3C5WP

Complex between pp2a-specific methylesterase pme-1 and pp2a core enzyme
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
296
structure length
294
Chain Sequence
RDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHAMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCKPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PP2A A subunit
publication title Structural mechanism of demethylation and inactivation of protein phosphatase 2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 294
sequence length 296
ec nomenclature ec 3.1.1.89: Protein phosphatase methylesterase-1.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c5wP00
4YX9A 5K5EA 3TEJA 1FFDA 3NWOA 4Q3KA 4DNOA 4B9EA 2DR0A 1TIBA 2VA9A 4INZA 3WIOA 3QPCA 5C8XA 1ZD5A 1QZ3A 4EY7A 5JAHA 1AMNA 1ZOIA 2ZSHA 3HRHA 3I2JA 1R9NA 3G0DA 2VATA 1JU4A 3DEAA 4UBKA 5CXUA 5BV7A 3QVMA 4BRZA 2WG2A 4MYDA 2DFPA 1W4LA 3E1GA 1F8UA 3O4IA 1U8EA 2XQKA 1FFCA 2WM2A 4QA9A 1CIJA 1IZ8A 3D2BA 4N5HX 4G9EA 4G9GA 3G9TA 3IBTA 2V97A 3CCBA 4U2FA 3TRDA 5D3KA 5AKYA 2RAUA 3QMMA 2EDAA 1ZJ4A 4C01A 1THTA 2WHQA 3H1AA 4Q3LA 3IB3A 4G1FA 4RGYA 5K3AA 4G8BA 1AKNA 3I2GA 4H7FA 3WL7A 4DM7A 1QTRA 4EUSA 2HA2A 2WFMA 2OQIA 4RNCA 5ALYA 1AZWA 4J7AA 4WY5A 3LP5A 2G5TA 1VE7A 4W1QA 3ESDA 1QIJA 2R8BA 3RKSA 2W22A 4ROTA 3WK9A 4BAZA 4C87A 4TPKA 1XKTA 2OCGA 4QDTA 5KWIA 5CTAA 4JYMA 1MX5A 1VA4A 3QBJA 1R9MA 3DKRA 1UT6A 5C7YA 5AKXA 2UZ0A 2GZRA 5DYWA 2LIPA 2WUDA 3BWXA 2WHRA 2QJWA 3ESAA 5AIAA 3WK7A 1GKLA 3K6KA 2W6CX 3LCRA 1K6EA 5CXXA 3SC2A 1MX9A 1JFRA 3DKKA 3WWOA 4DLNA 1K4YA 5FPPA 5AKGA 4BVKA 4TVKA 5C81A 2J4CA 1CUYA 3WZLA 5EIHA 1FJ2A 4X7BA 1USWA 1EB8A 4B7ZA 2XMCA 7YASA 5JAOA 5T4EA 3ILSA 2G4LA 5EIEA 3O0DA 3G0CA 4B81A 2QS9A 5LLSA 1LZKA 1CEXA 1LGYA 1LPMA 3FOBA 1QFSA 5K3EA 2C7BA 2G5PA 2Z8XA 3NOXA 3C8DA 4KAAA 1BU8A 3HSSA 4DMKA 1WM1A 2X8BA 1TK3A 1EDBA 1VOTA 4BB0A 3AILA 3I1IA 3BIXA 4QLOA 4BP8A 3BJMA 2GYUA 2HA5A 2WU4A 4MWSA 4Q3OA 5CT5A 1QIKA 3QMWA 2PVSA 4NS4A 1W1IA 1BN6A 2IX9A 5ALVA 5I9IA 4IHAA 3ANTA 5HK9A 2GYVA 2B9VA 3TGLA 1H2ZA 3SWWA 3WK5A 4M0EA 4PV7A 3W06A 4B84A 1HDEA 3PFCA 2XQGA 4H0CA 3V1MA 5JD4A 1G4HA 1QE3A 2EEPA 2ZYRA 2H7YA 3H17A 3R3YA 4KE8A 1N8SA 2X5XA 1WCYA 5HKBA 2ACKA 4UBOA 1CUCA 4X97A 2EDCA 3AZOA 3UMJA 3O9VA 4N8DA 4X6XA 2QJRA 4OB6A 5DYTA 3DCNA 3B12A 1VJ5A 4B80A 1DU4A 2C0PA 1EDDA 1TCBA 3IULA 4J0JA 2Y2VA 1WPRA 2PL5A 3E4DA 1LZLA 2HA7A 1W6RA 5HF8A 4J0GA 5JYCA 4UFOA 2XUJA 3KOOA 4A16A 3PUIA 3L1IA 3KWFA 3M3DA 4L9AA 1XZCA 3HLKA 2XMRA 3WL8A 2WIJA 1EHYA 4MXDA 3DNMA 2XQJA 5A71A 1EA5A 3DYVA 4WFIA 4XJVA 3ICVA 3IURA 4G4GA 4F21A 3KSRA 1BN7A 3GA7A 2GBIA 1EK2A 1R4ZA 4DNPA 3GFFA 2WIFA 2OGSA 2QXUA 4N8EA 4CCYB 3C8HA 5CH8A 2VEOA 1DT5A 4MQLA 4LXIA 4CG3A 1H22A 4CI9A 4N8SA 4HVTA 4RPCA 5CH3A 1GQRA 3IUNA 4CG2A 1PFQA 2BUAA 3I6ZA 3YASA 3Q8WA 4GEGA 5ALEA 2QR5A 1XLUA 4JNCA 2QM0A 1EI9A 3I6MA 1GKKA 4H7HA 3WKDA 2I3DA 4QDXA 2YXPX 4UBJA 2QZPA 2OCLA 2WG0A 4KE6A 3HACA 2XQFA 2RONA 1U4NA 4FDMA 3I2IA 4DSAA 4PSUA 4PSCA 1WOMA 1MNAA 2XUFA 2CKMA 1BCRA 1YS2X 2HFJA 1TAHA 2QVBA 4X92A 4ZREA 1ZD2P 1N1MA 5LP1A 2VQ6A 1EK1A 4AZ0A 2PPLA 2BUBA 5LKRA 5AM2A 4FTWA 2XLBA 3DL7A 2PKYX 1M33A 4B6GA 2B61A 2GZSA 5I8PA 3D5EA 1ETHA 3N0TA 2HHAA 5K3FA 5T4BA 2ZJ6A 4CG1A 4KAFA 5HKAA 1ISPA 3H19A 2DCMA 3M82A 1JMKC 2QTBA 4DSZA 4BZZA 4FLMA 1G66A 5HZGA 1WHSA 3EQ7A 1P0MA 4XIIA 2AXEA 4HS9A 4FNMA 4HAIA 4FBMA 4HZGA 2WIKA 1MU0A 2OCIA 3VXKA 4WDRA 4U2EA 1ACJA 5J3JA 3OPMA 1XRQA 3BIWA 5ISMA 3FSGD 2WILA 3R3VA 3HABA 3H0CA 4P08A 4GDMA 3OG9A 4IH1A 2VJBA 5D3ZA 2IITA 2V98A 1CUSA 1FSSA 4BVJA 2PBLA 4M0FA 2XUHA 1XKLA 4JEIA 3C6BA 1XRMA 3VISA 3AFIA 2JEZA 1YA8A 4K6KA 3MVEA 1JI3A 2JEYA 3T4UA 1DX4A 4DNFA 1VA5A 3PFBA 1KU6A 1YSCA 4GECA 2Z5GA 1LPAB 4LHEA 5DNVA 1C7JA 1O6GA 4OB8A 2PU7A 3ED1A 3DS8A 1SCIA 5CMLA 5CH5A 3AIOA 4ZRDA 1VE6A 1MJ5A 2Y6UA 1EB9A 3L1HA 4AO7A 2JF0A 5JALA 4YASA 3A2MA 4AQDA 5HQ3A 1H2WA 1W75A 3GELA 3K9BA 4YPVA 2K2QB 4IQ4A 1MNQA 4G4JA 3WKAA 3H2IA 4OB7A 1Q0RA 4OPMA 2ZSIA 2WIGA 1XRPA 3WQHA 3STXA 5AI8A 5DJ5A 2J4FA 1MAHA 2B20A 3LLCA 5DNWA 5FRDA 2XQIA 4OYYA 2QXTA 2QRUA 1LPSA 1EINA 2XUQA 4CIBA 4U2GA 3AUKA 4X6YA 4Q34A 2BGRA 3QPAA 1CPYA 3FVTA 5IKXA 4P92A 4UHDA 3FSGA 3QM1A 5AJHA 2XT0A 1Q84A 1O6FA 1R3DA 2Q0XA 1HLGA 4QWMA 3E3AA 5SYMA 4IH9A 3WYNA 4Y2YA 1X2BA 5LZ5A 2XE4A 1ZI9A 3WMRA 2GYWA 3LIIA 2B4KA 2HU5A 1GXSA 3D59A 2VTVA 1H2YA 3I28A 4AMYA 5DNUA 5LZ8A 3C70A 4DMCA 4P93A 3C43A 3V1LA 3FLBA 4I19A 2QUBA 2BFNA 2H7XA 1EX9A 4UHHA 4YK7A 1H2XA 1CRLA 2PM8A 2O7RA 3H18A 3O4JA 3BE8A 1JU3A 2PSDA 3H2GA 4QNNA 4AX4A 2CMFA 2WKWA 5AI5A 4AB1A 2C4HA 2PSEA 2XMDA 5K3DA 1QGED 2YASA 4C89A 1SOMA 2XMSA 3EQ9A 5BWBA 3C6ZA 3H2KA 4G4IA 1XLWA 3GROA 3MUOA 3WYDA 1C7IA 4FLFA 1VZ2A 5JAPA 4FLEA 2QT9A 1TCAA 1JKMA 5AK6A 1UOQA 5AKZA 2XUOA 1XZKA 1E89A 3B3QA 1NU6A 3CN7A 5E2IA 1E5TA 1XROA 4H77A 2D5LA 3WI7A 3VJLA 1XZJA 3MGAA 5T4FA 2XMGA 3PI6A 2FJ0A 2XUDA 2XI4A 1BEZA 3P2MA 5SYNA 1EDEA 5AI6A 1DTEA 4BYMA 4E14A 3RK4A 1THGA 1WPXA 3O4HA 2PUHA 1Y7HA 3STVA 4EHBA 3PICA 1IUOA 1TCCA 2JGEA 1T2NA 1KU0A 4DGQA 2DSNA 3WK6A 1XZLA 3G9UA 4EA6A 1IMJA 1CVLA 4WDQA 1GPNA 2O2HA 2WTMA 4ZXFA 1X70A 2OQVA 3D0KA 2HFKA 1RYYA 4WFKA 5ESRA 1CUZA 5ALWA 4XVCA 4H35A 5AKLA 1TQHA 4G5XA 1E3QA 5FUMA 4BCCA 3HJUA 4H7IA 5LZ9A 1CLEA 4OU4A 5JD6A 2CB9A 2WHPB 2VT7A 4H7EA 1AURA 2VAVA 1R1DA 4FKBA 5AKHA 2WJ6A 3WL5A 4UBLA 3A70A 1SC9A 2JGIA 2XUGA 2XUKA 2ZYHA 5EGNA 3F67A 2XMQA 4WY8A 4Q1VA 2PUJA 2JGKA 3WLAA 4K6HA 4CCWA 3HXKA 2WLSA 3V48A 1CUFA 1FFEA 1F0NA 4UHBA 1QIGA 2J3QA 4S0XA 4N5IX 2Z8ZA 5FDFA 3WA7A 2DHDA 4IH4A 4BAUA 4LXHA 4MJ3A 3WJ2A 4NZZA 4XWGA 4QZVA 1ZGBA 1CFJA 1SFRA 3R3WA 2O2IA 4X94A 3OOSA 4OCZA 1IVYA 2QKYA 1R88A 4HXFB 4KACA 3O4GA 1J2EA 1P0QA 4KYVA 4Q82A 1L7QA 4LYEA 1QIMA 3KXPA 3FCYA 4OD0A 4BCBA 4H18A 5AK3A 1LPPA 3WKCA 1WB4A 2PSJA 5K3BA 2Z3ZA 1T4MA 4X95A 1UKCA 3IIIA 1CUWA 4RE6A 3WK8A 1E8MA 1Z68A 2RI6A 2R11A 2XMBA 1FFAA 4PO3X 4X90A 4UFNA 3S8YA 3QPDA 1EXWA 3GUUA 3TJMA 2ES4A 4EB0A 4G8CA 1UOPA 4FBLA 3R3ZA 4U2DA 2ONCA 4QWWA 1LLFA 2WJ4A 3NUZA 2PSHA 2P8SA 3A2NA 5ALRA 1XQVA 5C8ZA 3I2FA 1BEEA 5A7HA 3BJRA 3WJ1A 5ALDA 2YH2A 4CCYA 3BL8A 5EIAA 2XUIA 5AM0A 4Y2SA 4BCDA 5C8VA 2WUEA 5ALGA 2OCKA 5CT6A 2HA4A 3HEAA 4FWBA 4U2CA 5EHNA 1OILA 4Y2VA 1QLWA 4X71A 2DQZA 1ZJ5A 1QIFA 2WFZA 5CBKA 1ACLA 3CXUA 4KRYA 5A6VA 1WB6A 3PUHA 1P0IA 3R41A 2JGLA 1TKRA 4Y9SA 5AM1A 4OUKX 2JBWA 3AZQA 4GXNA 3FAKA 2ROQA 3ICWA 3W05A 1RP1A 4QDZA 5AOAA 3PDCA 2VJAA 1XZAA 2CJPA 1L7AA 5E4JA 1U65A 2VT6A 4BC0A 3G9XA 4C4ZA 5LZ7A 1CQWA 3KDAA 1IUPA 2XDWA 3B5EA 5DWDA 4AN1A 1XFDA 2WFLB 3DYIA 1YCDA 1MAAA 1XRRA 3G02A 4Y2UA 2OLEA 3G9ZA 1VZ3A 1YB7A 4BZWA 2BAGA 4Y7DA 4F5ZA 1CUJA 5JAUA 1YA4A 2XMZA 1CUBA 1YB6A 3IA2A 1SCKA 3WA6A 2NW6A 3AJAA 2CBGA 4BTLA 4B0PA 4CIAA 1LBSA 2E3JA 3DL4A 3S2ZA 2C0QA 1UKAA 2ZYSA 1IZ7A 5K3CA 1XZHA 4QDUA 1A7UA 5ALSA 2FUKA 4FFWA 4A5SA 3NGMA 2OPHA 1HPLA 1UXOA 4OSEA 3OURA 5IVIA 3BF8A 4JUIA 4L72A 3D2AA 5ALOA 5CURA 1QJ4A 3STYA 3WL6A 4BAGA 1HKHA 1L7RA 1XQWA 1Y37A 3C45A 4Y2TA 4BVLA 4W1PA 1TRHA 5ALIA 3CCCA 3OM8A 2BGNA 2WG1A 5JZSA 1VLQA 2VJCA 3HC7A 3FYUC 3ANSA 5JZBA 4P9NA 4FOLA 5ALLA 3FYUA 3DD5A 3L1JA 1XZEA 3HZOA 1QIIA 2H1IA 1UZAA 2ZJ7A 5FOQA 1HL7A 2QMQA 3U1TA 4V2IA 4W1SA 1NX9A 1XZMA 1E8NA 1N5RA 1GPLA 3H2HA 4MEAA 5JASA 2FX5A 5HQ3B 1CQZA 3OTQA 5AM5A 4EY8A 4UBNA 1QIDA 2ZYIA 2X76A 2XLCA 5AKEA 4BRSA 5KBYA 2PSFA 5AI4A 1K5PA 2Y6VA 5EFZA 5LKAA 1XZIA 3STWA 4EY5A 1Q83A 4ZV7A 5BWCA 1LBTA 3VKFA 4FMPA 3D2CA 5AI0A 1JJBA 2V96A 1OCEA 4Q05A 1DWPA 4DMFA 4B9AA 2H9YA 4L0CA 4JH0A 3O9MA 3RARA 5E4YA 2AJCA 4X6UA 4F60A 3F98A 3R3XA 4HXGA 5JZ9A 4BE9A 3H04A 3STTA 1ZI8A 3ZLUA 2AJBA 5EHQA 5ALHA 4C88A 1UK7A 4WCVA 1ODTC 2I3ZA 3GZJA 4PSDA 4GBGA 5AHXA 4AMZA 1CUHA 3EF3A 4QLAA 2Z3WA 2O2GA 2BKLA 2XB6A 1Y7IA 3C6YA 5AM3A 3QZUA 4OU5A 2RHTA 4UBIA 2OGZA 2VSQA 4NVRA 2FJPA 4H7DA 4KJXA 2HA3A 5DTIA 3I6YA 3WWDA 1AC5A 3K2IA 2O7VA 1RWQA 2CZQA 3DQZA 5DLPA 2PU5A 3W9BA 4ARBA 1XZDA 4KE9A 5YASA 1J07A 3QYJA 3LS2A 1Q0ZA 4QEKA 2VF2A 5CT4A 1YR2A 1XLVA 1E8DA 3F96A 1UK6A 4L3WA 2IIVA 5AIBA 1GGVA 4MEBA 4BATA 3W2TA 4J0IA 4K6GA 3BF7A 4E11A 4W9RA 4C4XA 4UPDA 3IUMA 4J03A 4E46A 1U2EA 5F4ZA 5HF5A 1XQYA 2Y1KA 4PNZA 1BROA 2OG1A 2G63A 4UUQA 1WHTA 2OXEA 5KREA 1A88A 1DWQA 3D3NA 4U2BA 1PV1A 4WFJA 2HL6A 4BDTA 4AO8A 1CUEA 5JADA 1GPKA 1XZFA 4Y2PA 1D07A 2ZVDA 2VJDA 3AZPA 5CRIA 3FLAA 5A7GA 4Y2JA 1R50A 4DTCA 3ESCA 3VDXA 2WTNA 4EBBA 3M81A 5IVHA 2WUFA 1LNSA 4PF1A 2VAXA 1LPBB 3WWEA 1LPNA 3IVMA 5AI9A 1CUXA 3DDUA 1H23A 5E4TA 1FFBA 3A6ZA 3GBSA 3V1KA 2ACEA 4C6HA 2C5FA 5ALKA 1EVEA 3WWCA 5D7BA 3H1BA 4X93A 4ZI5A 1ORVA 4X91A 4J0DA 4AXBA 4PQEA 1W76A 4MWTA 5JD5A 2Y2UA 3R0VA 1ZD4A 1XZBA 4O08A 4D9JA 4HXEB 2DQYA 5A62A 3VVMA 4J0CA 3T52A 3KD2A 4W63A 5JARA 3QITA 1ZI6A 3DOHA 4DIUA 2DHCA 3HYSA 3WK4A 1MN6A 4FFVA 5EI5A 2JGMA 3C5WP 1AQLA 3EQ8A 5JIBA 1JJFA 2RGUA 5AO9A 5DYYA 5CT8A 5AP9A 3I1YA 3JYHA 1YS1X 1CUDA 3VJKA 4FHZA 3X3HA 1S8OA 4AO6A 2HA6A 3EIOA 1MTZA 4K2AA 4ITVA 4F0JA 2BCEA 4HRXA 1DQZA 3OC0A 4A23A 1CUAA 3IUJA 1UWCA 5ALZA 4BE4A 3WWPA 2GBFA 5A2GA 1C4XA 5ALMA 1UK8A 4X00A 3F8SA 5IVDA 4EY6A 4UHFA 4J0KA 4OYLA 2H7CA 3VVLA 5IVKA 3E0XA 1CR6A 3JWEA 5LZ4A 3C87A 5KWJA 5BOVA 4Y2XA 2WHPA 4UBMA 5AH0A 4DMHA 3BXPA 5AKJA 2AJ8A 1UOOA 4H7JA 4H7KA 3ZI7A 5FLKA 2HIHA 2WJ3A 1ZIXA 3HI4A 2HDWA 4NMWA 1CUVA 1QOZA 1J1IA 1ORWA 4Y2QA 3M83A 5LZ2A 1CUIA 4BDSA 5H3HA 4TGLA 4ZV9A 4C4YA 1A8QA 4DYHA 2CUTA 2HADA 1XZGA 2JGJA 1DWOA 4AZ3A 2YYSA 2CEKA 1QO9A 5ALUA 5FPQA 4Y2RA 5ALFA 1QFMA 3V1NA 3R3UA 4K5QA 2GBGA 1XQXA 5ALPA 1F6WA 3I2KA 4QDOA 5T4HA 3VJMA 3KWJA 5AOBA 1DINA 4ARAA 4J3JA 1BCSA 1IUNA 2QOEA 1OXMA 2JGFA 3UUFA 4LKOA 1J06A 1PJAA 1LPOA 5ALJA 4W1RA 3RLIA 5EHXA 4B82A 2AJLI 5D6OA 3W9UA 5JANA 1VXRA 1QIEA 2HU7A 2BJHA 3Q0TA 4RE5A 2HA0A 1UKBA 5ALNA 1ODSA 2D0DA 3G7NA 4FNGA 3WKEA 4E15A 4XX1A 4KR0A 3U0VA 3WKBA 4DNQA 5FXMA 4JYPA 1KEZA 2JIDA 4HTAA 4AN0A 1CV2A 4GHWA 1WB5A 4B85A 4LYDA 4UHEA 4X85A 3V9AA 3LIPA 1AUOA 2QUAA 5FP0A 1JT2A 1QO7A 1DQYA 3A2LA 3G8YA 4MYSA 6YASA 3IUQA 3MUNA 3AIKA 5AKIA 3DLTA 1CUUA 4Z49A 1SCQA 5AKKA 4J0HA 4GLBA 3G0GA 3QH4A 4LIPD 5CT9A 3FLEA 1MPXA 2RIPA 4KEAA 3H2JA 4M0MA 5AICA 5K3FB 1ZGCA 3UUEA 2OGTA 3FVRA 5DTJA 1ZD3A 3G0IA 3F97A 3F9CA 4BTVA 3FNBA 4I3FA 2J3DA 4BC1A 5LYYA 5AK5A 5ALTA 3C6XA 1K63A 1G5FA 1BRTA 3ESBA 1W52X 2C5GA 1YAJA 3O95A 5HF6A 5AK4A 1JJIA 1VXOA 2WSLA 2OAEA 2WFLA 2OAGA 2I03A 5HF9A 5HCUA 3ZLTA 1AX9A 5AOCA 1QTIA 5CW2A 2XUAA 5IH7A 2WQZA 2DHEA 5FV4A 1GZ7A 2AJDA 3ZLVA 3AINA 4BBZA 2XUPA 4GWLA 1B41A 1YAHA 2GBCA 4G8DA 2WIDA 5HFNA 4QE3A 5FKJA 1K8QA 1DX6A 3PF8A 1ZIYA 2HRRA 3FYUB 3WIBA 1BE0A 4ZWNA 3WZMA 1HBJA 1MT3A 1P0PA 3BDVA 1DT3A 1N5MA 1UFOA 2RHWA 3FBWA 3R40A 1QONA 2ECFA 2ORYA 3SX4A 1GQSA 2WU3A 4PW0A 1ODCA 1UK9A 1A8SA 2HM7A 2WUGA 4UFPA 1BS9A 3ZWQA 4LXGA 5A7FA 5ALXA 3W04A 2BUCA 1HQDA 3C5VA 4IO0A 2I78A 2ZJFA 3QMVA 5ALQA 3AIMA 4HRYA 1YASA 1F0PA 4CFSA 1XRLA 1X2EA 4ZGBA 3FYTA 3IDAA 3ZPXA 4B0OA 1CUGA 3FWHA 5I7UA 3G0BA 1JMYA 1QIHA 5LIPA 2HRQA 3SK0A 5EHZA 3CN9A 4UHCA 1E66A 2V9ZA 4KRXA 4X3CA 3DJYA 3EBLA 4ETWA 5HK8A 4MQMA 2HU8A 1EVQA 3PE6A 4I4CA 1NU8A 1VKHA 3JW8A 3STUA 1GT6A 3D4LA 1A8UA 2C58A 4GI1A 5AM4A 3FCXA 4WJLA 1I6WA 4GW3A 3ZV7A 4KAJA 1MX1A 1ZICA 2PX6A 3N2ZB 3DOIA 3D7RA 3RM3A 3BDIA 4BP9A 1B6GA 5JATA 1G42A 5HFAA 1XRNA 4KE7A 4B83A 1AGYA 1MO2A 3PF9A 4EY4A 1EH5A 4EZIA 3I2HA
chains in the Genus database with same CATH superfamily
1K88A 4ZALA 3KAJA 4US2R 4N76A 2ILVA 4UU7A 3TEJA 1K7SN 1OT3A 1S9DA 3B3AA 3HL4A 4Z4EA 1YVUA 2I7XA 1FP6A 2O2JA 3MSCA 3HKCA 4PHGA 3W9YA 3CQ9A 3L05A 4G0QA 4GOXA 4F9GA 2ZT7A 4KMOA 4FX5A 4AJOA 2VA9A 1FTNA 4W5QA 4QECA 3SNKA 3FD8A 4L74A 3PTLA 3VHXA 4PIPA 4LX0A 2IZ0A 3GEHA 3KLMX 1ZN2A 1BMFA 1SUBA 1HT2E 4BQRA 2P5SA 1KK3A 4JX8A 2DLCX 1TJ4A 3DONA 1CNFA 1OX4A 4RVGA 5JXJA 2GRJA 3LW8A 1UINA 3V8MA 3H84A 1GP2A 2FNAA 3N2LA 1PWYE 5K8LA 3K70B 3USES 1DUSA 1ZD8A 4UTNA 4MYDA 2WW8A 1C1DB 2YMMA 3D8TA 3DE1X 3O4IA 5ES4B 2Z6UA 1TW2A 5CAEA 2PVCA 1PZEA 4U8HA 3O7WA 1ZXLA 1LU9A 3EB9A 1QP4A 1PO7A 1MDFA 1RQNA 3WOHA 1FFCA 2QX7A 1CZUA 3MK31 3S0JA 5JT1A 3OCVA 4HRAA 4Y1EA 3HA5A 3F9IA 1CIJA 1IZ8A 5DMXA 3GGPA 3IQEA 3AUAA 4OLAA 1ULUA 4G9EA 1D4ZA 1WHTB 2J3JA 4N49A 4M9QA 1F5NA 3WRVA 3NBAA 2HJSA 2VDMB 4HLUA 1Y4SA 4FOOA 4Q39A 4U2FA 2IBSA 1M83A 1QDUA 3AF3A 3PITA 3MJHA 3CY6A 2DF8A 4HB0A 1FW6A 3QMMA 3FBGA 3PE3A 4B6FA 1W46A 3E2PA 1F8GA 1B2RA 4FYYA 5EUQB 4WKNA 1BGXT 1E4YA 1KS9A 2ZRAA 3CX8A 4MWGA 2WHQA 4DMRA 4NBNA 1Z82A 5E9WA 3RVSA 3QELA 4Q3LA 3P94A 2W6OA 4HN9A 5K0GA 1E2BA 3L8CA 2ZT5A 2C4NA 3I2GA 3MPOA 4CQNA 3H5AA 4IIXA 2PKWA 4DM7A 1LSOA 3ITEA 2OUIA 1R10A 3DMFA 3DZIA 2HA2A 2AWNA 2WFMA 1S5PA 2OQIA 1VBMA 2KYRA 3DVLA 3N8NA 2UYYA 5ARDA 1R6TA 3JVDA 1OI4A 2C3YA 1ATZA 4HYYA 1N6RA 1EJBA 5F76A 1FYVA 3QKSB 1X1AA 3NEYA 4Z4QA 1B42A 1X1DA 4QG7A 5DM60 4ZRMA 1ZOLA 2P1ZA 3QTBA 3ESDA 2BFOA 4OMUA 2FFRA 2Y1LA 3DXZA 2WMYA 3UIEA 4F92B 1HWYA 4NRDA 1HRKA 4JZKA 2V45A 1IG3A 2UUCB 2H0AA 1QIJA 1JHUA 3RKSA 2W22A 4IXTA 4KQKA 3DWFA 2EBWA 4IQGA 4QNMA 1Z5UA 1XL0A 4TPKA 4YRJA 5BN4B 1XKTA 2H92A 1VL6A 5EINA 6YASA 5CTAA 1YJCA 3ZS9A 4ADSG 2A5GA 4MQ6A 4IUDS 1U2DC 4XVRA 2WJGA 3T99A 5K8JB 1FXWA 2EZTA 1T3HA 3G79A 3RSQA 3SQDA 1PNQA 1YHYA 3B1FA 2PH3A 1M1YA 2R6DA 4Q3NA 1FJGB 3V7UA 2QK4A 3ABZA 3H1FA 5LQCA 3DMTA 3G2KA 2GF0A 2JKYA 5IUKC 2HSJA 1L4UA 5A03A 5MGBA 3KDSE 1ZOOA 3KC2A 3WLJA 2DBZA 4UTXA 2QAGA 2Q41A 1GKLA 2H1VA 3LCRA 2ENWA 2W6CX 3QLTA 1K6EA 5CCDA 3FWYA 1PJCA 2KX7A 4O2AA 2AMYA 3HPQA 5CXXA 2O8FB 3UAVA 5B64A 4AJEA 4RVUA 2CNDA 5JDCA 1ZRHA 5K4GA 5C53B 3PNYA 5EJ7A 3KUDA 4EVQA 2EHJA 5COAA 1NONA 2ZIXB 3R1IA 1S1CA 1YZYA 4GM1A 5AHRA 5NLLA 5C81A 4YUZA 1V1MA 3UANA 3TAHA 2ZR9A 1TFUA 2ZYTX 1FJ2A 3I61A 4B4OA 5LLTA 3OIVA 2YFQA 3TM5A 1L3BA 4PS1A 2QLBA 3GD7A 3IAS1 5CEJA 5KSWB 1NW8A 4AIIA 3P0RA 3LTEA 5K0ZA 5EWJB 1AF7A 3JZFA 1RYNA 3FI0A 3OLCX 2GM4A 2FX3A 4RK7A 2FPPA 1G291 5AW3A 4PNEA 3I3OA 1F60A 2V7VA 1FTYA 1G2QA 2X9GA 5T4EA 1GLGA 5BSGA 4WY2A 3O1IC 4PAGA 4RA9A 3PXDA 1KOLA 5JWHA 4A73A 1E32A 3CUSA 4MVXA 4PFQA 4JBGA 1VBNA 4EKIA 3EA4A 2RBKA 3O0DA 3AUTA 2R6JA 4B81A 2FB9A 1KVSA 1RS0A 3OKAA 3DVRX 2R97A 3AM5A 1EHCA 2PA0A 4L3VA 3M1YA 2OK8A 3QOXA 1T6ZA 3B5IA 4PRZA 5JS2A 2PX2A 4CR6A 2OVFA 2JLSA 3OJEA 1LZKA 3KQMA 3Q6MA 4O4JB 3KR2A 1DBSA 3HCAA 1FZQA 3OTHA 1WWKA 1QVWA 2G07A 1CQIA 3W78A 1WNTA 1F3OA 1QFSA 2DFLA 2G0NA 3BCRA 3EWNA 3FTQA 3OD1A 4MWEA 1TW3A 4ND4A 4NH4A 2WAXA 4NU6A 4ESVA 5JW6A 2VPPA 3IP9A 4F4CA 4LV6A 5I6DA 1I7PA 3C8DA 4KAAA 4DQUA 1BU8A 1GZVA 2ZB2A 3AEQB 2R4QA 2VXYA 2VSXA 4JELA 4I5EA 4JEHA 3MD9A 2D1RA 2ZQZA 4DMKA 3KJQA 5JMOA 3UT5B 1AQYA 1TK3A 1XXHE 3RHSA 4HVCA 3RSGA 3UGQA 4H2DA 4XRRA 1N5KA 4FHEA 1T2EA 4YN3A 2JFOA 1G6OA 5KNDA 3INYA 3PVZA 2O6LA 3M89A 4BECA 1D04A 3LWNA 1OIVA 2E87A 4INPA 3BIXA 2W2QA 3R5SA 3IBSA 4OXKA 4BRUA 1N2IA 1WUHS 4BVGA 5G1PA 4YAKA 2D2EA 5T8KC 3ANMA 2ZYUX 5T5QA 1S2NA 1PW7A 1XV5A 1Z0IA 1Z29A 2WU4A 2GKOA 1OASA 2X1LA 3ELWA 3ZQ4A 3V46A 2PFSA 4ON9A 1C3LA 4RMJA 4EX6A 3HQ4O 3NR2A 5TX7A 1URPA 4C7OB 1NBMA 4QPPA 1ORRA 4JV5B 1FFHA 3PL1A 1Q12A 4KYIB 1RDFA 4PYJA 2J7KA 4A0RA 2IP2A 3GVPA 3BQ9A 4G5GA 2JI4A 1MB4A 1L4BA 4U5QA 4UZEA 3ZY4A 4E88A 3SJAA 4IIHA 4XDYA 5TARA 3SEZA 1VSTA 4OHOA 4CKXA 2RKWA 5DBGA 1GGJA 2B3DA 3MTAA 5ALVA 3BSSA 3LA8A 1MJHA 4ZFNA 3QY0A 5FBHA 2I4IA 3PUYA 3ANTA 2GYVA 1CHDA 4D9EA 2C3PA 4OLHA 4C2TA 4C78A 5BUZA 2QDXA 1H2ZA 4TMFA 1E5XA 2PTGA 3WK5A 4M0CA 3NTUA 1GZ6A 2IK8A 3W6ZA 2Z2ZA 3TAUA 5E1DA 3AXSA 3IOEA 2AI2A 4PV7A 4F85A 3KQPA 2RJOA 3WBFA 4I4IA 3WLKX 4N0QA 2JIOA 2XQGA 1G3QA 1DXOA 3AP1A 3V1MA 1YFKA 1P4HA 1TI7A 5SZKB 3V32A 5IARA 4LI0A 1KIMA 3VR1A 2PHZA 3GW8A 4JT4A 4MVJF 3KTDA 2EJBA 4LXYA 3WIUA 2H7YA 3QSGA 4AUKA 2YBDA 1DJOA 2FOXA 4CKCA 3SXUB 1GRQA 3EXHB 1SWWA 3JR3A 4XIGS 2R68A 4AQYB 3FDIA 3A3KA 4PG4A 3KEMA 1E58A 1KKUA 4XOIA 4EFMA 1E69A 1WV0A 4Q4LA 2AQ8A 2QRVA 4R1SA 3OIFA 5KU7A 5AW8A 4F2HA 2ACKA 1EEHA 1UP4A 3G6WA 1PAUA 4R9RA 4WBSA 1D6SA 4KWCA 4URUR 1HNNA 3AHDA 5KJEA 5HKKA 5BN3B 2VDKB 1IPEA 1KY3A 3T1VA 1T8PA 4N8DA 3MCUA 1F9EA 3N8GA 2QJRA 5B1YA 1P81A 1G20E 3ABRB 1I4WA 1DAHA 2Z8YM 3HFJA 4KUHA 3H2BA 1M3SA 3DZKA 5EGSA 1Z4KA 4KFCA 3KZMA 4L9WA 5BMOA 1P2DA 2FR8C 4Q4AB 4F8JA 1RSZA 3QF7A 3IULA 1D09A 3H7IA 3KDPA 4CKYA 4OJQA 1ZBQA 4HH1A 1RPZA 1Z13A 5J1TB 2PL5A 3E4DA 1R00A 3OA2A 3TF5A 3KQHA 3UYLA 5FOXA 2JCSA 2QQ0A 3OF3A 5HF8A 2L0XA 3GT7A 4F9EA 2X2EA 3K4PA 4GI5A 4MGEA 1SVKA 3BPSA 4UFOA 1BCSB 5CP8A 3SKXA 4ILEA 4MUXA 3TX6A 3L7YA 4IO1A 2XUJA 2ZYGA 2QV0A 4TKZA 2VP0A 1RKUA 4A16A 5I9TA 3KWFA 4BKMA 2OE2A 4L9AA 4QIHA 3FUCA 2BIFA 3TW8B 2IUSA 3RG8A 8ABPA 1NUHA 4TTSA 4MW2A 5GZ1A 3B3JA 3GLSA 2WIJA 1EHYA 1TIKA 3FMGA 1ORDA 5E1MA 4XKJA 3FA2A 5L9AA 3D3WB 2VDWB 4UU8A 3V2IA 2XQJA 3CH4B 1M1NA 1W0KA 3GMDA 3RVRA 4E4YA 2UZ3A 2J3EA 2FFHA 4NJOA 3SZLA 5A4DA 5BR7A 2CXSA 4CEIA 1H5UA 5A71A 2DUUA 1ZFNA 2UXDB 2IZ6A 4IVPA 1ZL0A 5CCBA 521PA 3JQFC 3SIRA 1T1IA 1AM4D 3E35A 3EEIA 3IURA 3QEJA 4XJVA 4PTLA 1YGYA 2OKCA 3EVAA 3R6TA 4L16A 5ICMA 5DIFA 3MHPA 3KSRA 5KNCH 4V1CI 3NTLA 1OWNA 4K9LA 3EGXB 1ZSVA 1YR7A 1O95A 1XVLA 5JS7A 1NSFA 1EK2A 1N75A 2OGUA 5LJLA 5EJ8A 3GCZA 3ZVKA 2PWBA 4EMUA 4TTAA 2QXUA 1IU9A 2R44A 4D56A 4N8EA 5CITA 1Y7TA 4CLHA 1RXSA 1R6UA 1CYDA 1QM5A 2PRZA 2EIHA 3GH1A 1IXKA 2VF4X 4GP6A 4QD3A 4DLKA 1B0PA 4S1PA 3CF4A 1ZJWA 4TKMA 3ZGOA 4N8SA 3V7FA 2P1RA 2VT2A 5TMPA 1I3CA 2P9EA 4QGFA 1QRSA 2W6IA 4DLZA 3D8RA 3JRWA 3NEJA 4RPCA 1DC8A 3VVBA 2EV9A 1BHSA 2WNIA 4G26A 3Q3GE 1M8FA 1Y1KE 3IUNA 4YRNA 2H4FA 3M2TA 1MOZA 5F12A 4GWGA 4KR2A 2PLAA 3ZUGA 1IM5A 4HGQA 3QLUC 4FS8A 1HQKA 3AUXA 4IXMA 1H2EA 1CD5A 1LWOA 4GEGA 4L5IA 4EG5A 5LXTA 1NFQA 3CIOA 5ALEA 3KQLA 2ECPA 1W48A 5GY7A 1OMOA 3QE0A 2QM0A 3TLAA 1C0IA 2ZWIA 5IKMA 4I8DA 4O29A 4M36A 3WKDA 5B1HA 4D9MA 1YONA 5KYNA 2Z0MA 2VKTA 1Q50A 3JZAA 4QTUB 4W5OA 3QPBA 3TO5A 3ASUA 3UUWA 4JY7A 1UEIA 2EF0A 2EKZA 3PIDA 5FA6A 1YZTA 1G8MA 4UE3S 4L0QA 4UBJA 4RH3A 4JP1A 3ZE9A 3O75A 3AR4A 4MVWA 4IXWA 2EKPA 2X7XA 3S5JA 2YZNA 3HACA 1ZJZA 1AZSC 4LY6A 2I33A 1BW9A 2VCEA 2ZAOA 1IUKA 1E1QD 1E64A 2AE2A 4TN5A 4C6SA 5BUQA 3BVPA 3ONDA 4A8HA 4FDMA 3DYBA 3INTA 4KGXA 1G7SA 1U9IC 3S27A 1PL8A 1QANA 2E4ZA 2EFCB 4Z86A 4PSCA 1D6MA 4DMGA 3PEFA 4BLPA 4GF5A 1WOMA 2H63A 2QF7A 2XUFA 4NBWA 4PHHA 4TXLA 3R4CA 5JEDA 3G68A 3ICQB 2WD8A 1YU9A 1YS2X 3GEMA 1G64A 4UEOA 1NNEA 2QVBA 3M8KA 4GO1A 4IGIA 4X92A 4IIEA 1TZKA 3TZKA 4UQLA 4RMIA 2E9SA 2HIAA 3I9KA 4ND1A 4MUHA 3ZCSA 2QTCA 3GLIB 4IEEA 1XNRB 2BUBA 1XTPA 2AEFA 1QZUA 2BL4A 2Q9CA 2CKDA 5AM2A 5KOIA 2QMYA 2PKYX 5JS6A 3U3RA 2QG6A 3MCTA 3MELA 4XIJA 2FSUA 1II9A 5G2OA 2HV8A 3O2NA 4Z9XA 4HV4A 5MFZA 1G0OA 1R0XA 2EBUA 2BI4A 2YOFA 3P45A 1KIFA 3QVWA 1G5HA 2H00A 2RSLA 3QJYA 4KNVA 4OAOA 2R48A 4JUBA 4A0HA 4POOA 5I8PA 1ZR4A 2VDLB 4JLAA 5C1DA 1QH8B 1ETHA 3O5AA 1TEVA 4HGYA 2B3TA 3IPRA 3EW9A 1O97D 4MTLA 2CJXA 4MKHA 2QHXA 2VC2B 3COSA 5HKAA 1M0SA 3H16A 4PZDA 1EFDN 2DCMA 4YRMA 1NR5A 3T9EA 3PK0A 1XL1A 3T7JA 4ZQIA 1SC3A 2QTBA 4L8VA 2ZI3A 1WJGA 3B6JA 3QVGA 1G60A 5D01A 4BZZA 1RRCA 1MMFB 3EGDA 2D2VA 3AW9A 3OWOA 4PC1A 4D3ZA 4OXNA 4I50A 4RHCA 4EPWA 4ZAGA 3IS3A 3NHUA 5HJ2A 5HZGA 1RXWA 1TPZA 1UT8A 3PX7A 1VIDA 1Z4JA 4V0MA 3W4JA 5HX7A 3LLVA 3L43A 4XDGA 4CW7A 6Q21A 1J0AA 5EWMB 4ZD6A 1N2CE 1OTYA 1Z75A 1RHQA 4PHFA 1A04A 4HS9A 4ID9A 5IM5A 3ORFA 1H8HA 1TDJA 4IDQA 2OY0A 4HAIA 3VPBA 4MGZR 4UTZA 1A5ZA 2NQ2C 1QQTA 1G3MA 4WLFA 2WIKA 4TSFA 4QXQA 2HR1A 3K0SA 4NBSA 1RRMA 4Q1CA 1X7XA 4LRQA 2W6MA 5U4XA 4TVSA 4ZCIA 4C21A 1T1EA 3RG2A 3B3FA 1AKUA 5B1EA 4IHJF 4YT2A 3UB4A 5AVVA 5KYTA 1VIVA 2RGDA 4MDHA 1RC8A 5KYYB 4NYMQ 1X39A 1XRQA 3U7QB 2IDZA 5TY0A 1Y3HA 4MW1A 3AHGA 2ADMA 1FDVA 1JG6A 2YMLA 3JX9A 5EKTA 3FIJA 2VDUE 3OG9A 2AG6A 4IH1A 4RKWA 1G98A 1XR3A 1IQ0A 2FCRA 4LZWA 4DLPA 5F4BA 1YNSA 2XVZA 1A5AB 2FWIA 1N7IA 3W8DA 2R2GA 4JUCA 3OFJA 3IB3A 4RTSA 1BMFD 2XUHA 3A1VA 2OQ2A 3QOYA 3PRJA 2CCKA 4P58A 1XKLA 3AI3A 1VHLA 3W5DA 4L4ZA 1TO1E 3C6BA 2YXNA 2AUMA 2FSIA 3L04A 4M7RA 3VRHA 5A5GA 1LRLA 2WAOA 2HLDA 5ICSA 4C05A 2ZIWB 3DT9A 4Y6LA 3TOSA 1H6BA 4EARA 1Q20A 1YVEI 5BR1A 2PGJA 2GZMA 3MVEA 2GD0A 3PKZA 2A94A 4YA6A 2ZKLA 1YJ5A 1DX4A 4TKUA 4W6QA 1SC4A 1TZJA 1L4HA 2ZBQA 5F7XA 2VHXA 4TM8A 2CMDA 3MINB 3NBZC 5EMHA 3V4SA 3TGLA 1R0LA 3LG2A 5M04A 3M6IA 3HO6A 2I2DA 1Z2AA 1Q1GA 1W5FA 5TV2A 4FFNA 5HCNA 5KC9A 1XC7A 1IBSA 4GKJB 3C7AA 3OLWA 1PL7A 5FNZA 4HB4A 1AVTA 1DEXA 2OYCA 5D8DA 1LPAB 1XVIA 1WMDA 2Q5JA 2XEXA 2Y9MB 3AP3A 4LHEA 5CGQB 3ZV4A 4BPRA 4BQIA 1SNYA 1SULA 4GKBA 4B7AA 3K8QA 3NV7A 4CN9A 1H4SA 3KHSA 1XNQB 3L84A 3EIQA 1T0PA 1JDSA 1VBKA 1XU4A 3LV8A 4BFVA 3DS8A 1SCIA 5JRDS 1D1TA 2JDID 4X20B 3Q7IA 1VCOA 1GV1A 1ONSA 3C7CB 4PY2A 5ICGA 4GPEA 1BDHA 5CMLA 1JZQA 1ZVJA 4J9UE 1NXVA 2VHYA 2XTNA 3P26A 2V65A 3EDYA 2CZGA 5DX0A 4PONA 3QX3A 4B87A 4RHUA 3SX2A 1AA9A 1T1SA 2BM9A 4HGRA 2Y6UA 3NKLA 3RIXA 3SXJA 3V34A 3OD5A 5EP2A 3L1HA 1H66A 4X1IA 3TNFA 1C29B 1C9NA 1EKXA 4H15A 4F2GA 2ZBRA 2AN3A 2CK3A 2OUKA 1IBRA 2BPOA 3IDQA 2HJRA 4LRUA 4EY3A 2HF2A 4YCMA 1U99A 4RQTA 1Z56C 2BYTA 4LJ5A 1SEPA 1KKMA 1O97C 1PWZA 3RRJA 1W75A 3E53A 1NP3A 3PR3A 2VHEA 3D02A 2A3RA 4YPVA 3OQJA 3KVVA 3HJCA 3SSOA 1BJRE 2XOKA 2J9GA 3IP1A 5AJTA 4ALNA 3SBEA 4YRZA 1N5DA 1MNQA 4RMGA 1UC4B 5IWAB 2VP5A 5FL3A 1QFXA 3WIEA 1VI2A 2G80A 1M2VB 2AYXA 5K4AA 5SY6A 2GBLA 2WIGA 3RW9A 3WQHA 2V1XA 3AETA 5AI8A 4AJPA 2HRZA 3UXMA 4PHCA 2CVOA 4J7CA 4IDAA 1HG0A 1JA1A 5EKDA 3FPFA 2BI8A 3CCFA 3L9XA 5COBA 3OQIA 2VXBA 4BVBA 5DNWA 2LGJA 3WSVA 3L7CA 2GX6A 4OYYA 1S4QA 4R2KA 3ZWNA 2AR9A 4GQBA 4TN1A 4M0KA 4US0R 1HX7A 5BXQC 1LPSA 2IY8A 3C1AA 1EINA 2QY6A 1ESZA 2XUQA 3DUFA 3KEFA 4Q7EA 2PWAA 4LRYA 1PKXA 4BO3A 4IGFA 4WK2B 1R6AA 2NXNA 1Z36A 4QNRA 4BNNA 3PS9A 5EP1A 4GMDA 3WO1A 2XWJI 2J9YB 2H18A 2EYQA 2QR2A 3NVDA 3QPAA 4N65A 4JI1B 5A4IS 5KYWB 2H59A 3L6UA 3AFMA 3P9KA 3LKBA 3F73A 5IKXA 4P92A 2HU2A 5IZCA 4FZRA 3CZAA 1U0SY 1GRNA 2ZXFA 3RAEC 3MXTA 5HJEA 2VZLA 4TXHA 3SKVA 1Q84A 3CSSA 3PQ5A 1K06A 1R3DA 4LQCA 1UQTA 1C1XB 1HLGA 3FWNA 5CLJA 4WVFA 3VU9B 2GHRA 4QWMA 3MGCA 2RG7A 3VOBA 3Q72A 4IH9A 5LMZA 4Y2YA 1JSCA 5LP6B 1DJMA 1RJWA 2DFTA 1X2BA 1S7GA 2HXYA 1P9RA 4Q4CA 1WW2A 2B8WA 1JGTA 4FDVA 5EMKA 2JG3A 2FV8A 2G1UA 1ZI9A 4WGGA 3WMRA 4RTJA 4LQ4A 1DAKA 3A4TA 3HSYA 4JR0A 4OQZA 2FY8A 2JJMA 2QN1A 5EZSA 3V8BA 1N2SA 1VG9B 3CSUA 1MG5A 3GJ5A 4NYIR 1GL6A 2OXTA 3ZXYA 3CZMA 4DXAA 2RB4A 4PX5A 3D59A 1UJNA 3IPXA 2A1TR 3RSLA 1L5YA 1FP7A 3W5SA 4KOEC 4P5PA 4QTYA 3RQSA 4MUNA 4KN9S 4TQ9A 2O1WA 4MDEA 3QKIA 5A4MS 1Y1QA 4DUGA 4HY3A 4KIGA 4OSPA 3V1LA 2PX0A 2RI0A 3HMQA 3ZZMA 5I3CA 2XT9A 1YQTA 3PZBA 3TBKA 1VCNA 2QUBA 4D74A 1L7PA 3FCEA 2BFNA 3IVRA 2H48A 1ZONA 4TL7A 1E0KA 4UZSA 3ZI4A 1NP7A 1NW3A 1K4KA 2HF9A 4YK7A 1CRLA 4LC1A 3SBOA 3F5MA 1YRBA 1Z6PA 4MZDA 1DRVA 1ZM9A 4LJ7A 1U9YA 2PM8A 4R0NA 3O21A 5KNDD 1ZC4A 1NIPA 3WP0A 5IS2A 4FIZA 4QU5A 4OHXA 4AL4A 1T9GR 1T43A 5DGDA 3HNPA 4YFYA 5AVUA 3U7HB 1MORA 1PT6A 2DGDA 3CX6A 3DW1X 4TV9A 1U28C 1Q15A 4YAFA 2C5AA 2PCLA 1ZSYA 1JU3A 1ZAKA 4YDSA 1ONNA 4QNNA 1APBA 3T3OA 1U2GC 3O0TA 1JAIA 2UU9B 4JLBA 3C3DA 4WLNA 1WZNA 1RPJA 3E8SA 3FSRA 3RRNA 3LLSA 1O87A 1WUIS 3PJDA 2OV1A 3BTUA 4UZFA 5FI1B 3A1SA 1ZK4A 1M0WA 1S4MA 2H2GA 4YJHA 4ZU3A 2C4HA 4ZVKA 4B1FA 5BV1A 4CGZA 3IALA 3ANNA 1B4DA 4CRWB 6NULA 1LDNA 5L8VA 2DPGA 3TTVA 3DO8A 4JJAA 2DFVA 3BM5A 1PT8A 4V3BA 1EFUA 2DPHA 2YZ7A 3OMLA 2QB5A 1W35A 5BWBA 1KTVA 2XKJE 5CLFA 2RMKA 5EIBD 5TQVA 2YZKA 3X1YA 3A3OA 4L27A 1JHRA 1JEDA 4G4IA 4HRVA 4YUXA 3GLHE 3ODGA 5TT0A 3RUIA 3MUOA 3ZTYA 1C7IA 3OT1A 4QULA 3PNQA 1BC5A 4Z5XA 1VZ2A 1HYEA 2X3FA 4XCQA 1XQ6A 3ZV3A 2SKDA 5LA6F 5JVDB 1TCAA 3RVLA 1JQ5A 3TDNA 3VC7A 1CJKC 5IU6A 1N9KA 3QKSA 4BX8A 3T1TA 1O8BA 2DWCA 4Z4IA 3VC1A 4X66B 3MMZA 1UKYA 3G5LA 1EFAA 2XUOA 3RRMA 4CR8A 5DM1A 4X1KB 4FZ5A 3S2UA 4CLEA 5GVSA 1NU6A 4DE5A 3DNPA 3SC2B 1JG1A 1QB8A 5KYVA 2WEKA 4CWAA 1II8B 4YRQA 5JFOA 1Q2UA 3UTCA 1NF9A 1YMUA 1MIOB 2Q4OA 3P9SA 3ITNA 2Y1OA 1YGPA 4ENPA 4WOCA 4H77A 2JIRA 3WL3A 3FOEC 3VR4A 1GTRA 2W2OA 3M5DA 5GIOE 1EX7A 1Z37A 4I5IA 4IW3B 5HHTA 2W7TA 4TL8A 1Y4AE 3B5JA 4ITRC 4OBWA 5J5CA 2XI4A 1QZZA 1JDBB 1V48A 1I8TA 3HWRA 2QQ5A 3JQGB 4QBKA 1GVHA 1NMYA 3TNJA 2HLHA 1DTEA 3DE4X 3CONA 5FFFA 1WO8A 4JLPA 3RK4A 2HRCA 4ZVLA 3T7SA 1PBTA 1OXKB 1WPXA 2X0NA 4PIMA 4RJTA 4E5SA 3QJ5A 3CO5A 3FTEA 5EKXA 1NW7A 2OO5A 3LKZA 2X2OA 4MR9B 4MVJP 3ZWYA 4DLRA 1IUOA 1GSOA 5A3RA 1XOIA 3WLOA 5EHIA 4K9SA 4HDMA 2PUEA 5BR8B 5KUTA 2ZVQX 4KTTE 3HCEA 2X0KA 2C2ZA 1GDDA 1L1EA 2JGEA 3Q12A 2ZIXA 4B17A 1TA4A 1ZNZA 4W8OA 5CBPB 4ZYVA 1RHMA 2Y05A 1XMPA 4PE5B 3SP1A 1O03A 5I01A 2FMIA 4CGYA 3GA0A 1X14A 3E84A 3EW7A 8LDHA 3Q8MA 3MT9A 2C5SA 2WYOA 2NZXA 4HK4A 4NDAA 2OYSA 2Q4RA 5IDQA 4AYXA 4MRMB 5TE9A 2AT1A 5IYZA 3AEUB 2OBNA 2DSNA 3UJPA 3TVTA 3ZQ6A 2REXB 1OWPA 5FL7D 5AMXA 1SU8A 1MDBA 4AF7A 7GPBA 5KTPA 3ZVNA 1TU4A 3TZQA 4Q3BA 1CVLA 1PS0A 2CLSA 4GOND 2NTEA 3OZFA 1P1BA 2XRZA 3FTCA 5T3UA 4FYJA 3CBQA 1YRAA 5DBHX 3C4QA 1VHTA 2HFKA 3KOUA 1J33A 3SVLA 4RPJA 1O95D 2C03A 1RQ7A 1R5NA 4NJEB 4DMLA 4AJ1A 4L8WB 4H3SA 1NWHA 4LG1A 1IPHA 3H5RA 1NN3A 1GSAA 4LK2A 4WFKA 4M89A 1Z33A 1CUZA 3JAWB 5AVXA 3KSZO 1P74A 2HT1A 4KDCA 3R9WA 2YXBA 4QQ8A 1TQHA 4ALIA 1KH3A 3FMPB 1KFKB 4II3A 4DJTA 3BB4A 4TMZA 3B6MA 5FUMA 4MMZB 4N5MA 2O20A 2J33A 2WJHA 1VP9A 5F64A 5HMLA 5K1ZA 4JI3B 3U5ZB 4OU4A 4LZOA 5JD6A 1WBDA 1LB1B 3RBZA 1KORA 2VT7A 4H6PA 2W6ID 2QLLA 3ZY6A 4Z4CA 2ZK7A 4IIJB 3LCVB 5D51S 1P7ZA 2FEWB 1UZNA 5EIBC 4YBZA 5IMBA 1U80A 1YQUA 1WIWA 3WL5A 1FQKA 1EPUA 5JTTA 2YFKA 4BFUA 2R84A 3QFRA 1PYOA 2JGIA 3CZPA 3IUYA 3PGLA 1RRKA 3OU7A 1T2VA 2ZYHA 4ID3A 3CPEA 3FDZB 4V0NA 3TECE 1KAEA 4CTNA 1H2AS 3L4BC 1EYZA 4B76A 1RI4A 4BGUA 5E7QA 3G49A 3HXKA 1BH6A 1JLSA 4NG4A 4MJXA 3X2SA 4DUYB 4C7OA 1QGYA 1CUFA 2RH5A 1Z2DA 4PGMA 4KQHA 4KC0A 1E9EA 4C7XA 3S81A 2UXCB 3C3YA 1Z8FA 2WVAA 1JSRA 3MF4A 4MPRA 4UHBA 4UM8B 4KNWA 2X2FA 3S7ZA 2J3QA 3OZUA 1WE2A 4F3TA 2UYQA 2ZJ1A 3Q9SA 4FCWA 2Z8ZA 1PFYA 1RQLA 2PRKA 3ZK7A 4C3OB 2YJNA 2O1EA 2ST1A 5IK2A 3EZGA 4U7TB 3GHHA 3G2QA 3H8VA 2XGMA 3KSBC 2ENUA 4NY1A 3NC0C 4PRYA 3QEKA 3OIUA 5H83A 1MD9A 4C0KA 2LWIA 4FW9A 3FUUA 5GJCA 3CNLA 4IMJB 3RTEA 4OFBA 2AKYA 3KB8A 4DLYA 3OOSA 2GTIA 1IVYA 4F4IA 2QKYA 4KGZA 4ABTA 4EITA 4HXFB 3HJAA 4FGJA 1DJQA 4EW6A 1SOWA 5I7SA 1S2MA 3D0RA 3O4GA 5DSTA 3AKZA 3HUEA 4YRCA 3B36A 2O57A 2RARA 2VK1A 3GNTA 3L8FA 4Y9RA 3E48A 1A8IA 3NHYA 2OZPA 2VTEA 2VDPB 3EXHA 1AKMA 3GLVA 4Q82A 5U4QA 4FR2A 4DWOA 4EP1A 4LYEA 1M6NA 1PP4A 2NADA 3OX2A 5BN5B 2IF2A 3VSAA 1O77A 1W88B 3ZJ5A 4NBLA 2ZW9A 2PX8A 3U81A 1A1VA 2CDNA 3O8QB 3ILYA 4JYZA 5F5NA 2BHTA 4CUJA 5H80A 4D8VA 1JDTA 4EW3A 1K0UA 5DCWA 1UKCA 2QN6A 3KFXA 1CUWA 4RE6A 1WKCA 4PBRA 1U98A 3R0JA 3RANA 3JALB 1ZS9A 3IFSA 1QTQA 5LL6P 3QUCA 4IMPA 4MQ5A 3ANLA 4QBGB 5BYAA 4LC0A 1OH7A 1GGMA 4GGOA 1DKLA 3UJ3X 5BUCA 3R7WB 1ISGA 1PK9A 1PGQA 4C76A 3DOOA 1YCFA 3LBIA 2R11A 4CKZA 1N6OA 4C6RA 4TQUS 4ND2A 4RM2A 4DYVA 2R87A 3KV3O 3K7EA 3B38A 4LMAA 3UCFA 4KPEC 1ZUHA 4G1CA 2QI9C 4D9GA 3KQTA 4EELA 4LDQA 4E6EA 4WL0A 3BGIA 4WZBE 3U26A 5JCPA 2X5KO 1VL2A 2NYUA 3ZVRA 3SZUA 1Z6XA 4J0FA 3HKEB 1OXTA 1SBIA 1YZFA 2YVKA 5L3VA 2QT0A 2FSVA 3R7AA 1R64A 1DDIA 1SXJE 1QV9A 2QIOA 3LO8A 5F1YA 3B1XA 2FQQA 1L8QA 2Z8YA 3A3YA 4PZ9A 3QVKA 1MA3A 3PDIB 2LIVA 4J16A 2QSJA 1DMRA 3A4LA 4CPDA 2OZKA 3U7EB 4JVMA 1E79D 3UMBA 2VOEA 3HDTA 4QWWA 3D3WA 3UAYA 3DZDA 2WJ4A 3DTVB 3NUZA 4E94A 1R0WA 1XDWA 2J4DA 1U8ZA 3MT0A 1FDUA 4YJGA 5FWXB 5C18A 1Z39A 2IZ7A 1RLOA 1XQVA 3OF2A 1U7DA 5EESA 1TKAA 3TQCA 1AKVA 4BY9E 1SZPA 3H3XA 3BXGA 3CRVA 2MOKA 4DQKA 1JI0A 1KK2A 3LFHA 3OCWA 5T6MA 1U4OA 1KPIA 2IW3A 1XZQA 2W71A 4HWKA 4RPIA 2X41A 3ICPA 3A6GA 1H94A 3UV6A 1U3GA 2FDRA 1C14A 3BL8A 1FLDA 3RTAA 1SXJD 2FZWA 3O8OB 4ZICA 1NQOA 5C7OO 4MJ7A 1L5HA 4EG4A 3OA0A 3QLUA 4LYHA 2HLDD 1DCFA 2BKXA 5GADl 2OHHA 2O8BB 4BCDA 3M5PA 1PL6A 4YP9A 4FN4A 3TDMA 2OCKA 4LJYA 1QX4A 3LQQA 3V4OA 1SRQA 3G3EA 3HEAA 4FWBA 4CF7A 2J0SA 1YL7A 5E6RA 1AKQA 1JF8A 2OHOA 4U2CA 1OBCA 3WSTA 4W82A 4MKZA 2R1TA 4FFOA 3CURA 3L7BA 3PRYA 2FEPA 5H9WA 2A35A 2QBYA 2RBGA 4EG7A 2P90A 1GCOA 1KYQA 1YVDA 2JEOA 3FVWA 4OQXA 4TLCA 1I3KA 1ZJ5A 5F33A 4ZV4A 1SCUB 4BMZA 4RABA 2JVIA 2OOKA 3NWPA 1XCGB 1I6MA 3K8YA 1XKQA 2Q3HA 4Q9NA 1PTJC 4G67A 4LGVA 3VYSB 1ACLA 1EQAA 4XI9A 4KRYA 3QUAA 4DB2A 3A1CA 1V3TA 1GNLA 2WUVA 4RKFA 3C8MA 4XUEA 5BW4A 5BORA 5GIPE 3KPVA 5IMSA 4GXNA 4W9MC 3FAKA 3MBOA 1EGHA 5KJCA 1KWGA 2UYHA 3THXB 3NHSA 1LK7A 1AZTA 1Y1LA 4RL6A 1JKIA 3ZZNA 4B6JA 3I9V1 1X80A 4BJ3A 1IOWA 2ERXA 1STOA 2HCBA 2QMZA 3DFFA 1GYQA 5EMJA 3VX3A 4ZTUB 2DB3A 3PDCA 2Y1FA 1EWQA 1ZGHA 2IOFK 3ZDQA 3ZDDA 2CJPA 2E5FA 4BMOB 2PS3A 1U6KA 4BXOB 2CK3D 5C9ZA 4JC4A 5HOEA 1QG0A 4XJTA 1WPGA 2YN4A 3BE6A 2PBZA 4IQFA 1ZM7A 4KFSA 1DWUA 4JI0B 1W2HA 2ALJA 2XB4A 4C4ZA 3IODA 4ER5A 1EWKA 1IUPA 2W6JA 4ENTA 2X3UA 4FJ1A 4QICA 4RIFA 1DPFA 1R3UA 1VLZA 1UJ5A 2EJVA 1CE8B 2WFLB 3R8XA 2Q1UA 2I91A 2P1DA 3AKYA 4R5HA 2XVMA 2PX3A 1GR1A 2OHIA 4PZZA 1R66A 4ODIA 2JARA 3R6GA 1E2IA 4OV6B 2FG5A 3QPUA 1ZH2A 2VZ8A 2OLEA 3G9ZA 3CNNA 4U63A 4LTDA 1IN1A 1L4YA 1T35A 2Q0SA 1M2HA 4C29A 2WSSD 4RMHA 4BZWA 1JEQB 2RK3A 4MIYA 4Y7DA 5BSEA 4R68A 2PH7A 4IDNA 2JJ2D 2PRYA 4LRXA 4J8PA 5BWLA 4RFLA 4B6EA 2QMUA 5IT4A 2BFDB 2QRNA 4QXAA 1SIWA 2GN0A 1U3FA 2W2VA 4EB8A 1CUBA 3U7IA 1YNOA 4XX0A 3VV2A 1YB6A 4CIXA 3IA2A 5JE8A 4QJ3A 1WF6A 4OSOA 1QH8A 1E1CB 2WYWA 2ZAIA 3NM6B 1NMEA 4CIAA 1LBSA 3FHCB 2E3JA 1J8YF 3Q87B 4MV1A 5K3SA 4ZYTA 1UDBA 2AD5A 1YS4A 1XJWA 3GUZA 4PR3A 5CDYA 3W6PA 2X8JA 3CS3A 3QX9A 4B32A 4F11A 1VLJA 3FTNA 2JIZA 4JB8A 1IZ7A 1Z28A 3K9FC 1GNSA 1I9GA 4QDUA 1A7JA 2VHUA 3RLFA 4OHRA 2I71A 2Q5CA 2H4WA 3PGJA 1KQPA 3KQNA 1WEHA 3KT8A 3HADA 3UNXA 2FHSA 3PCTA 4IDPA 5IT5A 1FBNA 3PP8A 3OURA 4LJAA 1PNTA 1DRKA 1JXQA 4M1WA 4XR9A 5TVKA 2EWVA 3EMDA 3GJTA 3M6XA 4H1UA 4P86A 1NY5A 3I4FA 5EWMA 4ETIA 1LLCA 4ZN6A 2J67A 3BFPA 4BAGA 3PXGA 4KPUB 1SXJC 1OZHA 1NP6A 3MRTA 2IPNA 4NMHA 4GVXA 1RXUA 4W1PA 1LDMA 4EYKA 3OIYA 4C2UA 4BO4A 1FB5A 4EG0A 1UM9A 4U6SA 3SKYA 4G24A 4XGNA 4CETA 5LOVA 4R1OA 3AVWA 1JIVA 1MQ8B 2Q3MA 1NVVR 3IHWA 4AJ9A 1PR9A 2IS1A 1SUSA 2JL1A 4EYEA 1PJQA 3ICCA 2BMAA 2A33A 1P3DA 3DZ8A 3PWTA 2QW8A 4JVNA 3U7QA 3ROZA 4TVBA 2A1IA 5ALLA 3N8HA 1B00A 3H9CA 3K72B 4B79A 2SKEA 5M29A 4QU9A 2D1YA 2PVPA 1OPRA 3R5TA 4QPZA 4I9HA 4POAA 1FSFA 1XZEA 2C07A 3HZOA 2BJWA 3Q3VA 5DM4A 4QUHA 2HWWA 5G53C 4OXYA 4DUGD 3RABA 4YHHB 2E4UA 4O3FA 4HUTA 1IFXA 1N5JA 1PR5A 4EK9A 4QBTA 2WRZA 4EYGA 4CEJB 1ZCBA 3GCGA 3Q6NA 3CX3A 3WHIA 4TMVA 3HCNA 3RFFA 2OV2A 3W90A 5JI2E 4OHYA 3I5MA 2GKSA 1RYZA 3K70D 3G5TA 4I9GA 1D1PA 1E8NA 1GPLA 5FPKA 1E6LA 1JDVA 2WT8A 2HBYA 4PSAA 3ZJYA 4ASUD 1E6EA 4Y6OA 4HHEA 4MEAA 2W2LA 3HDYA 3SM3A 2QTMA 4N9QA 4RA6A 1ADCA 3MINA 2QMHA 1J0BA 1T5SA 4J7XA 1R4NB 1KGDA 1IVNA 1YCGA 1BHQ1 2WZDA 3ER9A 1YI8A 4L4XA 5HQ3B 2EFDB 3PC8A 2G9NA 5AM5A 4OAQA 1PHRA 1Q77A 4ZEXA 2DKNA 3A28A 1QIDA 1Q7EA 2ZYIA 3UFBA 3TR6A 3PQ6A 4MLPA 3WTBA 2P7HA 4BRWA 3A6EA 4BRSA 1YB5A 3HLYA 3I5UA 4N7BA 5ARCA 5GMOA 5J2UB 2IBMA 1W96A 2BTQA 4ZOLB 1Q11A 1HYGA 1E63A 1KARA 4WPGA 1K7EB 2LKDA 4JQSA 3QKWA 3STWA 1OIWA 3B85A 3RRXA 2DETA 2G82A 3BE5A 4YMIA 4FMPA 1VJGA 3TGWA 3BORA 2UUOA 1AF4A 4S05A 2HYIC 1VRVA 4YAWA 1OXSC 4WI1A 1M67A 2HUPA 3GU3A 2F1JA 4R8KA 1Z73A 2HDOA 1PZNA 2M6RA 2H07A 4ZO7A 1CJBA 2C2BA 3MN1A 3MWEB 1SU4A 3FDXA 3O9MA 3RARA 1JHYA 3ZDFA 3Q1KA 1IDN1 2AJCA 1KR5A 2W11A 2Q5HA 3KETA 2VRCA 2AE1A 3SFZA 2PS1A 1IPFA 4IOJA 3KYJB 1L4LA 4DV6B 1NG9A 4HAXA 4OI4A 1M6YA 3N5CA 2OV8A 4NR0A 5EHQA 1NMZA 1T36B 1YJBA 3FJYA 5DBOA 1E62A 4C88A 3BMCA 1UMCB 1QQAA 1SUIA 4G0PA 1BVRA 2A2ZA 2GA8A 2PD6A 2WF8A 4E1BA 4G0XA 4BFCA 2E4YA 4GP9A 4RY2A 4CQMB 3DZGA 2IPXA 3UKDA 5DMHA 1M2VA 2APJA 4X61A 3VR4D 4BKQA 4C3ZA 1KPGA 4BEWA 3WGZA 2WB4A 1CUHA 4JP2A 3UOAB 3FUWA 4GC5A 4PO1A 2E4VA 5J4YA 2O2GA 1OLSA 4YECA 5G4KA 4S1OA 3RODA 2BKLA 2YV4A 4FZ3A 1B14A 3GA5A 3X2EA 4CLXA 1XA4A 2O2YA 4F4HA 3I23A 4QYMA 2RHTA 2CNBA 2OGZA 3DHNA 3H4IA 4UBIA 1VHQA 3HRKA 3HU3A 4ZAVA 4BMNA 1JZSA 1Z6AA 3NYWA 1LQ2A 5C4MA 5JCZA 1P75A 3OE7A 3P9QA 5DTIA 1M0EA 2Z3VA 1U3UA 2WWWA 2ZM6B 2C4TA 3R9XB 1GTL1 4CI0B 3HGTA 2O5RA 4LZNA 3ZXIA 3WLPA 2ZRIA 1RWQA 2RIRA 4YV0A 3RJ5A 2CY0A 2YC2C 3DMRA 2D5AA 4P4NA 5EPEA 3TQTA 5IWCA 4IJ5A 4HMQA 4JB2A 4YUYA 1V9SA 2PYDA 1J07A 1XA3A 1EVZA 1WSBA 2FFJA 2FZCA 2PMFA 5KYWA 1U1CA 4BQOA 2FMFA 4ZT3A 2YZMA 4TS4A 1US8B 3LNCA 4CM4B 3MOIA 1BOOA 2XWSA 1WXHA 3QVUA 3ETNA 4BNWA 1GJRA 2AFIA 2PD3A 4DREA 5CT4A 3ZW8A 2IRWA 1EJ0A 3NP9A 3PNMA 3HZHA 3PGKA 4UM7A 2NZYA 3KZCA 1A5BB 2C78A 1QQ6A 1QGZA 3VU9A 4BNVA 1U6JA 2YL2A 3LQRA 4NKRA 4DR3B 3GPBA 1KETA 2YV2A 5LP6A 4B7CA 3R2JA 5JOQA 4X3PA 1ISFA 1OT5A 3JQPA 1ADBA 2P4EA 3R5FA 4O5OA 3PX2A 1TJYA 4MEBA 1Y3AA 2FETA 3AFNA 4IFBA 1KQNA 2F17A 4HAWA 4J0IA 1B8NA 2X0JA 4C04A 4XYLA 2FDCA 5EIOA 4AJKA 2J7PD 3H87A 2AR0A 2H5IA 3K73O 3LGXA 1T9AA 3QU9A 5ARBA 4PLZA 1MO5A 4O0MA 4EHLA 1CP2A 5FOVA 5JZOA 2NAFA 3RFUA 1P3JA 3S40A 3GQBB 2Y1KA 4HC4A 4MUAA 1CTQA 4BO2A 1H2HA 5EZYB 3CX7A 2BEUA 2WKSA 4L28A 2H2IA 4INAA 4UUQA 5AWFC 2Q8PA 3ZNPA 1OYYA 1FRVA 1U7OA 1J2UA 3JASA 3KT3A 4QFCA 3OQ6A 4M9ZA 4P5DA 4PGFA 1QRRA 1PV1A 4O0LA 4D92A 2HH9A 3TW6A 4YRDA 2HL6A 3FTDA 1M1ZA 1CUEA 3DXFA 4RC9A 5F5LA 3IR7A 1P8JA 3QVLA 1QHHB 1G8GA 1A3CA 2P9BA 3UH0A 1EE1A 2FN9A 3AR6A 4Y2PA 1D07A 2BDTA 1ULTA 2ZVDA 3HFSA 5B3KA 4DW8A 4I36A 3N2EA 1TCVA 1YDWA 1VC2A 3FLAA 3KVNA 2NTJA 5A7GA 3VNAA 4B6QA 1EUCB 1E1KA 1O4VA 3OLVA 2HJWA 1XTSA 4L5BA 1ZNWA 1T0UA 4CEHB 2DLDA 3EFBA 3ESCA 4R6WA 3HYLA 4UOZA 3DF9A 5IVHA 2B2NA 2WUFA 2REOA 4O1HA 2EWMA 2G76A 4FGKA 3ICOA 2A9VA 221PA 2ZSUA 4AT1A 1FMCA 1LPNA 4LJ4A 4NZPA 3PEVA 1CUXA 2XGOA 5JXWA 2VRWA 1NUUA 3V1KA 2BHLA 1JAYA 2YJ3A 4WOJA 1Z26A 1YBMA 2EGGA 2FPKA 2JH3A 3CV3A 3HB5X 3HZZA 3KWLA 1OH6A 2IDKA 3P2YA 4DKJA 3NHFA 1AK1A 5ITZB 3ZZTA 1YO6A 2E49A 3OJLA 4MHTA 3TE6A 4KBYA 3V55A 1U5BB 4WZAE 5BWOA 5E3IA 2F3RA 3EVNA 2WWYA 4MKFA 1RM4A 1BWQA 4X91A 4J0DA 2ZJZA 3D43A 3QKRB 2D2FA 3KOWA 3T3EA 4E07A 4DLTA 1KJ8A 4CCSA 5KOJB 4C3UA 1OFUX 1X9GA 5CJPA 4CT0A 2F1IA 2R79A 3G59A 4D4HA 1ESDA 2P4QA 3E7PA 1DXQA 2BR3A 3R0VA 4YDRA 5E2BA 4CM1A 4HGPA 3SMVA 1MIOA 1C8KA 4X8MA 1V5EA 3EG9B 1XCMA 2CN1A 3QKTA 1MB3A 1PCXA 2UDPA 4GGPA 5F2KA 4HNQA 4HWGA 1XJ0A 1P2BA 2XCLA 1KZ6A 1AUQA 4J0CA 1ISIA 2PDAA 5DHQA 5JARA 2ZWAA 2PD4A 2ASEA 5KSZA 2VBFA 4KWTA 3ZGLA 4L2IA 1YA6A 3HTXA 1BQ4A 4PS0A 3ZJVA 3ZDCA 1JG4A 1JXAA 3IAXA 3H6KA 4M7OA 4JBWA 4AKIA 2CNKA 2P35A 4DIOA 3FCUB 1VRWA 4Z7OB 2NUBA 1QS0B 2SCUB 1WLSA 3KCNA 3R77A 2IZ1A 3L40A 5FUVA 2Y9PB 1Q0PA 4UEKA 3LJKA 4E08A 4I9UA 7REQA 3HFGA 5GGYA 3M7IA 2ZROA 4IIVA 4E09A 1HE5A 1T2AA 1JJFA 1XPRA 4R7TA 1WXIA 1H2BA 2EX1A 2Q4EA 1DKRA 4KQXA 4R01A 4CIVA 5KQLA 1C5KA 2XCTB 2G83A 4IX9A 3T0GA 5CBPA 3L8EA 4JJ4A 3G13A 1RRFA 4RK0A 1NXXA 2PR7A 4DCNA 4NK4A 2IFTA 4ZCTA 5CUQA 1BMTA 1P7VA 1ZXBA 5E0OA 1SCDA 2OV3A 3WV4A 4CHGA 1DBIA 1MTZA 3P9YA 4FINA 2RCYA 4K2AA 4LISA 3LDHA 4M60A 4MRMA 4R41A 3JQ6A 4O4HB 4QSMA 1LFAA 2BCEA 5LD2B 4KR7A 3FKJA 3NXKA 5C80A 2VYQA 3SDBA 3OC0A 5CA1A 2A4KA 1SUAA 3LUDA 2WZBA 4MYRA 1UWCA 4UXJA 3MFQA 2GBFA 2GPNA 4HNAB 3UGTA 1C4XA 4XYMA 4R3NA 4X00A 4PYKA 3EIWA 1T3ZA 3CWQA 4BFSA 4NLLA 4Z9AA 4EY6A 1SUDA 2YJ5A 4NZOA 2Z83A 3HKBB 4GKKB 3AH8A 1PTKA 4P4SB 2EGHA 3EMVA 1FF9A 4NJEA 3W3AA 5SY9A 4ZCMA 5IM4F 1ULBA 1Y1RA 2EBFX 2GTPA 2CYBA 4JI6B 4FE7A 1E4OA 1MC1A 1F0KA 3IT1A 3X1XA 2BEWA 4BQPA 1RAIA 2H7CA 3ETJA 1QGAA 3RF7A 1F38A 5IVKA 3DBIA 3E0XA 3PUVA 2QL6A 4MVYA 1B93A 2Q1XA 3TIGA 1M8GA 2OHXA 1GV0A 2IYLD 2OENG 3C87A 4GMGA 5KWJA 1DXHA 1X8KA 1W49A 1YQDA 3ET4A 1U7WA 3E9YA 5BSMA 4V39A 1JR2A 1IBLB 3BXPA 3EISA 3VU3A 5CCXA 4QPDA 4ND8B 1YWGO 3LOQA 3NLLA 2C9YA 1IB0A 2AJ8A 4LC9A 5AKJA 5EMLA 1UOOA 4F9FA 1TYCA 4DLUA 2C8LA 2GMWA 3GHYA 3LDUA 4H7JA 1N1GA 1JDPA 4LVNA 1H4TA 1LDBA 3AESA 4KV7A 4MS3B 4N40A 3ZI7A 5GONF 5EKUA 4WA7A 3FKSA 1RJGA 3LUAA 3PFKA 4IJUA 1SBZA 2VYNA 3HJTA 3FDZA 1Z3CA 1O96B 4TRMA 4RZ2A 3D31A 3ROEA 3VOTA 4ZEVA 5A4KA 3M6VA 1XEXB 1RE1A 4HMOA 5B5SA 4Y2QA 4E03A 2OECA 1IEWA 1QNLA 2WD7B 3FN4A 3I0ZA 1LDYA 4MWZA 3VNQA 1J49A 2I1QA 3GOHA 4NDZA 3BRWD 5CG1A 2WSYB 1G2IA 1YDMA 4MW9A 2ZRKA 4RV9A 1C8BA 3WADA 4XSHA 3KQQA 4OIFA 1M1UA 2NZ8A 2B1RA 2BC9A 2K6GA 4R31A 3GLIE 5F9FA 3CFYA 3PHBE 1G8SA 4TGLA 5ADUS 3F47A 1YU6A 2QLTA 1U3CA 2TMYA 5J5AA 1E2HA 1N6LA 2IODA 4ND3A 1TB4A 3OZVA 4DYHA 5DM70 1EK0A 1SUEA 1ZHFA 3MIIA 2B1GA 3MYRA 4LJKA 2ZE8A 2QE7D 5I5EA 3VI3B 1UBGA 3RI3A 1T4GA 2J5QA 2LR0A 2YYSA 3GNQA 3KUUA 3TN7A 2CEKA 4XDZA 3O8DA 1NUSA 2GWRA 1GU7A 5FPQA 1HEIA 1CDEA 4IIDA 1QAMA 4W7SA 5IBRA 3ZE8A 1QRTA 1Z18A 3KKMA 1QFMA 1TL7C 4TV8F 3ZJ4A 4W5JA 3SQWA 4II2A 3JQBC 1J5PA 3ZBQA 3NRBA 4EUFA 1UPCA 2VBCA 4PLWA 5K20A 2H5LA 3BTVA 4KTVE 2ZUTA 1GTJ1 1P7PA 2GLUA 3QFFA 5BY2A 8ADHA 4AP9A 4AZWA 2EZ9A 4MB0A 4LYYA 3I2KA 4ETMA 4P2GA 2J9RA 4DRXB 3Q11A 4PX3A 4QAJA 1X1EA 2BGJA 2IHZA 2Q6KA 1W88A 1ZPDA 4GMFA 3CUUA 3FVVA 2XSZA 4LE1A 5LBUA 3UYKA 5B6PA 2YJGA 1DINA 3QYFA 3C97A 4C4SA 4LHXA 5B3JC 2R6ZA 5EUBA 4J3JA 1HC7A 5EXDA 5KOYA 3OLYA 4M8KA 3II6X 2PMKA 3SSNA 2CXNA 1RI1A 2FN4A 3UUFA 4GG1A 1NRJB 2NUAA 2W98A 5DSXA 4YMTA 1Z7GA 4IFIA 1NM5A 2JIZD 3R7WA 4XVHA 5TF0A 5B3LA 3LF1A 1P2VA 4KMSA 5CR9A 4XTRA 5KQSA 1TK9A 2JJ1A 2J59A 3OIGA 4XEUA 2H7VA 5KEIA 5IBCA 4NIMA 1WDWB 1KJJA 2XXJA 5CXUA 2NUTB 4BGDA 4KWHA 1Z45A 3W9UA 4DADA 1RQGA 1PU2A 2QLJA 1HY3A 3IEKA 3DWEX 1VXRA 4NBKA 3HCRA 5JWRA 3AT1A 4WLEA 2ZULA 2XZLA 3DC2A 2HA0A 4BQNA 1VCIA 1UKBA 1X0XA 2YY6A 4MLDA 2H57A 5TS3A 4DN6A 5A04A 2I34A 3ZDBA 2C2WA 2PEYA 2WICA 3K0KA 3RS9A 3W77A 1YUMA 5ALNA 5AW9A 4RTOA 4Q47A 1G18A 1Y42X 2HRBA 3G2PA 3JR7A 1AMUA 1V4NA 1ZBDA 2AGVA 1JHOA 2P79A 3P19A 4X6LA 3RFTA 3V33A 5FWAA 2JK0A 4E15A 1XMJA 2EKLA 2ZETA 4XX1A 4KR0A 3GLTA 2FSFA 3LC1O 4DNQA 4I1VA 3DTVA 3ELBA 1U02A 4D3SA 4NESA 4MV3A 4ZVSA 1WB5A 3SJUA 2OHVA 5AJVB 3UQZA 2A59A 2B98A 4O4LF 1FDWA 3HN7A 1N78A 4PAWA 4HD8A 4HPWA 2GAAA 3R5JA 3ZW7A 1KMMA 2QTVB 2C0CA 1T0JB 1SHTX 1V5GA 2F90A 5TLSA 3DFZA 1BCRB 1UC8A 2PKEA 4I4TA 2WOJA 3JSXA 3A6PC 2QUAA 1TEZA 3CEHA 4PCUA 5FP0A 4D4GA 3JVVA 3LCUA 5BVHB 3CNHA 3PHIA 2ZM5A 1QO7A 5T41A 4JI8B 1KC1A 2UAGA 5IW8A 1W73A 3N7TA 1UDAA 3FY4A 4MGYR 3BWYA 5AKIA 3VR2D 3DLTA 1CUUA 3TLGB 4G0NA 5ERXA 2XW6A 4Z49A 2QTAA 1YULA 4AKEA 4B09A 1P29A 3CA8A 4GLBA 4A1FA 2JJQA 1PR0A 1TMGE 3A2KA 3A6JA 5KX5A 4F5WA 1R4MB 5AUPB 3GJ8A 1VIYA 1XNHA 1SCUA 3DHWC 3OHMA 4LIPD 2X9LA 3M5WA 1E92A 1PVDA 1SG9A 2QTZA 2CFTA 1T26A 3A9TA 2RIPA 3O7MA 1EVLA 1GUYA 1XPJA 3DWGA 4KEAA 4L4UA 5LN1A 1JBKA 3VC2A 1Q0LA 5BRJA 4JXZA 1CK4A 1K86A 4URHA 3U5TA 5K3FB 4P4TA 3AC0A 4OKIA 3T12A 1SQSA 2ZBPA 3HM2A 1D2MA 1E96A 4OMDA 1PT7A 4QUJA 4II7A 3L8DA 5DNEA 5LWHA 1JV2B 3CYFA 3BAFA 4BTVA 2EP5A 4FB5A 3UICA 3OICA 4C07A 4OI1A 4I3FA 4WNIA 2N1MA 4BC1A 1NYLA 4WK6A 3D6AA 3L18A 3H8JA 4LCJA 4M87A 4BVAA 3K09A 1PEYA 3C6XA 4FSHA 4G85A 2YV1A 1R16A 1XQ9A 5H59A 1LBEA 4F3RA 5C8DA 4Q00A 4DA0A 1XALA 1Y5MA 3SF0A 3A7EA 4RTQA 3RC3A 2IYTA 1U0BB 1I3NA 1ABEA 1W52X 4YR9A 1BVYF 5JPIA 2C5GA 1YAJA 3RS2A 3U6KA 2ZB4A 2A7XA 2X6RA 4M1KA 4PVDA 4IZOA 4QVIA 1TUIA 2ON6A 3PWKA 3DAGA 2WU8A 4QHTA 2WFLA 1CE8A 4OK6A 4ZPJA 1RYEA 1T4BA 2OOSA 4Y8VA 5HF9A 4GL4A 5HCUA 4WCDA 2VPXA 3RYFB 4ZODA 2ZUDA 4AKSA 5T57A 4BWGA 4W5HA 1A2QA 1N33B 1QTIA 4EPXA 2X9VA 3AXTA 5CX1B 3OOWA 2MIIA 4UQPA 3PHJA 4FYPA 1HUQA 4WEOA 3P97A 1BS2A 4V38A 2ODEA 1YE5A 2ZWMA 1JEQA 3DFUA 4AX8A 1M10A 2AEMA 4GXRA 4DV3B 4KU4A 4RV5A 4GYKA 3AINA 3E5MA 1OU0A 1Y48E 4OQLA 1SKQA 2BFDA 2IHBA 1C30B 5EJIA 3GVIA 5C0OE 1B6RA 4GE0A 4DZZA 1ZZEA 4MRPA 1O6BA 3FGZA 1TMYA 2OBXA 2XUPA 2IW1A 1I4LD 1B41A 4GWLA 1A97A 1E1CA 4D0RA 4ZJPA 1KO4A 3S1AA 3GDWA 2HDHA 4E0BA 3OPYB 3CUVA 4LRWA 3SF8A 1HDXA 1OXVA 2WIDA 4G84A 5FADA 1ENOA 2RHOA 1K7CA 1I51A 3E5RA 1Z7EA 4F46A 1AG9A 4EI9A 2NO0A 4DILA 3IUEA 4F3YA 1USGA 1DX6A 3PF8A 2HRRA 3B20A 1JHXA 5DP2A 4YCNA 4ICIA 3I04M 3G9QA 3E8XA 4HSGA 4I5FA 3CPJB 3FW1A 4D0GA 1E2GA 4Z99A 3HA3A 3L0YA 2CDAA 3AP2A 1AJEA 5E3JA 2FZVA 4C5AA 3WZMA 1HBJA 1K66A 2FEAA 2UUPA 3EFOB 1J2YA 1P6QA 3HNOA 4IOKA 3BMXA 4MVJM 5EAIA 3QEAZ 2PJDA 3H0EA 1ST2A 1UFOA 2DPXA 1FLVA 1CSEE 1WTAA 2CUKA 1WNFA 2CE7A 2EG9A 2XA2A 2FN3A 3BWCA 3OT5A 5DX8A 2RHWA 4DV1B 3FBWA 3S29A 6REQB 1NATA 1OFGA 1GR0A 3W5VA 1QONA 5DM2A 1ZM4A 2W48A 1YZHA 1GQSA 2Q1WA 1A69A 3HR4A 3L7DA 1LY1A 3NU1A 4C4RA 5AW6A 4JA2A 3IXLA 4HNSA 3LHIA 4JFRA 4M76B 2OT3B 4PW0A 2WUGA 1AUVA 2JD0A 4F56A 1BS9A 4FFBB 5C34B 4L08A 4B6SA 1V95A 5A7FA 1XE3A 2VSYA 4FBGA 3ZZUA 3W04A 3DEIA 1OHHA 3NX4A 4OUDB 4U7FA 2WBLC 5JG7A 3C5VA 2FI1A 2DE0X 1DDOA 3QIAA 4RTNA 4YXWD 2JZCA 4HR7A 1GL9B 4BNYA 2YNMD 4YS6A 4I2NA 3WLIA 5LSAA 2GCGA 4YGYA 5BOSB 4JS0A 4DC0A 3K16A 4LXQA 2DSTA 4ZI7B 3LOPA 4LYFA 2F8SA 1F0PA 2YR0A 3MPUA 4A03A 1HI9A 4HB2A 5I9NA 1FPMA 1DELA 2NYAA 3EGEA 3COVA 3TG2A 4UDNA 2B0CA 1KTIA 3ACBA 1X2EA 1WXFA 1W29A 1KSGA 2QL9A 3FYTA 1H2RS 2ZR7A 4KHZA 2GHIA 4B0OA 4OEHA 1V8FA 2VTKA 3QE3A 5TF4A 1RYBA 5JCOC 1JFFA 2F64A 2H52A 3DXYA 3UWKA 2OWDA 1QIHA 2ZE5A 4RD6A 2X7JA 3SK0A 3RHZA 1M6VA 2VJYA 1NVFA 3TPFA 1OGYA 1C81A 2PUTA 5J23A 2CJWA 1WA5A 3PA8A 1OXXK 2L42A 4R0VA 4UHCA 5DFAA 5BPHA 5CA0A 2O6HA 5J5VA 1MO3A 5THKA 2IZZA 4JFAA 1BIFA 5CXSA 2A57A 4LHYA 5EVCA 4NEHB 4F86A 3K2EA 4ZHQB 2I6TA 1YDGA 4MQMA 2WJZB 1E9RA 2HU8A 1EVQA 3PE6A 4OXRA 5HK8A 5LMUB 4K28A 1Y8QB 2GDJA 2FEMA 4H3KB 3EHDA 4J90A 4I4CA 3MNFA 3CLTD 1J99A 2C2OA 1L5MA 2P9YA 2P78A 2IYYA 2HJVA 1DRWA 1TKCA 1VYHA 3IESA 3STUA 3WOVA 1FYFA 4RGBA 3FCXA 1WMAA 1XK7A 4RO0A 3IC5A 2H9AA 2QRKA 3MQ2A 5ANRB 1CXZA 4GW3A 4YI3A 1D2CA 5FNVB 4BHTA 1FXSA 1E7WA 4GX2A 1K0FA 3ZV7A