3C60D

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
201
Chain Sequence
FEAQKAKANKAVDERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
molecule keywords TCR YAe62 alpha chain
molecule tags Sugar binding protein/immune system
source organism Mus musculus
total genus 43
structure length 201
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c60D02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3c60D01
4CN4A 3VXSD 1RK0A 1CXFA 1F97A 2RCSH 2XYCA 3KLSA 2A83A 2DBJA 1UQSA 3MJ9H 2P42B 3X11B 1F13A 2DLTA 4RSVA 5KBNC 3JUYA 2BNRE 3V5KB 3HPLA 4RFNB 3FTGA 2F74B 1MCEA 5F1OB 1U8OA 3T04D 2W07A 1R3KA 4HK0A 4W68A 2AJXH 2NW2B 5IHZB 5C08E 3WSQH 1OF2B 3WO3B 3KPSE 1CLZL 1CT8B 3H9SA 3NCJL 4NYLB 3N1QC 3NCBB 1MREL 5D2LA 3SDCA 2LABA 5CGYC 5GRUL 1ITCA 3HHRB 5FOJA 4JHAH 4WUUA 1EGJA 1P1ZA 2WINA 2EC9U 2FR4B 1A2YB 3DVIA 5F6HI 4WW2F 3VGAB 2Z8VC 1RZJH 4ODTH 1JMXA 5F6IB 3HC0B 1MI5A 4N0FB 3GI8L 2MNUA 1I4FA 2HH0L 1N7ML 4JM2F 4P3CH 3AU1B 3FOMA 3RZCB 1LP9B 5CEYA 3TIEA 5MEPA 4IDJH 4ZPTA 1EIBA 4KK5C 5GS3A 3T4YB 4HCRL 3VRJA 1G6VK 3MRQB 3NVQA 3CXDL 3RJDA 3ULUC 4R4NC 4FG6C 5DFVC 5HDOA 1DBBL 2DWEA 5IWLA 3BQUA 4N68A 1MWAA 1NFDE 1FGNH 1MJUL 3B6SA 4OT1H 3RVVD 4LEXL 3U0PB 4BYHA 3VRLE 1IQWH 4XBEH 4FTVD 4JKLA 2DKSA 1BX2B 2OTPA 5FM4A 4OV5B 1NMBH 4UTAL 1F02I 3CDYA 4U7KA 3P9MB 4LSSH 3FFDB 4I4WA 4GRWE 4KVCL 4YHLH 2VZTA 4J7RA 3A6CH 1FNLA 1LK3L 3SQOH 4M62H 3PABA 5KOMC 1QD0A 3PJSB 2B7DT 2ZPKH 1JNLH 4DN3H 5BS0D 1S7WA 4PJ5B 3RBSA 3I3EA 2JJVA 4TUKH 4U1LA 2LAAA 1ZLVK 4ODUA 5DMIL 4UT9H 1YYLH 1AGCB 4KDWA 1HQRB 1HHHA 2DQJH 2DYPB 4L29B 1R3JA 3DHMA 2VDOL 1CGUA 4XNQB 2A9NH 3LQAL 1N0XH 1BQHA 1AD9B 3QG7H 1A4KB 2FJHA 3QXAA 4KXZH 4KY1H 2W9DL 1SY6H 4X8JA 2MCPL 1P6FA 1XAUA 4RFEA 4KU1A 3NBNA 2P24B 2J6EH 4ALAH 3ZMRA 4JDZB 4LQFH 4JPIA 1JHLH 1L9MA 3MV9A 4YEFA 3CLFH 1J9CT 3VI4F 4U1NB 2YUXA 3IFLL 4NQCB 4H20H 1J0ZA 3MOQA 1E4WL 3QPQC 4Z95L 5T5NG 3BE1H 4DOHB 4F7CB 3RGVD 1R24A 1MNUH 1ERNA 2E27H 1AKJA 4KTEH 2R29L 4ZAKD 2A77H 2XG5A 5D7JB 2HP4A 3BGMB 3IKKA 3TV3L 1ITBB 2NNAA 3QEQE 3ULVH 4DGYH 4ZD3L 1ZT7A 4WFEE 5EA0L 1R0AH 5EBLB 2YWYA 2DI7A 3DJ9A 5GGTH 3W0WA 3TBTB 1DFBL 1X5GA 3SJVA 3REVA 1Q9OB 2FB4H 5HHNB 3NFPA 1I9RL 3TBVA 2VQUA 1KJMB 5FO7A 1FVCB 1DL7H 1VERA 3FO0H 4QTIL 3VFRA 2Y23A 3PXJA 4QXTB 3OKMA 4PJIA 1MCOH 5A2FA 3GZKA 4I3RL 3AMKA 2EDRA 1N5AB 3NGBB 4PRHA 4QF1B 4R0LB 3WLBB 1N5YH 1DBAL 5A3IC 1UH3A 4PJ8D 4PLJC 2GSGB 2A73B 3GSQA 4F7EB 4JFHD 3REWA 3SGEI 3SE8L 1ZHNB 4NJAH 4K3DL 3TZVC 1OSPH 1KCSH 4ZNCD 4OLXL 2B1HL 4KHXL 5CP7B 1H3TA 1IEHA 5ABDE 4RMUA 1MAMH 4LRNH 4ODXA 2AQ2A 4NHCL 3C6LB 5E94A 4Q7DA 2ESVB 4ZUSB 2VLKB 2QQNH 3EHBD 3PWLB 4FQ2H 4IJ3B 2JLLA 1FYTE 2HJLB 2VXTL 4ZSOE 5L2KB 1HINH 3HZMB 4PRAB 5TF1L 1CE6B 4ODWB 1HHKA 1A4JA 1MCSA 4O2CA 3HNTL 1ORQB 5D7SL 5TH2A 3I6LD 3X11A 1XF2B 4U1SB 1NBVL 3QFJE 1RD6A 2IQAB 3DVNB 3S96B 4NHUB 4UV4L 2KQNA 3B5HA 5J89A 4L4VD 4IIQC 1Z0NA 2IANB 4KI5E 5FF6A 5IHZA 4EI6B 5GRXG 5FM5O 5E9DB 1QSFE 1XCQA 2CMRL 3U4AA 3JWOC 4NYLA 5D2NC 3VXME 15C8L 1WK0A 1GC1C 4P4KB 2BRRH 3K8KA 3DPBA 4Q9QH 2H32H 2ZKHH 4NQDD 3ARDA 4R2GD 1A2YA 3S88H 1CDHA 2EIBA 1A0QL 2WK2A 3AREA 3EOAB 2BSRB 4F57H 4O2FB 4Q6IC 1TVDA 4N0FA 3NIFF 4WVRA 5GHWL 1U3HA 5T3ZH 3RZCA 1F3JB 4DWHA 1NCWH 5IT2L 5HI4D 1II4E 4PJFA 1IL1B 2ILLA 3A67L 2BVOA 3BH8B 3C5ZD 1AY1H 1RZGA 3O41B 2NXZC 1JHKH 1OGAB 1ZHBB 3G04B 3GBNL 3MOAH 3BZ4B 1WZ1H 4QTHB 5IMKA 2NY6D 1I85C 2YXFA 5CKAA 3VG9C 4R8WH 4HC1A 2VN4A 3GSUB 1BX2A 1WICA 1CGWA 1A64A 4OV5A 3Q0HA 4YJZL 1MCCA 3GDBA 4S1RL 3OKLA 4MCYB 4BSVA 4XNUL 4XNYL 3P9MA 1L9NA 4QHMB 2ICEA 3CFKB 2FNBA 1A3QA 3DV6B 2QQKH 3QO1B 4U2ZA 1DLHA 5MP6H 4EBQL 1MIEL 2Z92A 4ZG1A 2GJ6B 3V5DA 3PJSA 1OP3K 1OAYH 3TNNB 4OIIH 5DHYB 4ZFGH 1LE5B 4KZDL 4NCC2 4OTXH 1U8QA 4NKIH 1XR9A 2R1WB 3QUXD 4Y0GA 4MJ5B 2J8UB 4LLUB 4JREB 3QUZB 3RIFF 5TF0A 1MVFA 5FUOH 4Z7VA 3WKNA 3CSPA 3BUYA 3O45A 3T08A 1CGSL 3R1GH 5I1KL 2H8PB 4Y4FC 2RAMA 3G9AB 4KK6D 5IQ7L 1A4KA 1TJHL 4K3GA 3ARFC 3TNMB 4LVNB 5FYJU 1I1RA 4GXVL 1BAFL 4EI5D 1EO8L 5IMMB 3IAQA 2WQ8A 4OZFG 2P24A 2MCG1 4QXUH 4QRPB 3ARBB 1XF5A 3EYUH 3BPLB 5IVZB 4PJDE 5TQ0L 4AEHH 2W59A 3LEYL 4P59L 4L8CA 1DDHB 3P0YH 3WIHH 3PV6A 4NQCA 2F8OA 4NQEE 1HKLL 3LAFA 3VMNA 5F44A 3KPLB 1TJIH 3PWNA 4APQB 5FEBA 3U0WH 3EBAA 4FP8H 4YXLH 3QCUL 1E28B 3SKJH 1WBZB 5F3HB 1YEDB 4PUBL 3D25A 3FRUA 3L7FB 3DIFA 3O4LE 3TBTA 3KAAA 5A16A 3CZJA 1S78C 4XP5H 5I1AA 1HWHB 4QXTA 4XAKE 5ISZB 5DQDL 4G80B 2CIIA 4OLYH 3MJGX 2WW8A 3AAZA 3TT1L 4OGAD 3U79A 3VCLB 3ORJA 5EIIA 4R0LA 3ARGB 3WLBA 1T04A 4PJHB 1X5ZA 2AV7A 2GSGA 1IAII 3MNZA 3MRJB 3D2UB 3S97C 3ARPA 3IDJB 4HIJA 2ICWJ 2OI9B 4PTTB 5GGSA 5ALCL 2DQHH 2X1PA 3L95A 5ESAB 2R2CA 4O58H 5C0AD 1A5FH 1H3VA 3KHOA 1TJGL 2VLKA 5HPOA 4BQBA 1T1XB 1Q9WA 2YC1B 3L3IB 5L2KA 4WY7H 4WU7A 3HZMA 2D9QB 1KT2A 1T20A 2C3GA 5C0RL 3UJTL 3QAZC 5IMLB 3A6BH 5E2TL 5HXMA 3IDMB 2HVJB 3RVWD 3UROR 4NQSB 2QQLH 3C6SB 3H7LA 1XF2A 2ORBH 3DUUB 3RBGA 5IGXH 3D0LB 2XXMB 4NHUA 1KIRA 3WDHA 1DANU 1SYVB 3X13A 4N9OB 3AGVA 4Z7UE 3RA7L 3E3QC 1VACB 2H32B 1WWWX 4EI6A 2V5YA 4YFDB 2AEQL 2N56A 2C3HA 1MAJA 4NO2A 3FO9B 4XHJD 4OCLC 4ZOEA 4P5TC 3D85A 2VIRB 1OW0A 1QSED 4UTBH 3U4BH 2VH5H 2X1XR 2AKRB 3TZVA 5D1QC 1J8HD 1NC4A 3KXFB 3S6CA 5FB8B 5TE6H 1JTOA 3FOLB 2CR6A 2G60L 1ZT1B 3MRLB 3QIBD 5CSZB 5K9JL 2DB8A 1F3JA 3ELAT 2XFXA 4HWBH 4R3SB 4U31A 3RKDD 3QULA 1K8DB 2MOVA 3LSOB 3WMSA 1IL1A 3FT2A 3CSBA 1H0DB 5IB2A 4KJQC 5CS7A 4ONFH 4XMPH 1WCQA 3BZ4A 5DJ6B 1NFDF 4QTHA 1AQKH 5DT1L 4O2EB 2I9LB 5SX5K 4YQXL 2Q87A 3LKNB 2A6IB 4DJMA 3VRLF 4PRPB 3ET9F 4QGYA 1IT9H 4HXBH 4MCYA 1C16B 2QSCH 2DI8A 2CRYA 2QSVA 2A6KB 3CFKA 3QDGB 4GRWF 3VD7A 1ZTXL 2GJ6A 3MLZH 3KPTA 3VXUB 1C7TA 1YY9C 2D03L 2FGWL 4LLQA 4M6OL 1AGBB 1I9EA 1UXSA 4KAQH 4MA3B 3PIQB 4NP4H 1YEHH 2R1WA 4MJ5A 2BVUA 1G9NC 4LLUA 3QUZA 4JDTL 1IGJA 5EZIL 2AK4A 5GZND 5KAQG 5LGJB 3OAYH 4E41B 3O3AB 3G5ZA 5JQHC 1INEL 4OZFA 3V4PL 3TCLA 2XIDA 3BISA 2H8PA 2XWTA 5DUBB 3H9SE 3B2UD 2OR7A 5TE4H 5B3JE 5D2LE 3VFVB 2YK1H 2CJUL 3HE7D 1I85A 1D6VH 4H88L 1RZFL 2NY2D 4WUUE 3QDAA 3GMMB 3HG1B 3RU8H 2YRLA 4MNGA 4U0RC 2C26A 3KPNA 1NJ9A 3EJZC 2E7BA 4QRPA 1MI5E 3ARBA 3S36L 4WI2A 4UILL 3WO4C 3IKCB 2VNCA 2DKUA 1NQBA 2J2ZA 5FA3A 2VLJA 2FLBT 2YD7A 3ROLA 3WFEL 1SM3H 3SDXA 4GRLB 1LVEA 4ODVL 1DN2A 2EC8A 1RJLA 4QOKD 4KRPC 3KPLA 5MENA 4NZRL 1KBGH 3CFEB 3QDMD 4PRBB 5CUSH 5FCUL 4PPTA 1GXEA 4EDWH 5EU5A 2EIDA 2OJZH 3VFPA 1GOGA 3ZKXC 3HE6D 1E28A 1NMCC 4M5ZL 1TXKA 2YUVA 3FZUC 3TN0C 3UJJL 3L7FA 3BJ91 1FCCA 4Y4FA 1NAKL 4DZ8B 2PCPB 1E27B 5F8RC 2DD8H 4LP5A 3LQZA 2W91A 1DBJL 1SBBA 3BEWA 5JZ7D 2B4CC 5I1GL 3LMJL 1X7QB 3T0ED 3BYYA 3VCLA 5HYJD 3ARGA 3MJ6A 5GGVY 3GMLB 1A9EA 4LSQL 1WSST 3MRJA 3EKCA 1BFSA 3QUKB 3QXDA 4X9BA 4MQXD 4JFYB 4PTTA 2BFVL 4HULB 1P7KA 4QKXB 4ELMA 1URLA 4NO0A 2R69L 2BNQB 1FGVH 4JFFD 1KTDA 2P48B 1MFDL 1VA9A 2Y6SD 4NNPH 1S7QA 2RJMA 2PKDA 3RY4A 1VEMA 3BW9B 1UM4H 3CK0H 3JTTA 3M45A 2ADGB 3VFNB 1EVUA 1NBYB 1IBGL 4OCYL 3IDMA 2HVJA 4R97C 5DTFA 1KTKE 5SWZD 2XOTA 4NNXB 1MEXH 3D0LA 4KMTH 4MXQC 3L3JB 5IB1B 3H3BC 1EEUA 2BCKB 3MV9E 4U6HA 1FZMA 3BDYL 3K8LA 1KIPB 1VACA 3MCLH 2E3VA 5I16B 1I9IH 3MUGA 4KI5F 1FBIL 5BQ7A 5HGHB 3CFDB 3S98A 3V6OA 3QUMH 4JRYD 1NCDH 2VIRA 4OFPA 4FFWC 5E7FA 4WEBL 5M95B 1PG7H 3KPOB 3SKNB 3G6DH 2AKRA 5H2BA 4G7VL 3TO2B 3KXFA 5FB8A 1FO0L 3MJ8A 4FXKB 5IFJA 3SO3C 3FOLA 4KUZL 3VGDA 3W0WE 1RZ8B 2IBBA 3MRLA 4NN6C 4OJFH 5I1IL 1NBZA 3SJVE 4LOUC 3VXRA 1OLZA 3OKYA 5B38G 1JPFA 1WZLA 4MVBD 5EBWB 3OR6A 1GZQB 3C87A 4P9HL 3WLWD 1EFQA 5JW5B 1V3LA 2XA3A 5DJXB 4O2EA 2I9LA 1NUGA 2VQTA 1YMMD 5JIKA 4MQ7B 4PRPA 3GB7A 5T33L 1S5HA 2YA2A 4PJCA 1V5JA 5GS0L 43CAA 1C16A 4OKVB 5KVFL 2HKHH 1RJCA 2A6KA 3HPJB 4L3EB 3UTSB 5I30L 3QDGA 4XP4H 4Q97A 5BJTA 2YD4A 1I8MA 2X89A 3CLEH 4LCIL 3QRGH 3VXUA 3R06B 3S35L 3VD9A 3GSRB 3OTTA 1AGBA 4JFDE 2WLYA 1C1EL 4K94L 4Y5VC 32C2A 5F7DB 1MJ7H 4MA3A 3PIQA 2I9TA 5EO1B 4P46C 2FX7L 5AYUH 3I2CL 3HMWL 4ONGL 4IOSD 3L3GA 4UAOC 2R2BB 3MGTB 3O3DB 5MEQB 4Y2DD 4CMHB 5LGJA 3ME0A 1FORH 2VLRB 3LVEA 5I73C 4ZTPH 2IBZX 5TE7L 4GG6B 2MWCA 2FO4A 1MCDA 1EVTC 2F5BL 4J4PA 3TJEH 3KJ6H 4JZNB 5FCSH 3LOWA 2QKIB 3GSNA 2R0WH 3MRRB 3OKOB 3G6JF 5E24E 5EU6D 3RVTC 3OHXA 3CMOL 2CKBH 1FPTH 3B9KC 4PJDF 4PIRF 1J1PL 5EZOH 4HIXH 2J8HA 3IJHA 1WWAX 1M7DB 1INQA 4PJFE 5I1DB 1Z3GL 5D9SB 4KVNL 1O5DT 4PRNB 5AUMB 3CFEA 2BRQA 3VWKC 2P7TB 5KVGH 4K71C 1A6WL 4KK9C 3F7PC 4AH2A 1EAJA 4RFOL 2PETA 2DBLH 3IXAA 5T1MA 5C8JB 2X4SA 4OGZA 3S5LB 1KNOB 4LPCA 1E27A 1SEQH 3N85L 1YQ2A 1A02N 4X6FB 4XC1L 5EOTA 3NPSC 2VDLL 1P84K 1DEEA 4UBDC 1IQDB 4D9QD 2NY1B 4X6DB 1E4JA 3MXVH 1J88A 3GRWL 3H42H 1X7QA 3KNBB 2EEDA 3PHSA 2B1AH 3H3PH 2EXWD 3S5LG 3GMLA 1WC7B 4K8RL 5FYJH 3BMVA 2QJDA 2N7AA 3QUKA 4ZO7A 5F1NA 4JFYA 1U9KA 1R5WB 3VJ6B 3QDJB 1QHPA 3DO3A 4HUKB 4Z7VE 2GT9B 3O2VH 3RL2A 3QWQB 1CLCA 3ZE2E 1RU9L 3OGOE 3SPVA 2XKNB 4XVUC 5EN2A 4ZUVB 1MIMH 2HFEA 1FFRA 1MFEH 3SOBL 3TN0A 1M7XA 5JR1H 1ZLUK 1YEKL 3OF6D 2ITDB 3VXSB 3Q5TA 5IB5B 5CJQL 4GOSA 5I1HH 3DSFH 1CFSB 4NRZA 3CMGA 3L3JA 3EW3B 2BCKA 4L4TA 4LPUA 3P0VH 3QUMB 2FL5A 1AE6H 4Z7UF 5AZ2H 5I6XC 1KIPA 1MPAL 4PS4L 4H1LH 5I16A 3FN3A 3GMPB 4EOWH 4NQCE 5HGHA 3NN8A 1U95B 4XNXL 3U30B 1RUAL 2FJFA 1B0WA 2ZSWB 5CILH 5JNYA 2YN5A 2ZJSL 3OKEA 4FFYH 5MERA 2UWEB 2X4RA 5B38A 4ZQKA 1QSVA 2EDKA 4KRLB 2KQMA 3SKNA 5C09D 1RVFL 1GZPA 2VAAB 2V7HB 1T7XA 5D1ZC 4PV8A 4Z7NE 1T22B 1RZ8A 3P77B 3GUTB 5HI3C 5BOPA 4MQTB 3EO0B 4M7ZC 1JTTA 5E08L 4O4YL 1T89A 5E6YA 3S37H 3ULUH 4NUJB 1WEJL 1QFOA 5GRVL 4OSUH 2VLLA 2NPLX 3AFLA 2NZIA 1GZQA 2VWEC 3DYPA 1KCUH 3SE4C 3UTPD 5TGBB 4TVPE 2DN7A 4I77H 4HIIB 2DQFA 4U6VL 4PRIB 2L4OA 3BPCB 1AXSB 4MQ7A 2YZ8A 5GRJL 3L3DB 4MMXC 2Z91B 1L7IL 4D9RE 3MLSH 5JA9A 3Q48A 4Q58C 5IM7B 1HNFA 4MGXA 4AQOA 2VLKE 3CVHA 2WBJC 5GZOD 3UYRH 5EULV 2C1OB 2R56H 2I26N 5L2KE 4KKLD 1S7SA 4UNTA 3BP6B 4Z7WE 1FSKC 2VISA 5BV7C 2X9XA 3QDHA 3O2WH 4RGMB 1SJEA 1RZKC 5JIIA 3LIZH 1ND0A 5C0FB 3MGTA 1YECL 3O3DA 3MRGA 1LK2A 2OK0H 2NX5B 4XPGH 1D5XA 2VLRA 5CSGA 1CQKA 4M1GH 4DGIH 1RUQH 5C7XH 2YSSB 3PGDA 1OAQL 2VXVL 2C1PA 1DQMH 4GG6A 4ZAKC 4PYHA 4CVXB 5GISH 1TCRB 3U83A 3WNOA 3QEGL 1N4XH 4PGEB 2AQ1A 1JGUL 2ZCLH 5D2LF 5B3JF 3FMGL 4NN5C 4HUWB 4JZNA 4LNVA 4BQ9A 3VWJC 1BFVH 3CGTA 4M48H 5K33A 2BDNL 2CKBB 4MLSA 1OAUL 1G7PB 1ORSA 3D39D 2Q7NA 4HV8B 3VDAA 1BVZA 4XCNB 3MREB 3MRRA 3HZYB 3BIKA 5DVKA 3WIFA 3D69A 1GYAA 5J9PB 4XVSH 5DJ0B 1TQCC 1DZBA 4P3WA 3CUPA 1LEIB 3QHZH 5DJDB 2MQ0A 1HWGB 1C5BH 3GK8H 3P9LB 2AI0H 4NZDA 1EGJL 1UENA 5CCKH 3OPZL 5D9SA 4MNQA 4N8VB 4BQ6A 1CLYH 3GMQB 3SHSA 2H2SC 1RPQA 1TTFA 2P7TA 3ZHDA 3ABZA 2XQYG 3WE6B 3DXAD 2YR3A 1EXUB 4OB5H 3RGVB 5C2BH 3V52H 3S5LA 4GT7A 2OP4H 4DAGL 2B0SL 4S11A 2X4PB 1BZ9A 5KANG 1IQDA 2GJ6E 1HSBB 4HQQL 5F1KC 5SWSA 4X6DA 2VSDA 4YXKH 5J3HD 4X7DC 3TYGH 1R6VA 2BC4B 5FECA 1MH5B 3AB0C 4QY8A 3PWUA 1VKXA 1HCVA 2KBGA 4TQEL 4Q9BA 2AK4E 2XQBL 4EKXA 1A3LH 3VJ6A 5D7IB 5GGQL 4PJ8B 5J8OA 3W82A 4TSAH 5F8QC 1EBPA 5DI8B 1KFAH 1CICC 4F3FB 2GJZA 3CJJA 4OD1H 4PTUA 4ZTOH 5T5FH 2X44D 3NFNB 3VWKA 1MJ8H 3QFDB 1K8IB 3BHBA 3IDNB 3B2VL 3KYNB 3MLUH 4A6YB 4HF5L 4HXAL 1P84J 3SN6N 3UPAA 1QBAA 2EDDA 2FATL 5F21B 1JVKA 4NN7C 1HILA 5TDNB 4MNGE 2C4XA 4QRPE 1TTGA 4PR5B 4POUB 4CNIA 1CFSA 3N0PB 5BXFA 2Y06H 2A74A 4PBXA 4XHQA 5DYOB 5CP3H 5HJ3A 2VLJE 1G7QA 4YC2B 2XI9A 2X09A 4WU5B 5F3BB 5LG1A 3GMPA 3SDXE 4Q2ZA 4UU9B 4FZEH 2AEIT 5DR5L 2ZUWA 1I8LC 4QHKJ 4BK5A 1NEUA 5DA0B 5MENE 2ZSWA 1WV7T 3JBG7 5EO0B 3U7WL 2UZYB 4CBPA 5D1XC 5J7CC 3PGFL 5C07B 3ZE1E 4HT1L 5L7XL 2V7HA 1FLRL 4LDLB 4XP6H 5E95B 3WS3B 5CHNB 2VDRL 3MBXL 2C3VA 3MRFA 3P77A 5DZLA 4DTGL 3GUTA 3EO0A 4NQDB 3BGFC 4N90D 1NCTA 4GXUN 4WTXA 4BZYA 2AVGA 5DWUL 4RIRB 5TQ2L 3DRTA 1JFQH 3Q1SH 1FG2A 4HEPG 3UTQB 5GRZA 4YDKL 2Y7QA 3NAAH 4D8PB 5TGBA 4ZOCA 3LRGA 2H26A 4HIIA 3C5ZB 3BPCA 4HS8H 3LDBB 2BERA 3L3DA 5CINL 1YNTB 4ELME 3FN0H 3U46A 4J6RH 4PP1D 4RZCB 2J7LA 2NY6B 4LF3B 4AG4L 4D9LH 5IM7A 4TSCH 5J11C 4BFGA 4FTVA 2C1OA 1N64L 1G9MH 4X7TA 3EDKA 3BP6A 5E1AB 4YBLB 2JJSA 4TOYL 5E6IC 5F7LB 1J1XL 1AFVH 1QLEH 4OKDA 1MRFH 1AGDB 2JB6B 3I02B 1RZ7L 1MHHA 3BPNC 4OFDA 4PJXB 1FNAA 3TBYB 4HSQA 5BS0A 4K23L 4I0PD 4N1HB 1S9YB 2ICCA 3JV0A 5BVPL 1NCCL 4U0QB 3QUXB 1FH5H 5DUML 1XF3A 2YSSA 3EYVB 2MQ3A 5GS2H 5I71C 3JV5A 3O9WD 1TCRA 2AJVH 2EDWA 4YE4L 1T7ZA 2HWZL 3LPWA 1IGYB 5L9DL 3SE4A 3NMEA 3MSPA 3KPRA 2IMMA 3MBED 3OGCB 2ZOKB 3VA6A 4HV8A 3EYOB 3VMOA 1LDSA 4DKDC 1C5CH 4POZD 3WUZA 2CUHA 5CFHA 3C9NB 2IADB 1VGKB 4EI5B 4M4PA 5DJ0A 1MSPA 3QUYC 5FGCB 3U82B 3I6GA 2EXYD 2VXSH 4KQ3H 4RMSA 4OCWH 4NO5A 4WHYH 3VXRE 2DQIH 5I15L 1LEIA 5DJDA 3VDCA 5MHSD 4M6ML 3SE3A 4PJFF 3P9LA 4HWEL 1BFTA 3ILPA 4RISL 4G9FD 1Q9KA 5IROC 1ZGLB 3GMQA 1KN2H 5IFAL 1DQDL 4ZFOA 2IJ0C 1QFHA 4AL8L 5M7QA 3WE6A 5J6GB 3HMXA 1JI2A 1G7LA 1NUNB 4X4MA 5AYQA 3RGVA 2EH8L 4PRPE 1HIMH 3MV01 5TDPB 5DSCB 2PXYC 3QIUD 4M93C 4PJCE 1G7IB 2AXHA 4OD3L 1JGDA 4ZAKA 1QRNB 1MCHA 4HGMA 1D9KB 1ZKAA 4U1HB 2DQEH 2X4PA 3AS0A 1S7UB 2I07B 4M7KL 3V4VL 1U91A 1C7SA 1A1MB 4GUPB 2E9IA 3VXUE 1EX0A 2ZP0T 5I8EB 5F7NC 3MLYL 1F90H 4XCFL 4NOFA 4PJAE 2HFTA 2LU3A 1CCZA 2PO6D 1BVLB 1MH5A 3SDAD 4U3HA 3NTCH 4KTYA 3IDUA 5HPMA 4Q9RH 1CI5A 1AI1L 4Z7VF 4Q74A 1BIIA 4BFEA 4PJ8A 4P23C 3HFMH 1N2RA 4S1SL 2X4TB 4J3OC 1W0VB 5DI8A 4PGCA 3ZE2F 2R0LH 2DQCH 4F3FA 2BSSB 3RNKA 3N50A 1QQDB 5IB3B 4JN1L 4L9LB 5J4MA 5C0AB 2GTWA 4Q0XH 1IC4H 4A6YA 2A1WL 5I66B 3SBWC 1A6PA 1REIA 3C5JB 3SDYL 5JHLH 5T5NF 4LARH 1KEGH 3GSXA 1MVUB 2ARJQ 1MCIA 4RAUA 1IFHH 1UWXK 4G5ZH 4LSPH 3FT3B 3RPIB 5DYOA 3CH1B 3L1OH 5CEXB 3QH3B 4F15B 1N8ZB 4WU5A 2OS7A 4NKDB 2MSPA 4UU9A 2XWJB 4QRRA 4GMSL 1VB9A 1UM6L 5KSBA 3D48R 4UQ2A 1RFDH 5DF0A 4L4VA 5EO0A 5FV1L 3PL6C 1TVBB 3INUL 5I75B 5JUEL 1BIHA 2VQ1B 3VMPA 4CMMA 3HI6H 4Z7NF 1KXVC 1QSEB 1ZA6A 1FL5A 4NQDA 1MHEB 3VG0L 5DLML 4UT6H 1GGIH 1D5IH 2OXHA 1UCBH 3PNWA 3K74B 12E8L 2R23B 2IFFH 3RVUD 4RIRA 1T7YA 3QIBB 1DQJA 3FB8A 2HT4C 1ZHLB 1CZ8H 3EFDH 4UB0L 2ZUUA 1IZKA 1YN6B 4I8DA 1WFNA 5DFTA 3UTZA 1FVDB 4D94A 3O3EB 4JO4L 2APWA 3UMTA 4D8PA 3PP3H 1T7VA 3GSNH 4KJWD 4M6NL 4U1MB 3H3KA 1YNTA 3B2UC 4TULL 2CK0H 4FQCL 1ULVA 4U1IA 1PZ5B 1RIHL 3I9GH 4IMLB 1HZHH 5IG7B 3TESA 1G6RH 1RHHB 3K81A 1JIBA 1OB1A 3EOTL 1DLFL 4XVJH 5E1AA 4FQXD 4Z7WF 4MXWH 3AMLA 4WFGD 4C83B 4ZS6D 4J3XA 5JW4M 1HHJB 1W0WA 1MCKA 4GAGH 1K3ZA 1MFCL 3L3KB 2F58L 4AIZA 2RCSL 3HNSL 1J05A 1R3LA 5I1LA 4ORGB 3S8WA 2HN7A 4JFEA 3MJ9L 4L4TE 4GW4B 4RDQG 5C1MB 5ITBH 1EEZB 1IEAA 3KPPA 3O3BB 4F7MA 1MF2L 2UYLA 1FZKB 3IVKA 3D9AL 3MRDB 1I3VA 3O2DH 5C0DA 5HYIA 1HNGA 2GFBB 3U9PH 3LEXB 1YNKH 5DEFA 4JG1H 5I1CL 1IGYA 5E2UH 5E5RB 1BD2E 2C4FT 2Y72A 2AJXL 3WSQL 3OGCA 3MUJA 1NL0L 3EYOA 1CGVA 2AABH 3LQAC 4L9DA 4LVHC 3NCYP 2DDQL 2NY2B 1VGKA 1M1SA 3CZFB 2YPVH 4WGWB 3ZKSD 3PWJB 5KSAC 4GS7C 1OD7A 4MAYC 3WFCH 5IBTH 3VW3H 3BEVB 4YHNB 4YHML 3P0GB 4X7SL 3ZLQC 3RTQC 1FL3A 3QEUA 1NGZA 5DMKA 1NDGA 4YK4C 1D5ZB 1X9QA 35C8L 3NH7L 2XN9D 5B8CC 1FV1A 5HHOE 4BSJA 1KENH 2R0KL 4LAQH 1LO5B 4MHHI 2Y6SC 1JE6A 2RQ8A 3QDMB 3X14B 1FGNL 5DJAA 1C12B 1MFBL 4OT1L 4XBPA 2E7MA 5HI5C 3T4AB 1I9JH 2OTUB 3U48A 1UZ6E 2QR0B 3HE6B 3JV6B 1IQWL 4U1HA 5JORA 2B4CH 5E1HB 5KS9A 1WAAA 4PGBB 2ZG2A 5JW3H 4FZ8H 5C0BA 1CD1A 5I8EA 5IBLD 2H6PA 1OTSD 5C0ND 1YEFH 2J8OA 2XT1B 3A6CL 1SBSL 1BVLA 4M62L 5BRZA 3QUYA 2V9RA 3SO5A 1EFXA 4FQJH 3T0EB 3P4NA 4FABL 5HYJB 2VLRE 5DQ9B 4TUKL 1IAOB 4JZJC 3VFOB 4FNLH 4GG6E 1K6QH 1N6QL 5HHVH 2X4TA 1YYLL 5IROA 2R1XA 2NTSP 3BGAA 5A43C 4HMCA 3QWOB 1QQDA 4YUEH 5IB3A 4L9LA 4EUPH 1SEBB 1EDQA 2DQJL 1AP2B 4M8VA 4R4FH 4JFFB 4U1JA 5C0AA 4XTRD 5IMOB 2X6MA 2HFGL 1HH6B 2QSTA 3EO9L 4G6KH 3C5JA 2PXYA 4NGHL 4RMTA 3BKYL 2P8MA 4HUNB 1Q8MA 3LEVL 4TYUA 1S7VB 1T5WA 3FT3A 3RPIA 5CEXA 2VB5A 5SWZB 2ZZUT 1JUFB 4TNVF 4UINH 3QH3A 3RVXD 4CJ1A 5ADPH 4Y89A 4DZBB 2MHAB 4NO3B 4NKDA 3I3DA 3SDXF 2I5YH 4MNQE 1DBML 4LSUH 1QBMH 2Z93B 2XTJC 1OQXA 4Y4KD 3TT3H 3ILQD 4GAYB 4XPAL 1ZLVH 3BP7A 3ZE1F 1CDJA 1TVBA 3BE1L 4YHZH 1QNZH 4EN3D 2VQ1A 1Q94B 4JRYB 2E27L 5CD3A 3S34L 3QG6B 1QSEA 4HLZG 3LKRB 2A77L 3DHJA 5EU7E 1WIOA 1VPOH 3SY0A 1T03L 2ZNWA 4OCXL 3C60C 3QCVH 4HS6B 1J8HA 2IG2L 3BUTA 1RQ5A 3UAJD 1QFUL 3ULVL 1I1AD 1TPXB 4DGYL 4CKVX 1T21A 3V8OA 1XF4A 4PG9A 5GGTL 3QIBA 1LILA 1ZHLA 5SWSE 2VMFA 4X6DE 4MA8L 1YN6A 4UT7L 4KHTL 3OAUH 2IEPA 2W38A 1KC5H 2ZUYA 3ZYJA 1UB5B 1G0DA 4XPHH 5JW4R 5LXGL 3FO0L 3W81A 2N4IA 4OI7A 1PLGH 2EKSB 4JR9L 3WXWH 2FECI 1KJ2H 4ZO8A 4U1MA 1NSNL 3VD5A 4I2XB 1G6RB 2ARJA 3AS1A 2KKQA 4ELMF 1S9KC 1SQ2N 4CADA 3K3QA 1YY8A 1PZ5A 3OKNA 4ONHB 4GW1B 4OD2B 4IMLA 4ENED 5FV2A 5IG7A 2CUMA 1CDYA 4NJAL 1OSPL 2QHRL 1RHHA 3S4SB 4F8TA 4L8DA 3TA3C 4RMVA 4Z7OE 1T1WB 1QG3A 2FH8A 1HHJA 2IAMD 4FQ2L 4OAWB 3QB7C 4O9HL 5FA4A 4QNPE 1VADB 2DLEA 3OB0H 4NKMB 1FAKT 1EHLH 1UWGH 2I24N 1QO3A 1YC8A 4ORGA 3RUGA 5JOPD 2R9HD 5EC1B 2XZAH 1HXMA 2D31B 4DEPB 1EEZA 1HYSC 5DZOA 1FZKA 4S1DC 1GL4B 4OZGB 4Y2DB 5I8CB 5KN5B 3G5VB 5TPWL 3LEXA 1BZ7B 5K9QI 1GAFH 4OGYH 1C08A 2WV3A 4QO1A 4P49A 5GRVK 4LGSB 2UZIH 3D18A 4QRSB 3LKSA 3L3HA 4Z77B 3HE7A 9CGTA 2IPUK 2BRRL 2V6HA 2LVEA 2ZKHL 3UTTA 4OLUH 1A6AA 5ETUA 3LHPH 2CLRB 4WV1B 4L3CB 3TWCH 5JMOC 4IRJD 1G1YA 3CU7A 1JWUB 3ZKXB 4Y5YC 3BZEB 3PWJA 1WFUA 5EU6B 5IKCB 1INDL 1CD9B 3NACH 4YHNA 4JQIL 5AAMA 3KDMB 5CEZH 3S3SA 2UUDK 5T3ZL 1X5IA 4YBHA 5J12B 4G6MH 4UMGA 3WFDH 3TM6A 1MCBA 4BUGA 5HYQB 4LSVL 3ZE0E 1E6JL 2HFFA 5JHDA 1X5KA 5BW7C 4RWHA 4O51B 1DVFD 4QOKA 5DD1H 2HT3C 1KIQB 4IRZL 3MOAL 5E0QA 5BOZG 2WAHA 5DJ2B 3X14A 4XWOD 1TVHA 5SWQB 4PJCF 1U42A 5IVOA 1Q72L 4G3YL 2OTUA 1UB6B 3TJHD 1FIEA 2EYTA 3O8XC 1WTGT 2QR0A 3JV6A 4KXZI 25C8L 3H9ZA 3GI9H 3T3ME 4FTVE 4ERSH 3T65A 3MPCA 4N8CH 2EIZB 1T2JA 4BFIB 1X4XA 4ODHL 2PR4L 4GSDL 2F54D 3SCMC 5I74C 1Y18A 4WHDA 4DKAA 1UM5H 4XI5C 2QQKL 4PJAF 2DLFH 4LLYB 1YDPB 3Q6GL 4XAWH 1MFAL 1YEJH 2EDNA 3GJEB 2ARWA 5BS0E 1TENA 4ZFGL 5FKAB 3T0EA 5FYKD 4X98A 3PWPA 1UZ8B 3ARRA 5KSAA 5DQ9A 1OP9A 3IYLW 4EUPB 3PHOB 3VFOA 1IGCL 2P8LA 1Y6KR 1U8IA 4LBEB 3JWDH 2VWEE 4XXDA 4H25B 5B8CA 3CC5B 4H0IA 4KRMB 1MCPL 5HVHB 4MS8C 1AP2A 3KPRE 4JFFA 4PB0H 5DD6B 1R5IB 3ETBF 3R1GL 4OIBA 1YJDL 1HH6A 4OZ4B 2BNUB 1I7UB 1QP1A 5EOQL 1A22B 1N6VA 4D0CB 3MZTA 4U1KA 4Y5XB 5JXEC 1U3ZA 4WUKH 1EJOH 2QADC 1UADC 2NY5H 3MXWH 4M1CD 1S7VA 3MV11 3F5WA 4KROD 5SWZA 3WN5C 3T3PE 5JXAH 1JUFA 3RWGB 1EZVY 4QXUL 2FZ3A 1J5OH 5LAXA 2MHAA 2W92A 3EYUL 4NO3A 5IQ9B 3BP5B 4PLKD 1OP3H 4NKOA 3MLXL 4Y1AD 4ZXBD 2OL3H 3SDDB 3PGCB 4HH9A 1M71A 2JE8A 4JLRA 3SE9L 4GBXB 3DO7B 3GBLA 3FJTA 1X4ZA 4AZ8A 1BFOA 3TFKD 2R8SH 4JDVA 4X4ME 5F1IA 3H0TB 5F1SA 3STZB 2Q86B 1IM3B 4JZJA 5IUSA 4KKLC 3H7BA 2FX8L 3KYOB 2MJWA 3VH8G 2Y4SA 5C09B 4U1GB 2P5WD 5LWYH 2UY6A 1IGMH 4ZFFB 1RUPH 4K9EH 2W9EL 2WIIB 1T6WA 3ARXA 5EZJA 1KJ2B 2K7PA 4YDLB 3MA9L 5E70A 1UB5A 4K3JL 1TTUA 5FDWB 2DYPD 2ADIA 3B9DA 3BOVA 4IRSD 4BH8B 4G6JL 4OLYL 2YD3A 1FNSL 1IGIH 5FOBA 3O0RH 4G6AD 4HHAA 3FQNB 7FABH 3O6FD 4ONHA 1YN7A 4GW1A 4OD2A 1YMMA 4P46B 4JFHE 4M61A 3ARTA 2DQHL 1K3IA 1S7RA 1OT2A 1KXTB 1TQBB 4AEIH 5BV7H 5I18H 2PUQT 3HRZB 2CSPA 4BK4A 3WL9B 1A5FL 5I1EL 2FX9L 1JYVA 4OAWA 2FHCA 4M7LH 4NKMA 2YD6A 5TFSH 1B6DA 4NJ9H 5CIPB 5BMFL 3KS0J 4L8BA 4QHLA 1F00I 2VL5B 2C4FU 3QQ4A 3C60A 4JO3L 4IMKC 1W0YT 3I6LE 1YPZB 2H41A 4OCSH 2ORBL 4J1UA 5IGXL 1AXTL 4QRRE 5D7JD 3MACH 4OZGA 4UIKL 1LO2H 4HJJH 3DYMA 3G5VA 3DMMB 5KSBE 1BZ7A 4S2SB 3ZL4L 4L4VE 1OD9A 4J2XA 3VGBA 2YMXH 3IDIB 2PF6A 3FB5A 4CVUA 5CMAB 5DRNB 5IFHL 2FEEL 4Z8FL 4WI5A 3U0TA 5IVXB 5TJWK 3U4BL 2NY3C 4NQDE 5HTSA 1AH1A 2JK5B 3D39B 2DM2A 4L3CA 4WV1A 4X5WB 1AIFA 4Z5RB 2X4OA 8FABA 4K71B 4X6BB 4UUJB 4LKXB 5C6TH 4GG8B 5EU6A 3BZEA 4IDLA 1TZHB 2GY7B 5H37G 3GO1H 5HBBA 4DKEL 3I50L 5GS1C 4AMKH 3KDMA 4NQVB 1NGPH 3HS0B 1KB5H 2PW2A 2VZOA 1CD8A 1T3FA 3VI3E 5FYKU 2DI9A 1G0YR 1TFHA 1I7ZB 4JGMA 4NRYB 5H94A 3ZSSA 3NPSB 5E99L 2ESVD 4O51A 1N26A 1KIQA 3TH3T 4XMPL 5DJ2A 1NLDL 1ETZA 5SWQA 1J7VR 1S8DB 4X4XB 5F7UA 1AR2A 4RBPK 3DXAB 4OQTA 5T3XL 1UZ6F 5F89B 5HHXH 1X5AA 4LCCB 3CCHA 4RGNB 1JNJA 3TPUB 2EIZA 1ZVSA 3K7UA 1E4KC 1VESA 4GQPH 3HLAB 2QSCL 1UVQB 1KCLA 2IGFH 1LEGB 5GGUA 4XMLH 1WTLA 2FRGP 4X83A 4LLYA 1YDPA 4O00A 2YBRB 2IAND 3MLZL 1JPGB 5C0CA 1H5BB 4ESKA 5ESVA 4JRXD 4X80H 2NY0D 3VFSB 4KZEL 2FBJH 4JFEE 4KAQL 5GGVH 1J11A 4Y5YA 4FMKA 1GGTA 4ZPVA 4P4KD 4MDJA 2HTKD 3M1BB 1M05B 1Y6MR 4E5XB 4GG6F 1BGXH 2CDEB 4JFZH 4H25A 5D70L 5FYLE 3GIZH 3OXSA 1DQQB 5BW7A 2F53D 4QRQB 4TVSa 5E2WH 5DD6A 3BKCL 3TBSB 5SX5H 4OZ4A 2PTTB 1I7UA 1MRCL 4LKCB 1JWSB 4D0CA 4WO4D 1IE5A 4R6UA 4KGJA 1ZA3B 3RU8L 1OGAD 4F2MA 4AJ0A 1GGBH 2OL3B 2R0ZH 3OF6A 3T8XB 3FO2B 5KVMC 1S7TA 5DS8A 2FHFA 5D1ZB 1PBYA 4Y19A 2ICES 3GIVB 2W65B 3VH8A 5C08D 2EIEA 3PGCA 3UC0H 4PP1C 5C92A 3E6HA 3TYFB 3RWFB 3U7AA 2OTWA 1FVEB 4R96B 3VGGA 1F58H 4I3SH 1FHGA 1U93B 5CJXC 1BBDL 3O6LL 1KBGL 2Q86A 1IM3A 5CUSL 1I3RA 2OJZL 3KYOA 2QSQA 5C09A 2Q8AH 5ESQB 3QA3A 1FJ1B 2W9LA 4DKFL 4ZFFA 5KS9E 3QJFB 1WAAE 1CG9B 4QRUA 2X4QB 3E6FA 3VFUB 5C0BE 4JM4H 5C3LD 3FQTA 5SV4A 1ADQA 3MV7D 1P2CA 4X6DF 1S3KH 3W11C 1FDLL 3V5HB 2HTLD 3LS5L 5JXEA 4Z0XB 4I3GA 5I19H 3BRFA 5I0ZA 4FQ1H 5BRZE 3O9WC 3HZKB 4JEGB 5EPMB 3WN5A 4U3CA 5HY9B 1A8JH 4LAJH 2XACC 3FQNA 3E8UL 1JNNL 4PD4K 4DVBB 2DMBA 3OZ9L 5DHVH 1FFNB 5EOCL 4DW2L 4HUVB 1XGYH 4NM8H 5GSRB 5C0AE 4F58L 1SYSB 1XH3B 3HRZA 4PLNC 1IEBB 2CGRH 3WL9A 5GS0C 4Z7OF 3SKMA 4PGZA 3NABH 1PKQA 4QNPF 5EFIB 1XGTB 5IESH 3WXVH 5CIPA 4OZIA 4KI1A 4GXUM 1RUML 1UM4L 5FKPB 1PDKA 4KKBD 1A7PL 2A9MH 3EGSB 5D6CB 3VWJB 1HYRC 3IETB 4JQVA 4HFWA 3C08L 1HQ4A 3MRPA 1Q1JL 1ZT4A 5I1JH 1DSFL 2BY0A 3B5GA 1CFQB 1NKOA 4I0PB 2V2WB 1NCUA 1C5DB 1CK0L 4S0TD 2VDPH 3MCLL 1I9IL 3IDIA 2DTSA 1TIUA 2WNGA 5DRNA 1EMTL 4LLVB 3OX8A 3SEPA 4JG0L 3QHFL 3QUML 3UCRA 2HJKA 3LN4B 4P2OD 3LN5B 2EEAA 1UWEH 2VDNH 1FZOB 5ISZD 5DJ8B 3MBEB 2I60H 3AVEA 2JK5A 4HFUL 4X5WA 1KB5B 1J8HE 4X6BA 5A1AA 4TN9A 1TZHA 4OJFL 3SDAC 1I1YB 1WBXA 2FIKA 4NQVA 3HS0A 3V7MA 2Q8BH 1QLRB 4LEOB 5D71L 2IQ9L 3ZE0F 1NAMA 4NRYA 3E2HC 3GNML 2R4RH 4G9FB 5E00B 4UV7L 5D7LE 2YKLH 4X9FA 4LNRB 3EYQD 2ERJC 4X4XA 3QEQD 3DXAA 1OLLA 1IMHC 3N1MC 5FHBH 1F45A 4FFVD 5JOEA 1IKFH 1HDMB 3T3MF 3ULSB 3QIUB 4DVRH 2VLME 2ITCB 2VR9A 5A2IH 2NTFA 4P2YA 2NLJA 1LEGA 3F7VB 5IHBA 2VZ1A 1M7IB 1YNLL 3HAEH 4DFHA 1L6XA 1NUFA 3CLEL 4JY4A 4KKCC 1NANH 2YBRA 2DKMA 3W9DA 1JPGA 2JTDA 3ZDXE 4NPYB 3RUGE 2I27N 4FQIH 5EORL 2XWBB 1VCAA 2DLIA 4OM0H 2ADFH 3U36B 3QI9D 1B0GB 2PO6B 1GIGH 5AYUL 2YD9A 4K8RC 1GSMA 5GS1A 1KTLB 4RNRB 3BRGC 3V4UH 2CDEA 4ISVB 1A6VH 1OAXH 1JWMB 1FE8L 1RIUH 3ARYA 4ZTPL 1DQQA 2J1KA 5FUZL 1ZOXA 4QRQA 2D7NA 2ZUSA 2BK8A 1HHIA 3PUCA 3TBSA 5L8JB 4MSWB 2VC2L 2YEZB 4MJIB 3V6FA 2DF3A 4LKCA 5E8NB 4PJGB 5AWNL 4K3EL 3B4NA 4JPVL 3KVQA 3UTTE 3L7EA 2RFXB 3FAXA 4I0KA 3T3PF 2EDLA 4WWKC 4O5LL 3T8XA 1E4KA 3WDJA 5HVGB 2BXYA 5DZNA 4RAVA 3V0WL 1PZUB 1FPTL 1Q0XH 4OLWH 1J18A 4KI5D 1IM9A 1BLNA 2B5IB 2GK2A 1CLZH 3I75A 3NCJH 4UDTB 5JHDE 3VXMD 3TYFA 4PG2C 4EVNA 1FVEA 1MREH 1ZGLM 4R96A 5DJCB 4H8WH 3MRMB 5GRUH 1F6AA 4QOKE 5H8DA 4XPBL 4LP4A 4TTGA 2VJXA 3RGHA 3ZTJG 4F33B 2LU7A 2DBLL 3GI8H 4MDIB 5FGBA 1LWRA 1N7MH 3F65A 5GPRA 5I2IA 4N0CC 1CG9A 1EEYA 2WWKT 5ANMA 3RDTC 3TBWA 3VFUA 1G7JB 4YEEA 3HMXL 3LQMA 3N1FC 4JKPH 1FFOB 4WGVB 4HCRH 4PJBB 3V5HA 4HJ0D 4E41D 4XH2A 3PHQA 5J11B 4Z0XA 1HI6B 2HLFD 3CXDH 4HUMB 4MA1C 2X41A 1OT1A 4L5FH 3MXVL 2EYSB 4V2CB 1AHWB 3T0EE 3PWPE 4V1DE 5GSVB 4LEXH 4FN0A 1LMKA 3ES6A 5FYJL 5E8OA 1HH9B 2B8OT 1OVZA 3MLVH 1YMHB 3UBXB 1FFNA 2AERT 4W6YB 1H3GA 4M9OA 5GRWA 4PY7B 4LDOB 2IFGA 3O2VL 3MLRL 2KZ1B 5GGSY 3F6IA 1XH3A 4YPGA 1IEBA 4ODSL 3LCYA 4KVCH 4JVWA 1P7QD 3MA7A 4JPKH 1LK3H 3LRSA 3QIWC 1XGTA 3VD4A 2Z31C 2E9WA 3CFBB 4Y7MA 4MCZB 4FQXB 3T2NH 3EGSA 5CD5C 1MFEL 2XZZA 4TUJA 1F8TL 3IETA 2JJTC 5DMIH 4F80A 2VDML 5SWZE 2OJEA 1FN4B 4TNVK 3WEXB 2BOBA 2GITA 3K46A 4A6YL 1CS6A 1CFQA 4JY6B 2BVYA 5JPMA 4RX4D 2V2WA 4PD4J 4LLWA 4OI8A 2L7UA 5KSBF 2VDOH 3LKPA 3TO4D 4KKAD 2DL2A 3LQAH 1QFWL 3O9WA 2W9DH 4LLVA 1K2DA 4ZS7H 3W2DL 2Y5EA 5CILL 3BZFB 3VGHA 1AGFA 1PYWB 2HLAB 4P57B 4IEFB 5C70A 3QZWG 5DO2C 1T7WA 5DJ8A 2MPAL 3LD8B 3MBEA 3QCTL 4X6CB 1AO7B 2FSEA 5IBLC 2ZOLA 1XGQB 4JFQB 3AS2A 1T1ZB 5FGRA 4UI2A 1RZIA 1VFBA 4HZLB 3IFLH 3VI3F 4NQED 3SDCC 4Z95H 1E4WH 1NGWB 2P5EB 2DLHA 1ZLUH 4OSUL 5E8PA 1OTTD 3GBMH 4XT1C 1KELL 2CH8A 2R29H 2X4NA 4WHCA 2XN9B 3KGRA 4Y16D 3TV3H 4ZFZB 5LGKA 4I77L 4ELKA 3HC3L 4ZD3H 5EA0H 1YMME 2XRAL 1YC7A 3SKOA 1UJ3B 1Z6JT 5BZDA 4XCYB 3QIUA 4JHZA 1JPTL 1X4YA 3RWDA 5GIRB 2XXCB 4AM0A 3DX7A 2ITCA 1I9RH 2IMNA 4OLVL 3BD4A 2NXYC 4U2YA 1Q38A 3F7VA 4P23B 4QTIH 5MEOB 3BQUC 2R56L 2EICA 5IF0A 2HJFA 4I3RH 5F9WB 1DBAH 2OYPA 5DD3H 3O2WL 3U2SA 3FQXB 1UG9A 4YDIL 2BSED 5E2JA 3SE8H 2PO6A 3ILQC 3LIZL 4X5XA 3SDAA 1F4YL 3M8OL 2IPKB 2NY7L 4ISVA 2A0LD 3J7HA 4PV9B 4OZGE 2OK0L 3EUUA 3HUJA 1U2HA 4NHCH 5HGBB 2R1YA 5GXBB 3AUVA 2E6JA 2OCFD 1DQML 4N9GA 3KLHC 3QQ3B 3DRQB 4CDGC 1G84A 5TF1H 4G8FA 1N4XL 2ZCLL 2J4WL 4PJGA 3HNTH 1BFVL 4LHQB 2Z4QB 3BXNB 5D7SH 5DK2B 2M2DA 4YAQA 2RFXA 1IARB 1XGPA 2H9GA 2M8XA 4UV4H 4C57C 4LCWE 4LSDA 2BVTA 5L0QC 2OMBA 3LH2L 4GKNA 1OCWH 4K7FA 2E8ZA 3BN9C 3X3GL 1OOAA 2CMRH 4NQXB 1C5BL 3O6ML 3MRMA 1Q0YH 4ENEC 1CLYL 3OJVC 4L3ED 1RAMA 4N5ED 4M8QA 3CSYB 3OBAA 5F70A 1K4CB 1A0QH 4BSWB 3T0AA 1JZ6A 4OB5L 1RULH 1CLOL 3UX9B 2IAMC 4ZNEA 4EN3B 4U6YA 3KG5A 2JELL 4WW2B 5KS9F 1S9XA 3WCYA 3AM8C 1WAAF 5L6YH 1T0NA 3DROB 1G7JA 5IT2H 4PB9H 5C9JB 4CN6A 3ZKMC 1F5WA 1FFOA 1RMFL 3NCCB 1I1AB 3A67H 4G43B 1YEIL 4JM2B 2E9JA 4DUXA 2C3WA 5C0CE 5EZLB 1MY7A 4NZTL 1DEDA 4YXKL 2EYSA 3BDBA 1AHWA 1Q9LA 4WWKA 3WD5L 3D87B 4LRIC 4X6EB 5ENWA 2VRAA 1HH9A 4I5BB 1YMHA 1F4WL 3GJFH 4S1RH 4LLMA 1MCQA 5I9QC 2BP3A 3VDBA 5IJVA 3F7YA 4XNYH 4Y4HD 3VXQA 4XCCL 1O7VA 3MYJB 5JLZA 4EBQH 4JZOB 3G9VA 5IK3A 1KFAL 1QFPA 2GEEA 3DBXA 5T5FL 1U8NB 2BX5A 4JANB 1AQDB 4MCZA 1D5BB 3F58L 1I3GH 1QPPA 4FQXA 4KZDH 2VABB 2NZ9D 4HIHA 1CXEA 3IU4H 2X05A 1Z0MA 2V2XB 5L2JB 1L4IA 2IWGA 2WWKO 5HD8D 5BZWB 4Y19E 2OX5A 3QZWA 1X6NA 2ATKB 4LSRL 5F9AC 5I1KH 5ID1A 3UDWC 4I18A 5T1LA 4NRXA 3VE0B 2X70A 3ESUF 2IH1B 2QEJA 1TJHH 3VFTA 1A6ZA 1DQTA 3HTLX 1BAFH 5CLTA 1YEEL 3RX5A 2Y36L 1PYWA 2HLAA 5DMGD 2FCBA 3O11A 2CIKB 5B39G 4RFNC 3JXAA 4OFIA 1MI5D 3DI2B 3VXPB 5F72S 1T1ZA 2DQGL 4LHUD 5TQ0H 5HHMD 1LHZA 2OQJB 5H35B 3UJIH 4P59H 4PY8I 3RWCA 4IRJB 3QIWA 3U1SL 2OLDA 2A6DA 5IOPA 3RZWA 4MNHB 1JFQL 4K07A 3FHQA 2AJZB 1LO4H 5F96H 3VGAC 5F6IC 3UO1H 1A21A 5IHUL 2LVCA 2EO9A 3NAAL 2XN9A 3ARUA 3QCUH 4HKXB 5INDA 1G1CA 3DVGB 3UTPE 4BZ2L 4HS8L 5IJKC 4TUOB 4PUBH 3RZCC 5I8OH 4XCYA 4E9LA 4RDQF 4DCQB 4GO6B 4TSCL 2BVQB 3HI5H 4M02A 1PKQE 3K4AA 1TNNA 5MEOA 4I9WE 3C8KB 5DQDH 3BD5A 3ZTNL 4DFIA 4OZIE 4JFOB 3TT1H 1IAIM 2F54B 5AD0A 2W0FB 3UPRB 3ZDXF 4PLKC 3RUGF 2UVFA 1MRFL 4E0RB 1JJUA 1KV3A 4XP1H 3FQXA 2V5MA 3FQUB 5IW1A 4P2QD 2ED7A 2VUOA 4X5LA 4X9HA 3WHE1 2D0GA 4NSKA 3TFKC 3WIIH 5EWIL 3FFCA 1H3PL 2BOCA 3C09B 4I48B 1TJGH 1FH5L 4QXGL 3KR3H 1DANT 3RWIB 5J1AB 4IS6B 3DRQA 3GMRB 4AY0A 3CPLB 4HX1A 3OR7B 2JIXB 1AGEA 5C0RH 3UJTH 4YHYB 3ECBB 5DRZB 3UYPA 1ES0B 4F7PB 2WUCL 3EO1B 2XTJB 3BXNA 3VXTB 5CJ8A 1LNUB 3D0VB 1BWWA 5DJZB 4OF3A 5DD5L 1T2QL 5FK9B 3WNPA 3IJYA 4PRID 3MC0A 1VEPA 1CR9H 2NR6D 3RA7H 1HXYA 4K3HA 3GSVB 4YHPA 4KROB 3RQ3A 4PBWD 4ZYKB 4F37F 1AC6A 4NQXA 4ZOAA 2AEQH 4KQ4H 4FA8A 4C58B 1AKJD 1ZHKA 2WBWB 3CU1A 2IPTL 3UZQA 2YD1A 4Y1AB 1KOAA 4HAGA 1HHGA 1KN2L 4RWYH 4ZXBB 4K7PL 4Y4KA 1FNGA 2C7UA 3P11L 3MYZA 1K4CA 1OWRM 4P9ML 1WF5A 2J88L 4GRMA 1MQKL 4EN3A 4LCYB 1L0QA 1OM3H 3SJVD 5K9JH 4F8QA 4EDXB 2R4SL 3P73A 5LBSH 3P40A 2NX5D 2P5WB 3VFMB 2DQEL 43C9A 1MLBA 2DTML 2AQ3A 2BHYA 3U4EB 2CQVA 4ZUUB 2DQDH 2IC2A 1IKNC 2AXGB 1JRHI 5D7JC 1IC5L 1NGXA 3GJFB 1F90L 2C3XA 1I8KB 4YQXH 3DGCR 4IOFD 3U6RB 4HK3N 1GJIA 2VL4A 4I5BA 4PYGA 1ACZA 1FNHA 4IRSB 2M1KA 3CX2A 1J86A 5F9DC 4D0DB 5C0IA 2G2RB 4KRNA 1T1YB 4Q9RL 1TZGL 3STLB 3NZHH 4OZHA 3O6FB 3EYFA 3MO1B 3MMEA 4JZOA 1ZTXH 4AYFA 2R0LL 2EZ0C 1BOYA 2HMID 2NY4D 4PJ9D 2FGWH 4GMTH 3NGBC 4R0LC 4M6OH 4JFDD 1D5BA 4NDMB 4Q0XL 7CGTA 1MRDH 3W5MA 2IAMA 2DLGA 1UJTA 4A2MA 4BKLA 4LARL 3AM8A 4JDTH 5C0EA 3LKOB 2V2XA 1BVKA 2E7CA 3GMNB 4GRWH 4PREB 1YZZA 2BHUA 5AAWA 3C6LC 3L3OB 1INEH 1K4DB 3V4PH 3ZZ1A 3R4DA 2WP3T 4LSPL 5B39A 4XPTH 3O4OB 3OXRB 4IJ3C 1CL7H 3VE0A 2WIMA 2IH1A 2CJUH 4H88H 1RZFH 2BSTA 1NFIB 4LRIA 5J6HB 5FYJD 4YX2L 2EE2A 2CIKA 4CU7A 4RGOH 4QWWD 4WW1B 4HIEB 1A1NA 2E6PA 3QQ9D 1Z9LA 3S36H 1GPOL 4JHBA 4RQQB 3HI6L 3RWHA 1U3HD 5ANME 1JF1B 5HSFA 5H35A 1A7RH 3RY6A 1U8MA 4P2RD 1U8KA 3BWAB 4IRJA 3WFEH 5DK3A 1W72H 1BQUA 4TRPL 1Y0LA 2PYEA 2XKUA 4ODVH 1ZLWK 4FOMA 3NCMA 3U9UB 1OW0C 5EC2B 4NZRH 2AJZA 1RUKL 3G5XB 5CJ5A 4JGUA 3BYTA 5ICXB 4CVZB 3HI1B 5LQBL 1SVZA 4HKXA 1ZE3C 6CGTA 4M5ZH 2YPKB 3W39A 4GKSA 4WRLA 4J3UA 4D2NA 1DVFA 2F19H 3UJJH 2CUIA 5IEKA 3V6ZB 3UDWA 3BKJL 2DWDB 2RB8A 3MV8B 1NAKH 4FFZL 3QNYB 5DA4A 3DSNA 1KF9B 2FWOB 2GUOB 3G08B 3HZVB 5L8KB 5ACZB 4NKQB 1GVIA 1DBJH 1CU4H 2DOCA 2P46B 5CGYD 2ZUTA 1S5IH 1LO0L 5AZEH 3C8KA 3LV3B 4JFOA 1DN0B 3T0BA 3V5KA 1B4JL 3UPRA 4LMQI 2F74A 4LSQH 4E0RA 4JY5L 4N0UB 2BFVH 2NW2A 3PP4L 1OF2A 4JRXB 4JPWL 1WT5C 1X3DA 2NY0B 3EDJA 5C07D 4KK5D 1CT8A 1IAIL 1BP3B 3DETD 1NUDA 4OZGF 4ZDHB 4WNQB 2DM7A 2XZQL 4I48A 5ITBL 3ULUD 4R4ND 4FG6D 1MFDH 5DFVD 5J1AA 4IS6A 4KKNA 2FR4A 3GMRA 1A3RL 3P9WB 3CPLA 3ECBA 2D2OA 3HC0A 4E42B 3AS3A 2D0FA 2Y9RT 4F7PA 3DOSA 4OCYH 2F53B 4YIQB 3EO1A 2MFNA 5IJKA 2VE6B 4JREC 3RX7A 1VFUA 3AU1A 3QUZC 3D0VA 2PTVA 1LP9A 1SJHB 1UKTA 2O26U 1T83A 5FK9A 2B2XL 5CLWA 3T4YA 4WO4B 3BDYH 3MRQA 5BO1H 4WJ5B 2OSLB 4B7LA 3N9GL 5DVOA 1JZ8A 2BY2A 1UA6H 2D7MA 4ZYKA 1DUYB 3TCXA 5B21A 4M43L 4JO1L 4LVNC 3VW3L 2H3NB 3WS6C 4NFCA 3T0WA 3U0PA 2WUBL 4ZXBA 5C08B 3IFNL 4WEBH 2Z8WC 5K9QG 1MAKA 3ARBC 4G7VH 4K2UL 4R7DB 4XNMB 1FO0H 3BPLC 2F5AH 3DLQR 5KSUB 3HNVL 4KUZH 3HB3C 3FFDA 1L7TL 2YPLE 4LCYA 2Y07H 1NCAH 4KKBC 5GQBA 1NCBL 4PJ5A 5ICZB 4X7FC 4UQ3B 3VFMA 3RJQB 3ULVC 3U4EA 2D7QA 4FQLL 3TEUA 4APQC 4MD0B 4OQTL 3DGGB 4P9HH 3E0GA 4HPOH 3MV7B 1AGCA 4TVPD 1HQRA 1YEFL 4F7TB 3EZJB 3T2QA 4J12A 2DYPA 4L29A 1WBYB 5T33H 3OL2A 1QUNA 2HKFL 4LLDB 4XNQA 2AJ3B 4Q9CA 6FABH 3EJYC 4FQJL 2G2RA 4AENB 2V9TA 1AD9A 3QPQD 3KPMB 5KVFH 3HUJE 3C8HA 5I30H 3MO1A 2EDBA 5LCVL 4OUUB 3S35H 4YUEL 3G6JE 4EIZC 1HE7A 3SGDH 3ARGC 4BFBD 4K94H 1C1EH 4JDZA 3Q3GB 4GRWB 1YEGL 3S37X 2XY1A 2OZ4A 3OJDB 2FX7H 2P1YA 3VXNB 4P2CG 2OI9C 2O61B 2AXFB 4G6KL 2XQYK 3HMWH 3FL7A 2GCYB 4QLRA 3LKOA 3MJ7B 4U1NA 4P4RB 5HYFA 4PREA 3GMNA 5JW4Q 3QT2A 4F7CA 5IW6B 1A6UL 5JO5B 3OXRA 5TE7H 4JJHA 3C2AH 1ED3B 4UINL 3G6AB 3EYQC 5DGQA 1JBJA 1IKNA 2F5BH 4POYA 5D7JA 1ZXQA 3BGMA 4G7YL 5A3ID 1QRND 4LSUL 1D9KD 4FFVC 1UT9A 3D85D 1QLFB 1NFIA 4LFHD 3TT3L 5JDSB 5EBLA 1EH9A 2DQTL 4Y8DC 1P9MC 1Q9OA 3OKKB 4OM1L 5HHNA 4WW1A 1MFNA 1LE9B 3KYAA 3CMOH 1QNZL 4ZNEE 1KJMA 1W72B 1FVCA 4P2OB 1Z9MA 1FZJB 3IS0X 1J1PH 1JK8B 3DV4B 2FJGB 1VPOL 3H9YA 1H8NA 4MD5B 2XTLA 1N5AA 1Z3GH 4QF1A 3TVMB 3V6OC 1F4AA 4KVNH 1SVCP 1CYGA 2A73A 5B4MC 4WEUD 4F7EA 1B0RB 1RV6X 3GMOB 5E03A 1ZHNA 1GOFA 3ARWA 2E7HA 2G5RA 4J23A 1I1FB 2X1QA 2AGJH 5CP7A 1A6WH 4XPHL 2WANA 3C6LA 1KJ2L 2ESVA 1ADQL 4ZUSA 3MNWB 3MJ9A 3PWLA 4X9GA 2WP3O 2HJLA 1U36A 4PRAA 1E4XI 4WI3A 3N85H 1CE6A 3G08A 4ODWA 4CDHA 3QEQB 4XC1H 1F4HA 3BO8B 1ORQA 3LY6A 3EJJX 1WGOA 4RMWA 2H45A 4C56D 2D4FA 4U1SA 2ZCHH 1FL6B 3GRWH 4OZIF 5EH1A 3DVNA 2IQAA 3S96A 2Q76B 1CVSC 3FQRB 5EOCJ 1XIWB 4JN2B 4K8RH 3VFGL 2Z9TA 4YWGL 1EHLL 2AK4D 2IANA 4RAHA 4JRXA 5E9DA 5E4EB 4JAMB 3SKUD 3K2UH 2VDQH 4ZDHA 2XZAL 1U8JB 3KS0H 3BX7C 2GAZB 2NXZD 4U6XB 3QI9B 4P4KA 4M9PA 4JKWA 1A7QL 1HSAB 4D3CL 4YHIB 3EOAA 2JJWA 2BSRA 4E42A 4O2FA 2V7NB 1GAFL 4OGYL 4G6FD 3SOBH 2F53A 4NFBA 3BDXA 2VE6A 4HWZB 1FYTB 4J3TA 4ZSOB 4IHOB 4NBYB 1JZ3A 1YJDC 4XNZB 1AR1C 1JN6B 1SJHA 4N5UA 3LPGA 1JPST 1QACA 1KJ3L 2HLFC 5HVWA 3BH8A 3LHPL 3O41A 2OSLA 1OGAA 1ZHBA 3MROB 3G04A 3TWCL 2MKLC 3QFJB 1GGYA 5ACLA 4J4PC 2O5ZL 5KSVB 2G9HB 4XNXH 2H3NA 1KLUB 2XV6B 1TZIB 2ZJSH 3T77B 3GSUA 3WFDL 1XCTB 4MXVE 5C08A 1QSFB 4NC1C 3VXMB 1RVFH 3HCVB 4C54A 1WT5A 5FHAL 3P30H 5DRXB 3IFPB 4QHMA 3I6KB 1WITA 5DD1L 3BPOB 3DV6A 3QO1A 1NAML 1UXWB 5E08H 4O4YH 4DQOH 5GS2D 2F9BT 3ARFD 3TNNA 2EDHA 3H2WA 5DHYA 4ZUWB 1C8PA 4GRLC 5ICZA 1LE5A 3F7RA 2J8UA 4PRDB 3DGGA 3NFSH 1PX3A 2DM3A 1T4KB 3MV7A 2X7LB 3QNZB 4F9LA 2DLFL 3KJ4B 3TIDB 2YD5A 1SY6A 1L7IH 4KC3B 3FQWB 2AJ3A 4HUUB 4NO0D 3IDYB 1TNMA 2UUDH 1X5FA 3FFCE 3KPMA 2J6EA 4JGJA 3TNMA 2XA8L 3CAFA 2D7TL 3WS6A 3M17B 3ZT6A 2PYFB 2ZCKH 5IMMA 4RCAA 3JWDL 4HBCL 3GKWH 4XC3L 4PB0L 5IVZA 1P7QB 3OJDA 4HKBB 2O61A 1OTUC 2AXFA 2N7BA 5HDQH 1DDHA 1YECH 5GJSH 4YDJB 2Q7YB 4XMKL 1S78D 5EUOB 3T2OA 5IW6A 5E56A 5JO5A 1OAQH 5D7KD 4APQA 3G6AA 5GGTA 1BBJB 3FMGH 1QLFA 1WBZA 5F3HA 2OL3L 5JDSA 2BDNH 1YEDA 3TO4B 3LB6D 5KG9B 5J13B 3ROOB 1LE9A 5K59E 1J1OL 4Z9KB 2ICWI 1H8SA 2ZSVB 4U33A 4OF5A 3CFCH 5ISZA 1BJ1J 3DV4A 2FJGA 4G80A 5JTWA 5LWYL 2YOCA 3BT2L 3QPXL 3RL1B 1IGML 1EGJH 3OPZH 4HJGB 4PJHA 4K9EL 3TH4T 4HMEA 3D2UA 2AV1B 2BVEA 4MWFB 3HR5B 3IDJA 4MQSB 1PAMA 3GMOA 2AK1H 1I1FA 4NNYB 4NQEB 5ESAA 3ESVF 1Z5LB 2VXQL 1R3IL 2J5LB 4HBQA 1JGVH 1FC1A 3BIBX 3A0OA 3MNWA 1ZS8B 2CO7B 2RBLA 3KLDA 3GHEL 4F9PC 1T1XA 1T89C 2YC1A 3L3IA 4OZHE 4TSBH 4Y16B 2XZCL 2B0SH 3QEQA 5IMLA 1MWAH 5ID0B 4N0YH 4P5TD 5F7YC 2X89D 1CFBA 5CSBA 3O4LB 4HQQH 4NQSA 3C6SA 4AEIL 5D1QD 3DUUA 1BM3H 5I18L 3FQRA 1GHFL 1P9MA 2EH7L 1SYVA 2E5EA 5IB4B 3JV4B 2V17L 1GGCL 1A7NL 4TQEH 5TFSL 4NJ9L 2VOTA 2H32A 2XQBH 3R0NA 4K7PX 5JOPE 3IDXH 3MRHB 4JAMA 2VDKL 2LV4A 4JO2H 3FO9A 5HDLA 4TTDC 3QI9A 4KMQA 3ZHKA 1KIUA 2X1OA 4WDIB 3GSWB 4LDEB 4OCRL 5F9JB 8CGTA 2WSKA 4NC0B 5D8JH 1LO2L 5HGDB 3B2VH 1DP0A 4HF5H 3MLPA 2V7NA 1PY4A 1ZT1A 2FATH 5CSZA 4IHOA 1MJJB 4R3SA 4CMHC 2X9WA 1K8DA 4HKZB 3LSOA 4OCMC 5K9KB 1H0DA 4PJIE 3TH2T 3QYCA 4RA3A 3MROA 2AJUL 1YY9D 3NPZB 1EO7A 4PRHE 2G9HA 5DJ6A 1P5UA 2PYEE 1U3JA 3GO1L 3TPKA 4FXGB 3LKNA 2A6IA 4Z7UB 2O5XL 3U7WH 1FQ9C 1KB5L 4PP2B 1IGFL 5E5MB 3T77A 5BVJB 1XCTA 3PGFH 5GGRB 4HG4K 2WBKA 3MUZ1 4CUCA 5TDOB 3THML 3NA9L 2X5PA 5L7XH 3MR9B 1BQLH 3WHXB 3I6KA 1HEZB 3V7AG 4KV5E 4GJTB 1WFTA 3MBXH 4DTGH 3T0XA 1WWBX 2Z35B 3ZYOA 1UXWA 5CZXC 3EYSH 3H6JA 2HRPL 5DWUH 4QRTB 5DQJB 2GY5A 2X42A 1FC2D 1BZQK 1UACL 4YFLI 3KLAB 4UDUB 4YDKH 1FRGL 3EJZD 3H9HB 4MA7H 4XMLL 3P4MB 3QNZA 4E41A 3O3AA 3T1FB 4URTB 5J57B 3DX9B 1ZVHA 3TIDA 1XGRB 4NWTL 3RNQB 1VFAB 2M26A 4YFEA 3FQWA 5EU7C 5KVEL 5DUBA 3TLRA 2FBJL 4AG4H 5FYKE 1T0MB 3VFVA 5GGVL 1ODAA 2JCCB 3HUJF 3RHWF 4L8SB 2VXUL 2G75B 1NLBL 1QYGL 2PYFA 3GMMA 3HG1A 1BGXL 1N64H 2NY1C 2WWMC 5C9KA 3MRKB 1J1XH 3GIZL 4Y4HB 1KXQE 3WIHA 2EECA 4LGRB 3FZUD 1JCKA 4G42B 2COQA 3IKCA 3TN0D 1RZ7H 1LP9E 3QQNA 2A83B 4S0SD 4K23H 1QR4A 5EUOA 1MELA 4MD4B 4GRLA 1NCCH 2AS5M 5DUMH 1GGBL 1MHPL 5JOFB 4PRBA 1Z9OA 3FTGB 4F37K 3PDOB 4YE4H 3CH8A 1BBJA 2HWZH 5L9DH 4H0HB 1BD2D 3RI5K 1R3KB 4HK0B 2HYMA 5DRWB 2WZPD 3UC0L 3DVFA 1TMCB 3TO4A 3H9SB 4DZ8A 2PCPA 5D2LB 1DTUA 3N06B 1F58L 3ARSA 1P1ZB 4FQQB 2ZSVA 3GFUA 4NBXB 5KANI 4JVUA 2Q8AL 1MI5B 4PJ5E 3U30C 1F4XH 4HWEH 3HKFA 3OKDB 4LHUB 5HHMB 4OGXL 1MCRA 1U0QA 3FOMB 3VD3A 4NQTA 3TIEB 2AV1A 5D96B 1XZ0B 4HDIB 5MEPB 1DQDH 4JM4L 4ZPTB 2GQHA 4AL8H 5HHOD 5F6HJ 1NH6A 3MRBB 2IH3B 3BH9B 1VDGA 4MXQD 2BNQA 2NXYB 2V9QA 4P3DB 2EH8H 3LZFH 1MWAB 4FQ1L 4LHUG 1ZS8A 4OD3H 2VAJA 4X7EC 1I7RB 3BW9A 3CFIC 4XRCB 3O3UN 2ADGA 3VFNA 1NBYA 5E8EB 4FFWD 1J8KA 1CIUA 1HK6A 4NNXA 2Q1EA 4ZO9A 1NMAL 4NM8L 1CBVH 4XCFH 4HC1H 4I4WB 2CGRL 4LVOB 5IB1A 4W81A 4LASL 5IB4A 3NABL 4U7MA 3PABB 3SDDD 2LFGA 3Q5YA 4MB4A 3R8BB 2GK0B 3R8QA 4LOUD 4GBXD 3KHQA 3UPCA 3RVVC 1U41A 4U1LB 3SGKC 4DOHE 3CFDA 4ODUB 4S1SH 1FAIL 4QGTA 4P2QB 4WDIA 3GSWA 5EBMB 2UY7A 2JJSC 3KPOA 2FHBA 4JN1H 2A6JB 1PY9A 1HHHB 3TO2A 4HWBA 4WCYL 4FXKA 4RGMC 4CVWA 1R3JB 3U7YL 2VDPL 1J0KA 4MZ2A 3SGJA 4UNVA 2FJHB 4F9PA 4XCEB 4M7LT 4X8JB 1BJ8A 1WLHA 3FHAA 4K55A 4P0DA 3VU2A 5K9KA 1DQLH 4KTDL 2N1KA 5C71A 5EBWA 1F2QA 5C0JB 4GMSH 5JW5A 4IOFC 4MNQD 1AJ7L 3EDEA 5DJXA 3PV7A 1UM6H 2O93L 4P46D 2Q8BL 3RAJL 5BVJA 2ZUQB 5GGRA 4MXVF 1ZAGA 4BM7A 4GKOA 5D5MB 3INUH 5JUEH 5TDOA 1R24B 4OKVA 2R4RL 1ZWIB 3QWRA 1AKJB 3WHXA 2ESVE 4L3EA 1HEZA 3HPJA 3UTSA 5F9OL 3VG0H 3X3FL 5DLMH 2NNAB 4DUWA 3SE3C 3R06A 1BOGB 3GSRA 1CFTB 1ZT7B 12E8H 3NCYS 1ZLSL 1LDPL 3W0WB 4Y88A 5GJTL 5F7DA 3BFOA 1X5LA 5EO1A 5SWSD 3SJVB 3CNKA 2MKWA 3TBVB 5FO7B 1KN4L 2R2BA 5MEQA 3H9HA 2XKSA 3V0AC 5DFWH 3RGVC 3VFRB 1XR8B 3DMMD 1CTNA 3P4MA 3OKMB 3B9KD 4O02L 3DX9A 1TETH 4M6NH 1XGRA 3MOBL 2IANE 3RNQA 3RIAK 4XPFH 4JRXE 5E9DE 4HG4J 4FQCH 4FQIL 2YA0A 3GSQB 4OM0L 1RIHH 2ADFL 2JCCA 1OARL 3ZYZA 5L88L 4OUOA 3VWKD 1OWWA 1A6VL 3EOTH 5CEZD 1DLFH 1OAXL 4QWWC 1T0PB 2QKIA 4TVPH 1OP5K 4KK9D 3OKOA 1KPRB 4KWUA 4Y4HA 3MTRA 1MFCH 2F58H 4GLRI 3HNSH 3KWWB 2LQRA 2NY4B 4PJ9B 3S9DB 1HHKB 3D5OF 4JFDB 1A4JB 1M7DA 3R0MA 4O2CB 5I1DA 4PJ8C 4WI9A 4MD4A 5TH2B 2ZUXA 3GSOB 1RK1B 1OGAE 4PRNA 4UBDD 5AUMA 1MF2H 5JOFA 3D9AH 4NWUH 3PDOA 1DBKL 2IBZY 5I1CH 1GH7A 1Q0XL 2YS4A 4OLWL 3T0VA 1H9VA 5C8JA 3EHBC 5FF6B 4RGND 1ZGLP 5DRWA 5MI0B 1NL0H 1XCQB 4N8VG 3TF7C 1CWVA 1KNOA 2GW5A 4H8WL 4EQ2A 5KTEH 4X6FA 4Q6YA 5K59F 2DDQH 1FIGH 1JGEB 4B41A 4FQQA 3ARDB 3UBXI 4YC2C 4XVUD 3O81A 3AREB 1DE4B 4OIAA 4FXLA 5K93A 1L6ZA 3KNBA 3RX8A 5D93B 1FNEB 3GM0A 3OKDA 1F3DJ 4LHUA 1WC7A 1U3HB 4YHMH 4JB9L 4X7SH 2J8UE 3L5XL 1XZ0A 4HDIA 4JKPL 35C8H 3NH7H 3D3VD 4P2RB 3MV7E 1ZV5A 1R5WA 3DETC 3MRBA 4PJFB 2R0KH 2IH3A 3QDJA 2KDGA 2GT9A 2BVOB 3BH9A 2JB5L 1RZGB 4P3DA 3S3JA 1RURL 4YH6A 3UP1A 1IC7L 3NCFB 4L5FL 3GKZA 3MCG1 5ITFB 4R2GC 1MFBH 2DQUH 1OQOA 5IMKB 1M4KA 2XKNA 2AJYL 4ZUVA 1I7RA 4XRCA 4M1DH 4OZHF 4NUGH 2QTEA 1ZMYA 3MLVL 3UZEA 2DMCA 5E8EA 2AEPL 3OKLB 3EOYG 4BSVB 2ITDA 3VXSA 1KGCD 5HI4C 5IB5A 2ICEB 4H1LB 3L9RB 3LS4L 5D1ZD 4LIQL 1DLHB 3C5ZC 4JPKL 1YQVL 1SBSH 3LDBC 2Z92B 1P4BL 5HI3D 3V5DB 4X4ZA 2HT2D 4DGVL 1JRHH 3QUMA 3FB6B 3JWOH 1OSZB 2GK0A 1F11B 3T2NL 1R5VB 2NY6C 1U8QB 1GC1H 4FABH 1XR9B 1U95A 1JP5A 3ULVE 4H1LG 1N6QH 5E2VH 4BZ1H 2XG4A 2UWEA 4P2QA 2ENSA 3JSSA 4H26B 4PFEA 5EBMA 4Z7VB 4YBLC 3BUYB 2A6JA 3O45B 3KPRD 2VAAA 2HFGH 2SEBB 3EO9H 1T22A 5EIVA 1QEWB 5ALBL 4NGHH 4R9HA 4OZFH 4XCEA 1MOEA 1A7OL 3BKYH 4ZS7L 5F7EL 3LEVH 2H1PL 4NUJA 3QUXC 2WBJD 5ISZE 3JZ7A 4PJIF 3WFBH 1WWCA 1KTRL 4JHWH 5C0JA 1XF5B 1NANI 3HC4H 2DIJA 3OAZK 4PJHE 1DBMH 4OF7A 1ZEAH 2GI7A 4HD9A 4PRIA 3K4DA 1AXSA 4L8CB 1K9TA 2Z91A 4XPAH 1G9EA 2OR9L 5DMJB 4KK6C 3PV6B 5D5MA 4FMFA 4DN4H 2EDQA 4XVTL 1LEKB 1ZWIA 3GBML 3SGKA 4EI5C 5AG9A 3VFWB 3S34H 3PWNB 1U8HB 4KV5F 4HS3B 1T03H 3O6KH 4OCXH 2J3SA 2IG2H 3OB0K 1QFUH 5IIEB 1BOGA 3VGEA 1CFTA 1QBLH 3VWJD 4WFFD 3D25B 3FRUB 4NIKB 4CGTA 3DIFB 1OHQA 5K9OB 5A16B 1RIVH 4MA8H 4UT7H 4KHTH 4S1QL 5C0FA 3F62A 5LXGH 3DURB 2NX5A 2FD6H 1XR8A 5I1AB 4JR9H 2CIIB 1NSNH 3AAZB 5EIIB 4CVXA 1T04B 2AV7B 5DD3L 1D9KC 3MNZB 4PGEA 3V6OE 4HIJB 1PD6A 2V2TB 1OAKL 4HUWA 2HG5B 5GGSB 3F7QA 2P4AB 2QHRH 2CKBA 2O5YH 2H2SD 3L95B 1G7PA 5T3ZE 3KXFE 1J12A 5INCB 4XCNA 3MREA 3HZYA 1UH4A 1KPRA 3WBDA 5J9PA 3FB7B 4O9HH 5F7FA 3PE9A 3WFZA 1Q9WB 4WU7B 4Z7WB 1KT2B 1LP9F 3KWWA 1T20B 4M7JH 4HK3J 5FYKL 4OGAC 4PJ9A 3BP4B 4KH2A 4P5MB 2DL9A 2CRMA 4JFDA 3GSOA 4N8VA 1RK1A 1EA9C 3KPQB 4YHOL 4WWID 3MODL 4QRRD 2D9CA 1KIRB 2YWZA 3ZT7A 3CSGA 4L9LC 1B9ZA 4X4YB 3GHBH 1OCWL 5TPWH 3X13B 1EXUA 3F12B 1CF8L 3MNVB 3EAKA 1CE1H 1KEMH 4NO2B 2BHZA 2MTPA 5J0BA 1Q0YL 4NZUL 1NGQL 1HCFX 1WFOA 3D85B 5KW9H 1H8OA 2UZXB 4TNWF 3RVWC 3QDGE 3BSZL 3C5SB 1JGEA 1CICD 3IRZA 3TZVB 4OFYD 3IXTB 1HSBA 4KUCD 1NC4B 4F15C 5ADOH 4V2BA 1DE4A 4HWUA 1RULL 4LPTA 1INDH 5C86A 1FNEA 3HA0A 4JQIH 2BC4A 4S10A 4GQ9L 5L6YL 2XFXB 4PB9L 3QULB 4LFHG 1CXIA 4LSVH 1E6JH 4P2RA 5I75C 4BJLA 5D7IA 3FT2B 4E41E 4XHJC 5KJRH 5IB2B 4Z0BH 4IRZH 4DUVA 3WKMH 5ITFA 1RJYB 2DAVA 4GAJL 4NZJA 4MJID 1Q72H 4G3YH 5DUPL 2YD8A 3NFNA 1G0XA 3QFDA 4UOW1 1K8IA 5AEAA 25C8H 3IDNA 3BAEH 3KYNA 3V2AR 3QIBC 4IIQB 3HG1E 5D1XD 5TDNA 4ODHH 1XGUB 2PR4H 4GSDH 3RKDC 4NC1E 4QHKI 2VITB 3QP3A 5D2NB 4PR5A 5JQ6L 4H1LA 3L9RA 4EIGB 3KYKH 4M4RA 3Q6GH 1MFAH 3GGWB 3FB6A 1OAZL 4C56B 1PEZA 2BJML 1P4IL 1OSZA 4LLQB 1G9MC 4JFED 1F11A 1I3GL 1UXSB 5F3BA 3EFFB 1R5VA 5EUOE 1N3NB 4Q6IB 4YXHH 4L4JA 1GOHA 2FEDD 2VR4A 1QKZH 4MB3A 1IGCH 3IU4L 4UNUA 4HPYH 1P6AB 1IGJB 2AK4B 4H26A 5I8KL 5C07A 5FYLD 2OZ4L 3G5ZB 1MCPH 4JRWA 2ZG1A 4OZFB 3TCLB 5D72L 1YJDH 5IVNA 2NXZB 2XWTB 3WS3A 2SEBA 5CHNA 1FP5A 1KUMA 1D5MB 1QEWA 5EOQH 1WZKA 3VG9B 4G6FB 1OY3B 4MNGB 3VRIB 3UTQA 3KPNB 1NJ9B 4M5YL 5GZNC 3EZ8A 5E6ID 3MLWL 3MLXH 3C5ZA 4R90H 3ZDYE 3UJIL 5FA3B 2P43B 2VLJB 1BF8A 3ROLB 3SE9H 3SDXB 5E8DL 4RZCA 2BNQE 1RJLB 3HE7C 4LF3A 5MENB 1ZANL 1LEKA 2NY2C 4NQUA 1E6OL 3JWNC 1LO4L 3VFWA 5F96L 1U8HA 4X8XA 1NGYB 5EU5B 2FX8H 3UO1L 3VFPB 4HS3A 1WVZA 4M03A 2YRPA 5IIEA 2EE9A 4XP9L 1G9NH 1UKQA 2VN7A 2W9EH 1AGDA 3MCKB 2JB6A 3I02A 5C0BD 5I8OL 4Y4FB 5K9OA 4PJXA 2EDYA 1QA9B 3TBYA 1JPSH 3E1F1 3LQZB 1MCFA 3MA9H 3ARFB 4K3JH 1HN1A 3DURA 3BEWB 3VXOB 2KPNA 3HI5L 2ED9A 1S9YA 1H3UA 5BRZD 3QUYD 4G6JH 3QUXA 4YDVB 1EFXD 1FNSH 3EYVA 5ACMA 3HE6C 1A9EB 3DI3B 4A2LA 2FECL 4XP1L 3QXDB 4LPXA 2V2TA 2HG5A 1P7KB 4ELMB 3MX0A 3LB6C 1E4XH 2ZOKA 4QHNB 4NO0B 1AO7D 3WIIL 5FDYA 5INCA 1HOCB 1KTDB 3K2MC 5I1EH 2FX9H