3C5WP

Complex between pp2a-specific methylesterase pme-1 and pp2a core enzyme
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
296
structure length
294
Chain Sequence
RDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHAMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCKPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of demethylation and inactivation of protein phosphatase 2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PP2A A subunit
total genus 103
structure length 294
sequence length 296
ec nomenclature ec 3.1.1.89: Protein phosphatase methylesterase-1.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c5wP00
2XUIA 4QLOA 1ZGCA 7YASA 3WK5A 2HFJA 4J0KA 2HHAA 2WLSA 5LZ8A 1BROA 3DLTA 3LCRA 3ILSA 1XLVA 4W1RA 2HDWA 1LBTA 1OXMA 3PICA 2PU7A 1AKNA 3WMRA 2ACKA 1JU3A 2ZVDA 1YASA 4HXEB 4BCBA 2JGLA 4U2BA 1XZBA 4OYLA 4AN0A 1O6FA 5AM1A 5YASA 5HK8A 2WIFA 3K9BA 3WWPA 3PFBA 3PDCA 3I2FA 1CR6A 1N1MA 3D4LA 2ONCA 1H2WA 1AX9A 2XB6A 2WTMA 4UBJA 3PE6A 4J0HA 1MX1A 1ACLA 4C4XA 3H1AA 3I28A 1TK3A 2VF2A 5C8ZA 2I3ZA 2QUBA 2XQIA 4HRXA 5ALDA 4MEBA 5CXXA 4H7FA 1EDBA 1R50A 1VXRA 5IH7A 3F9CA 4QE3A 4FWBA 1IZ7A 2XUJA 4CIAA 3OTQA 1ZOIA 1Y7HA 3DKRA 5AIBA 1CFJA 5AKXA 3TJMA 1SCKA 4BZZA 3FLAA 1WB4A 3IA2A 1YAJA 1SC9A 1QO9A 2FX5A 3IB3A 3RLIA 4AB1A 4PSCA 3G9UA 3EF3A 4G8DA 2XQGA 1QZ3A 1TCAA 3HACA 4UBIA 1SOMA 5CH8A 1L7AA 1TKRA 3O9MA 4W63A 1A7UA 4X97A 4HVTA 4BE4A 2QUAA 4ZV7A 1W76A 2VEOA 2JGIA 4P93A 1GPKA 2BCEA 2J3QA 3SK0A 5EIEA 2HRRA 1XZEA 2QVBA 1QIKA 4H7EA 2PU5A 4DNQA 4E46A 2PPLA 4J7AA 2ZJFA 2WG0A 1X70A 4BVJA 2QOEA 3AZPA 5JD4A 4ZWNA 3BIWA 2PSFA 4EY7A 2WU4A 4U2DA 2RGUA 4UFOA 4Q3OA 3EQ8A 2CUTA 1YCDA 3IULA 1BS9A 2V96A 4FBMA 4PW0A 3STTA 5FV4A 1KU0A 1UOPA 4I19A 4AO6A 3GBSA 5BOVA 3PUIA 1W1IA 5JIBA 2JGJA 3D3NA 3WIBA 4DNOA 4OUKX 4FFVA 3PF8A 1W6RA 5AICA 2PSJA 1D07A 1J07A 4Q05A 4YK7A 2RAUA 4X92A 3KSRA 3QITA 4MQLA 1EK1A 3KOOA 4HAIA 4IH1A 1Y37A 3HSSA 1YB6A 4WFKA 1VA4A 1QIJA 3DYVA 3HC7A 1AC5A 2XUDA 3DOHA 4WJLA 3QPDA 3C45A 3I1IA 4ARAA 4PSDA 2CEKA 1T4MA 4X6XA 3H19A 3AIOA 3K6KA 2R11A 4GDMA 2W6CX 1XZIA 4UBNA 5AKKA 1EVEA 3GUUA 2HRQA 1BEZA 3WWEA 4IH9A 5CT9A 3WKAA 3HYSA 4MYDA 3DYIA 4C89A 4BCCA 1AMNA 1YA8A 3HXKA 4YPVA 5KWIA 3A2MA 4Y2SA 1ZIYA 3O4HA 3FNBA 1CUUA 4MYSA 3V1NA 2XMRA 5HFAA 3H17A 4W1PA 1LPNA 5AM2A 3AZQA 1JT2A 4GECA 4C4ZA 4PSUA 1E5TA 4B83A 5HQ3A 4INZA 3D2CA 2LIPA 2OGSA 2WTNA 3BDVA 5AKLA 2WILA 1ETHA 3W04A 2QM0A 3WLAA 2C0PA 2X8BA 5EFZA 2I78A 5ALSA 4CG1A 3BE8A 3M81A 4J0CA 3BDIA 1CUXA 3WKEA 1UKAA 3D5EA 3IUQA 4M0FA 1ZD2P 1IUPA 4BBZA 2C5GA 2DHCA 1XZDA 4JEIA 1JI3A 1YA4A 3GZJA 3I2KA 1JJBA 1LPPA 4G4JA 3FVRA 5A71A 1XZLA 1Q83A 2JGKA 3F67A 5JYCA 4B6GA 4BVLA 3AZOA 4C4YA 2GZSA 5LZ4A 4EY5A 4KJXA 2ORYA 5JAHA 3FOBA 4N5IX 1BN7A 3BWXA 3W9UA 3WL7A 3TEJA 4BYMA 1FFDA 3C6XA 3GFFA 3UMJA 2ACEA 4QWMA 4X6UA 5AI4A 3STWA 5FPQA 1QTIA 2XUHA 1G42A 1IUNA 4Y2JA 5ALNA 2WFLB 4UBLA 4X6YA 3O95A 3DKKA 3OC0A 1CUFA 2BKLA 1GT6A 1DX4A 1AZWA 2RHWA 5AJHA 1F8UA 3IVMA 3R40A 1HPLA 3G02A 2H7YA 3BXPA 4E14A 2QT9A 3CCBA 1QIEA 3CN7A 2QRUA 3GELA 1CUGA 3CXUA 4AZ3A 2ECFA 3F96A 2Z5GA 5IVHA 3VISA 3VJLA 5FDFA 5ALXA 1AQLA 1E89A 1EVQA 2XLBA 1F0NA 1ACJA 2G5PA 5LYYA 4EB0A 2HL6A 1QIIA 3M83A 1JFRA 3T4UA 4JYPA 4X85A 1O6GA 1XQYA 4LKOA 3BJMA 4HXGA 1U65A 4KE9A 5K3CA 5BWBA 1XZMA 2WUDA 1PFQA 3IUNA 3H2HA 4U2CA 5CT6A 2GBIA 1P0IA 4C6HA 4DMFA 4LXGA 5AM4A 1G4HA 4FLMA 2H1IA 2AJ8A 4PQEA 4X71A 4Y2UA 1ORWA 2Q0XA 2CBGA 2JIDA 4N5HX 4AMYA 4NS4A 5K5EA 4FTWA 1TRHA 3VJKA 1LPBB 5DYYA 5ALIA 2WHRA 2PSDA 4Q3KA 4CCYA 4X7BA 4IH4A 4UHFA 5EHNA 1CEXA 3H18A 3WIOA 5D7BA 1A8UA 3L1JA 3D2AA 5HZGA 4OB7A 4Y2QA 1M33A 1JMKC 1LPMA 2Z3WA 1KEZA 1YSCA 3TGLA 3IBTA 2XUFA 1E66A 3FSGD 1XQXA 2Z8ZA 1JMYA 1VE7A 2CB9A 2XLCA 1UOOA 3D7RA 2OG1A 3S2ZA 3I6YA 4J3JA 4G9EA 1CUAA 1ORVA 3R3UA 5HF8A 4F60A 3NOXA 2DQZA 3VVLA 1CUYA 5T4BA 4H77A 1WB5A 1BCRA 3I6ZA 3R3VA 1UOQA 1K4YA 3A70A 3HABA 1XFDA 3QMVA 3UUFA 3LS2A 4OSEA 4FLFA 2WFZA 2WSLA 4X91A 3ZV7A 3H2GA 5LLSA 3RK4A 4X95A 4G1FA 3H2JA 3HZOA 2Y2VA 5DNUA 2V9ZA 1XRMA 1GKLA 5HKAA 1FFEA 3C70A 2ZSHA 1QGED 5AKZA 3EBLA 2Z3ZA 3LP5A 4JNCA 3LLCA 1MJ5A 2PUJA 5AKEA 3SX4A 4X93A 2O2GA 2DHEA 5AOBA 3HI4A 4QWWA 4X90A 4BZWA 3ZPXA 1LPSA 4H7HA 5FP0A 1XRNA 3E1GA 1ZI8A 2XMSA 4B81A 5E4JA 3BIXA 3C6BA 3D2BA 3V48A 1CUEA 3JWEA 3DOIA 1QE3A 3U1TA 4QA9A 4CCYB 4GXNA 2GBGA 2GBCA 2CJPA 2IX9A 1VLQA 3STYA 3Q8WA 2HA4A 1QOZA 2VJAA 1N5MA 5HF5A 4ZV9A 3W06A 2AJBA 5F4ZA 4KE7A 3PFCA 4H7KA 5AOAA 4PO3X 5CT5A 4RE6A 3WK6A 3AJAA 4HTAA 2IITA 2BJHA 3IUJA 4HXFB 2XQJA 4MQMA 3ZI7A 1U2EA 4F0JA 5FOQA 1WCYA 1FSSA 2WHPA 4Y9SA 1LNSA 5EIHA 2O7RA 5K3DA 1TIBA 2WQZA 4UHBA 2HA5A 4XVCA 2JBWA 4HRYA 4Q34A 5C8XA 5ALJA 3NGMA 2HU8A 2P8SA 5CW2A 3WI7A 5A62A 1ZJ4A 6YASA 1TCBA 1WM1A 1HLGA 1MNQA 1K5PA 3JYHA 5HQ3B 4UHHA 2JGEA 1QIMA 3QPCA 2WFMA 1BEEA 1EXWA 2BFNA 4EZIA 4AZ0A 1A88A 3RM3A 3QVMA 3DCNA 2H7XA 3KXPA 5EHZA 4J0GA 5JAOA 1JKMA 1QFSA 2HU5A 4U2GA 3DQZA 4QDUA 3S8YA 4B7ZA 1QONA 2Y6UA 2Y6VA 4LIPD 2RI6A 5AK5A 4G8BA 5AIAA 1R3DA 4OU5A 3WZMA 3FCYA 2XMBA 1GXSA 4AO7A 3D0KA 3DEAA 3QYJA 4GW3A 1EDDA 2VA9A 2ZYRA 3GA7A 1ODSA 4LYEA 4DMCA 2PL5A 2YASA 1A8SA 3ZLUA 2C0QA 4YX9A 1C7IA 1CLEA 3R3WA 1CUHA 3DS8A 5AK4A 4K2AA 2BGNA 3G0GA 4E11A 3V1KA 3G0DA 1WB6A 1T2NA 2XMQA 1HDEA 3ESDA 5ALPA 4K6GA 3JW8A 4ARBA 5E2IA 5BWCA 5LZ7A 1CQWA 3WK4A 3OOSA 2BUCA 2DSNA 1A8QA 1SCIA 2FJ0A 2CZQA 2Z8XA 3ESBA 3BJRA 5D3ZA 2JEYA 5EHQA 3QBJA 1J1IA 3MVEA 3BF8A 1ZD4A 2BAGA 1L7QA 3OG9A 4XX1A 3WWCA 2X5XA 3QM1A 4DM7A 3B5EA 2JF0A 4N8SA 5ALGA 1EK2A 2PKYX 5LZ9A 1OCEA 2CKMA 1XLWA 1P0QA 3H1BA 3AILA 5ALKA 1THGA 4P92A 3MUNA 4KAJA 5JANA 5AK3A 4D9JA 3ANSA 4JH0A 4WFIA 4C01A 4J0JA 1UK8A 5ALHA 3WZLA 2HA2A 4CCWA 3G0CA 4RPCA 5HFNA 4MWTA 1LPOA 4A23A 1MU0A 2EDAA 4CG2A 4MEAA 3YASA 4Z49A 2B4KA 2OXEA 2QMQA 4DNFA 4H0CA 3L1IA 1DWQA 1X2BA 2ZJ7A 5JADA 3O4JA 5AKYA 5ALEA 2ZSIA 3EQ7A 2PSHA 2G63A 4ROTA 4BAZA 4NMWA 4FOLA 1DTEA 3C43A 5ALRA 2E3JA 5ALFA 3FAKA 5JATA 2B20A 3STUA 1QIGA 2O2IA 3WL5A 3WWOA 5AKIA 4Y2YA 4DSZA 4UUQA 2QXTA 4EUSA 4IHAA 2XMDA 5ESRA 3QMWA 4H7DA 1IMJA 5SYNA 3I6MA 2WJ3A 3ESCA 4FNMA 1ZGBA 1C4XA 4S0XA 1E3QA 1G5FA 4KE6A 3R3YA 5CRIA 1CUBA 4CIBA 3FYUB 2WJ6A 5ALWA 2VJBA 2WUEA 5ALTA 4FMPA 3WQHA 5AM3A 1DWPA 1XLUA 5HK9A 2OGTA 5AI8A 1MN6A 5CH3A 1XQWA 1XQVA 1Y7IA 2HA3A 4BATA 4H7IA 5JAUA 3N0TA 4Y2TA 4OPMA 2AXEA 1CV2A 2VATA 4BRSA 5A7FA 5CXUA 5ALVA 5FXMA 3ED1A 3HRHA 4BE9A 2AJDA 3WA6A 4QNNA 1TQHA 4FBLA 4QDZA 5JZBA 2V98A 4M0EA 2QJRA 2ES4A 2WIKA 5IKXA 4KYVA 1BCSA 2HU7A 4I3FA 1U4NA 1ZD3A 2HM7A 4ZI5A 2AJCA 1IZ8A 3SWWA 2VTVA 1DQZA 4ITVA 3C6ZA 4KAFA 2J4CA 3O4GA 2DHDA 5LKRA 4K6KA 3ICVA 1BRTA 4BP9A 1MT3A 4AN1A 1IUOA 4DYHA 3WK9A 2PSEA 5AI0A 1SCQA 1QIDA 1JJIA 4BDSA 2GYUA 3WL8A 1MX9A 3AIMA 3R0VA 4WFJA 1ZIXA 5HF6A 2BUBA 3WK8A 1N5RA 2JGFA 2YH2A 4FNGA 3VVMA 2RIPA 4MJ3A 3P2MA 4TVKA 1TCCA 4K6HA 1XRRA 3RKSA 4AO8A 3I2JA 4CG3A 4EY4A 5AHXA 5K3BA 2XE4A 4RNCA 1KU6A 4DMHA 4OB8A 5ALOA 5AO9A 2EDCA 2DFPA 3WKBA 3VXKA 5KBYA 3NWOA 3FYTA 2XDWA 2ZYHA 1EH5A 4GEGA 5HF9A 4H35A 4WDRA 5CH5A 4U2FA 2D5LA 2XT0A 3F98A 5DTIA 3DDUA 4Q1VA 5J3JA 1LGYA 2AJLI 1QLWA 1JJFA 4FDMA 2R8BA 5HKBA 4B9EA 2YXPX 4ZGBA 1CUCA 1H2XA 5K3AA 1R9NA 3WJ2A 4KRYA 4N8EA 1NX9A 5CMLA 5IVDA 1THTA 1FFAA 5T4EA 3W2TA 1F0PA 3AINA 5AP9A 3ICWA 4W1SA 3VJMA 4Y2VA 2PX6A 2GYVA 1CUJA 4DTCA 2OAGA 4BRZA 4XIIA 3ZLVA 4DNPA 2GYWA 5AM5A 5T4HA 5I7UA 4QZVA 1UZAA 1YS1X 4G9GA 1YR2A 2W22A 2BGRA 4J0DA 3H2KA 1G66A 4YASA 1QFMA 3EIOA 4AX4A 1MAHA 5A7HA 1PJAA 5CT8A 4H18A 4F21A 4FFWA 2B9VA 3TRDA 4GWLA 5DJ5A 4J03A 3KWFA 3WWDA 1ODCA 4X94A 5D6OA 3M3DA 3I2IA 2HA7A 3W05A 4EBBA 2I03A 2ZJ6A 3V1MA 2QXUA 5K3EA 5JAPA 5EGNA 3WYNA 3OPMA 5DYTA 5ISMA 1BU8A 1XKLA 4K5QA 1MPXA 1GQRA 4PV7A 1AURA 2WIDA 1X2EA 1GGVA 4UPDA 5D3KA 1W4LA 3V1LA 5DNWA 4CI9A 4AXBA 1C7JA 3AFIA 5K3FB 4DGQA 3V9AA 3FCXA 2HIHA 4H7JA 3QMMA 4C88A 2FJPA 3R41A 1GQSA 1UT6A 4UHCA 4KACA 3C8DA 1GPLA 4NVRA 2GZRA 3G9ZA 3O4IA 1WPXA 3FBWA 1CPYA 1UKCA 3QH4A 4G4IA 2HFKA 3BF7A 3F97A 2VT6A 4BDTA 2OCIA 2B61A 3CCCA 3ANTA 1XZFA 3WJ1A 4BB0A 5CBKA 2PVSA 1YB7A 1USWA 5AOCA 2OPHA 4QEKA 3OURA 4PNZA 4DSAA 5DTJA 1B41A 3DL4A 4M0MA 4Y2XA 4TGLA 4IQ4A 4ZREA 5H3HA 1P0PA 1R9MA 5BV7A 1H2ZA 2PM8A 4CFSA 2OQVA 3RARA 2XMCA 5CURA 2XQFA 3WK7A 4IO0A 3E0XA 3H2IA 2WUGA 4AQDA 2WJ4A 1CUIA 5ALYA 1ODTC 4HZGA 4MXDA 3SC2A 1MX5A 4UHEA 1Q84A 2OCGA 2EEPA 5AI9A 3K2IA 5FRDA 2DQYA 4OYYA 1TAHA 3IDAA 1CIJA 1W75A 4B85A 4JYMA 3C5VA 2ZYIA 4TPKA 1YS2X 4A5SA 1RP1A 2OCKA 3DD5A 4J0IA 1WPRA 2QZPA 5LZ5A 1VE6A 2OCLA 4DLNA 5DYWA 4N8DA 1ISPA 1N8SA 4P08A 1HL7A 3W9BA 4EA6A 4XJVA 4GBGA 3VDXA 2WKWA 2G5TA 5LKAA 1LLFA 3G0IA 2K2QB 3EQ9A 5JZSA 3MGAA 1Z68A 5DWDA 4ZXFA 3KWJA 5FUMA 2QS9A 3Q0TA 3H0CA 3U0VA 3FWHA 1PV1A 5A6VA 2HA6A 4ZRDA 1UK9A 2I3DA 3HLKA 2C58A 3LIPA 4Q82A 3I1YA 3BL8A 2XUPA 1K63A 1VA5A 3FSGA 3DJYA 4BCDA 4UFPA 3M82A 3LIIA 1J06A 2WHQA 4OD0A 2O2HA 5C81A 4G5XA 3N2ZB 1CQZA 1E8MA 1CUDA 3ESAA 2XUAA 1ZICA 4UBKA 2ROQA 5KWJA 2WUFA 2JEZA 1Q0RA 1QJ4A 1XROA 1K6EA 4B80A 4U2EA 4C87A 1XKTA 4B9AA 4L0CA 5E4TA 2HADA 1QO7A 3NUZA 4EY8A 5E4YA 4JUIA 4LXHA 4RE5A 3C87A 2FUKA 3T52A 3ZWQA 2ZYSA 2RONA 1DX6A 1NU8A 5FPPA 1MNAA 1QIHA 1MO2A 1J2EA 5CT4A 5I9IA 1GKKA 2WU3A 5IVKA 5LIPA 1XZGA 3WKDA 1VOTA 3QZUA 4PF1A 1DT3A 5AI6A 5ALUA 3PI6A 1R1DA 1RWQA 4OCZA 1VXOA 3O0DA 2QJWA 4B0OA 4B0PA 2YYSA 4WCVA 4QDTA 4BAUA 2WFLA 1CUZA 3AIKA 4QDOA 1ZJ5A 3D59A 1OILA 4X3CA 3I2GA 5I8PA 5AM0A 4UHDA 2VJCA 4BTLA 4X00A 1WHTA 3E4DA 2Y1KA 4DMKA 4Y7DA 1UWCA 1EINA 4W9RA 1VZ3A 1DU4A 4L9AA 5T4FA 4GLBA 2VAVA 3A2LA 3KDAA 2WIJA 3G8YA 5ALZA 1H22A 1UK7A 4QDXA 4KE8A 3UUEA 4LYDA 3B12A 3G9TA 1IVYA 3DL7A 4FKBA 1UFOA 2C7BA 1E8NA 1WOMA 1XRLA 3E3AA 4EHBA 4I4CA 1JU4A 4WY5A 3GROA 4L3WA 4L72A 4QLAA 5AKGA 4OU4A 2XMZA 5EI5A 5JALA 2HA0A 4F5ZA 2JGMA 4DIUA 5FKJA 3DNMA 1B6GA 1VKHA 4OB6A 1EDEA 2WIGA 3FYUC 2UZ0A 2IIVA 5JD5A 4BP8A 1P0MA 4Q3LA 3C8HA 1YAHA 5JARA 1EHYA 2VJDA 3STXA 5EHXA 2X76A 4BC0A 5AK6A 2VT7A 3ZLTA 3WKCA 1R4ZA 4KEAA 1XZHA 1BN6A 2PBLA 1Q0ZA 3HJUA 5DLPA 2WG2A 1XZJA 1CUWA 1EX9A 1VJ5A 4BVKA 1XZAA 3G7NA 1BE0A 3H04A 5C8VA 3R3ZA 1ZI6A 5AKJA 1UXOA 3QPAA 1VZ2A 1XRPA 3AUKA 4NZZA 5LP1A 2XI4A 5EIAA 3X3HA 5JD6A 3IURA 2O7VA 5AKHA 3C6YA 1ZD5A 2VSQA 4Y2RA 1K8QA 2H9YA 1FJ2A 1FFCA 4G8CA 2J3DA 1CVLA 1AGYA 4MWSA 1XZCA 5A2GA 3A2NA 4UBMA 3IIIA 3PUHA 5LZ2A 1MTZA 2PUHA 4B82A 1XRQA 2XUOA 1DT5A 5C7YA 4BC1A 3FVTA 1E8DA 3MUOA 5FLKA 1QTRA 1UKBA 1AUOA 5HCUA 2CMFA 4O08A 5AI5A 2DR0A 4BTVA 4G4GA 1XZKA 4KAAA 5DNVA 2RHTA 1LPAB 2XUKA 4RGYA 4P9NA 2J4FA 3F8SA 1GPNA 2XMGA 5CTAA 2XUGA 2V97A 3I2HA 2NW6A 2D0DA 5ALLA 1CRLA 3FYUA 2OGZA 2BUAA 4B84A 1RYYA 2G4LA 1DWOA 2DCMA 4AMZA 3G9XA 4BAGA 1ZI9A 1HBJA 4V2IA 1W52X 1HKHA 3FLEA 1FFBA 1EA5A 2C4HA 3WA7A 5IVIA 1S8OA 2VAXA 5JZ9A 3WYDA 3L1HA 2XUQA 1F6WA 5K3FA 1DINA 1CUSA 1L7RA 2OLEA 3O9VA 2QR5A 5SYMA 1H23A 2H7CA 1WHSA 4HS9A 2C5FA 3STVA 1QIFA 4LXIA 1CUVA 4WY8A 1DQYA 4Y2PA 1EB9A 3A6ZA 4GHWA 2VQ6A 2XQKA 3CN9A 3VKFA 1EB8A 5A7GA 4WDQA 3B3QA 1R88A 4KR0A 4EY6A 4A16A 3PF9A 2GBFA 1UK6A 4UBOA 2QTBA 3WL6A 2WHPB 1NU6A 4KRXA 1LBSA 4E15A 1I6WA 1LZKA 3FLBA 2WM2A 1SFRA 3C5WP 1MAAA 3HEAA 5KREA 4W1QA 5ALMA 3KD2A 1HQDA 2OQIA 2WG1A 2QKYA 4ETWA 4FHZA 5JASA 1GZ7A 2Y2UA 1U8EA 2OAEA 1LZLA 3R3XA 5AH0A 1EI9A 4FLEA 4XWGA 3OM8A 4UFNA 3G0BA 3IUMA 4GI1A 1H2YA 5ALQA 4LHEA
chains in the Genus database with same CATH superfamily
2P4HX 2X2FA 2XUIA 3HMKA 3OJWA 4K9OA 4U1RA 4WK6A 1CRWG 4ZOLA 2O0HA 2XT9A 2D2VA 5KCZA 2JC3A 2GCNA 4DJDC 1DCTA 5CBPB 2HFJA 5LZ8A 2Q27A 2J08A 4KITB 2QT0A 3DLPX 3DDWA 2WJGA 4DG5A 2HDWA 3PNQA 1M2HA 1G5HA 3C5EA 2N1MA 5CIQA 1V5WA 3UMSA 1GHTA 1J9ZA 1RQ2A 4Z3OA 4LFAB 4XVHA 1TDJA 1TW3A 3GLIE 4BNMA 3DVLA 2VJOA 4YJ3A 4G2TA 4NV3A 4DQLA 5E6RA 2PVPA 2MR5A 3TW8A 2OZPA 1KEEA 1LSJA 2IUYA 2V0NA 3IBGA 4ARSA 1USVA 4DRXB 2NZVG 1YWGO 2V0CA 3RJ9A 4RD3A 4BCBA 5B3LA 4Q1DA 1HQKA 4BX0A 3K9CA 2XUZA 3EIQA 2QV7A 1R6DA 4FGZA 3L41A 1GO2A 4TXMA 3N8KA 1I3MA 3MSCA 4L27A 1XZBA 5K03A 1AB6A 3PTAA 3AIIA 5JQWA 3ZIAA 2TSYB 2VN8A 1O6FA 2PL1A 4QOGA 4MA4A 5IH3A 5CCDA 5EC8A 3EPKA 4ZO4A 3DO8A 4NP6A 5K3OA 3WYBA 2MYPA 5HK8A 4D9KA 3CVUA 3PJFA 3OUUA 4HAUA 1CZKA 3NBAA 4ID9A 1B0UA 4YP1A 5BXQC 2AI1A 5EZSA 2XXAB 4CYMA 3AOEA 2G1UA 1PK9A 1T35A 3DXXA 2W93A 3PDCA 4Q9IA 3PHGA 8GPBA 4DCVA 1FU7A 3KFLA 3PX7A 1Z5ZA 4Q39A 1Z45A 4M7PA 2PUDA 2WTBA 3L8MA 2JBAA 5E1MA 3URKA 3O8OA 1L5QA 4DDKA 2X1HA 1K7YA 3DEZA 4QYWA 4MHTA 3EDYA 1K8RA 1FMJA 1Q0TA 2VNAA 4ZOAA 2ZR0A 4Q1CA 4O4IA 2YW9A 4J0HA 2O1WA 3EZ9A 1ACLA 1OGIA 3H1AA 3PPVA 1FTQA 5CJPA 2O9JA 1EIZA 1NRJB 4OHUA 4JXXA 4KSBA 5C8ZA 4HUQA 1PR9A 2UKDA 4LYYA 1DKRA 1T36B 3Q41A 2F2TA 4ZDJA 3QELB 1ZK1A 1KEPA 4YRPA 5ALDA 1PG0A 5ADWA 3L0ZA 1MP0A 4MEBA 2V7WA 1LJLA 1U9IC 2QI9C 2HLDD 1OWOA 1GEGA 4TV8B 4U7JA 1DJNA 4LYHA 1OZGA 4HLUC 2PXAA 3A9CA 4CMEA 1H2BA 4FWBA 4BPBA 3G0HA 1GDDA 4BNZA 4A4DA 2GZ1A 2DLNA 2DKFA 3VU9B 3D8TA 2C2WA 3E9QA 3AUSA 1R8YA 3BMNB 4A8JA 4HGRA 1CZUA 3AYZB 4LJ4A 5FL7D 4OL9A 4JX9A 4NV0A 5F78A 2JRCA 3HKBB 4XYGA 1VI2A 4I66A 9LDBA 1QKJA 1G60A 5BVGB 2UUCB 1OZFA 4IVNA 4Q4CA 1FS5A 1AN9A 3FLAA 3IA2A 4F4CA 1Z8DA 2IHUA 3BERA 3L0IB 3MS4A 1WCXA 1JTEA 1ZH8A 3JARA 5CYFA 1QU2A 1RAAA 3MD0A 2OFOA 5T6BA 1U9IA 2INGX 1SZJG 3CZMA 1TVEA 5J5VA 1C14A 2RAFA 5EJGA 3W2HA 1OYWA 1UEIA 3HYLA 1THMA 4ZMBA 1E59A 3JVIA 3OZRA 1LI5A 1VRWA 1WBJB 3EF3A 4G8DA 3ROPA 3T9EA 3OHSX 2AHOA 2ZUDA 2O19A 1HEIA 2ZJAA 2O3TA 4F7WA 4I1PA 4ZZ2A 2LUOA 1QZ3A 1BAPA 3C7AA 1RLIA 1TCAA 3COSA 4XD7A 5J5CA 4N47A 5AJXA 1DRUA 1EVKA 2QVZX 4RVGA 5A04A 4KLNA 1IY8A 4A8PA 1KGDA 1N0UA 3FOAA 1TKRA 1BYUA 2PS3A 3O9MA 5SZKB 2QL6A 1PL6A 2H6EA 1Z0DA 3IRVA 5JFOA 1KL7A 4HVTA 5L3ZA 5K0GA 1QK3A 4J76A 5FH9A 5C8YB 3LYUA 2QUAA 4AF8A 3VH4A 1S89A 5H68A 1OX4B 5H80A 2HPHA 2VEOA 1GPKA 1QDUA 2BCEA 2J3QA 3P9RA 4BX9A 5EIEA 4G0OA 1W85B 3HXOA 2XKBA 2B35A 3ITEA 3K71B 1H1TA 2R8ZA 3VHLB 2NXWA 4LNUB 4FNAA 3GGGA 2HGSA 4DPLA 5B30A 1G5RA 1Y9JA 1RP7A 2ZR9A 1JHZA 4J7AA 3U7FB 3ZHTA 9MHTA 3GRAA 4HNAA 1J33A 4OBEA 3IJPA 4KQKA 3KQSA 4KR9A 1DBWA 1E92A 2II6A 5H5JA 3ZZUA 3FJYA 1X70A 3WNVA 2C2ZA 3C3PA 4PTYA 1Z5WA 1N8NA 2XYRA 3L7AA 1IUKA 3LQQA 4BVJA 3CKLA 3QSYA 1I1QB 2P5TB 2QOEA 1KIFA 3JD1A 5ENZA 5FLXA 2NZ2A 1JHAA 4ZWNA 4NJEA 2R9VA 3BIWA 5KS2A 3MHTA 1PYOA 3B78A 2QSYA 3TX2A 3F4BA 4EY7A 2BEVB 2WJVA 5AK0A 2AOUB 4EG4A 2XB8A 1CQJA 1II8A 3AR5A 3LNTA 2BR3A 3OT1B 1XJCA 4GOJA 1YCDA 3IULA 4MUFA 4OIMA 4C22A 2RHRA 1TUBB 4AJKA 5FBQB 3STTA 3D31A 4D0SA 1W29A 1KU0A 3T5GA 2BFCA 1L5MA 4I19A 1RJEA 3MJDA 1Y42X 3VR4H 2BZGA 2RBGA 4TZKA 5BOVA 5GTDA 4M4SA 1J24A 2K5UA 4KX5A 2E4VA 4TSFA 5C52B 1IN7A 3M6VA 1XWWA 4DNOA 4GMGA 3L06A 2ALJA 5AICA 2OO7A 2C4KA 2HMVA 2RI1A 2YWCA 4MMZB 4JASB 4L08A 1SOAA 1J07A 2GZMA 2UDPA 3NIBA 4HY3A 1R2QA 1RYEA 3HCFA 4C7MA 3NHKA 3KSRA 1Y1PA 1BU5A 3NP7A 4MQLA 1Z62A 2NU9B 4EYKA 3QE9Y 3ICQB 3OQNA 5JNTA 2OD9A 4N01A 2AT1A 1X19A 4HAIA 1SO8A 4IH1A 3VYSB 3KZKA 4R2MA 2VZ9A 3UH0A 2B94A 4UDYX 3ZHRA 4PRYA 1MOQA 3REFA 4DPMA 5CJJA 1V7PC 1Z7YA 4MS3B 4EVQA 1OHHA 3FFBA 4ZYYA 3WRXA 1SU6A 1NLMA 1Z5PA 3A27A 3DYVA 3MGBA 4ESVA 3HCOA 5F7JA 3GZNB 3BRSA 3G79A 2A1IA 3NVAA 1N0VC 4BWGA 3MGKA 1XCOA 4B3IA 1YBFA 1U3GA 2VK1A 1KMHB 4XD7D 4EF4A 4NU8X 2IY9A 1D2AA 1CJUC 1BH6A 2C2YA 1EGMB 1A9TA 3DO5A 4R2JA 1FVXA 1T4MA 3MGGA 3N7AA 3LX8A 1YDMA 3NC1C 3NEJA 4X1YB 2DPLA 2DMRA 2VBCA 4DIEA 2GZ3A 2PZLA 1M34E 1GN9A 2PS9A 3CEAA 3GLGE 4LYGA 4Q5IA 4Z4QA 4BASA 4F5YA 4ZVVA 5CFRA 4N3BA 1SBYA 3KL2A 3M5WA 3RSZA 5CT9A 3WWEA 4A92A 3QP9A 1S8NA 5KMGA 2ZROA 4IDEA 3R3SA 1XSEA 2G36A 3BREA 4KDEA 4BP1A 1XJQA 3T7CA 4CQLB 2PL9A 1AV7A 2R68A 3HN6A 4CKBA 3M4XA 4EPTA 3MIZA 4Y2SA 1HTWA 2JFVA 4OAPA 4PQRA 3TNYA 4HQFA 4KXVA 1CUUA 1VGVA 1KMCA 1RQLA 1T2UA 2K4MA 2X14A 3ABZA 3H17A 4BUZA 3FN4A 2XDQA 3PUYA 4F06A 5AM2A 5IW8A 1GG2A 1PDWA 1OROA 4JJEA 4ZU1X 5JBNA 2DBRA 5FADA 1JT2A 3SF8A 3UT5B 3SN6A 1E2IA 4OBBA 1NVVR 4PSUA 1DKQA 3S1AA 4DSUA 1KFKB 4EHLA 3DMNA 2E85A 1XAGA 2ZYGA 4WGGA 1PFWA 1FJXA 2GPJA 4GWGA 1QS0B 4RCZA 4DSTA 1RBMA 3UMRA 2P11A 2I55A 3FTPA 3BTUA 4MO9A 2W2LD 3K96A 4ZK6A 1GFWA 1EX6A 2ZTHA 4C6RA 2ZIFA 2G70A 2WYVA 4E2YA 3RKUA 4DWJA 4C43A 1GUBA 1TKAA 2TMYA 4YTEA 1JQBA 3GB9A 3VZBA 1GV1A 1MORA 2PA0A 4OK5A 5HKKD 2QM0A 2VL7A 2ZJ8A 3EXG1 2P9QA 3OAAD 2R84A 4F8EA 2W4MA 5E6SA 2PL3A 1PZEA 3WLAA 1IOWA 3O6VA 3O2SB 4JFAA 5TPZA 3ABRB 5CDFA 1KJYA 3AHHA 1W4CA 2QN7A 1HNWB 3EXHB 2ZBUA 1YBAA 5K0FA 2DWOA 5E6UB 4M87A 2YV5A 3HJRA 3N07A 4CG1A 5B4TA 3BE8A 2YWBA 3NHLA 1R4NB 4H1UA 2Y1FA 4YBZA 5ABPA 1U1DA 5KJ6A 4I50B 2X15A 3ZV5A 2PGJA 1KI3A 3PNSA 5ER6A 4OHMA 2EZTA 4XB6B 2P9ZA 3RSCA 3E03A 4QT4A 5DEIA 3R7SA 4YPOA 4ZI7F 1XVIA 3M5PA 4E0BA 4GLJA 5K0ZA 2H31A 2VDPB 2G0NA 2ZPAA 3VO1A 2DHCA 2PXHA 3K5PA 3GMDA 1R0SA 2FAXA 2OHVA 2ZTMA 3E2IA 4NAHA 1HYQA 3SC2B 1JIQA 3I2KA 3WGGA 2IYPA 3MYRA 1XTBA 4O02B 5DCLA 4R9SA 4RFLA 5AVUA 3TS1A 4PS1A 2V6GA 4QGSA 2FPGB 2JGKA 4D8VA 4EHHA 4XCQA 4CTNA 2BSQA 1A72A 2NVOA 3GX1A 2YQZA 5JOQA 5JYCA 2XZLA 1ZC4A 1TC1A 2I6TA 4DMMA 5KYGA 4GXQA 5HGJA 1EK0A 4ND1A 1ESDA 1JA1A 1ZM7A 1R6AA 2E87A 3AZOA 5LZ4A 3HVUA 3R9KA 3W5BA 4KVZA 3CSSA 1VP9A 1N5OX 3NJ8A 2OV6A 1N34B 2R97A 2YZ2A 1V0JA 4Y1RA 1IEXA 2NIPA 4A27A 3W9UA 2RB5A 3BWXA 2ZVJA 4H60A 3DDSA 5HYVA 4GGPA 4FR2A 4YP9A 3TEJA 3E4CA 1JU9A 3VR2D 5FX2A 2IQ5A 1D5WA 1NRIA 1V9CA 5CAEB 1XPJA 3GFFA 3HVRA 1M1NB 2R00C 2ACEA 4RVSA 3STWA 1QTIA 1O95A 3K94A 2X58A 3KZMA 1U94A 5DNDA 2KSQA 3M70A 4Y2JA 3OTOB 5HMMA 1SKBA 5JSFA 1UPXA 5T6MA 3SOPA 3HU1A 2IIBA 3SM3A 1Y8QA 1BXKA 5EWLA 3PNLA 2PWPA 1K3TA 1EGVB 2VSYA 3ETHA 1V5GA 2PWZA 3JQCA 3MF4A 1G4AE 3O95A 4PYMA 4LGYA 3OC0A 4AD8A 1R0CA 1Q0HA 1X7YB 2W2LA 2I99A 1DOAA 5FOXA 1F0YA 5JRZA 3QFFA 2BKLA 2WYHA 3ROTA 1N2GA 2Y4NA 4XASA 2HQ1A 4I55A 3KQOA 3MMXA 1TKCA 1DX4A 3L7JA 5T64A 4L8GA 3IVMA 5C7LO 1HPLA 3T0FA 1JB9A 3NLLA 1AGXA 1BFUA 1LS6A 2CBXA 3BXPA 3H3XA 4JBWA 4RV9A 4E3ZA 3QFRA 1XYGA 3DBVO 3IQEA 3P1JA 5BT9A 3BJEA 2HQOA 1QIEA 1HETA 2GK6A 2VJYA 3CCBA 2VZ8A 4LRWA 1RJ9B 4TM7A 1CUGA 3RBZA 5TIIA 5GJVC 3S1AB 3PHCA 4J16C 2ECFA 4E5NA 3WIEA 5BMVF 1XU4A 2W0MA 4B5LA 2AFHE 2JGDB 3K0EA 4GNRA 1IHXA 3OJEA 4C7JA 3DYBA 2ZWVA 3QLVA 4B7XA 4Z54A 3RRXA 3W4KA 1IBCA 2WHEA 4ND6A 3VJLA 4BNVA 1IOZA 5FDFA 2RCNA 3AP1A 2J5BA 4NG5A 1SK8A 4V0ME 5A3JA 1KTIA 4KJZA 4MROA 1TM2A 1EVQA 2NUBA 5JYDA 3PENA 1ACJA 3UG6A 4D9MA 4EVIA 1S6YA 2G5PA 1UMKA 3L6UA 3P32A 1XHFA 3O3OB 3W3AA 4EMBA 1JR6A 4IZIA 1A5BB 1TF2A 1XNJA 3L6EA 1JALA 2HJWA 3M83A 2ONYA 3LT1A 3GWZA 2NZXA 5ICFA 4MPTA 4JVLA 1L5YA 4X85A 1O6GA 1ZGHA 2VNSA 2CUNA 5KI6A 3L9WA 2PLWA 4KWCA 3BD9A 3CUUA 2IY7A 5LYJF 1MFZA 2PQMA 3C16C 4TMKA 2AQIA 4YDSA 1SBCA 1H85A 2IHNA 1WUTA 3HCNA 3B52X 3HBAA 1EDZA 2VDOB 4Q93A 5JR3A 2I62A 1YDEA 3H2HA 3U2QA 5CT6A 2J3IA 4CEJB 3Q6NA 4MGKR 4OFZA 4YA6A 3VAYA 4K05A 2P9JA 3AC0A 5KU1A 2JFQA 4PAWA 4OH7A 4FLMA 3AJDA 1T24A 2FR1A 1DAFA 3OLCX 3ZE1B 5J2UB 2H29A 4NKRA 3AFOA 1KARA 4KQFA 3JQGB 4EAAA 3KV3O 2Q0XA 4NE9A 1TK9A 3Q5DA 3OOYA 2YHUA 4GI7A 1QH1A 5CVTA 4Z4GA 2VH5R 2ISQA 1DKPA 1LBQA 5CLLA 4UOQA 3VJKA 2PLFA 1X7DA 4JSYA 3E3NA 2HWXA 1CY0A 1TLTA 3E9CA 2WHRA 3EJ6A 4KO1S 3PCXA 3DZBA 2G0TA 4X7BA 2ADMA 1ZU4A 4E33A 2JZOA 1IFXA 4HBGA 1RAEA 1T36A 2XWJI 1CEXA 1VLLA 3H18A 1ZD1A 2Q5CA 3FTFA 4ZVLA 5KOIA 1GAWA 1C7QA 3QFHA 2O8CA 1ZXBA 3QU7A 4UREA 3REGA 3UOGA 2PEYA 2VHJA 3D6AA 2PMCA 1H1LA 4MRSA 3OZAA 4OB7A 3TIGA 4QU8A 5JY6A 2AUNA 2OO5C 1M33A 3DE3X 1NW7A 1IWPB 2UZ3A 2RIRA 1U0SY 3BSFA 3K73O 3F73A 1JMKC 1LPMA 4DYDA 3W8NA 1HDRA 3A4VA 3DEJA 1I10A 3CB4A 1KEZA 1C30B 2WP0A 2ZKLA 1PJ3A 3HL0A 3RNOA 3TGLA 1EP2B 2J0EA 2WJZB 1ENYA 3IBTA 5DX0A 3ZW9A 1SXPA 3E05A 1RI4A 4BV9A 4DVJA 1CF2O 1TYEB 2IY8A 3FY4A 3L77A 4EECA 3RC9A 2Z8ZA 3ERCA 1U2SA 2XLCA 2IW3A 5C1IA 3AR8A 3FH0A 3L7KA 4J3JA 1RD4A 1LLQA 5DLYA 1F8FA 5BURA 2BFEA 1ORVA 4G4SO 5J4VA 1YS4A 4TVOA 1ONOA 1E2BA 4P6VF 3NOXA 4PYQA 2DQZA 5L3QB 3LHDA 1O77A 3VVLA 5I45A 1JKJB 3MMZA 3PITA 2DFTA 2GM5A 2H1HA 4YB8A 1BVRA 4FFRA 1LNQA 1Z83A 3QV1A 1VJRA 3R3VA 4I55F 1S9HA 5FNZA 5B36A 1THZA 2EVWX 3K4HA 3ABQB 3INYA 4EJ0A 1RAFA 4PM4A 2OUKA 4DY6A 5C18A 4D8YA 2JAWA 5EN4A 2JVJA 4FLFA 4MW9A 4XTCS 4YV2A 3OZSA 2EKBA 2I9PA 3M49A 1HFKA 3B1YA 4G6ZA 1EA7A 4Z3DA 3ZV7A 5LLSA 4RD2A 1SKQA 2ZRKA 3HJBA 3NNNA 2JFZA 4DLWA 3RYHB 1SD1A 3IT1A 4IOMA 3MYYA 3IP3A 2WB2A 3LX4A 5DM1A 1D2NA 4R31A 2FKNA 1NW6A 2V9ZA 4MRAA 1MO4A 2D4HA 1PD1A 3KJGA 1GKLA 4LMBA 5K4AA 1XA3A 5JDCC 1TVMA 1FS6A 2PZEA 3NOVA 3MOIA 4I08A 2AN4A 3GCWA 4KO8A 2NTJA 1IK6A 1Z7WA 2JFFA 4EEZA 1BKDR 2OBXA 3WMFA 3ONWA 4OQNA 2H1SA 4OO3A 2CLCX 1GYRA 2YJ3A 1U28A 3G23A 4WCFC 4HUQB 1M83A 2HCRA 4R54A 5JSHA 4L2IB 1E3WA 4JNCA 4V2UA 3F5QA 4D0GA 2GEJA 4MULA 1RLOA 4F8JA 4R7GA 3O83A 1GSAA 3HVHA 4YRCA 4XWAA 4MV0A 4C4SA 2QLNA 5E8JA 5CB4B 4RTKA 3LFTA 4WIAA 3MAGA 3N2EA 3N9IA 1ICEA 4X93A 2Z2JA 1D2EA 1JDTA 3QLEA 4G5RA 4I4LA 5K05A 1P2SA 1M0SA 2QMOA 4Y6QA 1JSZA 3JWIA 4RHUA 3PSAA 3Q9NA 4YT8A 1WBBA 1TD9A 2WVJA 2CLSA 1C1DB 2KX7A 3RK1A 3VU1A 4DR5B 2R3SA 2M98A 2BV3A 1R6TA 4PPYA 3E48A 4AJ4A 5F3WB 1H4TA 3FGOA 1II8B 4H7HA 4PGMA 3UBMA 2R60A 5IG2A 4AUNA 3IHWA 1R9GA 5F51A 1CTQA 5SY9A 4B81A 1W47A 3KUDA 4DCNA 2D1TA 4D6PA 4UUNA 1G64A 3LD9A 3W79A 3PYLA 1RJDA 1HE2A 1FSFA 1YZVA 3C6BA 4J9UE 2GF2A 4MQ4A 2J3MA 3V48A 4IWNA 4P4LA 4V0RA 2PZKA 2PFSA 4FGKA 1OWLA 4C3UA 1ZOPA 2FA9A 3DM5A 4B8YA 5DM60 2VUUA 2GBGA 1I4EB 1IK4A 4BNYA 1SBHA 1NM5C 2CJPA 4L3OA 2EBFX 2IX9A 3K1AA 4XH9B 4N0EA 3PJRA 2FPPB 2OFXA 3SIRA 3S6JA 5BW6B 5FWXB 4M7WA 3ORYA 5HF5A 4FXPA 1CQPA 3UENA 4KE7A 3N8NA 5DGTA 3ZHYA 4DJAA 3ZWXA 4PGAA 3SE7A 1OYYA 1SWVA 4HMPA 2XNHA 3FTNA 5AOAA 4YYEA 5BOSA 2QG9A 5TJHA 4L5JA 3EEOA 1ILWA 5LP6C 1N5LA 4DY4A 3Q87B 3GT3A 4HTAA 4L73A 4P7GA 5HJ2A 4HX9A 4PE5B 5T8KA 1F8GA 1U2ZA 5EHIA 1S01A 5A3VA 2BFOA 3CNHA 1CS0B 2GLUA 1ZA1A 1WUYA 3PTZA 2MR6A 4HXFB 4KQGA 5G0SA 1E1YA 1P4JA 2J7PD 1LB1B 4ZP1A 2XQJA 4GXTA 4MQMA 5DBIA 3OPYI 2NTNA 3CNQS 3GUHA 4IKPA 4OLFA 4KFTA 3HE3A 4F0JA 4LE2A 4QM7A 4G63A 1BHQ1 4NNJA 2ZJZA 4XLZA 3VHXB 1XZ8A 4FOPA 3H1EA 1NFFA 2OV4A 2PKEA 4ITUA 1Y34E 2DUJA 2G1PA 2C96A 1WCYA 3MT8A 4D57A 5JWOA 4GP6A 4K6FA 1S4QA 3BXHA 1BMFA 1N32B 3THYA 1TIBA 1DFHA 2P2LA 3O3MB 4X9XA 3ZDFA 4DR2B 3VNVA 2E4XA 1MC1A 1PZMA 2GAIA 3QX8A 1EFRD 2NQ8A 2PFKA 1G18A 2JBWA 3WBJA 2FUNB 5LQKA 3MJFA 2WWXA 2V1UA 5AW8A 3DZGA 1DV2A 2DQ4A 3A6HA 4EATA 4I8DA 4JUDX 4Y0VA 1ABFA 4TL6A 5HS4A 1WR8A 3R1IA 3ZI4A 4DAOA 3OZVA 5A62A 4D9GA 1ZJ4A 1HSOA 4CLHA 2H0QA 5G2OA 1K3FA 1U0LA 2QY6A 3KYBA 1A8PA 1ZFNA 1PR6A 3OLQA 4IMRA 4O0MA 2OENG 5LNK6 5HNKA 2Q1YA 4DIDA 3EXEB 3BXXA 1T34A 1KBOA 3Q40A 3ST7A 1KSGA 5LQRA 1V48A 3R77A 1QIMA 4JOQA 3QPCA 5KDDA 2C3MA 5KQLA 1GGMA 1BEEA 3PC6A 3U5TA 2VAMA 4EW2A 1OV6A 1CW2B 1ZJ6A 3MELA 1ESZA 5ICMA 1EXWA 1M67A 3OM9A 2M6SA 3QG1A 3PEYA 3RM3A 4JI4B 3EBPA 2LDBA 4RZUA 4YJHA 2YYZA 3F1KA 2GBPA 2PR2A 2VDQB 1EJ2A 1A2OA 3AUUA 3ONDA 4I9HA 4ZQGA 4CMJA 1E6MA 3MOSA 3K35A 4I1IA 1Y1SA 1ZM2A 5GZ1A 3IEUA 4WOBA 1R7RA 2O8FB 3ZQUA 3S55A 2JFPA 3K0FB 4MS3A 3E7FA 3GP3A 1TU4A 4F9GA 2B7LA 3Q6IA 4WXHA 1F60A 2FRXA 4GSYA 1XDGA 1EM6A 1TT5B 2WSIA 1A8HA 1DRJA 3WICA 5B57C 3BE4A 4LDAA 1QONA 5KYXB 2V7PA 4D4HA 2ZE6A 1XVTA 5CM2Z 4WK4B 1RYFA 2D0PB 2GEBA 2ID7A 2JA2A 4IGAA 4MUJA 2ZE8A 4BLTA 4UPEA 1NE2A 1Q7TA 4GPD1 4R84A 1OT5A 1UBTS 4QUGA 4RHTA 4QPPA 4I5GA 3D4BA 1GUAA 4JFRA 2MMCA 3AJEA 4Z9FA 3THRA 1BS2A 3WZMA 5B7GA 3IE0A 1GXSA 1L9XA 1GL3A 2OO3A 2RAPA 1WP4A 2AK2A 2EWMA 4MNTA 2FI1A 5FOTA 1GSHA 1KVQA 4IQGA 2YIJA 1DVRA 3REQA 1IB6A 1UBCA 1EDDA 2V4MA 4GPAA 1SC3A 4HGOA 1P1RA 2Z9CA 5G4LA 3H5WA 1YTUA 4U7DA 1J09A 2ZIUB 1P1CA 5SY6A 2JLRA 3F47A 3DR3A 1W35A 2P77A 3G88A 1AF4A 1S3FA 2RC5A 3R3WA 4HI0E 1DAEA 4G5GA 5AK4A 2VF4X 1UMCB 2GK4A 3MJVA 2N47A 2TMKA 1F6DA 3G7UA 3MCUA 4KPUB 4LDQA 4RSMA 1G8JA 4P83A 2BGNA 3QKUA 3U4AA 3L02A 5G1OA 1I3NA 5KQRA 2PX0A 3AYXB 3G0GA 3PDJA 1TTTA 5IAKA 3V1KA 1ODFA 3QV2A 4HQ0A 4KIJA 4QQKA 3VR0A 2ZRCA 1GPMA 1O03A 4UEQA 4CIYA 1C4WA 3KKKA 4AF6A 4BWVA 5A02A 5ES3A 3OD5A 3SG0A 4NQZA 1CR4A 5ALPA 4K6GA 4N12A 2YXLA 4ARBA 1S2GA 2UVPA 1R10A 3QNMA 4FPXA 1EU1A 5FR1A 3ESRA 3P9CA 4FFMA 1GQQA 3TRKA 5CDTA 4GM4A 1XB2A 1OVMA 2E6KA 1VLHA 1G2OA 5EL0A 4EYGA 5DVZA 1G7CA 2J31A 1VJ1A 3GG2A 1G1MA 3KR1A 3OWHA 3M1LA 1ZEMA 2I1LA 2VRWA 3ZIUA 4QU5A 2JA1A 1EEHA 1SCIA 1L5WA 3FMVA 6PFKA 3OCJA 4A0FA 2VJMA 1AB5A 2XAUA 3BA1A 3LRPA 4K6CA 4KIUA 4XQ0A 3BJRA 4YCCA 4P0QB 2ZCUA 5D3ZA 1RIFA 3CVVA 1XL0A 1UJ5A 4EYOA 2ZYWX 2RAVA 5CA0F 2BTOA 3NT2A 2DETA 2CF5A 4FFOA 4CCSA 1ZMXA 1EUCB 2MU1A 2R5WA 4IF4A 5EHQA 1YR1A 4HDKA 5E9AA 3ZE2B 1OBCA 1SQSA 1TAUA 2UYYA 2AE1A 3MVEA 1XEWX 4JDPA 4S1TA 3RIMA 3STHA 3VPXA 4QBGB 3K5HA 5TXGA 3CNOA 4IWXA 1SVMA 1ZD4A 2GOYA 2V6BA 3GLFA 1ETUA 1AS2A 3C24A 4G89A 4Y98A 3RWBA 3CTMA 2BAGA 3GDFA 4AU1A 1I5OA 4YRNA 1XPUA 5T3UA 3DF9A 3RVBA 3WWCA 2M32A 2P79A 1P77A 3BE5A 1U8TA 3IIKA 3QM1A 4B4OA 1KZ9A 1XXHB 1J8DA 2GCPA 4Z9XA 1VPEA 3LQRA 3TNDA 4ZKDA 3DBIA 4NOJA 1HXHA 1P2FA 4NF2A 2R1TA 5ALGA 5JD3A 5LZ9A 1GTZA 1D4ZA 1UUFA 2JZNA 1Y3CE 2P6UA 1B2RA 3NT5A 3D8HA 4P0PB 2R6JA 1Z29A 3K09C 3JRXA 4TMWA 4KZPA 5ALKA 4YMTA 2EZ8A 1EVJA 1JSXA 3ONEA 1U3FA 3G1UA 3HB4X 1BQ3A 3MUNA 3D8BA 2ZRJA 5DSXA 4K6OA 4D9JA 4GSKA 1NIJA 4ACBA 3ANSA 4II2A 4GLLA 4C01A 2AQKA 1HOXA 3FLMA 4MLDA 3F3MA 4Z4HA 1UK8A 5ER9A 4EB6A 1AKRA 2FZEA 3MS7A 3X2FA 4ETIA 5HSGA 3PT5A 1YGPA 2C2BA 2H4FA 3MTGA 2X4DA 3G13A 4JKIA 2AEJA 1SUCA 4G56A 4Q6BA 1XMPA 4QYMA 5ENDA 5FAXA 3WBBA 1RBYA 3OHMA 1CY2A 2EKPA 1QH9A 3KPWA 4GBJA 1JPVA 2ZR7A 4YCDA 1KQPA 5CUQA 4EVRA 4YRTA 4UZEA 3GT7A 2B4KA 3GFTA 3K4QA 3KEFA 3CR8A 1UWVA 4NCNA 3RG8A 3WHLA 1WRBA 4KODA 4KXNA 4NAVA 2QRQA 3T7SA 2H85A 2Q7XA 2QMQA 3EDMA 5CDFE 3CS3A 4NEGA 1EFKA 3EGCA 5AJVB 1KOJA 2BPOA 1SURA 1X7YA 4N4AA 2V6IA 5JADA 3ESQA 5ALEA 1P9NA 3EQ7A 3BIOA 3WGMA 4D92A 1ZGGA 1XZNA 3P9SA 2F43A 1KQ3A 4AY4A 3LC1O 3S68A 5JXJA 5T67A 4JLMA 4BAZA 1PBNA 1PL0A 1U2PA 4XYMA 4ARVA 3JWPA 3ZWCA 1MO3A 4IG4A 3IAM6 4ADSG 2R4UA 4RK1A 1P18A 1WUKS 1K5HA 3I6BA 1UDRA 1QV7A 3HHPA 4R1MA 3IP8A 1J0EA 5CLQA 3KSMA 2Q7OE 2OFFA 2XNJA 3RUIA 4F4UA 4YRIA 3HXMA 3RS0A 2J59A 1UC8A 3UAXA 5DO9A 3A7EA 3A1NA 1Z3CA 5IZCC 2H65A 2KBEA 5D51S 4JC8A 4QUAA 4B73A 4S05A 4DREA 4HOYA 5TQ0A 4CLDA 3NDBB 3KT6A 2YX1A 3TH5A 3D7NA 3BC1A 3ENWA 3KLNA 4Y2YA 4LJAA 5AKIA 3ZDAA 3CZCA 4UUQA 2QXTA 3TFWA 4IHAA 2PXCA 4MR9B 2XMDA 5ESRA 1BRMA 2RMKA 3DB1A 2PGAA 3MRSA 3NP9A 2I3BA 4EJSC 4BMCA 5LD2C 5AUPB 3P0EA 4QUHA 2O8BA 5TMEA 4ZHSA 1M5TA 1F4LA 1N0WA 2VF8A 4B74A 3K5IA 5B1DA 4XVQA 2IYUA 1TFUA 4S0XA 4KIGA 4XM1A 1E3QA 2FPIA 3W8DA 3C41J 3KVVA 1DG1G 4I1VA 2CV1A 5HCIA 1PE0A 1IHPA 3FHTA 4MW6A 4P22A 4CODB 5HDBB 2D5CA 3B1JA 4M99A 5L3QA 3NKLA 2O2CA 3OFJA 3ORSA 4UMFA 4JA2A 2VTEA 5EA2A 2AG0A 4JI6B 1RT9A 3VH3A 4OP1A 2XDYA 3UMBA 4DMUB 1CP2A 1PP4A 2WUEA 1K2VN 4G1BA 3MJTA 2QVYX 2M2IA 1MZPA 5JSZB 1AK1A 1P6UA 4S2UA 2C5BA 3P0FA 4LGCA 2IGTA 3B2NA 1MIHA 2BZ1A 2I8LA 3H1PA 2Q41A 5KMGB 1D3AA 1DWPA 1Z6ZA 3COPA 4LOHA 5J2UF 4NBRA 3F5MA 4YEDA 1LF0A 4H3HB 4QUJA 4WVLA 4R2IA 1N6OA 4J0FA 1MN6A 2YN2A 1CYEA 4ND8B 1LDEA 3E23A 1PJ8A 5IXJA 1UBHS 1XQWA 3OZ7A 1PK8A 1TEXA 4C0SA 3DLCA 2FDXA 4ZCTA 3SC4A 1IVNA 4ZTBA 4AMUA 2VDKB 5IAOA 1RAIA 3AFMA 3TRHA 5MF6A 4YLEA 2OP0A 3S2UA 5HRCA 4J4BA 3L05A 5DGHA 1SBIA 2XGOA 1WU8A 4Y67A 5BMOA 5BMVB 3INNA 5FV7A 3TE6A 4OPMA 1MJNA 2FOIA 1EZ4A 4OV6B 2CLIB 1T5BA 2EJCA 1P2BA 2QT1A 3V2IA 3LCCA 4LVUA 4C0WA 2RBEA 3EWNA 5BWOA 3EG9B 3OO0A 2VATA 1NMEA 4BRSA 2PJRA 2WNSA 5GONA 1SB9A 1NXPA 2FW8A 1MC8A 3M3PA 4H6WA 5ENVA 5ALVA 3ED1A 1L8OA 4UU7A 1II0A 2IOFK 2OECA 4F92B 5ULLA 5CB4A 3UTDA 1OH8A 2Z9BA 4QNNA 4QREA 4F6LA 1E79D 4AG6A 3PG5A 1PDOA 4UUMA 4KXUA 2BFWA 2WNIA 4OQZA 4QBFA 4CV3A 1Z07A 5FOWA 4G84A 4ZVKA 3SKXA 3W2FA 2QJRA 3RO7A 4B48A 4LFBB 3GRRA 2ES4A 2WIKA 3WFZA 2PWAA 5E6SB 6ADHA 1I14A 3QXJA 3OZWA 2VJPA 3AX6A 4P33A 3NI2A 1TPZA 3WQBA 5LYJB 2YUTA 1PHRA 1UPFA 5GWXA 3FDJA 2QRMA 4IV0A 1B6SA 4MS1B 3NORA 3EXAA 3JRWA 1Z4LA 1BXRB 2ZPTX 1EFTA 4FYHA 1IZ8A 3SWWA 4UXIA 5F2OA 4AW9A 5DGDA 1L2TA 2KHZA 4YCAA 1I7NA 3OESA 5I5EA 4ZYTA 2IUEA 3C3EA 1Z3IX 2EKLA 1I4WA 4KAFA 4ZU3A 4OLJA 2IEZA 3CPSA 2EKZA 1KI4A 4RFSB 4FB5A 1L5ZA 4Q9KA 1NONA 1P5ZB 2FFAA 4CKCA 5A06A 5I9LA 3OIVA 4FI3F 4HN9A 4X6LA 1YACA 3DVAA 4AKSA 1XMOB 1N8TA 3D7SA 1V6CA 1E99A 3SSNA 4IFBA 1W19A 1GUZA 4J7CA 4XM0A 5JWHA 3X2SA 4ALIA 5IT5A 5KINB 4RNDB 5MFPA 3A6DA 4AZWA 2DG2A 2OK8A 4K9MA 3M4ZA 5HPYB 5BUSA 2YWGA 5FWXA 3O8OB 2M6KA 1RYDA 3N74A 3T35A 3WNCA 1IUOA 1N9KA 4NL4H 4WOJA 1UWKA 2OUIA 2A5DA 2J9XB 3BZUA 4L7QA 4XI9A 1IXZA 3MWFA 4F56A 3B89A 3AVOA 4A1OA 3RYHA 2YRXA 4BNTA 3VQTA 3B1XA 2V7BA 1RJGA 1JJIA 1OWPA 1XTZA 2GDJA 3NTQA 3DC2A 1CS0A 1ZM3A 2EIXA 3SJAA 5E38A 1S2OA 3NIGB 4HDNA 3WK8A 2LP4Y 2PGNA 1WXHA 4DLZA 3CV3A 2EX1A 3OCUA 2CDNA 4CN9A 4TROA 3NUQA 1B6RA 3DAGA 3NBMA 3FTQA 3L8CA 4Z8XA 5IJ9B 3Q2KA 4FCCA 1HFWA 3PE3A 2UVDA 1NWHA 2WU1A 2GILA 4B6OA 1XRRA 1QVZA 2ZATA 3A9SA 2WZBA 2VOJA 1AHHA 3ILHA 4JLUA 1F6BA 1Q92A 2BT4A 2WKSA 5DBGA 3RKSA 4CG3A 1H2AS 2PTGA 5K3BA 1N6KA 1YI0A 2BI4A 4URFA 2Z5LA 3KUCA 5AYVA 4O4LF 2BHTA 4UEJA 1X13A 2FQXA 1A27A 2AR7A 1KKMA 4PWZA 4QOEA 1TJ3A 1M2OA 3JV7A 3VYWA 4RXTA 3QUQA 3V46A 1U0GA 2FDRA 5FWYA 3AG5A 3RQIA 1EXDA 2X0KA 2J67A 2ZW9A 3IP9A 2J6HA 2JVKA 2KW5A 4LXXA 1Q3HA 5FPHA 4S1PA 4J0EA 5HJ5A 2E7ZA 2GQ0A 2R00A 1UQRA 1MABA 2OCAA 4QHYA 3VXKA 3NWOA 2QROA 2A9JA 3HHEA 1NQOA 4GC9A 1ZUNB 3BJIC 2FFHA 4WDRA 1QRDA 5BYKA 4HO1X 4JAVC 5DNAA 2D5LA 1U7DA 3CUVA 2DFVA 3EXFB 5SICE 1NBMA 3KQMA 2HPZA 4RVHA 4YR7A 4DADA 5BMVA 1LGYA 1NKVA 4K8RB 2AJLI 1UBRS 4FMDF 1JJFA 2XQVA 4G2NA 2CGEA 4BMOB 4GBED 3ICOA 3JQDA 2PS1A 4F45A 6GPBA 2R8BA 2VQFB 4BKMA 1XA4A 4X0EA 5G0VA 1BWSA 2W2XA 4ZGBA 3Q3JB 3RD5A 2G6TA 1HMPA 4B3FX 1R00A 4L8WB 4OXNA 5K3AA 1ABBA 4M22A 2YKGA 3FTEA 1D04A 1NLFA 2GPWA 3C8UA 3AUAA 4MTCA 1Y4ZA 2YJTD 5FI3A 2W2OA 3EFOB 3IAFA 5CMLA 2GA9A 4RC9A 4BNFA 1T1GA 2JI6A 4R3NA 4NBSA 5C0OE 3RS5A 1SXJE 4MR7B 3L8FA 3W3AH 4N6GA 4F6CA 2ZB4A 3SXUA 2RFLA 1ZUD1 5T4EA 3UBTA 1J7JA 3FWKA 3ASYA 1IBKB 3F4KA 3F6PA 5JWRA 2XEDA 3IILA 4BMPB 3P9NA 4W1SA 2H5IA 2CNLA 3MBKA 1BW9B 1IIBA 4OHWA 1T4CB 2GYVA 3GGDA 1KVSA 3JASB 4W9NA 4D4KA 4ESEA 5IN4A 3THWA 1CUJA 5ITWA 5C51B 1FLDA 1RLTA 3AUFA 4DTCA 4G1UC 3HI6A 4TN1A 3HK2A 1XVVA 2C57A 2H4ZA 2GYWA 3U0BA 4M86A 3HSKA 3UPUA 3O31A 5LBIA 3ZVLA 3BHIA 4KTTE 2HHLA 1L9KA 3CWCA 1N36B 3SHFA 2BHLA 4S2EA 1DO2A 3WGOA 1VYVA 3AG6A 3H6HA 4O2BB 3VH1A 3R9XA 1YS1X 4EUNA 3T4XA 2HZBA 3L82B 2J8ZA 5IDVA 1AG9A 3UUWA 1YR2A 2W22A 3S70A 5HUQA 5T3YA 3PZRA 3OBBA 3MRTA 2YRFA 3FRHA 4HF7A 4J0DA 4LOIA 5G1PA 1G66A 4D8UA 1QFMA 2XMPA 2Z04A 4EQZA 3FUCA 5COBA 3EIOA 9LDTA 2RH5A 4AX4A 3Q8KA 3ME5A 1IH8A 1SKYE 1YK1A 1ZQ1A 2YL2A 1ZN7A 3F5DA 4H18A 3TIFA 4D43A 4B17A 4F21A 4CLOA 4X60A 1V7ZA 3NCTA 1CQIA 3OSUA 4TS1A 4B47A 3DH0A 2QPLA 2KLBA 1C5KA 1EHCA 4ALKA 1LK7A 2GPTA 2PNFA 3BWCA 3ROZA 4BMXA 2C7QA 2RHHA 1YOVB 4IINA 1CZLA 1SIOA 1JEAA 3I42A 1C1XB 3NWEA 4LPSA 1Z26A 1Z37A 5K2MA 3GI1A 4EQ6A 3TBKA 4EJSA 4E3WA 1LC3A 1YRQA 5IYZF 3UHOA 3OLZA 5IJ9A 1KP9A 1NDQA 2YJZA 3BWMA 3H99A 4LHZA 2Q6TA 1U8FO 3JD0A 4RKEA 3BMCA 5JCPA 2I03A 2ZJ6A 1ESEA 1NBMD 3EGDB 2VPTA 3V1MA 4YUYA 3N0XA 1QNFA 2RHBA 5FR2A 2Y1WA 5FPSA 3RIEA 5IKMA 3CVXA 3K0SA 1D0IA 1HI9A 2R62A 4E2ZA 2YFYA 1KDRA 2I4LA 4B4VA 5A9SA 4M8NE 5J47A 3DBHB 3E15A 3BRWA 3EX7C 2H9IA 2I66A 1BU8A 2JJ2D 4LZWA 5FTJA 4YCLA 3VR4D 1ID8A 2OHOA 2O5VA 4ATNA 1XKLA 4TMFA 1ZU5A 3RUHA 2RH8A 2WT4A 1U2DA 3U16A 1OGJA 1H42A 5KVQA 4PV7A 4EGFA 2P65A 1RCFA 1OI2A 1YB2A 3CZRA 1R6XA 2QZZA 3IAAA 2FW9A 3PVSA 4MJ7A 1VIAA 4QJIA 2A9OA 4YONB 1G21A 3NETA 3H9JA 1MABB 4UPDA 4WA7A 3WADA 2H0RA 1W4LA 1XCPA 221PA 5KSWB 4JSRA 5KX5B 2FPSA 5EXTA 4CI9A 3FCUB 2QTZA 2R66A 2VRCA 1DI0A 3AF3A 5TGZA 4DKJA 1T9HA 3FCXA 4H7JA 5FULA 4DLKA 2IIPA 1CJMA 4N18A 2FJPA 2IPNA 3A4YA 1QYCA 4JB3A 1L5HA 3FYDA 1J0XO 1UT6A 4UHCA 5LQMA 4DKXA 2P2CA 2NTEA 3P9QA 2IZOA 2NO4A 2PV7A 3OICA 1TZ2A 3HXPA 1I3OA 2VZLA 1SR8A 1GPLA 3OQ1A 3R5TA 4HSGA 5FUVA 4A6PA 5A5DA 3DTYA 1WV0A 2IYAA 2D0IA 3P2OA 3LOUA 4B3BA 4BO2A 5KTSA 3L7DA 3G9ZA 3H9EO 3G6WA 3O4IA 4LF4B 4GLOA 4YCNA 4LVOA 1UKCA 4FCWA 2VIIA 3H11A 3LCJA 4BZXA 4L28A 1C29B 1RBQA 3F97A 3EIXA 2VUSA 3X1MA 2B61A 2P8JA 3FNGA 3FPEA 3Q6MA 2GN6A 3DOEA 4D5EA 3MM4A 1KQGA 4CKEA 3WJ1A 3CH7A 1RMTA 3JQAD 2WYOA 4QRHA 2GHTA 4DILA 1EFAA 4B1FA 2I65A 4YWJA 1XNQB 2H2DA 4EG5A 3QWBA 4PYJA 4JLAA 4ZO9A 1K9VF 5AW0A 2PVSA 1YB7A 1USWA 5AOCA 1K88A 2WMYA 1P6XA 5DKFA 5KAMA 3RAGA 2IHBA 3SFZA 2MOKA 4HX5A 4QEKA 1UXJA 3RVPA 4LRXA 1EAYA 5HQTA 1RRGA 1G2PA 2HLNA 2TYSB 1YS7A 2Q3DA 3I34X 5IC5A 1UJ4A 3UT0A 2XRMA 4BZQA 1B41A 1FP4B 2FW1A 3D8UA 1KY3A 1UKYA 2DJ5A 2GN0A 3HLTA 4ZI7A 1R9MA 5JDCA 5U4XA 2PM8A 3JD3A 3ESZA 4FSDA 4BGUA 4ECAA 1GCAA 4EI8A 2OQVA 4AIRA 4F84A 1QP8A 1JFFB 6LDHA 1SWWA 2PT7A 3KFXA 5CURA 4MVJH 4NZ9A 1E5DA 2IPMA 3H83A 3RVQA 1QXSA 1HY3A 5LP6F 3R9XB 3IQXA 3FAZA 5CVEA 1P0CA 2WUGA 3PNMA 4S24A 3A1UA 1V2HE 1VKOA 4M38A 4QHSA 3QVGA 4HAZA 2DY0A 1Q84A 3EGXB 4GMXA 1NHWA 1U2RA 2V59A 4OKIA 5AI9A 3VZPA 4CZ2A 4YUXA 1J0BA 1BVUA 2J32A 1O9GA 3GLKA 3BAZA 1X7XB 4K0RA 3L8ZA 5BSFA 2DQYA 3DKIA 3UB3A 3A8TA 4Y1EA 2FEMA 1CIJA 3QBDA 1I1OA 3WYFA 2VA8A 4A8JC 3BWBA 3L9XA 1CQIB 4DHEA 3UXMA 5JPDA 2D8MA 2OHXA 4B85A 2A9KA 1I01A 3C5VA 3CFYA 3TQFA 1RQPA 4TPKA 2FPPA 3UJ6A 3DMGA 4D46A 3GA0A 1N2CE 2FKAA 5E7MA 1GGHA 3DD5A 4O0LA 1WE2A 2ZRPA 3EUWA 1MVNA 4GYYA 4IZOA 4WERA 1JDPA 3RTDA 4KXQA 1WPRA 2FN4A 3A3OA 3V97A 4AULA 4BVAA 4EKGA 4DV7B 5CCXA 2KWIA 3B6EA 2H4XA 1TMOA 1C80A 1ISPA 4D4IA 1FUUA 2P6OA 3FVQA 4AJPA 1TJPB 4LUCA 2JLVA 4PFSA 1Z2CA 4WXMA 3GRKA 5HDQA 2ZZNA 5BRJA 4ALMA 4JXKA 3FDZB 3QUCA 3RIYA 3EIEA 4KREA 4MKFA 1XTTA 3Q10A 1AKUA 1KH2A 2P2DA 4DBLC 4XJVA 1E63A 1ISJA 2I0FA 2WKWA 4LA4A 2OEPA 3U40A 3H05A 1OXXK 2Y99A 4DXHA 3AESB 1NULA 1N2SA 1OIWA 3UWMA 1EM8B 1KJZA 2CFIA 4DCUA 3IA7A 5DHRA 3BYZA 3BL5A 1DDGA 2P69A 2CXPA 4IXDA 3VR6D 3P8ZA 5L51A 3KAPA 1AQIA 1YRBA 4MW5A 1J49A 4WTOA 3ROQA 3BGDA 3RC3A 4FJ1A 4ZRNA 4N5LA 4F3YA 2CFSA 2TECE 1ADJA 2EZUA 4LOJA 5DWDA 1HH4A 4DLUA 2ISCA 1W36B 4ZXFA 5DLDA 1ND6A 1OTYA 5IYZA 1JVNA 3ER9A 2QS9A 2ZDHA 1YV9A 2PMWB 1JVBA 1YQDA 3Q0TA 5E0KB 3K6JA 5EIBD 1Z6YA 2PE5A 2P0YA 4JVNA 3BWYA 3EZNA 3AHGA 1Q2XA 2WJHA 3E18A 2YJGA 2YZKA 1PV1A 3PQEA 3MTEA 4INOA 2HA6A 3LXUX 1N3LA 3GH3A 3PQ8A 4LF9B 3VPBA 5L95A 3ZCVA 3DLHA 4LAFA 3LSYA 4HRVA 4ND2A 4U8GA 4WWHA 1T2VA 4XWWA 3W77A 4E1VA 3C98A 1ZMBA 3SHOA 3HLKA 3UHPA 4IJQA 4NDAA 1NQUA 2PN1A 3GLIB 3FWNA 3LT2A 5DHTA 2GX6A 5A4KA 2HSEA 4I1YA 1RM5A 4ZXPA 1TZMA 3VOTA 2W58A 1NYLA 3C15C 1O57A 3FZYA 4NBKA 3O1IC 4ARZB 2LVBA 1TEHA 1JWBB 1I0IA 3BB3A 4D9BA 1XL1A 1NUTA 1GKYA 4K2HA 1PF7E 3DLBA 1GTVA 1GAJA 1UXKA 3G8DA 1L4GA 2WPDD 3AUJB 3OMWA 5DTEA 4HB3A 4J6FA 4DLAA 2OORA 4PYKA 6REQB 4C5BA 3P9KA 4HNSA 3O26A 3R5HA 1OPRA 2V1XA 5E3JA 1P9OA 1QCZA 1W2HA 1PWEA 2C1XA 2KI5A 3KQWA 4F85A 2C3UA 2ZTLA 5H0IA 2WABA 1Y6RA 2XUAA 1QE0A 2FGKA 2C5SA 2RGEA 1LSSA 1WKVA 2ROQA 4I50A 5EXDA 2E4YA 1NVGA 4R1TA 2AEEA 1L5VA 5KWJA 4A15A 4K9KA 1QH0A 3LXRA 1Q0RA 4PZ9A 1S9DA 3R0XA 4NRDA 3UK1A 4NCIA 3KBBA 4B9AA 5LLTA 5E4TA 1QO7A 1QVAA 2GAOA 3HU2A 4IDCA 1JQKA 4K1LA 4N49A 4BWFB 4V1CB 3PQ6A 4BEJA 5J2TA 2Q8NA 1PKEA 3VI3B 4DUGA 4FGSA 1IC6A 4NX2A 5LB4A 4WASA 2ZS8A 4NI5A 4E5DA 2FUKA 3P4XA 2A88A 3ZWQA 2BMAA 2IXAA 2OM6A 2ZYSA 2C20A 3RJTA 5EXSA 4Q7JB 2FSUA 1X0XA 3QPWA 1YB5A 3KQQA 4FYIA 4Q9DA 5AXDA 5TQJA 4GUAA 3I30X 1UXHA 2I71A 4DPKA 2XH8A 5I4IA 1ZUWA 5LR6A 1YGYA 2ICAA 1VSTA 2YWFA 3DXYA 2DBYA 3PQ5A 5J1TB 5DGXA 3UY4A 5JJBA 3KEOA 4NG4A 4ZODA 1U8ZA 2VNIA 3RASA 4V0OA 4F3RA 1AS3A 1DZIA 1XZGA 2MYUA 4HPJB 4O8CA 3DB2A 3QZUA 2WC1A 2QUJA 3L46A 3RAFC 1DT3A 2EL7A 2XIJA 3DE1X 2XKAA 2ZE5A 3FWPA 2LCFA 5CVUA 1Y3FE 4YHBA 5FO0A 5ILOA 4A36A 1CZNA 2Y27A 1UANA 1KORA 2NUTB 4P8RA 1FLVA 2ZIAA 1XUOA 1CVRA 1JLSA 1YI1A 1RWQA 3PI6A 1XI2A 3O0DA 5D84A 1JJVA 2BGKA 2QJWA 2MCFA 5HW0A 2EFEB 2JLCA 1OIXA 3A04A 4LVCA 1WDWB 2BBWA 4H3KB 4WQMA 2CDBA 3FYHA 5F5XA 5FFMA 5AR1A 5I4CA 3KHUA 4FDAA 4HN4B 3IQWA 4QO7A 5IEJA 3M6WA 1BJTA 1V41E 2BM0A 3BFVA 3VPSA 4R2KA 4UD6A 2ZVPX 2EEZA 1FTWA 4QDTA 1HDCA 1T5LA 2ZXFA 1S7CA 2REQA 4HWTA 2FR8A 2QJTA 1JNYA 2WFLA 5FBWB 1CUZA 2Q4EA 5DXAA 1CQXA 3T6KA 4DMGA 4DZTA 4U5XA 4BVEA 1NN3A 1GZUA 1H93A 3DMTA 1ZJ5A 1SBNE 2FU5C 3HFGA 5D00A 4ZC8A 4JD5A 1SUAA 5FOSA 4YDHB 3ZDXB 3F9IA 4X3CA 2CWWA 3M6XA 5THXA 1SUPA 5AM0A 2EQAA 4M1QA 3NV9A 2Z2YA 1U81A 3PXGA 4UAGA 4AJ1A 4GX2A 4BTLA 5CHEA 4RLSA 2CL0X 4BX8A 2X9NA 2F1JA 2FSVA 3MLEA 3VZSA 4ZYWA 1EFCA 2VQDA 4Y3UA 3UJ7A 1JTFA 2XSZA 1UWCA 4R0NA 2VCHA 1NASA 2FWJA 4NH4A 3KLPX 3EXFA 4H6VA 4U9HS 3UOAB 3VOBA 2PRZA 3WSWA 3N6VA 4WLOA 4L9AA 1KH1A 3OZUA 1XFAA 4BLQA 4GLBA 5ITZA 2VAVA 1LBIA 3IB6A 1R6VA 1OLXA 3NBUA 3ROEA 3WX0A 2WIJA 1PJZA 1K6MA 3HUUA 3N2GA 4PAMA 3MIIA 1VDZA 5ADHA 2I2FA 2JGAA 5F33A 4RY2A 3AQ4A 3T8YA 3I1FA 2HF7A 2R87A 3F2VA 4KE8A 1C8KA 5BQ5A 4NU0A 2YCBA 2F3PA 4DIKA 2YZNA 4HB0A 1IVYA 1R0XA 1Z5UA 3SZUA 1SXQA 1E1LA 2YV3A 2P4EA 2L17A 2PBZA 1XWIA 1C3OA 1VSBA 2Q6LA 2C7BA 3BWEA 3DL7A 4FKBA 4LWQA 2HUPA 2DY1A 4UM9D 4J7UA 5EMKA 4AMGA 2COUA 1VPDA 1WOMA 4UASA 5DM0A 3TSCA 4EHBA 4ZYVA 1DC4A 1YQXA 1JU4A 3EFBA 1RABA 3L0SA 2JIBA 3I5AA 1XZPA 5JHHB 3A1SA 3RH0A 4AP5A 1QAQA 3EPHA 2W8BA 2V0GA 1VBMA 1E9AA 2UYQA 3F7NA 3S44A 3FFXA 1L1FA 2E1PA 3T5DA 3RHTA 1D1QA 1RRKA 3L8HA 1GTRA 4MUIA 3T4PA 1U80A 4WT7A 4HK4A 2GJ4A 2ZJ5A 2FN3A 1IB0A 2OORC 3NB0A 3PC7A 3OIUA 2YZ7A 1JYEA 1M1UA 4NBNA 3R5XA 2XMZA 2Q5JA 4AZTA 3ZVKA 1Y1QA 4EL5A 2XRZA 3F6EX 1ES9A 5EKUA 1UPTA 2V65A 4QUKA 2NV0A 4DIFA 4F5ZA 3EDCA 4QNRA 4S0ZA 4DIUA 1VKJA 3RODA 3EOAI 4ARCA 1Z0SA 3DNMA 1VKHA 1SCUA 1O97D 5B2EA 4TZTA 1OLOA 2VDWA 3MCWA 3DUFA 3ODGA 4QYIA 3NS7A 3BCSA 4REQB 1HDIA 2VDVE 4TLEA 2PZMA 3BT7A 4UHKA 4KK4A 1KC3A 2WWIA 4FC6A 3DHYA 2NU7B 2DR2A 5JJKA 3TD2A 5IMBA 4FDVA 1M72A 3IOBA 4P7JA 3RF6A 1TJ5A 1T6YA 4X8MA 2SCUB 1N6HA 5HG0A 4B75A 3H2SA 2G1JA 1YAHA 3TTSA 4UZFA 4DUZB 1FNCA 3BGWA 3OUZA 4JT8A 5E95A 3GCDA 4FMDB 2VJDA 3ZWDA 2H1LA 3JYOA 1JYFA 2X76A 4BC0A 4JQOA 1MR3F 5IDQA 4KQMA 3TTUA 4DMLA 3A0RB 4B2PA 1CJTC 2VT7A 4FU0A 4OP3A 3PQCA 2G08A 4HLCA 3VC2A 3RBAA 4M37A 3U7RA 3DAFA 4D9IA 1V8BA 1KY5A 3EBOA 4KEAA 3VNBA 4DA9A 3IHTA 4C7XA 1P6QA 2BCJQ 3IVXA 2ZRQA 2A9QA 3LCUA 1V37A 2RKBA 3CRW1 3ZJTA 2FR0A 4L95C 1BN6A 2QI9F 5DNEA 4JP5A 3NKFA 3FETA 4AZSA 4MR9A 4YP0A 4ZOLB 4W6QA 5DLPA 4CDGA 2PGDA 4LV5B 1XZJA 1CUWA 2AMYA 5FO1A 3SJCA 3VKWA 4LSZA 4ARUA 4JV5B 1ZN8A 5H83A 2GA8A 2BEUA 4IZHA 4K9RA 2ZAMA 2XPCA 2VXYA 1ZI6A 2H9AA 4MYCA 2HY7A 4FR5A 1UXOA 4LOAA 5E6RB 3JVUA 3PGXA 4FSHA 4CPDA 2C2HA 2DFLA 5CDUA 3MCZA 4B33A 1NDHA 3K20A 5IULC 3ZDDA 3L4JA 2GEVA 2EC5A 2GUWA 1OASA 3AUKA 3ZYZA 1VSQA 5EMHA 1MXFA 3KZNA 4H08A 3K6SB 1PDVA 4O2AB 2B5OA 1PLKA 2GETA 2ZT7A 1WUIS 4S35A 2W4IA 3D3WB 3X3HA 2VP3A 3IURA 2O7VA 3CC8A 4NE7A 4KQIA 4XCXA 2C8KA 5AKHA 4BNKA 3C6YA 5B3KA 5I47A 3H6GA 1A9QA 2Q4OA 3O47A 2C07A 1T4DA 3OBIA 2LE0A 4KWEA 1H6BA 4MVWA 1L4MA 2BW0A 4UD2A 3VNQA 4IRMA 3RADC 5CD9A 3TOZA 2J3DA 3DTTA 4TYWA 5HTOA 4HATA 1JLLA 5HP4A 1E5LA 4V0SA 1ONBA 1SXJB 2ZTUA 3KZCA 1XZCA 1WNFA 3QTLA 3WLPA 1CEEA 5JSKA 4COKA 4DDHA 5IHXA 1FUYB 1B93A 3V1YA 4C20A 1LV7A 4TKLA 2ECKA 4ZK2A 4URXR 1DP4A 4YCJA 3UJDA 1ZA2A 5I01A 4C3VA 1EK6A 1MTZA 3AF0A 4IEEA 1BG6A 4TMYA 1DT5A 3ZH9B 2VWGA 4EPVA 5DCWA 4C5CA 2CNKA 3DNPA 3C1AA 4O4IF 4OM7A 1G16A 2YHSA 3PX3A 4BFTA 4CLOB 1ST3A 1W6UA 4DQUA 1QTRA 1UKBA 4GOXA 1AUOA 4IXNA 1E6EA 5HCUA 4AICA 4YT4A 3QOFA 5AI5A 2FSPA 4GM0A 1PJSA 3GJ5A 3A05A 2C1EA 2J1LA 1NG9A 4RMJA 3FE2A 1I7PA 3FFWA 4EQ6B 4HS4A 2AYZA 4XDHA 4YJHB 2WIBA 4Z86A 1HYHA 3SR3A 4ALLA 4OHZA 2XUKA 5FNVB 2BRUC 1O6BA 1RQRA 4P9NA 2J4FA 2XE8A 5DHSA 5EQJB 1GPNA 1U31A 1VLMA 4JK3A 2A5FA 4WLVA 4AWXA 4DZZA 1E3DA 2IBMA 4WXPA 4D45A 1G59A 3DMDA 4GI2A 2DWUA 3HO1A 2XUGA 3VUFA 3W78A 3DZKA 1ZD8A 2V97A 3QU5A 1ZJWA 4OLAA 3DUFB 4QYIB 2D0DA 1VHLA 3FYUA 1JS1X 3GEEA 2OGZA 1BXRA 1OWMA 2NYAA 3BM5A 5D6NA 5ETJA 4UVEA 4DLSA 2G4LA 3JYQA 2QGNA 1SIUA 4O5AA 3SYKA 3W7BA 3B1FA 5CYOA 3W3ZB 4AMZA 3U37A 2QBYA 4LYFA 1SCAA 3IC5A 5CA0B 4JBGA 1JHMA 1W52X 1H8HD 1HKHA 3U4MA 1R37A 2JCXA 2CXUA 1Z8NA 1QQ5A 4MAAA 2UVQA 3C1UA 3WA7A 1JW9B 3PVZA 1Y4DE 4NU6A 1JPUA 1KO5A 2GZ2A 1RI1A 2Z95A 4LMRA 4WK0B 5F3RA 3PQDA 2CNBA 1ESCA 1M2FA 1EZZA 5JZ9A 4A2PA 3AWIA 1MQAA 3QKRB 3GPDG 2V74B 4G65A 4PFQA 2VHTA 2ZSJA 4ZAYA 3IUSA 4D8TA 3ADOA 1L7RA 3KU1A 3O9VA 4E5UA 2PUCA 1L5FA 2QR5A 1RWWA 5LXTB 4J1TC 4HJXA 2PUWA 3EHEA 3OE5A 5FPTA 7MHTA 1OBOA 3DOUA 3VR5H 3UANA 1WHSA 2OHIA 1ZAKA 1KI2A 1Q1EA 4MUMA 2V7XA 3U49A 3G2OA 1VMKA 4XM2A 4WY8A 1DQYA 2I9KA 2CE2X 1ZNWA 4EA7A 3QEAZ 2C31A 4KB5A 1GNLA 1U7ZA 2QYSA 4GZ3A 4QHTA 4GHWA 4KXWA 1NNLA 3GW8A 1PT8A 2VQ6A 3A06A 4I5IA 4PYNA 4QUBA 4RAOA 3HCRA 5E3HA 1GSOA 4ASUA 3O90A 4CHTA 1FNBA 1ZM9A 3IHLA 4YFVA 4UPVA 1FVHA 3VKFA 5EYPB 5A7GA 1KZ4A 1FFWA 3TXYA 4TKMA 4WDQA 1EWQA 1LRLA 5TVKA 1U9CA 5FUYA 2ATVA 1R88A 1A50B 2VAPA 4HR7A 1ESMA 4A16A 2WJPA 4YPFA 3L0DA 3LW8A 1IZZA 2FW6A 1WG8A 2Q5HA 2WJIA 3CW2A 4CF7A 5KJEA 4BFYA 4UBOA 5AJTA 3TTVA 1UAAA 3VDQA 2XYHA 4QUIA 4L5AA 4AJ2A 2FMTA 1UFKA 4QPZA 5HOQA 1E64A 1NU6A 1LBSA 4CR6A 1R66A 2EWVA 3OY7A 1Q1QA 4E15A 4JI0B 5CTJA 5GM2A 1HYEA 4TV9B 3JS5A 3UWSA 1PUXA 2K2WA 3THYB 3L6CA 3IUYA 4M21A 1AJEA 3PNKA 2AYYA 1LSOA 2R8PA 1WWKA 1LZKA 1H6DA 3OPNA 4HSEA 4YS6A 1OF1A 4NONA 2BEVA 4RSRA 1P45A 3R7LA 2EYUA 3CRVA 3VTKA 3JALA 4M49A 4FOOA 4UEOA 2R48A 2IH4A 1U99A 2YHIA 3HEAA 3VR3A 2C9OA 4YGXB 2TRSB 4KPEC 4RL6A 1TUBA 5ALMA 2RGDA 1KMQA 3KLBA 3RIGA 3G5LA 3U9TA 4BKQA 1RHQA 4L50A 1PQWA 3BN3A 1E79A 3PEEA 2HPAA 4Y6GB