3C6AA

Crystal structure of the rb49 gp17 nuclease domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
206
structure length
198
Chain Sequence
GTLIRATTLSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSEGRGQDYHALQIIDITEFPYKQVAVYHSNTTSHFILPDIVFKYLMMYNECPVYIELNSTGVSIAKSLAMDLEYDNIICDSFIDLGMKQSKRSKAMGCSALKDLIEKDKLIINHKGTIQELRTFSEKGFHDDLVMSLVIFGWLTTQEKFAEYAGKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Terminase large subunit
publication title The structure of the phage T4 DNA packaging motor suggests a mechanism dependent on electrostatic forces.
pubmed doi rcsb
source organism Enterobacteria phage rb49
molecule tags Viral protein
total genus 66
structure length 198
sequence length 206
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3c6aA00
5M1NA 3C6AA 3CPEA 5M1KA 4IEEA 4IDHA 5M1QA 5C10A 5C12A 5M1OA 4IFEA 5C2DA 5C2FA 5M1FA 3C6HA 5M1PA 4IEIA 5C15A
chains in the Genus database with same CATH superfamily
3MWPA 1FKPA 4MQ3A 4FYDA 3ZX3A 1CXQA 1WSHA 3CG7A 3LDNA 3V1QA 2EWSA 4LY7A 3DLRA 1EKEA 3V1OA 2GWKA 3BEXA 2A41A 5AQQA 1CZAN 3MEDA 4O8KA 4H8KA 4MO5A 3LWLA 3V6DA 3CYMA 4M45A 2VG6A 5IWAK 3CPEA 3RVCA 5BRFA 2HHUA 3LL3A 4CFAA 2KFNA 2Q0RA 1T05A 4H0VB 4CHQA 1YTAA 3KK3A 3LPUA 5KPTA 3FGUA 3LP2A 2E4LA 2KHOA 2WC9A 3RTVA 1J9AA 1QHTA 3AY9A 3DLKA 5J1EA 3L2RA 3HSTB 1RTJA 2KZMA 3SUOA 1RT3A 3OYJA 1C1AA 2YKNA 3NE6A 3C95A 4RW4A 3VF4A 1S9EA 3CHWA 3KVGA 5F2RA 2AA4A 1X9SA 4B1WB 2YCHA 4FL9A 2ZGYA 1LW0A 3ZYYX 5HP1A 2D0AA 4IZ9A 4KHUA 1A5VA 3G71N 4DSKA 2HB5A 4FLWA 3QNNA 4NCGA 4C23A 3AA3A 5HL7L 4CD1A 2NZTA 4BRMA 5BPNA 4KHWA 4ZHRA 1YITN 4NXMK 1C0MA 4CGIA 3QO9A 1HNIA 4CZHA 3ZCMA 4OKEA 3VTIA 1L5UA 5ELZA 3DMJA 3FZKA 5HRRA 3E9LA 4A57A 5JS1A 1NM1A 3QERA 1NGAA 1U6ZA 3MN6A 4JAXA 2P5GA 4FW1A 4CK3A 4BRHA 5ADXA 2IIRA 4NYFA 3SMPA 1MDUB 4PKGA 5BR8K 5BPMA 2B4JA 4C8KA 1Z05A 2Q1NA 4IKFA 4BRKA 4TSXA 2YHBA 2E88A 4JKHA 3M1FA 4FXDA 2RPIA 3AVLA 3TTFA 3ULEB 2D4WA 2F4VK 3AVHA 3EO3A 2W6KA 3OYKA 2D1KA 3CJ7A 3LM2A 4QAGA 3D45A 3TAMA 1HUXA 3ZX0A 4W5QA 1VQNN 3NGZA 3OYAA 3DLGA 2HHHK 3VOVA 1KAXA 2OTJN 3V9ZA 4JLHA 3VEZA 4BDZA 2P1JA 2O8EB 1WSJA 3HL8A 1OVQA 1NK0A 1QSSA 3I8BA 3WNHA 4AILC 3OYGA 1DTQA 5HRSA 5HBMA 4JI1K 2RF2A 2QKKA 5AQFA 5AQGA 5AQPA 1CLQA 4WE1A 4Y0WA 5AQKA 2LSNA 4XH1A 1TV6A 1C0FA 4RWTA 5FPNA 1E4GT 4CGJA 4K8ZA 3KJVA 4FVUA 1U48A 5E26A 4W5OA 3AVMA 4XH4A 3AO2A 2NNWA 1P90A 3HT3A 1Q18A 2YNGA 4WQ5A 3T7ZA 4JKAA 2KKZA 4JK8A 1QVFM 3UKRA 1NGIA 1RTHA 1RCHA 4YY3K 4KRFA 1SKSA 1WSGA 1S9GA 3VETA 3GOIA 1N5YA 1VQ9N 1JL2A 3HVRA 2E2QA 3SZ2A 2D0CA 4H5RA 5KTQA 2IVOA 3G25A 1RT5A 4X64K 4JI5K 3AAPA 2H3GX 4KHNA 2EX3A 3ENBA 4HVJA 3MXIA 5FLXO 1RBRA 1HRHA 3AGRA 4F2RA 3SCXA 3VEOA 4KREA 3DAWA 4DR7K 3RR7A 3M6GA 1TAUA 1O13A 3A5NC 1Q7YO 3TANA 4YORA 5CZ1A 1GLAG 4CGFA 4CJ7A 3IAYA 1UA1A 2QWQA 1NOZA 1ATSA 1F21A 4Q5VA 2DY4A 3VF6A 3JXUA 4J2EA 3AGKA 4B9MA 1ITGA 1YUWA 4IJAA 3U9ZA 1Z25A 4FJMA 3KKSA 4B3OA 5JS2A 1U47A 5AQJA 3DXMB 5HLFA 4DV6K 4KHPK 1C6VA 1S1UA 4M3WA 4BE0A 3SNNA 3FZMA 3CMEN 1W2BM 3KD1E 2E8AA 4EHUA 1GLDG 2XY7A 1D4XA 1V4SA 2FSJA 4HCCA 3OBWA 2PY5A 2IS3A 3N4PA 2RE2A 3O3FA 4CECA 3S3NA 4WYBA 2O8FB 3RMCA 3PIOL 5JVHL 3NH2A 2RN2A 4FWKA 1EWQA 1X9JA 2J4RA 2B5JA 4KKOA 3VEYA 1KSPA 3VGKA 1IKWA 1KRPA 1NGBA 2OZSA 3AO5A 1X9MA 3R8EA 4HWIA 2YNHA 2G8IA 3MAQA 3CF5L 1T44A 3LWMA 3H3OB 4HTUA 3VERA 4B9VA 4DV4K 3KHYA 3KD5E 3KTQA 5JLFA 1NGGA 1KC8O 3MN7A 4KTWA 3EE9A 3A2FA 3SJJA 4CZFA 5DMRA 2V51B 3NH1A 3JAMO 3QEIA 4KB1A 4ILHA 1SL2A 3NF8A 5HROA 2OPQA 1FK9A 1VQPN 3MMVA 1I39A 5FRMA 2O8BA 4BDYA 5LY3A 4GW6A 4GNIA 4B1ZA 3HSCA 2BGGA 5CR4A 4M3RA 4EIAA 4DWIA 5AZIB 1GLEG 3LALA 5KQ8A 2DFEA 4CJ4A 4WQ4C 2P9UB 4WFBL 2XO7A 2OPRA 1LOTB 5AQNA 2G8UA 1P8ZA 4GVMA 2OANA 3HZ6A 2Q0UA 5GIOA 4CZJA 4B9SA 3OY9A 4CZGA 2JWLA 1V4TA 3O6WA 2P9LA 5AZJB 1K6YA 3ZT1A 2GWJA 2XRIA 4JI8K 4OPAA 5AZIA 4Z4CA 3RSEB 3HBTA 1IKVA 4CFDA 2GUIA 2P9UA 1MWKA 1M1KO 4LFBK 4CEEA 4CJFA 4DTJA 1K8KB 3HM9A 4FJJA 3TAEA 1HNZK 5BN9A 3J7AP 1BIZA 2KTQA 1ZYQA 4CZKA 1RDCA 3CM5A 5EOYA 4H4OA 1JLFA 4OGCA 3RMAA 3CC2N 3L2WA 4CK2A 2PZSA 4CW7B 4IOCL 4OX9K 2D5RA 4DR5K 2PYLA 3NF9A 1D8YA 4GY2B 4B9QA 2FSKA 4CZIA 2VCPA 1K8KA 4YOWA 4BRNA 5LMNK 3NVMA 5AQRA 3K5LA 3AVFA 1BCOA 5E84A 3ZSYA 5C12A 2F9TA 5GINA 1J54A 3QNOA 3O4WA 3K5NA 4FJHA 2ASPA 1RBUA 2YHWA 4XH5A 3MXMA 5J2QA 3T19A 3QICA 4E89A 2QWRA 3VQBA 1HPMA 3NGYA 2NUBA 1NG9A 2I5JA 1WNSA 2FBYA 4BC5A 4ZTFA 4CZLA 2HNDA 3ZETA 1G15A 2IAJA 3SK3A 1Q8IA 1ATRA 3MK6A 4CFCA 4DQQA 2HMPA 4KB0A 3O3GA 1VSDA 2E6MA 3CETA 4IDHA 2FF3B 3D7EO 1NOYA 4BG8A 3BZKA 1N36K 4CJQA 3TSUA 2A5XA 3IMXA 3OYIA 1WBBA 3HPOA 4CJPA 1U4BA 4K25A 2V7YA 4F9OA 1KVCA 5HRPA 4Y1CA 3CCLN 2QXLA 4B08A 4K43A 2EHGA 4JI0K 1XC3A 5BREA 3I56N 3Q7CA 4LSLA 3VA0A 4Q0BA 1RTDA 1GLBG 1QVGM 2FXUA 1XNRK 4IEEA 2BDPA 4MDBA 1XI1A 2CGLA 4FWRA 4FWLA 3V1RA 2ZWHA 3V9WA 1ZBIA 2W42A 4G1QA 3DI6A 4K41A 1HLUA 3OHRA 1T3VA 2UXBK 1A5XA 3MN9A 3U8XA 3CCMN 1N33K 1D9DA 3CCJN 1JLEA 3VPZA 1Z6RA 3V9XA 1G99A 1HYVA 1ZBSA 4LH4A 1OVYA 4BREA 3AVIA 4AH9A 4FJ7A 3SUQA 4IO9L 1IG9A 5EVZA 3CFRA 1UA0A 2VGMA 4CBWA 4IXCA 1TK5A 2G8FA 3AAQA 2P9SA 4IDKA 3WNFA 4M42A 3ZSVA 3O8MA 2OZMA 4CJKA 5AQIA 3QIPA 3NDKA 3WXLA 4BG9A 4UY8O 4N56A 1OH8A 4BACA 3ZT4A 3QB0A 2GBZA 3K58A 3TTCA 4C1NK 4CERA 4CEZA 4ZTJA 3KZBA 3OYBA 1T03A 5LJWA 4EP4A 1VSIA 4QS9A 4FK0A 1WOQA 4Z0UA 2HVIA 3C6TA 4M7YA 3OBYA 1NGJA 1NMDA 3L4IA 1U04A 1ASWA 4CESA 1IV0A 3DRPA 3OYLA 3KWIA 2UUCK 1KQSM 3TR8A 4HUEA 5FROA 1Y97A 2V7ZA 3TAPA 3OYMA 3O4QA 5KI6A 4DG1A 4H5NA 2P9KA 3LP3A 1RDBA 3TSQA 5M1PA 2UXDK 5M1NA 4FOEA 1JLBA 1JXEA 4DB3A 2XHBA 3P39A 3FR0A 2B6AA 4HUFA 4CEQA 4WF9L 1WSIA 3H45C 3LDLA 3H1QA 1IJJA 3D2FA 1TUUA 3CCEN 2BH1A 1BHLA 2F96A 4LF7K 1NGHA 4Z4IA 1RFQA 5F1XA 1SKRA 3OJSA 3M3ZA 1BCMA 1BISA 2Y1JA 4F3TA 4IEIA 4E7JA 1BG3A 3PLAA 2WOMA 2DFFA 4M3ZA 1XNQK 5BRDA 1CZ9A 1RDWX 3GBTA 3IG1A 1WSFA 2O8CB 2ATQA 3ALYA 3NH0A 4H5VA 4DR2K 4JI6K 4BRLA 4IO8A 2XY8A 3CCSN 4CEBA 4BC3A 4LSNA 1QE1A 3K2PA 4BR2A 4CEAA 3C65A 1L3SA 1MA9B 1BIUA 3CJCA 4J2BA 3CQXA 5F0XA 4B3TK 3QEWA 3S3OA 1JL1A 2HMIA 2BANA 2CH5A 1FXXA 3QIOA 4DTMA 1OH5A 2O8CA 4DR6K 1H1VA 3SUNA 4C8MA 4QOZB 4BY9C 3B8AX 4AHTA 1VQ5N 3O3HA 3DLLL 1XQSC 2D0PA 3L3VA 1IBMK 3Q7BA 3D2EB 1SUQA 4DUYK 2E20A 1KTQA 5LJVA 4A2BA 3MXJA 1NJIO 2UXCK 4CI6A 4GV6A 3WT0A 3CC4N 2P9PB 3KWGA 5AQSA 3H08A 3J80O 2CGJA 4B1YB 4WQ5C 1KD1O 1VQON 2IOCA 2RHKA 3O5BA 3LANA 4JI7K 2PFUA 4KI4A 1HJOA 2GTDA 4JN4A 3VEVA 4DU1A 1QSYA 3VQ7A 3VGMA 1T6DA 1S22A 5C25A 4RW6A 3TTDA 4GVEA 3FZFA 2CH6A 4O5BA 2P9PA 4QS7A 5KPZA 1JCEA 4DTSA 1JLGA 1NGCA 2KFZA 5CZ2A 1XUPO 3WNGA 5AQUA 4E19A 4CEDA 1JLQA 4CIFA 1MU2A 4B9NA 3VQDA 3PX4A 3E9OA 3AVJA 3T3FA 2PYJA 3QMLA 3BF1A 1W97L 4JRQA 2ZJPL 3PIPL 4CEFA 1HKCA 5C15A 5LMUK 4PA1A 1K73O 2HF3A 2YHYA 2IVPA 2JWKA 5C42A 4LF8K 4KBOA 1NKBA 1K8AO 3IDHA 2WBNA 5M1FA 5C2DA 3IUCA 1LAVA 4JKDA 3HI0A 4DTUA 1WB9A 4RTFD 5C2FA 4BRAA 3NAEA 3R3LA 2FBXA 1OH6A 3VQ9A 3UB5A 3ULEA 3KLHA 1RT6A 1S6QA 2DFHA 1TVRA 3OYNA 4YOVA 4V19S 4ILGB 3P31A 3K59A 3P1GA 1HX1A 1KFDA 4H0YB 1SL0A 1NJYA 1NGEA 4I9LA 1QQCA 4DF8A 2BTFA 2O8EA 3VESA 1N8RO 2UUAK 4FJKA 4CJLA 2A42A 3NVKA 3SAGA 3K0SA 3BDPA 3JSMA 2HW3A 1CXUA 3BZCA 3LDOA 1O1WA 4OPJA 3W0LA 1Z26A 2PBDA 4F2SA 5SZTA 1ILYA 3C6HA 2X78A 1EWRA 2I7PA 4C8LA 3OYDA 1Y64A 3S41A 4ELUA 1X3NA 4B9LA 3DRRA 1QQOA 1NKEA 3NHGA 3FZHA 3MX2A 4DQ8A 3U3YA 3DWLA 1ATNA 3P83D 3A0IX 3QBWA 1VQMN 1VHXA 2F8SA 3TSPA 2P9IB 2O4GA 3KKRA 3O9RA 1GLCG 4DSJA 3L2UA 4H0PA 1T8EA 3RRGA 3VQAA 4PY5A 3AA5X 1LW2A 3UKUB 3I8DA 4JKCA 3OW2M 1TUYA 1NNEA 1HJRA 1VQKN 2HOEA 3HK2A 2YHXA 4O0JA 3CJBA 3P5JA 4W5NA 3LAMA 4W5TA 1HKGA 3ASMA 3AVNA 3F73A 3JS6A 5JVGL 1VQ6N 4H0TB 3WXKA 1HYSA 3P38A 4GMJB 5AFUA 1L3TA 2Y1IA 4DFPA 2ZJQL 4A5AA 4J2AA 3EZ5A 4O5FA 3M8PA 4KAZA 4ID1A 4BQZA 3O9SA 3G4SN 2FBVA 3FE1A 2Z1GA 1QSLA 3NCIA 4GV9A 4CFBA 4DQRA 4JHDB 3RMDA 4AHRA 5C0YA 4FLVA 3THWB 3MEEA 4KHSA 2XY6A 1C0UA 3KLEA 2G8HA 3DXMA 2HHXA 3MCPA 3UE5A 4FM2A 3C94A 4CIEA 1RBVA 3MEGA 1IG8A 2I7NA 3O4NA 3LDSA 4DQPA 4EZ6A 3J81O 4BRIA 4JKGB 5AFUH 4JHDA 4BRCA 3F9MA 2A6AA 3CMAN 4YHHK 3THWA 2HNYA 3OS0A 5AJ3K 1J5EK 1BL3A 3OVNA 4BR4A 1JCGA 1FW6A 4N76A 4J8FA 3CJAA 4R79A 3CC7N 2O8FA 4I9QA 4MLHA 4DFKA 2ITGA 3J8AA 3PX6A 3WQUA 2F9WA 4JKGA 3DOKA 1KLNA 1W9HA 2Z1HA 1IO2A 4CBUA 3HYFA 4PKHA 3PUFA 2HBJA 1Q81O 1HR0K 3CJ1A 1NJWA 1R0AA 4CK1A 2VGNA 3O9UA 3D6RA 5GIPA 3SPZA 1ZBHA 4MLEA 4JD2B 3KLFA 2QTDA 1U45A 4BRQA 3L8BA 4Z4EA 4OO1J 4FO0A 3J7YP 1BOTO 1BGXT 1YIJN 1S1WA 3WEEB 5CE3A 4BRDA 4HTLA 3A5LC 4ELTA 4M3UA 1GOBA 3CQ8A 2Z1JA 1TKTA 1VK0A 4DV7K 4B3MK 1QQNA 1BQMA 3ATVA 4FWOA 3HXMA 3DXKB 4JD2A 4JK7A 4CE9A 2X6SA 4O4GA 5GAEP 4DU3A 4FWSA 3SV4A 4B9TA 3DYAA 5JMVA 2GUPA 3IFRA 3WEEA 2IDOA 1KXPA 4YDUA 2G8WA 1YJNN 3TABA 1ZXOA 5KQDA 4FM1A 4JI4K 2F8TA 3V9SA 3MX5A 1ZBFA 4YOUA 5TKWA 5DM6L 4CVNE 3V9UA 3SLCA 3ZSZA 4UQGA 3QLHA 4DV5K 3S3MA 4BRGA 2HBKA 3LDQA 4AF1A 4B1UB 4OVLA 5AZJA 4BVOA 1TAQA 3RSEA 3K57A 3ID8A 4DS4A 4FJ8A 1RGIA 1VSJA 4DF4A 2YKMA 3EY1A 2E2NA 3I33A 4DTPA 4JK9A 2ETJA 2QWPA 3GG4A 1IKXA 2GEMA 4FZYA 2FLOA 5M1KA 5BR9A 2Q97A 2ZM6K 3V4IA 3O80A 4BE1A 4M3YA 1EQYA 4KH5A 1X1PA 2YX6A 2NRRA 4AHSA 4LFCK 4DUZK 3SBGA 1YT3A 3HPHA 4I7FA 4IG0A 4Z4FA 4FJGA 5HOOA 1VSHA 2YJEA 4A2AA 1DT9A 4PL8A 3C7NB 3V81A 4CEOA 4F8RA 4I2QA 4ICLA 2ZE2A 4CCHA 1RDDA 1JLAA 4B1VA 3L4QA 3E1YA 1OKJA 3A8YA 2JLEA 3VF2A 3AV9A 1S6PA 4AHCA 5D3GA 1NGDA 4ISFA 1C0TA 2R7YA 3FZLA 3QFUA 2VWKA 5SWMA 1JXBA 2QWLA 1SS6A 4CF9A 4DQSA 4JKBA 4E7LA 2PAVA 1HQUA 1S1TA 4ID5A 4JI3K 1VSMA 2ZGZA 4XIUA 3W3DA 4M3TA 1X9WA 3AVGA 2BUPA 5K14A 3P4IA 5FDLA 4YOXA 3VN5A 4CJWA 4FWPA 3QEVA 2FC0A 2FBTA 3WXJA 1YXQA 4EAHD 4M41A 1BA0A 3MDQA 4O0IA 4JI2K 1VSKA 4I6MB 1K9MO 3DRSA 4N41A 3ID6A 3VENA 1S72N 4CJSA 3THXB 5AQXA 4NLCA 1IBLK 1YHQN 3EN9A 2YV0X 4IOAL 1VQ7N 3PSFA 3GDQA 1W0HA 3FFKB 4OLAA 4CHOA 4QCLA 3O1WA 3EKUA 3HM8A 4NLBA 3HRGA 4JEPA 1EX4A 1T7PA 1TGOA 3CPWM 4IG3A 2QWMA 1YTUA 4AM6A 3THXA 3ZLJA 3THVA 4B9UA 3VEXA 1B9DA 1VSLA 3VQ5A 3KIOA 4DR3K 1LWFA 2VG5A 4OKKA 3BGRA 3TAGA 3MCAB 1XMQK 4GV3A 4M7XA 3EZWA 4ISGA 2ZF5O 4KHQA 4PL7A 4Y1DA 2HVHA 4BRPA 4NYNA 3TPQA 3QINA 1VQ8N 4FPBA 5I3UA 1KAZA 2HSTA 2O8DB 3I0SA 4AQYK 3NF6A 3OYHA 1WAJA 3VQQA 4WFAL 2G8VA 4DR1K 1SQKA 4B3RK 1LCUA 1NK7A 1KVAA 3AA2A 5BRHA 1RDUA 4LH5A 3VQPA 5H1SQ 4NCBA 3HTVA 1RT4A 3GE1A 3ITHA 4DCHA 1HPZA 1YI2N 4DKWA 2E2PA 4IFYA 4CHYA 1U49A 4FWNA 3LDPA 2O8DA 1QHAA 4DTOA 4FWQA 2OPSA 4JKFA 3TARA 4KHYA 2IGIA 2JGUA 2X6NA 4OJRA 4IBNA 1C1CA 1UWBA 3L2QA 4C8OA 1IBKK 3NMUA 4EFHA 1RBSA 2ZQBA 3TI0A 1NMNA 3O9TA 4BE2A 4B3SK 3MECA 4G9ZA 3KK7A 3LAKA 2KLAA 2NRXA 4M3XA 1BQNA 4DS5A 1I94K 1KAYA 5B8HA 3C6AA 1SZ2A 2F7TA 1D5AA 4BQLA 3L3UA 4WFNL 3PSIA 2Z1IA 4AM7A 1TL3A 1NU0A 3SQ1A 2YI1A 3AO3A 4JRPA 1NKCA 3T1AA 3T1YK 2HHQA 4KV8A 2KW4A 4OGEA 4E0DA 3R6MA 3AARA 4YFUA 3MWTA 4DSFA 3ZSQA 1TKXA 3KLIA 1HQEA 1RDAA 4K42A 3BUZB 4KO0A 4BRFA 4ILJA 1NK4A 2DTUA 3THYB 4FM0A 4RW8A 4MO4A 3EYZA 2VWJA 3RWUA 3RMBA 1FKOA 1QTMA 2O4IA 2W40A 3M5RA 4H5TA 1GLFO 3OJUA 3D2EA 2OPPA 3CI5A 1T6CA 1B92A 4FJLA 4CJRA 3MN5A 4GKKK 2KQ2A 4PHTX 4E7KA 3B6PA 1I3AA 3OYEA 2Q36A 4EZ9A 3M8RA 3THYA 5J2MA 4H5WA 4BR0A 4CGGA 1DLOA 1W7AA 4QS8A 3TU5A 4O44A 4F4KA 3AO1A 4L3QA 3C6UA 3QFPA 3ZSRA 4M63C 3TAFA 4KH4A 1Q82O 2VQEK 3VQ8A 3EEQA 1YJWN 3HVTA 3SBTA 1KCFA 1RT2A 3VQ4A 1XWLA 3BF3A 4JYAK 1YAGA 2DPNA 2ZD1A 3O1BA 3VQEA 1UAXA 5TKYA 4BC2A 3EL2A 4CJEA 1NBWA 4E7HA 2UUBK 1C0GA 1HYZA 3IKMA 1RT1A 1M90O 4CJ5A 5AR0A 3VEWA 3IRXA 2HHTA 3G6EN 4KTQA 4BR9A 5DK5A 4FZZA 2A1SA 1BDGA 4DV1K 3K9KA 3K9JA 3D0PA 1YVUA 5FPDA 4BROA 1XHZA 5GAGP 1SV5A 4YNQA 4DFMA 3HO1A 2HBLA 1WUAA 4KH6A 1UOCA 3F9KA 4A61A 1XHXA 1EETA 3ZT2A 2QEXN 1EP4A 2ASOA 4DLGA 1S5JA 2ITMA 3GL1A 2HBMA 3G10A 4YOYA 3CCQN 4DV2K 1JJ2M 5AQZA 3JYTA 3OA9A 1ASUA 3I0RA 2AP1A 4CF8A 5ADXH 4FLYA 3UKRB 3ENHA 1WAFA 3VGLA 3NGIA 4LF4K 4CD3A 3PX0A 3ULDA 4DQIA 4AHVA 4YOTA 2NLXA 5AQWA 3VMFB 4DHYA 3SV3A 4FJNA 4KI6A 5I9EB 4IJNA 4FVMA 4X66K 5GADP 4CJVA 3VQCA 5J2NA 3AO4A 3L0QA 3H6EA 4FSVA 2E2OA 2VYPA 3TWHA 4FK4A 4W5RA 4LF9K 1LWEA 4JKEA 4OLBA 2HHVA 3LZIA 1LWCA 4CIGA 1DEJA 2W41A 4O55A 5C10A 3H46O 2W6LA 3TAQA 1VRTA 4DV0K 4O8UA 3WQTA 4JNEA 4FLUA 4RG8A 1S1XA 5HRNA 3SI6A 3I55N 2NRWA 1QS4A 3ZT3A 4FOIA 2E1YA 2KZZA 1YF5L 5AQOA 4EP5A 4H03B 4MDAA 3SPYA 2P9IA 3CJ9A 3SQ4A 3QEXA 3LP0A 4CHPA 3UKUA 3K5OA 1R59O 2A1RA 3DLEA 3AVAA 2VQFK 1MWMA 3CERA 5AQTA 3K5MA 1HNVA 3O08A 3CCRN 1WN7A 2WFBA 4E1MA 1OH7A 5EXWA 4NXNK 2GV9A 4DU4A 5T7BA 3HOTA 3ENOA 1KFSA 4BGBA 1ZBUA 3OYCA 1HNWK 5KGWA 4FLXA 4PKIA 4NB4A 4BR5A 3KLGA 5AQMA 3SUPA 5M1QA 1HMVA 3RRHA 1XMOK 1BO5O 1TYQB 4DTNA 3WNEA 3M8QA 2P5OA 4JS5A 2ZJRL 4F3OA 4YDUC 1NJZA 3WXMB 5JICA 4DSEA 5KRSA 3ZX2A 3OS1A 4KPYA 2UU9K 5J2PA 3O9QA 2WUSA 3R1XA 5CYQA 5FPEA 4FK2A 4DTXA 4CF2A 3WXIA 3IS9A 4PWDA 4DSLA 4K8XA 4FJ9A 2A3ZA 4IFVA 2NRHA 1LV5A 3DJCA 2OTLN 2VG7A 1YJ9N 1GLJO 1TYQA 1VRUA 5AQVA 1C1BA 1YVNA 2V52B 1E4FT 3HP6A 4KTZA 4FJXA 1KVBA 3DOLA 2ASMA 1S1VA 2HF4A 4HUGA 1RBTA 4X65K 1LAWA 1ZBLA 4CZMA 3NF7A 3SAFA 2E5LK 4IFEA 3F2KA 3NFAA 1NJXA 2QM1A 5BN8A 4U7BA 3VTHA 1NK6A 3DLHA 1RILA 3ZEUB 1E3MA 3EKSA 4NO7A 3E66A 3AA4A 1RNHA 2O8BB 3HOSA 1DTTA 2P9NB 4H4MA 1U2VB 2QK9A 1BA1A 3CXCM 4Z4GA 5CYMA 3OTOK 1HKBA 3QETA 2XY5A 4FJ5A 3A5OC 3CCVN 3U6FA 4DFJA 1IKYA 3U9DA 3ZEUA 1BI4B 4BWMA 2NRTA 1NWKA 3BP8A 5KRTA 3AVCA 3ZSWA 2OYQA 1NK8A 1TK8A 3SJHA 2P9LB 4A62A 2P9NA 2WONA 4C8NA 4DTRA 3LM9A 1U2VA 1QZ5A 5A2QO 4N47A 3NBPA 2YNIA 3CQYA 1DGKN 3U3GA 2E1ZA 1BWFO 1EO1A 3DXKA 2RKIA 4KFBA 1VAZA 1BI4A 2YHAA 1GOCA 5CY4A 2Q2RA 2P51A 1A5WA 5EY4A 2A40A 4CHNA 1SL1A 4RW7A 2IC3A 1J6ZA 4FCYA 4ISEA 3A5MC 3RR8A 2QWOA 3CFOA 4FWMA 4DMNA 3N4QA 3FLCO 4E7IA 3SQ0A 1L3VA 3G0ZA 3VQ6A 4MFBA 4LF6K 4CBXA 2D0OA 2FSNA 5I42A 1JLCA 5M1OA 2FF6A 5AQLA 4X62K 3QBXA 1DKGD 2BE2A 5AQHA 1J53A 4A59A 4CGDA 2HNZA 2Q31A 1QQMA 1Q9YA 4J2DA 5IT9O 4LD0A 1N32K 3SAHA 4RCHA 3PV8A 2Q3SA 3SMSA 4XEIA 2D0BA 5C24A 4BDPA 3J7ZO 3F5TA 4CF0A 4RW9A 3QEPA 3ZETB 1NK9A 3ISNC 3BY5A 3HP9A 2UYTA 3QDKA 2IVNA 1TKZA 4B8AB 5KPRA 4CGHA 1XC9A 3CCUN 5KGXA 4E1NA 4K0KK 3ATUA 1VSFA 1GOAA 4B1XB 2X74A 3L2VA 3LZJA 4CJUA 3R9PA 3KK1A 3B6OA 2QXFA 4Z4HA 3S9HA 5AQYA 1BU6O 1REVA 4JS4A 3OS2A 4PUOA 3L6QA 1NK5A 3CD6N 2QA4N 5EU7A 1Q86O 4CF1A 4IWVA 1CZBA 2VWBA 3C7NA 5CHIA 3U4LA 2NRVA 4WQ4A 5FRNA 4BVPA 2YNFA 3E9PA 1IH7A 1X3MA 5JLHA 3VA3A 2G8KA 2HHWA 3PY8A 4GKJK 4BR7A 4PQUA 3DLBA 1TKDA 4BC4A 3PO4A 3CIPA 4C1NI 4DV3K 4CHZA 1D9FA 3C0BA 1RT7A 4B8CA 4FLTA 1RTIA 4CJ3A 4H0OA 3UIQA 4BGAA 3AVKA 3EE8A 3T69A 1S3XA 4WCEL 2QWNA 5GAHP 4FLZA 4U67L 5BPLA 3AVBA 1BUPA 2P9SB 4NCAA 4HHTA 5FPMA 4LC9B 1ESVA 1B9FA 4LFAK 4AHUA 4OKJA 1TL1A 3CFPA 1N34K 3H3NO 1SKWA 3T1HK 4Z94A 4HCBA 4DR4K 3FFIA 3SYZA 4L8RB 3KK2A 1FJGK 1TK0A 4I6MA 5EX5A 4OPKA 1WBDA 4OPHA 4R5PA 3M8SA 3LPTA 2GELA 3E01A 5DM7L 1L3UA 1ZC6A 4I2PA 1VQLN 5E41A 1Q9XA 1WLJA 1JKHA 2CGKA 2QKBA 4CJTA 1HNXK 3ZSOA 1QZ6A 1EXQA 4E3SA 1JCFA 4JV5K 4IOXA 3WUHA 3ZT0A 2WTUA 1ASVA 2QI2A 4FJIA 3CM6A 3HPGA 3H1VX 5MLCQ 4FZXC 3DM2A 4A5BA 1N6QA 2P9KB 2OA8A 2OCEA 4ELVA 1SAZA 4LF5K 3OYFA 1GLLO 1NGFA 2NRZA 2AJQA 1KLMA 1J5OA 4H0XB 3PO5A 4E1JA 1WSEA 4BWJA 2YJFA 3ZSXA 2E6LA 4DLEA 3SQ2A 3LP1A 4FW2A 4CZEA 3D2FB 1NLVA 4FPAA 4N5SA 5LL6Z 2GX9A 4DSIA 3HJFA 4EHTA 2QW9A 3QESA 1VQ4N 2HHSA 1VSEA
chains in the Genus database with same CATH topology
1WUAA 4KH6A 3MWPA 4BC5A 4A61A 4CZLA 4BR4A 1JCGA 3ZETA 3ZX3A 2QEXN 3SK3A 1ATRA 3MK6A 4J8FA 2ASOA 2HMPA 3CJAA 4R79A 3CC7N 2ITMA 3LDNA 4MLHA 2EWSA 3GL1A 3CETA 2HBMA 4IDHA 4YOYA 3CCQN 2FF3B 3D7EO 3J8AA 1JJ2M 5AQZA 4BG8A 2GWKA 3OA9A 3WQUA 3TSUA 2A5XA 2AP1A 2A41A 2F9WA 3BEXA 3IMXA 1CZAN 4JKGA 5AQQA 5ADXH 4O8KA 4MO5A 3UKRB 3ENHA 3VGLA 4K25A 2V7YA 4F9OA 3CPEA 4CD3A 3RVCA 5BRFA 3LL3A 4CBUA 4PKHA 1Q81O 2QXLA 2HBJA 4YOTA 2Q0RA 3CCLN 3CJ1A 4K43A 2NLXA 4H0VB 1XC3A 2VGNA 5BREA 3I56N 3Q7CA 3FGUA 3O9UA 5AQWA 3D6RA 3VMFB 4DHYA 5KPTA 5GIPA 4MLEA 4JD2B 1GLBG 2KHOA 2QTDA 2FXUA 1QVGM 2WC9A 4BRQA 4IJNA 5I9EB 3AY9A 5GADP 4IEEA 4OO1J 4MDBA 3L0QA 4FO0A 2CGLA 3H6EA 4FWRA 4FWLA 2ZWHA 1BOTO 2E2OA 4FSVA 2VYPA 1YIJN 4K41A 1HLUA 3WEEB 4JKEA 3OHRA 5CE3A 4BRDA 1T3VA 4HTLA 1DEJA 3A5LC 3MN9A 2W41A 3U8XA 5C10A 3CCMN 3CCJN 3H46O 3VPZA 1Z6RA 3VF4A 1QQNA 1G99A 3ATVA 3CHWA 3KVGA 4FWOA 5F2RA 1ZBSA 2AA4A 3DXKB 4JD2A 1OVYA 4JK7A 4O8UA 3WQTA 4B1WB 4BREA 4JNEA 2YCHA 4FL9A 2ZGYA 5GAEP 4IO9L 3ZYYX 4FWSA 5EVZA 5JMVA 2GUPA 2NRWA 3I55N 2VGMA 3IFRA 4IXCA 4CBWA 4IZ9A 4FOIA 2E1YA 3WEEA 3AAQA 1YF5L 5AQOA 2P9SA 4H03B 3CMAN 4MDAA 3G71N 3O8MA 1KXPA 4YDUA 1YJNN 2P9IA 5AQIA 3CJ9A 4C23A 3WXLA 1ZXOA 4BG9A 5KQDA 5HL7L 4UY8O 3MX5A 3UKUA 3QB0A 1R59O 4CD1A 4YOUA 2NZTA 5TKWA 4BRMA 1MWMA 5DM6L 3CERA 3TTCA 5AQTA 5BPNA 4C1NK 3O08A 1YITN 3SLCA 3CCRN 2WFBA 5EXWA 3KZBA 4BRGA 4CZHA 2HBKA 3LDQA 4AF1A 4B1UB 3HOTA 3ENOA 4BGBA 5LJWA 3VTIA 5AZJA 5ELZA 4BVOA 3FZKA 4PKIA 3E9LA 3RSEA 4NB4A 1NM1A 4A57A 3ID8A 4QS9A 1WOQA 4BR5A 5AQMA 1NGAA 1RGIA 1U6ZA 3MN6A 4M7YA 3OBYA 5M1QA 4JAXA 2E2NA 1NGJA 3I33A 1BO5O 4BRHA 5ADXA 1TYQB 2IIRA 1NMDA 3SMPA 3L4IA 1MDUB 4JK9A 2QWPA 3GG4A 4PKGA 2ZJRL 5BPMA 2GEMA 4YDUC 3WXMB 3KWIA 5JICA 3ZX2A 1Z05A 2FLOA 5M1KA 1KQSM 2Q1NA 2V7ZA 4BRKA 5BR9A 3O9QA 2WUSA 3R1XA 5FPEA 2Q97A 4JKHA 2E88A 3M1FA 4H5NA 2P9KA 3WXIA 3ULEB 3TTFA 2D4WA 3O80A 3TSQA 3EO3A 5M1PA 5M1NA 2A3ZA 2NRHA 2D1KA 3DJCA 4FOEA 2OTLN 1YJ9N 1EQYA 3CJ7A 1GLJO 1TYQA 2YX6A 3LM2A 4KH5A 4DB3A 5AQVA 3P39A 1HUXA 1YVNA 2NRRA 2V52B 3FR0A 3ZX0A 1E4FT 1VQNN 4WF9L 3SBGA 3VOVA 2ASMA 3H45C 3LDLA 3H1QA 5HOOA 2HF4A 1IJJA 3D2FA 1TUUA 1KAXA 1DT9A 2YJEA 4PL8A 4A2AA 3C7NB 3CCEN 2OTJN 2BH1A 3VEZA 1NGHA 1RFQA 5F1XA 3I8BA 4B1VA 3L4QA 3E1YA 3M3ZA 4CZMA 1OKJA 3A8YA 3SAFA 4IEIA 3VF2A 1BG3A 3PLAA 1NGDA 5AQFA 5AQGA 5BRDA 5AQPA 4IFEA 4ISFA 3F2KA 1RDWX 3GBTA 4Y0WA 2QM1A 3FZLA 3QFUA 5AQKA 4XH1A 1C0FA 4RWTA 5FPNA 1E4GT 5BN8A 4U7BA 3VTHA 4FVUA 2QWLA 1SS6A 4H5VA 5E26A 3ZEUB 4XH4A 4JKBA 2NNWA 4BRLA 1P90A 4IO8A 3CCSN 2PAVA 3EKSA 4NO7A 1Q18A 3E66A 4WQ5A 3T7ZA 4BC3A 4JKAA 2KKZA 4JK8A 2ZGZA 1QVFM 3UKRA 1NGIA 3W3DA 4BR2A 3HOSA 3C65A 1MA9B 2P9NB 3CJCA 2BUPA 3P4IA 1U2VB 3CQXA 3VETA 3GOIA 5F0XA 4YOXA 1BA1A 3CXCM 4FWPA 1VQ9N 2CH5A 3WXJA 1YXQA 2E2QA 4EAHD 1HKBA 1H1VA 3A5OC 3CCVN 1BA0A 4BY9C 3B8AX 3MDQA 1VQ5N 3DLLL 1XQSC 3U9DA 3ZEUA 2D0PA 4H5RA 2NRTA 1NWKA 2IVOA 3D2EB 3G25A 3Q7BA 2E20A 3BP8A 4I6MB 1K9MO 5LJVA 3AAPA 2H3GX 3ID6A 2P9LB 3SJHA 3VENA 4A2BA 2P9NA 4A62A 1S72N 1NJIO 3LM9A 1U2VA 5AQXA 4NLCA 4CI6A 1QZ5A 4GV6A 3WT0A 3CC4N 2P9PB 3ENBA 1YHQN 3KWGA 5AQSA 3AGRA 3CQYA 3EN9A 2CGJA 3VEOA 4IOAL 1VQ7N 3GDQA 1DGKN 4B1YB 4WQ5C 1KD1O 3FFKB 2E1ZA 1BWFO 3DAWA 1EO1A 1VQON 3DXKA 3O1WA 2RHKA 3EKUA 3HM8A 3O5BA 4NLBA 1VAZA 2PFUA 3HRGA 3M6GA 4JEPA 2Q2RA 1HJOA 2GTDA 4JN4A 3VEVA 1O13A 3CPWM 3A5NC 1Q7YO 5EY4A 3VGMA 1T6DA 4YORA 2QWMA 2A40A 1GLAG 4CJ7A 1S22A 1J6ZA 4ISEA 3A5MC 3TTDA 2QWQA 3FZFA 4GVEA 4AM6A 2CH6A 1ATSA 2QWOA 2P9PA 4FWMA 4QS7A 5KPZA 1JCEA 3N4QA 3VEXA 3FLCO 3VF6A 1NGCA 3JXUA 3AGKA 1YUWA 4IJAA 1XUPO 3U9ZA 5AQUA 4CBXA 2D0OA 2FSNA 3MCAB 5AQJA 5M1OA 4GV3A 4M7XA 2FF6A 3EZWA 5AQLA 4ISGA 3QBXA 3DXMB 1DKGD 3E9OA 5AQHA 4A59A 2ZF5O 2Q31A 3FZMA 1QQMA 4PL7A 1W2BM 3CMEN 2E8AA 4EHUA 1GLDG 4BRPA 3QMLA 3SAHA 3TPQA 3BF1A 1W97L 4RCHA 2ZJPL 1VQ8N 3PIPL 1D4XA 1HKCA 1V4SA 4FPBA 3SMSA 1KAZA 2HSTA 2FSJA 5C15A 4XEIA 1K73O 3OBWA 2HF3A 2YHYA 2IVPA 2JWKA 4WFAL 1SQKA 3F5TA 1LCUA 4KBOA 3J7ZO 3ZETB 3N4PA 1K8AO 2RE2A 3IDHA 5BRHA 2WBNA 1RDUA 5M1FA 5C2DA 5H1SQ 3HTVA 3IUCA 4WYBA 3PIOL 2UYTA 4JKDA 5JVHL 3QDKA 3HI0A 2IVNA 3GE1A 4FWKA 5KPRA 4RTFD 3CCUN 4DCHA 5C2FA 1X9JA 4BRAA 1YI2N 3R3LA 4DKWA 2J4RA 2E2PA 3ATUA 3VEYA 3VGKA 3UB5A 4FWNA 3ULEA 3LDPA 1QHAA 4B1XB 1NGBA 4FWQA 4JKFA 3R9PA 3R8EA 4YOVA 4HWIA 4ILGB 5AQYA 1BU6O 3P31A 1HX1A 3L6QA 3CF5L 4H0YB 1T44A 3CD6N 2QA4N 1Q86O 3H3OB 3NMUA 1NGEA 4EFHA 4IWVA 3VERA 2VWBA 3O9TA 3C7NA 2BTFA 3VESA 5CHIA 1N8RO 3KHYA 3U4LA 2NRVA 3KK7A 4WQ4A 4BVPA 4G9ZA 2A42A 3E9PA 1X3MA 2KLAA 5JLHA 3NVKA 3SAGA 2NRXA 5JLFA 1NGGA 1KC8O 3MN7A 3LDOA 1KAYA 5B8HA 4BR7A 3W0LA 3C6AA 2PBDA 3EE9A 1SZ2A 2F7TA 4BC4A 4BQLA 4WFNL 3CIPA 4AM7A 4C1NI 4CZFA 2V51B 1ILYA 3C6HA 2I7PA 2YI1A 3C0BA 1Y64A 3S41A 4ILHA 1X3NA 4H0OA 4BGAA 1QQOA 1VQPN 3MMVA 3FZHA 3EE8A 3T69A 3R6MA 1S3XA 3AARA 3MX2A 3MWTA 4DQ8A 4WCEL 2QWNA 3DWLA 5LY3A 5GAHP 4U67L 5BPLA 1ATNA 4GNIA 3HSCA 1BUPA 4B1ZA 3A0IX 2P9SB 3QBWA 1VQMN 5CR4A 4EIAA 3TSPA 1GLEG 5AZIB 5FPMA 2P9IB 4LC9B 1ESVA 5KQ8A 3O9RA 1GLCG 3BUZB 4K42A 4H0PA 4WQ4C 2P9UB 4WFBL 4BRFA 1LOTB 3UKUB 3H3NO 4ILJA 5AQNA 4JKCA 4MO4A 4Z94A 3OW2M 2W40A 1P8ZA 3M5RA 4H5TA 1GLFO 1TUYA 2OANA 3D2EA 3HZ6A 2Q0UA 5GIOA 4CZJA 4I6MA 5EX5A 1VQKN 2HOEA 4OPHA 4CZGA 2JWLA 3CI5A 1T6CA 1V4TA 3O6WA 2YHXA 2P9LA 3CJBA 2GELA 5DM7L 5AZJB 3MN5A 2GWJA 1ZC6A 1VQLN 1HKGA 4OPAA 5AZIA 4PHTX 3RSEB 3HBTA 3JS6A 2CGKA 5JVGL 2P9UA 1M1KO 1MWKA 1VQ6N 2Q36A 4H0TB 3WXKA 1K8KB 1QZ6A 3P38A 4H5WA 1JCFA 4BR0A 5AFUA 4QS8A 4IOXA 5BN9A 2ZJQL 3TU5A 4A5AA 3WUHA 4L3QA 4CZKA 2QI2A 4O5FA 3QFPA 4M63C 4KH4A 5EOYA 3H1VX 5MLCQ 1Q82O 4A5BA 4BQZA 3CC2N 3O9SA 1YJWN 3G4SN 3SBTA 3FE1A 4IOCL 2P9KB 3BF3A 4GV9A 1YAGA 2DPNA 1SAZA 4GY2B 4B9QA 2FSKA 3O1BA 4JHDB 5TKYA 4BC2A 4CZIA 3EL2A 5C0YA 1GLLO 1NBWA 1K8KA 1NGFA 2NRZA 2VCPA 4BRNA 4YOWA 3NVMA 1C0GA 5AQRA 4H0XB 3IKMA 1M90O 5E84A 4E1JA 5C12A 2F9TA 5GINA 2YJFA 3O4WA 5AR0A 3VEWA 3G6EN 3DXMA 3MCPA 3UE5A 2ASPA 4BR9A 4CZEA 3D2FB 2YHWA 4XH5A 1NLVA 4FPAA 1BDGA 2GX9A 3QICA 1IG8A 2I7NA 3K9KA 3K9JA 4EHTA 2QWRA 2QW9A 4BRIA 1HPMA 5FPDA 1VQ4N 4BROA 4JKGB 5AFUH 5GAGP 4JHDA 4BRCA 3F9MA 2A6AA 2HBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1N A;  3C6A A;  3CPE A;  5M1K A;  4IEE A;  4IDH A;  5M1Q A;  5C10 A;  5C12 A;  5M1O A;  4IFE A;  5C2D A;  5C2F A;  5M1F A;  3C6H A;  5M1P A;  4IEI A;  5C15 A; 
#chains in the Genus database with same CATH topology
 3MWP A;  1FKP A;  4MQ3 A;  4FYD A;  3ZX3 A;  1CXQ A;  1WSH A;  3CG7 A;  3LDN A;  3V1Q A;  2EWS A;  4LY7 A;  3DLR A;  1EKE A;  3V1O A;  2GWK A;  3BEX A;  2A41 A;  5AQQ A;  1CZA N;  3MED A;  4O8K A;  4H8K A;  4MO5 A;  3LWL A;  3V6D A;  3CYM A;  4M45 A;  2VG6 A;  5IWA K;  3CPE A;  3RVC A;  5BRF A;  2HHU A;  3LL3 A;  4CFA A;  2KFN A;  2Q0R A;  1T05 A;  4H0V B;  4CHQ A;  1YTA A;  3KK3 A;  3LPU A;  5KPT A;  3FGU A;  3LP2 A;  2E4L A;  2KHO A;  2WC9 A;  3RTV A;  1J9A A;  1QHT A;  3AY9 A;  3DLK A;  5J1E A;  3L2R A;  3HST B;  1RTJ A;  2KZM A;  3SUO A;  1RT3 A;  3OYJ A;  1C1A A;  2YKN A;  3NE6 A;  3C95 A;  4RW4 A;  3VF4 A;  1S9E A;  3CHW A;  3KVG A;  5F2R A;  2AA4 A;  1X9S A;  4B1W B;  2YCH A;  4FL9 A;  2ZGY A;  1LW0 A;  3ZYY X;  5HP1 A;  2D0A A;  4IZ9 A;  4KHU A;  1A5V A;  3G71 N;  4DSK A;  2HB5 A;  4FLW A;  3QNN A;  4NCG A;  4C23 A;  3AA3 A;  5HL7 L;  4CD1 A;  2NZT A;  4BRM A;  5BPN A;  4KHW A;  4ZHR A;  1YIT N;  4NXM K;  1C0M A;  4CGI A;  3QO9 A;  1HNI A;  4CZH A;  3ZCM A;  4OKE A;  3VTI A;  1L5U A;  5ELZ A;  3DMJ A;  3FZK A;  5HRR A;  3E9L A;  4A57 A;  5JS1 A;  1NM1 A;  3QER A;  1NGA A;  1U6Z A;  3MN6 A;  4JAX A;  2P5G A;  4FW1 A;  4CK3 A;  4BRH A;  5ADX A;  2IIR A;  4NYF A;  3SMP A;  1MDU B;  4PKG A;  5BR8 K;  5BPM A;  2B4J A;  4C8K A;  1Z05 A;  2Q1N A;  4IKF A;  4BRK A;  4TSX A;  2YHB A;  2E88 A;  4JKH A;  3M1F A;  4FXD A;  2RPI A;  3AVL A;  3TTF A;  3ULE B;  2D4W A;  2F4V K;  3AVH A;  3EO3 A;  2W6K A;  3OYK A;  2D1K A;  3CJ7 A;  3LM2 A;  4QAG A;  3D45 A;  3TAM A;  1HUX A;  3ZX0 A;  4W5Q A;  1VQN N;  3NGZ A;  3OYA A;  3DLG A;  2HHH K;  3VOV A;  1KAX A;  2OTJ N;  3V9Z A;  4JLH A;  3VEZ A;  4BDZ A;  2P1J A;  2O8E B;  1WSJ A;  3HL8 A;  1OVQ A;  1NK0 A;  1QSS A;  3I8B A;  3WNH A;  4AIL C;  3OYG A;  1DTQ A;  5HRS A;  5HBM A;  4JI1 K;  2RF2 A;  2QKK A;  5AQF A;  5AQG A;  5AQP A;  1CLQ A;  4WE1 A;  4Y0W A;  5AQK A;  2LSN A;  4XH1 A;  1TV6 A;  1C0F A;  4RWT A;  5FPN A;  1E4G T;  4CGJ A;  4K8Z A;  3KJV A;  4FVU A;  1U48 A;  5E26 A;  4W5O A;  3AVM A;  4XH4 A;  3AO2 A;  2NNW A;  1P90 A;  3HT3 A;  1Q18 A;  2YNG A;  4WQ5 A;  3T7Z A;  4JKA A;  2KKZ A;  4JK8 A;  1QVF M;  3UKR A;  1NGI A;  1RTH A;  1RCH A;  4YY3 K;  4KRF A;  1SKS A;  1WSG A;  1S9G A;  3VET A;  3GOI A;  1N5Y A;  1VQ9 N;  1JL2 A;  3HVR A;  2E2Q A;  3SZ2 A;  2D0C A;  4H5R A;  5KTQ A;  2IVO A;  3G25 A;  1RT5 A;  4X64 K;  4JI5 K;  3AAP A;  2H3G X;  4KHN A;  2EX3 A;  3ENB A;  4HVJ A;  3MXI A;  5FLX O;  1RBR A;  1HRH A;  3AGR A;  4F2R A;  3SCX A;  3VEO A;  4KRE A;  3DAW A;  4DR7 K;  3RR7 A;  3M6G A;  1TAU A;  1O13 A;  3A5N C;  1Q7Y O;  3TAN A;  4YOR A;  5CZ1 A;  1GLA G;  4CGF A;  4CJ7 A;  3IAY A;  1UA1 A;  2QWQ A;  1NOZ A;  1ATS A;  1F21 A;  4Q5V A;  2DY4 A;  3VF6 A;  3JXU A;  4J2E A;  3AGK A;  4B9M A;  1ITG A;  1YUW A;  4IJA A;  3U9Z A;  1Z25 A;  4FJM A;  3KKS A;  4B3O A;  5JS2 A;  1U47 A;  5AQJ A;  3DXM B;  5HLF A;  4DV6 K;  4KHP K;  1C6V A;  1S1U A;  4M3W A;  4BE0 A;  3SNN A;  3FZM A;  3CME N;  1W2B M;  3KD1 E;  2E8A A;  4EHU A;  1GLD G;  2XY7 A;  1D4X A;  1V4S A;  2FSJ A;  4HCC A;  3OBW A;  2PY5 A;  2IS3 A;  3N4P A;  2RE2 A;  3O3F A;  4CEC A;  3S3N A;  4WYB A;  2O8F B;  3RMC A;  3PIO L;  5JVH L;  3NH2 A;  2RN2 A;  4FWK A;  1EWQ A;  1X9J A;  2J4R A;  2B5J A;  4KKO A;  3VEY A;  1KSP A;  3VGK A;  1IKW A;  1KRP A;  1NGB A;  2OZS A;  3AO5 A;  1X9M A;  3R8E A;  4HWI A;  2YNH A;  2G8I A;  3MAQ A;  3CF5 L;  1T44 A;  3LWM A;  3H3O B;  4HTU A;  3VER A;  4B9V A;  4DV4 K;  3KHY A;  3KD5 E;  3KTQ A;  5JLF A;  1NGG A;  1KC8 O;  3MN7 A;  4KTW A;  3EE9 A;  3A2F A;  3SJJ A;  4CZF A;  5DMR A;  2V51 B;  3NH1 A;  3JAM O;  3QEI A;  4KB1 A;  4ILH A;  1SL2 A;  3NF8 A;  5HRO A;  2OPQ A;  1FK9 A;  1VQP N;  3MMV A;  1I39 A;  5FRM A;  2O8B A;  4BDY A;  5LY3 A;  4GW6 A;  4GNI A;  4B1Z A;  3HSC A;  2BGG A;  5CR4 A;  4M3R A;  4EIA A;  4DWI A;  5AZI B;  1GLE G;  3LAL A;  5KQ8 A;  2DFE A;  4CJ4 A;  4WQ4 C;  2P9U B;  4WFB L;  2XO7 A;  2OPR A;  1LOT B;  5AQN A;  2G8U A;  1P8Z A;  4GVM A;  2OAN A;  3HZ6 A;  2Q0U A;  5GIO A;  4CZJ A;  4B9S A;  3OY9 A;  4CZG A;  2JWL A;  1V4T A;  3O6W A;  2P9L A;  5AZJ B;  1K6Y A;  3ZT1 A;  2GWJ A;  2XRI A;  4JI8 K;  4OPA A;  5AZI A;  4Z4C A;  3RSE B;  3HBT A;  1IKV A;  4CFD A;  2GUI A;  2P9U A;  1MWK A;  1M1K O;  4LFB K;  4CEE A;  4CJF A;  4DTJ A;  1K8K B;  3HM9 A;  4FJJ A;  3TAE A;  1HNZ K;  5BN9 A;  3J7A P;  1BIZ A;  2KTQ A;  1ZYQ A;  4CZK A;  1RDC A;  3CM5 A;  5EOY A;  4H4O A;  1JLF A;  4OGC A;  3RMA A;  3CC2 N;  3L2W A;  4CK2 A;  2PZS A;  4CW7 B;  4IOC L;  4OX9 K;  2D5R A;  4DR5 K;  2PYL A;  3NF9 A;  1D8Y A;  4GY2 B;  4B9Q A;  2FSK A;  4CZI A;  2VCP A;  1K8K A;  4YOW A;  4BRN A;  5LMN K;  3NVM A;  5AQR A;  3K5L A;  3AVF A;  1BCO A;  5E84 A;  3ZSY A;  5C12 A;  2F9T A;  5GIN A;  1J54 A;  3QNO A;  3O4W A;  3K5N A;  4FJH A;  2ASP A;  1RBU A;  2YHW A;  4XH5 A;  3MXM A;  5J2Q A;  3T19 A;  3QIC A;  4E89 A;  2QWR A;  3VQB A;  1HPM A;  3NGY A;  2NUB A;  1NG9 A;  2I5J A;  1WNS A;  2FBY A;  4BC5 A;  4ZTF A;  4CZL A;  2HND A;  3ZET A;  1G15 A;  2IAJ A;  3SK3 A;  1Q8I A;  1ATR A;  3MK6 A;  4CFC A;  4DQQ A;  2HMP A;  4KB0 A;  3O3G A;  1VSD A;  2E6M A;  3CET A;  4IDH A;  2FF3 B;  3D7E O;  1NOY A;  4BG8 A;  3BZK A;  1N36 K;  4CJQ A;  3TSU A;  2A5X A;  3IMX A;  3OYI A;  1WBB A;  3HPO A;  4CJP A;  1U4B A;  4K25 A;  2V7Y A;  4F9O A;  1KVC A;  5HRP A;  4Y1C A;  3CCL N;  2QXL A;  4B08 A;  4K43 A;  2EHG A;  4JI0 K;  1XC3 A;  5BRE A;  3I56 N;  3Q7C A;  4LSL A;  3VA0 A;  4Q0B A;  1RTD A;  1GLB G;  1QVG M;  2FXU A;  1XNR K;  4IEE A;  2BDP A;  4MDB A;  1XI1 A;  2CGL A;  4FWR A;  4FWL A;  3V1R A;  2ZWH A;  3V9W A;  1ZBI A;  2W42 A;  4G1Q A;  3DI6 A;  4K41 A;  1HLU A;  3OHR A;  1T3V A;  2UXB K;  1A5X A;  3MN9 A;  3U8X A;  3CCM N;  1N33 K;  1D9D A;  3CCJ N;  1JLE A;  3VPZ A;  1Z6R A;  3V9X A;  1G99 A;  1HYV A;  1ZBS A;  4LH4 A;  1OVY A;  4BRE A;  3AVI A;  4AH9 A;  4FJ7 A;  3SUQ A;  4IO9 L;  1IG9 A;  5EVZ A;  3CFR A;  1UA0 A;  2VGM A;  4CBW A;  4IXC A;  1TK5 A;  2G8F A;  3AAQ A;  2P9S A;  4IDK A;  3WNF A;  4M42 A;  3ZSV A;  3O8M A;  2OZM A;  4CJK A;  5AQI A;  3QIP A;  3NDK A;  3WXL A;  4BG9 A;  4UY8 O;  4N56 A;  1OH8 A;  4BAC A;  3ZT4 A;  3QB0 A;  2GBZ A;  3K58 A;  3TTC A;  4C1N K;  4CER A;  4CEZ A;  4ZTJ A;  3KZB A;  3OYB A;  1T03 A;  5LJW A;  4EP4 A;  1VSI A;  4QS9 A;  4FK0 A;  1WOQ A;  4Z0U A;  2HVI A;  3C6T A;  4M7Y A;  3OBY A;  1NGJ A;  1NMD A;  3L4I A;  1U04 A;  1ASW A;  4CES A;  1IV0 A;  3DRP A;  3OYL A;  3KWI A;  2UUC K;  1KQS M;  3TR8 A;  4HUE A;  5FRO A;  1Y97 A;  2V7Z A;  3TAP A;  3OYM A;  3O4Q A;  5KI6 A;  4DG1 A;  4H5N A;  2P9K A;  3LP3 A;  1RDB A;  3TSQ A;  5M1P A;  2UXD K;  5M1N A;  4FOE A;  1JLB A;  1JXE A;  4DB3 A;  2XHB A;  3P39 A;  3FR0 A;  2B6A A;  4HUF A;  4CEQ A;  4WF9 L;  1WSI A;  3H45 C;  3LDL A;  3H1Q A;  1IJJ A;  3D2F A;  1TUU A;  3CCE N;  2BH1 A;  1BHL A;  2F96 A;  4LF7 K;  1NGH A;  4Z4I A;  1RFQ A;  5F1X A;  1SKR A;  3OJS A;  3M3Z A;  1BCM A;  1BIS A;  2Y1J A;  4F3T A;  4IEI A;  4E7J A;  1BG3 A;  3PLA A;  2WOM A;  2DFF A;  4M3Z A;  1XNQ K;  5BRD A;  1CZ9 A;  1RDW X;  3GBT A;  3IG1 A;  1WSF A;  2O8C B;  2ATQ A;  3ALY A;  3NH0 A;  4H5V A;  4DR2 K;  4JI6 K;  4BRL A;  4IO8 A;  2XY8 A;  3CCS N;  4CEB A;  4BC3 A;  4LSN A;  1QE1 A;  3K2P A;  4BR2 A;  4CEA A;  3C65 A;  1L3S A;  1MA9 B;  1BIU A;  3CJC A;  4J2B A;  3CQX A;  5F0X A;  4B3T K;  3QEW A;  3S3O A;  1JL1 A;  2HMI A;  2BAN A;  2CH5 A;  1FXX A;  3QIO A;  4DTM A;  1OH5 A;  2O8C A;  4DR6 K;  1H1V A;  3SUN A;  4C8M A;  4QOZ B;  4BY9 C;  3B8A X;  4AHT A;  1VQ5 N;  3O3H A;  3DLL L;  1XQS C;  2D0P A;  3L3V A;  1IBM K;  3Q7B A;  3D2E B;  1SUQ A;  4DUY K;  2E20 A;  1KTQ A;  5LJV A;  4A2B A;  3MXJ A;  1NJI O;  2UXC K;  4CI6 A;  4GV6 A;  3WT0 A;  3CC4 N;  2P9P B;  3KWG A;  5AQS A;  3H08 A;  3J80 O;  2CGJ A;  4B1Y B;  4WQ5 C;  1KD1 O;  1VQO N;  2IOC A;  2RHK A;  3O5B A;  3LAN A;  4JI7 K;  2PFU A;  4KI4 A;  1HJO A;  2GTD A;  4JN4 A;  3VEV A;  4DU1 A;  1QSY A;  3VQ7 A;  3VGM A;  1T6D A;  1S22 A;  5C25 A;  4RW6 A;  3TTD A;  4GVE A;  3FZF A;  2CH6 A;  4O5B A;  2P9P A;  4QS7 A;  5KPZ A;  1JCE A;  4DTS A;  1JLG A;  1NGC A;  2KFZ A;  5CZ2 A;  1XUP O;  3WNG A;  5AQU A;  4E19 A;  4CED A;  1JLQ A;  4CIF A;  1MU2 A;  4B9N A;  3VQD A;  3PX4 A;  3E9O A;  3AVJ A;  3T3F A;  2PYJ A;  3QML A;  3BF1 A;  1W97 L;  4JRQ A;  2ZJP L;  3PIP L;  4CEF A;  1HKC A;  5C15 A;  5LMU K;  4PA1 A;  1K73 O;  2HF3 A;  2YHY A;  2IVP A;  2JWK A;  5C42 A;  4LF8 K;  4KBO A;  1NKB A;  1K8A O;  3IDH A;  2WBN A;  5M1F A;  5C2D A;  3IUC A;  1LAV A;  4JKD A;  3HI0 A;  4DTU A;  1WB9 A;  4RTF D;  5C2F A;  4BRA A;  3NAE A;  3R3L A;  2FBX A;  1OH6 A;  3VQ9 A;  3UB5 A;  3ULE A;  3KLH A;  1RT6 A;  1S6Q A;  2DFH A;  1TVR A;  3OYN A;  4YOV A;  4V19 S;  4ILG B;  3P31 A;  3K59 A;  3P1G A;  1HX1 A;  1KFD A;  4H0Y B;  1SL0 A;  1NJY A;  1NGE A;  4I9L A;  1QQC A;  4DF8 A;  2BTF A;  2O8E A;  3VES A;  1N8R O;  2UUA K;  4FJK A;  4CJL A;  2A42 A;  3NVK A;  3SAG A;  3K0S A;  3BDP A;  3JSM A;  2HW3 A;  1CXU A;  3BZC A;  3LDO A;  1O1W A;  4OPJ A;  3W0L A;  1Z26 A;  2PBD A;  4F2S A;  5SZT A;  1ILY A;  3C6H A;  2X78 A;  1EWR A;  2I7P A;  4C8L A;  3OYD A;  1Y64 A;  3S41 A;  4ELU A;  1X3N A;  4B9L A;  3DRR A;  1QQO A;  1NKE A;  3NHG A;  3FZH A;  3MX2 A;  4DQ8 A;  3U3Y A;  3DWL A;  1ATN A;  3P83 D;  3A0I X;  3QBW A;  1VQM N;  1VHX A;  2F8S A;  3TSP A;  2P9I B;  2O4G A;  3KKR A;  3O9R A;  1GLC G;  4DSJ A;  3L2U A;  4H0P A;  1T8E A;  3RRG A;  3VQA A;  4PY5 A;  3AA5 X;  1LW2 A;  3UKU B;  3I8D A;  4JKC A;  3OW2 M;  1TUY A;  1NNE A;  1HJR A;  1VQK N;  2HOE A;  3HK2 A;  2YHX A;  4O0J A;  3CJB A;  3P5J A;  4W5N A;  3LAM A;  4W5T A;  1HKG A;  3ASM A;  3AVN A;  3F73 A;  3JS6 A;  5JVG L;  1VQ6 N;  4H0T B;  3WXK A;  1HYS A;  3P38 A;  4GMJ B;  5AFU A;  1L3T A;  2Y1I A;  4DFP A;  2ZJQ L;  4A5A A;  4J2A A;  3EZ5 A;  4O5F A;  3M8P A;  4KAZ A;  4ID1 A;  4BQZ A;  3O9S A;  3G4S N;  2FBV A;  3FE1 A;  2Z1G A;  1QSL A;  3NCI A;  4GV9 A;  4CFB A;  4DQR A;  4JHD B;  3RMD A;  4AHR A;  5C0Y A;  4FLV A;  3THW B;  3MEE A;  4KHS A;  2XY6 A;  1C0U A;  3KLE A;  2G8H A;  3DXM A;  2HHX A;  3MCP A;  3UE5 A;  4FM2 A;  3C94 A;  4CIE A;  1RBV A;  3MEG A;  1IG8 A;  2I7N A;  3O4N A;  3LDS A;  4DQP A;  4EZ6 A;  3J81 O;  4BRI A;  4JKG B;  5AFU H;  4JHD A;  4BRC A;  3F9M A;  2A6A A;  3CMA N;  4YHH K;  3THW A;  2HNY A;  3OS0 A;  5AJ3 K;  1J5E K;  1BL3 A;  3OVN A;  4BR4 A;  1JCG A;  1FW6 A;  4N76 A;  4J8F A;  3CJA A;  4R79 A;  3CC7 N;  2O8F A;  4I9Q A;  4MLH A;  4DFK A;  2ITG A;  3J8A A;  3PX6 A;  3WQU A;  2F9W A;  4JKG A;  3DOK A;  1KLN A;  1W9H A;  2Z1H A;  1IO2 A;  4CBU A;  3HYF A;  4PKH A;  3PUF A;  2HBJ A;  1Q81 O;  1HR0 K;  3CJ1 A;  1NJW A;  1R0A A;  4CK1 A;  2VGN A;  3O9U A;  3D6R A;  5GIP A;  3SPZ A;  1ZBH A;  4MLE A;  4JD2 B;  3KLF A;  2QTD A;  1U45 A;  4BRQ A;  3L8B A;  4Z4E A;  4OO1 J;  4FO0 A;  3J7Y P;  1BOT O;  1BGX T;  1YIJ N;  1S1W A;  3WEE B;  5CE3 A;  4BRD A;  4HTL A;  3A5L C;  4ELT A;  4M3U A;  1GOB A;  3CQ8 A;  2Z1J A;  1TKT A;  1VK0 A;  4DV7 K;  4B3M K;  1QQN A;  1BQM A;  3ATV A;  4FWO A;  3HXM A;  3DXK B;  4JD2 A;  4JK7 A;  4CE9 A;  2X6S A;  4O4G A;  5GAE P;  4DU3 A;  4FWS A;  3SV4 A;  4B9T A;  3DYA A;  5JMV A;  2GUP A;  3IFR A;  3WEE A;  2IDO A;  1KXP A;  4YDU A;  2G8W A;  1YJN N;  3TAB A;  1ZXO A;  5KQD A;  4FM1 A;  4JI4 K;  2F8T A;  3V9S A;  3MX5 A;  1ZBF A;  4YOU A;  5TKW A;  5DM6 L;  4CVN E;  3V9U A;  3SLC A;  3ZSZ A;  4UQG A;  3QLH A;  4DV5 K;  3S3M A;  4BRG A;  2HBK A;  3LDQ A;  4AF1 A;  4B1U B;  4OVL A;  5AZJ A;  4BVO A;  1TAQ A;  3RSE A;  3K57 A;  3ID8 A;  4DS4 A;  4FJ8 A;  1RGI A;  1VSJ A;  4DF4 A;  2YKM A;  3EY1 A;  2E2N A;  3I33 A;  4DTP A;  4JK9 A;  2ETJ A;  2QWP A;  3GG4 A;  1IKX A;  2GEM A;  4FZY A;  2FLO A;  5M1K A;  5BR9 A;  2Q97 A;  2ZM6 K;  3V4I A;  3O80 A;  4BE1 A;  4M3Y A;  1EQY A;  4KH5 A;  1X1P A;  2YX6 A;  2NRR A;  4AHS A;  4LFC K;  4DUZ K;  3SBG A;  1YT3 A;  3HPH A;  4I7F A;  4IG0 A;  4Z4F A;  4FJG A;  5HOO A;  1VSH A;  2YJE A;  4A2A A;  1DT9 A;  4PL8 A;  3C7N B;  3V81 A;  4CEO A;  4F8R A;  4I2Q A;  4ICL A;  2ZE2 A;  4CCH A;  1RDD A;  1JLA A;  4B1V A;  3L4Q A;  3E1Y A;  1OKJ A;  3A8Y A;  2JLE A;  3VF2 A;  3AV9 A;  1S6P A;  4AHC A;  5D3G A;  1NGD A;  4ISF A;  1C0T A;  2R7Y A;  3FZL A;  3QFU A;  2VWK A;  5SWM A;  1JXB A;  2QWL A;  1SS6 A;  4CF9 A;  4DQS A;  4JKB A;  4E7L A;  2PAV A;  1HQU A;  1S1T A;  4ID5 A;  4JI3 K;  1VSM A;  2ZGZ A;  4XIU A;  3W3D A;  4M3T A;  1X9W A;  3AVG A;  2BUP A;  5K14 A;  3P4I A;  5FDL A;  4YOX A;  3VN5 A;  4CJW A;  4FWP A;  3QEV A;  2FC0 A;  2FBT A;  3WXJ A;  1YXQ A;  4EAH D;  4M41 A;  1BA0 A;  3MDQ A;  4O0I A;  4JI2 K;  1VSK A;  4I6M B;  1K9M O;  3DRS A;  4N41 A;  3ID6 A;  3VEN A;  1S72 N;  4CJS A;  3THX B;  5AQX A;  4NLC A;  1IBL K;  1YHQ N;  3EN9 A;  2YV0 X;  4IOA L;  1VQ7 N;  3PSF A;  3GDQ A;  1W0H A;  3FFK B;  4OLA A;  4CHO A;  4QCL A;  3O1W A;  3EKU A;  3HM8 A;  4NLB A;  3HRG A;  4JEP A;  1EX4 A;  1T7P A;  1TGO A;  3CPW M;  4IG3 A;  2QWM A;  1YTU A;  4AM6 A;  3THX A;  3ZLJ A;  3THV A;  4B9U A;  3VEX A;  1B9D A;  1VSL A;  3VQ5 A;  3KIO A;  4DR3 K;  1LWF A;  2VG5 A;  4OKK A;  3BGR A;  3TAG A;  3MCA B;  1XMQ K;  4GV3 A;  4M7X A;  3EZW A;  4ISG A;  2ZF5 O;  4KHQ A;  4PL7 A;  4Y1D A;  2HVH A;  4BRP A;  4NYN A;  3TPQ A;  3QIN A;  1VQ8 N;  4FPB A;  5I3U A;  1KAZ A;  2HST A;  2O8D B;  3I0S A;  4AQY K;  3NF6 A;  3OYH A;  1WAJ A;  3VQQ A;  4WFA L;  2G8V A;  4DR1 K;  1SQK A;  4B3R K;  1LCU A;  1NK7 A;  1KVA A;  3AA2 A;  5BRH A;  1RDU A;  4LH5 A;  3VQP A;  5H1S Q;  4NCB A;  3HTV A;  1RT4 A;  3GE1 A;  3ITH A;  4DCH A;  1HPZ A;  1YI2 N;  4DKW A;  2E2P A;  4IFY A;  4CHY A;  1U49 A;  4FWN A;  3LDP A;  2O8D A;  1QHA A;  4DTO A;  4FWQ A;  2OPS A;  4JKF A;  3TAR A;  4KHY A;  2IGI A;  2JGU A;  2X6N A;  4OJR A;  4IBN A;  1C1C A;  1UWB A;  3L2Q A;  4C8O A;  1IBK K;  3NMU A;  4EFH A;  1RBS A;  2ZQB A;  3TI0 A;  1NMN A;  3O9T A;  4BE2 A;  4B3S K;  3MEC A;  4G9Z A;  3KK7 A;  3LAK A;  2KLA A;  2NRX A;  4M3X A;  1BQN A;  4DS5 A;  1I94 K;  1KAY A;  5B8H A;  3C6A A;  1SZ2 A;  2F7T A;  1D5A A;  4BQL A;  3L3U A;  4WFN L;  3PSI A;  2Z1I A;  4AM7 A;  1TL3 A;  1NU0 A;  3SQ1 A;  2YI1 A;  3AO3 A;  4JRP A;  1NKC A;  3T1A A;  3T1Y K;  2HHQ A;  4KV8 A;  2KW4 A;  4OGE A;  4E0D A;  3R6M A;  3AAR A;  4YFU A;  3MWT A;  4DSF A;  3ZSQ A;  1TKX A;  3KLI A;  1HQE A;  1RDA A;  4K42 A;  3BUZ B;  4KO0 A;  4BRF A;  4ILJ A;  1NK4 A;  2DTU A;  3THY B;  4FM0 A;  4RW8 A;  4MO4 A;  3EYZ A;  2VWJ A;  3RWU A;  3RMB A;  1FKO A;  1QTM A;  2O4I A;  2W40 A;  3M5R A;  4H5T A;  1GLF O;  3OJU A;  3D2E A;  2OPP A;  3CI5 A;  1T6C A;  1B92 A;  4FJL A;  4CJR A;  3MN5 A;  4GKK K;  2KQ2 A;  4PHT X;  4E7K A;  3B6P A;  1I3A A;  3OYE A;  2Q36 A;  4EZ9 A;  3M8R A;  3THY A;  5J2M A;  4H5W A;  4BR0 A;  4CGG A;  1DLO A;  1W7A A;  4QS8 A;  3TU5 A;  4O44 A;  4F4K A;  3AO1 A;  4L3Q A;  3C6U A;  3QFP A;  3ZSR A;  4M63 C;  3TAF A;  4KH4 A;  1Q82 O;  2VQE K;  3VQ8 A;  3EEQ A;  1YJW N;  3HVT A;  3SBT A;  1KCF A;  1RT2 A;  3VQ4 A;  1XWL A;  3BF3 A;  4JYA K;  1YAG A;  2DPN A;  2ZD1 A;  3O1B A;  3VQE A;  1UAX A;  5TKY A;  4BC2 A;  3EL2 A;  4CJE A;  1NBW A;  4E7H A;  2UUB K;  1C0G A;  1HYZ A;  3IKM A;  1RT1 A;  1M90 O;  4CJ5 A;  5AR0 A;  3VEW A;  3IRX A;  2HHT A;  3G6E N;  4KTQ A;  4BR9 A;  5DK5 A;  4FZZ A;  2A1S A;  1BDG A;  4DV1 K;  3K9K A;  3K9J A;  3D0P A;  1YVU A;  5FPD A;  4BRO A;  1XHZ A;  5GAG P;  1SV5 A;  4YNQ A;  4DFM A;  3HO1 A;  2HBL A;  1WUA A;  4KH6 A;  1UOC A;  3F9K A;  4A61 A;  1XHX A;  1EET A;  3ZT2 A;  2QEX N;  1EP4 A;  2ASO A;  4DLG A;  1S5J A;  2ITM A;  3GL1 A;  2HBM A;  3G10 A;  4YOY A;  3CCQ N;  4DV2 K;  1JJ2 M;  5AQZ A;  3JYT A;  3OA9 A;  1ASU A;  3I0R A;  2AP1 A;  4CF8 A;  5ADX H;  4FLY A;  3UKR B;  3ENH A;  1WAF A;  3VGL A;  3NGI A;  4LF4 K;  4CD3 A;  3PX0 A;  3ULD A;  4DQI A;  4AHV A;  4YOT A;  2NLX A;  5AQW A;  3VMF B;  4DHY A;  3SV3 A;  4FJN A;  4KI6 A;  5I9E B;  4IJN A;  4FVM A;  4X66 K;  5GAD P;  4CJV A;  3VQC A;  5J2N A;  3AO4 A;  3L0Q A;  3H6E A;  4FSV A;  2E2O A;  2VYP A;  3TWH A;  4FK4 A;  4W5R A;  4LF9 K;  1LWE A;  4JKE A;  4OLB A;  2HHV A;  3LZI A;  1LWC A;  4CIG A;  1DEJ A;  2W41 A;  4O55 A;  5C10 A;  3H46 O;  2W6L A;  3TAQ A;  1VRT A;  4DV0 K;  4O8U A;  3WQT A;  4JNE A;  4FLU A;  4RG8 A;  1S1X A;  5HRN A;  3SI6 A;  3I55 N;  2NRW A;  1QS4 A;  3ZT3 A;  4FOI A;  2E1Y A;  2KZZ A;  1YF5 L;  5AQO A;  4EP5 A;  4H03 B;  4MDA A;  3SPY A;  2P9I A;  3CJ9 A;  3SQ4 A;  3QEX A;  3LP0 A;  4CHP A;  3UKU A;  3K5O A;  1R59 O;  2A1R A;  3DLE A;  3AVA A;  2VQF K;  1MWM A;  3CER A;  5AQT A;  3K5M A;  1HNV A;  3O08 A;  3CCR N;  1WN7 A;  2WFB A;  4E1M A;  1OH7 A;  5EXW A;  4NXN K;  2GV9 A;  4DU4 A;  5T7B A;  3HOT A;  3ENO A;  1KFS A;  4BGB A;  1ZBU A;  3OYC A;  1HNW K;  5KGW A;  4FLX A;  4PKI A;  4NB4 A;  4BR5 A;  3KLG A;  5AQM A;  3SUP A;  5M1Q A;  1HMV A;  3RRH A;  1XMO K;  1BO5 O;  1TYQ B;  4DTN A;  3WNE A;  3M8Q A;  2P5O A;  4JS5 A;  2ZJR L;  4F3O A;  4YDU C;  1NJZ A;  3WXM B;  5JIC A;  4DSE A;  5KRS A;  3ZX2 A;  3OS1 A;  4KPY A;  2UU9 K;  5J2P A;  3O9Q A;  2WUS A;  3R1X A;  5CYQ A;  5FPE A;  4FK2 A;  4DTX A;  4CF2 A;  3WXI A;  3IS9 A;  4PWD A;  4DSL A;  4K8X A;  4FJ9 A;  2A3Z A;  4IFV A;  2NRH A;  1LV5 A;  3DJC A;  2OTL N;  2VG7 A;  1YJ9 N;  1GLJ O;  1TYQ A;  1VRU A;  5AQV A;  1C1B A;  1YVN A;  2V52 B;  1E4F T;  3HP6 A;  4KTZ A;  4FJX A;  1KVB A;  3DOL A;  2ASM A;  1S1V A;  2HF4 A;  4HUG A;  1RBT A;  4X65 K;  1LAW A;  1ZBL A;  4CZM A;  3NF7 A;  3SAF A;  2E5L K;  4IFE A;  3F2K A;  3NFA A;  1NJX A;  2QM1 A;  5BN8 A;  4U7B A;  3VTH A;  1NK6 A;  3DLH A;  1RIL A;  3ZEU B;  1E3M A;  3EKS A;  4NO7 A;  3E66 A;  3AA4 A;  1RNH A;  2O8B B;  3HOS A;  1DTT A;  2P9N B;  4H4M A;  1U2V B;  2QK9 A;  1BA1 A;  3CXC M;  4Z4G A;  5CYM A;  3OTO K;  1HKB A;  3QET A;  2XY5 A;  4FJ5 A;  3A5O C;  3CCV N;  3U6F A;  4DFJ A;  1IKY A;  3U9D A;  3ZEU A;  1BI4 B;  4BWM A;  2NRT A;  1NWK A;  3BP8 A;  5KRT A;  3AVC A;  3ZSW A;  2OYQ A;  1NK8 A;  1TK8 A;  3SJH A;  2P9L B;  4A62 A;  2P9N A;  2WON A;  4C8N A;  4DTR A;  3LM9 A;  1U2V A;  1QZ5 A;  5A2Q O;  4N47 A;  3NBP A;  2YNI A;  3CQY A;  1DGK N;  3U3G A;  2E1Z A;  1BWF O;  1EO1 A;  3DXK A;  2RKI A;  4KFB A;  1VAZ A;  1BI4 A;  2YHA A;  1GOC A;  5CY4 A;  2Q2R A;  2P51 A;  1A5W A;  5EY4 A;  2A40 A;  4CHN A;  1SL1 A;  4RW7 A;  2IC3 A;  1J6Z A;  4FCY A;  4ISE A;  3A5M C;  3RR8 A;  2QWO A;  3CFO A;  4FWM A;  4DMN A;  3N4Q A;  3FLC O;  4E7I A;  3SQ0 A;  1L3V A;  3G0Z A;  3VQ6 A;  4MFB A;  4LF6 K;  4CBX A;  2D0O A;  2FSN A;  5I42 A;  1JLC A;  5M1O A;  2FF6 A;  5AQL A;  4X62 K;  3QBX A;  1DKG D;  2BE2 A;  5AQH A;  1J53 A;  4A59 A;  4CGD A;  2HNZ A;  2Q31 A;  1QQM A;  1Q9Y A;  4J2D A;  5IT9 O;  4LD0 A;  1N32 K;  3SAH A;  4RCH A;  3PV8 A;  2Q3S A;  3SMS A;  4XEI A;  2D0B A;  5C24 A;  4BDP A;  3J7Z O;  3F5T A;  4CF0 A;  4RW9 A;  3QEP A;  3ZET B;  1NK9 A;  3ISN C;  3BY5 A;  3HP9 A;  2UYT A;  3QDK A;  2IVN A;  1TKZ A;  4B8A B;  5KPR A;  4CGH A;  1XC9 A;  3CCU N;  5KGX A;  4E1N A;  4K0K K;  3ATU A;  1VSF A;  1GOA A;  4B1X B;  2X74 A;  3L2V A;  3LZJ A;  4CJU A;  3R9P A;  3KK1 A;  3B6O A;  2QXF A;  4Z4H A;  3S9H A;  5AQY A;  1BU6 O;  1REV A;  4JS4 A;  3OS2 A;  4PUO A;  3L6Q A;  1NK5 A;  3CD6 N;  2QA4 N;  5EU7 A;  1Q86 O;  4CF1 A;  4IWV A;  1CZB A;  2VWB A;  3C7N A;  5CHI A;  3U4L A;  2NRV A;  4WQ4 A;  5FRN A;  4BVP A;  2YNF A;  3E9P A;  1IH7 A;  1X3M A;  5JLH A;  3VA3 A;  2G8K A;  2HHW A;  3PY8 A;  4GKJ K;  4BR7 A;  4PQU A;  3DLB A;  1TKD A;  4BC4 A;  3PO4 A;  3CIP A;  4C1N I;  4DV3 K;  4CHZ A;  1D9F A;  3C0B A;  1RT7 A;  4B8C A;  4FLT A;  1RTI A;  4CJ3 A;  4H0O A;  3UIQ A;  4BGA A;  3AVK A;  3EE8 A;  3T69 A;  1S3X A;  4WCE L;  2QWN A;  5GAH P;  4FLZ A;  4U67 L;  5BPL A;  3AVB A;  1BUP A;  2P9S B;  4NCA A;  4HHT A;  5FPM A;  4LC9 B;  1ESV A;  1B9F A;  4LFA K;  4AHU A;  4OKJ A;  1TL1 A;  3CFP A;  1N34 K;  3H3N O;  1SKW A;  3T1H K;  4Z94 A;  4HCB A;  4DR4 K;  3FFI A;  3SYZ A;  4L8R B;  3KK2 A;  1FJG K;  1TK0 A;  4I6M A;  5EX5 A;  4OPK A;  1WBD A;  4OPH A;  4R5P A;  3M8S A;  3LPT A;  2GEL A;  3E01 A;  5DM7 L;  1L3U A;  1ZC6 A;  4I2P A;  1VQL N;  5E41 A;  1Q9X A;  1WLJ A;  1JKH A;  2CGK A;  2QKB A;  4CJT A;  1HNX K;  3ZSO A;  1QZ6 A;  1EXQ A;  4E3S A;  1JCF A;  4JV5 K;  4IOX A;  3WUH A;  3ZT0 A;  2WTU A;  1ASV A;  2QI2 A;  4FJI A;  3CM6 A;  3HPG A;  3H1V X;  5MLC Q;  4FZX C;  3DM2 A;  4A5B A;  1N6Q A;  2P9K B;  2OA8 A;  2OCE A;  4ELV A;  1SAZ A;  4LF5 K;  3OYF A;  1GLL O;  1NGF A;  2NRZ A;  2AJQ A;  1KLM A;  1J5O A;  4H0X B;  3PO5 A;  4E1J A;  1WSE A;  4BWJ A;  2YJF A;  3ZSX A;  2E6L A;  4DLE A;  3SQ2 A;  3LP1 A;  4FW2 A;  4CZE A;  3D2F B;  1NLV A;  4FPA A;  4N5S A;  5LL6 Z;  2GX9 A;  4DSI A;  3HJF A;  4EHT A;  2QW9 A;  3QES A;  1VQ4 N;  2HHS A;  1VSE A; 
#chains in the Genus database with same CATH homology
 1WUA A;  4KH6 A;  3MWP A;  4BC5 A;  4A61 A;  4CZL A;  4BR4 A;  1JCG A;  3ZET A;  3ZX3 A;  2QEX N;  3SK3 A;  1ATR A;  3MK6 A;  4J8F A;  2ASO A;  2HMP A;  3CJA A;  4R79 A;  3CC7 N;  2ITM A;  3LDN A;  4MLH A;  2EWS A;  3GL1 A;  3CET A;  2HBM A;  4IDH A;  4YOY A;  3CCQ N;  2FF3 B;  3D7E O;  3J8A A;  1JJ2 M;  5AQZ A;  4BG8 A;  2GWK A;  3OA9 A;  3WQU A;  3TSU A;  2A5X A;  2AP1 A;  2A41 A;  2F9W A;  3BEX A;  3IMX A;  1CZA N;  4JKG A;  5AQQ A;  5ADX H;  4O8K A;  4MO5 A;  3UKR B;  3ENH A;  3VGL A;  4K25 A;  2V7Y A;  4F9O A;  3CPE A;  4CD3 A;  3RVC A;  5BRF A;  3LL3 A;  4CBU A;  4PKH A;  1Q81 O;  2QXL A;  2HBJ A;  4YOT A;  2Q0R A;  3CCL N;  3CJ1 A;  4K43 A;  2NLX A;  4H0V B;  1XC3 A;  2VGN A;  5BRE A;  3I56 N;  3Q7C A;  3FGU A;  3O9U A;  5AQW A;  3D6R A;  3VMF B;  4DHY A;  5KPT A;  5GIP A;  4MLE A;  4JD2 B;  1GLB G;  2KHO A;  2QTD A;  2FXU A;  1QVG M;  2WC9 A;  4BRQ A;  4IJN A;  5I9E B;  3AY9 A;  5GAD P;  4IEE A;  4OO1 J;  4MDB A;  3L0Q A;  4FO0 A;  2CGL A;  3H6E A;  4FWR A;  4FWL A;  2ZWH A;  1BOT O;  2E2O A;  4FSV A;  2VYP A;  1YIJ N;  4K41 A;  1HLU A;  3WEE B;  4JKE A;  3OHR A;  5CE3 A;  4BRD A;  1T3V A;  4HTL A;  1DEJ A;  3A5L C;  3MN9 A;  2W41 A;  3U8X A;  5C10 A;  3CCM N;  3CCJ N;  3H46 O;  3VPZ A;  1Z6R A;  3VF4 A;  1QQN A;  1G99 A;  3ATV A;  3CHW A;  3KVG A;  4FWO A;  5F2R A;  1ZBS A;  2AA4 A;  3DXK B;  4JD2 A;  1OVY A;  4JK7 A;  4O8U A;  3WQT A;  4B1W B;  4BRE A;  4JNE A;  2YCH A;  4FL9 A;  2ZGY A;  5GAE P;  4IO9 L;  3ZYY X;  4FWS A;  5EVZ A;  5JMV A;  2GUP A;  2NRW A;  3I55 N;  2VGM A;  3IFR A;  4IXC A;  4CBW A;  4IZ9 A;  4FOI A;  2E1Y A;  3WEE A;  3AAQ A;  1YF5 L;  5AQO A;  2P9S A;  4H03 B;  3CMA N;  4MDA A;  3G71 N;  3O8M A;  1KXP A;  4YDU A;  1YJN N;  2P9I A;  5AQI A;  3CJ9 A;  4C23 A;  3WXL A;  1ZXO A;  4BG9 A;  5KQD A;  5HL7 L;  4UY8 O;  3MX5 A;  3UKU A;  3QB0 A;  1R59 O;  4CD1 A;  4YOU A;  2NZT A;  5TKW A;  4BRM A;  1MWM A;  5DM6 L;  3CER A;  3TTC A;  5AQT A;  5BPN A;  4C1N K;  3O08 A;  1YIT N;  3SLC A;  3CCR N;  2WFB A;  5EXW A;  3KZB A;  4BRG A;  4CZH A;  2HBK A;  3LDQ A;  4AF1 A;  4B1U B;  3HOT A;  3ENO A;  4BGB A;  5LJW A;  3VTI A;  5AZJ A;  5ELZ A;  4BVO A;  3FZK A;  4PKI A;  3E9L A;  3RSE A;  4NB4 A;  1NM1 A;  4A57 A;  3ID8 A;  4QS9 A;  1WOQ A;  4BR5 A;  5AQM A;  1NGA A;  1RGI A;  1U6Z A;  3MN6 A;  4M7Y A;  3OBY A;  5M1Q A;  4JAX A;  2E2N A;  1NGJ A;  3I33 A;  1BO5 O;  4BRH A;  5ADX A;  1TYQ B;  2IIR A;  1NMD A;  3SMP A;  3L4I A;  1MDU B;  4JK9 A;  2QWP A;  3GG4 A;  4PKG A;  2ZJR L;  5BPM A;  2GEM A;  4YDU C;  3WXM B;  3KWI A;  5JIC A;  3ZX2 A;  1Z05 A;  2FLO A;  5M1K A;  1KQS M;  2Q1N A;  2V7Z A;  4BRK A;  5BR9 A;  3O9Q A;  2WUS A;  3R1X A;  5FPE A;  2Q97 A;  4JKH A;  2E88 A;  3M1F A;  4H5N A;  2P9K A;  3WXI A;  3ULE B;  3TTF A;  2D4W A;  3O80 A;  3TSQ A;  3EO3 A;  5M1P A;  5M1N A;  2A3Z A;  2NRH A;  2D1K A;  3DJC A;  4FOE A;  2OTL N;  1YJ9 N;  1EQY A;  3CJ7 A;  1GLJ O;  1TYQ A;  2YX6 A;  3LM2 A;  4KH5 A;  4DB3 A;  5AQV A;  3P39 A;  1HUX A;  1YVN A;  2NRR A;  2V52 B;  3FR0 A;  3ZX0 A;  1E4F T;  1VQN N;  4WF9 L;  3SBG A;  3VOV A;  2ASM A;  3H45 C;  3LDL A;  3H1Q A;  5HOO A;  2HF4 A;  1IJJ A;  3D2F A;  1TUU A;  1KAX A;  1DT9 A;  2YJE A;  4PL8 A;  4A2A A;  3C7N B;  3CCE N;  2OTJ N;  2BH1 A;  3VEZ A;  1NGH A;  1RFQ A;  5F1X A;  3I8B A;  4B1V A;  3L4Q A;  3E1Y A;  3M3Z A;  4CZM A;  1OKJ A;  3A8Y A;  3SAF A;  4IEI A;  3VF2 A;  1BG3 A;  3PLA A;  1NGD A;  5AQF A;  5AQG A;  5BRD A;  5AQP A;  4IFE A;  4ISF A;  3F2K A;  1RDW X;  3GBT A;  4Y0W A;  2QM1 A;  3FZL A;  3QFU A;  5AQK A;  4XH1 A;  1C0F A;  4RWT A;  5FPN A;  1E4G T;  5BN8 A;  4U7B A;  3VTH A;  4FVU A;  2QWL A;  1SS6 A;  4H5V A;  5E26 A;  3ZEU B;  4XH4 A;  4JKB A;  2NNW A;  4BRL A;  1P90 A;  4IO8 A;  3CCS N;  2PAV A;  3EKS A;  4NO7 A;  1Q18 A;  3E66 A;  4WQ5 A;  3T7Z A;  4BC3 A;  4JKA A;  2KKZ A;  4JK8 A;  2ZGZ A;  1QVF M;  3UKR A;  1NGI A;  3W3D A;  4BR2 A;  3HOS A;  3C65 A;  1MA9 B;  2P9N B;  3CJC A;  2BUP A;  3P4I A;  1U2V B;  3CQX A;  3VET A;  3GOI A;  5F0X A;  4YOX A;  1BA1 A;  3CXC M;  4FWP A;  1VQ9 N;  2CH5 A;  3WXJ A;  1YXQ A;  2E2Q A;  4EAH D;  1HKB A;  1H1V A;  3A5O C;  3CCV N;  1BA0 A;  4BY9 C;  3B8A X;  3MDQ A;  1VQ5 N;  3DLL L;  1XQS C;  3U9D A;  3ZEU A;  2D0P A;  4H5R A;  2NRT A;  1NWK A;  2IVO A;  3D2E B;  3G25 A;  3Q7B A;  2E20 A;  3BP8 A;  4I6M B;  1K9M O;  5LJV A;  3AAP A;  2H3G X;  3ID6 A;  2P9L B;  3SJH A;  3VEN A;  4A2B A;  2P9N A;  4A62 A;  1S72 N;  1NJI O;  3LM9 A;  1U2V A;  5AQX A;  4NLC A;  4CI6 A;  1QZ5 A;  4GV6 A;  3WT0 A;  3CC4 N;  2P9P B;  3ENB A;  1YHQ N;  3KWG A;  5AQS A;  3AGR A;  3CQY A;  3EN9 A;  2CGJ A;  3VEO A;  4IOA L;  1VQ7 N;  3GDQ A;  1DGK N;  4B1Y B;  4WQ5 C;  1KD1 O;  3FFK B;  2E1Z A;  1BWF O;  3DAW A;  1EO1 A;  1VQO N;  3DXK A;  3O1W A;  2RHK A;  3EKU A;  3HM8 A;  3O5B A;  4NLB A;  1VAZ A;  2PFU A;  3HRG A;  3M6G A;  4JEP A;  2Q2R A;  1HJO A;  2GTD A;  4JN4 A;  3VEV A;  1O13 A;  3CPW M;  3A5N C;  1Q7Y O;  5EY4 A;  3VGM A;  1T6D A;  4YOR A;  2QWM A;  2A40 A;  1GLA G;  4CJ7 A;  1S22 A;  1J6Z A;  4ISE A;  3A5M C;  3TTD A;  2QWQ A;  3FZF A;  4GVE A;  4AM6 A;  2CH6 A;  1ATS A;  2QWO A;  2P9P A;  4FWM A;  4QS7 A;  5KPZ A;  1JCE A;  3N4Q A;  3VEX A;  3FLC O;  3VF6 A;  1NGC A;  3JXU A;  3AGK A;  1YUW A;  4IJA A;  1XUP O;  3U9Z A;  5AQU A;  4CBX A;  2D0O A;  2FSN A;  3MCA B;  5AQJ A;  5M1O A;  4GV3 A;  4M7X A;  2FF6 A;  3EZW A;  5AQL A;  4ISG A;  3QBX A;  3DXM B;  1DKG D;  3E9O A;  5AQH A;  4A59 A;  2ZF5 O;  2Q31 A;  3FZM A;  1QQM A;  4PL7 A;  1W2B M;  3CME N;  2E8A A;  4EHU A;  1GLD G;  4BRP A;  3QML A;  3SAH A;  3TPQ A;  3BF1 A;  1W97 L;  4RCH A;  2ZJP L;  1VQ8 N;  3PIP L;  1D4X A;  1HKC A;  1V4S A;  4FPB A;  3SMS A;  1KAZ A;  2HST A;  2FSJ A;  5C15 A;  4XEI A;  1K73 O;  3OBW A;  2HF3 A;  2YHY A;  2IVP A;  2JWK A;  4WFA L;  1SQK A;  3F5T A;  1LCU A;  4KBO A;  3J7Z O;  3ZET B;  3N4P A;  1K8A O;  2RE2 A;  3IDH A;  5BRH A;  2WBN A;  1RDU A;  5M1F A;  5C2D A;  5H1S Q;  3HTV A;  3IUC A;  4WYB A;  3PIO L;  2UYT A;  4JKD A;  5JVH L;  3QDK A;  3HI0 A;  2IVN A;  3GE1 A;  4FWK A;  5KPR A;  4RTF D;  3CCU N;  4DCH A;  5C2F A;  1X9J A;  4BRA A;  1YI2 N;  3R3L A;  4DKW A;  2J4R A;  2E2P A;  3ATU A;  3VEY A;  3VGK A;  3UB5 A;  4FWN A;  3ULE A;  3LDP A;  1QHA A;  4B1X B;  1NGB A;  4FWQ A;  4JKF A;  3R9P A;  3R8E A;  4YOV A;  4HWI A;  4ILG B;  5AQY A;  1BU6 O;  3P31 A;  1HX1 A;  3L6Q A;  3CF5 L;  4H0Y B;  1T44 A;  3CD6 N;  2QA4 N;  1Q86 O;  3H3O B;  3NMU A;  1NGE A;  4EFH A;  4IWV A;  3VER A;  2VWB A;  3O9T A;  3C7N A;  2BTF A;  3VES A;  5CHI A;  1N8R O;  3KHY A;  3U4L A;  2NRV A;  3KK7 A;  4WQ4 A;  4BVP A;  4G9Z A;  2A42 A;  3E9P A;  1X3M A;  2KLA A;  5JLH A;  3NVK A;  3SAG A;  2NRX A;  5JLF A;  1NGG A;  1KC8 O;  3MN7 A;  3LDO A;  1KAY A;  5B8H A;  4BR7 A;  3W0L A;  3C6A A;  2PBD A;  3EE9 A;  1SZ2 A;  2F7T A;  4BC4 A;  4BQL A;  4WFN L;  3CIP A;  4AM7 A;  4C1N I;  4CZF A;  2V51 B;  1ILY A;  3C6H A;  2I7P A;  2YI1 A;  3C0B A;  1Y64 A;  3S41 A;  4ILH A;  1X3N A;  4H0O A;  4BGA A;  1QQO A;  1VQP N;  3MMV A;  3FZH A;  3EE8 A;  3T69 A;  3R6M A;  1S3X A;  3AAR A;  3MX2 A;  3MWT A;  4DQ8 A;  4WCE L;  2QWN A;  3DWL A;  5LY3 A;  5GAH P;  4U67 L;  5BPL A;  1ATN A;  4GNI A;  3HSC A;  1BUP A;  4B1Z A;  3A0I X;  2P9S B;  3QBW A;  1VQM N;  5CR4 A;  4EIA A;  3TSP A;  1GLE G;  5AZI B;  5FPM A;  2P9I B;  4LC9 B;  1ESV A;  5KQ8 A;  3O9R A;  1GLC G;  3BUZ B;  4K42 A;  4H0P A;  4WQ4 C;  2P9U B;  4WFB L;  4BRF A;  1LOT B;  3UKU B;  3H3N O;  4ILJ A;  5AQN A;  4JKC A;  4MO4 A;  4Z94 A;  3OW2 M;  2W40 A;  1P8Z A;  3M5R A;  4H5T A;  1GLF O;  1TUY A;  2OAN A;  3D2E A;  3HZ6 A;  2Q0U A;  5GIO A;  4CZJ A;  4I6M A;  5EX5 A;  1VQK N;  2HOE A;  4OPH A;  4CZG A;  2JWL A;  3CI5 A;  1T6C A;  1V4T A;  3O6W A;  2YHX A;  2P9L A;  3CJB A;  2GEL A;  5DM7 L;  5AZJ B;  3MN5 A;  2GWJ A;  1ZC6 A;  1VQL N;  1HKG A;  4OPA A;  5AZI A;  4PHT X;  3RSE B;  3HBT A;  3JS6 A;  2CGK A;  5JVG L;  2P9U A;  1M1K O;  1MWK A;  1VQ6 N;  2Q36 A;  4H0T B;  3WXK A;  1K8K B;  1QZ6 A;  3P38 A;  4H5W A;  1JCF A;  4BR0 A;  5AFU A;  4QS8 A;  4IOX A;  5BN9 A;  2ZJQ L;  3TU5 A;  4A5A A;  3WUH A;  4L3Q A;  4CZK A;  2QI2 A;  4O5F A;  3QFP A;  4M63 C;  4KH4 A;  5EOY A;  3H1V X;  5MLC Q;  1Q82 O;  4A5B A;  4BQZ A;  3CC2 N;  3O9S A;  1YJW N;  3G4S N;  3SBT A;  3FE1 A;  4IOC L;  2P9K B;  3BF3 A;  4GV9 A;  1YAG A;  2DPN A;  1SAZ A;  4GY2 B;  4B9Q A;  2FSK A;  3O1B A;  4JHD B;  5TKY A;  4BC2 A;  4CZI A;  3EL2 A;  5C0Y A;  1GLL O;  1NBW A;  1K8K A;  1NGF A;  2NRZ A;  2VCP A;  4BRN A;  4YOW A;  3NVM A;  1C0G A;  5AQR A;  4H0X B;  3IKM A;  1M90 O;  5E84 A;  4E1J A;  5C12 A;  2F9T A;  5GIN A;  2YJF A;  3O4W A;  5AR0 A;  3VEW A;  3G6E N;  3DXM A;  3MCP A;  3UE5 A;  2ASP A;  4BR9 A;  4CZE A;  3D2F B;  2YHW A;  4XH5 A;  1NLV A;  4FPA A;  1BDG A;  2GX9 A;  3QIC A;  1IG8 A;  2I7N A;  3K9K A;  3K9J A;  4EHT A;  2QWR A;  2QW9 A;  4BRI A;  1HPM A;  5FPD A;  1VQ4 N;  4BRO A;  4JKG B;  5AFU H;  5GAG P;  4JHD A;  4BRC A;  3F9M A;  2A6A A;  2HBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...