BOOA 2D69A 3OIHA 3QBUA 5DXXA 4XVDA 1R0MA 1RBLA 3CQKA 1VS1A 1M1BA 3P8JA 4UQ9A 1TX2A 1BF2A 4O15A 3WQ8A 4CN4A 3WF0A 3I6RA 4GY0A 2TPSA 4PUWA 3S1WA 2GJLA 4H7CA 3EX6A 3OU8A 1B3ZA 3E0WA 5HUPA 3GTHA 4KCUA 3WCZA 3EXTA 5FIPA 1OFOA 2WKLA 5A3HA 3M0LA 1V3HA 2WV8A 3F5LA 3O16A 5BRBA 5HNUA 1EEPA 4QGCA 3BLDA 2OX1A 3NUKA 1YBQB 1KFCA 1ZQ5A 3DHPA 4E4PA 1PZ2A 3LXBA 3UBPC 1S2WA 2Z6IA 3G6MA 1OZMA 3DG6A 1EX1A 1IYXA 3UXAA 2PCQA 2WOQA 4HNCA 3WLHA 2W66A 3WBYA 1D9EA 1LQAA 1JCYA 3SCQA 2CNCA 2WO5A 3BLIA 1R7OA 2HPMA 1OT1A 3S6DA 4XAPA 2FB3A 3CL8A 4GCAA 2PGRA 4N9BA 4BQ2A 1PBGA 3M0VA 1VEPA 3BGJA 3SM0A 2X42A 3BAKA 1W3TA 4FXRA 3GXTA 1Q6DA 1QNQA 2REQA 2DW6A 1ZB5A 1KFEA 1PIGA 4A2RA 3N4EA 1NWRA 4YVVA 3WLIA 2Y5SA 2FPYA 4KEMA 1AL8A 4LYRA 5JU6A 3W24A 3QRHA 5CJ5A 2I9EA 2OX4A 1DIEA 4JTDA 3B4UA 1CZ1A 1F9CA 3GNRA 2OODA 3VGFA 4R7WA 1ISXA 1OFAA 3UJ2A 1PL9A 3TUUA 1CGYA 4V2XA 1FCQA 2XIIA 2QQ6A 1S5MA 1QK2A 1NH6A 1B54A 2ZWZA 2W79A 3E0LA 3N19B 2D20A 1DJQA 5CZKA 3UR8A 1YDOA 1ECEA 1TZ7A 3CUFA 3L4UA 3AXMA 1KA9F 2Q8LA 5G2WA 1VYRA 1XRSA 4CQ9A 4QDPA 5EFFA 3C2FA 1OX4B 3F4WA 2VRQA 2BLEA 1T96A 3PZGA 4PRWA 2Q01A 1AZ2A 3TEVA 1OGSA 1UKSA 1IWPA 4AHQA 1A5OC 4QEEA 2TYSA 1YXDA 2HE8A 2JIEA 2GSHA 1K8ZA 4QNEA 4UOQA 4B5NA 1ZJAA 1VD6A 3GS6A 2R94A 3KBSA 3OZYA 3M0JA 3BJSA 5BOEA 2J6XA 3AFBA 3P2VA 3USBA 1Q6CA 3E02A 4GGBA 3CMGA 3TV8A 4FF7A 3NZGA 3BV7A 1XG4A 2W62A 1JL8A 2GGEA 5I02A 3WDRA 3BE7A 1FRBA 5CLWA 1CXIA 3K8MA 4P61A 3GG0A 4C5ZA 4R5EA 2PZNA 1UKQA 4N2YA 4KPLA 2CC0A 4MNKA 5CEWA 2VWSA 4MKNA 3S2NA 4GGHA 1HJUA 1EO5A 1QWGA 2C1IA 3BO9A 4OHQA 3CZEA 3APGA 3TC7A 2ZE0A 3RLHA 4A3QA 4H9UA 3VI2A 1M3UA 3C86A 1YTEA 2PTDA 4WEVX 1C8YA 1FWCC 1GT8A 1E4IA 1SYTA 1W1TA 3UESA 5L9FA 1HG3A 2VZVA 5DFAA 1E3ZA 1BQGA 3T0TA 2HMCA 4DWSC 3ATZA 3LMZA 4CEXC 1DE6A 5AY7A 2E7FA 3W01A 4HNVA 2YCLA 1KM5A 4YTRA 2E68A 3EKGA 1B30A 2QUNA 1BKSA 1UROA 4JY8A 4ZQOA 1R47A 1Y0EA 5I7GA 4KWOA 1MZHA 3GVGA 2WZMA 1BPLB 1UD6A 4IGMA 4QG9A 1GEQA 4DJDA 4IIDA 1IGWA 3BURA 1QCWA 3TSDA 4W93A 4WGXA 4Q8TA 3E2VA 3EOOA 3PN8A 1UPMB 1GVRA 1XBVA 3NURA 3TQPA 2RDUA 5M5DA 9XIMA 3TW7A 1DTNA 4LRSA 3QKEA 3B8SA 1UWRA 2VEPA 4XZWA 5I77A 1XLGA 2Z1XA 4AEFA 3PSWA 4OKDA 3CBWA 4LNYA 3L9CA 1M01A 4JTJA 2JE8A 1ME7A 4N6FA 1BSIA 1BWVA 4HB7A 4ZB2A 2VC7A 1RVKA 2ATSA 4F8XA 3ZJ7A 4GUFA 3EB2A 2E6DA 3S1XA 3UG5A 4CGTA 3TC6A 3R7MA 3CB3A 3ARSA 4JKKA 3R94A 2PP1A 3A4WA 2X16A 3NNTA 4Z1AA 3NJ3A 3I3EA 5JVLA 1ZALA 4KGLA 3WDIA 3U3HA 2E40A 5DMLA 2PD9A 3QMRA 4DAFA 1K9TA 1L8PA 3RR1A 2V5JA 1KRBC 2OFJA 1XD0A 3WD1A 5GQBA 5BMXA 3CZ8A 4D6FA 3V18A 2GVJA 3V3WA 3ARQA 3GAYA 1XH2A 1JZ7A 5CJMA 2YSWA 5CZTA 1A0CA 3B0UX 7XIMA 2BP1A 3ONCA 1W17A 4MDPA 1X1NA 4DXXA 3VGEA 1LM1A 1ZBVA 2ZTJA 2H3BA 3I4KA 2A3LA 4DAIA 1XIEA 2VR2A 2BXVA 3FY1A 1F8MA 3FHAA 1JPMA 3PUGA 1PIIA 4E38A 2AGTA 3W7EA 4DBSA 1H2JA 1NDZA 8A3HA 4U3CA 3VC5A 1QMLA 3H53A 1WV2A 5HATA 4H41A 1UP0A 1TVPA 3L7RA 2CESA 3WLSA 2J7GA 3WNPA 1KM0A 2J9XA 4DO6A 1A50A 1F7BA 2V38A 1C8QA 1FY6A 3C2YA 4DLFA 1P1XA 5BMWA 2CZEA 4LUTA 2CXGA 1RPKA 5D8WA 1H49A 3M0IA 2DVUA 3OQEA 4A29A 1OIMA 1NARA 3CS2A 4NHVA 3HA1A 4ZQPA 5ECVA 5AECA 2IKHA 3BG3A 3O9NA 1OCQA 1VJIA 2UZ9A 7REQA 2X0HA 1GPWA 2WWDA 1KD0A 3CPRA 3VAVA 4KFOA 1EB3A 4PYSA 2UY2A 2GQAA 1AA1B 4TTUA 4DBDA 3SRKA 3VKDA 3I68A 2I16A 1PSCA 2WB5A 3QOMA 3GH5A 3PP7A 3R8GA 4UFJA 3BGAA 4IFKA 4PUMA 5IBXA 3SO7A 5TF0A 3N3MA 4D6JA 3L21A 1YLVA 1XLLA 3WJSA 1H7RA 1HJWA 1PIFA 4J9JA 3NSNA 3IIOA 4GZEA 1F6YA 2VKZG 3VIHA 3WQWA 2QR6A 5LSMA 5FAJA 3KHDA 1WZMA 5AHEA 3ZQ9A 3EZ4A 3W7KA 1TV8A 1XYZA 2O9OA 4HSOA 4ZB0A 3AO0A 2ZZ4A 3OLIA 2V5LA 1JNDA 2VZOA 3E12A 1M9HA 2PDYA 4PBEA 4HPNA 2Z2AA 3VD4A 5F1UA 2A79A 2X2GA 4EP8C 4BQ3A 4PL2A 2D3LA 4KFNA 4WGHA 1PHWA 3IGSA 4WDWA 3CPUA 2PAJA 5AC5A 4LEQA 5TAOA 3S6OA 3V0UA 4OJYA 1OCNA 2PEVA 3S1UA 3T7VA 1WCGA 4HK7A 4UZUA 4DYEA 4O1FA 3NL5A 1NM9A 3OB8A 3UYCA 3CEUA 2YA1A 1TTPA 3PPCA 5BOFA 3ZT7A 3R10A 1Q2RA 3BAIA 1T7LA 1GZJA 3VX0A 4Y90A 2YDRA 3T6CA 5DCDA 4HU4A 2I1OA 1VLIA 3P8IA 5AHFA 3VDHA 5M1TA 2NQ9A 1EP1A 1H60A 3HGOA 3BLPX 1D7FA 2RGLA 1B1YA 2YIHA 2B0MA 4EK7A 1X7FA 1VPQA 4M7TA 1O60A 1GOIA 4RDZA 1RZMA 1O12A 4W85A 4AMCA 4IWWA 3HG4A 3OZMA 1GGOA 4ES4A 2ON3A 1LRNA 5A6KA 3O05A 1LL6A 3PBWA 3UETA 1UKOA 2J78A 1OIFA 3DYOA 4PTXA 5MKGA 2VFIA 4PCSA 2O4QA 1WKFA 3ABRA 5HXMA 1E4LA 1Q6FA 1PZ1A 3NA8A 1KM1A 1ENUA 3NZRA 4A21A 3V5OA 3N11A 2UY5A 2WQDA 3BAXA 5CAKA 4D6GA 4JFWA 5E70A 3RGTA 2QUTA 4PMRA 3ME3A 4ZQNA 4LCRA 4BEUA 2AMGA 1JQVA 4M8UA 4ZE4A 5LA0A 1A80A 3FKRA 3ITGA 4M19A 4XAZA 3QJAA 1M7JA 1MW0A 4Z1BA 4DBUA 1VJSA 3VGHA 3E2QA 4B4HA 3F4DA 1S2VA 4HCHA 4ZB5A 3VNMA 1S2AA 4Q4PA 5B80A 2JEPA 3NDYA 1LTDA 4R7OA 1OG0A 2ZRXA 2C14A 2ZDRA 3CHVA 3CZLA 2WANA 3NL3A 5AYZA 1S5WA 1M03A 1TV5A 1EBHA 4C6PA 4UOJA 1HTIA 2BY1A 1NP0A 4ZVJA 4LWWA 2ACSA 2FZNA 1PX3A 1F3EA 2OTDA 2QCLA 5IHSA 1EDTA 4LBRA 1LLOA 1L2UA 1V0KA 3AZTA 3MANA 2DW7A 3WQFA 5DO8A 4X9SA 1QOXA 3VUSA 1GVOA 2FFCA 3UWYA 3WFAA 4PMOA 2EF9A 1Q7ZA 2WQPA 2P3ZA 2I5GA 3DC0A 3WEZA 1EQPA 4AIBA 1VHCA 5RUBA 2PWDA 3W2KA 3SGGA 2QF8A 4ATDA 4PFHA 4MVAA 3RX3A 1L6WA 3D3AA 3CUHA 1V3IA 4HTBA 2VTFA 3Q4DA 4REQA 3NQFA 4O1CA 4OIFA 2BGSA 3ZO9A 2QKFA 2ACQA 2HXTA 3PSVA 3DG3A 4A8IA 4F2BA 1ONRA 1DQUA 3ZSTA 2YXOA 2P8BA 3HG5A 2D1ZA 3BSGA 2PGEA 4MNJA 2OLHA 1BEUA 1JZ4A 3TYZA 5CC6A 5AHIA 1OYAA 3KBVA 4PB3A 1JFHA 5FACA 3I65A 1QOPA 4ZOBA 4KWVA 4PUEA 1TUFA 4FPSA 1KGXA 3TOPA 3VUPA 3G6LA 3EWXA 1I4NA 3PG8A 4LRTA 4S3AA 1KRMA 1FTXA 2J4GA 1V08A 2GOUA 3WQCA 3DEQA 4WY0A 1QU4A 2OPJA 1JZ5A 4LXFA 4PRTA 3ARRA 1BXNA 2PTWA 2YLAA 4ZQCA 3GNPA 5KINA 4DJED 1ITUA 3FXGA 4XZBA 4GISA 3MV11 5D2TA 4O54A 3OA3A 2DQWA 2EPNA 5DBUA 2GDVA 1TQXA 4I9JA 2X40A 4JIRA 3REQB 3NVDA 3KWSA 3B8WA 3IGUA 1L9WA 3A9BA 4E2VA 1V3LA 3ITXA 4UIOA 3RNDA 4J3VA 1B3XA 3FEQA 4Q6JA 5DF0A 1SZFA 3W7RA 1TQJA 3W73A 5K9CA 5EMLA 3RO6A 4ZO6A 3MHFA 1UR0A 3LXAA 2CLOA 6PTDA 3ID7A 3S9ZA 3S6TA 1EKOA 1EHAA 2I7GA 1YE4A 4FX6M 1U33A 3WUBA 5TNVA 2WZIA 2QDGA 5E5CA 4MB4A 3G8RA 4GRSA 1JRBA 4DJFD 5HQMA 5I78A 4A6GA 2D22A 2GYIA 2AKMA 2EKGA 3MUZ1 1THFD 1WNOA 6XIMA 5CG0A 4GWEA 4AWUA 4B3ZA 1Q85A 4NASA 4F9JA 3W29A 1TV3A 2GVGA 2W92A 3CV1A 3KBJA 1KCLA 2HE5A 4G56A 8XIMA 4IQDA 1I60A 2PZ0A 3HPXA 4XZMX 1XICA 3M0YA 3CNYA 4IUOA 1MNSA 4MF4A 1BYDA 3R89A 1B3WA 4CQDA 3H2AA 3E2RA 4MWAD 1GYNA 3K13A 5GVJA 4LOCA 4ZFCA 1WXJA 2IKJA 4MFDA 4DXKA 4KMQA 1Q7QA 1XWYA 1WE5A 4GH1A 2BVYA 3IJ7A 4E0CA 3TTEA 2UY3A 4FF5A 2IMRA 3THDA 5H8UA 4BI6A 3G1XA 2V68A 4XUGA 4HNUA 4CEUC 2NX9A 4OWGA 3B0YA 4LX4A 3T55A 2PDBA 2PDIA 1IR1A 3T78A 3ANYA 2WMJA 1MW3A 3SUUA 4P2VA 3SSZA 5LIXX 4ZZ9A 4JTRA 1TWSA 4GX9A 2OJPA 2XIBA 3HOJA 1VGAA 4Q7NA 4HU8A 4AZ7A 4WKFA 4ADSA 4D72A 4FX8A 2P53A 2DPEA 4JYDA 3ABZA 2BY0A 1RLDA 3B40A 2YPIA 1E6NA 1GHRA 2DZVA 5FKYA 3A6OA 3AYVA 4HP5A 3TYBA 3PJUA 3NQ7A 2WKGA 1GVSA 2ONEA 3QTPA 1VFSA 1G67A 1HJQA 4HNOA 3JS3A 1Q6QA 1OB0A 1M5WA 5FEPA 3VIKA 4LVBA 4TIMA 4A4AA 4U2ZA 4LS0A 4X63A 3M07A 3BARA 1U83A 3NXFA 1JZ2A 1UKTA 3VDBA 1RBAA 3AISA 8RUCA 1PKLA 1W1IE 1J6OA 2FVMA 1XINA 1OWQA 1GOMA 2VZTA 4LUIA 3TN3A 4AH7A 3BW3A 1ISWA 4ADUA 4LVGA 1CGUA 2ZUWA 1US2A 4GBUA 3TR9A 3B9EA 1KB3A 3CQ0A 3EWUA 1MZRA 3UJRA 3QPEA 3OYZA 2PGWA 3ES8A 2GUBA 1ZAJA 3M0ZA 1QXLA 1CI1A 5DT7A 4GXPA 1A4LA 1J18A 1H0IA 3A4AA 4LB4A 1ZP4A 3LM3A 2CWNA 4WLCA 4GVHA 1REQB 3PB2A 1PDZA 4M6UA 3LCLA 2R1LA 3VIOA 3WUGA 4NAFA 4XIMA 3QEZA 4Q8UA 2ISDA 1JAKA 4R27A 3T42A 1US3A 4LUSB 3T40A 4REQB 4GVIA 1ZL1A 1BVWA 3TAOA 1QI2A 4GA8A 1I2PA 1T8XA 4QE5A 3TCSA 1C29A 3GXPA 6ENLA 1P0EA 4W89A 3DFTA 2XFFA 3WH7A 5AZ1A 4ORMA 2X7WA 2DH3A 1G9HA 4HN8A 4KWWA 3RMJA 4MLJA 1EYEA 1O1HA 4UMBA 5K4XA 3EX3A 1EXPA 1LJYA 3E5PA 3SCRA 4AFYA 2DJLA 4B2DD 1VCGA 3CL6A 4I5RA 3UY8A 4H8UA 4WY0B 2BXZA 4ILSA 5LNRA 2ESCA 2XIOA 2YBVA 3W1AA 1OF6A 2OT1A 5FL1A 2XPKA 4HHMA 2D2HA 4AIUA 3QQWA 3ZR4A 4NIRA 3ITCA 4PCPA 2GZXA 3WX7A 3EDEA 3R5EA 3QOKA 3BLOA 1GCYA 5CC7A 3IAQA 3VABA 3GFYA 1R3SA 4BKNA 1HO1A 4BS0A 3KL5A 2E8YA 3SDOA 4ONVA 1K9EA 1CXKA 3AUJA 3PBMA 3SN1A 1UD5A 3ZVHB 3OHMB 4GIRA 1VFOA 3M0MA 2GGIA 4BI7A 5JBEA 3R11A 4JTSA 4PTMA 3KDNA 1R38A 4G7FA 4HTYA 4P7RA 1Z89A 1GG1A 1FH7A 4LW7A 3BPWA 1TX0A 5BU6A 3GH4A 3TYEA 1TPWA 1EGMA 4R3UA 1CCWB 1Z32X 2YB4A 4YTUA 4IFOA 3DI1A 4RNJA 5A2BA 3VKCA 4O28A 1YYAA 3UR2A 1U5HA 3C2VA 3KUMA 4E4FA 5BXSA 1ME9A 1X8CA 3HMCA 3AHTA 4GVGA 2G37A 3VA8A 3VO0A 4JDYA 5CPQA 4FK9A 3KZSA 3LLDA 3K4WA 1DIDA 2F2HA 1UOZA 1E51A 2D3NA 1XCXA 4MAZA 7ENLA 2H9AA 3PZNA 5BXTA 4O13A 4F0RA 3WG6A 3WD2A 1RXOB 1SW0A 3W75A 4AXNA 4D8AA 3GYEA 1B57A 5I24A 3GDRA 1D7KA 4ERGA 1QPOA 3CV6A 4M81A 1YADA 4Y6GA 3UXDA 4H2HA 4DXVA 4LS2A 3TTYA 1NFBA 3EKZA 3PB0A 5F2IA 1XX1A 4B16A 4H6QA 3GR7A 4F0MA 4P7QA 1KM3A 2INZA 1ZCCA 4XZLX 2Z1BA 3MP4A 3WLNA 4JFSA 2QNEA 2CETA 2G3FA 3LGGA 2PDGA 1I2QA 2R91A 1SO6A 4M56A 2CERA 4AVNA 3NDZA 2ISSA 2OR2A 2C1GA 3GXFA 3GNNA 5C8BB 2PMQA 1UMLA 1WDRA 4RZ6A 3P84A 4N4QA 3MUAA 4DELA 1GYMA 4R7JA 3E74A 3LCGA 5DT5A 4JTHA 5HA7A 3CUXA 4CUCA 4YL2A 3IK2A 3OBKA 4ZSUA 2VX5A 1FP8A 2C0AA 3U7VA 3DECA 5FI8A 4TU1A 1VPXA 1B5TA 4O18A 3GC5A 1EPVA 3CB8A 1XLAA 3W9ZA 4HMCA 4Z42C 1UC5A 3GYCA 4CCDA 5I0DA 4JNZA 1VEMA 4K8HA 4UR7A 9RUBA 4RE2A 1DXEA 5F1VA 3R43A 2P76A 1ZJHA 4NSBA 1JUKA 1FQ0A 2AQOA 1O5RA 4YWSA 3P7YA 1R6WA 4D6HA 1ELSA 3A5VA 4GIYA 4CQ8A 5HQLA 1IIGA 3G3MA 4QTGA 1GPFA 4W9TA 2J7FA 2YOCA 1MEWA 2GWGA 4NZ1A 2O9PA 1BRLA 2RUSA 3MSGA 1E15A 4NG3A 2DZBA 4WY0F 4YYCA 3MQTA 1OC7A 4Y8EA 1NVMA 3GE7A 3HPAA 2PP3A 2WLZA 1KQZA 2P1FA 4QFUA 3GFXA 4DPPA 2JF6A 1MW1A 1N8WA 1HGYA 4XAFA 3BUVA 1IEVA 5FJPA 4AZIA 1FX6A 2GJPA 3SECA 2FVLA 2BSLA 3MVTA 5DX7A 4BF5A 4UWMA 2YYTA 4ZA0A 3GW0A 1SZNA 2DP3A 3DDMA 3I6EA 3A21A 3SFKA 3DFOA 3GXMA 3S5ZA 3EOLA 3WFLA 1FP9A 3HM7A 2GSEA 4ZOEA 1TE6A 3KOZA 3TA6A 4N7QA 1JYWA 4XD6A 3C61A 3GDLA 4Z2JA 3IRDA 3GG7A 3DC8A 3LUTA 5I07A 2QCEA 4JFVA 1PYMA 3LPFA 5AB3A 4H2CA 4RDVA 4ZXLA 1C7TA 4EVZA 1AW1A 2OLAA 3BW2A 3VXGA 2V3GA 1EUNA 1AJ0A 5EFDA 2FTWA 4S1FA 4NQ1A 3SCUA 2BVWA 1J10A 1AMYA 3K8LA 1BSLA 4CVWA 1PEZA 3EXSA 1G1YA 1XIBA 3U2EA 4WKAA 1GORA 1VBRA 3BWWA 1T8QA 1V6WA 3RCYA 2E67A 3C5QA 1UB3A 4A3RA 4ZGYA 1G7UA 3I7QA 2ZRVA 2YW4A 3ARTA 4OU1A 1GKRA 1Q3NA 4JIQA 1E1CB 4NXKA 2QVNA 2OXNA 1W5PA 4WSJA 4TX8A 4GI9A 4JPGA 3VTRA 1W2PA 2JF7A 1KKRA 2PDWA 2VFHA 3OVPA 1Z6KA 3GC2A 3C0JA 1XSIA 1WAUA 1XDLA 3RCMA 4YXGA 4NT0A 4FLSA 4JN7A 1JAEA 4H04A 4WDXA 3G18A 2INFA 3VOJA 2ZOXA 3GDKA 3NQMA 4HPJA 1LDCA 1K1DA 1TZZA 4RPPA 2J7CA 1FHLA 3OGVA 4L65A 1TR9A 4I7UA 1N8IA 3TSMA 3KBMA 1C8VA 1GOWA 1ICPA 2DIJA 4TVCA 1ISVA 2GGGA 3VD5A 3PFMA 3RRAA 1J11A 3MUIA 1W9PA 3JRKA 5AYXA 1E72M 1H7OA 1IXPA 1E9LA 4NZ5A 4DJFC 2WVVA 4WSHA 1ADOA 4EX4A 1XUZA 1UA7A 4HQVA 5BWAA 2VI0A 3B0PA 3TJIA 5CQ1A 1J0YA 3S3GA 4WJXA 1WDPA 5D05A 3WL0A 1O5XA 1ADDA 4YMZA 1BVZA 4JKLA 3NM1A 2Q8XA 3V0SA 4POCA 5JIWA 3NPWA 1J2BA 1OGGA 4V1YA 2PF0A 1LBLA 3ONBA 1LUCB 2R1PA 5E0FA 1CLXA 4G8TA 4RNHA 4GQRA 4C6MA 2I5QA 3QGAC 3UGRA 5FJOA 2C18A 1C9WA 2YL9A 2YZRA 3KS6A 3TK7A 5I23A 1PKMA 3UVAA 1PJ9A 4U3AA 1BYAA 4R53A 2G41A 2ZQ0A 4KETA 2BGQA 4GFIA 1ODUA 3P6LA 5F4SA 4HU0A 3IK4A 2Y5EA 3IV8A 1VLWA 4W7WA 3UG4A 4QR6A 1GUVA 3TVAA 3UZYA 4H9MA 2J77A 4M24A 4RDYA 3NVTA 3ANVA 5BRQA 4J1OA 3SN0A 3VKAA 3FSTA 3I3BA 1GZGA 3U48A 3GDBA 2E1DA 3Q58A 1XFBA 4E8GA 4HT3A 1DOSA 4S3KA 4XD4A 5AHNA 4EACA 1Q4WA 1WXZA 4O1BA 2VDHA 3I10A 2XFYA 3NQGA 4L1GA 3VM5A 2PWUA 3E0FA 2V8ZA 5CPMA 2FPTA 4FNTA 5CBJA 1UCWA 4LCSA 2NSXA 4UTIA 1XKJA 4S3EA 1JVNA 2A7RA 4MNMA 1E4MM 4L9ZA 4HPHA 3R12A 1X6UA 3EMZA 4K2SA 3LHVA 2WVTA 5C9ZA 1ONWA 4K6AA 1H11A 4F0HA 1QHZA 2V69A 2QHAA 4KERA 1DKWA 1V02E 3VNZA 3DESA 4GH3A 5H2ZA 3B8IA 2HTMA 2X8RA 3ZT6A 4QJ1A 2Z00A 5FSEC 1E0XA 1OY0A 4XAGA 4IMCA 4QG8A 2FH8A 2HXUA 2RAGA 3QGKC 3PJXA 3PPHA 1GKQA 3QYSA 2P8CA 3HV8A 5JH1A 3M6DA 3SR7A 3C4UA 4S39A 5AN7A 4WR3A 3EDFA 2GVEA 1ZFJA 3H2OA 1NOWA 1Q45A 4J35A 4B92A 4MLRA 2FMOA 1DQXA 3WQ4A 3TX9A 2PD5A 4H4IA 4JD4A 2WMGA 3N6QA 3V36A 1V02A 3NFUA 1IZKA 2IQ0A 4S38A 1TA3B 3VDCA 1CXEA 4C6EA 1VBHA 1JG9A 1BHGA 1R2TA 3B06A 2YW3A 1JDCA 4PMVA 1XDJA 4MY8A 3KX6A 2RDTA 1MXDA 3B0VC 4DUWA 1TPEA 1LORA 3LI1A 3M41A 2B4GA 1KFLA 2PDQA 2J62A 3B04A 5H91A 4YNGA 1E71M 4S3DA 2G0WA 3W2UA 3PBGA 3SCOA 1FXQA 1A49A 2ZUSA 3VNJA 1UUMA 5DBTA 1J12A 4RX0A 3PZTA 1TMLA 3VD9A 1MDRA 4W86A 5H1WA 2ALDA 1RCOB 3QYQA 2ZZ2A 4PODA 4U2YA 4E3TA 3QHNA 2ZKMX 1GTEA 3A24A 3MSDA 4UUIA 1Y5XA 4PMDA 4S3FA 4J2MA 1RA5A 4DO5A 3NQDA 1UR8A 4AEEA 3SZ8A 2PTYA 1DIOA 1DPMA 4HNNA 4BCEA 1I9CB 1Y7VA 1XFCA 3R25A 4X22A 4QROA 3E5BA 2FJUB 4XTIA 2XSAA 3EXRA 4PL1A 1EGVA 1VIZA 4DJDD 1QVBA 4GYPC 3IUDA 4DWSA 2TSYA 1QUMA 3KAOA 1AODA 1HP5A 3WQDA 1F4AA 4C1KA 3KLLA 1LG1A 4B9YA 3H21A 1I8JA 4BF9A 2NWSA 2XSXA 4MMWA 1CNVA 4LVAA 4QX4A 2BWGA 4UTHA 2V67A 1ZSXA 3MKCA 3ZS4A 1PV8A 1AZ1A 2V5KA 2OQYA 1DXIA 2WCSA 2EPOA 5ENLA 1EA0A 2DT3A 4C6QA 4PN2A 2R8WA 2EJAA 4O52A 4EIVA 3TWAA 3QPZA 3QMTA 4US5D 4YHEA 1WO2A 3FSUA 5M17A 3QV9A 1LF1A 3CQIA 1BKHA 2XH2A 3TOYA 4ZO9A 2ZE3A 3CIWA 2ZRWA 3A5FA 5A6BD 2WSQA 3AYTA 3B9DA 3N15A 5G4HC 2CWXA 2BDQA 2ZA3A 4YJ5A 1BYCA 4UQDA 1C92A 2Z24A 1NDYA 4BQ5A 4Q8NA 1OZQA 4LF1A 5C2GA 4DQWA 3M16A 4IIFA 1U1JA 3W27A 4LAKA 5AVNA 2Y89A 2CLEA 1FWTA 2IUZA 1U30A 3FKKA 4F3HA 2FHCA 4CQCA 1OHLA 1EDQA 4TXEA 3MBFA 5KTLA 1RSCA 1XQLA 3RMEA 4AZ5A 3RX4A 5E9AA 1PKYA 3THUA 4O1DA 4FALA 1OFPA 2VEFA 4U33A 3HN3A 4JL2A 3FGCA 4YTQA 3KTXA 1UKPA 3P0WA 1UW9A 2ZX5A 4PMJA 3URQA 1HNYA 2V81A 2X05A 4H6KA 4DRSA 4XUYA 3R1ZA 4C6KA 3CLWA 4Y9OA 1ZNNA 4R33A 3VDAA 4BHYA 3K4DA 5IDZA 1TCDA 1JUEA 1W6TA 2D0HA 3LS9A 4F0SA 1VCVA 4CNTA 4L61A 3W2JA 3WF3A 1ZAIA 1H5YA 2R1NA 1LWIA 3DUGA 2B7QA 3OO2A 5I06A 4ICMA 4JX5A 3W2MA 1Y65A 4LYKA 2WHJA 2DFAA 2GJXA 2XYLA 1ZENA 5LGXA 3O1NA 1JI2A 1JXKA 4Q8PA 1X8FA 2SFPA 2DT2A 1GQLA 3MI2A 5T26A 1MMFA 8TIMA 3WDQA 3AZRA 3MMTA 1CGVA 5D33A 4AG0A 3ARVA 4IG2B 3OZOA 1WQ5A 1A5UA 5J04A 1DJWA 1NOFA 3OOQA 1JUBA 1KLYA 4F9DA 1T6MA 4Z1DA 1Q65A 3T1GA 4P8VA 3MS8A 1CENA 1P6WA 1JULA 3APYA 4PGLA 4O1EA 5T8GA 3W1LA 3D0CA 1MVYA 5M3WA 4XK2A 5D9MA 2WKJA 3NO3A 3CWHA 2HZGA 3TQ0A 3K30A 2VGFA 1DHKA 3R2GA 1W5OA 4IMFA 4PH6A 1KCKA 4CN1A 2ZZ3A 1TE1A 5M03A 3EPMA 6REQB 3W1TA 3UZ5A 4ZR8A 2AL1A 2Z25A 1OD8A 4FOJA 5GJPA 1A53A 3ALFA 3LV5A 3WJXA 4GG9A 3U4AA 2NT1A 1XLCA 3LZ3A 2DSWA 4MADA 1UBSA 4RLIA 1QRQA 4UBPC 3W3OA 5DCEA 1XIJA 4N4PA 5C9WA 2GK1A 3CQJA 2NUXA 2VYOA 3DAQA 1XLIA 1TSIA 5TBOA 2FFIA 4ZBCA 5FJIA 3DCPA 4PCFA 3KE0A 3WD0A 3B8DA 2QCDB 2QJHA 3G24A 3OPSA 3UVIA 5SWUA 2EQDA 2O92A 4HJWA 3TNOA 3P14A 5DRIA 3JUGA 1XLMA 1AH4A 3V5FA 3THAA 3VIFA 5GNYA 1L6YA 3AIRA 1QBBA 1KRAC 1NWTA 4LH8A 3RLUA 3W86A 3QHOA 1KNWA 3M5ZA 4KW2A 3SIZA 3EDDA 1XCWA 3BOFA 2YX0A 2OZTA 5A8NA 4MJMA 3IARA 3N2XA 4ZEPA 3S9YA 1CPUA 3TCEA 1Q6GA 4UFLA 2ICSA 3T8LA 1YNYA 5ABFA 2VC5A 2XVGA 3GXNA 3A3WA 2L5HA 3N3TA 2Y88A 1CB2A 3R6IA 1IIHA 1CX9A 4MPQA 2YDQA 3ITTA 4UB9A 3WBAA 3THQA 1J6PA 2G95A 1E6XM 3WSUA 2A1YA 2YDAA 3Q65A 4QLLA 4L6HA 1J0JA 1I2OA 3WQOA 4HMNA 3L4ZA 3R4IA 3TC3A 4U28A 4AIOA 2CBUA 2OU4A 3L65A 2B7PA 3GH7A 3Q67A 3GNDA 2R6OA 1JCJA 1EZ2A 3OIXA 5A94A 4P7NA 3R8RA 2VGBA 4JYFA 2GUUA 2VMFA 1O4UA 4P8UA 1OT2A 4LV4A 1S2CA 1UUOA 3L23A 1VH7A 2WJDA 5K2ZA 4AC7C 5I5RA 4M7SA 3W07A 3COTA 3ZWTA 2VD8A 3OG2A 5LHFA 4PSRA 5BXPA 1JCLA 2NUYA 1KXVA 3WDHA 4JHMA 3WD3A 3S0CA 2Z0IA 3QR3A 3J7HA 4OZOA 1DXFA 1RQEA 1Y5WA 5I3DA 4LAOA 4AZCB 4O0ZA 3K4AA 2WSRA 3M6YA 3FOKA 5CC3A 2VJXA 4JL1A 2O7QA 3CUGA 3W7OA 2OEKA 3GHSA 4LCQA 1UR2A 4NZ4A 3STCA 2Y7EA 3DKJA 3LU2A 4XQ6A 1TPFA 1K7EA 2QIWA 1GQJA 3H23A 1OFBA 2XG9A 1F6PA 1SFLA 1DORA 2FZMA 5CPLA 5XINA 4M6PA 4QISA 1XISA 1PTAA 4AHOA 1DEDA 4IM4A 4ZQRA 2PDHA 4CD4A 5LHEA 3ES7A 3FYPA 4C60A 4L7ZA 4BFAA 2VX7A 4H7ZA 1ZBCA 1WKYA 1JRCA 3GY1A 2XWEA 3GIYA 3S5YA 3WQ6A 1I45A 3SSJA 3QHMA 4HKPA 1H7WA 1EP2A 3TROA 1K6AA 3DZ1A 1KXQA 5FL0A 1EEXA 3S5SA 4GI6A 3PTMA 1W1ZA 3F2BA 1MWOA 1I1WA 5JIPA 2PE4A 3GTIA 3CUJA 5BU9A 4TR9A 1E5NA 2WHKA 2A6NA 1EH9A 4LANA 2A7PA 1HQTA 3GKAA 3N1AA 1B9ZA 1G4EA 1C90A 2HV5A 4O14A 3KHJA 3W71A 3I6TA 1Q6RA 2A3HA 4BWLC 5A6TC 4S3BA 1CECA 2VR4A 4XKYB 4FO4A 3DXIA 1ADSA 1CXHA 2CKSA 1KBJA 3CXOA 3HV9A 2LLEA 2Z26A 3V4BA 5DMMA 4M82A 1ZPTA 3PWAA 1HIZA 3W70A 3IJ6A 4O4VA 3W6YA 4WUIA 4P8WA 3EAUA 2V3DA 5DXYA 4C1NA 4EE9A 4IJRA 4JS3A 1L6GA 1V3KA 1UWAA 2GFTA 1FCVA 2BODX 2VZUA 4TX9A 2FZ8A 3N14A 3UQNA 2QXWA 1XBXA 3BH4A 5EMUA 3E1F1 5FJTA 4N02A 4EF9A 3GG1A 3MCOA 3P67A 2WMIB 2XUCA 2O9TA 1J01A 5G4EA 3MP3A 1IT7A 1QK0A 4DF1A 2CU0A 3PJTA 3GU1A 3C8FA 4I5XA 2QS8A 1GK8A 2J75A 2C79A 4GC4A 4N9EA 4AZHA 4CD6A 3WYZA 5LA1A 1M7XA 3B3DA 3KS5A 3UWEA 5CC5A 1R87A 1I6NA 4AB4A 1ZP3A 3TKFA 3CHEA 1KM6A 2HVOA 5A69A 2VVNA 1P0BA 2IXUA 3BLEA 3G22A 2GQ9A 2QCGA 3N6JA 1QW7A 2NVDA 1MFUA 1OCJA 3BMXA 2ZZ6A 1SMDA 3OLEA 3PJWA 4KH2A 3KL0A 1WUEA 4XD5A 4QJ5B 4RV8A 1RY8A 4URIA 3RN6A 1CGTA 1VPYA 4P7OA 1V03A 2NV2A 1SW3A 2ACRA 5LNWA 1J8VA 4JBRA 5LGZA 3AHZA 1SMAA 3NM3A 3VOHA 1VENA 4LSBA 3ZJ6A 4PMQA 4WJEA 4ATLA 2CBIA 7ODCA 4MWAB 5DY3A 4JIHA 5FEWA 1DWAM 2OO6A 2Q3RA 3KL3A 4JX4A 1V3JA 4Y9NA 2HBXA 5EB8A 1LQ2A 4HVXA 3W82A 4PTWA 1K4GA 2PRMA 2XIMA 5MF5A 3MB9A 5JMUA 2NWRA 3H26A 4PULA 3O8AA 3SY1A 1PO9A 3W37A 4RXFA 3MC5A 4A35A 4PSPA 3YPIA 5CZ0A 3ZT5A 4IJBA 1FCUA 2P0OA 4MGGA 3URNA 2QJMA 4PRRA 3BW4A 3SB0A 1YHTA 1D3GA 3IIPA 3DGBA 1H1YA 3IJQA 1FWNA 2W6RA 3SRFA 5G1TA 3A9IA 3HTWA 3SGZA 3ARZA 4W7VA 3FJ4A 4O53A 4PCNA 2E09A 4OQVA 3VCRA 1K8XA 2RH9A 3CAQA 3TJ4A 4NP7A 7TAAA 3EDJA 3STFA 2OKOA 2A4AA 5ABEA 4PTVA 5KMYA 3MUXA 1GTHA 1F73A 1GYLA 1ITCA 2YB1A 2Z27A 1DJIA 4D6IA 3QW4B 4L4OA 4LV9A 5LZLA 2TMDA 4LU0A 4PB4A 3S2JA 2YR1A 3WJYA 4XBSA 1TWZA 3BDKA 1L8NA 1EJRC 3FA5A 3GHRA 1ZJBA 1KFBA 3PZIA 3LHZA 1D3HA 4MJ4A 4ZXOA 3NTYA 4ZCWA 3MKKA 3CWNA 4DN1A 3JW7A 3WBEA 4WKHA 1SJCA 1X38A 2EPMX 3E38A 4H9YA 5DN1A 3NR0A 4JKMA 2XFRA 1A5CA 1WUFA 3WLTA 5H8PA 3AU6A 4JIEA 3EX2A 3AIBA 2FQIA 2Y62A 2HS8A 1HJSA 4Z1YA 4C5YA 2CBJA 4CCEA 3GD6A 4GJ1A 4HU3A 1R7AA 1SZGA 3GB6A 3LRLA 1IQ8A 2XU2A 2ZICA 3ITOA 2A2IA 2V0TA 3KP0A 4HZ8A 1KWGA 3QF0A 3AHYA 3VOCA 1OBAA 4J3XA 5HNRA 3P60A 3NPXA 2FLIA 4HYVA 4F0KA 4IXHA 1B0IA 5BW6A 2VO5A 1A5NC 2ZA1A 4D9PA 2PP0A 3UXKA 4MHBA 1J9YA 4GBDA 4RCXA 5I3FA 3LMYA 1RLCL 3KFTA 4UQBA 3MO4A 3EEZA 2PDUA 4C65A 1VEOA 1SO4A 2D0GA 4KCWA 3LD5A 3PNUA 3R13A 3V75A 3W84A 3L4VA 2QAFA 3ZLHA 1MUWA 2G3IA 1CIUA 1W8SA 2FHFA 2VFFA 5LIYX 3N6HA 4KWUA 4GXMA 1SPQA 3G0SA 3IEBA 2C19A 4MTVA 2XWDA 4U31A 1KFWA 5REQB 1LBMA 2P0IA 3E96A 4HMEA 3P81A 3AI0A 4QM1A 1WP6A 4KEUA 4CVUA 4D8ZA 2ZADA 1JD9A 2F6UA 1BD0A 4C1LA 3GU2A 1RK5A 1W9BM 2JEQA 3P3BA 5C2XA 2ZTKA 5LXEA 5D09A 1C91A 3HIJA 3KRBA 3PG9A 1EBGA 4W8BA 4ML9A 4NUWA 7CGTA 2HCVA 5AC6A 2VR5A 4DPQA 3VX1A 3HU7A 1UD2A 2PDXA 1FOBA 1HGWA 3BTNA 3ZIZA 2XN0A 1X96A 1B3VA 4DNMA 4KCTA 2C1HA 4M80A 1O94A 3XINA 2Q02A 2OWCA 2QUUA 4M1RA 4FP1A 3MTWA 3O63A 2VCBA 4QQ3A 3WLOA 1R2SA 3GQYA 4QJ3B 1VKFA 3G77A 4JTIA 5ECUA 4HBKA 4IX2A 2ZIDA 3UR7A 5EGRA 2J88A 5D9OA 2POZA 3M4HA 1JZ3A 3NL2A 3A47A 1X98A 4EXAA 1OVDA 1E0TA 3W7NA 3MP5A 3DHDA 4NX5A 1TJ2A 2WPBA 3AUOA 2RDXA 4LUJA 4MYXA 3M44A 2IPGA 2CIPA 3U2ZA 3EMCA 3STGA 3UW6A 4CNSA 5I00A 3MJMA 2MANA 1XG3A 2F84A 4E5TA 1F4HA 4GABA 5A6MA 5IRPA 3U2CA 3AOFA 1RHCA 4LT9A 1FWEC 1KFJA 2TRSA 3SY8A 3FCPA 5DELA 5EMJA 4WDUA 3W7CA 1C7SA 4R34A 6XIAA 1OYCA 4C91A 1RCXB 3T0DA 3TIMA 2CXEA 4RNFA 4GX8A 1GVFA 4TVDA 4IGHA 4GUGA 3SEPA 3LNMA 4OE7A 3JVAA 1TMQA 5AVHA 3WK2A 1NQKA 3AMCA 1LRTA 4B91A 4Q4RA 3T05A 4N6EA 2KZHA 3G1AA 3W7MA 4Z2HA 3T4CA 4NX0A 1DJYA 3LK6A 5EPDA 3IIZA 1UPPA 4NRRA 1OFEA 4WRHA 2XM1A 2UWFA 4U5IA 3O6CA 4QP0A 4H8VA 1FDZA 2BMBA 2EHHA 1GW1A 2BFGA 2F61A 5HWJA 3V35A 5CPOA 3VDGA 4V15A 4XD3A 1KXHA 4AD4A 4OUEA 4JAWA 1E43A 4MFEA 2YBTA 3AXIA 3G1SA 3WLRA 1GWJA 2R1MA 3CIXA 1ALDA 4R9OA 3W7DA 2XVNA 1PZ3A 2GVLA 4KBXA 1G4SA 4PEEA 4IGNA 2DSVA 4IMGA 3U2OA 1VYPX 2PB1A 4QSFA 1BGGA 3ALGA 3MU7A 4OBRA 1OCBA 3S47A 3A64A 1RR2A 3A4XA 3L2MA 5CBIA 1YPXA 2OEJA 1XLBA 2JK2A 2GSJA 2WK2A 1HFBA 2FGLA 4EAYA 4BZYA 5HUOA 3H7UA 4QLKA 1CYGA 3GZAA 2X2YA 1KBIA 1HL2A 1VIWA 4D1JA 1KLZA 4J2PA 3R8HA 4M0XA 3QXBA 1Z69A 2PDKA 5F2LA 2PC8A 1YTKA 3RPTA 5AFDA 2G3MA 3EWBX 4E3VA 2CZ5A 1DV7A 1UWIA 1J0KA 3BMVA 5CSRA 4YPJA 1PE1A 2OCZA 3BG9A 3PZOA 2OGYA 3CMJA 4JIPA 1XH0A 2VGIA 1ZTVA 2Z28A 5HMDA 1TFVA 3LBMA 2DU2A 3GK0A 5D37A 3QFEA 3RF9A 3WLPA 3N2BA 3H54A 1PS9A 1WBHA 1XIFA 3WJZA 3UZJA 1UMYA 1G4PA 1TZ9A 2G97A 4GJIA 3VIGA 3WH6A 3ZYZA 1DWJM 3CU2A 4EANA 4O8AA 4HNTA 4NJIA 3GLCA 3ITLA 4KESA 1XRFA 4LB3A 5D32A 4JTGA 3WMLA 3WLLA 4ERIA 2PPGA 4US6A 2VEMA 1QI5A 3PHAA 2PCEA 1J0HA 3G2GA 4DZAA 3VCCA 4XVEA 1BFNA 3U4FA 1V3MA 2OMAA 3WNLA 4WXYA 4D2JA 3ITVA 1HVXA 4UTLA 5A8OA 2AGKA 4RE0A 4MG4A 4E6MA 3H7VA 1YXCA 3LBCA 3CZJA 3L5AA 4IP5A 3VILA 2J66A 1XS2A 2DSZA 4M6VA 1KBKA 1K6WA 3P62A 4A05A 4RKAA 2QV4A 3ABQA 3C8NA 3AMLA 4RV3A 1YE6A 3WQEA 4DO4A 3UXLA 1K4HA 3PS7A 3NQBA 4G7EB 1I1XA 1XIMA 1HKVA 5A1AA 1ICSA 1XP3A 2WJEA 3WL1A 2ZC1A 1N7KA 3WLMA 3O07A 2YFNA 4DO7A 3CH0A 3ZZ1A 2IQDA 1A5LC 1O66A 5EBAA 3AJXA 2GQ3A 5GNXA 4ROQA 4KRTA 4TOQA 5AC7A 2D0FA 3BV4A 3FNDA 1TWWA 3LCFA 1V7AA 2DZAA 3BGGA 3ERPA 4UTMA 5LIKX 4LEFA 4FB7A 2VFDA 3U8GA 2Z6JA 2DZPA 5KZDA 2VVSA 1VYSX 1VZWA 1W91A 1V5XA 2HNHA 2WM1A 1LLZA 1S38A 2VDGA 3QMSA 4ZENA 4LPCA 1P6CA 1W3KA 2EG8A 1S3TC 1DHPA 4J7RA 5XIAA 4O11A 3WH5A 4PTDA 4XO6A 3SIMA 2VT0A 5D2YA 3NQ8A 2IKGA 3VVGA 3ARPA 1SO3A 3VMOA 4JEQA 2WHMA 4L5ZA 3T0BA 5G5IA 3GAKA 2PDFA 3SBFA 3MZNA 1KCXA 1XYMA 1ZZMA 4I8DA 2REQB 3MHGA 4JTQA 3NSMA 4U5KA 2X30A 2QGYA 4DJFA 1BF6A 3WUFA 3NGFA 2NX1A 4L6DA 5K9DA 3PR2A 3SUVA 3RILA 4AYGA 2JBMA 4IMAA 4L9XA 4ACZA 2GGHA 3LDVA 3AYSA 1EC7A 4UR8A 3B8TA 4XV0A 1XLEA 4FXJA 1HKIA 3S1VA 4IQJA 3KOWA 1QHOA 1TVLA 2OB3A 2QPSA 4C7GA 3UA3A 3RM9A 2EPKX 3LZ5A 1E1EA 3S42A 4C6JA 1ITQA 5G2HA 1H7NA 2WC3A 5K9XA 3NZQA 1M41A 4C7FA 4I6KA 3M43A 1K70A 1MQPA 2E5DA 5D04C 3TTQA 1V79A 1XIDA 2OO0A 1BWLA 3WBXA 2Y8KA 4PE8A 2AL2A 4H8NA 5C70A 4JHOA 1PCWA 2DV0A 4UNKA 2Z7GA 3P80A 1W9XA 4LC6A 1XF0A 4HPXA 2WAGA 4JTLA 2W27A 4XSLA 3S46A 3WQVA 4W5UA 1PWMA 3GG8A 1FWWA 1EYWA 1G69A 4GUIA 3LRKA 4GI8A 2XDFA 4IF2A 1W8GA 3VNYA 1QPKA 3DERA 2CITA 4J4KA 1DVJA 1E6PA 2B31A 5G1MA 4JDBA 1XQKA 4XZ9A 2DORA 3L5LA 3MZ2A 4NAEA 1AQFA 1XD1A 1HUVA 2HVMA 3RDKA 3FIGA 4Y9MA 2DUAA 2ZCGA 1B31A 3BSMA 3VPLA 3B9OA 1OFRA 1Q6LA 2X1UA 1YNPA 2QVHA 4PR4A 2J25A 3H2CA 3AROA 3GO2A 3HJEA 1W9VA 2AQVA 2WXDM 2J13A 4JN6A 4O8RA 5I79A 3TZNA 5KSWA 5PTDA 2VL4A 1QTWA 1U1HA 1N2VA 4DZ5A 4RE3A 3ZJ8A 5EYWA 3C6CA 2P50A 3RITA 1PCKA 4A3HA 4O19A 1PB0A 5BCAA 2C0HA 3BLKA 1XDMA 3PWIA 1P5BA 4G2DA 2C16A 1NJJA 2WBGA 4FXFA 2VWTA 2YCLB 1MXSA 2QMKA 3TFXA 4AU0A 1S1RA 1KGWA 1GKPA 5C9XA 3GXDA 2O4MA 4FOKA 2Y8UA 4C6FA 1T41A 3WDPP 2PUZA 2TODA 3A4JA 4L9YA 2J7BA 3G8EA 2X09A 1OK4A 4R9XA 4TX6A 2XHYA 1WDQA 4GPNA 1EFZA 2ZX7A 3WZ0E 3N73A 3LTPA 2BOGX 1KFKA 3M7WA 1VJZA 4JN8A 1J5SA 4GE8A 4UQEA 4AEOA 1TIWA 1PZ0A 3RFAA 4UZSA 3MT1A 1DJGA 2WNNA 1NWSA 2H8XA 5LNUA 1YDYA 1KCZA 1MRQA 4B90A 1O1ZA 5TIMA 3U57A 4J28A 3FJLA 4IHCA 4RUBA 3WD4A 2E28A 3KOFA 3P5ZA 4G5DA 3CJPA 3MMWA 4IP4A 4ZTXA 1S46A 4DWSD 4OFCA 5C6MA 4HOWA 1G6CA 3PZQA 4M6QA 1LL4A 3W6MA 2VM8A 2E9MA 1LT8A 4CKQA 4B2DA 4FS9A 1F61A 4UTWC 4GLEA 1ZRQA 1W3LA 4GYPA 3GKFA 3QV7A 2DVXA 1VBUA 3RM8A 3OLGA 4C6LA 1VC4A 5CPSA 2ZFAA 2OT0A 3MMDA 4OTKA 3VIPA 2VENA 4QNWA 2YL6A 5CKSA 3EEGA 2EPLX 3O0FA 3RU8X 1US0A 4GINA 3T2QA 4WX2A 4QXIA 3TTSA 1B4KA 1C3FA 1O5KA 1UH4A 4MYAA 4FIQA 2QW5A 1UC4A 2V3FA 3G1RA 3MCMA 4IPJA 2BOFX 3UERA 4ERAA 3NWRA 1XKYA 1F8IA 3RRXA 4GQ0A 2J47A 1SR0A 1TELA 4Z2IA 3W26A 5HPCA 3CH9A 3DU0A 3F4CA 2CKRA 4GQQA 1WKEA 4B3LA 3HPFA 1FKWA 4GYFA 4AZGA 4C6CA 1NF7A 1LP6A 3M5VA 4MJ2A 3WLJA 3LOTA 2CLKA 1P7TA 3PZMA 5F2MA 4F2UA 1RJQA 3GNOA 4CQAA 4PMXA 2DZWA 4C6DA 5FA5A 3B0XA 4JQAA 2DQXA 3L4XA 4IOTA 1OYBA 1EOKA 4JXCA 3U0HA 5F4WA 3LA4A 3CZKA 3NAVA 3GTNA 1W32A 3UA4A 2DUXA 3MDUA 1UZ1A 2ADAA 3TH6A 3BCDA 4RZBA 3NZ1A 2C91A 3TSBA 1R9ZA 4LUTB 1XLJA 5GNZA 3H4XA 2PLCA 3BQ6A 2OSYA 1D8WA 3GVRA 4Q4QA 3ZVIA 1RP9A 1HKMA 4C7DA 4G1NA 1ZLPA 2FZBA 1OSEA 4P7LA 3W83A 2F8QA 2XZ9A 2A3BA 4MY1A 3WN6A 2VELA 3CV2A 1YBQA 4RNIA 2YKKA 7REQB 1SJAA 4IGSA 4ZL1A 4X0VA 1A5BA 3VE7A 4OVXA 4AW7A 1F3TA 3VE9A 4M1BA 2ALRA 3EPNA 4NI8A 3EOEA 3IJLA 4MY9A 4PMZA 4OV9A 5FD0A 1XYCA 4JEJA 3RG6A 3VOFA 1M53A 3WQGA 2R1KA 3NQEA 3STPA 1W5QA 3IVSA 1A3WA 1ME8A 5JXQA 1W1A1 2OG9A 4IFKB 1U2YA 3ABOA 3PC0A 3FW6A 1BAGA 4JTAA 3WNMA 1EXBA 4HPGA 3UPMA 1V6UA 1XPYA 3WQ5A 1XC6A 3H24A 2ZUTA 2P3EA 1ISYA 1JPIA 2FTYA 4MOZA 3WBWA 1HX0A 2C8NA 1X6NA 2YDSA 1Q6EA 2JKEA 1XLDA 1SW7A 4IIHA 1GOKA 3A13A 3T81A 4DUXA 1UUQA 4DF0A 1GJPA 4GCXA 2Y24A 1EWEA 4FLRA 1O68A 4Q8OA 3EX4A 3W0KA 5JBFA 1QI0A 1XM3A 4LYPA 3UP8A 3EA1A 3UCDA 1P48A 2NVAA 2HSAA 1QPQA 2PBOA 1J0ZA 1XR2A 3VNDA 1OK6A 2J74A 1ZHAA 4XAYA 2QULA 2ZX8A 3PBUA 1JPDX 1QW8A 4Q7BA 4AWEA 2AOSA 3EWCA 5BXRA 3L2LA 5DANA 3ITYA 1Q8JA 3MSRA 1PX8A 1Z41A 1R9XA 2E8ZA 4FSAA 4YIWA 3TJLA 4IPNB 1UD8A 3M64A 4UFHA 3C2RA 4J3WA 2ZWYA 4NNCA 1J2WA 3N2MA 3MY9A 1WZLA 3BLFA 3W72A 2ZVRA 3AS2A 3GU9A 1RP8A 3AXKA 2Z7KA 3W81A 3POCA 2ZZ1A 5DCBA 5JH2A 3DFSA 3W76A 2EO7A 3KWXA 4XB3A 4CD7A 3FXYA 4K38A 4I8YA 1VFFA 3K2GA 3Q45A 2XN1A 3N18A 5MKGB 3EOSA 2G4FA 2AQWA 3SCSA 6CGTA 3IGXA 4D8LA 3N29A 4IIBA 2RDWA 5D2WA 5HBFA 4HZ7A 5EMKA 1EX5A 1IWAA 3PTDA 4H00A 5E1QA 3RPDA 1AUSL 2Y61A 4QE4A 4RK8A 4DHGA 4I9AA 3T8QA 4RZ5A 1UP3A 4Q3MA 1H41A 4R88A 1M7OA 3W85A 4WJ8A 1OGBA 1NOUA 2FDMA 2YCKX 4HSNA 5KZMA 4ICCX 4DYJA 1YRRA 1IXQA 3DN5A 3AYRA 2QCCA 4XBKA 1DP0A 3H2FA 2DIKA 4DM2A 5C0QA 1TIMA 4OGZA 3FA4A 3WO8A 5D8ZA 5A6LA 3RM4A 4TQTA 3AXXA 4GUJA 1BXCA 1TREA 5CGQA 5CGMA 2NT0A 2Y2WA 4JHZA 3DFHA 3SUSA 2PS2A 2QCFA 1MSSA 1JDAA 1R3TA 3I7RA 1HZYA 3HQPA 4N42A 1OFDA 2Q09A 1DWHM 3BJFA 1IGSA 5LKYA 1TPVA 1X1OA 1BLIA 3RJXA 5D9NA 3R0UA 4UR9A 1TJPA 3H2EA 3QZAA 1KM2A 1V8EA 4NYYA 5CG7A 4QBXA 2HROA 3LCIA 3RU6A 2WW5A 1P43A 1R3YA 3FVMA 3KOYA 1LL7A 2E9BA 2Z29A 4FZIA 5T91A 3EMQA 3VOIA 2EKCA 3OBEA 2AKZA 2QUVA 1AK5A 3CEPA 1TRIA 2ZXBA 3BXWA 1ZY9A 4UNLA 1VR6A 3EDKA 2PODA 3H22A 4ZE5A 2V3EA 2BG5A 2HDJA 1OABA 4MZ8A 3VM7A 2HK1A 1YEYA 4MUZA 4S2BA 4NZ3A 1RVGA 1QAPA 3TYCA 3SAZA 3VGDA 4HHPA 3UXIA 2DVTA 2J79A 3LEPA 4ZTYA 2Q71A 2ZX6A 4C90A 2QGHA 5HR7A 4H8HA 4MZ1A 1OX6A 1R3QA 3UY7A 3N2CA 3D6NA 5EKYA 1VFMA 3IRSA 2J6VA 2ZYFA 1JEZA 2EJ1A 4RR4A 1JZ8A 1QT1A 3E0IA 1JPHA 2CEQA 4LC8A 5HQEA 3G5EA 1VFLA 5IM51 4H83A 2E5CA 2PBGA 2DUZA 4BWLA 4DY1A 2E6AA 1E70M 3ARWA 4AX7A 8XIAA