3C5WC

Complex between pp2a-specific methylesterase pme-1 and pp2a core enzyme
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
294
Chain Sequence
FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPTPDYFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of demethylation and inactivation of protein phosphatase 2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PP2A A subunit
total genus 107
structure length 294
sequence length 304
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3c5wC00
3RL3A 3EGGA 2O8GA 1Z2WA 1AUIA 4ORAA 1FJMA 1NNWA 2HYOA 4ZVZA 4F0ZA 2R17A 3K7VC 4H2FA 4Q7FA 1S95A 2NXFA 2Q8UA 1T70A 2JOGA 2QJCA 3E7BA 4IL1A 2AHDA 1XM7A 4H1SA 4O43A 4IYPC 1M63A 2BDXA 4MP0A 4YKEA 1QFCA 2A22A 3T1IA 3ICFA 3PSOA 4H2GA 4WWLA 5IOHA 1G5BA 4M0VA 3H63A 3V4YA 1UTEA 3QFMA 4FCXA 3JYFA 3KBPA 3H68A 4LACC 1W24A 1V73A 2IE4C 4DHLA 1Z2XA 3P71C 4H2BA 4O4KA 2NYMC 3C9FA 3CK2A 2QFPA 4UT3B 1HO5A 2HYPA 1UF3A 3H62B 3H60A 1OI8A 2USHA 5HPEA 2WDFA 4H1YP 4O5GA 4FBKA 2WDCA 4I5LC 2HY1A 2WDDA 3PSNA 4XPNA 1S8EA 3AUZA 1IT6A 3H64A 2Z1AA 1HP1A 3DW8C 3H61A 3QFNA 3QG5C 4UWQA 3DSCA 2Z72A 1USHA 4DSYA 3QFKA 4FBQA 5B8IA 3RL4A 4G9JA 5JPEA 4LTYA 3K7WC 4V0XA 4NZVA 3AV0A 3RQZA 4MOVA 4JA7A 4ORCA 4H2IA 4J6OA 5EQVA 3ZTVA 1HPUA 3H69A 1S3LA 3H67A 2XMOA 4FBWA 4O24A 1WAO1 1WARA 1MF8A 3TGHA 3FGAC 3IVDA 1II7A 4UT2A 2O8AA 2Z06A 4MOYA 1KBPA 3HVQA 3THNA 2GJUA 3N5UA 5JJTA 3RL5A 4OR9A 3GVEA 4KKZA 4TUGA 5GTUA 5F3WA 2WDEA 3QFOA 4HD0A 4ORBA 5C1VA 1SU1A 3LL8A 4V0WA 3IB8A 5DNYA 4DT2A 1S3MA 3E7AA 2NYLC 2BQ8X 1JK7A 1T71A 2YVTA 3DSDA 3ZU0A 4KBPA 2IAEC 4ZX2A 1S70A 3THOB 3C5WC 3EGHA 4I5NC 1XZWA 4JA9A 4TUIA 2ZBMA 1TCOA 4LU9A 3IVEA 1S3NA 2P6BA 3IB7A 1U32A 5JPFA 2BCDA 1OIEA 2DFJA 2IE3C 3H66A 4B2OA 2CV9A 2KKNA 2QFRA 1QHWA 1OIDA 5J28A 4V0VA 5INBA 2NPPC 4UT3A
chains in the Genus database with same CATH superfamily
3RL3A 3EGGA 2O8GA 1Z2WA 1AUIA 4ORAA 1FJMA 1NNWA 2HYOA 4ZVZA 4F0ZA 2R17A 3K7VC 4H2FA 4Q7FA 1S95A 2DXNA 2NXFA 2Q8UA 1T70A 2JOGA 2QJCA 3E7BA 4IL1A 2AHDA 1XM7A 4H1SA 4O43A 4IYPC 1M63A 2BDXA 4MP0A 4YKEA 1QFCA 2A22A 3T1IA 3ICFA 3PSOA 4H2GA 4WWLA 5IOHA 1G5BA 4M0VA 3H63A 3V4YA 1UTEA 3QFMA 4FCXA 3JYFA 3KBPA 3H68A 4LACC 1W24A 1V73A 2IE4C 4DHLA 1Z2XA 3P71C 4H2BA 4O4KA 2NYMC 3C9FA 3CK2A 2QFPA 4UT3B 1HO5A 2HYPA 1UF3A 3H62B 3H60A 1OI8A 2USHA 5HPEA 2WDFA 4H1YP 4O5GA 4FBKA 2WDCA 4I5LC 2HY1A 2WDDA 3PSNA 4XPNA 1S8EA 3AUZA 1IT6A 3H64A 2Z1AA 1HP1A 3DW8C 3H61A 3QFNA 3QG5C 4UWQA 3DSCA 2Z72A 1USHA 4DSYA 3QFKA 3E0JA 4FBQA 5B8IA 3RL4A 4G9JA 5JPEA 4LTYA 3K7WC 4V0XA 4NZVA 3AV0A 3RQZA 4MOVA 4JA7A 3D03A 4ORCA 4H2IA 2YEQA 4J6OA 5EQVA 3ZTVA 1HPUA 3H69A 2DXLA 1S3LA 3H67A 2XMOA 4FBWA 4O24A 1WAO1 1WARA 1MF8A 3TGHA 3FGAC 3IVDA 1II7A 4UT2A 2O8AA 2Z06A 4MOYA 1KBPA 3HVQA 3THNA 2GJUA 3N5UA 5JJTA 3RL5A 4OR9A 3GVEA 4KKZA 4TUGA 5GTUA 5F3WA 2WDEA 3QFOA 4HD0A 4ORBA 5C1VA 1SU1A 3LL8A 4V0WA 3IB8A 5DNYA 4DT2A 1S3MA 3E7AA 2ZOAA 2NYLC 2BQ8X 1JK7A 1T71A 2YVTA 3DSDA 3ZU0A 4KBPA 2IAEC 4ZX2A 1S70A 3THOB 3C5WC 3EGHA 4I5NC 1XZWA 4JA9A 4TUIA 2ZBMA 3FLOA 1TCOA 4LU9A 3IVEA 1S3NA 2P6BA 3IB7A 1U32A 5JPFA 2BCDA 1OIEA 2DFJA 2IE3C 3H66A 4B2OA 2CV9A 2KKNA 2QFRA 1QHWA 1OIDA 5J28A 4V0VA 2ZO9B 5INBA 2NPPC 4UT3A
chains in the Genus database with same CATH topology
3RL3A 3EGGA 2O8GA 1Z2WA 1AUIA 4ORAA 1FJMA 1NNWA 2HYOA 4ZVZA 4F0ZA 2R17A 3K7VC 4H2FA 4Q7FA 1S95A 2DXNA 2NXFA 2Q8UA 1T70A 2JOGA 2QJCA 3E7BA 4IL1A 2AHDA 1XM7A 4H1SA 4O43A 4IYPC 1M63A 2BDXA 4MP0A 4YKEA 1QFCA 2A22A 3T1IA 3ICFA 3PSOA 4H2GA 4WWLA 5IOHA 1G5BA 4M0VA 3H63A 3V4YA 1UTEA 3QFMA 4FCXA 3JYFA 3KBPA 3H68A 4LACC 1W24A 1V73A 2IE4C 4DHLA 1Z2XA 3P71C 4H2BA 4O4KA 2NYMC 3C9FA 3CK2A 2QFPA 4UT3B 1HO5A 2HYPA 1UF3A 3H62B 3H60A 1OI8A 2USHA 5HPEA 2WDFA 4H1YP 4O5GA 4FBKA 2WDCA 4I5LC 2HY1A 2WDDA 3PSNA 4XPNA 1S8EA 3AUZA 1IT6A 3H64A 2Z1AA 1HP1A 3DW8C 3H61A 3QFNA 3QG5C 4UWQA 3DSCA 2Z72A 1USHA 4DSYA 3QFKA 3E0JA 4FBQA 5B8IA 3RL4A 4G9JA 5JPEA 4LTYA 3K7WC 4V0XA 4NZVA 3AV0A 3RQZA 4MOVA 4JA7A 3D03A 4ORCA 4H2IA 2YEQA 4J6OA 5EQVA 3ZTVA 1HPUA 3H69A 2DXLA 1S3LA 3H67A 2XMOA 4FBWA 4O24A 1WAO1 1WARA 1MF8A 3TGHA 3FGAC 3IVDA 1II7A 4UT2A 2O8AA 2Z06A 4MOYA 1KBPA 3HVQA 3THNA 2GJUA 3N5UA 5JJTA 3RL5A 4OR9A 3GVEA 4KKZA 4TUGA 5GTUA 5F3WA 2WDEA 3QFOA 4HD0A 4ORBA 5C1VA 1SU1A 3LL8A 4V0WA 3IB8A 5DNYA 4DT2A 1S3MA 3E7AA 2ZOAA 2NYLC 2BQ8X 1JK7A 1T71A 2YVTA 3DSDA 3ZU0A 4KBPA 2IAEC 4ZX2A 1S70A 3THOB 3C5WC 3EGHA 4I5NC 1XZWA 4JA9A 4TUIA 2ZBMA 3FLOA 1TCOA 4LU9A 3IVEA 1S3NA 2P6BA 3IB7A 1U32A 5JPFA 2BCDA 1OIEA 2DFJA 2IE3C 3H66A 4B2OA 2CV9A 2KKNA 2QFRA 1QHWA 1OIDA 5J28A 4V0VA 2ZO9B 5INBA 2NPPC 4UT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL3 A;  3EGG A;  2O8G A;  1Z2W A;  1AUI A;  4ORA A;  1FJM A;  1NNW A;  2HYO A;  4ZVZ A;  4F0Z A;  2R17 A;  3K7V C;  4H2F A;  4Q7F A;  1S95 A;  2NXF A;  2Q8U A;  1T70 A;  2JOG A;  2QJC A;  3E7B A;  4IL1 A;  2AHD A;  1XM7 A;  4H1S A;  4O43 A;  4IYP C;  1M63 A;  2BDX A;  4MP0 A;  4YKE A;  1QFC A;  2A22 A;  3T1I A;  3ICF A;  3PSO A;  4H2G A;  4WWL A;  5IOH A;  1G5B A;  4M0V A;  3H63 A;  3V4Y A;  1UTE A;  3QFM A;  4FCX A;  3JYF A;  3KBP A;  3H68 A;  4LAC C;  1W24 A;  1V73 A;  2IE4 C;  4DHL A;  1Z2X A;  3P71 C;  4H2B A;  4O4K A;  2NYM C;  3C9F A;  3CK2 A;  2QFP A;  4UT3 B;  1HO5 A;  2HYP A;  1UF3 A;  3H62 B;  3H60 A;  1OI8 A;  2USH A;  5HPE A;  2WDF A;  4H1Y P;  4O5G A;  4FBK A;  2WDC A;  4I5L C;  2HY1 A;  2WDD A;  3PSN A;  4XPN A;  1S8E A;  3AUZ A;  1IT6 A;  3H64 A;  2Z1A A;  1HP1 A;  3DW8 C;  3H61 A;  3QFN A;  3QG5 C;  4UWQ A;  3DSC A;  2Z72 A;  1USH A;  4DSY A;  3QFK A;  4FBQ A;  5B8I A;  3RL4 A;  4G9J A;  5JPE A;  4LTY A;  3K7W C;  4V0X A;  4NZV A;  3AV0 A;  3RQZ A;  4MOV A;  4JA7 A;  4ORC A;  4H2I A;  4J6O A;  5EQV A;  3ZTV A;  1HPU A;  3H69 A;  1S3L A;  3H67 A;  2XMO A;  4FBW A;  4O24 A;  1WAO 1;  1WAR A;  1MF8 A;  3TGH A;  3FGA C;  3IVD A;  1II7 A;  4UT2 A;  2O8A A;  2Z06 A;  4MOY A;  1KBP A;  3HVQ A;  3THN A;  2GJU A;  3N5U A;  5JJT A;  3RL5 A;  4OR9 A;  3GVE A;  4KKZ A;  4TUG A;  5GTU A;  5F3W A;  2WDE A;  3QFO A;  4HD0 A;  4ORB A;  5C1V A;  1SU1 A;  3LL8 A;  4V0W A;  3IB8 A;  5DNY A;  4DT2 A;  1S3M A;  3E7A A;  2NYL C;  2BQ8 X;  1JK7 A;  1T71 A;  2YVT A;  3DSD A;  3ZU0 A;  4KBP A;  2IAE C;  4ZX2 A;  1S70 A;  3THO B;  3C5W C;  3EGH A;  4I5N C;  1XZW A;  4JA9 A;  4TUI A;  2ZBM A;  1TCO A;  4LU9 A;  3IVE A;  1S3N A;  2P6B A;  3IB7 A;  1U32 A;  5JPF A;  2BCD A;  1OIE A;  2DFJ A;  2IE3 C;  3H66 A;  4B2O A;  2CV9 A;  2KKN A;  2QFR A;  1QHW A;  1OID A;  5J28 A;  4V0V A;  5INB A;  2NPP C;  4UT3 A; 
#chains in the Genus database with same CATH topology
 3RL3 A;  3EGG A;  2O8G A;  1Z2W A;  1AUI A;  4ORA A;  1FJM A;  1NNW A;  2HYO A;  4ZVZ A;  4F0Z A;  2R17 A;  3K7V C;  4H2F A;  4Q7F A;  1S95 A;  2DXN A;  2NXF A;  2Q8U A;  1T70 A;  2JOG A;  2QJC A;  3E7B A;  4IL1 A;  2AHD A;  1XM7 A;  4H1S A;  4O43 A;  4IYP C;  1M63 A;  2BDX A;  4MP0 A;  4YKE A;  1QFC A;  2A22 A;  3T1I A;  3ICF A;  3PSO A;  4H2G A;  4WWL A;  5IOH A;  1G5B A;  4M0V A;  3H63 A;  3V4Y A;  1UTE A;  3QFM A;  4FCX A;  3JYF A;  3KBP A;  3H68 A;  4LAC C;  1W24 A;  1V73 A;  2IE4 C;  4DHL A;  1Z2X A;  3P71 C;  4H2B A;  4O4K A;  2NYM C;  3C9F A;  3CK2 A;  2QFP A;  4UT3 B;  1HO5 A;  2HYP A;  1UF3 A;  3H62 B;  3H60 A;  1OI8 A;  2USH A;  5HPE A;  2WDF A;  4H1Y P;  4O5G A;  4FBK A;  2WDC A;  4I5L C;  2HY1 A;  2WDD A;  3PSN A;  4XPN A;  1S8E A;  3AUZ A;  1IT6 A;  3H64 A;  2Z1A A;  1HP1 A;  3DW8 C;  3H61 A;  3QFN A;  3QG5 C;  4UWQ A;  3DSC A;  2Z72 A;  1USH A;  4DSY A;  3QFK A;  3E0J A;  4FBQ A;  5B8I A;  3RL4 A;  4G9J A;  5JPE A;  4LTY A;  3K7W C;  4V0X A;  4NZV A;  3AV0 A;  3RQZ A;  4MOV A;  4JA7 A;  3D03 A;  4ORC A;  4H2I A;  2YEQ A;  4J6O A;  5EQV A;  3ZTV A;  1HPU A;  3H69 A;  2DXL A;  1S3L A;  3H67 A;  2XMO A;  4FBW A;  4O24 A;  1WAO 1;  1WAR A;  1MF8 A;  3TGH A;  3FGA C;  3IVD A;  1II7 A;  4UT2 A;  2O8A A;  2Z06 A;  4MOY A;  1KBP A;  3HVQ A;  3THN A;  2GJU A;  3N5U A;  5JJT A;  3RL5 A;  4OR9 A;  3GVE A;  4KKZ A;  4TUG A;  5GTU A;  5F3W A;  2WDE A;  3QFO A;  4HD0 A;  4ORB A;  5C1V A;  1SU1 A;  3LL8 A;  4V0W A;  3IB8 A;  5DNY A;  4DT2 A;  1S3M A;  3E7A A;  2ZOA A;  2NYL C;  2BQ8 X;  1JK7 A;  1T71 A;  2YVT A;  3DSD A;  3ZU0 A;  4KBP A;  2IAE C;  4ZX2 A;  1S70 A;  3THO B;  3C5W C;  3EGH A;  4I5N C;  1XZW A;  4JA9 A;  4TUI A;  2ZBM A;  3FLO A;  1TCO A;  4LU9 A;  3IVE A;  1S3N A;  2P6B A;  3IB7 A;  1U32 A;  5JPF A;  2BCD A;  1OIE A;  2DFJ A;  2IE3 C;  3H66 A;  4B2O A;  2CV9 A;  2KKN A;  2QFR A;  1QHW A;  1OID A;  5J28 A;  4V0V A;  2ZO9 B;  5INB A;  2NPP C;  4UT3 A; 
#chains in the Genus database with same CATH homology
 3RL3 A;  3EGG A;  2O8G A;  1Z2W A;  1AUI A;  4ORA A;  1FJM A;  1NNW A;  2HYO A;  4ZVZ A;  4F0Z A;  2R17 A;  3K7V C;  4H2F A;  4Q7F A;  1S95 A;  2DXN A;  2NXF A;  2Q8U A;  1T70 A;  2JOG A;  2QJC A;  3E7B A;  4IL1 A;  2AHD A;  1XM7 A;  4H1S A;  4O43 A;  4IYP C;  1M63 A;  2BDX A;  4MP0 A;  4YKE A;  1QFC A;  2A22 A;  3T1I A;  3ICF A;  3PSO A;  4H2G A;  4WWL A;  5IOH A;  1G5B A;  4M0V A;  3H63 A;  3V4Y A;  1UTE A;  3QFM A;  4FCX A;  3JYF A;  3KBP A;  3H68 A;  4LAC C;  1W24 A;  1V73 A;  2IE4 C;  4DHL A;  1Z2X A;  3P71 C;  4H2B A;  4O4K A;  2NYM C;  3C9F A;  3CK2 A;  2QFP A;  4UT3 B;  1HO5 A;  2HYP A;  1UF3 A;  3H62 B;  3H60 A;  1OI8 A;  2USH A;  5HPE A;  2WDF A;  4H1Y P;  4O5G A;  4FBK A;  2WDC A;  4I5L C;  2HY1 A;  2WDD A;  3PSN A;  4XPN A;  1S8E A;  3AUZ A;  1IT6 A;  3H64 A;  2Z1A A;  1HP1 A;  3DW8 C;  3H61 A;  3QFN A;  3QG5 C;  4UWQ A;  3DSC A;  2Z72 A;  1USH A;  4DSY A;  3QFK A;  3E0J A;  4FBQ A;  5B8I A;  3RL4 A;  4G9J A;  5JPE A;  4LTY A;  3K7W C;  4V0X A;  4NZV A;  3AV0 A;  3RQZ A;  4MOV A;  4JA7 A;  3D03 A;  4ORC A;  4H2I A;  2YEQ A;  4J6O A;  5EQV A;  3ZTV A;  1HPU A;  3H69 A;  2DXL A;  1S3L A;  3H67 A;  2XMO A;  4FBW A;  4O24 A;  1WAO 1;  1WAR A;  1MF8 A;  3TGH A;  3FGA C;  3IVD A;  1II7 A;  4UT2 A;  2O8A A;  2Z06 A;  4MOY A;  1KBP A;  3HVQ A;  3THN A;  2GJU A;  3N5U A;  5JJT A;  3RL5 A;  4OR9 A;  3GVE A;  4KKZ A;  4TUG A;  5GTU A;  5F3W A;  2WDE A;  3QFO A;  4HD0 A;  4ORB A;  5C1V A;  1SU1 A;  3LL8 A;  4V0W A;  3IB8 A;  5DNY A;  4DT2 A;  1S3M A;  3E7A A;  2ZOA A;  2NYL C;  2BQ8 X;  1JK7 A;  1T71 A;  2YVT A;  3DSD A;  3ZU0 A;  4KBP A;  2IAE C;  4ZX2 A;  1S70 A;  3THO B;  3C5W C;  3EGH A;  4I5N C;  1XZW A;  4JA9 A;  4TUI A;  2ZBM A;  3FLO A;  1TCO A;  4LU9 A;  3IVE A;  1S3N A;  2P6B A;  3IB7 A;  1U32 A;  5JPF A;  2BCD A;  1OIE A;  2DFJ A;  2IE3 C;  3H66 A;  4B2O A;  2CV9 A;  2KKN A;  2QFR A;  1QHW A;  1OID A;  5J28 A;  4V0V A;  2ZO9 B;  5INB A;  2NPP C;  4UT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...