3C5WC

Complex between pp2a-specific methylesterase pme-1 and pp2a core enzyme
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
294
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPTPDYFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of demethylation and inactivation of protein phosphatase 2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PP2A A subunit
total genus 107
structure length 294
sequence length 304
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3c5wC00
1HO5A 1II7A 4H2BA 3H69A 4B2OA 3IVEA 2QFPA 4V0XA 4DHLA 4H2IA 3QG5C 2BQ8X 4UT3B 5GTUA 3KBPA 4I5NC 4KBPA 1XM7A 4UWQA 3H67A 3ZTVA 4UT2A 3RQZA 4M0VA 3K7WC 1WAO1 1T70A 2CV9A 2O8AA 3TGHA 3IB8A 2DFJA 3H60A 5HPEA 1TCOA 1NNWA 2NXFA 4O5GA 5C1VA 3IVDA 2NPPC 2WDCA 3H62B 4O43A 3DW8C 3RL4A 1Z2WA 4UT3A 4FBWA 4TUGA 1SU1A 3ZU0A 4LACC 3H64A 2Z72A 3LL8A 2QFRA 1OI8A 2ZBMA 1QHWA 1V73A 4OR9A 1S3NA 1FJMA 3DSCA 1Z2XA 2BCDA 5J28A 1HPUA 2WDFA 5B8IA 4V0VA 4YKEA 1U32A 2YVTA 4I5LC 3C5WC 2QJCA 1T71A 5INBA 1G5BA 1M63A 2JOGA 3T1IA 3E7AA 3H63A 3P71C 1OIDA 4DT2A 3K7VC 4J6OA 4ORBA 2IAEC 3C9FA 4FCXA 3EGGA 4IL1A 5EQVA 3AV0A 1HP1A 2USHA 4ORAA 3RL3A 1KBPA 1OIEA 1IT6A 5JPEA 1S3MA 2WDDA 2Z1AA 3EGHA 2NYLC 3QFNA 4ZX2A 2XMOA 2Z06A 5IOHA 2HY1A 4MOVA 4H2GA 3CK2A 1W24A 3PSOA 3QFMA 5DNYA 5JJTA 4H2FA 4KKZA 1AUIA 4O4KA 4MP0A 4JA9A 3DSDA 5F3WA 3H66A 3QFKA 3AUZA 4HD0A 3THNA 3N5UA 4MOYA 3V4YA 2HYPA 1XZWA 2BDXA 4H1SA 4Q7FA 4TUIA 3GVEA 2Q8UA 1UF3A 3PSNA 1S70A 2P6BA 4FBQA 1S8EA 3FGAC 3HVQA 4O24A 1USHA 4ZVZA 4LU9A 2HYOA 2KKNA 4JA7A 1S3LA 2AHDA 2IE4C 3IB7A 4ORCA 4DSYA 4LTYA 3THOB 1UTEA 4NZVA 1QFCA 2A22A 3H68A 2IE3C 4G9JA 3ICFA 2R17A 4FBKA 4H1YP 4XPNA 3QFOA 5JPFA 3E7BA 4F0ZA 1MF8A 3H61A 2O8GA 4V0WA 1JK7A 1WARA 2NYMC 2WDEA 3RL5A 2GJUA 4WWLA 1S95A 3JYFA 4IYPC
chains in the Genus database with same CATH superfamily
1HO5A 1II7A 4H2BA 3H69A 4B2OA 3IVEA 2QFPA 4V0XA 4DHLA 4H2IA 3QG5C 2BQ8X 4UT3B 5GTUA 3KBPA 4I5NC 4KBPA 1XM7A 4UWQA 3H67A 3ZTVA 4UT2A 3RQZA 3FLOA 4M0VA 3K7WC 1WAO1 1T70A 2CV9A 2O8AA 3TGHA 3IB8A 2DFJA 3H60A 5HPEA 1TCOA 1NNWA 2NXFA 4O5GA 5C1VA 3IVDA 2NPPC 2WDCA 3H62B 4O43A 3DW8C 3RL4A 1Z2WA 3E0JA 2ZO9B 4UT3A 4FBWA 4TUGA 1SU1A 3ZU0A 4LACC 3H64A 2Z72A 3LL8A 2QFRA 1OI8A 2ZBMA 1QHWA 1V73A 4OR9A 1S3NA 1FJMA 3DSCA 1Z2XA 2BCDA 5J28A 1HPUA 2WDFA 5B8IA 4V0VA 4YKEA 1U32A 2YVTA 4I5LC 3C5WC 2QJCA 1T71A 5INBA 1G5BA 1M63A 2JOGA 3T1IA 3E7AA 3H63A 3P71C 1OIDA 4DT2A 3K7VC 4J6OA 4ORBA 2IAEC 3C9FA 4FCXA 3EGGA 4IL1A 5EQVA 1HP1A 2YEQA 2USHA 3AV0A 4ORAA 3RL3A 1KBPA 1OIEA 1IT6A 5JPEA 1S3MA 2WDDA 2Z1AA 3EGHA 2NYLC 3QFNA 2DXNA 2XMOA 2Z06A 4ZX2A 5IOHA 2HY1A 4MOVA 4H2GA 3CK2A 1W24A 3PSOA 3QFMA 5DNYA 5JJTA 4H2FA 4KKZA 1AUIA 4O4KA 4MP0A 4JA9A 3DSDA 5F3WA 2ZOAA 2DXLA 3H66A 3QFKA 3AUZA 4HD0A 3THNA 3N5UA 4MOYA 3V4YA 2HYPA 1XZWA 2BDXA 4H1SA 4Q7FA 4TUIA 3GVEA 2Q8UA 1UF3A 3PSNA 1S70A 2P6BA 4FBQA 1S8EA 3FGAC 3HVQA 4O24A 1USHA 4ZVZA 4LU9A 2HYOA 2KKNA 4JA7A 1S3LA 2AHDA 2IE4C 3IB7A 4ORCA 4DSYA 4LTYA 3THOB 1UTEA 4NZVA 1QFCA 2A22A 3H68A 3D03A 2IE3C 4G9JA 3ICFA 2R17A 4FBKA 4H1YP 4XPNA 3QFOA 5JPFA 3E7BA 4F0ZA 1MF8A 3H61A 2O8GA 4V0WA 1JK7A 1WARA 2NYMC 2WDEA 3RL5A 2GJUA 4WWLA 1S95A 3JYFA 4IYPC
chains in the Genus database with same CATH topology
1HO5A 1II7A 4H2BA 3H69A 4B2OA 3IVEA 2QFPA 4V0XA 4DHLA 4H2IA 3QG5C 2BQ8X 4UT3B 5GTUA 3KBPA 4I5NC 4KBPA 1XM7A 4UWQA 3H67A 3ZTVA 4UT2A 3RQZA 3FLOA 4M0VA 3K7WC 1WAO1 1T70A 2CV9A 2O8AA 3TGHA 3IB8A 2DFJA 3H60A 5HPEA 1TCOA 1NNWA 2NXFA 4O5GA 5C1VA 3IVDA 2NPPC 2WDCA 3H62B 4O43A 3DW8C 3RL4A 1Z2WA 3E0JA 2ZO9B 4UT3A 4FBWA 4TUGA 1SU1A 3ZU0A 4LACC 3H64A 2Z72A 3LL8A 2QFRA 1OI8A 2ZBMA 1QHWA 1V73A 4OR9A 1S3NA 1FJMA 3DSCA 1Z2XA 2BCDA 5J28A 1HPUA 2WDFA 5B8IA 4V0VA 4YKEA 1U32A 2YVTA 4I5LC 3C5WC 2QJCA 1T71A 5INBA 1G5BA 1M63A 2JOGA 3T1IA 3E7AA 3H63A 3P71C 1OIDA 4DT2A 3K7VC 4J6OA 4ORBA 2IAEC 3C9FA 4FCXA 3EGGA 4IL1A 5EQVA 1HP1A 2YEQA 2USHA 3AV0A 4ORAA 3RL3A 1KBPA 1OIEA 1IT6A 5JPEA 1S3MA 2WDDA 2Z1AA 3EGHA 2NYLC 3QFNA 2DXNA 2XMOA 2Z06A 4ZX2A 5IOHA 2HY1A 4MOVA 4H2GA 3CK2A 1W24A 3PSOA 3QFMA 5DNYA 5JJTA 4H2FA 4KKZA 1AUIA 4O4KA 4MP0A 4JA9A 3DSDA 5F3WA 2ZOAA 2DXLA 3H66A 3QFKA 3AUZA 4HD0A 3THNA 3N5UA 4MOYA 3V4YA 2HYPA 1XZWA 2BDXA 4H1SA 4Q7FA 4TUIA 3GVEA 2Q8UA 1UF3A 3PSNA 1S70A 2P6BA 4FBQA 1S8EA 3FGAC 3HVQA 4O24A 1USHA 4ZVZA 4LU9A 2HYOA 2KKNA 4JA7A 1S3LA 2AHDA 2IE4C 3IB7A 4ORCA 4DSYA 4LTYA 3THOB 1UTEA 4NZVA 1QFCA 2A22A 3H68A 3D03A 2IE3C 4G9JA 3ICFA 2R17A 4FBKA 4H1YP 4XPNA 3QFOA 5JPFA 3E7BA 4F0ZA 1MF8A 3H61A 2O8GA 4V0WA 1JK7A 1WARA 2NYMC 2WDEA 3RL5A 2GJUA 4WWLA 1S95A 3JYFA 4IYPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HO5 A;  1II7 A;  4H2B A;  3H69 A;  4B2O A;  3IVE A;  2QFP A;  4V0X A;  4DHL A;  4H2I A;  3QG5 C;  2BQ8 X;  4UT3 B;  5GTU A;  3KBP A;  4I5N C;  4KBP A;  1XM7 A;  4UWQ A;  3H67 A;  3ZTV A;  4UT2 A;  3RQZ A;  4M0V A;  3K7W C;  1WAO 1;  1T70 A;  2CV9 A;  2O8A A;  3TGH A;  3IB8 A;  2DFJ A;  3H60 A;  5HPE A;  1TCO A;  1NNW A;  2NXF A;  4O5G A;  5C1V A;  3IVD A;  2NPP C;  2WDC A;  3H62 B;  4O43 A;  3DW8 C;  3RL4 A;  1Z2W A;  4UT3 A;  4FBW A;  4TUG A;  1SU1 A;  3ZU0 A;  4LAC C;  3H64 A;  2Z72 A;  3LL8 A;  2QFR A;  1OI8 A;  2ZBM A;  1QHW A;  1V73 A;  4OR9 A;  1S3N A;  1FJM A;  3DSC A;  1Z2X A;  2BCD A;  5J28 A;  1HPU A;  2WDF A;  5B8I A;  4V0V A;  4YKE A;  1U32 A;  2YVT A;  4I5L C;  3C5W C;  2QJC A;  1T71 A;  5INB A;  1G5B A;  1M63 A;  2JOG A;  3T1I A;  3E7A A;  3H63 A;  3P71 C;  1OID A;  4DT2 A;  3K7V C;  4J6O A;  4ORB A;  2IAE C;  3C9F A;  4FCX A;  3EGG A;  4IL1 A;  5EQV A;  3AV0 A;  1HP1 A;  2USH A;  4ORA A;  3RL3 A;  1KBP A;  1OIE A;  1IT6 A;  5JPE A;  1S3M A;  2WDD A;  2Z1A A;  3EGH A;  2NYL C;  3QFN A;  4ZX2 A;  2XMO A;  2Z06 A;  5IOH A;  2HY1 A;  4MOV A;  4H2G A;  3CK2 A;  1W24 A;  3PSO A;  3QFM A;  5DNY A;  5JJT A;  4H2F A;  4KKZ A;  1AUI A;  4O4K A;  4MP0 A;  4JA9 A;  3DSD A;  5F3W A;  3H66 A;  3QFK A;  3AUZ A;  4HD0 A;  3THN A;  3N5U A;  4MOY A;  3V4Y A;  2HYP A;  1XZW A;  2BDX A;  4H1S A;  4Q7F A;  4TUI A;  3GVE A;  2Q8U A;  1UF3 A;  3PSN A;  1S70 A;  2P6B A;  4FBQ A;  1S8E A;  3FGA C;  3HVQ A;  4O24 A;  1USH A;  4ZVZ A;  4LU9 A;  2HYO A;  2KKN A;  4JA7 A;  1S3L A;  2AHD A;  2IE4 C;  3IB7 A;  4ORC A;  4DSY A;  4LTY A;  3THO B;  1UTE A;  4NZV A;  1QFC A;  2A22 A;  3H68 A;  2IE3 C;  4G9J A;  3ICF A;  2R17 A;  4FBK A;  4H1Y P;  4XPN A;  3QFO A;  5JPF A;  3E7B A;  4F0Z A;  1MF8 A;  3H61 A;  2O8G A;  4V0W A;  1JK7 A;  1WAR A;  2NYM C;  2WDE A;  3RL5 A;  2GJU A;  4WWL A;  1S95 A;  3JYF A;  4IYP C; 
#chains in the Genus database with same CATH topology
 1HO5 A;  1II7 A;  4H2B A;  3H69 A;  4B2O A;  3IVE A;  2QFP A;  4V0X A;  4DHL A;  4H2I A;  3QG5 C;  2BQ8 X;  4UT3 B;  5GTU A;  3KBP A;  4I5N C;  4KBP A;  1XM7 A;  4UWQ A;  3H67 A;  3ZTV A;  4UT2 A;  3RQZ A;  3FLO A;  4M0V A;  3K7W C;  1WAO 1;  1T70 A;  2CV9 A;  2O8A A;  3TGH A;  3IB8 A;  2DFJ A;  3H60 A;  5HPE A;  1TCO A;  1NNW A;  2NXF A;  4O5G A;  5C1V A;  3IVD A;  2NPP C;  2WDC A;  3H62 B;  4O43 A;  3DW8 C;  3RL4 A;  1Z2W A;  3E0J A;  2ZO9 B;  4UT3 A;  4FBW A;  4TUG A;  1SU1 A;  3ZU0 A;  4LAC C;  3H64 A;  2Z72 A;  3LL8 A;  2QFR A;  1OI8 A;  2ZBM A;  1QHW A;  1V73 A;  4OR9 A;  1S3N A;  1FJM A;  3DSC A;  1Z2X A;  2BCD A;  5J28 A;  1HPU A;  2WDF A;  5B8I A;  4V0V A;  4YKE A;  1U32 A;  2YVT A;  4I5L C;  3C5W C;  2QJC A;  1T71 A;  5INB A;  1G5B A;  1M63 A;  2JOG A;  3T1I A;  3E7A A;  3H63 A;  3P71 C;  1OID A;  4DT2 A;  3K7V C;  4J6O A;  4ORB A;  2IAE C;  3C9F A;  4FCX A;  3EGG A;  4IL1 A;  5EQV A;  1HP1 A;  2YEQ A;  2USH A;  3AV0 A;  4ORA A;  3RL3 A;  1KBP A;  1OIE A;  1IT6 A;  5JPE A;  1S3M A;  2WDD A;  2Z1A A;  3EGH A;  2NYL C;  3QFN A;  2DXN A;  2XMO A;  2Z06 A;  4ZX2 A;  5IOH A;  2HY1 A;  4MOV A;  4H2G A;  3CK2 A;  1W24 A;  3PSO A;  3QFM A;  5DNY A;  5JJT A;  4H2F A;  4KKZ A;  1AUI A;  4O4K A;  4MP0 A;  4JA9 A;  3DSD A;  5F3W A;  2ZOA A;  2DXL A;  3H66 A;  3QFK A;  3AUZ A;  4HD0 A;  3THN A;  3N5U A;  4MOY A;  3V4Y A;  2HYP A;  1XZW A;  2BDX A;  4H1S A;  4Q7F A;  4TUI A;  3GVE A;  2Q8U A;  1UF3 A;  3PSN A;  1S70 A;  2P6B A;  4FBQ A;  1S8E A;  3FGA C;  3HVQ A;  4O24 A;  1USH A;  4ZVZ A;  4LU9 A;  2HYO A;  2KKN A;  4JA7 A;  1S3L A;  2AHD A;  2IE4 C;  3IB7 A;  4ORC A;  4DSY A;  4LTY A;  3THO B;  1UTE A;  4NZV A;  1QFC A;  2A22 A;  3H68 A;  3D03 A;  2IE3 C;  4G9J A;  3ICF A;  2R17 A;  4FBK A;  4H1Y P;  4XPN A;  3QFO A;  5JPF A;  3E7B A;  4F0Z A;  1MF8 A;  3H61 A;  2O8G A;  4V0W A;  1JK7 A;  1WAR A;  2NYM C;  2WDE A;  3RL5 A;  2GJU A;  4WWL A;  1S95 A;  3JYF A;  4IYP C; 
#chains in the Genus database with same CATH homology
 1HO5 A;  1II7 A;  4H2B A;  3H69 A;  4B2O A;  3IVE A;  2QFP A;  4V0X A;  4DHL A;  4H2I A;  3QG5 C;  2BQ8 X;  4UT3 B;  5GTU A;  3KBP A;  4I5N C;  4KBP A;  1XM7 A;  4UWQ A;  3H67 A;  3ZTV A;  4UT2 A;  3RQZ A;  3FLO A;  4M0V A;  3K7W C;  1WAO 1;  1T70 A;  2CV9 A;  2O8A A;  3TGH A;  3IB8 A;  2DFJ A;  3H60 A;  5HPE A;  1TCO A;  1NNW A;  2NXF A;  4O5G A;  5C1V A;  3IVD A;  2NPP C;  2WDC A;  3H62 B;  4O43 A;  3DW8 C;  3RL4 A;  1Z2W A;  3E0J A;  2ZO9 B;  4UT3 A;  4FBW A;  4TUG A;  1SU1 A;  3ZU0 A;  4LAC C;  3H64 A;  2Z72 A;  3LL8 A;  2QFR A;  1OI8 A;  2ZBM A;  1QHW A;  1V73 A;  4OR9 A;  1S3N A;  1FJM A;  3DSC A;  1Z2X A;  2BCD A;  5J28 A;  1HPU A;  2WDF A;  5B8I A;  4V0V A;  4YKE A;  1U32 A;  2YVT A;  4I5L C;  3C5W C;  2QJC A;  1T71 A;  5INB A;  1G5B A;  1M63 A;  2JOG A;  3T1I A;  3E7A A;  3H63 A;  3P71 C;  1OID A;  4DT2 A;  3K7V C;  4J6O A;  4ORB A;  2IAE C;  3C9F A;  4FCX A;  3EGG A;  4IL1 A;  5EQV A;  1HP1 A;  2YEQ A;  2USH A;  3AV0 A;  4ORA A;  3RL3 A;  1KBP A;  1OIE A;  1IT6 A;  5JPE A;  1S3M A;  2WDD A;  2Z1A A;  3EGH A;  2NYL C;  3QFN A;  2DXN A;  2XMO A;  2Z06 A;  4ZX2 A;  5IOH A;  2HY1 A;  4MOV A;  4H2G A;  3CK2 A;  1W24 A;  3PSO A;  3QFM A;  5DNY A;  5JJT A;  4H2F A;  4KKZ A;  1AUI A;  4O4K A;  4MP0 A;  4JA9 A;  3DSD A;  5F3W A;  2ZOA A;  2DXL A;  3H66 A;  3QFK A;  3AUZ A;  4HD0 A;  3THN A;  3N5U A;  4MOY A;  3V4Y A;  2HYP A;  1XZW A;  2BDX A;  4H1S A;  4Q7F A;  4TUI A;  3GVE A;  2Q8U A;  1UF3 A;  3PSN A;  1S70 A;  2P6B A;  4FBQ A;  1S8E A;  3FGA C;  3HVQ A;  4O24 A;  1USH A;  4ZVZ A;  4LU9 A;  2HYO A;  2KKN A;  4JA7 A;  1S3L A;  2AHD A;  2IE4 C;  3IB7 A;  4ORC A;  4DSY A;  4LTY A;  3THO B;  1UTE A;  4NZV A;  1QFC A;  2A22 A;  3H68 A;  3D03 A;  2IE3 C;  4G9J A;  3ICF A;  2R17 A;  4FBK A;  4H1Y P;  4XPN A;  3QFO A;  5JPF A;  3E7B A;  4F0Z A;  1MF8 A;  3H61 A;  2O8G A;  4V0W A;  1JK7 A;  1WAR A;  2NYM C;  2WDE A;  3RL5 A;  2GJU A;  4WWL A;  1S95 A;  3JYF A;  4IYP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...