3C5WP

Complex between pp2a-specific methylesterase pme-1 and pp2a core enzyme
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
296
structure length
294
Chain Sequence
b'RDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHAMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCKPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PP2A A subunit
publication title Structural mechanism of demethylation and inactivation of protein phosphatase 2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 294
sequence length 296
ec nomenclature ec 3.1.1.89: Protein phosphatase methylesterase-1.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c5wP00
4AXBA 4EA6A 1JJBA 1HPLA 3WL8A 4C89A 2PSEA 4YASA 5EI5A 4B6GA 3KD2A 4X7BA 4HXGA 2WU3A 5LZ5A 2HU5A 2J4FA 4UFPA 3WZMA 4MWTA 4X92A 3EQ8A 4AN0A 5C8VA 5FUMA 3DL7A 1Q83A 3PUHA 2ACEA 2WQZA 5C8XA 1D07A 1GPKA 2OCKA 2PM8A 1XZHA 2DCMA 3H2KA 3FBWA 1F6WA 2PU5A 3Q8WA 3G02A 3F96A 1PJAA 1CUSA 5K3FB 1EH5A 3GELA 4G4JA 5KWJA 4J0DA 1UKBA 2ZSIA 1Q0ZA 4ZV9A 3FLBA 2VSQA 5AI8A 1MO2A 3LLCA 4FMPA 4BRZA 4X95A 3PFBA 2OGTA 4K6HA 3VDXA 1JI3A 2PL5A 3C6XA 1DQZA 4K5QA 4QA9A 2ZYSA 3I1YA 3H0CA 2PSJA 3M82A 2JGJA 2B4KA 4WJLA 4QDTA 2HU8A 3QMVA 1PV1A 2B61A 1QOZA 2QUBA 3ILSA 1R9MA 2JIDA 4Y2YA 4BTLA 5JAUA 2Z5GA 3I2HA 4UHCA 3V1MA 3FCXA 4BRSA 1QIFA 5K3AA 5T4HA 1CV2A 4IQ4A 3KSRA 2XUPA 2PUHA 2XQIA 2JGMA 1E8MA 1XZIA 4BB0A 3B12A 1Y7HA 1YS2X 3JYHA 4Y2VA 2H7YA 1EINA 5ALUA 4B84A 4UHHA 3CXUA 4F21A 4EY8A 2AJBA 4G5XA 3IUNA 2Y6VA 1MX9A 1VJ5A 1CUZA 2JGIA 3D3NA 5LZ9A 3C6YA 5BWBA 4FBLA 1GQRA 3R3XA 2H9YA 3G9UA 1SFRA 3PICA 1FSSA 2WJ4A 4L3WA 3NGMA 4X3CA 4IO0A 5I8PA 4FWBA 3C87A 3I2FA 2Y6UA 2BGRA 3D7RA 5AIBA 1W75A 5AKLA 2VF2A 1YAHA 2WHRA 4X97A 1WHTA 2XB6A 3D2AA 2VAVA 3S2ZA 4AO7A 3O4HA 1CEXA 5A62A 3L1IA 4KJXA 4MQLA 4J3JA 1T2NA 4PO3X 4X93A 3WYNA 5A7FA 2WUGA 1SCQA 1USWA 2CZQA 5LYYA 1BCRA 3LIIA 2X8BA 1NU6A 3ICWA 4GXNA 1QIJA 3SWWA 2FUKA 2O2IA 1A8UA 2Z8XA 4HS9A 2ORYA 5FXMA 3H2GA 1AURA 2X76A 1JFRA 3FYUB 2CKMA 4BBZA 3G0GA 5ALPA 4P93A 1XZMA 1EDEA 5HFAA 2OLEA 3DD5A 3VKFA 1EK1A 1K4YA 1R9NA 4C01A 1L7QA 4DLNA 1UK7A 2OGZA 4KRYA 2IIVA 1GQSA 2JGKA 5K3CA 5AI9A 1EVQA 1XRRA 1MU0A 2BCEA 1VKHA 4HXEB 4TGLA 4C87A 2O2HA 2DQYA 3G0CA 4U2FA 4KEAA 4F5ZA 1EX9A 3PFCA 5A71A 2OG1A 5CMLA 3VVLA 5AKKA 3G9TA 5C7YA 4OB8A 4Y2SA 2WHQA 5KREA 2QKYA 4BDSA 3EQ9A 5AM5A 5F4ZA 2OQIA 1UOPA 2EDAA 4B80A 3ANSA 2G5PA 4MXDA 5HF9A 1AX9A 5DWDA 1H2YA 3H2IA 2WFMA 2RONA 5JAOA 3W2TA 4AO6A 2XMGA 5T4FA 2GYUA 4J03A 4UBKA 2RHTA 3IULA 2YXPX 2PPLA 2VT6A 1R4ZA 2WIJA 2XE4A 3C8DA 2QRUA 1MT3A 3R3VA 4CG2A 2AJCA 4BC1A 3V1LA 4H7DA 3PUIA 2H7XA 2GBCA 3KDAA 4QDZA 4UBJA 2WTMA 5SYNA 1AC5A 1YB7A 3WQHA 2B9VA 2V96A 4Y2XA 4PW0A 5FV4A 4EY6A 1E89A 2ZYHA 4QLAA 2HADA 2RAUA 4Q82A 3FVTA 4K2AA 4QE3A 3BIWA 1QO7A 2XUAA 1EB8A 2I03A 5AKGA 3MUOA 3G9XA 4I3FA 5HQ3B 3KWJA 1YR2A 5CH8A 4N8SA 4QDOA 4BCCA 4GLBA 4ZV7A 5DYYA 2VJBA 3I28A 1UK9A 3I2GA 4MEAA 2WG1A 4INZA 4Q1VA 5C8ZA 3NUZA 4X6UA 2Z3ZA 4BAUA 3HSSA 4U2CA 3F97A 1U8EA 4BCDA 2ECFA 4WY8A 1LPMA 4W1QA 1QE3A 3RKSA 3BJMA 5CT6A 1CUFA 3IIIA 4DIUA 3ICVA 4RE6A 3H18A 2Z3WA 3O4GA 4CIAA 3QPAA 4Q3OA 2PSFA 2XUJA 1VE7A 5AKYA 4FLEA 1DWQA 3FOBA 1A7UA 4BVJA 1LBSA 3HACA 2BUAA 2OGSA 2DHEA 1HKHA 1TIBA 4LXIA 4QNNA 1CQWA 2HA2A 4X71A 3RLIA 1YASA 2D0DA 4LIPD 1EDDA 1MTZA 1MX5A 3E1GA 4ROTA 4TVKA 2WIGA 4NVRA 5HF6A 1UK6A 3WK9A 2C4HA 4X91A 2J4CA 1C7IA 2XMCA 5AO9A 2HA4A 1Q0RA 1CUGA 4Q3KA 3QPCA 1A8SA 3MGAA 1MPXA 1AQLA 3BJRA 5JZBA 1ZIYA 1DT3A 4HAIA 3V1KA 1WB5A 2PSDA 4G8CA 3BE8A 3W9UA 3M3DA 4J0IA 4H7FA 3DCNA 3GFFA 4XX1A 3ZV7A 4F60A 3R3ZA 3SK0A 4ETWA 5ALXA 1THGA 2VQ6A 1G5FA 2HFKA 2XQJA 2ES4A 4KE6A 2AXEA 3CN7A 1QTRA 4G4GA 4E14A 1CUBA 4UHFA 5E4YA 4UHBA 4EY7A 5EHZA 1UT6A 3LP5A 1Q84A 3W04A 4I19A 2ACKA 2Z8ZA 3O9MA 5JAPA 5A7HA 2QJWA 3QITA 3I6ZA 1W1IA 4BVKA 3QM1A 3FSGA 1QIIA 4AMZA 4PV7A 4E15A 5EFZA 1XRQA 4PQEA 1U4NA 1DINA 3NOXA 3O4IA 1EXWA 4OPMA 1LLFA 3WIBA 2K2QB 1KEZA 1BRTA 2VAXA 4C6HA 1U65A 3ZWQA 4BZZA 3LIPA 1WCYA 2V98A 1QONA 1MJ5A 2BAGA 4LKOA 3FNBA 5JARA 4HTAA 1A88A 4OU4A 1MNAA 1H22A 1P0MA 1UFOA 3AINA 3BIXA 1LZLA 2QMQA 2YYSA 3M81A 5AKXA 4N5HX 3WKBA 1EVEA 1QJ4A 5ALRA 5AICA 1K8QA 5AOCA 5D3KA 5I9IA 5D3ZA 7YASA 4PSUA 2HU7A 4G8DA 4X90A 2XUGA 3C5VA 3QZUA 4Y2QA 3I2KA 4DSZA 1MAHA 3TRDA 1ODTC 4GBGA 1N5RA 5LZ2A 2OQVA 1JU3A 4FFVA 4NZZA 5JATA 5ALOA 2WUEA 3DYIA 3EBLA 2VATA 4Y2JA 4FFWA 1O6GA 2QM0A 1ISPA 1IUPA 1ZICA 1DTEA 3Q0TA 2PX6A 1BN7A 3F98A 1UXOA 3C6ZA 3W9BA 3WLAA 1XQXA 3LCRA 2WIFA 3CCBA 2WUFA 3FVRA 1K6EA 4CG1A 5AM0A 1LNSA 1WPRA 5CH3A 2QUAA 4AB1A 4GI1A 1LPOA 3QPDA 3AIKA 4MQMA 5IKXA 5A7GA 4DNOA 1J1IA 2JEYA 3EF3A 2NW6A 1XFDA 1IUNA 4B9AA 3MUNA 3PI6A 4WFIA 2P8SA 2RGUA 3CCCA 4UBNA 5J3JA 1ORVA 1HL7A 4CIBA 2WG0A 3B3QA 4M0MA 4KE8A 4MYDA 1WB6A 4GEGA 4FKBA 2XQGA 5K3DA 2OPHA 5DLPA 2HA3A 2HHAA 4U2BA 4EY4A 2XT0A 5IH7A 5AI0A 1O6FA 3R0VA 2HIHA 1ACJA 3IB3A 3DEAA 1XZEA 1LPBB 3WWDA 4B83A 1W76A 4ARAA 4BYMA 4PSCA 2XLBA 2WJ3A 4OYLA 3I6YA 1TRHA 2QOEA 2FX5A 4EB0A 2FJPA 5FLKA 4AMYA 1QIHA 5CXUA 4DSAA 1BS9A 3VXKA 4UBOA 3OPMA 5ALHA 4DMKA 1VZ3A 2FJ0A 1UOOA 4J0KA 1XZCA 1Y7IA 1NU8A 3AZQA 1W52X 1XZBA 3DDUA 1JT2A 3MVEA 4BATA 2XMBA 5IVKA 4KR0A 1ZI9A 2CJPA 2ONCA 1BU8A 4AO8A 3RM3A 1SC9A 1N1MA 1JJIA 2XUHA 5JZSA 3O95A 1GZ7A 3X3HA 4H7IA 4XWGA 4OB6A 4WDQA 5H3HA 3C70A 4B9EA 1E8NA 1Y37A 4B0OA 3K6KA 5CT5A 4UUQA 3DOIA 4XVCA 4EY5A 4X00A 2Y2UA 1XROA 4FDMA 4K6KA 5ALSA 4UPDA 3V9AA 4ARBA 4L0CA 1QIGA 4C88A 2BUBA 5AKIA 5ALEA 3QMMA 2WHPB 4B85A 4U2EA 5LKAA 1VLQA 5HK8A 4G4IA 3HJUA 1ZJ5A 3WK6A 4QWMA 4E46A 5EIEA 3O0DA 4Z49A 1JJFA 3U1TA 1KU0A 1X2EA 4ZREA 2CUTA 1XKTA 4W1PA 5CW2A 4M0EA 3P2MA 4P08A 3E4DA 4ZWNA 5HFNA 3HRHA 4ITVA 3R3WA 5ALGA 4WY5A 3DLTA 3WA7A 2HA7A 1L7RA 3DNMA 2VT7A 1SCIA 2E3JA 3DS8A 1EA5A 4DNPA 1ZGBA 4YK7A 1DX6A 5ALTA 1ETHA 4ZGBA 4J7AA 2BKLA 4DMFA 3A2NA 4J0GA 1H2ZA 2UZ0A 1UWCA 1XRPA 2GBFA 5KWIA 1VOTA 2QVBA 1G4HA 2HRQA 1F8UA 4I4CA 5YASA 2JGEA 3AZOA 1YB6A 5HZGA 2VJAA 4XJVA 2QXUA 1WB4A 4G1FA 2WFLB 3O4JA 3WK8A 1U2EA 3I2JA 2W22A 1E3QA 3STTA 3HC7A 2VTVA 2XLCA 2ZJFA 3OC0A 3H19A 2R11A 3D5EA 3F67A 3HYSA 4CCYA 1CUYA 2BJHA 3BF8A 1BROA 1CIJA 1ZD5A 4GW3A 5CH5A 3W06A 1XZJA 5HF8A 5T4EA 5FDFA 3AIMA 5AM2A 4P9NA 1J07A 3WJ2A 5EGNA 3A70A 5AM4A 2XDWA 1ZI8A 3I6MA 4AZ0A 3WL6A 2OAEA 4BE9A 3FSGD 4G9EA 4BCBA 5DNWA 3AUKA 4W1SA 1CQZA 1R3DA 1QFSA 3LS2A 1AMNA 1XKLA 3OURA 3HLKA 2HL6A 3K2IA 4OSEA 1CUDA 5EHXA 2O7RA 5T4BA 4CI9A 4G9GA 1GGVA 3AJAA 1CUEA 5AK5A 4ZRDA 5BV7A 5ALZA 5CTAA 1QIDA 5AKHA 1XLWA 3L1JA 3RARA 2VJDA 2Q0XA 1XQWA 1EI9A 2YASA 2WHPA 1XZFA 4HZGA 1C7JA 4BDTA 5AK3A 3VJLA 1E66A 3WWOA 2WG2A 4KYVA 3H17A 2C7BA 4GHWA 2XMZA 1UOQA 4Q34A 3STXA 5JD5A 1IZ8A 5EHNA 3PF8A 1EHYA 4C4XA 2XMDA 2XQKA 1CFJA 3A6ZA 5AP9A 3FCYA 2G63A 1UK8A 4N8EA 2O2GA 4BC0A 2ZJ6A 1J06A 3T4UA 3L1HA 2V97A 1M33A 1YA4A 3BDVA 1OXMA 1XZAA 3DYVA 3D59A 3ESCA 5ALNA 3N0TA 1THTA 3DKRA 1IUOA 4BAZA 4F0JA 1CLEA 2C5FA 1UZAA 1KU6A 3PE6A 5LZ7A 4G8BA 3H1AA 5E4TA 3AZPA 2HFJA 5JALA 3ESBA 5HK9A 1JKMA 3R3UA 4BAGA 1ORWA 1CUHA 4QLOA 3ED1A 3C43A 1AUOA 1LPAB 5AOBA 3WYDA 4S0XA 5ALFA 2XUDA 4RE5A 4LYEA 3ZPXA 5EHQA 2WU4A 1WM1A 4H35A 3ESDA 2BGNA 3BWXA 1ZJ4A 4B0PA 1RYYA 2WFLA 4KAAA 2OAGA 1X2BA 3C6BA 4OYYA 1K5PA 3WKEA 1IVYA 4IH1A 2IITA 1CUAA 3DOHA 3DKKA 2JEZA 3WIOA 2VA9A 3IDAA 2YH2A 5FP0A 4UFNA 4PNZA 3D4LA 4WFJA 5AKEA 3G7NA 2PSHA 1LPPA 3D2CA 5BOVA 5AHXA 3QVMA 3QH4A 1RP1A 3KXPA 4FNMA 4U2DA 2J3DA 1IZ7A 3IBTA 2Y1KA 1HDEA 3QYJA 5FPPA 2XUFA 2LIPA 4FNGA 2PKYX 4OU5A 4BZWA 1CPYA 4KAJA 5E4JA 4WCVA 1XRLA 4MYSA 4U2GA 3GZJA 1W6RA 3WKCA 3C8HA 4H7EA 5LZ8A 3WMRA 5CT4A 4CG3A 3YASA 4JEIA 5ISMA 1BEEA 3ZI7A 4HXFB 2JGLA 3KWFA 4IH9A 4IH4A 2WIKA 5E2IA 1NX9A 5FKJA 2GZSA 4UBMA 1MAAA 1DWOA 3WK5A 1GPLA 3V1NA 1BE0A 3STYA 4AN1A 4EZIA 3R41A 5C81A 1A8QA 2ZYIA 1WHSA 1CVLA 1CUVA 2BFNA 4KACA 4FHZA 2XMSA 5JD4A 3G8YA 1OILA 5AI4A 4Y7DA 2GZRA 3AIOA 2WILA 4MEBA 4KAFA 3OM8A 4E11A 2PUJA 1S8OA 2WIDA 3NWOA 4QWWA 4DGQA 5DTJA 5AM3A 1JU4A 1XRNA 5ALVA 4DTCA 2OCIA 5ALIA 1DT5A 4DNFA 4IHAA 1R88A 5AM1A 1HQDA 3H2HA 5DJ5A 2CB9A 3A2LA 4Y9SA 4BE4A 1XQYA 2ZYRA 5CBKA 5K3BA 3G0IA 4B82A 4GWLA 5AOAA 4W9RA 1QZ3A 2AJ8A 4OCZA 3UUEA 4CFSA 3PDCA 5IVDA 4FOLA 4V2IA 4O08A 1CR6A 3O9VA 5D6OA 2JF0A 5DYWA 2JBWA 4H7KA 1XLUA 3R40A 4HRXA 1F0PA 3EQ7A 1QTIA 2WFZA 3WK4A 4H7JA 3EIOA 2I3DA 2PVSA 4Y2PA 1K63A 3STWA 1XZKA 4N8DA 4P92A 1YS1X 4J0CA 2XUIA 1CUWA 1BCSA 4JYPA 1MNQA 1TKRA 5HCUA 1TQHA 2XUKA 4CCWA 3T52A 2GBGA 4KRXA 5CURA 5IVHA 5I7UA 1DU4A 1OCEA 2C0QA 2RIPA 5IVIA 4DM7A 4RPCA 2W6CX 3VISA 4H0CA 2DSNA 3G0DA 4NMWA 2QS9A 1ZIXA 5JYCA 4BP8A 4M0FA 4J0HA 1VA5A 3CN9A 3ZLTA 4CCYB 1CUXA 2WKWA 1WPXA 3STUA 3VVMA 5DNVA 5JZ9A 2OXEA 3IA2A 1ZD2P 4QDXA 4Y2UA 2XUOA 3GA7A 2HRRA 1CUCA 3UMJA 3JWEA 5JASA 1W4LA 2ZJ7A 1G66A 2BUCA 1DQYA 3FYTA 1JMYA 1H2WA 3DL4A 5FPQA 5HF5A 2GBIA 2RI6A 5ALJA 3AILA 4A16A 5JANA 4FTWA 2R8BA 4JYMA 2HA0A 2XMQA 3C45A 3ESAA 1XZGA 1ODCA 5KBYA 4Q05A 1XRMA 1H23A 3WA6A 5ALWA 5CT9A 4YX9A 4K6GA 2O7VA 4X6XA 5JADA 5AIAA 3UUFA 4PSDA 4N5IX 2EDCA 4HVTA 5ESRA 1EK2A 4AQDA 5ALQA 4A5SA 5LZ4A 4UHDA 4Y2TA 5K3FA 1FFDA 4X85A 4KE7A 2WLSA 5ALKA 1LGYA 4UHEA 1YAJA 4BP9A 2C5GA 1B41A 3BXPA 2G4LA 2ZSHA 3GBSA 4ZXFA 3KOOA 3QBJA 2WJ6A 4JNCA 4LYDA 4X6YA 1GT6A 2DQZA 3BDIA 2WTNA 3FAKA 2ZVDA 2DR0A 1CUUA 5LKRA 1ACLA 5AJHA 1AKNA 1I6WA 2DHCA 4ZI5A 1ZD3A 3I1IA 3WI7A 1TCBA 3SX4A 1P0IA 2QR5A 1PFQA 3SC2A 3WJ1A 3OTQA 5CT8A 3K9BA 5ALMA 4LXGA 1T4MA 4YPVA 3FYUC 2QT9A 3HEAA 3ZLVA 4LHEA 2WUDA 3HI4A 4W63A 1X70A 4OD0A 5ALDA 5AI6A 2VJCA 4H7HA 1E8DA 1WOMA 3D2BA 1AZWA 3PF9A 1FJ2A 2HDWA 3IUMA 5AK6A 1E5TA 2PBLA 1HLGA 2PU7A 3WL7A 3WL5A 2HA6A 4EBBA 5HKBA 2V9ZA 1P0PA 3H04A 4GECA 5DYTA 4PF1A 5FOQA 4DMHA 2H7CA 4XIIA 2RHWA 1BN6A 1FFAA 1QIEA 4J0JA 3TGLA 4QDUA 5AI5A 1VXOA 1B6GA 1XZLA 1FFCA 1J2EA 3U0VA 4JUIA 2OCGA 4GDMA 5D7BA 3GROA 1XLVA 4OB7A 3N2ZB 4AZ3A 2J3QA 1FFBA 1C4XA 3BF7A 1HBJA 3WWEA 1QIKA 1G42A 1TAHA 5LLSA 4EUSA 4EHBA 4H77A 1RWQA 3ZLUA 2WSLA 4B7ZA 1UKAA 4Y2RA 3HXKA 5CRIA 1GPNA 5A2GA 5JD6A 5JAHA 1VE6A 5LP1A 1DWPA 4HRYA 5SYMA 4BVLA 1EB9A 1UKCA 3H2JA 2AJLI 5A6VA 5ALYA 5BWCA 2CBGA 5HKAA 3STVA 4MJ3A 3WZLA 1QIMA 2DFPA 4A23A 3F9CA 3IVMA 2C0PA 3IUQA 3VJMA 3HABA 5JIBA 3VJKA 3DQZA 3W05A 4DNQA 1YA8A 3WWPA 3FYUA 4RGYA 3E3AA 3QMWA 1QFMA 5AH0A 3F8SA 1L7AA 3WWCA 1P0QA 2WM2A 1AGYA 1DX4A 4C4ZA 3A2MA 1GKLA 1CRLA 3WK7A 1CUIA 2XUQA 3V48A 1EDBA 2QTBA 3BL8A 2XQFA 3G9ZA 1R1DA 3R3YA 4WFKA 1N8SA 5DTIA 2JGFA 5AKZA 5AKJA 2I78A 1TK3A 1F0NA 3G0BA 3WKAA 2CMFA 3RK4A 1LPSA 1VXRA 3M83A 1SOMA 3OG9A 1QO9A 4DYHA 3S8YA 2XMRA 2Y2VA 1R50A 3TJMA 5K5EA 3AFIA 2I3ZA 3FWHA 3HZOA 2H1IA 4WDRA 4L9AA 2C58A 5EIAA 1MX1A 1VZ2A 6YASA 3DJYA 4JH0A 2HA5A 2GYVA 1LPNA 5CXXA 4DMCA 5AK4A 1YCDA 2B20A 1JMKC 2QJRA 4FLFA 4RNCA 4FBMA 4LXHA 1FFEA 5FRDA 4C4YA 4D9JA 2VEOA 5LIPA 1QLWA 4Q3LA 4L72A 5DNUA 1H2XA 4FLMA 1TCAA 2QXTA 2QZPA 4NS4A 1MN6A 2HM7A 1LBTA 3FLAA 2ROQA 1GXSA 4TPKA 2X5XA 3OOSA 3I2IA 1YSCA 2DHDA 3JW8A 2IX9A 1ZD4A 4KE9A 3H1BA 1TCCA 4BTVA 4UBIA 2AJDA 4MWSA 4QEKA 2CEKA 3IURA 1ZOIA 2OCLA 1QGED 1VA4A 3C5WP 3ANTA 4B81A 1XQVA 3FLEA 1ZGCA 1IMJA 4QZVA 4X94A 4W1RA 4H18A 3E0XA 3GUUA 1SCKA 5EIHA 2GYWA 1GKKA 1CUJA 4UBLA 5K3EA 2G5TA 5ALLA 4AX4A 1LZKA 5HQ3A 1XZDA 2XI4A 2D5LA 3WKDA 1BEZA 3TEJA 3D0KA 3IUJA 4UFOA 2EEPA 1ODSA 1Z68A 1N5MA 3B5EA 1ZI6A 4OUKX
chains in the Genus database with same CATH superfamily
1HDXA 2Q2OA 3GB9A 1NBHA 4AXBA 1KIMA 3DTYA 4MAAA 4QXPA 5HIIA 1JJBA 3AR2A 4OJTA 2JL1A 4LG1A 1R0KA 2R1TB 3KUXA 3LWDA 3WL8A 3WGUA 2CK3A 3I52A 3INGA 1PKEA 3NTOA 5IZCC 1IN6A 4O2RA 3ZCPA 4N0MA 1CZLA 1LRKA 5GM1A 4MQ5A 4KZKA 2CC2A 1SU6A 3CSSA 2BI4A 3RJ5A 3KCNA 4IYRA 5M34A 1WSWA 5LZ5A 5J2UB 1ZVKA 1TRKA 2F17A 2XODA 4LGYA 3C3JA 4UFPA 1QHYA 1YU6A 2QRLA 1U2DA 2VK2A 4MWTA 4LZNA 4N6NA 4JT8A 4E1AA 2LKCA 2DFTA 2PAFA 2Q1UA 2IYQA 2XYVA 5CHYA 4E32A 4P80A 3LK7A 5FUMA 2MT9A 1DHTA 2FN8A 2NYRA 2V5VA 3M4YA 1O95A 3PJEA 3PUHA 5DHSA 4JL6A 5KQSA 2ACEA 4FYPA 4XQ0A 2NSHA 2VP9A 4RXUA 2I80A 3RIHA 4YJDA 2JGAA 3PQ2A 1IATA 1GSHA 2IIQA 4O0LA 2JEOA 4B4DA 1SHTX 1C4WA 2FEOA 4DR2B 1WCIB 3NHZA 1DRKA 1PQ4A 5I8ZA 2OCKA 2QAGA 4YY3B 3QXSA 2XAAA 4NRDA 1XF1A 2VHYA 3P27A 3ZIAA 4Y0AA 1XYVA 2DCMA 4TWRA 1K8YB 3WGTA 3J81A 1F6WA 1XVTA 3SS9X 1VSUA 4CN9A 2I5PO 2PU5A 4PRLA 1OKKA 3COSA 3CJRA 2GZ1A 1CUSA 5JLJA 1IAQA 1CRZA 4XVUA 4C4AA 3DC7A 1YGYA 3IP5A 4K7JA 2FPPA 4G4JA 3B3JA 2ADOA 1JFTA 3EIHA 4KQHA 3FLBA 1F8YA 3RHSA 1NXPA 4P3KA 2VSQA 1OTXA 3CBQA 2Y1GA 4OG2A 4ROSA 1ZMRA 2CBXA 3FCCA 1T6XA 2OSBA 1YR7A 4UHKA 5EN4A 4DQVA 5K9ZA 5MF6A 4A2CA 5EJFA 2QRNA 3GPCA 5FNVF 4JOSA 1UT8A 1LDMA 3MYRA 4UNPA 3L7IA 4P4UA 4WNCA 1NVKA 1QP4A 1R9JA 4PPQA 4NE2A 3CW8X 9ATCA 1GDTA 5GGYA 2I7DA 3JQ8B 4NQZA 2OGTA 4K6HA 1MUUA 3C2QA 4TYQA 1A9ZA 1TEZA 4ARIA 1MENA 3AR8A 4Z0TA 3SBOA 2ZYSA 1W8DA 3RJZA 3GRZA 3JQFA 3INYA 3KZVA 5FH9A 1K8ZB 1V5WA 1OT3A 1CFZA 1OROA 4FIDA 4E22A 2B4KA 1RC1A 4QDTA 5PNTA 4DA8A 3OZDA 5HHTA 1FQOA 1PV1A 1SN7A 3AL2A 3I32A 2D74A 4QEZA 5E1OA 3RIEA 4BASA 1F14A 4UAUA 1QX3A 1WTCA 3A9RA 3K7EA 1ZCZA 5AR1A 1U9CA 1T1JA 1WG8A 1VFPA 2R8EA 5BN1A 2ABWA 3FYCA 3T3MB 4C6TB 2QUBA 2I4NA 4Y2YA 4I5FA 3FUUA 1Z2EA 5JAUA 4UOQA 4JOBA 3F78A 4Q3DA 4NBSA 1E0DA 1AIPA 2XB9A 3GH3A 3QA3E 5D01A 5DU2A 5DSZA 3S2GA 4I1IA 3WGNA 3IO5A 4CF4A 5J59A 1QIFA 4XFJA 1HDIA 3WRWA 3IMCA 4RTLA 2PNFA 2VSNA 3OE7D 3PK0A 2C83A 4I55A 5T4HA 1NRWA 2HHLA 1NW4A 4YMWA 4RENA 4B8WA 4R83A 1NMYA 4URHA 3R0ZA 3BT7A 3LLUA 2XOKA 4ER7A 1XZIA 2B1QA 3FYSA 3A6PC 3GGGA 4BB0A 2P0AA 2JC3A 4Z0HO 3WSWA 4B4VA 1WBJB 3JYHA 1K3UB 2PUAA 2H7YA 4IX1A 3WJ7A 4DR7B 3AUYA 3F0TA 4DGSA 2ZM5A 4K05A 4ZRMA 2FW1A 4KREA 1TJPB 1I2ZA 4R2XA 1C0IA 3H83A 1RHQA 5FLEX 3IUNA 3FZYA 3AL0C 1VJ5A 1Z3CA 3TQQA 4IUYA 3NDRA 2BTEA 1CUZA 1JN0A 3NFRA 4E51A 3OP4A 3D3NA 4CODB 1Q3KA 2QD2A 2NV6A 2ZREA 3AF5A 1J2TA 1K4MA 2BBTA 3C6YA 3K8ZA 3KZMA 3N74A 4HX2A 1W29A 3BEOA 4HOYA 3HO8A 5EXSA 5JVDF 3O93A 1Z0ZA 1EJBA 1WUKS 2JD1A 3ACCA 3PVZA 2H2HA 2WMDA 1SA0B 2YWDA 2MSNA 1GQQA 2X7JA 3H9JA 4F3YA 3R9WA 3RC1A 3FGOA 5C7IO 5FI1B 5FB3A 2HMTA 3ZVKA 1C9KA 1I30A 2JAXA 4BV2A 1DCKA 1V5EA 1RWOA 2QZSA 1XKQA 1EP2B 1DAIA 1XTUA 3R8CA 4KO2S 4EW6A 2RGXA 3SZUA 2W2QA 4D0RA 5I7OA 2BGRA 2PLRA 3NHYA 3DP9A 1FJGB 1H4SA 3SE7A 4HGOA 5IASA 1MOPA 1X7YA 1GTZA 3KTAB 2B8NA 1NMXA 3C98A 3R6GA 2DR3A 3TLXA 3ZQ6A 5I4IA 5REQA 5IFLA 4I8XA 3K1AB 3PEWA 1W75A 5BQ3A 4BO3A 3NR2A 3I58A 3VKHA 2FSHA 5C1IA 1JJVA 2A94A 5LR6A 4MRNA 2YXEA 1V7CA 3WLLA 1E2QA 1YAHA 3UJ8A 1Z4JA 4Z2YA 4CEJB 3EEIA 3DM9B 4U4AA 1V1RB 2VWPA 2IVFA 3D2AA 1L5ZA 2UYYA 3KV1A 1V6AA 1N2ZA 1YZVA 4H7PA 3AEKA 3STHA 1ZSYA 5TVGA 4D80A 1SVSA 3W2EA 1ENYA 3OPYI 3RVMA 3ZH9B 1F2VA 4LYJA 1GGKA 4WKOA 3LGXA 4KJXA 4TTJA 4KN8A 1RI4A 2ENWA 3CVUA 5EYPA 1ZVJA 3RRYA 1EXNA 2I54A 3FI9A 3JPYA 2V6GA 4MINA 3I5XA 3NAMA 1T2NA 2BCJQ 2VNJA 2C2MA 3DG9A 4YP0A 3WYNA 5K8IA 5A7FA 4DV6B 1C1XA 2WUGA 5FBWB 4DCTA 1S1MA 1CDZA 2LRHA 2QK4A 3AHGA 4MKIA 5LYYA 1G8YA 5CK4A 2GBPA 4Z1MA 2X8BA 1DI0A 1E9DA 2FZWA 3B1KA 1N1DA 4KFUA 4EABA 4CLOA 1Q95A 2JD0A 3LBAA 3CB2A 4GM1A 3UTDA 3O2SB 1RWPA 4ZOLF 4YTEA 4G5OA 1DAGA 3FW1A 5KNLA 1ULZA 5DNYB 4NLLA 2ZBFA 4LJ8A 2FRDA 4LSMA 3SC6A 2REQA 3TIXB 3AHCA 2Z8XA 3ZU4A 4LPSA 1ORDA 3ZD9A 2ORYA 2RFLA 3IPXA 3N58A 1TT5B 3QSYA 3SZMA 4D45A 3ROPA 2PUCA 1CC1S 3GR6A 1SU7A 2X76A 5MFPA 1ZRNA 3ZE0B 2G5GX 4M49A 2ECQA 2IEIA 1FK8A 1UM9B 2Z9DA 3ENVA 5EP3A 3U48A 3KLBA 5ARBA 1K6IA 2FZLA 1C9JA 1I7PA 4BBZA 3JV7A 3BREA 2IHNA 4JX8A 2P9YA 3L2OB 3AFGA 1JIJA 3HSKA 1EFRA 1D1PA 1VTKA 4P82A 3UV6A 4AF6A 1IVSA 1C3XA 2HQRA 4CF5A 1Y9ZA 2YVUA 2AIRA 2H2AA 4X5OA 3QV1A 2OLEA 3VKFA 3VYTB 3MT8A 1C7QA 4X20A 4A92A 2XTNA 4MMZB 1M1YA 4HP8A 4OFBA 3PR3A 3VZDA 1A5ZA 5K8JB 1COZA 4QXMA 4HEHA 4EPXA 1KYXA 1ZC3A 4JROA 2GZAA 2KLHA 5B3AA 4CM8A 3LVBA 4KJZA 1ECPA 1RM0A 4YHBA 3UAWA 3R8FA 3UBTA 4WXYB 3EVNA 3ON5A 1H65A 2IIVA 4H15A 2JGKA 5IT4A 2B4RO 2HMYB 2HNKA 2WBLC 3IVGA 1XRRA 3OSZA 5JQGA 3F73A 1WV1A 5F1YA 3KJNA 1JLMA 2BCEA 2BP7B 2ZPAA 4UVIA 4R0NA 4ZOBA 3GFPA 2RHDA 2ZBUA 4RIFA 4HXEB 1XAIA 3OMLA 2DQYA 1W4BA 1T5TA 3GA5A 1RKVA 2YY5A 2GN9A 1CVIA 1XTBA 1SOWA 3WBFA 3WWZA 3URMA 4A03A 2I6FA 1EX9A 2JIZA 2QZ4A 3NC0C 3R77A 3D4OA 3PKZA 3ZLJA 5HQTA 2FMIA 2TMYA 3NIFB 4FUQA 2WAAA 3IKVA 4OVKA 1IQUA 5AKKA 1NF3A 2IY7A 1CP3A 2AQKA 1Y1SA 2H48A 5C7YA 1X14A 3H5OA 1USGA 3O75A 4OB8A 1CY6A 3EG9A 1T26A 1JDJA 4BMDA 4MR8B 3UCEA 4R2LA 2YIJA 2QKYA 3LXUX 3MTAA 2QN1A 4DDVA 1N6LA 1G5HA 3EMDA 1JEYA 1TA4A 3NHKA 3ME5A 4XYEA 1MB2A 1PR0A 2NXWA 2IFTA 1AN0A 2C88A 4UCXA 1D2NA 1GQFA 3H6KA 3L18A 4L78A 4DKXA 3T3PB 1XB2A 2OQIA 1ZFNA 2O6LA 4Y0NA 3OCYA 4L95C 1L0BA 2RH4A 5DPMA 2FV8A 1QK5A 2EDAA 3ANSA 4OQDA 4HDCA 1M1NA 4Z8XA 3NHRA 3QOFA 3QU9A 4GH5A 4GR9A 5EPEA 4YCNA 1OW3B 3IRUA 3DMPA 3UFBA 1SHLA 1IY0A 2D3WA 5M3BA 2NT4A 2WFMA 2RONA 4HMQA 3W2TA 4AO6A 2XMGA 4N7BA 1QYVA 6ABPA 1C30B 1NLMA 1UMBB 2C9DA 3E3OA 1OH8A 4W6QA 2ZP1A 2IE0A 2Q3HA 5A9SA 4KC0A 2IXTA 1TIKA 3IULA 3L92A 1GADO 4I9GA 1U7OA 3CVJA 3OCXA 4RIIA 4CJXA 3D6HA 2PPLA 4HDSA 3FWPA 2DTEA 2VT6A 1YFLA 1R4ZA 2WIJA 2HXYA 3L93A 3TTWA 1CQJB 1TJYA 2P2NA 1KMNA 2A9FA 3FBTA 3IAXA 1LJUA 1U3UA 2GEVA 3RVJA 3Q2OA 1KAQA 1K9VF 2ZVPX 3NASA 4FEGA 1BDIA 1NG1A 3UGQA 3ND9A 1HV8A 1II8A 4BC1A 4CU5A 4QLBA 3FWNA 4RDXA 5HM6A 3HXOA 1OR8A 3V1LA 2VDWB 3EGVA 2QQ5A 1MR3F 1O94A 1UMCB 3OFKA 4LXQA 4GKVA 4MKFA 1T8SA 1S6YA 5TQ2A 2ODPA 1LDNA 2ZRHA 4YJGA 4AY2A 2GKOA 3I9OA 1OV4A 2AN1A 2SNIE 3E9CA 4YDRA 4YMUA 1WMEA 2GD0A 2AFHE 2R85A 2OK7A 4W5TA 4G1MB 1L9XA 2G82A 4FWIB 4B79A 5FL7D 1JI0A 2VQFB 5HMLA 3GRRA 5IXSA 3ZDXB 3FPJA 1CDEA 3ETDA 3GO4A 3PDIB 1QOQB 3AY0A 4IDAA 3KTOA 4JJ7A 4PO8A 3SZGA 5AW6A 4UARA 5HP4A 1N33B 1D6NA 1NFRA 2WTMA 3WQHA 4U9IS 5B7PA 2B9VA 1W5TA 2IYWA 4PC6A 4HPXB 4LDJA 4HAZA 5IEBA 1GG2A 1H9CA 5KYYA 5EWMB 4PW0A 2OBXA 2EG9A 5DE3A 4C05A 3WQSB 3I61A 1TQDA 3GT3A 2Y0BA 4DLXA 2RAUA 2I55A 1Z25A 1E1RA 1NXXA 3L7AA 2GVZC 4QE3A 3BIWA 4LC9A 3NHPA 5FBQB 1R0BA 2QD3A 2PGNA 1T13A 2PMWB 3OO1A 4HI0E 1XRSB 2AD5A 4TRMA 5AKGA 2GBLC 2QQ0A 3G9XA 5HFJA 2OG2A 3AQ4A 2H63A 1XVUA 4AS1A 4EH1A 3CUYA 5CPBA 3ISTA 4YRJA 2F4VB 1G20A 3K2BA 4GLBA 5FNZA 2G36A 5TEVA 3QJ5A 2RGNA 5DYYA 3PPYA 4OXYA 1AXRA 1JVBA 3GNSA 3T7DA 4V0KA 4WI1A 1ZNZA 2IZ6A 2WF8A 3BFJA 3BBPA 4MEAA 1U11A 1YR1A 5C8ZA 4DMGA 2CUKA 1KQOA 4KPYA 4XRRA 3MELA 2HLDA 4R1PA 3KVRA 4MOWA 1L5RA 5HR5A 2O0MA 1K7CA 1R6DA 1U8EA 1N75A 3DV9A 3F97A 4G0NA 4CQLA 2VFAA 1BHO1 3DM5A 4BCDA 1QH0A 1BXGA 1QKIA 4K3UA 5HUHA 1T9CA 1AGNA 1N1GA 2EIHA 3NBYC 3N2KB 3P4YA 3ECAA 4CLXA 3P9RA 4G1UC 5BQOA 3RKSA 2X22A 3BJMA 2WABA 4RH0A 1JIXA 4RZIA 5CVEA 3V1TC 1NQXA 2OBMA 4MIEA 4XWYA 2X0DA 4D4HA 3LG2A 4P7GA 1KDRA 4AM8A 1QMPA 3G2IA 3H18A 4IDNA 5K3OA 4H3VA 4NU0A 4DYVA 3UXEA 4GUAA 4GFDA 2PSFA 4ZAXA 4LI0A 3JQQA 3NBFA 4B4KA 4QIHA 4DLPA 4CKWB 3LLSA 2AFHB 5IKEA 1ZJZA 2DH6A 1M8GA 4MQ6A 1EX6A 3ZY5A 5KINB 2QAGB 3S0JA 4CLHA 5GINE 4YMVA 1XXHA 4G5HA 1GYPA 2GJ8A 3CEPB 4ZDWA 4B3FX 1IHDA 4EW1A 5JI2E 3FHCB 2G4VA 1C3LA 2W11A 2AWOA 1U8TA 2IF2A 1J5PA 3HBLA 3A37A 4LEIA 4PLTA 4X7PA 3TBHA 1J25A 4PC1A 1ZUWA 4BUJA 4YROA 1EGHA 2PKRA 3W78A 2OGSA 3GXOA 3O38A 4F5DA 1NFFA 2FPPB 3ZUPA 2GUGA 4QM6A 4X71A 2PS0A 3CX7A 1XN1A 1NSFA 3IVRA 1MT0A 2C1EA 2G0TA 1U7TA 3C1OA 1RRKA 3HFRA 3ZYZA 3H9QA 2CL7X 1G64A 2GLUA 1EDDA 3TLYA 3TS1A 4HUJA 4HVCA 1OASA 1XK7A 4MLDA 3OEHD 2ZT6A 1YI0A 1YE8A 1BQ3A 2R5WA 4L4RA 2P9EA 2UVQA 3BHNA 1N4AA 1P5JA 5HS4A 1ULSA 1V1JA 1HDYA 3DO8A 4TVKA 3TTVA 4ZI3A 1Z0UA 1GPMA 2CNNA 2GTPA 2LGJA 3ZVLA 4CKXA 5LQMA 5I6DA 1F2DA 2O3QA 2OLKA 3NYIA 3UXMA 1SHKA 5FFNA 1L1FA 4ZI7F 1R6XA 2HV8A 2ZW9A 5TX7A 1DUVG 4RF4A 5HJ2A 3GN2A 1YQDA 1L4KA 1QG2A 2FVYA 2NN3C 2C4HA 3EULA 2NYUA 4L76A 4ND6A 4BNDB 4X91A 1FMLA 2DJIA 2JLQA 3MLAA 1YC2A 1ST2A 1NULA 4UM9B 4K6OA 3SYMA 2PKQP 5H80A 4KXNA 3QUAA 2XMCA 3JD4A 4Q66C 4L4SA 1U4SA 4X41A 2V7EA 5AO9A 1T8TA 2HA4A 1C81A 2D5BA 2A9VA 2ODAA 3TNYA 1EIZA 4O8CA 3KZKA 4FIZA 2A58A 1XNJA 1CUGA 1HG1A 1OZGA 1UPFA 1XDGA 2C3PA 3EMBA 4P54A 3QPCA 4Q3KA 4W5NA 2IPXA 3DBOB 1S01A 5EJAA 3OEWA 3VYSB 1PZMA 4RZ3A 3MGAA 4QBFA 1TB4A 1Y33E 1TGVA 2NLOA 4I55B 4LE0A 1QBKC 1NYRA 2BYTA 4KDFA 1ZIYA 1DT3A 4HAIA 3V55A 5EXTA 2Q9BA 4HZUA 1Z37A 1XRJA 2Z6VA 1LK0A 1NW6A 3HYTA 3PC4A 2XMPA 5GONA 1N2SA 4AG5A 3UMRA 3X1KA 1EGVB 2PRYA 4WUVA 3HVUA 4J7XA 3LGSA 1G5QA 1KSJA 2R25B 3M3DA 4WAUA 2PKCA 3RR2A 5IDVA 4FX2A 621PA 4NMXB 5JWOA 1U0GA 2MMGA 4H7FA 4UVGA 1HEYA 1P1RA 4XX1A 1I14A 4F60A 3VZCA 1P4HA 4AECA 4B31A 4ETWA 3IP6A 5CX4A 4P98A 3SSOA 1THGA 1NRXA 1QYXA 3X1JA 3OZBA 3WWYA 4M37A 1VLJA 1FLAA 5CLGA 2Y0CA 1K75A 1WEHA 3AONB 2J67A 2HH9A 2Y68A 4HLNA 3WQBA 2OB2A 2XD4A 1RXCA 2ZRPA 3F5DA 3DAOA 4H6WA 1XMVA 1Q74A 4ZVVA 1H0HA 3HA5A 1NQ5A 3HCOA 1OBFO 3BAFA 421PA 4DUGD 3DZFA 4EKNB 1RHRA 3LHDA 4GZMA 4E30A 4DC1A 1MGPA 3P5BA 4URZR 4IBOA 3EVDA 1M1YE 1UT6A 3G2JA 2JLVA 1EESA 3NIBA 1RYBA 1V5FA 4YCBA 5LB2A 3WLKX 1BFKA 4IGFA 1Q84A 5KDOA 2D8AA 5BUSA 2YKGA 4MVJM 4I19A 3ONWA 1OFHA 1X7YB 3O9MA 4DJTA 5JAPA 1RBMA 3V7FA 2RGWA 1ZGZA 2R6JA 3E58A 5REQB 2Y0DA 2GTIA 4QL3A 4PFQA 4NICA 3MTQA 3GOHA 1UBEA 1Y6JA 5G0VA 3G13A 4JGIA 3PLAE 3I23A 1SUCA 1W1IA 5AJYA 4BVKA 4KFCA 1LS1A 1BE8A 1SZCA 5BSHA 2RH9B 1HF3A 1NNLA 1X7HA 3I0ZA 4OMDA 2PTHA 4MO2A 1IHYA 1Y4AE 4UQOA 3HDVA 1XG5A 2HDOA 5DI3A 4BJ1A 4PY2A 1BJKA 4UVDA 5KOJB 4M8IA 2GI4A 3D43A 3S4YA 3Q85A 4L7VA 5LA6B 3W2GA 4QPJC 2E0IA 3CM0A 3KQMA 3AEKB 5KSPA 3C7KA 1M1XB 1PEAA 2QVLA 2W6OA 2ZJAA 1U4NA 3C3MA 3DAPA 4XOUA 3O4IA 4DDMA 5CDHA 5HW0A 3LZDA 4A3SA 2WKPA 3MF4A 4R31A 1U0BB 3R4CA 3WIBA 2BSQA 1NUPA 1BD4A 2K2QB 1TX4B 4Q7EA 1AMOA 1T9GR 2QJFA 4EEXA 3FCOA 4MW2A 1C1XB 2BWJA 2ZUUA 4UTZA 5SV2A 4GL2A 3JRNA 1LJLA 1XWWA 3JQAA 3RFXA 1CRWG 3T0GA 3P45A 4OHOA 4E5MA 4E4YA 4PXAA 3ZWQA 4CLOB 4C0HA 5IDQA 1I0LA 1K86A 3IBFA 2CBZA 3LIPA 3LM8A 2V98A 2EWMA 3MMPA 4RLQA 4TMTA 4HBZA 1V5GA 1RAHA 3DF7A 3NPMA 3CZ5A 2CNBA 3FNBA 1M5RA 1FP2A 2REQB 1O0BA 3OLCX 4KHZA 1N0HA 5JARA 3OQ6A 4HN9A 4HTAA 1NQWA 1MNAA 2OP0A 5D8DA 2IDKA 2W90A 3R7FA 3HCEA 4OAOA 1TM2A 1UBNA 1LZLA 1RE1A 5IBCA 4LOJA 5ILQA 4F56A 1Z26A 2YYSA 2ZETA 1XVVA 2PX2A 1U0NA 2KI5A 1N6OA 2VDQB 1EFAA 4FS8A 3TGWA 4RQAA 2PWBA 1IM5A 1LWNA 1Y3HA 2CHEA 2NIPA 3DZBA 2O57A 3Q0EA 2X5OA 1Q7EA 3E81A 4KSBA 2JNWA 1E0KA 1FVOA 2FDRA 1FMCA 2FZCA 4O59O 5AOCA 3SP1A 1EWTA 3NI2A 4X20B 1LSJA 1MJHA 4JB8A 5D3KA 1M1YB 4ZDIA 5A06A 5KNDH 4EJSA 1EK0A 3ETJA 4NH0A 4J16A 1PJTA 4G8DA 4P6VF 3ZHOA 4M89A 3AWIA 4CM8B 1IHXA 3T61A 5KOYA 3C5VA 1ZD8A 1CYDA 2NU6A 5KYTA 1JYSA 3HE3A 3KT0A 3KIPA 3KRTA 1OX4B 5G4LA 1J56A 2DQKA 5JC8A 5JQGB 3QBEA 2XT9A 1JIQA 3TRDA 6NULA 3AP2A 5FUXA 2OBNA 3LTEA 5BMVF 1ODTC 4GQBA 4BPBA 1CF9A 1NXWA 2XB8A 1KHHA 3N75A 3T7SA 1XDSA 2VI5A 1B7GO 1DEHA 2RKOA 1JU3A 3EPLA 1GUDA 4EECA 4ZTUB 3GL9A 4K88A 1UFQA 3ILVA 5E3IA 4CQJA 3A7DA 4U7GA 4XEUA 5ALOA 5JATA 2HW8A 4B3IA 1YS7A 3EXHC 5I9MA 4Y2JA 3BRQA 3KQVA 2F59A 1S8NA 1DADA 4JYAB 1MQAA 3IRVA 2CSXA 4RPIA 4UASA 1SKBA 5J2TA 1IUPA 1D9ZA 4G09A 4HEQA 2OGWA 3LPNA 3EG9B 1NP6A 1GRRA 2CDNA 3DEKA 3U4IA 4NK5A 3TZEA 4BNZA 3AKZA 1A5AB 2BHNA 1ZUD1 1YZYA 3Q0TA 4JJ4A 2W6JD 1U7XA 4Q21A 1LBEA 3BXXA 1EDOA 2OM6A 2OZPA 4UEQA 1VPEA 3R75A 4ARCA 1KXZA 1DKUA 5G40A 1JW9B 2VOEA 3WLAA 1RLJA 2WYIA 4F93B 3AFNA 3L6BA 3EIFA 4K6MA 4HSGA 2HIAA 1TUEA 3VU0A 3IP1A 4LFCB 3S2FA 5KU7A 1G20E 4D46A 2W8BA 3DLIA 3D31A 3FDZA 3KPWA 4UU1A 5COAA 1KFEB 1RHJA 3AEXA 3MERA 4HNRA 4JUDX 4KRGA 4MGYR 1IWOA 2QX8A 2CXNA 5CH3A 4GI1A 1UIRA 2Q1TA 3H5RA 1KH2A 3QOYA 1HT3A 1M1NB 2FK7A 3DE7X 4LHWA 5TRTA 1U7HA 4ENWA 5EJ5A 3TB4A 3ID6C 1GM5A 2VC2B 5A7GA 2BN4A 1E3IA 3TI9A 2FDCA 3INTA 1J1IA 1L1EA 2ZB4A 2V7PA 3K4HA 3EF3A 2NW6A 2ZJ1A 4K26A 1YA6A 1BWRA 5F3WB 2D59A 4K9MA 5A9SB 4BQIA 1X77A 1E77A 4J7UA 3AF6A 4CIDA 2PRJA 4GU5A 2OVFA 1LBIA 4JJ6A 5FHQA 4B3TB 2RGUA 3A1TA 1P44A 4N5LA 4QUGA 4UBNA 2I2WA 4HDSB 3T3GA 4NK4A 4A0GA 4L9SA 3UM9A 3NAGA 3BM5A 4YC7A 5LD2C 5CYOA 2EW8A 2PKXA 2DWCA 1ZH8A 2FPXA 1E18A 1JEJA 1MA3A 1TD9A 4GWGA 2NV2B 5GZ6A 2Y9PB 4D97A 1EVJA 3BGVA 3GRFA 1BGWA 5B3JA 4Q9HA 3DR5A 4N49A 2AC4A 4WUTA 4DQXA 5FWYA 2FMHA 2RJOA 3ETHA 3JATA 4JJKA 2P8JA 5JC1A 4GEGA 4RM2A 1Y3BE 4FKBA 1Q1BA 1T9KA 2BFMA 1IG0A 3KKEA 4YJGB 4Q9NA 4ERNA 1HDZA 1X1RA 2W2XA 5B36A 1P2TA 4XI9A 4MB6A 5TQVA 3USES 5U9CA 1V2HE 5IDWA 2HHAA 5F23A 1PX2A 1LI5A 1XLTC 1DBSA 1BOFA 1XXHE 4BLVA 3ZHCA 4TWJA 1YVEI 4ADSG 3PVCA 3HBAA 4YRFA 1WBBA 3UWKA 2I67A 2R66A 1P7ZA 1YCFA 3VR3D 1O2DA 5GAJA 4TYWA 3L5OA 2DH5A 4LDRA 1RI3A 1N2CA 2R8OA 2W0MA 3IEIA 1WD5A 4LGCA 4LWOA 3TSYA 4KODA 1D8TA 3PRHA 3BXOA 3WWDA 3ZU6A 4BKRA 2ZXEA 4I6GA 4CDMA 3TW8A 3IAEA 3LD9A 3N8KA 1UEJA 4IO1A 4MVCA 3OFSA 5D51S 3A6DA 4AJEA 1B23P 4MVYA 2GVNA 4GMDA 5KAMA 2QTNA 4OYLA 1YI8A 4GXQA 1TRHA 3V3TA 2ZZKA 2EERA 3BGIA 4QYTA 4IGIA 1RJDA 3ZDBA 2D1YA 3H9CA 3H4VA 3DLBA 3VMMA 3PUYA 3I09A 4D9EA 2D2VA 5LSAA 2JCVA 3TLZA 4BQEA 4B09A 1G20B 4IICA 4EHAA 4Z4FA 1OF1A 1V43A 3AVPA 2P5YA 1EXMA 3ONVA 1G8KA 4TKZA 4IAOA 1Q20A 4Q9AA 5CXUA 3RFFA 3GLFA 3FKSA 1VFNA 3R0QA 1YQQA 3VGPA 3UHFA 1BS9A 2DBZA 4NONA 1YRAA 3A25A 1OWLA 1SHJA 2EZTA 2CLCX 2VQ3A 4KNWA 3ESXA 4M9XA 1XDBA 5H9WA 2V3WA 4FE4A 4F97A 4DMKA 2CB0A 2CGEA 3OWHA 4IHKA 4BO1A 3WAKA 4FI3F 4J0KA 3OQ1A 2K6GA 3DP7A 4YMIA 5J5CA 3SBXA 3RUPA 3N7AA 2NSLA 1OLXA 2ZSKA 1JLKA 4PPNA 1U8CB 4XR9A 2AOVA 4CQLB 1SIWA 1BXGB 2IGTA 5AHKA 4BB6A 1W4CA 3F8TA 2J7PD 4DAEA 2W37A 3LUDA 4QATA 2OZEA 2KBFA 1CEQA 2XA9A 4KV7A 4MDHA 1GGNA 1ZNWA 3IAM6 4JUAA 4YJ2F 4KQEA 1V37A 1YMQA 2B8JA 3ETGA 3WYBA 3WO1A 4DVGA 1JT2A 4BATA 2XMBA 2XRFA 1RQPA 4ZT5A 3NP9A 5IVKA 4FDTA 2NO6A 4XWOA 4JLDA 4WMLA 5EWJA 2X40A 1DQNA 4LCBA 1B1CA 5T7BA 5UKDA 1TJ5A 1KVQA 3VNSA 4PS1A 5ECYA 5KHOC 1DV1A 2J4DA 2JFNA 2N3ZA 1RPTA 3MN1A 3KDSE 2F1RA 4EYKA 2XRZA 1ZHOA 3UKOA 3Q2IA 4TZTA 1C9NA 2N0SA 1XXHB 1JJIA 1OXBB 1YIOA 3FFBA 4LRTB 1YMVA 1YZTA 4CL3A 4ACBA 7ABPA 3HMQA 4A5OA 4J2HA 2ZRQA 4W5RA 1J5EB 4HQ0A 1TAGA 3O95A 1GZ7A 2L82A 2C9CA 3X44A 1YZLA 2POQX 3OX2A 2ZIVB 3DBIA 3K8OE 1GU7A 3HB0A 1YKFA 4I36A 2C3UA 4R41A 5A6SA 2IYOA 3T5DA 5C3MA 1HY3A 2XAUA 2Y05A 2AF4C 2AUNA 3LAWA 1LTQA 4WDQA 3L8YA 1E8NA 4PYLA 1I33A 4TKLA 4B0OA 4K6CA 2BTOA 4PAOA 2GNOA 1AV6A 4MZDA 2B1IA 3K6KA 2N9UA 3LY7A 3Q41A 1KEEA 4DEXA 1JT9A 4N41A 4DG5A 2J0SA 5DN9A 1LY1A 4E2XA 4BGDA 1E5LA 4C0XA 4B1FA 4H1WA 1Y5NA 3NHMA 1DP4A 2Y2UA 1P77A 4FDMA 4GQIA 4K6KA 1JAYA 5ALSA 2E4ZA 4AMBA 1KJZA 4M55A 1TK9A 5JV5A 2BUBA 5BR4A 1GRVA 1PS0A 5AKIA 4A6DA 3SQXA 4JFAA 2YZMA 1HEIA 4HLQB 3T54A 3AX6A 1UZUA 3NAQA 4JSRA 4WBSA 2G67A 3SX2A 3CRMA 4DIKA 3P8ZA 4GLFA 4ETMA 2NTVA 3MGKA 2BPOA 1YH3A 1YHYA 3A3OA 1Z5ZA 1ISMA 4U2EA 4WLUA 1CW2B 1HEUA 3KJZA 4RDIA 3UJDA 1M66A 1ZJ5A 4TMVA 4UDYX 3QF4A 5JFTA 2VRWA 4M7WA 4Q4LA 4NJOA 3WK6A 5B1EA 4QWMA 1NKVA 1NUSA 2F1IA 3O0DA 5CITA 1W5SA 3SF8A 5EIEA 4MJXA 2JPDA 5A05A 4JBXA 3VOTA 5I45A 2XCUA 2ZBGA 2JJ1A 4DQKA 5BSWA 1QR6A 1ORHA 1G7RA 3KHKA 2CY0A 3EY9A 4ZMSA 4C21A 3UN1A 5H4GA 3DE0X 3H5AA 2ZI7A 1FTSA 3UC5A 5CCDA 4HZUB 3CF2A 2MWMA 5GONB 2G17A 1UPCA 3MJDA 1N6NA 1Z0AA 5B1HA 2WTUA 2CHVA 4I9FA 3BRWA 2W83A 3D4NA 3UAYA 4C0JA 1EFKA 1J09A 4RV4A 1C0LA 1G21A 4R2KA 3CX4A 3RS8A 5CW2A 5LOVF 5C31A 3W6UA 4CKEA 4DLBA 3ZXUB 1JR3A 1C9MA 4NX2A 4QYWA 4QRDA 2NPOA 3TD9A 5DXAA 5GJVC 1FYVA 4ZWNA 3G2QA 3HRHA 5HFNA 4ZQFA 4F06A 4UDXX 4MQEA 4W5QA 2EIXA 3B48A 3H65A 3KLMX 1P5FA 4HD8A 5CVUA 4WY5A 2GRAA 3FPAA 3NDIA 7ADHA 1RPZA 2JK0A 1RWKA 1JIUA 4C0KA 1L7RA 3FB4A 2OCXA 4OQEA 5CUQA 4CDRA 1SIBE 1T5IA 4QU8A 2ZK7A 2XPCA 4P5PA 2E3JA 3WJAA 3W8EA 4K9QA 5FWDA 3M70A 2QNIA 2X58A 1ZGBA 3GXBA 3VTFA 4DNPA 5E0KB 3JARA 2LR0A 1NBMA 2CDCA 2HMSA 4XVHA 4ABYA 2WVJA 4EATA 5L45A 1ETHA 1PR3A 4FD3A 1MH9A 1O6CA 3A1SA 1H3NA 1SKYE 2C07A 2Z2JA 3ABOB 3FTCA 3LPAA 4NU8X 4P8RA 3ZHRA 4ZGBA 2CXHA 1FP6A 4GZ5A 1KDOA 4BLTA 1X9HA 2BKLA 3PUZA 3OZCA 2P68A 1KEVA 3AF4A 4Y30A 3F6SA 2J07A 3A2NA 2JJQA 1QHEA 3ZE8A 1DIBA 3SS8A 3TXYA 3BG5A 1T1GA 1XRPA 2GBFA 1OJLA 2H52A 2J3LA 2CCKA 3UVEA 2O2XA 3WGHA 5B3KA 2ZDHA 2JZCA 4G81A 2VHWA 2QTAA 4XLLA 4S24A 3L8GA 5ABPA 3JWJA 3JSXA 1JDNA 1G4HA 1U0HC 1JG7A 3GAFA 4L5AA 4WZ6A 4I4CA 4YRRA 5ITWA 3HKBA 3IH5A 4ILEA 4RH3A 4BNLA 2J5QA 4E5DA 2PBRA 2ZS8A 3WRXA 2P9ZA 5CYPA 3KE8A 3QFHA 5HZGA 2HHCA 4C06A 3EZLA 5DI3B 4I2NA 4E1VA 1ZCFA 4G5SA 1M1ZA 2YJ4A 2MYNA 4NOKA 4KSYA 1BRMA 1BC5A 1JNXX 1QMGA 2O0JA 2VRBA 2WFLB 2YIDA 3M6LA 4DIBA 2ZTUA 4INJA 4NZNA 4C4TA 3EFOA 2R6R1 4URFA 2AEFA 5E4FA 1YCHA 4OQMA 3QHPA 4OBXA 2XNKA 5B4UA 3DEYX 3B8HA 4HNUA 2H4HA 3PYXA 2O59A 2DHQA 1E3QA 1I5OA 4YCAA 3U6KA 3HC7A 5B1SA 2PZEA 3VR4D 5DYNA 5KYWB 1XMXA 1NASA 5DM4A 4AUEA 3GGSA 3E0QA 5DISB 2B2XA 4L0DA 3JQGA 5E9AA 1TMGE 4JBIA 3DE2X 1M9NA 4CIVA 1CEEA 3FH0A 1W48A 3ANLA 3D4IA 3Q3VA 4H0FA 5KSWB 3D5EA 3T5PA 2P91A 1XX6A 2IYSA 4CCYA 3OPQA 4PLCA 2CN1A 3QTBA 4LY9A 4M9RA 4Z0PA 1HMPA 4M9UA 5J2UF 1RXUA 4MLPA 4DIMA 1CUYA 2BJHA 4UVEA 2PXHA 2WD8A 4KL8S 4FSXA 4LZPA 3ZHTA 1CIJA 2PRSA 5FADA 2ZB2A 3NBKA 2OXCA 1OLSA 3GRPA 1D09A 1X7XA 2R2GA 2NZVG 1Z7GA 5F1PA 2MMCA 5AVQA 2E89A 3K2QA 4ODIA 5AVWA 1S8FA 1R00A 3BHIA 2IXFA 2I29A 5BWOA 1SBZA 3AIMA 1SKYB 4IXWA 4PG7A 5AM2A 1C1YA 1EMDA 3OLVA 4UDOA 1J07A 4EJSB 1PQWA 1SH7A 3C85A 4PYJA 1JA9A 4M1ZA 4IJ6A 4MPJA 5EGNA 3WRYA 4R9SA 3GLHE 1U0SY 1VRVA 3IBGA 5AM4A 3I6MA 3DEIA 1E20A 1VLZA 4DHEA 2NU6B 2QYOA 5CDGA 4BLWA 5JJ5A 4UEOA 4X66B 4Z9FA 1SU8A 4BCBA 2AHOA 4IL5A 1FE8A 3TLKA 4RSHA 4TRJA 2GNAA 2B1JA 4S12A 4WFQA 2CYCA 2I0FA 5TEWA 1QAMA 3TRJA 1ORTA 1Y6QA 5KPDA 3LS2A 3RABA 3PBKA 1MVNA 1E2PA 1SUPA 4LYAA 4ZVKA 2EZ4A 1I7DA 3HLKA 2HL6A 3L40A 2YJTD 4ZK6A 3E1KA 1HT0A 4CETA 4D5GA 2QAJA 4H1UA 5AVZA 5EHXA 2FX2A 1KNXA 3NYRA 5E9WA 5KQMA 3AUTA 4CI9A 2BFDA 1N2CE 3R7WB 4HSEA 4HGPA 4TLCA 4GZLA 1PUJA 4PR3A 4YN3A 1GGVA 5AK5A 2NU8A 5J2TB 5ICGA 4PSKA 3QWFA 3L6OO 1VI2A 5CCXA 1N2JA 3F8WA 5BV7A 2C00A 1N8KA 1S7GA 3FCUB 2Y0PA 2IYLD 1PFKA 3B9QA 5CTAA 1QIDA 2AC7A 2CK3D 4Q9LA 2VPXA 1X8LA 2ZM6B 1TM5E 4PLHA 4BLQA 2KSQA 3P2YA 3ADBA 2ZEJA 2R1VA 3KYIB 5KYYB 4DB2A 1EI9A 3HP1A 1GTJ1 1A98A 1GLNA 1C7JA 3PU6A 4B3XA 1ZG3A 2HZ7A 3FDZB 1AHPA 4MVJI 1E66A 1FNSA 4KQJA 5BP7A 3BK7A 1PR1A 4XD7A 3I9V1 5L6LB 1JLHA 3GLFE 3PPWA 2HCJB 4KH0A 4GHWA 4M7PA 2HREA 1E6KA 1G6OA 2ZG6A 1JG4A 2OAP1 3LNCA 4Q34A 1WZNA 2OORA 4M54A 4UMDA 3UJBA 1O95D 3I34X 4R3WA 1QTNA 1RI1A 4J9UE 4HR7A 4JLMA 4O2LA 3T9CA 3U1VA 1G60A 1CFJA 4OLAA 4RUKA 3QU4A 1BA2A 4XQ9A 2GF0A 2C95A 2AEJA 2E9SA 1GL3A 1UQUA 1EFLA 1UK8A 1ZM9A 2H8GA 2IZOA 1FLDA 2O2GA 3HN6A 4TVBA 3P0HA 3UG6A 3RSGA 1ZH4A 2I62A 3L1HA 3AKEA 2V97A 4DLKA 5B4TA 4ZRNA 2QVCA 2HGSA 1VIYA 2QD5A 1W87A 3BZBA 4KB5A 4XCXA 1OKKD 2C1XA 1OUMA 2QW8A 3DWIA 4DXAA 1FP4A 1T8PA 2EQAA 4EMTA 4F1JA 1R6TA 3CF4G 4UU0A 3QWIA 2M6KA 5AVXA 3GLHB 2HLPA 2FSFA 3NOOA 2OT3B 4R3UC 2GJKA 2VPIA 2H07A 2ZAOA 4FFBA 3EDYA 5FWYB 3JATB 4YRGA 1O08A 2J6IA 2P7HA 3K94A 1I13A 3TLAA 3EPHA 3GI1A 4QPCA 4S04A 2J3MA 4UQLA 1FYEA 3GNTA 4RO0A 2SKCA 1IUOA 1XMSA 2DY1A 1DBQA 4LDNA 1G8PA 1XI2A 1IYZA 5C5DA 4YWJA 2C9YA 3S5JA 4HNTA 1GO2A 1K92A 5K03A 3AHIA 3L07A 3VAZA 2DPXA 2FR8C 2PKWA 2OFPA 4WTOA 3ZGXA 1VDMA 1Y5MA 1A71A 1OB2A 2HIMA 5DCWA 1VHQA 1N34B 4I5EA 3IXQA 1AKMA 4QU0A 3H1AA 1TA9A 4JKOA 5D86A 3AZPA 3F46A 2AOXA 3E22B 3E7FA 3IE2A 3P1JA 4ZVOA 5CG2A 1P4GA 2Y71A 2HRDA 5IK2D 1A9PA 1NVUQ 3KHSA 1NVWQ 4ZZIA 1K7YA 2P75A 2Z2KA 3O8QA 1N2CB 1UF9A 4J2TA 2OE2A 2PPVA 3AB3A 3RAGA 4BAGA 1KSHA 1F5NA 5DCYA 1V2GA 4QLOA 2XX3A 4L0MA 3ED1A 5IULC 3HDJA 3GLKA 2IXEA 4BFZA 2BKUA 1C3VA 3C43A 1AUOA 1CR4A 1GSOA 3GJTA 5AOBA 2XB4A 4XGNA 5GGXA 5KWEA 3ZS8A 1FXWA 3G2PA 3KK0A 3LPDA 3VSAA 5LYJF 3EDCA 4HNHA 1ZOPA 2BBOA 4OK3A 3TZQA 4EARA 3NCTA 1XCBA 1B8NA 1KBQA 4I1OA 2MYUA 2WU4A 1UBSB 4AS2A 2HJSA 3AEYA 3LW7A 1J0CA 4Z5XA 1T3HA 3BWXA 4FOSA 5JLAA 2OY0A 3WNVA 4WKNA 5EJ7A 4QVIA 3GOQA 1FB5A 2I9PA 1Z9BA 4AICA 3GLFB 1XVAA 1XMJA 1P2VA 2F62A 2GX6A 3NBUA 4XPIA 3GX1A 5FIUA 1N7HA 3OT1A 4O2BA 1RYYA 3IX7A 1P7CA 5JNRA 1CIVA 1X2BA 3Q0IA 3COZA 4NBRA 3PFFA 3N6XA 4HZIA 4WZAE 3JQFC 2G04A 1HNNA 3MLBA 1IVYA 4Q3EA 5D00A 2FW7A 3ORHA 1QGZA 2EL7A 1OLXB 1XV5A 2V54A 3GK3A 2GK4A 3VR2A 1JALA 3WIOA 4CUKA 3E7PA 3TX2A 3V8RA 2AG1A 5GJBA 1QQTA 2OD2A 2BV3A 4OI4A 5FP0A 5MN4A 2CXXA 5ETJA 5FULA 3D4LA 1IXYA 3CWQA 5TMPA 4ZTZB 3V1YA 3BZWA 2V7VA 3SHQA 4IVNA 5HJ7A 4L9WA 3RSLA 3U9LA 4AKHA 1PVDA 4WT7A 3E9NA 3R0XA 3ELUA 1LPPA 1QWOA 2NP7A 1T43A 2R4TA 3PX3A 5EWJB 1QZUA 5JPDA 2O52A 3JYQA 3PXDA 3QVMA 5FOVA 3V1UA 3F5SA 5D1NA 3ZE9A 1E2KA 5C7OO 3ND6A 4TL8A 1HDEA 1W2HA 3VI4B 2ODWA 1RJEA 1ULBA 3T7TA 1G21E 2IEYA 5FTMA 4BLSA 3UB2A 1BWSA 2RCNA 5IT0A 4JI0B 1JR3E 2E85A 3UWMA 3QLEA 2PKYX 1LTKA 5J4YA 3P2JA 4KPEC 2H06A 4BZWA 3HFSA 3L4BA 4KAJA 4U02A 4MS1A 5DDIP 5F3DA 4BHTA 2JIPA 3DW1X 4DW8A 3ISVA 5D85A 2QA5A 5TGDA 3LX8A 5THKA 1RNLA 4JN6B 4OATA 3GZJA 5A6SB 5K0JA 1VYUA 4YP9A 2BOVA 1G6KA 2XV1A 4C4OA 3A1UA 4K1LA 2P2LA 4NBKA 5TPZA 4PG4A 4MCJA 4BIMA 3C8HA 2ZJ2A 1KYIA 1TZ2A 2VQSA 1C80A 4RYLA 2Q50A 2VXOA 2ZIUB 5COBA 4ZO8A 1G8FA 1YJBA 2REBA 5CT4A 4D25A 5AQ1A 3M6UA 4JEIA 2QU7A 1BE6A 5EJ2A 1BEEA 5F33A 5HILA 5KJFA 3LC2O 3KWFA 1UXGA 3TRHA 1PDOA 4ZT3A 3OFND 4RTPA 4JD5A 3OLXA 4NU6A 1PE0A 4C14A 4NG4A 2B7BA 3M7IA 5AW1A 4M9CA 4JC0A 1T6YA 1T5SA 2BZSA 3A4NA 4EFMA 3C3BA 1PGQA 4WZAB 1BE0A 3CRNA 2YINC 1Z28A 5K8TA 2GO1A 1X38A 4J94A 5LQAA 2ZUFA 1V3UA 4Z1MD 3BDAA 5E0OA 5FI0B 4QSMA 3LRXA 1WHSA 1EWYA 2J87A 3RU3A 4YUAA 1MB3A 2G08A 2IYPA 4NZPA 2JAQA 5K0EA 2F3TA 3QF4B 3L4KA 4RPGA 4FHZA 3G49A 3CLVA 4J4HA 2ZYWX 3SF8B 2QN6A 2E82A 2I7XA 3DUFA 2JRLA 1WY5A 3SHTA 2BFCA 3GLTA 4BFLA 2HSDA 1JSRA 4P3NA 3ZJUA 4MEBA 1RXWA 5ITVA 2WIDA 3NWOA 3PQ7A 4P81A 3U7FB 3WLNA 3GIDA 1OYOA 5DIFA 3DT9A 3ZD8A 4BZPA 1ZU5A 3EXG1 3ZBUA 3K9CA 4KPUA 1JTVA 4YO8A 3I9KA 1SAYA 2AE1A 1RVV1 3I6IA 3CZRA 4DTCA 5HKKA 1E9SA 1GWNA 2HCTA 1EFRD 2PG3A 4P22A 4GSLA 1U31A 1G21B 3M2PA 4MS4A 1F6BA 1NXVA 3A6LA 3EDRA 4CKEB 3KKLA 4ND7A 2EJBA 3D7MA 4IHAA 1IY9A 2QMZA 3HVJA 5AM1A 2OKCA 1DBWA 1NQVA 1NV8A 2HF7A 4J7CA 1EVKA 1JHMA 4BNMA 4MQEB 2H2DA 1ZD1A 8GPBA 2ZUWA 3LBHA 4QFMA 3TSWA 2ZSAA 3TTXA 4BE4A 2FRDC 2PO7A 4NYIQ 4ZJZA 5BN5A 1R0CA 1BW9B 1EM6A 3FMVA 4D82A 1N6PA 1QPBA 1W96A 4B82A 5SZHB 1VIDA 2I33A 2ZITA 4PN3A 3AY3A 4TS1A 4TSRA 1TTHA 5IRCD 1Z22A 3ELWA 2LIVA 2N1MA 1QZ3A 2AJ8A 2PMCA 4K28A 4L57A 4OCZA 5H4HA 2VDNB 3PDCA 3E2IA 3IXLA 3IUBA 4LBZA 4K9DA 3VH4A 3OF2A 4F4UA 5AK0A 4HAWA 2QQEA 2JIZD 4JT2A 4TL6A 5HIMA 2JF0A 1J8DA 1ZKMA 3EJ6A 2JBWA 1JIVA 3JX9A 4HRXA 4YDHB 1F0PA 4JCCA 3BN3A 3DH0A 3EQ7A 1VMAA 4ML3A 3SIWA 4HMOA 4S2EA 2YJGA 1VCNA 2PFKA 3WK4A 5KVVA 3E70C 4V0NA 3OQBA 5KYVA 5TMEA 4OL0A 1PLJA 1EBBA 3L01A 2PVSA 2BMJA 2F55A 3COJA 1VGVA 3NUQA 1QDUA 1L5FA 3BH0A 1Y4ZA 4KDCA 3SFVA 4R51A 5EJGA 1GIAA 2IOYA 5CEFA 4EYGA 2VH2A 1K63A 2B21A 2JFUA 2ZUVA 1PI3A 3HKBB 1FLVA 1XZKA 3LUFA 4O5OA 5EJEA 2P77A 1CUWA 3OJWA 3RRNA 2ISCA 4FYJA 4MNTA 1LQUA 4ENTA 5HCUA 2G28A 4MARA 2OV2A 4BJ6A 4PLWA 1A0OA 3TW4A 1TQHA 2XUKA 3TZBA 4CMIA 2QY6A 4NFSA 3GCGA 5I4KA 3EFOB 4WESA 2QQGA 5CURA 5IVHA 3UJNA 4QHTA 1ZZEA 4YRTA 2CF6A 3ZOZA 3SKYA 3CQ9A 4NI5A 4O02B 4KRFA 3EZFA 3R44A 2P9BA 4HQOA 4GOJA 3UPUA 1BTOA 2OBLA 3BTUA 4LUCA 1OYVA 1YZHA 3IB6A 5DNAA 3ROTA 5KTSA 3AJ8A 2FETA 1D8AA 4OYRA 4OQQA 2W6IA 2P0YA 3CLSC 4OJNA 3QYFA 1HE8B 2QS9A 3HU5A 1UDXA 1TMKA 3JQGB 2J1LA 1RBQA 1ZIXA 2I6GA 3GZ4A 4CV2A 5KJCA 2YV1A 1Y4UA 1NMEA 4CT4B 4CCYB 2AW3A 5KIAA 3ELBA 3LCCA 1HTBA 2FSPA 4DT1A 2WKWA 1MHTA 1Z0DA 1QLHA 3DGFC 5DNVA 1JJAA 2OXEA 5K0ZA 5DLDA 1I9GA 5A1JA 4NV3A 3IA2A 5AUPB 1RIIA 1PUIA 1HSZA 3E61A 4TRNA 3NWPA 1DCFA 3RUCA 2VRNA 5BOSA 1OLSB 1GAJA 3MXOA 2P30A 3RSHA 4IINA 2IEAA 3U17A 4NBTA 4M0LA 4RMJA 1DC4A 1VP3A 3EGEA 1J00A 1VL1A 3JWEA 5JASA 1N3LA 1ES9A 2WA2A 1IXZA 3DB1A 3KU4A 3T9BA 1DQYA 2GZMA 4PTYA 3SZLA 4OREX 1OWNA 2E5FA 1MRSA 2FW8A 1V4VA 4HH1A 4LC1A 5G3ZA 4GC5A 1MA0A 5FPQA 1UDCA 5HF5A 4PYIA 2HSGA 1VLLA 2GBIA 5ALJA 4DIOA 3QXXA 1WU7A 1QH9A 3L7BA 3HY6A 3BK1A 1E1RD 4RGBA 1XT6A 4XJTA 3T34A 5JANA 1X1BA 2OWEA 5KTOA 4MKRA 1O94C 1EPUA 5IU6A 3UK6A 1V8DA 2AN9A 3NVKI 3IAFA 3I01A 1JRLA 4Q18A 1E63A 1UCFA 2IYTA 3UYKA 2XMQA 2LBPA 3C45A 3CLKA 3UG7A 3M6AA 4DJFC 5EAIA 4Q05A 4XLZA 1PGOA 4Z4HA 1Y7PA 3QWHA 2NO1A 2AMLA 2R8XA 3PNQA 2FH5B 3AJ9A 5DWVA 2MHCA 5EERA 4DY4A 1R5BA 4EW3A 2FU5C 5ALWA 1ATZA 2BFDB 1FSZA 3ILHA 3KKMA 3MAAC 2WKQA 4NEHB 1JBEA 4JLUA 2NU8B 5JADA 2Q6OA 5FA8A 5AIAA 2YWEA 3UUFA 2FQYA 4B6RA 1PJCA 4U3JB 2FMUA 5FTWA 4CR7A 3MRXA 4JOCA 1SIUA 2HLDD 2C4NA 4HVTA 1FDOA 2PE5A 4QT4A 3C41J 4F96A 2G0AA 3F4BA 4AQDA 2JANA 4ZVSA 1YB4A 2R1VB 1MV5A 3QVWA 4YAIA 4DLZA 1BX1A 3WLFA 4EJ0A 3LVRE 3ZX5A 3ETCA 2QG9A 4EGJA 2PY6A 5HCIA 3R9XA 3L49A 3D3WA 4Y2TA 5K3FA 5KUTA 3FNEA 4P3PA 2FSIA 3NUGA 3ZD7A 5LCXA 1DIOB 5G4KA 3UK1A 1J4AA 1NJ2A 3CY6A 4TT3A 3V33A 3ZW8A 4M53A 3FPKA 2G7ZA 5E3JA 1NVVR 3WBBA 5CFQA 1VL2A 1WXQA 3P52A 4UHEA 1AA9A 1YBMA 1YAJA 1H2RS 5FYQA 4BP9A 1BA3A 2PQ2A 5ITZA 3ZTYA 1W88A 4OP2A 4TTQA 5ADUS 4P2BA 4AJNA 1B41A 2G4LA 3GBSA 4OOEA 5K05A 4BKUA 4XX0A 2FZEA 3LH5A 4IZHA 1AQUA 2Z9CA 1IZZA 2HRCA 1PFGA 4I55F 4LYDA 5IUNC 2O5CA 3ZHSA 1R4NA 4CMKA 5B6IA 2QLMA 4P58A 4LXYA 2DQZA 1NRJB 2WTNA 2NSJA 3K0BA 4FXPA 2DR0A 1YU9A 4EPWA 1KFCB 1IBSA 1IC6A 3GAMA 4QUEA 3RTGA 5JSZA 1FP4B 2EBHX 1LH0A 4ISCA 5E7QA 4A2WA 1UJ4A 2EZ8A 1GSIA 3B5IA 3H75A 3TM5A 2WOOA 2FUG1 5J4LA 1I6WA 4ER6A 2DHCA 4CCAA 4PCUA 4FFBB 4Z4IA 3D6VA 1UJBA 1ZD3A 3WI7A 5K2OA 2NTEA 1A27A 2HMWA 1W47A 2PLNA 2YXBA 4EKYA 5K3SA 1NM5A 2UV8A 4L4YA 1NVEA 2WC1A 5KTYA 1C3JA 2DCUA 3S68A 2QR5A 3AUAA 3JQRA 3PWKA 4GVLA 3ZN2A 5B64A 1KPHA 2B3DA 4R8LA 1BAPA 2JKVA 1OAAA 5J4HA 2OUKA 5BN4A 3NFYA 4OJYA 4GLOA 3LHKA 2EFHB 2RK3A 4ZGGA 4PNPA 1XGKA 1S89A 4Y6LA 1TC2A 2BFBB 3BYZA 1V11A 3QE4A 4RF3A 3RRFA 2ATEA 5C3UA 3QA9A 1G8MA 2WUDA 3COWA 4M87A 1GYRA 3HI4A 3UA4A 4EOGA 3O8QB 4RCVA 5F64A 4UOEA 4FFDA 3CUEF 2GD2A 3LKZA 5JSHA 4OD0A 5FEUA 1H8EA 2ASEA 2WJHA 2BMDA 3FDIA 3TR6A 1SRRA 2P90A 1DB3A 5HDBB 2QMUA 4NPCA 1GGFA 3D2BA 2YWFA 1AZWA 5JEDA 2HQOA 2PEZA 2DULA 1USKA 2RB4A 4CGYA 4D3ZA 1YL6A 2V8BA 3IUMA 5GVSA 1YC5A 3G8CA 2PU7A 2ATCA 2EJVA 3AB7A 1NUUA 3TLEA 4RK7A 3T3DA 4D0SA 1GA1A 4W6ZA 3GRKA 1H5UA 1HRDA 1RWVA 4D9MA 3W2HA 1WNTA 4XGKA 3VSEA 3B60A 3KOWA 4EBBA 3OO0A 1PVOA 2D1RA 3GFGA 4MHTA 4V2UA 5DYTA 1Y8RA 3X1DA 4UHJA 4S05A 2J45A 3FHJA 3LSYA 5EWLA 1TPYA 1KI2A 1R9GA 2XGGA 3OVMA 2QVYX 1BSVA 3ECSA 2DUNA 3F6RA 3OT1B 4JWKA 4O2BB 4BLOA 5LA6F 4AY3A 2ZUCA 2O2EA 2I8CA 4EUKA 5L3RA 3G5AA 4RSGA 4IPTA 4P53A 1Y42X 4B3JA 2OTCA 3DMDA 2UZ3A 1Z33A 1XZLA 1QCCA 2HHHB 4KR2A 4HGZA 4EPVA 4MX8A 2IHJA 1GTVA 2FPIA 3GEDA 1ADYA 2GDZA 3WP1B 2C4KA 3ZDEA 1L8AA 1FQKA 1L7XA 2Q07A 3EN0A 3L43A 2YVKA 1AS0A 2OCGA 4GDMA 4MDEA 4NCXA 3W5HA 5A4IS 1O97D 4OB7A 5EJMA 3SC4A 1IOZA 3OAAD 2H1RA 4K9PA 4U7FA 3OICA 1NJ1A 4LNUA 1C8LA 4X9XA 4N0DA 5DTRA 5F52A 3RC9A 1FRZA 3WLMA 1IY2A 1SHUX 2WF5A 2QL5A 4XCVA 1YIAA 1B1AA 1N0IA 2OZLB 1QO0A 2PGIA 2JKZA 4I46A 3AR4A 3D5TA 4ENPA 1GZ5A 3GWGA 3O83A 4TN5A 3I5UA 1LFAA 3U7RA 4D81A 2WJWA 1RMQA 3IR6A 1FXSA 3PUVA 4Q5IA 1DG1G 3ZLUA 4RQBA 3FJOA 3ZE6A 1Y48E 2HK9A 4FMDB 2GD6A 1KVSA 3PGLA 3KKQA 3QYAA 1SOAA 4WZZA 4CEIA 1R8YA 1SQ6A 1RKBA 4YP7A 1T4CA 4Q1BA 3GZNA 5A3VA 3GJZA 3NB0A 1G16A 2Q5IA 1C0KA 3WQQA 1OFIA 1UKCA 4AWXA 3H2JA 4HWTA 3CEAA 3B1WA 1O97C 3T5GA 1PWXA 4REMA 2CBGA 4GMFA 5BWCA 3K73O 2JLAA 5HKAA 1QCYA 3UJAA 2WFAA 2GAIA 4M1WA 1T2EA 4PLFA 4U1RA 1RKXA 4I1SA 3I53A 4NOJA 4RKFA 2WF9A 2VTEA 4MUNA 1H4VB 4C0BA 4D2IA 1BHSA 2AQIA 3MNFA 2QTWB 3VJMA 4BO2A 1U94A 3GDGA 3U62A 5JQGF 2VPPA 3VJKA 4HNVA 2JLRA 3AETA 4R1NA 2CF5A 4ES6A 1ID8A 1E6EA 4KDRA 1T9ZA 2PVCA 4DNQA 1YA8A 2R79A 2ZQYA 1PHPA 3SDZA 1JQDA 2I3AA 1GPBA 3FYUA 1SXJA 2Q0QA 3EVBA 1U8FO 4HQLA 1BX3A 4H3SA 4BVFA 1QX4A 1U0FA 3BCRA 1BXRA 4FOTA 3W8DA 4UXHA 2X8AA 2NTYC 1P0QA 2XBMA 1RLIA 3B8EA 2W6PA 1NJSA 1TEVA 4W7IA 5KNCA 2LTAA 1QYWA 3NYWA 3CE9A 3G88A 1LSOA 4C0AC 4EPYA 3OPYA 2XUQA 1WHSB 1YQEA 4IIHA 1KARA 1EDBA 2ET6A 4MB0A 2ICAA 2RGCA 2X42A 3BL8A 2NP6A 1E3DA 2WJAA 1QYDA 4ZYWA 4PGGA 1Q7RA 4C4PA 5SZKB 5HOEA 3LUCA 1N8SA 3TLJA 3TSAA 2HTFA 4DXHA 3U2QA 3KBBA 3MMSA 2JGFA 3DUFB 1J2UA 2BFCB 1CB7A 2EGUA 2IC5A 3RLFA 1IE3A 3IQZA 4R71A 1H05A 3DZHA 3H8JA 1W1WA 3R9KA 5HIKA 5FBVB 1F0NA 3OZEA 2O0KA 3LUKA 1RHUA 2M6LA 4EI9A 4JU9A 3OEEA 1E2EA 4G0QA 4KPUB 3ZWNA 3M83A 3NTUA 4GP6A 3OE5A 3IEPA 3RS0A 1Z63A 1FYDA 4F6RA 4LRYA 1KDTA 1VBNA 3OG9A 4MS4B 2D62A 3EA4A 1VL6A 3QF7A 4CMEC 3S8YA 4PYRA 2A33A 2I6SA 4MV9A 3RIYA 1J8QA 1HQKA 1K4KA 1YUBA 2FEMA 2Y2VA 2IIPA 3FSRA 4GOND 2VR1A 5IC6A 5JD3A 3TJMA 1P0CA 3AUSA 4K87A 4D3XA 2ACVA 1X92A 4JMPA 5LUBA 3HZOA 4CVNA 1VJRA 4O4JB 4ALNA 1E3JA 3CR7A 2VYVA 1H93A 1J7KA 2C58A 3DFKA 2B99A 4J1SA 4L9AA 4ZPJA 5DLEA 5EIAA 5BN5B 3WGGA 5K6TA 4QG3A 1VZ2A 1ODIA 1FQWA 4AMGA 2HA5A 1E62A 3E4CA 3LYUA 3SEFA 4PYNA 1EVYA 1WIWA 2PT7A 1NY5A 2Y4OA 5IM4A 4R8SA 1N8TA 1SVMA 3RF7A 2ATVA 2CLSA 2X23A 3JR3A 5G3YA 4QOSA 1YCDA 5F2OA 4E6PA 4RNCA 3A6FA 1UDRA 1AKYA 3BBLA 3HGQA 4HEA6 4I1UA 4EELA 1XK6A 3C1UA 1FFEA 3DSRA 1SD1A 5JNUA 1EVLA 2LCIA 2DTXA 3CTMA 1P18A 2C2WA 2NO5A 4C4YA 1HO3A 1I2AA 3LBYA 3FOZA 3F4LA 4IRXA 1C3OA 3BMQA 4J16C 3L7MA 4YRQA 2AX3A 1WXFA 2VEOA 4HN2A 4OFWA 1A9TA 1QGAA 2ZFUA 3CC8A 1WMDA 3HKEA 4ZO7A 4U7JA 4Q3LA 4UQPA 2WAYA 2WUWE 3JQBC 3MTGA 3QVUA 3FR8A 3MK31 2RGRA 3K0SA 4OX9B 1H2XA 2R7KA 3WBKA 2WMNB 1N2IA 2Q7DA 1BG6A 3PGJA 2ZIGA 1GRCA 3H3JA 3B78A 3V2IA 3C8ZA 3FDJA 1BIFA 6AT1A 4F4FA 3MQ2A 1DKQA 2E7ZA 2HM7A 1FP7A 2XDQA 4CMIB 1EGMB 4CQNA 3AUXA 5A2QA 1GXSA 2R47A 4WESB 1W94A 5LJLA 5FHRA 3BWEA 1P5HA 1FTQA 3Q7QA 3OOSA 3FF1A 2QPLA 1LF0A 4TL7A 1KORA 1IJKA 5EMMA 2BR3A 4GVXA 2H92A 4F4JA 3UHPA 3EOAI 1