3C5WP

Complex between pp2a-specific methylesterase pme-1 and pp2a core enzyme
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
296
structure length
294
Chain Sequence
RDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHAMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCKPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PP2A A subunit
publication title Structural mechanism of demethylation and inactivation of protein phosphatase 2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 294
sequence length 296
ec nomenclature ec 3.1.1.89: Protein phosphatase methylesterase-1.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c5wP00
4BC1A 4Q82A 1H2ZA 3MGAA 2HA2A 5AK5A 1XZDA 2WHRA 4Y2VA 3ICVA 1Q84A 5BWBA 1P0MA 3WZMA 4B82A 2XMQA 1OILA 4NVRA 1XRNA 3EQ9A 5AOCA 3BF8A 5LYYA 4H7HA 3WK7A 3I2KA 3YASA 4KYVA 4HXFB 3H17A 3R3WA 5HF9A 1XRRA 5CXUA 5AI6A 1JU4A 1TKRA 1HL7A 1C7JA 1UZAA 3H18A 1A7UA 4NS4A 4FNGA 4OB6A 5CT9A 3C5VA 5DTIA 3T4UA 4BAGA 2VJAA 3B3QA 4RPCA 5AOBA 3PE6A 1XRQA 1NX9A 1ZGCA 4TGLA 3UUEA 1EDDA 1XQWA 5AM1A 2Z8XA 4E14A 4BTLA 3AUKA 4FHZA 4ZRDA 5ALHA 1C4XA 3HACA 4J0HA 3W04A 1JI3A 2Z8ZA 2EDCA 2PSHA 1ORVA 2QS9A 4C87A 1UKAA 4KRXA 3PDCA 2WIJA 2CUTA 3KDAA 1GXSA 3O4HA 4U2FA 3O4GA 2Q0XA 5FRDA 1JMYA 3K6KA 1L7QA 4W9RA 5I9IA 3Q8WA 1GQSA 4CCYA 4WFJA 3B5EA 5AI4A 2WLSA 3C6BA 1ZIXA 4ZXFA 1FFAA 2DFPA 4ZV7A 4Y2TA 3V1MA 5AI0A 2XDWA 2ACEA 4DIUA 1Y37A 3O4IA 5FPQA 5CT6A 2RAUA 4GHWA 5CH3A 5AIBA 2ZYHA 2K2QB 4H7EA 3R0VA 2XMRA 4LYEA 3LIPA 2AJBA 2XUKA 2HU8A 3AIKA 4G9EA 1CUGA 1CUSA 3DLTA 5HK8A 1AMNA 4QE3A 5DLPA 5D3ZA 3FOBA 2CBGA 2HHAA 5JAHA 5ALSA 1CUDA 1WHSA 5JASA 3IUQA 5AKJA 1QFSA 1OXMA 2DCMA 1SFRA 2FUKA 4UHFA 2AJ8A 1TCCA 4X3CA 2WU4A 1DWOA 4ARAA 4AZ3A 4Q3LA 1EB9A 1XFDA 4UBOA 4AMYA 2ZYSA 2HA3A 1MX5A 2WG0A 1WHTA 1SC9A 4L9AA 3K9BA 4RGYA 3MUNA 1S8OA 2BUAA 5F4ZA 3VISA 5EIHA 4RNCA 5JD4A 1ZD3A 4L3WA 2QM0A 4ZV9A 5CH8A 3DNMA 1EVQA 1BU8A 3SWWA 3GELA 4AZ0A 3G9ZA 4X00A 3E1GA 1EA5A 1O6GA 5JANA 1MT3A 5LZ8A 2OAGA 3FWHA 1CUHA 5EIEA 3QITA 1QIGA 4DM7A 4HXGA 5C8VA 5A6VA 1W1IA 2PKYX 3STXA 1VLQA 3WI7A 4WY8A 3QMMA 2OGSA 3GBSA 4EY7A 2VAXA 4NZZA 1E89A 5IVKA 5ALRA 5IVDA 5ALIA 1VKHA 5DNVA 4U2CA 1KU0A 3TEJA 1X2EA 5LP1A 1WOMA 3OC0A 2XI4A 3TGLA 1A88A 3HZOA 4H0CA 2E3JA 5C8ZA 1CUFA 1CR6A 2XQKA 1GKKA 5KBYA 2HDWA 4FWBA 4OYYA 2HL6A 4AQDA 4C88A 1D07A 3HEAA 4Y2QA 2O2GA 1CUXA 2JGFA 3KD2A 2ONCA 5D6OA 3D4LA 4GXNA 4UFNA 7YASA 2HA6A 3WWEA 1EK1A 2QXUA 4MQLA 3DKRA 3I28A 4J0JA 1DU4A 2HFJA 3H0CA 2BJHA 3D5EA 5A62A 5IVIA 1UOQA 2DR0A 2ZVDA 3ED1A 3L1JA 1J06A 4UHDA 1GZ7A 3WA6A 2YYSA 3HSSA 4S0XA 1T4MA 4EZIA 1MTZA 4QDZA 3B12A 4EHBA 4FKBA 5K3FA 2C5GA 3Q0TA 5SYMA 2LIPA 5SYNA 4PV7A 3WJ1A 1U65A 1J1IA 4BRSA 1XROA 3CCBA 3DD5A 2J4CA 4J0GA 5CH5A 6YASA 2JGIA 3G0IA 4N5IX 4E15A 3AIMA 4UFPA 1ZD4A 2WJ3A 4X71A 1C7IA 4GW3A 4BBZA 5ALTA 2QOEA 2OG1A 5AM2A 5DNUA 3FYUA 2XMSA 3K2IA 5H3HA 4AO8A 4FNMA 1QJ4A 2GBFA 4BATA 4DNPA 3M3DA 3T52A 4B80A 1MX1A 4X7BA 1JFRA 4ZI5A 5JATA 1TAHA 4NMWA 4DMHA 1G66A 2VJCA 3S8YA 4J0CA 4RE6A 4G4IA 5T4FA 3RM3A 3G7NA 3AZPA 1N5RA 2BKLA 4G4GA 5JD5A 2WIGA 3JYHA 4MEBA 4Y2UA 3H04A 4G5XA 1SCIA 3D0KA 1CIJA 4JH0A 3BWXA 4JNCA 4JEIA 5EHQA 4Y2SA 4GECA 4HRXA 4K5QA 5ALOA 3HABA 3OPMA 1UOOA 1VJ5A 3DYIA 2JGJA 2QZPA 3C6YA 4LXIA 5BV7A 3BDIA 1TK3A 3ESCA 2HRRA 5D3KA 4DLNA 2XT0A 3WKDA 1RYYA 1YAJA 3O9MA 5CT4A 4XX1A 1GGVA 1WPXA 1WB6A 3TRDA 2C58A 2GBGA 5CXXA 4M0MA 4AX4A 2Y2UA 3R3VA 4UHHA 2D5LA 4YK7A 4F0JA 2G5PA 3NOXA 3ESBA 4WDRA 3BXPA 4LXHA 2DHCA 4JYMA 1CUYA 2CKMA 1UFOA 3FLBA 1UK6A 4BCCA 1CV2A 5CT8A 1JJFA 5AKLA 1DX4A 3DDUA 5IKXA 4PO3X 3AZQA 1JKMA 5LKAA 4X6YA 2OGTA 4H7JA 5HKBA 4X90A 4FBLA 1QO7A 2ZJ6A 2RIPA 5K3CA 1W52X 1ZI8A 4N8SA 1XZFA 1U2EA 1KEZA 1JT2A 4GI1A 1DT3A 3ANTA 3VJMA 3WL5A 2QTBA 4KE6A 3I1IA 3WKEA 1GPKA 1UOPA 4LYDA 3WK8A 5CT5A 5JYCA 4UBJA 2OLEA 2YXPX 2HADA 3LIIA 4J7AA 3HLKA 3QBJA 2HFKA 5DWDA 1EINA 3RK4A 2G5TA 1YS2X 1H2WA 1XKLA 2GYUA 3DYVA 1YB6A 2PVSA 3IA2A 4Y7DA 1PV1A 2XE4A 3QMWA 2XUAA 3C87A 5ALFA 4Q1VA 1R50A 4X6XA 4UBLA 3VVMA 5FXMA 4BVJA 5CTAA 3AINA 4AN0A 1IUPA 3WL7A 1WCYA 4N5HX 3DOIA 1AKNA 5LZ9A 2YH2A 4DMFA 2BGRA 3DCNA 2YASA 1LGYA 4J3JA 3ZPXA 1CEXA 1UT6A 2O7VA 1ZD2P 4QZVA 2PX6A 4QEKA 4CG1A 4GEGA 1LPSA 1E8NA 4IH9A 3F97A 4A5SA 3PFBA 4Q3KA 1MO2A 3KWFA 3MVEA 4XWGA 5CRIA 3SX4A 4AO7A 1CUJA 3FBWA 2FJPA 2Y6UA 3I6MA 3FCYA 3F96A 2HA5A 5FDFA 1FSSA 3I2FA 2AJLI 5AKKA 2XUGA 1DX6A 2XMCA 4BRZA 3A2NA 1ISPA 3H1BA 3D59A 3PICA 2ES4A 2FX5A 4KAAA 4DSAA 3ZLTA 1UK9A 2WG1A 5FPPA 1IZ7A 3LS2A 4LKOA 1GPNA 4EUSA 2R11A 3WIBA 1Y7HA 1W76A 1XRMA 4WDQA 2OCKA 1BEEA 3QH4A 3R3XA 1G4HA 1MJ5A 2WTNA 4U2GA 1N8SA 3ICWA 4X94A 4Y2RA 2XMDA 2GZSA 2VAVA 3BE8A 1IUNA 1CUUA 3WWDA 3WK6A 3AILA 1LPBB 2VSQA 5ALQA 5AKXA 2IX9A 1F8UA 2C4HA 3C6XA 5A7FA 2PPLA 3BIXA 4AO6A 4QWMA 3WMRA 1VZ2A 2OCLA 4WFKA 2O2HA 2WIDA 4FTWA 3UMJA 1DWPA 1EVEA 2B61A 2WU3A 2XQIA 5AP9A 3W9BA 3H2IA 1ZICA 4AMZA 1BS9A 1WM1A 2PU7A 3V9AA 5DYYA 2XUOA 3C70A 3DJYA 1XLVA 3LCRA 5A71A 1JJIA 2I78A 3G8YA 5YASA 3LP5A 2OCIA 2O2IA 5CMLA 3I6YA 2CMFA 2WUDA 3ESDA 4CG3A 1N1MA 1J07A 1A8UA 1K63A 3STYA 1Q0ZA 5K3DA 2OCGA 3NGMA 2OXEA 2WFLB 1CUBA 2HRQA 4GLBA 3V1LA 5JZBA 1F6WA 4M0EA 4C6HA 4O08A 3QVMA 4PF1A 2G63A 2HU5A 4AN1A 5T4EA 5ALLA 3V1NA 3R3YA 3H2HA 5ISMA 1CQZA 3IBTA 1ACLA 5AICA 4I4CA 2ZSHA 5LKRA 2XQGA 3W05A 3DS8A 1GPLA 3QPCA 2H7YA 2QMQA 4W1PA 3I2JA 3C6ZA 4L0CA 3FSGA 5ALUA 2VJDA 1FFBA 5AKHA 4KR0A 5KWJA 5HQ3B 2ZSIA 3G0BA 5ALNA 2WUEA 2XLBA 1XZHA 4K2AA 3G9TA 1X70A 5EFZA 4Y9SA 4P9NA 3VKFA 4X91A 1AC5A 3FCXA 4J0IA 1WPRA 3BL8A 2ZJFA 2WHPA 2XUFA 1I6WA 5LZ7A 4TVKA 1CUCA 4W63A 1IUOA 2WIKA 1CPYA 4UPDA 1EB8A 5AKGA 3H2GA 4OU4A 5DJ5A 3W9UA 1KU6A 1E8DA 4CIBA 5HFNA 1H2XA 4N8EA 2XUDA 4BP9A 5ALYA 1DQYA 3OOSA 2VT6A 3EBLA 2V97A 1QIMA 2ZJ7A 2IIVA 2EEPA 5ALMA 1WB5A 1XLUA 3KWJA 5HFAA 4G9GA 5JARA 3PF9A 5LLSA 4MWTA 1XZMA 2Z3WA 1L7AA 4J03A 1YR2A 2VA9A 3M83A 5C81A 4Y2PA 2ZYRA 1O6FA 1UKCA 4BZWA 3HJUA 3H2JA 4YX9A 2CJPA 2CB9A 5HF8A 1CFJA 3R41A 1EI9A 3DOHA 1B41A 5AOAA 3JW8A 3D2BA 3FYUC 3ESAA 2DHDA 5HZGA 1RWQA 1CQWA 3AJAA 4E11A 2WSLA 3TJMA 4WFIA 2PSDA 3H2KA 3QM1A 1F0NA 4G4JA 4Q05A 4H77A 1L7RA 1TCBA 5AK6A 1YA8A 2WHQA 4DNFA 5ALXA 2PU5A 5HF6A 5JZSA 5JADA 3O0DA 1UKBA 5AI8A 4UBKA 1XZAA 5A2GA 2XLCA 4CCYB 3VJKA 2XQJA 1ZJ4A 5K3BA 1AQLA 3RARA 1QONA 1WB4A 3V1KA 1X2BA 4MYSA 2C5FA 3HYSA 5FUMA 3I1YA 4B85A 2BUCA 1ZOIA 1AZWA 3HRHA 2J3DA 4J0DA 3BJMA 1GQRA 2WFMA 2Y6VA 4FMPA 4QDTA 5JALA 2WUFA 1ODCA 3C43A 4OYLA 5LIPA 1CVLA 3D2AA 4F60A 5ALKA 5EGNA 1THGA 5AK3A 5JAPA 2GBIA 5AH0A 5C8XA 2RONA 4LHEA 3WZLA 1XKTA 2PL5A 2NW6A 4ZREA 1EDEA 4EA6A 4HZGA 4MXDA 3KOOA 4KRYA 5FKJA 4OD0A 4XVCA 4B84A 3R3ZA 2WJ6A 2WUGA 1VXOA 1FFDA 2OGZA 4MQMA 2XB6A 5A7HA 1MNAA 1DINA 2D0DA 4C01A 4B7ZA 4EY8A 3DKKA 3EF3A 4EY4A 4YPVA 4B81A 1SOMA 3MUOA 4DYHA 1R4ZA 1XQVA 1VOTA 4AB1A 1EXWA 2VQ6A 4PW0A 4BDTA 4UBNA 4Y2XA 3O95A 5T4HA 1QOZA 1QFMA 3F98A 1FFEA 2CEKA 1MX9A 2QVBA 4BB0A 5JAUA 4MEAA 5KREA 3IB3A 2WJ4A 4X85A 4C4XA 3ILSA 2JEYA 1MNQA 5EHZA 1YA4A 1W6RA 3VXKA 2DQZA 1CUVA 5ALPA 4HS9A 1TCAA 5AK4A 5JZ9A 4GWLA 3N0TA 2R8BA 1EH5A 3OG9A 3IIIA 3BF7A 3D2CA 1F0PA 4B0PA 1HQDA 5K5EA 2XQFA 5EI5A 1ZGBA 3C8HA 1JU3A 1K6EA 1MAHA 2GYWA 4P92A 5DNWA 4DMCA 4F5ZA 2HIHA 4W1QA 1QLWA 3WKCA 3I6ZA 1IMJA 4KAFA 4M0FA 5K3AA 3I2GA 1A8QA 2JGLA 2PM8A 4UHBA 2O7RA 4HXEB 3GROA 1USWA 4BE9A 1QIIA 3X3HA 3A2MA 4FLMA 1XZLA 3U1TA 5IH7A 3STWA 1GT6A 4MYDA 1AX9A 5I7UA 2PSFA 2WTMA 1JJBA 1QIKA 3CN9A 3P2MA 4OB7A 3QYJA 4IO0A 2X8BA 5AI5A 4EB0A 2VJBA 1ORWA 3E0XA 4CI9A 1P0IA 3HI4A 1J2EA 3EQ8A 2XUIA 2ACKA 1LBSA 4QLAA 1U8EA 1T2NA 3F67A 4LIPD 5BOVA 5K3FB 2B9VA 1SCKA 3G0CA 2C0QA 5ESRA 2BAGA 1ODTC 1AURA 1QIEA 4OPMA 4G1FA 1FFCA 3WKAA 1VE7A 5ALVA 1MPXA 1LZKA 1LPMA 2AXEA 2QJRA 5AI9A 5JAOA 2HA4A 2C0PA 1W4LA 5AM3A 4X95A 4MJ3A 4F21A 2WIFA 3G9UA 2JEZA 3WJ2A 4IH1A 5E2IA 2OPHA 3I2IA 1H2YA 1P0QA 2JGEA 3FYUB 2X76A 1CRLA 3WWOA 1XLWA 5AIAA 4KE7A 4FFWA 2OQIA 4CIAA 3FVRA 2I3DA 1LPAB 4Z49A 5DTJA 2XMBA 3QPDA 4HVTA 4UHEA 4LXGA 3WKBA 3DEAA 3G9XA 3A6ZA 2Z5GA 3WK4A 1XQXA 3PI6A 4QDOA 3FLEA 5DYWA 3AZOA 1MAAA 3ZLUA 1BRTA 1LPOA 5AKIA 1TRHA 2XUQA 4L72A 3PUHA 1M33A 4KE8A 5AKEA 4MWSA 1Q0RA 3G0GA 3ZLVA 5FP0A 5ALDA 1ETHA 4OUKX 3W06A 1XRLA 4W1SA 3QZUA 3E3AA 2V96A 4FFVA 1XZIA 1XZKA 3WL8A 4D9JA 5CBKA 5BWCA 4OCZA 2H7XA 1DT5A 5DYTA 1MU0A 3IVMA 4ZGBA 1EX9A 1VXRA 3RKSA 1LBTA 4BAUA 3O9VA 1YASA 1AGYA 5I8PA 3L1HA 1UK8A 4KJXA 4X92A 4JUIA 3EIOA 1CUZA 1EHYA 2B4KA 2DQYA 2QT9A 1U4NA 4JYPA 1Z68A 4HTAA 5ALEA 5AKYA 1BEZA 3OM8A 4HRYA 4AXBA 1NU6A 1HBJA 2BFNA 2Y1KA 3WLAA 4BVLA 1YCDA 3I2HA 1BCRA 2BUBA 4PSUA 2HA0A 2J3QA 2VTVA 4FOLA 2VATA 5E4YA 4PSDA 1QIDA 2W6CX 4UHCA 4QA9A 1BROA 4CCWA 1HLGA 5A7GA 1PJAA 3VDXA 5CURA 2H1IA 4DNQA 1ZI9A 1R9NA 2G4LA 5J3JA 3JWEA 4A23A 4V2IA 4A16A 1OCEA 3WK5A 2AJCA 2Z3ZA 5HK9A 2CZQA 4DMKA 2DSNA 3W2TA 4BE4A 3R3UA 1JMKC 1SCQA 1NU8A 1BN7A 3WYDA 5FOQA 4QDXA 3CXUA 5HF5A 2VT7A 2V98A 5LZ4A 1E8MA 1VA4A 2ROQA 2OQVA 1IVYA 3STTA 1UXOA 4UBIA 1VA5A 2XUPA 1MN6A 4G8DA 2QKYA 2JGKA 3NWOA 1QTIA 3ZV7A 2IITA 2JIDA 1XZJA 4E46A 4P08A 4KEAA 3BDVA 1CUEA 2GBCA 3IULA 4HAIA 5ALGA 3WL6A 5JIBA 4IQ4A 3PFCA 1YSCA 4KAJA 3BIWA 3HXKA 5FLKA 1N5MA 3WQHA 4UBMA 4BZZA 1K8QA 3R40A 1IZ8A 4X97A 2EDAA 2X5XA 3BJRA 4GDMA 1R88A 3IUJA 4EY6A 1ZIYA 5IVHA 2HA7A 3KSRA 4C4YA 3SK0A 3IDAA 1RP1A 4I3FA 2QXTA 3L1IA 4H35A 2DHEA 3IUNA 4BCDA 1QIHA 2VF2A 1ZI6A 1Y7IA 3C45A 1CLEA 2H9YA 4FDMA 3DL7A 5FV4A 4BP8A 1BCSA 2P8SA 4J0KA 3VVLA 4G8BA 4TPKA 3FNBA 1LPNA 1W75A 1DWQA 4PQEA 3S2ZA 1YS1X 2PSJA 2XMZA 4H7DA 4N8DA 1P0PA 4RE5A 3OTQA 2JGMA 3WA7A 1ACJA 1R9MA 3SC2A 3VJLA 5AKZA 5ALJA 4B83A 1QIJA 1A8SA 2C7BA 5JD6A 3WWCA 5KWIA 4B9AA 4INZA 3FVTA 5C7YA 4FLEA 4DSZA 1XZEA 4C89A 1FJ2A 4OB8A 5ALWA 5T4BA 1TIBA 4KE9A 3CN7A 1QTRA 4WY5A 5AHXA 1HPLA 3ZI7A 4G8CA 1H23A 1XZGA 4U2DA 4EBBA 5HKAA 5E4JA 5AO9A 1XQYA 3F8SA 4ROTA 2QJWA 5AM4A 3GA7A 3G0DA 1XRPA 4QNNA 5D7BA 4QDUA 1E66A 3U0VA 2XMGA 4BC0A 2B20A 5EHNA 4U2BA 2BGNA 2WQZA 4CFSA 3FLAA 1K4YA 5AM0A 4IHAA 3F9CA 1QO9A 1H22A 4X93A 4QLOA 2BCEA 3WK9A 1DQZA 5AM5A 2WM2A 4H18A 3DL4A 4XJVA 1PFQA 5EIAA 2XUHA 1CUAA 2QRUA 1HDEA 4OSEA 3FYTA 2UZ0A 1CUIA 3M82A 4BDSA 3CCCA 1ZD5A 1QGED 1GKLA 2RGUA 5CW2A 1QIFA 1QZ3A 4WJLA 2ECFA 4DGQA 4FBMA 1LPPA 2V9ZA 5HCUA 1R3DA 1TQHA 1LNSA 1VZ3A 2Y2VA 1CUWA 1UWCA 4Q3OA 4XIIA 1UK7A 3A70A 3C8DA 3IUMA 5EHXA 2WFZA 1ODSA 5ALZA 4K6KA 2RHTA 4BAZA 4ITVA 3STUA 3A2LA 4X6UA 2WHPB 2OAEA 2WG2A 4B6GA 2HU7A 3NUZA 3C5WP 2AJDA 4H7IA 2QUBA 5E4TA 5K3EA 1LZLA 4ZWNA 3FAKA 4BTVA 3GUUA 4BVKA 2PSEA 2FJ0A 3FSGD 1E5TA 2ORYA 1QE3A 4PSCA 1VE6A 3V48A 4GBGA 2JBWA 2RHWA 2HM7A 1LLFA 3AIOA 1XZCA 4WCVA 4H7FA 3IURA 3AFIA 3WYNA 4Y2JA 4B0OA 4K6HA 3STVA 1AUOA 1E3QA 1DTEA 1G42A 2JF0A 1BE0A 1Q83A 2XUJA 3D7RA 3LLCA 1EDBA 2ZYIA 3D3NA 1YB7A 1XZBA 3H19A 1B6GA 4Y2YA 5AJHA 2I3ZA 3WWPA 4ARBA 4BCBA 1YAHA 3HC7A 1K5PA 4K6GA 4U2EA 2PUHA 2W22A 1ZJ5A 3H1AA 4H7KA 3N2ZB 1G5FA 4ETWA 2WFLA 2H7CA 3QPAA 4C4ZA 3EQ7A 2WILA 2WKWA 3KXPA 3OURA 2RI6A 2VEOA 3O4JA 4KACA 3ANSA 4B9EA 2J4FA 4DNOA 1HKHA 4CG2A 4W1RA 3DQZA 2GZRA 1R1DA 3PF8A 3UUFA 2PBLA 5LZ5A 4DTCA 4Q34A 3E4DA 3QMVA 4FLFA 3G02A 4PNZA 2PUJA 3PUIA 2QR5A 3GFFA 1THTA 4BYMA 4EY5A 5HQ3A 4UFOA 2I03A 1BN6A 3WIOA 4YASA 1EK2A 4P93A 4QWWA 3GZJA 3ZWQA 2GYVA 4I19A 3RLIA 4IH4A 4UUQA 3M81A 2QUAA 5LZ2A 4OU5A
chains in the Genus database with same CATH superfamily
4ND2A 2E6KA 4IHJF 1XNJA 5CYOA 3LAWA 3ZVLA 1ENOA 3KJEA 4D96A 3I64A 4ZCLA 3UCFA 1EP2B 1YB5A 3ECAA 4YO8A 1NUPA 1Z17A 4R68A 4B73A 3L5KA 3PJEA 2XBLA 2ORWA 2VDLB 4RZUA 2YY7A 4B82A 3BE6A 2DHQA 3BWVA 4ML3A 3QKUA 3MWJA 1OILA 4NVRA 5LYYA 2JI7A 3BZWA 4H3KB 3JX9A 5AOCA 4A6DA 5KMGA 4U00A 2R25B 3LY9A 5JT1A 2AMYA 3MILA 2XE8A 4PHTA 4OP1A 3WK7A 1VL5A 3K5PA 1JJAA 5AWFC 1ARZA 5BV0A 4JXJA 1QHEA 4KYVA 5ILOA 1D9ZA 1RHQA 4MULA 4ECAA 1VHTA 3GLHB 3NTVA 1G2PA 2QLBA 3EWSA 4ZRNA 1XJ0A 5CXQA 3R3WA 4LGCA 4FOOA 3QFCA 1KAEA 4W5NA 1XRRA 3G59A 1YL6A 3V32A 4YECA 4CI0B 5CXUA 4HDKA 4BBJA 2QLJA 3EAQA 1Z0IA 3LDHA 2Q0HA 1H5NA 3JQ7B 3LQ2A 3NP9A 1FPQA 1GAEO 1T5LA 3L84A 1NNI1 2OQRA 1UXKA 1A7UA 1Q16A 1EWVA 1O57A 2A84A 4GPD1 4CU2A 2YKGA 1KERA 2QDXA 2VJAA 3IP5A 3B3QA 1Y34E 5AOBA 4X3OA 4P33A 4L1KA 1LI4A 1ZGCA 3IAAA 4TGLA 4QG3A 1EG2A 4RF4A 1ZNWA 5BSWA 4GP6A 3GLSA 1W36D 3EGXA 5AM1A 2Z8XA 4YP5A 5E3HA 3A06A 4E14A 3C6KA 2O0KA 2WYHA 2HWKA 5DRTA 4DANA 5JRJA 2EX4A 3RVQA 1S01A 2HH9A 3G2LA 3VMMA 4BTLA 4YUWA 1DC7A 4ZRDA 2HV8A 3DO6A 3FMFA 4COOA 1LTHR 1VL6A 2OCBA 4MP8A 5E9JA 3UAGA 2IHNA 1TM2A 1H0KA 3UJ3X 1MUUA 2IWRA 3T54A 4FBGA 2PSHA 2HLHA 1R15A 2VC2B 3VAAA 1WA5A 4FMDF 3UYLA 5FQOA 3C39A 4C5AA 4C87A 5LIRA 5L6LB 4C7BA 3D8TA 4KRXA 1JKFA 4MRRA 3TZKA 2H07A 1O3YA 2I80A 3LQKA 1H9AA 1PZNA 3ZOZA 2BI8A 3OZTA 4UEQA 3SXUA 5B1HA 3ZHVA 3CGGA 4IUYA 3TLMA 4GVLA 4YT4A 5L9AA 3NGXA 4HQRA 5A0TA 2YDXA 2GESA 5FRDA 2A9RA 2QL6A 1NULA 2DULA 1L7QA 3TLCA 4ZKEA 2V1XA 2VQFB 4WNCA 3Q8WA 1YQWA 3IH5A 3M1IA 5FLEX 2V5AA 4CCYA 3TOCA 3GQBB 4LHVA 2J9FA 4II2A 2SKEA 3B5EA 4US0R 3S2FA 1LRJA 2WLSA 3V6LA 2P2GA 3VHXB 4BEWA 1K98A 4X9XA 1JG2A 1Y1LA 1GRRA 5DWQA 1S1MA 4NCJA 1WXEA 3D1VA 4EHDA 2CLCX 2FFAA 3E53A 3S1AB 1GU0A 3UUGA 1I6KA 5F9MA 3F5MA 4OYRA 5TVGA 4CUKA 4KPYA 1VI5A 3L0YA 2BBSA 3SP1A 1EIWA 1CQPA 4J3FA 5AI0A 4BLQA 4HLQB 3DDHA 3PHHA 1D6MA 4OLHA 2Q3MA 5BR8B 3UJAA 4Z0NA 1ID1A 3EPLA 2Q7XA 3OFJA 5FPQA 3NWPA 5CT6A 3VPBA 5AIBA 4URWR 1T2AA 4Q4JA 5CH3A 4N7JA 4GEKA 4HGPA 1NBOA 2GLTA 1F8XA 1XD2A 3E48A 4Y1GA 2KLBA 3ISTA 1B93A 4LRYA 1XQ9A 2R60A 4XAQA 5E6UB 3P9ZA 2MOKA 2GKSA 5HK8A 5A4MS 1AMNA 1B1AA 1V47A 4R7ZA 1QB7A 2G0AA 4YJ3F 1I4EB 2QI9C 2HTFA 3QLTA 3SDBA 3JD3A 3HYTA 2Q2OA 1Y9DA 4BHTA 2XD4A 5A6SB 2ZJ3A 3VNRA 5EJFA 5EUQB 4LZZA 1YQ9A 1ZNYA 4OHPA 2WIAA 1E3WA 1L5RA 3WS7A 1U2SA 2GBPA 3LVFO 4K0KB 3SOPA 3ABOB 7AT1A 4ONEA 4OX9B 1UIMA 2RKWA 1HH4A 5ALSA 2FPIA 5T41A 3RSOA 3EB9A 4AFNA 5CVTA 1SPXA 1HF3A 1YZUA 1N5OX 2GTHA 3E9QA 4EYSA 2JDID 4LRXA 1R8QA 5JASA 4ZOAA 4I46A 5AKJA 3DPIA 5LQNA 5HQTA 1H8EA 2PA3A 3WGNA 2QTNA 2ZJ4A 3IJPA 1ZO8A 4B34A 4O2BA 3KZNA 2VJPA 2IYLD 3FDXA 3JPYA 3PDJA 3H6KA 4L2IA 1MW9X 5CDYA 2H2DA 2W98A 3FPHA 1MQ9A 1IXYA 3JVDA 4ESEA 2EV9A 4FHDA 1T6ZA 3JQFC 2P9HA 3L9WA 1HDYA 4JENA 3TQQA 2FSVA 2NN3C 4R7TA 3O83A 1W8IA 2P0AA 4RAOA 3F7NA 4ZOBA 3RSZA 1RVDA 5DK6A 1ZCZA 1HEUA 2Y4OA 3P94A 4DDWA 2Z4TA 4TYNA 1Y8QB 1SBNE 3IBCA 5JY6A 3KOXA 5B58T 1XDBA 2HXGA 2C3OA 1YFJA 3PFIA 1UT8A 4JL6A 5DV9A 4K9RA 1AUQA 2CD9A 4HXYA 3RGGA 1XFDA 5FHQA 2DPLA 2CUZA 1YF3A 4LWOA 1FMFA 1BVRA 1NR1A 4UBOA 2HT6A 3L7BA 3BGSA 1M9NA 1GL6A 5C18A 1E9SA 2HREA 4YB8A 1JQEA 1JFVA 3PRKE 4QVGA 2ZVJA 3FOEC 2EG5A 3CEJA 4KKXB 1KI3A 2HIMA 4RGYA 5EQDA 4JS0A 1TOAA 4QU5A 5JS6A 1DZIA 1PT5A 4KWIA 2P9YA 2NACA 5EIHA 3EQ6A 2B98A 4Q7MB 4XCXA 1KDOA 3QSGA 3IR6A 5DT9A 3SQLA 3LFHA 3THYA 3Q12A 2HEGA 2FRDA 4BFUA 3OQ6A 3E8XA 3EGIA 4MVJP 1ISIA 2XXAB 2JJMA 1MOSA 3WGKA 2C88A 3SJZA 2C2HA 2JFPA 1HY3A 3ILHA 4WJZA 1ZVQA 4OL0A 1WKVA 1RAFA 3ND9A 3RYHA 4RD4A 2QTVB 3C3EA 4WUVA 5CR9A 3SYRA 2HW8A 4K86A 4RHEA 4URUR 3R7DA 3QEBZ 1BU8A 3FPLA 4A1OA 3IBGA 4TMFA 3SWWA 2VPTA 1P74A 5HIKA 2IGBA 5JXJA 3H16A 2ZRKA 3BWEA 5DGDA 5F1YA 2GLXA 1NZDA 4MQBA 3GNLA 1SXHA 2QMUA 2TRSB 5GV7A 4MWEA 4ENRA 1AS3A 3HLYA 1CNEA 3FWHA 1CUHA 3EIWA 3G13A 2C3UA 5CDSA 1PGNA 1VB5A 1F8YA 2H4FA 5CDFE 2GCPA 2J4DA 2JIBA 2GZ3A 4JLDA 3TNDA 4PQYA 4G4SO 1N0WA 1EP1B 1M2FA 4G6ZA 1TTPB 2ID8A 4IQ8A 3RF7A 1NDHA 4DF3A 2C4KA 3M4YA 5KNCH 1PSDA 1XI2A 1SXPA 3GRAA 3O1JC 5IARA 3H2YA 4KKVA 3I6QA 4O4LF 1NYRA 5B3LA 4K40A 2PT6A 1IONA 1Y3FE 2JJ1A 1I24A 4OHUA 3FBTA 4PPQA 3A28A 2RARA 1E89A 5ENDA 5F77A 4A2PA 3VR0A 5IVKA 2VAWA 3N87A 1L1QA 3RIMA 1OTHA 1RBZA 5ALIA 4TXNA 1FUEA 3TSWA 4E5YA 5IK2A 1M1YA 2IODA 1PFYA 4YDRA 5C8YA 4FGSA 1X2EA 3WB1A 3V4LA 1O6BA 4JJAA 1WOMA 2I67A 3GD7A 4X66B 3QG1A 4ACBA 4AKSA 3TGLA 3G89A 4NNJA 2B5VA 3T5CA 1A88A 2IS4A 1TI7A 2F3PA 4D4MA 5K8JB 4WASA 2ISSD 1VLVA 4GKJB 1KZ1A 1CUFA 1QK5A 1RHMA 2ZSDA 1CR6A 3OX1A 3OKPA 1QH8A 1KR2A 1P1CA 2PUVA 2W7TA 3AETB 1X42A 2BCJQ 3RT1A 3ZLBA 4ERXA 3C3AA 3H5AA 3PK0A 4B3DA 4FWBA 3E0QA 4CT0A 3R24A 3L4KA 4HUTA 5BW8A 3VSDA 1L5VA 4C88A 4R40A 4CEHA 3KP1A 1O6CA 3KR0A 2JGFA 4XI9A 5J2TF 4NE2A 4YHHB 3DPUA 2WSYB 3BAZA 3HWRA 2Y1GA 4EHFA 2ZI5A 4QU9A 1RHKA 1KI2A 5EXSA 3DEKA 3WWEA 3GVHA 1C3VA 3QGMA 4B2PA 1POXA 4G8JA 4BYGA 4MQLA 5ICGA 1XCJA 3N0VA 2VRNA 1V71A 2XB2A 2CHEA 1C50A 2A9JA 2IEGA 1GZ5A 1PR6A 3BFJA 3OU6A 1Z73A 3D5EA 2BZ0A 2X0KA 4NQRA 4RHFA 1E1QA 4DLBA 1P4RA 3WAGA 2AFHB 3CCFA 4TL6A 2DR0A 1YL7A 1MRZA 3UWKA 3LQRA 1DLIA 3QLJA 3L1JA 3DTVB 3VR2A 1RM0A 4DJDC 1CXZA 1GA4A 2A0YA 2BFAA 2OZLA 4OAOA 1E2MA 1KMMA 1TK9A 2LW7A 3WA6A 3WGOA 4RMHA 1MP0A 1L5QA 1JHQA 2YYSA 4YONB 4R1QA 5T3UA 3TQOA 4EZIA 3M4JA 2VHEA 4XDGA 1M67A 1N9KA 1OU4A 4ZO7A 4EPYA 3MMNA 2P9JA 1WZIA 3OO0A 2ZVPX 2R4TA 3PE4A 1BOFA 2E4YA 4TS3A 1MV8A 3O84A 4L07A 5CW1A 5DNAA 2HQRA 2O2ZA 2VBFA 2PQ2A 5BR4A 2GAIA 2P90A 2EBWA 2W71A 4B75A 5KTNA 3UT5A 2GA8A 3ZE0B 3BL5A 5IM5A 2LIPA 4GL4A 5SYMA 3EA4A 5SYNA 1XP5A 2NSJA 4UTXA 1ULTA 4PV7A 5JSYA 3LX5A 5B2ZA 2X0DA 1S02A 1W5AA 2CY0A 2JHCA 4Y6SA 3L6DA 4QRDA 5AUQA 5TX7A 1T9BA 3MD9A 4DA0A 4FT2A 3QOYA 5CH5A 3VR5A 2JGIA 1Z82A 4K03A 3EUAA 5PGMA 4BNYA 3MWFA 5D87A 3ZE6A 4E15A 4CM8B 3NHWA 4KXWA 4NG4A 3L01A 4QUHA 2IDJA 2YR0A 3BXGA 3BWDD 4DB4A 2XZDA 2A1UB 4MPJA 4ZP1A 1X77A 4EUHA 3AIMA 5LD2C 5BSRA 3K31A 4UFPA 4XCQA 4A27A 1EESA 1W6UA 1E9CA 2QT1A 1Q7GA 2WJ3A 4JI3B 4CTNA 2DFNA 4LZWA 1DIRA 5AW7A 4GW3A 2P6PA 1Q77A 4LE2A 4PYOA 4ZCPA 1JW9B 1SC1A 5J4VA 2HMYB 4WOPA 2CSUA 1QYDA 1E4VA 3FYUA 4JY7A 3DYBA 2H57A 4RADA 3AY6A 3IDQA 1MPTA 4KOAA 5H3HA 2BMWA 5KTRA 4AO8A 3E2IA 1KYIA 4FNMA 3U0BA 2JFQA 3BMCA 2NXNA 3M5PA 2BGGA 1SHTX 2RCYA 1JIXA 2PFGA 1ZH6A 4RIHA 1PFGA 3DBOB 4UUMA 4D3SA 2DETA 3M3DA 3BT7A 2GN4A 3DVRX 5C4GB 4Q6BA 1A2KC 1G64A 5JATA 3UXEA 4NMWA 3OVMA 4Z6KA 4XIFA 3DZFA 4QQFA 4D9KA 5FAKA 2J85A 5TGDA 2UKDA 2W4MA 3R7LA 2BZ1A 3BA1A 3QSYA 1YTUA 1DJQA 2DQ4A 4CUZA 2A35A 4RE6A 2ZWAA 5DSXA 4UMVA 2RGCA 2DWPA 2YVAA 3OMLA 3RIYA 3OZGA 1J33A 5P8WA 5GM2A 2RAFA 3TQCA 1G8SA 3VPDA 2N42A 2IT1A 4MV4A 4G4GA 1P2SA 4RCYA 2I7DA 1D09A 3CZAA 1I3CA 2J9GA 4MEBA 3RSFA 4X62B 3RAGA 1U3GA 3CH7A 1T9GR 4TV9A 1U9IA 3IR5A 3JTMA 1SIBE 1W59A 3I53A 1CIJA 2C4WA 4NMMA 4CFYA 1W46A 1I3KA 2QX4A 3UW1A 5IVPA 4LZOA 2AIRA 1DJOA 3BWXA 4KR3A 1Z2AA 1YACA 2R5FA 1KC3A 3GU3A 3KVNA 1XMPA 2DKFA 2FW6A 2RH4A 3IPCA 3K5IA 3QU4A 3VI3B 4JEIA 3Q8KA 3FNEA 5HW0A 1WW3A 3WSVA 2I6UA 1IG0A 3L0OA 1G16A 1YE8A 4OY3A 3ZDFA 4EPVA 1HZZA 3PLAE 5HYVA 4IIJB 3VPAA 4YGYA 1EGAA 3A3PA 5GTDA 3AFGA 1F6DA 4DSOA 3PFKA 1M6EX 1HTBA 1CQXA 1VJ5A 3DYIA 2JGJA 4MUBA 2QZPA 4LHSA 5C34B 5C5CA 1Z12A 4IDDA 4M22A 3IVRA 3OLVA 1CVIA 4U6QA 1BMTA 3BDIA 4OGGA 4KUEA 2I4MA 3CS3A 4M36A 1WEKA 4TT3A 4AZ0B 1AGPA 1BWSA 2PWAA 4DLNA 2Z9CA 3GVIA 1QBGA 3AEKB 5D3KA 3HWSA 2YDYA 4TQAA 5K0NA 4N5NA 1I7QB 2ZZNA 3GT4A 2RGXA 4BV8A 1RDFA 3E7FA 4YA6A 4EMUA 4CW7A 1TJ4A 1XTJA 2ZBGA 3L0IB 3U81A 5DX0A 1QYXA 2FPPA 3TRDA 1I1OA 4M0MA 2ETXA 5GONA 4AX4A 2IOFA 3PNOA 4R8VA 1XT6A 5EXXA 1FF9A 2WJAA 1HC7A 1YJAA 2W6JA 5KIAA 1DV2A 2NZVG 3FSRA 5FB3A 3WLIA 2QVXX 1M34E 3UH0A 3OAAD 3L7NA 1DNPA 4HPWA 4YRPA 1JG1A 1GQ2A 2G5PA 3E03A 3VDRA 3NC0C 4GL2A 3ZJ4A 3T9EA 4OG2A 4ASUA 4BP1A 1M6VB 3B2NA 1QKKA 3A4NA 3ESBA 3PC6A 4WDRA 2FDXA 4IUBS 3GFSA 4JELA 1MJNA 2D1YA 5AHWA 2JJYA 4IHJB 3WNCA 3FLBA 1UK6A 2LTAA 2BFBB 2Z04A 3A1CA 3BRWA 2BEWB 2NNLD 2E82A 1M3SA 3BJIC 3NVMB 5AKLA 5DP1A 3WYBA 3ON5A 1DX4A 2FU5C 3PBKA 5L3QA 4PO3X 1Y1RA 9LDBA 5TVKA 3AZQA 2W2OA 5LKAA 4X1KA 1S8NA 1HQYE 3PGJA 4U5XA 5EE1A 5ECWA 1O6ZA 3OH8A 1U4OA 2ZSJA 1Q3TA 2QX8A 2YJ6A 4A92A 1WMEA 3A11A 5HGJA 4DJAA 1SXQA 4H7JA 3GX1A 1VG9B 1PNTA 4HBZA 4F4HA 3AW8A 1IXZA 1QO7A 4PNHA 2RIPA 2VSFA 2JIRA 4MGKR 5BMVA 4JC8A 4N8SA 2FSUA 3TZEA 1VKNA 1ZNXA 2ADOA 2CVHA 4RCVA 5LQMA 5ICMA 1CRZA 2D3WA 1DT3A 2PRIA 2XTJA 5LP6F 4BEVA 4CL3A 2B8TA 3D8HA 2BLLA 1AB6A 2IHBA 4H3VA 4AG3A 2V59A 1E9VA 5E3IA 2QD3A 1JVBA 4OXIA 4PE5B 4WVLA 2VLBA 1G7TA 1K7CA 3WFJA 2YXPX 2PNFA 2AE2A 2VIIA 3NHZA 4MR7A 3OFKA 1HXHA 3WYAA 1X6VA 2BJVA 1P3DA 2YN0A 1EINA 1X7DA 2VF5X 2FMKA 2G5TA 1JE1A 3A32A 3MRVA 4DKJA 1H2WA 1XKLA 4LOAA 1JAZA 1SUWA 1I1NA 1XUOA 5CVEA 5T64A 1LFDB 1C5KA 2PVSA 1A9TA 2IZ7A 2Q46A 3C74A 4MYUA 4WXMA 5BSMA 4ZTBA 3OPYA 1EPUA 4Y7DA 4PZYA 3KR1A 1PZXA 5D85A 3KB6A 3KSZO 4DLSA 1KOLA 4ZZ1A 3CBQA 3EDYA 5BW6B 1H4SA 1JA9A 1IWOA 4NPAA 4B8ZA 3H5RA 2DERA 3DDOA 4Z86A 1R50A 4S1TA 4CU5A 2IX3A 2JIZA 2IHYA 3VVMA 5FXMA 3SLRA 1TO2E 1N5JA 4Q02A 4MK4A 5DYIA 4AN0A 1RKXA 3WL7A 1M8KA 1V16B 1W1UA 3DOIA 3AQ4A 1AKNA 1WXFA 2HBQA 3DDCA 4HRVA 4KDRA 2DECA 4CM4A 2CLKB 4FMDB 5LZ9A 4LQLA 2YASA 3KE9A 3P2YA 5IDQA 3EJ6A 3E22A 3KVOA 5FWYB 1RAAA 1D0VA 5G4LA 3KZKA 3NBAA 4GOOD 3IPXA 3CLSC 1PGPA 1WD7A 2PBFA 3OHMA 2VP2A 1YCHA 2FW7A 2JGDB 3A6LA 5E0OA 3LHSA 3RC1A 4KIFA 1U3DA 3UMBA 1EEXB 1TMGE 2ONYA 4LZNA 1IHDA 4LVNA 1L5HA 4LI0A 3PSHA 1ADJA 5E3JA 2W2MA 2UU9B 6PFKA 1ND6A 3S1SA 3W7AA 4CG1A 2FMXA 3K92A 4WKCA 4AI6A 3KR2A 3R8CA 1L8LA 1HA3A 5FOTA 4ZVSA 3T3MB 4J1SA 3D3QA 3RC8A 3D4PA 1IAQA 3KXDA 3F97A 5JCJD 4A5SA 3PFBA 2G4VA 3A7EA 2UZ1A 1EUYA 4Q3KA 2Y05A 1YQQA 2HQSA 1KI4A 3LRXA 3SFZA 4MRPA 3FYHA 3HUFA 1VYHA 4YLEA 3PCRB 3B1FA 2I1QA 3JVIA 4X45A 5KO2A 1AGNA 1HE2A 4FIZA 4GSKA 1JG4A 1MJFA 4XLZA 2OGWA 3OIDA 3IE2A 5HILA 2GM9A 4RDIA 3NC1C 3RJ5A 1I01A 1CUJA 4Q4HB 2G8NA 1AT1A 3PRYA 3ZVMA 1C7QA 2FJPA 3T3EA 3I6MA 3R9KA 1DO0A 3EARA 4F9EA 1JSZA 3EULA 1GPWB 4U7FA 1B6TA 4N82A 5JSKA 4A10A 5FDFA 2COUA 4LJ6A 1T5BA 4N3AA 4R8SA 4OHBA 2O50A 3SIXA 5B3AA 2E2WA 2CC2A 2HWYA 3A2NA 1ISPA 3ZV5A 4ALJA 4YJ3B 3H1BA 2IH2A 4ENPA 2Q9CA 3BGWA 1N1EA 2PN1A 1N8TA 4C3UA 5IJ0A 5TGTA 3ORSA 3PICA 2A0KA 3AHJA 1XCGB 1XMVA 3LL7A 3C7TA 3LF2A 3TYXA 5JJKA 1S7CA 1R7RA 2AUNA 5C1BA 1U9ZA 3BREA 1DUVG 3EVZA 4YS6A 2AQHA 1DG3A 4LAFA 1L9XA 3H4MA 3EEQA 1K8RA 3MLEA 1H4QA 2C7RA 3OZVA 3I05A 3V7WA 4B3GA 2HX1A 2NXJA 2XCUA 5F7XA 5F76A 2OXRA 4UNPA 3ITDA 5IJ9B 4RS3A 1SKAA 3CMMA 1LH0A 3K9FC 5E9AA 3X1WA 2JH9A 3FYDA 3O75A 4WDQA 1UPTA 1NQXA 4WK0B 2BFMA 3ZXXA 2JLYA 4L50A 4I55F 3H4TA 3R3XA 3G8DA 3NAZA 2ZRCA 1YCGA 1RIFA 4N5DA 3CSSA 3I72A 1R12A 4BWVA 1JVNA 4IF4A 3ABQB 2FVXA 1CS0A 2G4CA 5FUQA 3CB2A 2C29D 4WZBE 1RI5A 721PA 4MHSA 1OWLA 2J3EA 1NXPA 2OFXA 3DJFA 2J6IA 4RTNA 4L4ZA 2VAVA 3B36A 3Q0EA 1CUUA 4IAOA 5MN4A 1EUCB 2RHLA 2LPMA 3V9PA 3WWDA 1KSHA 1L4HA 3BD9A 2AEJA 4OMUA 3W79A 4ARVA 1T36B 1LPBB 2DEUA 5ALQA 2OESA 4RENA 1KZHA 4RTRA 1Q50A 2YJ4A 2C4HA 3B1KA 3MXOA 3PC7A 4KG7A 3R9WA 5M7EA 3T94A 4OL9A 4M8SA 3KVRA 1RLUA 4I1VA 4QWMA 4Q4CA 3M49A 3P2OA 2VYFA 4OHCA 2HJRA 3CZPA 5BVHB 1D1PA 2J41A 5LD2B 4II3A 2PYDA 1PWZA 4FTWA 1GSOA 4F2GA 4H16A 5JVDA 1F8FA 2VR1A 4FSXA 4H1UA 1H1DA 4ZT4A 2FXVA 1EVEA 2NVUA 4HO1X 2WU3A 4TM7A 1M0SA 1K5HA 1PK7A 2QUKA 3W5UA 1EFHA 3KQMA 1G0OA 1X8KA 5DHRA 5AR1A 3LWNA 1IEVA 3E3OA 4NP6A 1P2TA 5LBIA 3R74A 4HV4A 4CJXA 1WM1A 2VJQA 1IJFA 1RYDA 5ARCA 3KQVA 3OQNA 3KSBC 3NHFA 2EKQA 1Q1BA 1RWXA 2G1KA 2XUOA 3C70A 2FX3A 1AMOA 1ZXBA 1XLVA 2X5KO 3R6WA 1HSOA 1S2NA 3VPGA 4EKNB 1VYTA 5REQB 4E09A 4LDRA 2CZCA 1WY7A 2O8BB 2IL1A 3BJZA 4H6PA 4MQUA 2VT2A 4EO7A 5ELXA 3O9ZA 1K08A 3HA2A 4DCGA 1JI0A 1G17A 3EODA 2ZDQA 3GV0A 3ILVA 4I4IA 1CS4C 4TMWA 3UW3A 4CN8A 4R1TA 2QV7A 3H97A 2O2SA 4IDHA 1RLIA 2FW1A 3NW9A 1FP4A 3ESDA 5C53B 4NCAA 1CZHA 1XXHE 1X14A 2BEUA 1N1MA 4E7PA 1A8UA 3A1NA 1QV6A 3K32A 2FOLA 4DS3A 4KFCA 3TLXA 4EABA 3RG2A 4OXQA 1PIWA 1G7RA 1J25A 3A14A 5K0BA 1Q0ZA 1SKBA 3K2EA 4MIYA 3PD0A 1TD9A 2OBNA 5F2EA 5K3DA 5HHTA 2V54A 4ZQEA 2WFLB 1CJBA 3TQRA 4ESOA 4ZIRB 2Q07A 5AVZA 2GWRA 4O4LB 3UMGA 3GYBA 4JN6B 2OHFA 4MGYR 3FPJA 1RAGA 3C1UA 4E5SA 5DM60 3TLZA 1M5TA 3KV1A 4LF4B 4L0QA 3PNPA 5JJLA 3BFPA 4C7VA 1NVBA 1QOQB 2UUOA 3MINA 4EGSA 4PF1A 2CNOA 2G63A 3UXMA 2Y1LA 5IX8A 3GG2A 3NM5A 3DG9A 4D6PA 4OIFA 4JT8A 3H2HA 3NIWA 2BONA 3K0AA 2RC6A 4C0HA 1QDEA 4AMBA 4PHCA 5AJZA 1JFFA 4DR3B 1H2BA 3LXUX 2IZ1A 3H1FA 3F90A 3TM5A 3I9V1 5IBPA 5AICA 2PKWA 1NVDA 3PYXA 1AGXA 1XWIA 3FDJA 2DBRA 4QGAA 4Z0TA 3W05A 3QPCA 3HB0A 3W8RA 4J9UE 4EY3A 1RCTE 5JFOA 3UMRA 4HQNA 4MUHA 1CY6A 4IMRA 4OGWA 4PC7A 1KZ9A 2Q6TA 2RGEA 4YJGA 5HBRA 2VJOA 2JA2A 1FFBA 3FVVA 3GK3A 1AJEA 3O47A 2F17A 3OJCA 2CCJA 4X7RA 2VDVE 3QBDA 4Y9DA 4YJHA 2E9SA 4MKZA 2M6LA 5J2TB 1SVWA 1NVFA 5ALNA 4G86A 2WUEA 3A10A 3EWIA 3DAGA 3NNSA 5ER9A 2PLWA 1XZHA 2XNJA 2Q5HA 4R05A 3UY4A 4K2AA 5KYYB 3EEFA 4EK9A 3OJ0A 3BK1A 1X70A 1PK8A 4PTLA 4UAVA 4IP0A 5EFZA 3PA6A 3NT5A 4I50A 1E0AA 3W6ZA 4INPA 2O7SA 2ZIGA 3PXXA 2R68A 2UYYA 4J16C 4WACA 2NYAA 4KN5A 1E3MA 5FD8A 4ZJPA 2WQ6A 3G5TA 4TWIA 4HADA 1U94A 3MXTA 1G1AA 1N2IA 2QG4A 2O0LA 3R5JA 1H2AS 1Z2PX 2VUHB 4S1VA 1MC1A 2WYVA 3GCXA 2PD6A 4I14A 1D2AA 5EAIA 3AOGA 4NULA 1E9BA 2XMPA 3KPVA 5ICEA 1ADCA 4TQGA 3VZCA 4QFMA 3V8PA 4F8JA 4ZCRA 2R62A 3QHQA 4W63A 3CZCA 5D1NA 1HE5A 4HTFB 2LV8A 1CPYA 2ATCA 1NVGA 1QC5A 3GZ4A 4M38A 3A4LA 4O2AF 4QJIA 4MJLA 4UPDA 5BURA 2Y92A 1QNFA 2V74B 1R18A 2QQ0A 2A2ZA 3G2IA 4PWZA 3BS4A 1DELA 1DUSA 1A0OA 1MD9A 2Z2YA 4M1SA 4RYLA 5M3BA 5DM4A 4MUMA 4KR6A 2JKVA 4E2FA 3VR6D 2X4GA 5DFAA 4N8EA 5I7AA 4F3RA 3KSMA 1Z7EA 2XUDA 1ZK0A 3E8MA 3ENWA 4BP9A 3IP6A 5C1PA 1TO1E 4EKGA 3EBLA 3HUUA 3NP7A 4IY1A 2WABA 1XMJA 4YBRA 3GFVA 3CW9A 1OKKA 1WVMA 1B8VA 3OCUA 4BRWA 4BZQA 4RGVA 1EFTA 1LEHA 2DMRA 3QE2A 1TJNA 4EVQA 4O25A 1ZVKA 1EXMA 4W6ZA 4YLGA 1W44A 3JZIA 4MWTA 1N7JA 1XEAA 2WKSA 4BIMA 1U7XA 2HD4A 1L7AA 3KAPA 3QW2A 4C22A 4EHJA 1A7KA 1M1UA 4J03A 1GPMA 3IT1A 3LWDA 4CV0A 4AU1A 2VA9A 5H4HA 1PZEA 3QVGB 2NP7A 1Z39A 3BWMA 4TRMA 1I4DD 1UKCA 5B5SA 1X9GA 2NOAA 3BGDA 2RHMA 3F74A 4ID3A 4YX9A 1N2XA 2MJLA 4JCCA 4HDSA 3DE0X 3I37X 4WSOA 3NHUA 4IXNA 5HOQA 1BD4A 2IA5A 2W2LA 3DOHA 3N05A 2MMCA 1J0XO 3K9CA 1GPBA 1E18A 3NOQA 1HZJA 1II8B 2BMJA 1RHJA 1ZL0A 1XCBA 3MPOA 3CSUA 3PENA 4Y3UA 1IZYA 2ZAGA 1RQPA 2W2PA 5H0IA 4DZRA 4S2UA 2JD2A 3PE3A 3A58B 5KNBD 4Q37A 3W5HA 1JEQB 5EL0A 1CFZA 4HUQB 1CQWA 2F3RA 1AV7A 3AJAA 3W2FA 2FFRA 1ZM2A 3PLNA 2WSLA 1FXSA 2VCEA 2XGMA 4WFIA 5B4VA 1NQOA 2PSDA 2R97A 3A4IA 4ZC1A 3EE6A 4JXXA 3FKJA 1Z4NA 3AY7A 2H0QA 2O0MA 2ZI9A 2W6OA 5FWDA 5H7XA 2B7CA 2FE4A 1E2NA 1MOZA 3A9VA 3G0OA 3L05A 4P2BA 4WCFC 2FDCA 3TZHA 2QAJA 1ZKDA 1YHNA 3W4KA 2WNSA 2A14A 5HWSA 3UEOA 5SZIA 4GE3A 5DI3A 1RW4A 2FZKA 3LJKA 3VUEA 3PTAA 1NMQA 1RQNA 3NHYA 5IW8A 1N3YA 4DA6A 4ZOLA 1Z9BA 2QTGA 2X6RA 1E7YA 4B6PA 3O0DA 1LK0A 1I1QB 2CDNA 3K4QA 3W1WA 4JUAA 3R3SA 5AW4A 1E2JA 3MGKA 4YWHA 2FWJA 4S1WA 4D8TA 1XZAA 1SOUA 4NKRA 4DIKA 2FP3A 4EFNA 3MJTA 1WF6A 7MHTA 2XLCA 5EE0A 1MO6A 1NE2A 1OIXA 4LJKA 1THZA 2X3UA 1B00A 3CUUA 3L49A 1LUAA 3QXSA 4HGOA 3VJKA 1JR6A 2HMAA 2RK6A 3B9PA 3ENQA 4IHKA 3LC0A 3MTEA 1HG0A 3OWOA 4F4IA 3U4MA 4IQ0A 3HLTA 2I62A 4OJYA 2W70A 3ZNNA 2X19A 2XGGA 1ZD1A 1NXOA 1AQLA 3FTDA 3PWZA 3P2EA 3JYLA 3T5TA 2IS2A 1Q92A 1QONA 4L0DA 5K51A 2B1GA 2YJTD 3OX4A 5BN5B 3BD8A 3A3KA 4JBIA 5FBRB 1X2BA 2QE7A 2ZJ1A 4I5EA 3UJPA 2FPWA 2G6TA 4GP9A 3HYSA 4HWGA 3I42A 4Q6WA 3TL2A 5FUMA 2O05A 3EBPA 4W8GA 3NTRA 4B85A 1WL8A 1TDJA 3GF4A 5FUWA 1U02A 3EAGA 4MUKA 3W0LB 2PO7A 3K0BA 4JLJA 1F51E 1N0VC 2XIJA 1DSSG 1DTWB 1M2VA 4FMPA 2E5FA 3OF3A 4BMYA 1KIMA 4REQA 3P9KA 5L3SB 4QUJA 3AP2A 1EAMA 1ODCA 1D8AA 1XB2A 3KQWA 1BAPA 2BGKA 1LLDA 5FIUA 4YN3A 5JNTA 1RXSA 3A1DA 5TF4A 5LIPA 1MF7A 1DEAA 1CVLA 2K7ZA 3JQBC 1M6HA 2JI4A 4U6SA 2AR7A 1R8XA 1XEXA 1XBTA 3QI7A 5CK5A 2VWHA 1HDOA 4YVFA 7ABPA 2WMYA 1TZMA 3IUYA 3TE6A 3F46A 5FPKA 2CEAA 4EP1A 3NRCA 1JIIA 3S28A 5IZ4A 1R27A 2IPOA 2J9ZB 3KYCA 5L45A 2MSEB 2IXDA 5FI1B 5TARA 5BUCA 4DADA 2VDKB 5C8XA 4OQZA 3B3AA 5EKTA 1WHSB 3DUWA 5FOXA 5JCOA 4DCPA 1NNSA 1XKTA 3HYNA 3UAYA 3LQYA 2PK3A 4YXWD 5I4CA 5ECYA 1G8HA 3B8EA 4G5SA 3T38A 3U7GA 1K7YA 1CX9B 4ZREA 3E9ZA 2ZANA 3KHUA 4L16A 5B1EA 3MG9A 1D4AA 2ZUVA 4I5DA 4MXDA 5LCXA 1I10A 5LSAA 4NBSA 4PINA 2ZWPA 3GEIA 4KRYA 1J8DA 4XVCA 4RTLA 1O9BA 2Z58A 1DO2A 1RIIA 2WJ6A 2Z2JA 1BXZA 1QCZA 3A9CA 4QOJA 2A8YA 1FFDA 4MVJI 2OGZA 1GRVA 4QRHA 1FMCA 5I8ZA 4DRXB 1VL1A 2VOJA 4B4OA 2GBLC 2I8CA 2RBEA 3A27A 4ZVQA 5EP4A 4AZ3B 5LP6B 2DHRA 3GLVA 5TQ0B 1U8AA 3S4YA 2Z5VA 3RT7A 1WU7A 3H8JA 1DDGA 4IKEA 2EWVA 1Z4OA 3KX2A 4LRSB 3WQBA 5MDHA 3J7AC 1ZINA 3RNLA 1S9DA 4J6FA 3CLUD 5A3VA 2PZLA 1FNDA 3VTAA 3F5DA 4B81A 1WHTB 1SOMA 3MUOA 3CF6R 4DYHA 5JRDS 1R4ZA 1XQVA 1QS0B 2X58A 4AB1A 3LO5A 2VQ6A 4P86A 3ZHOA 1AOXA 3T5DA 3P8ZA 4G5HA 1K92A 2ZUSA 4BDTA 4TZ0A 1P4JA 4FHFA 3H87A 3LPDA 1XDGA 5A9SB 4MZDA 4ZDWA 4FYWA 3GLHA 4L22A 4D80A 1OAKA 1YJ5A 1B8OA 5DBFA 3OU2A 2GHTA 5HS4A 3VU0A 3DTTA 3DZDA 3EFBA 1OI4A 3ML1A 1EK0A 1AQJA 5TE9A 3VDMA 3FNGA 4UQPA 3JQ7A 4H08A 1FEZA 1LRKA 3P26A 4QU0A 3S5JA 2WHEA 2GF0A 4X85A 4LS3A 4JGBA 4WV3A 4C4XA 1SB9A 2YV2A 2GI4A 3VKUA 4RD2A 3THXA 1MX3A 3HM9A 1MNQA 1K3TA 4RV4A 1KKUA 2J0EA 4NU8X 2O0JA 3N2IA 1QANA 3SGLA 1TJYA 2WSIA 3VPHA 4IO1A 4NCKA 2WMDA 4JC0A 5DNDA 1CUVA 5ALPA 3TNFA 2QRJA 3F1KA 3NTQA 2WPNA 3GIWA 2PY6A 3NHRA 3OLZA 5AK4A 2PKQP 3H1EA 3RS8A 3N0TA 1IYZA 1KP9A 1Z4MA 3I9NA 3NVAA 3FGNA 1P7VA 4K87A 5HEKA 2ZBFA 2EP8A 1RZUA 3IYLW 4I8DA 4NEHB 5K5EA 1R0LA 1M0EA 1MENA 2A59A 3IV7A 3MCVA 2H17A 5LQJA 4HHEA 5LNK1 1TYAE 3I8OA 2M9MA 2IELA 5D01A 3P2KA 3JPWA 1TM3E 2GYWA 2QYOA 3EK2A 2D00A 3K9QO 3SZLA 2YZKA 1EP9A 1P91A 3OKCA 4MW4A 2BR4A 5H81A 821PA 2WEKA 1WTCA 1XMXA 1I9GA 3MT0A 2IOFK 2Q4EA 3WP0A 4DMCA 2AQIA 3GPCA 3IUBA 1QLWA 2IUEA 2QSUA 2FFHA 2Y0CA 1I7LA 1FTYA 2QMOA 2KS6A 2HWWA 2HKIA 2LUOA 1E2FA 4PZAA 1WBDA 3W7BA 4Q7LA 3T3NA 3B70A 5KYKA 5H70A 1L3BA 3U4GA 5IT9A 4DUYB 3P9RA 2Q8NA 1VJ0A 2VPIA 4TYMA 1QQAA 1DDOA 3L82B 1EP3B 1WG8A 2CZGA 2KW5A 3UJ9A 3OY7A 2GPBA 1GGKA 3CEHA 4HDAA 2C54A 1LLQA 3VPSA 5EGSA 2AF4C 2PM8A 4ZO6A 2O7RA 4EO9A 1H4TA 1QYWA 2J33A 3Q3HA 2CT8A 4CKWB 4CMAA 1UR5A 2Q8PA 2X8WA 3C1AA 3DOFA 4MVJE 4BE9A 1SWWA 1PL6A 3SSNA 4MICA 1HMYA 1LQ2A 3QFFA 1DRVA 2RMKA 1CKEA 1YZFA 2QB5A 1PGJA 3F6CA 1QM5A 1MAVA 2KLHA 4MCAA 1U6KA 3RBAA 3QYFA 4PX3A 3RIEA 3RWBA 3ZEAA 2CV1A 4QFDA 3T1OA 3LLSA 1ECJA 1XZLA 1OR8A 4JSTA 1X1DA 3U1TA 1U7UA 3V33A 1Z47A 2W4QA 2ZJ0A 1XU9A 2ZU0C 1UP6A 3DBLB 1EKXA 4TKMA 4ALIA 5IH7A 2JI9A 4MWBA 5CCBA 5A02A 4AF6A 1GT6A 4MYDA 1O0CA 5I7UA 4Z9BA 5JLJA 4G0YA 3Q3CA 2WTMA 2ZCUA 4WJKB 1UP4A 1YZHA 4N9QA 3RHFA 2A5DA 1G4UR 3W2EA 4CR7A 3GJ5A 1SVKA 1BSVA 3WGIA 5E6UA 3C7KA 3QIAA 4ND4A 1HWYA 2NADA 2WM9B 5AVJA 4H7PA 4OB7A 4CWAA 1QO0A 4EKIA 4QTTB 1YRAA 4KXNA 1QF7A 4X1OA 3V7FA 3HO8A 1E2UA 3SHOA 4I55B 3ETNA 4UCQA 2XVYA 5A6SA 3TLYA 1MJGA 4D3XA 4IFBA 1STOA 3AHIA 1TTQB 3NASA 1SCNE 5L7TA 3N8KA 2C1XA 1ISGA 1MA0A 4PXAA 3HV2A 1FNSA 2LDBA 3MJFA 1UJ4A 4NMLA 1OLXA 2TMDA 2OPBA 1ETUA 2ACKA 3AK4A 3TJZA 1VE1A 4QLAA 4XWWA 5IHPA 1YK1A 2I6SA 1K8ZB 4C7OB 1DKQA 3NIDB 3F67A 3GMDA 5BOVA 4RVSA 3KB1A 1B16A 1NBAA 2IXBA 1SCKA 3H05A 5H02A 1V5IA 3KETA 2JLZA 1EFRA 2X4IA 5ESRA 1X87A 2BAGA 2JATA 3BH7A 2XCQA 5HA5A 1ODTC 1U0HC 4Q7QA 1JDBB 2XZPA 4OPMA 3SU8A 1GZSA 1T6XA 3KVYA 5E9QA 1SU8A 2A9KA 1SK8A 2UVPB 4WESB 2QRKA 3L4BC 1TM1E 1VE7A 1Y8QA 1TEXA 2C7GA 3B1JA 1LZKA 5L95A 2C4TA 4XTCS 3VR3A 4BQFA 1XDSA 1AO0A 4LC1A 1F1JA 1Y5LA 2OOSA 3R6GA 4CKCA 4IH1A 2ISQA 1UDCA 1CZUA 3ZHRA 1YR9A 3RU3A 3QKRB 3INYA 2PO5A 2QSZA 3ZY2A 4F4JA 4YMHA 3AOEC 2MYTA 4BQQA 4M86A 2X15A 3REGA 3PR2B 1HX7A 1CRLA 3GOHA 1PR9A 2G04A 3GG9A 2V6MA 1DG1G 5AIAA 4PN7A 4YRZA 2DBVO 4C29A 5IS2A 1DQSA 1EJ0A 3LYUA 5I9BA 1PUXA 4KQMA 2FUG6 4M1MA 4MTLA 5KSZA 1XHFA 5CIQA 4MVJF 1RTKA 5CFMA 3X1MA 2NT3A 3M70A 4CIAA 3TTUA 3T41A 3VSBA 2PZBA 1VBFA 1B26A 4BXOB 2XXAA 1UADA 4PYJA 4Z49A 4U7JA 5DTJA 5GZ3A 2XMBA 3KOYA 5DBHX 3F4KA 3FD8A 1LSUA 1JEJA 3DE7X 3GUHA 3L7JA 4LF7B 1D7AA 1RWPA 3OCCA 2QTVA 4UHEA 1YR7A 2FNAA 1F7VA 3U26A 4D4HA 5JFTA 1VRCA 2YRFA 3KOMA 4XE5A 3COPA 3G9XA 1UAGA 4NS1A 5CVDA 2HEIA 3STHA 3F3MA 1PFUA 3SZUA 3JQ9C 3VNBA 1USGA 3ZVRA 2Z5GA 3ZJVA 1W29A 1XQXA 4X64B 5JW6A 4QDOA 4ZODA 5DYWA 1RFLA 1R64A 1EMDA 3TW8A 1V4NA 4GM0A 1U2PA 4E6EA 4F6CA 2IYPA 2O8EB 3KTDA 2HOQA 2A86A 3OICA 3D6MA 4W5QA 4E1AA 2P4UA 1ENZA 3CLRC 3NTXA 4DDMA 2CYAA 4YJFB 2I2FA 4UEOA 5JJ5A 4CLRB 1M33A 1YR8A 4KE8A 3KUCA 5CM8B 2FN3A 4MRNA 5J2UF 3G0GA 1DEHA 4WZBB 2D5BA 1CHDA 1S1CA 3KV3O 4TN1A 3SN6A 5C8VA 2BKUA 4FQ8A 1THMA 5C32A 3WRVA 1Y9JA 3CR8A 1IBMB 4DA7A 2XB8A 2QPTA 2Q1UA 4B3JA 4MNTA 5IJWA 1TKBA 3L04A 5I7WA 3L9XA 2HK8A 3OJWA 2OYRA 2V96A 2ZPAA 4FFVA 1CEYA 1XZKA 3K15A 2C96A 3AJRA 1ICEA 3E61A 1V8BA 3D0RA 4AG6A 1FMLA 5D5HA 5J43A 1E2QA 1JPJA 4K9DA 2H7XA 2H85A 4M1KA 4JNKA 1SHJA 3CPHA 3F6PA 4WOBA 2XTZA 4GX0A 1EWKA 3GA0A 3HVUA 2A7XA 2BF7A 2QF7A 1EX9A 3RKSA 1QYIA 2GFIA 4MS4A 3WGQA 4IDGA 2QBYB 1O89A 3O91A 1OHHD 3AETA 1KH3A 5DHQA 1KL7A 1R0SA 3B1WA 5IU6A 1FZTA 4JUDX 5TT1A 1UK8A 1JWBB 5TPZD 1C14A 1QG4A 1OROA 1WVIA 3RC9A 1SQ6A 4O1IA 2IHJA 3HXMA 4GWGA 5K0LA 1L8QA 1CUZA 2GEJA 3PHJA 5HG0A 3RODA 3II6X 3V3TA 5BVGB 5H9WA 1EHYA 1EM6A 2YL2A 2WE7A 2DQYA 3BXOA 2ZZMA 3PNKA 4O2AB 1GPDG 3WGMA 5IAAA 1YZ3A 3W1VA 4BWFB 3MBOA 3E18A 1TGVA 5ALEA 2H4XA 1TJ5A 3HKDA 3EC1A 3CUVA 4QPPA 3B6EA 1U7TA 3O1HB 4AXBA 1F20A 2PS1A 2BFNA 1JFLA 2CWDA 2ZYTX 4UVGA 5AYVA 2FMUA 1ONNA 3A4YA 2KBEA 3QOFA 2PLRA 1EZ1A 1LQUA 1XXHB 3SHTA 4YFVA 1X1RA 2HA0A 4PSUA 3TWOA 2AFHA 2VTVA 1D0IA 4TXJA 4LYFA 4L6IA 5JC1A 1AY0A 3RFTA 2Q7OE 4DVGA 1UL1X 3TVYA 1AXRA 5EJMA 1LFAA 2PRZA 4CLOB 1VG0B 2IYNA 3FPGA 1CW2B 4QXQA 3REQB 4D8YA 4H1WA 1KTIA 1ECPA 3KZMA 5ELMA 1HT1E 3RARA 1JP7A 5COBA 2DRIA 3AU9A 5TRTA 4CCWA 1HLGA 1U80A 5A7GA 1PJAA 1E64A 5ITWA 1MZPA 5GQSA 4DNQA 1FTGA 4MAAA 4O1HA 2I7VA 1NZJA 1R9NA 1GUAA 1MQSA 2AXQA 4GBMA 1ILEA 1ABBA 2ERYA 2NU8B 3JWEA 2VDPB 4E30A 3HCNA 4XR9A 3QEOA 4K88A 3K0KA 5H1YA 4A3SA 4KPUB 4YH1A 1A2BA 1OT5A 2LRHA 8LDHA 3L7YA 5L8VA 2HCJB 1LVGA 4WZAE 4B3CA 1LDMA 3FMOB 3EXG2 4MB2A 1ZJWA 221PA 4K9OA 2Z5FA 1JNYA 1N3IA 3IJ5A 4DMKA 3PUZA 2VYNA 2IY7A 2OENG 2BEKA 4ZYYA 5IUNC 4CM8A 1UMKA 2DSNA 5KC8A 1PTJC 1V48A 4RA6B 2QM7A 1MQ8B 2F4NA 2A1UA 3GOQA 3WKCA 4AUMA 1MT0A 2J59A 3IQDB 3IS3A 2PQMA 4PYIA 2VP0A 2RAPA 3DXXA 1AK9A 3AVUA 1B3BA 1ZCAA 4L8VA 3RUEA 4XYLA 3CXUA 4V0QA 4LJ7A 1I6MA 2NO6A 2VT7A 1M2KA 1NJFA 4QXOA 4RM2A 2RHBA 4Q9HA 4CDMA 1QE0A 2H8KA 2PRSA 3HVKA 1QGYA 2XCTB 1NNLA 2FE1A 1LX7A 4HB0A 1IH8A 3C3KA 5IC6A 3RUDA 2XVZA 2OQVA 3KUXA 3M3PA 1HLFA 1IQRA 1KO1A 2HDOA 3STTA 4DM4A 1IZ0A 1EA7A 1QCYA 1UXOA 1VP9A 4M8IA 1JDZA 4ZVLA 2FDRA 3U4HA 3I39X 3ZU2A 2R00A 4HK4A 1AH2A 2HQOA 2QKYA 1MBZA 2HSZA 5BQOA 1WCV1 2JGKA 1R4MB 4LPKA 2YXNA 3TQFA 4UDYX 2JA1A 3R44A 5EG5A 3SM3A 4LDJA 2IITA 1XZJA 3ROZA 3MTGA 4ERNA 3L46A 4UM7A 4UHKA 4DIFA 4KEAA 1CUEA 3DXZA 2R1VB 5ALGA 1RI4A 4DSNA 2VYVD 4IQ4A 3PFCA 3JQAD 4Z4CA 3QHAA 4KAJA 1N0HA 5HOEA 3BIWA 3DMGA 2V1UA 3L6RA 3V8RA 1XEFA 5B2EA 3FB4A 1J7KA 2C78A 3KB2A 1V9CA 2SHKA 4BLSA 4E5VA 3E58A 4W9NC 1IHXA 3O5AA 5AVYA 4TMXA 2IYZA 2RG7A 3HVJA 3C15C 1I4LD 3PI7A 3HYCA 3HXOA 4GDMA 4DV6B 1R88A 1IJEA 1XQ6A 3I9FA 3GR6A 1FRNA 4EY6A 4MR8A 1UPUA 3M33A 2Q1WA 3DOOA 1S2LA 2PKRA 4MB0A 4JD5A 4MA5A 1NJ2A 1GYQA 5G3YA 1R6UA 4KO1S 1X1EA 4O63O 3KSRA 3CE9A 4C4YA 2F1KA 2B2NA 1YVEI 1U90A 3IQEA 2FMIA 4IIJA 4C78A 3W5BA 3OCZA 5H16A 2B2CA 4I3FA 1RAEA 1XGKA 3L1IA 2GZAA 4BMSA 2D74A 4JWTA 1SCDA 4NPCA 3HV0A 1B0UA 3QV1A 5E7MA 3FFXA 3ZZUA 1OBOA 1N2HA 3EPRA 3RFUA 5CBPB 2ZM6B 1C0KA 3MFQA 2JLVA 1L3IA 3DFUA 3F1LA 3RYTC 4MYRA 2FYTA 2O19A 2FSSA 2VZ0A 4B7XA 3LDAA 1C7ZA 4FDMA 2G72A 1EFDN 5CD1A 5CB4F 3UATA 4Y18A 2EWMA 5LQCA 4LC9A 1JYEA 2G88A 2ZUDA 4BP8A 3UJHA 4EQ6B 4CIYA 3Q87B 4J0KA 1PJ8A 2FPXA 1XX6A 2JIMA 3B7PA 3ZV6A 2BTOA 5AJYA 4WFQA 1YU9A 2LP4Y 4PZLA 4PZCA 2L42A 4G8BA 1EX6A 3PDHA 4GPTA 4HNQA 5B64A 5CCEA 2QL7A 4NYMQ 4HEJA 1VGQA 3OBIA 3QXHA 3DVAB 4PO9A 1LPNA 4N1AA 1DWQA 4PQEA 5I9MA 4D9BA 4TKLA 1GAJA 5FA6A 1YS1X 4K3UA 1HETA 1YVDA 4XPZA 1G2IA 1KJJA 3RD5A 4YLYA 5JSZA 2RB4A 2EIHA 3AEYA 4N8DA 4G5YA 3TR6A 3U2QA 3GCZA 4MARA 3ZZNA 1JB9A 1ESMA 4KZKA 2ICAA 2NZ2A 1JS1X 3RG8A 3QLEA 1OV4A 3BMQB 4G4SP 4IHJA 4LF9B 2G80A 3VJLA 3Q7SA 1V4BA 2BFBA 3K30A 4LJ9A 4ON9A 1SD2A 2ZUWA 1PSZA 1VSUA 5DLEA 5GAJA 4NRDA 1YQEA 4RS4A 1C0LA 2ZIAA 4Q9NA 1A98A 1YKSA 1HEYA 1B3RA 1P5JA 1UBCA 3W7VA 3P4YA 1VDMA 3JQFA 3WWCA 4CFZA 3VC7A 4DG9A 4CEIA 1HOTA 1T8WA 2E1RA 4JJGA 4NYIQ 2WI8A 3EDQA 4IVRA 5TLSA 3WGHA 3E7DA 4HQ6A 4RJTA 3JQRA 3HJCA 5HGXA 4HDCA 1KXJA 3F7OA 1B6SA 1B7GO 3PWSA 3N0WA 2O14A 1JTFA 5JEEA 3MJHA 5AOVA 3JQCA 3U61B 4QIHA 1XAJA 3FUUA 2YWDA 4DSZA 1P3JA 4RHCA 3GARA 2NU7B 4MWOA 3FPAA 4RFVA 4IXTA 3U5TA 3R0XA 4NEGA 4C76A 3CKMA 3OEWA 3EXEB 4M98A 3P52A 3D6NB 3ZI0A 2V7VA 4NZ9A 3ZVNA 4LI3X 1NW6A 2VUIB 1I6LA 4DAOA 5HIMA 1MB9A 1C1DB 1RWMA 1EXDA 1O97C 2GHQA 3CN7A 4PC2A 4RO0A 2VAPA 1DJPA 1G8KA 3KB8A 3KHTA 4WY5A 2RK3A 3T06B 2IF2A 3DV9A 2JGRA 3HYLA 4JROA 2R8EA 5KNBA 4G9EA 5AHXA 4R9VA 5JMPA 1HPLA 5EKXA 3ER9A 4HS4A 3PR1A 1AO3A 3MC1A 1K7FB 5BR7A 3UMSA 1IAVA 1KBQA 9ATCA 2ZSEA 4XTRA 2VL7A 4EBBA 1NQUA 1PEAA 2E49A 2IEIA 3FCCA 5HKAA 2A4KA 2EJTA 3TIXB 3TFOA 7REQB 4KQFA 4PGAA 1E58A 4XUCA 4XFKA 4LVOA 1E2DA 2PUWA 2QJWA 4EPRA 5AM4A 3SYMA 4FCWA 2N1MA 4L5CA 1AM4D 4TUYA 2CVZA 1GN9A 1VHQA 4WNYA 3WB0A 4X8MA 1QQ7A 3KQTA 1AZLA 1XRPA 4DGSA 1X3LA 4QNNA 3HA7A 1ZCFA 4QTUB 4FZRA 4B3MB 1C9KA 2FVYA 2GRUA 1J49A 2WJHA 2XMGA 3FKQA 1JLHA 2B8JA 4OHMA 5CFQA 1XL1A 1V16A 1V11B 2NO4A 1E3SA 5KYWB 4JVSB 1K4MA 2WAOA 2OFOA 1IEXA 4CFSA 5JYDA 3PQ2A 4IZ6A 1XQ1A 3W77A 3CO5A 3L8YA 3PU6A 4PAMA 5EUCA 4ETIA 1OY1A 1H22A 4HFNA 3S8EA 4FONA 3NJ8A 2F1RA 4QLOA 2UZAA 4X8OA 4XGIA 2BCEA 4P5EA 5J40A 1DQZA 1Q0SA 3QQPA 2WM2A 3DGFC 3IP1A 4Q4DA 3UKDA 1PSWA 3EUFA 1E2GA 3ZD7A 2KMLA 2IS6A 2I7XA 2QRUA 3I45A 4NIMA 4HB3A 4O8CA 1RQ7A 2P9FA 4OMDA 1KY3A 4R0MA 2WA2A 3MQ2A 5FTKA 2XGJA 3V7NA 4LMPA 1BU5A 1HQKA 3ETJA 2G83A 3DL0A 5ILQA 3M82A 1XNGA 3AXTA 1JLSA 3CCCA 4HMOA 1D2RA 1QGED 1GKLA 1NOIA 4I08A 5D86A 4POOA 5CW2A 1CC1S 1ISRA 2N9UA 3C24A 4WJLA 1JTEA 4LYAA 4FBMA 4DGQA 5KVQA 3SJAA 5BP7A 3TAXA 1IN7A 1CY8A 4YRBA 5LDDC 2XA1A 1Z13A 3AR8A 3DOCA 3PHBE 4QUDA 1KZ4A 1PFKA 1C2YA 1NHGA 1TQHA 1P4GA 3HCDA 3RC3A 5EJ9A 1VZ3A 1XU4A 4OSOA 1CUWA 4BX0A 3FH0A 3HPRA 2XYGA 3ND7A 1IULA 1UWCA 1JQ5A 4RVFA 1JDJA 3BBPA 1FBTA 4RL4A 1IHUA 5DBIA 3G2PA 2DUMA 3HVIA 1SXJD 3QKIA 1ZAKA 1N2SA 4KO8A 3CJQA 2DU8A 4M8LA 3C8DA 4JR2A 2P91A 3R5KA 1WXDA 2PX3A 3PD1A 4IOMA 4KVAA 5ALZA 2VTBB 3ZQ4A 3K70C 5CTJA 4YRAA 2MU1A 1TTHA 4KDFA 1OXSC 1FU8A 3RLFA 4CTJA 1W5BA 4CBVA 3UJ7A 1C1XB 2PMFA 3A1WA 4QYTA 4YJ3A 4AP6A 4Y67A 3NU1A 3AIIA 4BAZA 4FWIB 4Z3KA 3A2LA 4YALA 1G0NA 2Q2NA 2UXBB 3WRXC 1Y82A 2G82A 1FSZA 1VLLA 2WHPB 1H4VB 3LDGA 3U3ZA 5FI3A 4Z53A 2Z2XA 4B6GA 4X24A 5EIFA 3NUZA 4OGLA 3AVXA 3QWHA 1ULUA 2AV6A 4LE0A 5DN9A 1A4RA 3NALA 1H2RS 4LBWA 1EFAA 3LA8A 4Q66C 4RSMA 1JRLA 4RD3A 3HBAA 1LZLA 2P65A 1WZCA 2ZE5A 2GARA 2FI1A 2D1RA 3NTOA 1CEQA 4EELA 1GIAA 7MDHA 4P3YA 2I3GA 3VO1A 3VV2A 1L7BA 2Z5LA 4IEEA 4BV3A 4R69A 3MIZA 1CZLA 4C0SA 2WJIA 3T9AA 4M89A 1XEWY 4A8HA 1WY5A 4EJ6A 2ORYA 3IVCA 3FHJA 5KUTA 2ENUA 2G1AA 3UKJA 3QPBA 2OKGA 4IMPA 1GKUB 4LGMA 2VI5A 4BX8A 2V7PA 4EYGA 4YUAA 3I61A 4DV4B 3HG7A 2PUTA 1NVWQ 2HM7A 4HPJB 4TVOA 1A97A 3WL3A 1SBIA 1JDTA 3S2GA 3WGYA 5C2JB 2M32A 4C2TA 3UAWA 4RMNA 3X0DA 3ONWA 4ENTA 2PUCA 3DMYA 2AN1A 1DEXA 5KDLA 1CP3A 1TZ2A 2YN2A 3DQQA 1Q7EA 5AK0A 1YCFA 3DXFA 3CNBA 1T36A 1W0CA 1W49A 3ORQA 4FOPA 4INJA 4C6RA 4DRYA 1E1KA 1BC5A 3IURA 4H7FA 4EG5A 2DYKA 1BO6A 2NG1A 3G3EA 3MS7A 4E31A 1J90A 5AVQA 1FNCA 2BRUC 3RVOA 3WYNA 4V1CI 5ITZA 3QVUA 2HRDA 1L2TA 2FCAA 1PR0A 3TDMA 1KPHA 4Y2JA 3EUEA 4BVEA 4P53A 3M6XA 1S2OA 1M66A 1MIOB 2AB0A 5BVHA 3FI9A 4PZPA 1AUOA 4E5UA 2CB0A 2EARA 3MOGA 4RABA 2E37A 2H1RA 4LJ4A 3HA3A 4TRRA 4JLBA 1C3LA 4ZAVA 1P9LA 3E9DA 2J46A 1FK8A 1Q83A 1W48A 3F47A 1PNVA 3K53A 4NARA 1CQJB 2YVLA 1TKAA 3H13A 5BN4B 3TZQA 5CYFA 4E08A 1LV7A 1EDBA 3NPMA 1A8IA 3TRHA 1YZLA 4CR8A 1TIKA 1YZVA 3MBKA 2CN1A 4FFMA 3Q5GA 1HNZB 3L7KA 3VKHA 2ORIA 3NYQA 3PWKA 1I1HA 4F71A 5I7RA 1EFVB 5IC5A 1JDNA 1NI4B 3BXHA 4P58A 1OX4B 3IIJA 1KY2A 4D9EA 1BKDR 2A58A 1U2ZA 1BYUA 4D8XA 4OXYA 2GASA 3OOJA 5EE5B 5JXWA 4DN6A 5REQA 2I3ZA 2ZYAA 3GUVA 2ZJ5A 4BCBA 2O8BA 2XKAA 2ZKIA 3TKLA 1GDHA 2D8AA 2NT4A 3OQ1A 1YAHA 2CVFA 4K6GA 4RVNA 3ZWDA 4DSUA 2NAPA 1NI3A 3KC2A 1TYEB 3BDAA 2Q7DA 4G23A 4M53A 4PZZA 1BH6A 4ETNA 2B34A 2PUHA 2VP9A 3N6VA 2MSCB 5KNCD 2JANA 3M6VA 2OSVA 2C57A 3I9LA 1WCXA 1WZNA 4BWGA 2QMZA 1KFBB 3PNMA 3ZG6A 3CUEF 2I76A 4MA0A 4U7PB 2PKCA 4WEQA 2GVDC 5J2UB 1RI3A 2WFLA 1FLDA 4J2HA 4FMCF 5GGYA 4ZIRA 3QPAA 5DGTA 3QI2A 4O4LA 5FBLB 1IB0A 3AUXA 1NF3A 4QU8A 3Q9SA 3BB4A 3WNDA 2JFWA 5K8CA 1I7SB 1ZOOA 1F2UA 2WKWA 4BO1A 2ZJAA 3TPFA 1BDBA 5EIOA 3O8NA 3O4JA 3O8DA 4QOHA 4AM8A 2JHGA 4B9EA 3JQ6A 1K06A 4PSAA 4ENQA 3D9QX 2I2BA 3MD0A 3LP8A 4W1RA 5LPNA 1FY2A 3HDTA 1Q6ZA 5A9TA 5CFOA 1OXTA 3Q11A 2FN9A 3VM6A 3ZEIA 3ECCA 2GJSA 1E2PA 4S24A 5C8DA 3KJXA 3VSEA 1JX6A 3T7EA 3CVXA 3HDYA 4X44A 3Q8MA 2IHVA 3CVWA 2GUGA 2B4AA 2NNWB 4EZBA 1QGOA 1R2QA 2X0JA 3MYRA 4CM3A 1GJRA 1FZQA 5CD9A 3FCUB 1NW4A 1Y33E 5SICE 5CU7A 4C04A 3CA8A 2X8JB 5TNXA 4DWVA 4ZHSA 2ABWA 4RVUA 2RGWA 4HUJA 1DIBA 1ZCJA 3FRIA 3H6GA 3PUIA 3NCHA 4GOXA 2QR5A 3GFFA 4GX5A 1JKIA 4OHWA 4YI5A 2ENWA 3G2QA 4TMVA 1K3FA 4LQDA 4FEEA 5J2TA 1ICIA 2MR5A 2I4TA 4G1CA 5K0GA 2HWUA 2YN4A 4LMRA 5JUWA 4JLOA 2CD7A 4DIMA 2OFPA 4R98A 1GLNA 5KYYA 2VJKA 4GMKA 1GTJ1 2V6GA 3NFYA 2I7CA 4CCSA 1U0OC 2O59A 1YRYE 4QJBA 3RJ9A 1GO2A 1V6AA 2X77A 1FUIA 3JRNA 2XJ4A 3PA8A 5IAEA 5BNFA 1SUFA 2OBLA 3DB2A 5DLQC 4FN5A 3IALA 2PH7A 4ITRC 3PRHA 4M8NE 1PFWA 1J0AA 4DTIA 3TLEA 3AEZA 1EWRA 2HIAA 4AUEA 4MVCA 3RR2A 3VZSA 2J0VA 3COYA 3HTXA 1TW2A 2ISCA 1OJ7A 1PNOA 3RLIA 3V4ZA 2X7HA 4HJRA 3M81A