3C6AA

Crystal structure of the rb49 gp17 nuclease domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
206
structure length
198
Chain Sequence
GTLIRATTLSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSEGRGQDYHALQIIDITEFPYKQVAVYHSNTTSHFILPDIVFKYLMMYNECPVYIELNSTGVSIAKSLAMDLEYDNIICDSFIDLGMKQSKRSKAMGCSALKDLIEKDKLIINHKGTIQELRTFSEKGFHDDLVMSLVIFGWLTTQEKFAEYAGKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Terminase large subunit
publication title The structure of the phage T4 DNA packaging motor suggests a mechanism dependent on electrostatic forces.
pubmed doi rcsb
source organism Enterobacteria phage rb49
molecule tags Viral protein
total genus 66
structure length 198
sequence length 206
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3c6aA00
3C6AA 3CPEA 5C2DA 5M1KA 5M1NA 3C6HA 4IEIA 5C10A 5C2FA 4IEEA 5C15A 4IFEA 4IDHA 5C12A 5M1QA 5M1FA 5M1PA 5M1OA
chains in the Genus database with same CATH superfamily
1QQOA 4A2AA 3WXIA 1NJIO 1IO2A 5KQDA 2HHSA 1ZBSA 3LDPA 5KPTA 3VMFB 1T3VA 3C7NA 4N56A 4JK7A 1LAVA 2A6AA 4AHRA 3CJ9A 3UIQA 4ID1A 1XWLA 2NNWA 5I9EB 1P8ZA 4DF8A 3KKRA 4NCAA 4RG8A 3ID8A 1FKOA 3K5OA 1RTIA 3CM5A 3THVA 1EO1A 1NMDA 4WFBL 3AO4A 5K14A 4M63C 1WUAA 4BRCA 4YFUA 4BC4A 2NRHA 1XC3A 3M8RA 1TYQA 4AF1A 5AQTA 5HOOA 3GG4A 4YDUA 2FBVA 5J1EA 3OYNA 3HM8A 4WYBA 3J7AP 4BR2A 2HVHA 5AQWA 3QEXA 1W97L 3DYAA 1HR0K 1LWEA 2IGIA 4JKGB 4ISEA 2Z1GA 2KFZA 4BRKA 2IC3A 4LF9K 2HNDA 1MWKA 4K41A 4M3RA 3SZ2A 3FZHA 5CY4A 3AGKA 2OA8A 3L2WA 1S1WA 3LPUA 1KFDA 3H45C 3AVCA 4OKKA 4JI4K 1A5VA 2A3ZA 3DRRA 3ZSXA 1KVCA 3D2EA 4FLXA 2V7YA 3QBXA 2P9IB 3LM9A 2QEXN 4FVUA 2PY5A 3G25A 1KCFA 1D9FA 4DFPA 1CLQA 4DSJA 4AH9A 4B3SK 3FE1A 3ZT4A 4CJFA 4L8RB 4LFAK 4JV5K 1ILYA 1SL0A 3CC2N 3C6AA 4DS5A 1WSFA 3SPYA 1QVGM 4DQ8A 3VQ7A 2GELA 1DGKN 3T1AA 2Q2RA 4M3WA 5C15A 4JKBA 5E84A 1GLCG 2OTLN 3G4SN 3BDPA 4EP4A 3J7ZO 3FGUA 4CJSA 3N4PA 2IVOA 4KH6A 1KQSM 5BR9A 5AQYA 4CFCA 1HLUA 4KKOA 2AP1A 2D0OA 1X3NA 3GL1A 3MX5A 4DQSA 2W40A 3B8AX 2ASMA 5DM7L 5MLCQ 1S1VA 3ZX3A 4KHQA 1VQ9N 4W5NA 2IVNA 3LP0A 1NKCA 2EX3A 4R79A 1GLEG 4A5AA 3VEZA 3QLHA 2H3GX 3T1YK 1ZC6A 1XNRK 1OH8A 4E3SA 3VQDA 4DR5K 1LV5A 3KK7A 4NXMK 4M7XA 4PKHA 1JKHA 3KLIA 3DLEA 2P9KB 1EXQA 2HBKA 1DKGD 4H4OA 3HO1A 3ZETA 2UUAK 3HSCA 3EZ5A 3VF2A 3NAEA 3CJAA 1KRPA 2IVPA 3QEIA 3AVMA 2P9NA 2X6SA 3PSIA 4CHNA 2VYPA 2O8EB 3MX2A 2GEMA 3WNFA 4CJUA 3G71N 3R6MA 4B1VA 3SV4A 3E1YA 2W41A 4M7YA 3SQ4A 3SUNA 4PL7A 1JL1A 1HYVA 4I6MA 5J2MA 2D1KA 1I3AA 3HI0A 2X6NA 4WQ4C 4M3ZA 3K2PA 1NK4A 4CFBA 3KZBA 3A8YA 5HBMA 3I0SA 4YOXA 1V4SA 4NLCA 4CZIA 4XH5A 4DTRA 3IDHA 1IKVA 4O4GA 1K73O 4KB1A 3ZCMA 5CYMA 3WEEB 3O3HA 4DQQA 2IS3A 1BDGA 2KLAA 1RDAA 4CJTA 4F2SA 1NGHA 1QZ5A 1QQNA 1NLVA 3QFPA 4JS5A 3DM2A 2FXUA 1VQON 1NJYA 5AQFA 4F3TA 4CK3A 1WBDA 4CF1A 2FC0A 5AR0A 2Y1IA 2GBZA 3VF4A 4DV1K 3CG7A 4GNIA 4XH4A 5M1QA 3MEDA 1TKZA 3P4IA 2AJQA 3UKUB 3P5JA 2UXBK 1S1XA 2ZGYA 3D2FB 3HM9A 3EO3A 2DPNA 2P9UA 2UXCK 3TTDA 2P51A 1V4TA 4X64K 4FJJA 2GX9A 4M41A 3BGRA 5F2RA 3NFAA 1RT4A 3RRGA 1YAGA 4DQRA 3RR8A 2YI1A 1C0UA 2HBMA 2PFUA 2A1SA 4EFHA 1QQMA 3THWA 4IDHA 5M1FA 2F8TA 1QTMA 2JLEA 1C0GA 4YORA 1JLGA 5SZTA 2WTUA 1IH7A 1YVNA 3L0QA 2D0CA 2B5JA 4AHSA 1BI4A 3ALYA 1VRUA 2I7PA 1TK0A 3TPQA 5AQLA 4FJIA 4YOYA 1J5EK 1JXEA 4BRPA 4BC2A 1D8YA 2ASOA 2E6MA 1EWRA 3PX0A 4OPHA 4CGJA 1BIUA 2DY4A 3WQTA 1VSHA 4AM6A 1VQKN 4GKJK 3EYZA 3U3GA 4DU4A 1TK8A 3NF6A 3UKRB 4FL9A 4E7HA 3KWGA 3V9SA 1S72N 5TKYA 1C1CA 1RBRA 2RPIA 1YUWA 2KZMA 1X9WA 4IG0A 2XY8A 4EHUA 1BHLA 4FJ5A 4AHUA 3KIOA 4H0OA 3OYIA 1VQMN 3S9HA 3L2QA 3ENBA 5AQPA 4F2RA 2IOCA 1K8KB 1U2VA 3KVGA 2QM1A 1XC9A 4U67L 4H0TB 3WQUA 1VSDA 2HHVA 4CZHA 3HVTA 3THYA 1NGAA 4FJGA 5M1NA 1NK8A 1R0AA 4F3OA 2NRTA 4JLHA 5DK5A 4A5BA 5CE3A 4CGFA 4DV2K 4CE9A 3IAYA 4CEBA 1HJRA 3CMAN 3T1HK 3RWUA 3WXJA 1ATRA 5AFUA 1EP4A 3OYDA 4IJNA 2YNFA 1Q9YA 4DTNA 3RVCA 5DM6L 3T19A 4XEIA 1B92A 3WNEA 3V1QA 3C6TA 3D6RA 4ELTA 4E1NA 5JS1A 1C0MA 4H0VB 5LMUK 3MWPA 4FZZA 1HMVA 3LAKA 1J6ZA 1GLFO 5JLHA 1EX4A 4CHPA 2OPSA 5BR8K 1SL1A 2X74A 1L3VA 4KHWA 3OYGA 1MA9B 1RT7A 4LH5A 3CJ7A 5HRRA 3AVJA 3O9RA 5ELZA 1JLEA 4RWTA 3CI5A 3HTVA 3DLBA 3GOIA 1XHXA 3EN9A 2P5GA 4BR9A 2P9PB 3W0LA 4JI0K 3W3DA 1VSEA 3FFIA 1OVQA 2F7TA 4BGAA 3KLGA 4LF6K 1GLLO 2YKNA 3O3GA 2RN2A 4FCYA 1L5UA 4DTPA 3SAGA 1J54A 2HBLA 4ILJA 4Y1DA 2UUCK 1BU6O 4IWVA 3HPHA 2ZD1A 2FF6A 4RW4A 3PLAA 2FSKA 3JAMO 3AO1A 1VQ6N 3TABA 4O8UA 5LMNK 3O08A 4FJ7A 3KLFA 1ZBHA 4CVNE 4JKHA 4FWSA 2YHXA 3AAPA 1HQUA 2QWOA 2CH5A 4OX9K 4DSKA 4FK0A 3LP3A 3E9PA 4BE2A 2HSTA 3PO4A 4K8XA 3PX6A 3CD6N 5BPNA 4CJWA 5D3GA 2YV0X 4E7KA 2F9TA 3DXMB 4ELUA 4HVJA 1QQCA 1NGIA 4H0XB 4LF8K 3VQAA 3SK3A 2Z1JA 3V6DA 3L2RA 1FW6A 4CIGA 2HNYA 1TGOA 2E2PA 5F1XA 4LH4A 3TAPA 4K43A 4CJ4A 4J2EA 1J9AA 1YXQA 4BR4A 4E7IA 3LP1A 3O4NA 4XH1A 3F73A 1NG9A 5C0YA 3F9MA 4CF9A 3AVLA 5ADXA 4QS8A 3SUOA 2E2NA 3SQ0A 3U3YA 1NGGA 4BACA 4KBOA 1XI1A 3N4QA 3FZLA 2GWJA 3I55N 3ZSWA 1YT3A 4YOTA 2HVIA 2E1YA 5AZIB 3O80A 1WSIA 3EKSA 2YCHA 2YJFA 3E66A 4NYNA 1N8RO 4H5TA 4FWNA 2DFFA 3MN7A 1TKXA 3OYKA 1REVA 2ATQA 4E1JA 1BUPA 4CJEA 4OVLA 3NHGA 4IZ9A 5FROA 1TUYA 1WOQA 1IKXA 3EE8A 2VQFK 3VQCA 3I8BA 4M42A 1JLBA 2P9SA 4NO7A 4I9LA 2GUPA 2Q36A 1HUXA 3WXMB 3QNNA 3G0ZA 1WB9A 4DR3K 5AZJB 2YKMA 3B6PA 2HHWA 3ULDA 3QNOA 1DEJA 2QWNA 2IDOA 3V9UA 4DFKA 5IT9O 1Z05A 4QS9A 2E2OA 1NJXA 3LZIA 3WXKA 2O8EA 4LC9B 4BRDA 1RDUA 1J53A 3OW2M 2FBTA 3F2KA 4H4MA 1TL3A 4TSXA 1ZBFA 3P83D 4DR4K 2G8UA 3VPZA 2O8FA 2D0BA 4BY9C 1D5AA 1DTTA 3S3OA 2Q3SA 4JKDA 3CCMN 1FJGK 3PV8A 5FPEA 3TAFA 3CERA 4JI8K 2O8BA 2G8IA 2ZE2A 3PX4A 3RSEA 3KK2A 3KD1E 5J2QA 2HHTA 4CHZA 3VGMA 3VEWA 2EWSA 2IAJA 5GIPA 3OS1A 1U47A 2OTJN 2QWQA 4HHTA 1C0FA 4JI1K 4KTWA 3WEEA 1T03A 5AJ3K 3M8SA 3SJJA 1TK5A 3DLGA 5AQIA 2UUBK 2HOEA 1KFSA 1NGEA 3ULEB 4OJRA 3TAGA 1HKCA 4GVEA 5AQOA 3HSTB 1NWKA 1FKPA 2HMPA 4AHCA 5CZ1A 4NCGA 3QBWA 4FSVA 3CM6A 3TI0A 3GBTA 1S5JA 4CZEA 3NE6A 1XMOK 4B9LA 4YNQA 4DQPA 3WT0A 3SAHA 2W42A 4KPYA 2A40A 4J8FA 3LDLA 3V9ZA 3JSMA 4ILGB 2P1JA 4A59A 2G8KA 4B3TK 1NK0A 1BQNA 4EHTA 3ENOA 3SNNA 1QE1A 2A5XA 3QETA 3DRSA 5LJWA 4KHUA 3AVAA 2BANA 4DCHA 4J2DA 5EY4A 2P5OA 2VG5A 5HROA 5C2FA 1WBBA 3K9JA 3QFUA 4HWIA 5CHIA 4A62A 5KTQA 4DUYK 2RF2A 4JHDA 1FXXA 3ZSZA 3QO9A 1GOAA 1SV5A 1IJJA 3CCVN 3LPTA 2D0AA 2KW4A 4DSEA 4DTJA 3FR0A 4E19A 1SL2A 4O55A 1JLAA 1QSLA 2QTDA 4GKKK 1HNIA 2BGGA 4WQ5A 4BREA 3S41A 5FPMA 2YNGA 4C8OA 2YX6A 3C65A 4CJVA 4KO0A 4YOWA 1HX1A 4FJHA 3O1BA 3L2UA 3HYFA 1K9MO 2B4JA 5M1KA 3O8MA 1T44A 5JLFA 3TTCA 2GV9A 3OYLA 4B08A 5JMVA 3QICA 1RDBA 3AO3A 1TAQA 4A2BA 4HUEA 3Q7BA 1HYZA 3D0PA 1NOZA 1NMNA 4OPAA 1WSJA 3QDKA 1M90O 4JI5K 3IUCA 1VQ8N 2CGKA 2UYTA 3RMCA 4GV3A 4IFYA 2VCPA 4JN4A 2I5JA 2A41A 3MK6A 3DLRA 3CCSN 3AVBA 3VGLA 3V4IA 3ENHA 1SKSA 2ASPA 3DXKB 5DMRA 4HCCA 4KHPK 1NKEA 4BR0A 2E5LK 4NXNK 2BDPA 4YY3K 3OY9A 4CGHA 3SUQA 3O1WA 2QA4N 2UXDK 1GLJO 3RMDA 2P9LA 4BRGA 4DTUA 1YHQN 1Q8IA 4BRHA 4CJQA 5JVGL 4DB3A 3PIPL 1SAZA 2HHUA 3OVNA 4JI3K 1G15A 2VWKA 4W5OA 1XQSC 1K6YA 4LY7A 4BE1A 4CJ3A 4CZGA 4OPJA 2O4IA 3K57A 4KB0A 4M3TA 3SMPA 3E01A 3G10A 4FWLA 1OKJA 4LF5K 4FPBA 3SCXA 3MMVA 1IV0A 1Y64A 3CQ8A 1IKYA 4CEAA 1RBUA 1JLCA 5AQQA 3M6GA 3VTIA 2IIRA 4JYAK 3KLHA 3CFRA 2ITMA 3O3FA 2O8DA 3KTQA 3OYEA 1JCEA 5C42A 3SQ1A 2W6KA 1OH5A 5C12A 3M5RA 4EIAA 2A1RA 1U6ZA 4CGIA 4CEFA 3KKSA 3CCUN 4B9MA 1RNHA 1Q7YO 2W6LA 1HQEA 1J5OA 4CFDA 3DRPA 3O9QA 4JI6K 5AQJA 2ZJRL 1E3MA 3NF8A 1JCGA 3SQ2A 4J2AA 5AQXA 2NLXA 4CIFA 1VQ5N 4FWPA 4B3RK 4DU1A 5FPNA 4E0DA 1W7AA 5AQSA 4G1QA 4RW7A 4Z4EA 5FDLA 3ISNC 3ZSRA 3R8EA 1XNQK 3AAQA 4B1UB 2HHXA 3M3ZA 2Q1NA 3CXCM 5B8HA 5KI6A 3CCRN 4JRPA 4FZXC 4PQUA 3HOSA 2PAVA 4IOCL 1CXQA 4JD2B 1VRTA 4LF4K 4PL8A 2ZF5O 4BDYA 3H6EA 4KREA 3CCJN 1T7PA 1NGJA 5TKWA 4DWIA 2O8CA 5BPLA 4CHOA 4K25A 4RCHA 4FM2A 3VQPA 3AVIA 4FLWA 5KGWA 2E1ZA 3A5NC 1UA0A 4AHVA 3ZEUA 3C7NB 4CF0A 3AY9A 1ZYQA 1VSIA 4B9VA 4GV6A 4BWMA 4WFNL 4O44A 1U48A 1S22A 4M3UA 3LWLA 2V52B 3SBTA 4BRAA 4CK2A 1CZ9A 3DLLL 4DQIA 1VK0A 1QS4A 2CH6A 1TVRA 2YNHA 2HB5A 2KKZA 2OZMA 4BR7A 1TYQB 5J2PA 3EY1A 3AO5A 2EHGA 3ATVA 3H46O 4CD3A 1XMQK 3K58A 1U04A 4BVPA 1RBTA 4CJRA 4FK4A 4OGCA 1RCHA 3L2VA 5BN8A 1BO5O 2G8FA 1NGCA 2BH1A 1RT5A 4J2BA 5C10A 4CEDA 3DI6A 2VQEK 3ZX2A 4K8ZA 1X3MA 4BC3A 3EE9A 2FBXA 3F9KA 3VQ5A 5CR4A 4O0IA 2VG6A 2Y1JA 2OPQA 1KLMA 3AARA 4I7FA 2J4RA 2ETJA 4Z94A 4DV6K 1KTQA 5KPZA 4DKWA 3ITHA 5AQMA 1SS6A 4ZTFA 3HVRA 4LSLA 5BRDA 3VQ8A 1KAYA 5AZJA 4PUOA 4DV4K 1ASVA 4FJLA 3QB0A 3TAMA 1VSMA 3THXA 5H1SQ 4C1NK 1ZBLA 1NK6A 4FPAA 5C24A 3SUPA 1VSLA 3VF6A 3LZJA 4CBXA 1S3XA 2D0PA 3NGZA 2R7YA 4H03B 3M1FA 4GVMA 1IG8A 1NK5A 4FJNA 3OTOK 3J7YP 2O4GA 1U4BA 1BQMA 3ZLJA 2QWPA 2XY6A 4C8NA 1RDDA 5GAHP 1YJNN 1Q82O 1CZAN 1GOBA 4N47A 3MDQA 4FLUA 3CFOA 4U7BA 1Q86O 3SMSA 4A57A 4DV5K 3ZX0A 2GUIA 1YJWN 3DJCA 2YHAA 3NCIA 3L3VA 4DS4A 1TKDA 1X1PA 4BRQA 3CMEN 3FZMA 3OYAA 4FXDA 2B6AA 3HP9A 3R3LA 3LL3A 4I2PA 3U4LA 3CF5L 3LWMA 3H3OB 4CEQA 1LAWA 1BA0A 2HMIA 2PBDA 2FSJA 3ZETB 3NH1A 4JS4A 1RDWX 1CZBA 1S9EA 1JL2A 4EAHD 1YTAA 3QIPA 4Z4HA 1L3TA 3UB5A 4FW1A 4A61A 2P9NB 2D5RA 1HYSA 2Q0RA 4RTFD 3SI6A 3TU5A 2QXLA 1CXUA 2GTDA 1LW0A 4BRMA 4O8KA 1JLFA 2JWLA 4KAZA 4H0YB 1N33K 1VSJA 4WFAL 1RDCA 5KPRA 3T3FA 1EQYA 5FRNA 3BZCA 1WAFA 1UWBA 2YHWA 3M8PA 2F9WA 4I6MB 4CI6A 4CIEA 4JKGA 1HNZK 1NNEA 3LM2A 3T69A 1HPZA 4KFBA 4KTQA 1N5YA 2E4LA 1RTHA 1WNSA 2GWKA 4B9SA 3C0BA 1IKWA 4Y1CA 2P9IA 2KHOA 3V9XA 5FRMA 3SYZA 3OS2A 4IJAA 2XRIA 2WBNA 2OCEA 4EZ9A 5E26A 3VEYA 1NGFA 3K5MA 4CCHA 1LWCA 3SBGA 4BRIA 4CF8A 4F4KA 1QSYA 3DWLA 3VEVA 3OYJA 4JK8A 1GOCA 3WUHA 4MFBA 4AHTA 2ZQBA 4NYFA 4FWQA 3QEWA 1QHTA 2OPPA 4DV3K 5AQNA 2VGMA 4B3OA 1IBMK 4CZLA 4AQYK 5GAGP 3JYTA 1S1TA 1ZBUA 4LD0A 1RFQA 2Q31A 3WNGA 2QI2A 3G6EN 5HRPA 1D4XA 4WCEL 3NF9A 1HJOA 4JAXA 2QWMA 2P9UB 3KK1A 4EZ6A 1S6QA 5AQVA 2F96A 1QZ6A 4OLBA 2OANA 4M3YA 5SWMA 2G8HA 1EWQA 4Z4CA 4K42A 3AA5X 3VOVA 3RR7A 1W9HA 1WSGA 3CQXA 4IOXA 2WUSA 3QERA 3THWB 4OO1J 1ATNA 4X65K 3LALA 3ZSYA 4DV7K 3MN6A 4FYDA 4UY8O 1C6VA 4BRFA 3CHWA 3PIOL 5I42A 4ELVA 1BI4B 4KHNA 4IOAL 4JEPA 4AILC 1DT9A 1YJ9N 1HNVA 2DFHA 3OYBA 4IEEA 5AFUH 2P9KA 3TTFA 4FWMA 4W5QA 3R9PA 5AQRA 3H3NO 3HK2A 3IS9A 1YTUA 4BRNA 2AA4A 3EL2A 1IG9A 3BZKA 5C25A 4DSLA 2LSNA 4YOUA 2Z1IA 3QEVA 4FLZA 3MWTA 4CZJA 4DTSA 3V1OA 3ZT3A 4CEOA 1RT1A 4FWKA 3U9ZA 4H5VA 3HBTA 4YOVA 1W0HA 1UOCA 1SKRA 3AVFA 2WOMA 4WF9L 3CETA 2ZGZA 1BA1A 1C1BA 2BTFA 4PHTX 1NGDA 4IDKA 2NUBA 3LDSA 1FK9A 4ISGA 1LW2A 3BEXA 3U8XA 3DMJA 4MQ3A 4FK2A 1U2VB 3EZWA 3P1GA 3PY8A 4B9NA 4BQLA 3K0SA 4MO5A 4MDAA 4CECA 1RT2A 4KV8A 3THYB 2XY7A 3IKMA 1O1WA 5JICA 2V7ZA 2CGLA 1DTQA 3NGIA 5KQ8A 2NRRA 1K8AO 4WE1A 2PZSA 4Z0UA 3CC7N 1VHXA 4KI6A 4V19S 2ITGA 1LCUA 3CJ1A 1XUPO 1KLNA 4C1NI 4DFJA 4BWJA 2YNIA 2KQ2A 1WN7A 1P90A 2DTUA 3C94A 5M1OA 4OGEA 3U6FA 3HPOA 1NM1A 1Z25A 3UKUA 1HKGA 4KI4A 3D2FA 1X9JA 2A42A 1JJ2M 1A5WA 1O13A 2Q0UA 1I94K 1D9DA 2HHHK 5C2DA 4DTXA 5ADXH 3ZYYX 4DSIA 3CC4N 3AO2A 3TSQA 3A5MC 3OHRA 4M3XA 2E88A 4OKJA 2ZJQL 3A5OC 1E4FT 1LWFA 3VN5A 4JKEA 3NH2A 2PYLA 2UU9K 3LDNA 4JKCA 2QXFA 3SJHA 2QK9A 1Q18A 3AVHA 3MN9A 1OH6A 1I39A 2NRXA 3ZT1A 4DFMA 1M1KO 1Z26A 5HRSA 3PO5A 2YHYA 5EOYA 5EX5A 5LY3A 3BP8A 4CJPA 3O6WA 3MXIA 4CGDA 1NKBA 4IXCA 3C95A 5BREA 3VQBA 1BWFO 3QIOA 3DAWA 2OZSA 1R59O 4N41A 3H08A 1JCFA 1IBLK 5J2NA 4WQ4A 3I33A 3A5LC 4NB4A 1NGBA 4QCLA 3CJCA 4E89A 1KD1O 3FZKA 1RGIA 1SZ2A 3UKRA 4IKFA 1RT3A 3H1QA 5EVZA 3F5TA 4B9TA 1A5XA 4GMJB 1QSSA 3LP2A 1T6DA 3VERA 2YJEA 4O5FA 3QESA 2CGJA 4IO8A 4Y0WA 4FM1A 1GLDG 3JS6A 3IRXA 4CK1A 3MAQA 4IFEA 4F9OA 5JS2A 3NVMA 3OJSA 3ZSOA 1NOYA 2XO7A 3VQQA 3AVKA 3V9WA 1K8KA 3OBWA 2VG7A 4Z4FA 2JWKA 3CYMA 4KHYA 4BC5A 5BPMA 4BGBA 4K0KK 4FJKA 5GIOA 3TARA 1LOTB 1T6CA 1VSFA 1VAZA 4E7JA 4CZFA 1YI2N 1TAUA 3GE1A 3S3MA 4C8LA 3PSFA 3VEOA 4DLGA 3BF1A 1X9SA 3V81A 1SKWA 4BQZA 3NGYA 4X62K 3Q7CA 3MEGA 3O4WA 3O5BA 3OYHA 4YDUC 4MLEA 1RILA 4BG8A 2F8SA 2P9SB 3ZSVA 4B1XB 3MEEA 3VEXA 1BCOA 2E20A 4DF4A 4CJKA 3CIPA 1EETA 5AQZA 4NLBA 2ZM6K 1BCMA 3BF3A 1GLBG 4H0PA 5IWAK 4JKFA 4HUGA 1ASUA 4IEIA 3TAQA 1KXPA 4WQ5C 4OPKA 1NK7A 3VQ6A 1RTJA 3C6HA 4L3QA 2NRVA 3D7EO 4FW2A 2P9PA 4X66K 3QEPA 4QS7A 5EU7A 1W2BM 1BISA 1NJZA 4B9UA 3CCEN 3A0IX 3FFKB 2QWLA 2DFEA 3GDQA 5LL6Z 4XIUA 4O0JA 2O8FB 3VETA 5GADP 1OVYA 3C6UA 5E41A 1VQ4N 4DR7K 4LF7K 2HF4A 3MCAB 4DHYA 2O8BB 2E8AA 2NRZA 3IFRA 3RSEB 3L4QA 4ID5A 2E6LA 3UE5A 1N34K 4B8AB 1B9FA 3KJVA 2Q97A 1N32K 3RTVA 1KSPA 2KTQA 2HF3A 1ITGA 5AQKA 3HXMA 1ESVA 3HZ6A 2KZZA 2RKIA 3U9DA 3I56N 1KAZA 4ICLA 3E9OA 1VQLN 2NRWA 3DXMA 1VQNN 1ATSA 3KLEA 3K5LA 1WSEA 4H8KA 4KRFA 2I7NA 3QINA 4MO4A 3ZT2A 4CEEA 3VA3A 4CEZA 4FLVA 4ZTJA 1RTDA 4B8CA 3JXUA 3OBYA 4N5SA 3ASMA 3O4QA 3M8QA 3EEQA 3VTHA 3SAFA 3TWHA 1SQKA 4PWDA 1RT6A 4PY5A 3FLCO 4BDZA 4R5PA 4AM7A 5BRHA 4B1WB 2Z1HA 3ID6A 1MU2A 3NH0A 4Q0BA 1KVBA 1S1UA 4JHDB 5AZIA 4BROA 5A2QO 4DMNA 4BG9A 4CZMA 1WSHA 5GAEP 3VQEA 1DLOA 4H5WA 3J80O 3NBPA 3FZFA 3E9LA 3IG1A 3NMUA 5F0XA 3KK3A 3D2EB 4FJ8A 1HNXK 1L3SA 4IG3A 1KVAA 2FBYA 3VA0A 5FPDA 3HP6A 3RMBA 2X78A 4I2QA 4FOEA 4FOIA 5FLXO 4HCBA 5KRTA 3SPZA 4E7LA 4Z4GA 5EXWA 1T8EA 3LAMA 5CYQA 1C1AA 3HT3A 3RRHA 3LANA 2WFBA 2OYQA 3LDOA 5T7BA 2XY5A 3BUZB 3HOTA 2V51B 1SUQA 4BRLA 3HL8A 2F4VK 1C0TA 4DLEA 2QKKA 4NCBA 2HHQA 4B9QA 4UQGA 2QKBA 4C23A 4CGGA 3DLHA 3B6OA 4ILHA 2XHBA 3O9UA 4JI2K 1E4GT 4KH5A 3VESA 2P9LB 1U45A 4KH4A 4M45A 3VQ9A 4CBUA 4FJXA 5HRNA 4FLYA 3S3NA 1WAJA 4CJ7A 4KHSA 4CHQA 1ZXOA 3ULEA 1U49A 3K5NA 3DOLA 3SV3A 3AGRA 4BR5A 4HTUA 2ZWHA 1UA1A 4DR6K 3MXJA 3CFPA 2KFNA 1TUUA 2YHBA 4CHYA 1YIJN 3SLCA 4RW9A 5HP1A 4HTLA 1BIZA 4CBWA 4H5NA 1NU0A 1HPMA 1OH7A 2O8DB 1VQPN 4FWRA 4JRQA 4CD1A 5GINA 2WC9A 1UAXA 2QW9A 1S6PA 3AA4A 1F21A 1YVUA 3TANA 4I9QA 3QMLA 2G8VA 1TL1A 3HPGA 1NK9A 3OS0A 4OLAA 1ZBIA 4PA1A 1HNWK 4B1ZA 4DUZK 1X9MA 5LJVA 5KRSA 1BOTO 2E2QA 4DR1K 1S9GA 4CJ5A 1MWMA 4FZYA 1VQ7N 4BVOA 3MXMA 1HKBA 4C8KA 1YF5L 4PKIA 3CPWM 5M1PA 3HJFA 3AV9A 4FJ9A 4JK9A 5BRFA 4O5BA 4GY2B 2BUPA 2VWJA 3OYFA 1RBSA 3WXLA 4CERA 4EP5A 3NDKA 4CF2A 1ASWA 4GW6A 4HUFA 4FVMA 1JLQA 1BL3A 1TKTA 5AQHA 1H1VA 3L4IA 3AVGA 2VWBA 4FJMA 5AQGA 2O8CB 2JGUA 3CCQN 3OJUA 4DV0K 4IO9L 3L6QA 4CESA 5I3UA 4CJLA 5HL7L 3I8DA 2HNZA 3LDQA 3D45A 4G9ZA 3BY5A 1BG3A 3P38A 3ZEUB 2HBJA 3DXKA 3KWIA 3MECA 3K59A 1QVFM 4DU3A 1TV6A 2BE2A 4DR2K 3MCPA 4DTMA 4RW6A 4QOZB 3A2FA 4JKAA 2FSNA 1N36K 1XHZA 4BE0A 4IBNA 1L3UA 4DTOA 3OYCA 3DOKA 4DG1A 1RBVA 2QWRA 4CFAA 3L3UA 3CCLN 1Q81O 4JI7K 1QHAA 4ZHRA 3TSPA 3R1XA 3V1RA 1JXBA 4B1YB 4Z4IA 1MDUB 3MN5A 2NZTA 3CJBA 4FO0A 4CZKA 4LFCK 3P39A 5KGXA 3AVNA 2ZJPL 3I0RA 3O9SA 4ISFA 4GV9A 3J8AA 3NF7A 1NJWA 1BGXT 5BN9A 4RW8A 4QAGA 5CZ2A 4LFBK 3CQYA 2FLOA 4LSNA 3KD5E 1Z6RA 4N76A 1WLJA 3T7ZA 3WNHA 2G8WA 1N6QA 4F8RA 3VENA 3NVKA 2HW3A 3AA3A 2OPRA 1EKEA 3ZSQA 4YHHK 4CW7B 1YITN 1HRHA 1VSKA 2VGNA 4BDPA 1G99A 4OKEA 4IFVA 4DSFA 2FF3B 3HRGA 4Q5VA 3THXB 4C8MA 3TR8A 2RHKA 3VQ4A 3EKUA 5AQUA 3IMXA 1GLAG 1Y97A 3KHYA 3OA9A 3L8BA 1Q9XA 2D4WA 1NBWA 1KAXA 1T05A 3OYMA 4W5RA 3VGKA 4FWOA 3ATUA 3DLKA 3O9TA 1KC8O 4FM0A 3J81O 4FLTA 4B3MK 2RE2A 3H1VX 4JNEA 4PKGA 3AA2A 5JVHL 2WONA 3ZT0A 3CPEA 4H5RA 4JD2A 4W5TA 3TAEA 4KTZA 4E1MA 3K9KA 4MDBA 5HLFA 3RMAA 2PYJA 4MLHA 1B9DA 3PUFA 3P31A 3TSUA 1IBKK
chains in the Genus database with same CATH topology
3CD6N 1QQOA 5BPNA 4A2AA 3AARA 4MLEA 3WXIA 1NJIO 4BG8A 5KQDA 2J4RA 4Z94A 1ZBSA 2P9SB 3LDPA 2F9TA 3DXMB 5KPTA 3VMFB 4DKWA 5KPZA 1T3VA 5AQMA 4B1XB 3C7NA 3VEXA 4JK7A 1NGIA 1SS6A 2E20A 4H0XB 3CIPA 5BRDA 2A6AA 3SK3A 3CJ9A 5AQZA 1KAYA 4NLBA 2NNWA 5AZJA 3BF3A 5I9EB 1GLBG 1P8ZA 3ID8A 2E2PA 3QB0A 5F1XA 4H0PA 4JKFA 4K43A 1EO1A 1NMDA 4IEIA 4WFBL 5H1SQ 4C1NK 4M63C 4FPAA 1WUAA 1YXQA 1KXPA 4WQ5C 4BR4A 4BRCA 4XH1A 3C6HA 5C0YA 4L3QA 2NRVA 3F9MA 4BC4A 2NRHA 1XC3A 3D7EO 3VF6A 1TYQA 4AF1A 5ADXA 5AQTA 2P9PA 4QS8A 1S3XA 4CBXA 3GG4A 5HOOA 2D0PA 4YDUA 4H03B 2E2NA 4QS7A 1W2BM 1NGGA 4KBOA 3CCEN 3A0IX 3FFKB 2QWLA 3GDQA 3FZLA 2GWJA 3M1FA 3N4QA 3HM8A 1IG8A 4WYBA 3I55N 3VETA 5GADP 1OVYA 4BR2A 1VQ4N 4YOTA 5AQWA 1W97L 2HF4A 3MCAB 4DHYA 2E1YA 2E8AA 2NRZA 3IFRA 5AZIB 2QWPA 3O80A 4ISEA 4JKGB 3EKSA 3RSEB 2YCHA 4BRKA 5GAHP 1YJNN 1MWKA 2YJFA 3L4QA 4K41A 3E66A 1Q82O 1CZAN 1N8RO 4H5TA 3UE5A 3FZHA 4FWNA 3AGKA 3MN7A 3MDQA 2Q97A 4E1JA 4U7BA 1BUPA 1Q86O 2HF3A 3H45C 3SMSA 4A57A 5AQKA 3ZX0A 1ESVA 2A3ZA 3HZ6A 4IZ9A 1YJWN 3D2EA 2V7YA 1TUYA 2P9IB 1WOQA 3DJCA 3LM9A 3QBXA 3U9DA 3I56N 2QEXN 1KAZA 3EE8A 4FVUA 3E9OA 3I8BA 1VQLN 2NRWA 2P9SA 4NO7A 3G25A 3DXMA 1VQNN 4BRQA 1ATSA 2GUPA 3FZMA 2Q36A 3CMEN 3R3LA 1HUXA 3LL3A 3WXMB 3FE1A 2I7NA 3U4LA 3CF5L 1ILYA 4MO4A 3H3OB 5AZJB 1BA0A 2PBDA 1DEJA 2QWNA 2FSJA 3CC2N 3C6AA 3ZETB 1Z05A 4QS9A 1RDWX 2E2OA 1QVGM 4DQ8A 3JXUA 4EAHD 3OBYA 3WXKA 2GELA 1DGKN 2Q2RA 3UB5A 4LC9B 4A61A 4BRDA 2P9NB 4JKBA 5C15A 1RDUA 2Q0RA 5E84A 4RTFD 3VTHA 3SAFA 3TU5A 3OW2M 1GLCG 2QXLA 3G4SN 2OTLN 2GTDA 4BRMA 4O8KA 2JWLA 3J7ZO 4H0YB 3F2KA 3FGUA 1SQKA 3N4PA 2IVOA 4KH6A 4WFAL 1KQSM 5BR9A 3VPZA 5AQYA 1EQYA 5KPRA 1HLUA 3FLCO 2AP1A 4BY9C 2D0OA 4AM7A 1X3NA 2YHWA 3GL1A 3MX5A 4I6MB 2F9WA 4JKDA 5BRHA 5FPEA 4B1WB 3ID6A 3CCMN 3CERA 4JHDB 5AZIA 2W40A 3B8AX 4BROA 2ASMA 4JKGA 4CI6A 3RSEA 3LM2A 3T69A 4BG9A 5DM7L 5MLCQ 4CZMA 3VGMA 5GAEP 3VEWA 2EWSA 5GIPA 3ZX3A 1VQ9N 2GWKA 2OTJN 2IVNA 2QWQA 4H5WA 3C0BA 1C0FA 3FZFA 3WEEA 3E9LA 4R79A 3NMUA 1GLEG 5F0XA 2P9IA 2KHOA 4A5AA 3VEZA 3D2EB 2H3GX 1ZC6A 4IJAA 5AQIA 2HOEA 1NGEA 2WBNA 3ULEB 3KK7A 5FPDA 5E26A 4M7XA 4PKHA 1NGFA 3VEYA 3SBGA 2P9KB 4BRIA 1HKCA 4GVEA 5AQOA 1NWKA 3DWLA 3VEVA 4JK8A 2HBKA 4FOEA 2HMPA 4FOIA 3WUHA 1DKGD 3QBWA 4FSVA 3GBTA 4CZEA 3ZETA 3HSCA 4FWQA 5EXWA 3WT0A 3SAHA 3VF2A 3CJAA 2A40A 4J8FA 3LDLA 2WFBA 2IVPA 4ILGB 5AQNA 4A59A 2VGMA 2P9NA 4CZLA 4EHTA 2VYPA 3ENOA 3LDOA 3MX2A 5GAGP 3BUZB 2GEMA 3HOTA 2V51B 2A5XA 1RFQA 2Q31A 3G6EN 2QI2A 4BRLA 5LJWA 3G71N 1D4XA 3R6MA 4B1VA 4DCHA 5EY4A 4WCEL 3E1YA 2W41A 4M7YA 1HJOA 4JAXA 2QWMA 5C2FA 2P9UB 3K9JA 3QFUA 4HWIA 4PL7A 5CHIA 5AQVA 4A62A 4B9QA 4I6MA 1QZ6A 2D1KA 2OANA 3HI0A 4JHDA 4C23A 4K42A 4WQ4C 3VOVA 4ILHA 3CQXA 4IOXA 3O9UA 1E4GT 2WUSA 3A8YA 1IJJA 3KZBA 4KH5A 3CCVN 4YOXA 3VESA 2P9LB 5LY3A 3FR0A 4OO1J 1ATNA 1V4SA 4KH4A 4NLCA 4CZIA 4XH5A 3IDHA 1K73O 2QTDA 3MN6A 3WEEB 4CBUA 4WQ5A 4BREA 3S41A 5FPMA 4UY8O 4BRFA 2YX6A 3C65A 3CHWA 3PIOL 4YOWA 1HX1A 1BDGA 4IOAL 4CJ7A 3O1BA 4JEPA 1DT9A 1K9MO 1YJ9N 1ZXOA 5M1KA 3O8MA 2KLAA 1T44A 3ULEA 5JLFA 4IEEA 5AFUH 1NGHA 1QZ5A 3TTCA 1QQNA 1NLVA 2P9KA 3QFPA 3TTFA 4FWMA 3AGRA 5JMVA 3R9PA 4BR5A 3QICA 5AQRA 3H3NO 2ZWHA 2FXUA 1VQON 4A2BA 3Q7BA 5AQFA 1TUUA 4BRNA 2AA4A 3EL2A 4OPAA 5AR0A 3QDKA 1M90O 4YOUA 3VF4A 3IUCA 1YIJN 3MWTA 2CGKA 2UYTA 4CZJA 1VQ8N 4GV3A 3SLCA 4HTLA 4CBWA 4H5NA 4GNIA 4XH4A 5M1QA 4FWKA 2VCPA 1HPMA 4JN4A 3P4IA 2A41A 3MK6A 3U9ZA 3UKUB 3CCSN 1VQPN 4H5VA 4FWRA 3VGLA 3ENHA 3HBTA 2ASPA 3DXKB 2ZGYA 3D2FB 4CD1A 3EO3A 2WC9A 5GINA 2DPNA 4YOVA 4BR0A 4WF9L 2P9UA 2QW9A 3CETA 3TTDA 1V4TA 2ZGZA 1BA1A 2GX9A 3O1WA 2BTFA 4PHTX 5F2RA 1NGDA 1YAGA 3QMLA 2QA4N 4ISGA 1GLJO 2YI1A 3BEXA 2HBMA 2PFUA 3U8XA 4EFHA 1QQMA 2P9LA 4IDHA 5M1FA 1U2VB 3EZWA 1C0GA 4YORA 4B1ZA 4BRGA 1YHQN 4BQLA 4MO5A 1YVNA 4MDAA 5LJVA 1BOTO 2E2QA 4BRHA 5JVGL 3L0QA 4DB3A 1MWMA 3PIPL 1SAZA 1VQ7N 3IKMA 4BVOA 5JICA 1HKBA 2V7ZA 1YF5L 4PKIA 1XQSC 2I7PA 3CPWM 2CGLA 5M1PA 5KQ8A 3TPQA 2NRRA 4CZGA 5AQLA 4JK9A 1K8AO 5BRFA 4GY2B 2BUPA 4YOYA 3CC7N 3WXLA 4BRPA 4BC2A 3SMPA 4FWLA 1OKJA 2ASOA 1LCUA 3CJ1A 1XUPO 4C1NI 4OPHA 4FPBA 5AQHA 1H1VA 3L4IA 3MMVA 2VWBA 1Y64A 3WQTA 5AQGA 4AM6A 3CCQN 1VQKN 4IO9L 3L6QA 5AQQA 3M6GA 1P90A 3VTIA 2IIRA 5HL7L 3UKRB 4FL9A 3LDQA 5M1OA 3KWGA 2ITMA 4G9ZA 1S72N 1NM1A 3UKUA 1JCEA 1BG3A 1HKGA 3P38A 5TKYA 3ZEUB 5C12A 2HBJA 3DXKA 3D2FA 3KWIA 3M5RA 1YUWA 1X9JA 4EIAA 1QVFM 2A42A 1JJ2M 1U6ZA 3CCUN 1O13A 2Q0UA 4EHUA 3MCPA 5C2DA 1Q7YO 5ADXH 3O9QA 4H0OA 3ZYYX 5AQJA 1VQMN 2ZJRL 4JKAA 1JCGA 2FSNA 3ENBA 5AQPA 3CC4N 5AQXA 3A5MC 3OHRA 2NLXA 3TSQA 2E88A 2ZJQL 3A5OC 1E4FT 1K8KB 4FWPA 1VQ5N 1U2VA 3KVGA 4JKEA 2QM1A 5FPNA 2QWRA 4U67L 3LDNA 4H0TB 4JKCA 5AQSA 3SJHA 3CCLN 3WQUA 1Q18A 3MN9A 4CZHA 1Q81O 1QHAA 1NGAA 3TSPA 3R1XA 3R8EA 3AAQA 4B1UB 2NRXA 5M1NA 3M3ZA 4B1YB 2Q1NA 1M1KO 3CXCM 2YHYA 5EOYA 5EX5A 1MDUB 3MN5A 2NZTA 3BP8A 2NRTA 3CJBA 4FO0A 3P39A 4CZKA 5B8HA 2ZJPL 3O6WA 3CCRN 4A5BA 5CE3A 3O9SA 3HOSA 4ISFA 4IXCA 4GV9A 3J8AA 5BREA 2PAVA 4IOCL 4JD2B 5BN9A 4PL8A 3CMAN 1BWFO 2ZF5O 3WXJA 1ATRA 3DAWA 5AFUA 1R59O 3H6EA 1JCFA 3CCJN 1NGJA 4IJNA 4WQ4A 5TKWA 3CQYA 3I33A 3RVCA 3A5LC 2FLOA 4NB4A 1NGBA 5BPLA 5DM6L 1Z6RA 4XEIA 3CJCA 4K25A 3T7ZA 4RCHA 1KD1O 3FZKA 1RGIA 1SZ2A 3UKRA 3VENA 3NVKA 3D6RA 3H1QA 2E1ZA 3A5NC 3F5TA 5EVZA 4H0VB 3ZEUA 3C7NB 3MWPA 3AY9A 1YITN 2VGNA 1T6DA 3VERA 2YJEA 1J6ZA 4O5FA 1GLFO 4GV6A 5JLHA 4WFNL 1G99A 2CGJA 4IO8A 1S22A 4Y0WA 1GLDG 3JS6A 1MA9B 2V52B 2FF3B 3CJ7A 3SBTA 3HRGA 4BRAA 3DLLL 3O9RA 5ELZA 2RHKA 4IFEA 4F9OA 2CH6A 4RWTA 3CI5A 3HTVA 3NVMA 3EKUA 5AQUA 3IMXA 2KKZA 3GOIA 1GLAG 1K8KA 4BR7A 1TYQB 3EN9A 3OBWA 4BR9A 2P9PB 3KHYA 3OA9A 3W0LA 2D4WA 3W3DA 1NBWA 2JWKA 1KAXA 2F7TA 4BGAA 1GLLO 3ATVA 3H46O 4CD3A 3VGKA 4BC5A 3SAGA 5BPMA 4BGBA 4BVPA 2HBLA 3ATUA 4FWOA 3O9TA 4ILJA 1BU6O 4IWVA 1KC8O 5GIOA 1LOTB 2FF6A 1T6CA 2RE2A 1VAZA 3H1VX 4JNEA 4CZFA 1YI2N 4PKGA 3GE1A 5BN8A 3PLAA 5JVHL 2FSKA 1BO5O 1VQ6N 1NGCA 4O8UA 2BH1A 3O08A 3VEOA 3BF1A 3CPEA 4H5RA 5C10A 4JD2A 4BQZA 3ZX2A 3K9KA 4MDBA 3Q7CA 4JKHA 4FWSA 2YHXA 3O4WA 1X3MA 3AAPA 3O5BA 4BC3A 3EE9A 2QWOA 2CH5A 5CR4A 4MLHA 4YDUC 3E9PA 3P31A 3TSUA 2HSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6A A;  3CPE A;  5C2D A;  5M1K A;  5M1N A;  3C6H A;  4IEI A;  5C10 A;  5C2F A;  4IEE A;  5C15 A;  4IFE A;  4IDH A;  5C12 A;  5M1Q A;  5M1F A;  5M1P A;  5M1O A; 
#chains in the Genus database with same CATH topology
 1QQO A;  4A2A A;  3WXI A;  1NJI O;  1IO2 A;  5KQD A;  2HHS A;  1ZBS A;  3LDP A;  5KPT A;  3VMF B;  1T3V A;  3C7N A;  4N56 A;  4JK7 A;  1LAV A;  2A6A A;  4AHR A;  3CJ9 A;  3UIQ A;  4ID1 A;  1XWL A;  2NNW A;  5I9E B;  1P8Z A;  4DF8 A;  3KKR A;  4NCA A;  4RG8 A;  3ID8 A;  1FKO A;  3K5O A;  1RTI A;  3CM5 A;  3THV A;  1EO1 A;  1NMD A;  4WFB L;  3AO4 A;  5K14 A;  4M63 C;  1WUA A;  4BRC A;  4YFU A;  4BC4 A;  2NRH A;  1XC3 A;  3M8R A;  1TYQ A;  4AF1 A;  5AQT A;  5HOO A;  3GG4 A;  4YDU A;  2FBV A;  5J1E A;  3OYN A;  3HM8 A;  4WYB A;  3J7A P;  4BR2 A;  2HVH A;  5AQW A;  3QEX A;  1W97 L;  3DYA A;  1HR0 K;  1LWE A;  2IGI A;  4JKG B;  4ISE A;  2Z1G A;  2KFZ A;  4BRK A;  2IC3 A;  4LF9 K;  2HND A;  1MWK A;  4K41 A;  4M3R A;  3SZ2 A;  3FZH A;  5CY4 A;  3AGK A;  2OA8 A;  3L2W A;  1S1W A;  3LPU A;  1KFD A;  3H45 C;  3AVC A;  4OKK A;  4JI4 K;  1A5V A;  2A3Z A;  3DRR A;  3ZSX A;  1KVC A;  3D2E A;  4FLX A;  2V7Y A;  3QBX A;  2P9I B;  3LM9 A;  2QEX N;  4FVU A;  2PY5 A;  3G25 A;  1KCF A;  1D9F A;  4DFP A;  1CLQ A;  4DSJ A;  4AH9 A;  4B3S K;  3FE1 A;  3ZT4 A;  4CJF A;  4L8R B;  4LFA K;  4JV5 K;  1ILY A;  1SL0 A;  3CC2 N;  3C6A A;  4DS5 A;  1WSF A;  3SPY A;  1QVG M;  4DQ8 A;  3VQ7 A;  2GEL A;  1DGK N;  3T1A A;  2Q2R A;  4M3W A;  5C15 A;  4JKB A;  5E84 A;  1GLC G;  2OTL N;  3G4S N;  3BDP A;  4EP4 A;  3J7Z O;  3FGU A;  4CJS A;  3N4P A;  2IVO A;  4KH6 A;  1KQS M;  5BR9 A;  5AQY A;  4CFC A;  1HLU A;  4KKO A;  2AP1 A;  2D0O A;  1X3N A;  3GL1 A;  3MX5 A;  4DQS A;  2W40 A;  3B8A X;  2ASM A;  5DM7 L;  5MLC Q;  1S1V A;  3ZX3 A;  4KHQ A;  1VQ9 N;  4W5N A;  2IVN A;  3LP0 A;  1NKC A;  2EX3 A;  4R79 A;  1GLE G;  4A5A A;  3VEZ A;  3QLH A;  2H3G X;  3T1Y K;  1ZC6 A;  1XNR K;  1OH8 A;  4E3S A;  3VQD A;  4DR5 K;  1LV5 A;  3KK7 A;  4NXM K;  4M7X A;  4PKH A;  1JKH A;  3KLI A;  3DLE A;  2P9K B;  1EXQ A;  2HBK A;  1DKG D;  4H4O A;  3HO1 A;  3ZET A;  2UUA K;  3HSC A;  3EZ5 A;  3VF2 A;  3NAE A;  3CJA A;  1KRP A;  2IVP A;  3QEI A;  3AVM A;  2P9N A;  2X6S A;  3PSI A;  4CHN A;  2VYP A;  2O8E B;  3MX2 A;  2GEM A;  3WNF A;  4CJU A;  3G71 N;  3R6M A;  4B1V A;  3SV4 A;  3E1Y A;  2W41 A;  4M7Y A;  3SQ4 A;  3SUN A;  4PL7 A;  1JL1 A;  1HYV A;  4I6M A;  5J2M A;  2D1K A;  1I3A A;  3HI0 A;  2X6N A;  4WQ4 C;  4M3Z A;  3K2P A;  1NK4 A;  4CFB A;  3KZB A;  3A8Y A;  5HBM A;  3I0S A;  4YOX A;  1V4S A;  4NLC A;  4CZI A;  4XH5 A;  4DTR A;  3IDH A;  1IKV A;  4O4G A;  1K73 O;  4KB1 A;  3ZCM A;  5CYM A;  3WEE B;  3O3H A;  4DQQ A;  2IS3 A;  1BDG A;  2KLA A;  1RDA A;  4CJT A;  4F2S A;  1NGH A;  1QZ5 A;  1QQN A;  1NLV A;  3QFP A;  4JS5 A;  3DM2 A;  2FXU A;  1VQO N;  1NJY A;  5AQF A;  4F3T A;  4CK3 A;  1WBD A;  4CF1 A;  2FC0 A;  5AR0 A;  2Y1I A;  2GBZ A;  3VF4 A;  4DV1 K;  3CG7 A;  4GNI A;  4XH4 A;  5M1Q A;  3MED A;  1TKZ A;  3P4I A;  2AJQ A;  3UKU B;  3P5J A;  2UXB K;  1S1X A;  2ZGY A;  3D2F B;  3HM9 A;  3EO3 A;  2DPN A;  2P9U A;  2UXC K;  3TTD A;  2P51 A;  1V4T A;  4X64 K;  4FJJ A;  2GX9 A;  4M41 A;  3BGR A;  5F2R A;  3NFA A;  1RT4 A;  3RRG A;  1YAG A;  4DQR A;  3RR8 A;  2YI1 A;  1C0U A;  2HBM A;  2PFU A;  2A1S A;  4EFH A;  1QQM A;  3THW A;  4IDH A;  5M1F A;  2F8T A;  1QTM A;  2JLE A;  1C0G A;  4YOR A;  1JLG A;  5SZT A;  2WTU A;  1IH7 A;  1YVN A;  3L0Q A;  2D0C A;  2B5J A;  4AHS A;  1BI4 A;  3ALY A;  1VRU A;  2I7P A;  1TK0 A;  3TPQ A;  5AQL A;  4FJI A;  4YOY A;  1J5E K;  1JXE A;  4BRP A;  4BC2 A;  1D8Y A;  2ASO A;  2E6M A;  1EWR A;  3PX0 A;  4OPH A;  4CGJ A;  1BIU A;  2DY4 A;  3WQT A;  1VSH A;  4AM6 A;  1VQK N;  4GKJ K;  3EYZ A;  3U3G A;  4DU4 A;  1TK8 A;  3NF6 A;  3UKR B;  4FL9 A;  4E7H A;  3KWG A;  3V9S A;  1S72 N;  5TKY A;  1C1C A;  1RBR A;  2RPI A;  1YUW A;  2KZM A;  1X9W A;  4IG0 A;  2XY8 A;  4EHU A;  1BHL A;  4FJ5 A;  4AHU A;  3KIO A;  4H0O A;  3OYI A;  1VQM N;  3S9H A;  3L2Q A;  3ENB A;  5AQP A;  4F2R A;  2IOC A;  1K8K B;  1U2V A;  3KVG A;  2QM1 A;  1XC9 A;  4U67 L;  4H0T B;  3WQU A;  1VSD A;  2HHV A;  4CZH A;  3HVT A;  3THY A;  1NGA A;  4FJG A;  5M1N A;  1NK8 A;  1R0A A;  4F3O A;  2NRT A;  4JLH A;  5DK5 A;  4A5B A;  5CE3 A;  4CGF A;  4DV2 K;  4CE9 A;  3IAY A;  4CEB A;  1HJR A;  3CMA N;  3T1H K;  3RWU A;  3WXJ A;  1ATR A;  5AFU A;  1EP4 A;  3OYD A;  4IJN A;  2YNF A;  1Q9Y A;  4DTN A;  3RVC A;  5DM6 L;  3T19 A;  4XEI A;  1B92 A;  3WNE A;  3V1Q A;  3C6T A;  3D6R A;  4ELT A;  4E1N A;  5JS1 A;  1C0M A;  4H0V B;  5LMU K;  3MWP A;  4FZZ A;  1HMV A;  3LAK A;  1J6Z A;  1GLF O;  5JLH A;  1EX4 A;  4CHP A;  2OPS A;  5BR8 K;  1SL1 A;  2X74 A;  1L3V A;  4KHW A;  3OYG A;  1MA9 B;  1RT7 A;  4LH5 A;  3CJ7 A;  5HRR A;  3AVJ A;  3O9R A;  5ELZ A;  1JLE A;  4RWT A;  3CI5 A;  3HTV A;  3DLB A;  3GOI A;  1XHX A;  3EN9 A;  2P5G A;  4BR9 A;  2P9P B;  3W0L A;  4JI0 K;  3W3D A;  1VSE A;  3FFI A;  1OVQ A;  2F7T A;  4BGA A;  3KLG A;  4LF6 K;  1GLL O;  2YKN A;  3O3G A;  2RN2 A;  4FCY A;  1L5U A;  4DTP A;  3SAG A;  1J54 A;  2HBL A;  4ILJ A;  4Y1D A;  2UUC K;  1BU6 O;  4IWV A;  3HPH A;  2ZD1 A;  2FF6 A;  4RW4 A;  3PLA A;  2FSK A;  3JAM O;  3AO1 A;  1VQ6 N;  3TAB A;  4O8U A;  5LMN K;  3O08 A;  4FJ7 A;  3KLF A;  1ZBH A;  4CVN E;  4JKH A;  4FWS A;  2YHX A;  3AAP A;  1HQU A;  2QWO A;  2CH5 A;  4OX9 K;  4DSK A;  4FK0 A;  3LP3 A;  3E9P A;  4BE2 A;  2HST A;  3PO4 A;  4K8X A;  3PX6 A;  3CD6 N;  5BPN A;  4CJW A;  5D3G A;  2YV0 X;  4E7K A;  2F9T A;  3DXM B;  4ELU A;  4HVJ A;  1QQC A;  1NGI A;  4H0X B;  4LF8 K;  3VQA A;  3SK3 A;  2Z1J A;  3V6D A;  3L2R A;  1FW6 A;  4CIG A;  2HNY A;  1TGO A;  2E2P A;  5F1X A;  4LH4 A;  3TAP A;  4K43 A;  4CJ4 A;  4J2E A;  1J9A A;  1YXQ A;  4BR4 A;  4E7I A;  3LP1 A;  3O4N A;  4XH1 A;  3F73 A;  1NG9 A;  5C0Y A;  3F9M A;  4CF9 A;  3AVL A;  5ADX A;  4QS8 A;  3SUO A;  2E2N A;  3SQ0 A;  3U3Y A;  1NGG A;  4BAC A;  4KBO A;  1XI1 A;  3N4Q A;  3FZL A;  2GWJ A;  3I55 N;  3ZSW A;  1YT3 A;  4YOT A;  2HVI A;  2E1Y A;  5AZI B;  3O80 A;  1WSI A;  3EKS A;  2YCH A;  2YJF A;  3E66 A;  4NYN A;  1N8R O;  4H5T A;  4FWN A;  2DFF A;  3MN7 A;  1TKX A;  3OYK A;  1REV A;  2ATQ A;  4E1J A;  1BUP A;  4CJE A;  4OVL A;  3NHG A;  4IZ9 A;  5FRO A;  1TUY A;  1WOQ A;  1IKX A;  3EE8 A;  2VQF K;  3VQC A;  3I8B A;  4M42 A;  1JLB A;  2P9S A;  4NO7 A;  4I9L A;  2GUP A;  2Q36 A;  1HUX A;  3WXM B;  3QNN A;  3G0Z A;  1WB9 A;  4DR3 K;  5AZJ B;  2YKM A;  3B6P A;  2HHW A;  3ULD A;  3QNO A;  1DEJ A;  2QWN A;  2IDO A;  3V9U A;  4DFK A;  5IT9 O;  1Z05 A;  4QS9 A;  2E2O A;  1NJX A;  3LZI A;  3WXK A;  2O8E A;  4LC9 B;  4BRD A;  1RDU A;  1J53 A;  3OW2 M;  2FBT A;  3F2K A;  4H4M A;  1TL3 A;  4TSX A;  1ZBF A;  3P83 D;  4DR4 K;  2G8U A;  3VPZ A;  2O8F A;  2D0B A;  4BY9 C;  1D5A A;  1DTT A;  3S3O A;  2Q3S A;  4JKD A;  3CCM N;  1FJG K;  3PV8 A;  5FPE A;  3TAF A;  3CER A;  4JI8 K;  2O8B A;  2G8I A;  2ZE2 A;  3PX4 A;  3RSE A;  3KK2 A;  3KD1 E;  5J2Q A;  2HHT A;  4CHZ A;  3VGM A;  3VEW A;  2EWS A;  2IAJ A;  5GIP A;  3OS1 A;  1U47 A;  2OTJ N;  2QWQ A;  4HHT A;  1C0F A;  4JI1 K;  4KTW A;  3WEE A;  1T03 A;  5AJ3 K;  3M8S A;  3SJJ A;  1TK5 A;  3DLG A;  5AQI A;  2UUB K;  2HOE A;  1KFS A;  1NGE A;  3ULE B;  4OJR A;  3TAG A;  1HKC A;  4GVE A;  5AQO A;  3HST B;  1NWK A;  1FKP A;  2HMP A;  4AHC A;  5CZ1 A;  4NCG A;  3QBW A;  4FSV A;  3CM6 A;  3TI0 A;  3GBT A;  1S5J A;  4CZE A;  3NE6 A;  1XMO K;  4B9L A;  4YNQ A;  4DQP A;  3WT0 A;  3SAH A;  2W42 A;  4KPY A;  2A40 A;  4J8F A;  3LDL A;  3V9Z A;  3JSM A;  4ILG B;  2P1J A;  4A59 A;  2G8K A;  4B3T K;  1NK0 A;  1BQN A;  4EHT A;  3ENO A;  3SNN A;  1QE1 A;  2A5X A;  3QET A;  3DRS A;  5LJW A;  4KHU A;  3AVA A;  2BAN A;  4DCH A;  4J2D A;  5EY4 A;  2P5O A;  2VG5 A;  5HRO A;  5C2F A;  1WBB A;  3K9J A;  3QFU A;  4HWI A;  5CHI A;  4A62 A;  5KTQ A;  4DUY K;  2RF2 A;  4JHD A;  1FXX A;  3ZSZ A;  3QO9 A;  1GOA A;  1SV5 A;  1IJJ A;  3CCV N;  3LPT A;  2D0A A;  2KW4 A;  4DSE A;  4DTJ A;  3FR0 A;  4E19 A;  1SL2 A;  4O55 A;  1JLA A;  1QSL A;  2QTD A;  4GKK K;  1HNI A;  2BGG A;  4WQ5 A;  4BRE A;  3S41 A;  5FPM A;  2YNG A;  4C8O A;  2YX6 A;  3C65 A;  4CJV A;  4KO0 A;  4YOW A;  1HX1 A;  4FJH A;  3O1B A;  3L2U A;  3HYF A;  1K9M O;  2B4J A;  5M1K A;  3O8M A;  1T44 A;  5JLF A;  3TTC A;  2GV9 A;  3OYL A;  4B08 A;  5JMV A;  3QIC A;  1RDB A;  3AO3 A;  1TAQ A;  4A2B A;  4HUE A;  3Q7B A;  1HYZ A;  3D0P A;  1NOZ A;  1NMN A;  4OPA A;  1WSJ A;  3QDK A;  1M90 O;  4JI5 K;  3IUC A;  1VQ8 N;  2CGK A;  2UYT A;  3RMC A;  4GV3 A;  4IFY A;  2VCP A;  4JN4 A;  2I5J A;  2A41 A;  3MK6 A;  3DLR A;  3CCS N;  3AVB A;  3VGL A;  3V4I A;  3ENH A;  1SKS A;  2ASP A;  3DXK B;  5DMR A;  4HCC A;  4KHP K;  1NKE A;  4BR0 A;  2E5L K;  4NXN K;  2BDP A;  4YY3 K;  3OY9 A;  4CGH A;  3SUQ A;  3O1W A;  2QA4 N;  2UXD K;  1GLJ O;  3RMD A;  2P9L A;  4BRG A;  4DTU A;  1YHQ N;  1Q8I A;  4BRH A;  4CJQ A;  5JVG L;  4DB3 A;  3PIP L;  1SAZ A;  2HHU A;  3OVN A;  4JI3 K;  1G15 A;  2VWK A;  4W5O A;  1XQS C;  1K6Y A;  4LY7 A;  4BE1 A;  4CJ3 A;  4CZG A;  4OPJ A;  2O4I A;  3K57 A;  4KB0 A;  4M3T A;  3SMP A;  3E01 A;  3G10 A;  4FWL A;  1OKJ A;  4LF5 K;  4FPB A;  3SCX A;  3MMV A;  1IV0 A;  1Y64 A;  3CQ8 A;  1IKY A;  4CEA A;  1RBU A;  1JLC A;  5AQQ A;  3M6G A;  3VTI A;  2IIR A;  4JYA K;  3KLH A;  3CFR A;  2ITM A;  3O3F A;  2O8D A;  3KTQ A;  3OYE A;  1JCE A;  5C42 A;  3SQ1 A;  2W6K A;  1OH5 A;  5C12 A;  3M5R A;  4EIA A;  2A1R A;  1U6Z A;  4CGI A;  4CEF A;  3KKS A;  3CCU N;  4B9M A;  1RNH A;  1Q7Y O;  2W6L A;  1HQE A;  1J5O A;  4CFD A;  3DRP A;  3O9Q A;  4JI6 K;  5AQJ A;  2ZJR L;  1E3M A;  3NF8 A;  1JCG A;  3SQ2 A;  4J2A A;  5AQX A;  2NLX A;  4CIF A;  1VQ5 N;  4FWP A;  4B3R K;  4DU1 A;  5FPN A;  4E0D A;  1W7A A;  5AQS A;  4G1Q A;  4RW7 A;  4Z4E A;  5FDL A;  3ISN C;  3ZSR A;  3R8E A;  1XNQ K;  3AAQ A;  4B1U B;  2HHX A;  3M3Z A;  2Q1N A;  3CXC M;  5B8H A;  5KI6 A;  3CCR N;  4JRP A;  4FZX C;  4PQU A;  3HOS A;  2PAV A;  4IOC L;  1CXQ A;  4JD2 B;  1VRT A;  4LF4 K;  4PL8 A;  2ZF5 O;  4BDY A;  3H6E A;  4KRE A;  3CCJ N;  1T7P A;  1NGJ A;  5TKW A;  4DWI A;  2O8C A;  5BPL A;  4CHO A;  4K25 A;  4RCH A;  4FM2 A;  3VQP A;  3AVI A;  4FLW A;  5KGW A;  2E1Z A;  3A5N C;  1UA0 A;  4AHV A;  3ZEU A;  3C7N B;  4CF0 A;  3AY9 A;  1ZYQ A;  1VSI A;  4B9V A;  4GV6 A;  4BWM A;  4WFN L;  4O44 A;  1U48 A;  1S22 A;  4M3U A;  3LWL A;  2V52 B;  3SBT A;  4BRA A;  4CK2 A;  1CZ9 A;  3DLL L;  4DQI A;  1VK0 A;  1QS4 A;  2CH6 A;  1TVR A;  2YNH A;  2HB5 A;  2KKZ A;  2OZM A;  4BR7 A;  1TYQ B;  5J2P A;  3EY1 A;  3AO5 A;  2EHG A;  3ATV A;  3H46 O;  4CD3 A;  1XMQ K;  3K58 A;  1U04 A;  4BVP A;  1RBT A;  4CJR A;  4FK4 A;  4OGC A;  1RCH A;  3L2V A;  5BN8 A;  1BO5 O;  2G8F A;  1NGC A;  2BH1 A;  1RT5 A;  4J2B A;  5C10 A;  4CED A;  3DI6 A;  2VQE K;  3ZX2 A;  4K8Z A;  1X3M A;  4BC3 A;  3EE9 A;  2FBX A;  3F9K A;  3VQ5 A;  5CR4 A;  4O0I A;  2VG6 A;  2Y1J A;  2OPQ A;  1KLM A;  3AAR A;  4I7F A;  2J4R A;  2ETJ A;  4Z94 A;  4DV6 K;  1KTQ A;  5KPZ A;  4DKW A;  3ITH A;  5AQM A;  1SS6 A;  4ZTF A;  3HVR A;  4LSL A;  5BRD A;  3VQ8 A;  1KAY A;  5AZJ A;  4PUO A;  4DV4 K;  1ASV A;  4FJL A;  3QB0 A;  3TAM A;  1VSM A;  3THX A;  5H1S Q;  4C1N K;  1ZBL A;  1NK6 A;  4FPA A;  5C24 A;  3SUP A;  1VSL A;  3VF6 A;  3LZJ A;  4CBX A;  1S3X A;  2D0P A;  3NGZ A;  2R7Y A;  4H03 B;  3M1F A;  4GVM A;  1IG8 A;  1NK5 A;  4FJN A;  3OTO K;  3J7Y P;  2O4G A;  1U4B A;  1BQM A;  3ZLJ A;  2QWP A;  2XY6 A;  4C8N A;  1RDD A;  5GAH P;  1YJN N;  1Q82 O;  1CZA N;  1GOB A;  4N47 A;  3MDQ A;  4FLU A;  3CFO A;  4U7B A;  1Q86 O;  3SMS A;  4A57 A;  4DV5 K;  3ZX0 A;  2GUI A;  1YJW N;  3DJC A;  2YHA A;  3NCI A;  3L3V A;  4DS4 A;  1TKD A;  1X1P A;  4BRQ A;  3CME N;  3FZM A;  3OYA A;  4FXD A;  2B6A A;  3HP9 A;  3R3L A;  3LL3 A;  4I2P A;  3U4L A;  3CF5 L;  3LWM A;  3H3O B;  4CEQ A;  1LAW A;  1BA0 A;  2HMI A;  2PBD A;  2FSJ A;  3ZET B;  3NH1 A;  4JS4 A;  1RDW X;  1CZB A;  1S9E A;  1JL2 A;  4EAH D;  1YTA A;  3QIP A;  4Z4H A;  1L3T A;  3UB5 A;  4FW1 A;  4A61 A;  2P9N B;  2D5R A;  1HYS A;  2Q0R A;  4RTF D;  3SI6 A;  3TU5 A;  2QXL A;  1CXU A;  2GTD A;  1LW0 A;  4BRM A;  4O8K A;  1JLF A;  2JWL A;  4KAZ A;  4H0Y B;  1N33 K;  1VSJ A;  4WFA L;  1RDC A;  5KPR A;  3T3F A;  1EQY A;  5FRN A;  3BZC A;  1WAF A;  1UWB A;  2YHW A;  3M8P A;  2F9W A;  4I6M B;  4CI6 A;  4CIE A;  4JKG A;  1HNZ K;  1NNE A;  3LM2 A;  3T69 A;  1HPZ A;  4KFB A;  4KTQ A;  1N5Y A;  2E4L A;  1RTH A;  1WNS A;  2GWK A;  4B9S A;  3C0B A;  1IKW A;  4Y1C A;  2P9I A;  2KHO A;  3V9X A;  5FRM A;  3SYZ A;  3OS2 A;  4IJA A;  2XRI A;  2WBN A;  2OCE A;  4EZ9 A;  5E26 A;  3VEY A;  1NGF A;  3K5M A;  4CCH A;  1LWC A;  3SBG A;  4BRI A;  4CF8 A;  4F4K A;  1QSY A;  3DWL A;  3VEV A;  3OYJ A;  4JK8 A;  1GOC A;  3WUH A;  4MFB A;  4AHT A;  2ZQB A;  4NYF A;  4FWQ A;  3QEW A;  1QHT A;  2OPP A;  4DV3 K;  5AQN A;  2VGM A;  4B3O A;  1IBM K;  4CZL A;  4AQY K;  5GAG P;  3JYT A;  1S1T A;  1ZBU A;  4LD0 A;  1RFQ A;  2Q31 A;  3WNG A;  2QI2 A;  3G6E N;  5HRP A;  1D4X A;  4WCE L;  3NF9 A;  1HJO A;  4JAX A;  2QWM A;  2P9U B;  3KK1 A;  4EZ6 A;  1S6Q A;  5AQV A;  2F96 A;  1QZ6 A;  4OLB A;  2OAN A;  4M3Y A;  5SWM A;  2G8H A;  1EWQ A;  4Z4C A;  4K42 A;  3AA5 X;  3VOV A;  3RR7 A;  1W9H A;  1WSG A;  3CQX A;  4IOX A;  2WUS A;  3QER A;  3THW B;  4OO1 J;  1ATN A;  4X65 K;  3LAL A;  3ZSY A;  4DV7 K;  3MN6 A;  4FYD A;  4UY8 O;  1C6V A;  4BRF A;  3CHW A;  3PIO L;  5I42 A;  4ELV A;  1BI4 B;  4KHN A;  4IOA L;  4JEP A;  4AIL C;  1DT9 A;  1YJ9 N;  1HNV A;  2DFH A;  3OYB A;  4IEE A;  5AFU H;  2P9K A;  3TTF A;  4FWM A;  4W5Q A;  3R9P A;  5AQR A;  3H3N O;  3HK2 A;  3IS9 A;  1YTU A;  4BRN A;  2AA4 A;  3EL2 A;  1IG9 A;  3BZK A;  5C25 A;  4DSL A;  2LSN A;  4YOU A;  2Z1I A;  3QEV A;  4FLZ A;  3MWT A;  4CZJ A;  4DTS A;  3V1O A;  3ZT3 A;  4CEO A;  1RT1 A;  4FWK A;  3U9Z A;  4H5V A;  3HBT A;  4YOV A;  1W0H A;  1UOC A;  1SKR A;  3AVF A;  2WOM A;  4WF9 L;  3CET A;  2ZGZ A;  1BA1 A;  1C1B A;  2BTF A;  4PHT X;  1NGD A;  4IDK A;  2NUB A;  3LDS A;  1FK9 A;  4ISG A;  1LW2 A;  3BEX A;  3U8X A;  3DMJ A;  4MQ3 A;  4FK2 A;  1U2V B;  3EZW A;  3P1G A;  3PY8 A;  4B9N A;  4BQL A;  3K0S A;  4MO5 A;  4MDA A;  4CEC A;  1RT2 A;  4KV8 A;  3THY B;  2XY7 A;  3IKM A;  1O1W A;  5JIC A;  2V7Z A;  2CGL A;  1DTQ A;  3NGI A;  5KQ8 A;  2NRR A;  1K8A O;  4WE1 A;  2PZS A;  4Z0U A;  3CC7 N;  1VHX A;  4KI6 A;  4V19 S;  2ITG A;  1LCU A;  3CJ1 A;  1XUP O;  1KLN A;  4C1N I;  4DFJ A;  4BWJ A;  2YNI A;  2KQ2 A;  1WN7 A;  1P90 A;  2DTU A;  3C94 A;  5M1O A;  4OGE A;  3U6F A;  3HPO A;  1NM1 A;  1Z25 A;  3UKU A;  1HKG A;  4KI4 A;  3D2F A;  1X9J A;  2A42 A;  1JJ2 M;  1A5W A;  1O13 A;  2Q0U A;  1I94 K;  1D9D A;  2HHH K;  5C2D A;  4DTX A;  5ADX H;  3ZYY X;  4DSI A;  3CC4 N;  3AO2 A;  3TSQ A;  3A5M C;  3OHR A;  4M3X A;  2E88 A;  4OKJ A;  2ZJQ L;  3A5O C;  1E4F T;  1LWF A;  3VN5 A;  4JKE A;  3NH2 A;  2PYL A;  2UU9 K;  3LDN A;  4JKC A;  2QXF A;  3SJH A;  2QK9 A;  1Q18 A;  3AVH A;  3MN9 A;  1OH6 A;  1I39 A;  2NRX A;  3ZT1 A;  4DFM A;  1M1K O;  1Z26 A;  5HRS A;  3PO5 A;  2YHY A;  5EOY A;  5EX5 A;  5LY3 A;  3BP8 A;  4CJP A;  3O6W A;  3MXI A;  4CGD A;  1NKB A;  4IXC A;  3C95 A;  5BRE A;  3VQB A;  1BWF O;  3QIO A;  3DAW A;  2OZS A;  1R59 O;  4N41 A;  3H08 A;  1JCF A;  1IBL K;  5J2N A;  4WQ4 A;  3I33 A;  3A5L C;  4NB4 A;  1NGB A;  4QCL A;  3CJC A;  4E89 A;  1KD1 O;  3FZK A;  1RGI A;  1SZ2 A;  3UKR A;  4IKF A;  1RT3 A;  3H1Q A;  5EVZ A;  3F5T A;  4B9T A;  1A5X A;  4GMJ B;  1QSS A;  3LP2 A;  1T6D A;  3VER A;  2YJE A;  4O5F A;  3QES A;  2CGJ A;  4IO8 A;  4Y0W A;  4FM1 A;  1GLD G;  3JS6 A;  3IRX A;  4CK1 A;  3MAQ A;  4IFE A;  4F9O A;  5JS2 A;  3NVM A;  3OJS A;  3ZSO A;  1NOY A;  2XO7 A;  3VQQ A;  3AVK A;  3V9W A;  1K8K A;  3OBW A;  2VG7 A;  4Z4F A;  2JWK A;  3CYM A;  4KHY A;  4BC5 A;  5BPM A;  4BGB A;  4K0K K;  4FJK A;  5GIO A;  3TAR A;  1LOT B;  1T6C A;  1VSF A;  1VAZ A;  4E7J A;  4CZF A;  1YI2 N;  1TAU A;  3GE1 A;  3S3M A;  4C8L A;  3PSF A;  3VEO A;  4DLG A;  3BF1 A;  1X9S A;  3V81 A;  1SKW A;  4BQZ A;  3NGY A;  4X62 K;  3Q7C A;  3MEG A;  3O4W A;  3O5B A;  3OYH A;  4YDU C;  4MLE A;  1RIL A;  4BG8 A;  2F8S A;  2P9S B;  3ZSV A;  4B1X B;  3MEE A;  3VEX A;  1BCO A;  2E20 A;  4DF4 A;  4CJK A;  3CIP A;  1EET A;  5AQZ A;  4NLB A;  2ZM6 K;  1BCM A;  3BF3 A;  1GLB G;  4H0P A;  5IWA K;  4JKF A;  4HUG A;  1ASU A;  4IEI A;  3TAQ A;  1KXP A;  4WQ5 C;  4OPK A;  1NK7 A;  3VQ6 A;  1RTJ A;  3C6H A;  4L3Q A;  2NRV A;  3D7E O;  4FW2 A;  2P9P A;  4X66 K;  3QEP A;  4QS7 A;  5EU7 A;  1W2B M;  1BIS A;  1NJZ A;  4B9U A;  3CCE N;  3A0I X;  3FFK B;  2QWL A;  2DFE A;  3GDQ A;  5LL6 Z;  4XIU A;  4O0J A;  2O8F B;  3VET A;  5GAD P;  1OVY A;  3C6U A;  5E41 A;  1VQ4 N;  4DR7 K;  4LF7 K;  2HF4 A;  3MCA B;  4DHY A;  2O8B B;  2E8A A;  2NRZ A;  3IFR A;  3RSE B;  3L4Q A;  4ID5 A;  2E6L A;  3UE5 A;  1N34 K;  4B8A B;  1B9F A;  3KJV A;  2Q97 A;  1N32 K;  3RTV A;  1KSP A;  2KTQ A;  2HF3 A;  1ITG A;  5AQK A;  3HXM A;  1ESV A;  3HZ6 A;  2KZZ A;  2RKI A;  3U9D A;  3I56 N;  1KAZ A;  4ICL A;  3E9O A;  1VQL N;  2NRW A;  3DXM A;  1VQN N;  1ATS A;  3KLE A;  3K5L A;  1WSE A;  4H8K A;  4KRF A;  2I7N A;  3QIN A;  4MO4 A;  3ZT2 A;  4CEE A;  3VA3 A;  4CEZ A;  4FLV A;  4ZTJ A;  1RTD A;  4B8C A;  3JXU A;  3OBY A;  4N5S A;  3ASM A;  3O4Q A;  3M8Q A;  3EEQ A;  3VTH A;  3SAF A;  3TWH A;  1SQK A;  4PWD A;  1RT6 A;  4PY5 A;  3FLC O;  4BDZ A;  4R5P A;  4AM7 A;  5BRH A;  4B1W B;  2Z1H A;  3ID6 A;  1MU2 A;  3NH0 A;  4Q0B A;  1KVB A;  1S1U A;  4JHD B;  5AZI A;  4BRO A;  5A2Q O;  4DMN A;  4BG9 A;  4CZM A;  1WSH A;  5GAE P;  3VQE A;  1DLO A;  4H5W A;  3J80 O;  3NBP A;  3FZF A;  3E9L A;  3IG1 A;  3NMU A;  5F0X A;  3KK3 A;  3D2E B;  4FJ8 A;  1HNX K;  1L3S A;  4IG3 A;  1KVA A;  2FBY A;  3VA0 A;  5FPD A;  3HP6 A;  3RMB A;  2X78 A;  4I2Q A;  4FOE A;  4FOI A;  5FLX O;  4HCB A;  5KRT A;  3SPZ A;  4E7L A;  4Z4G A;  5EXW A;  1T8E A;  3LAM A;  5CYQ A;  1C1A A;  3HT3 A;  3RRH A;  3LAN A;  2WFB A;  2OYQ A;  3LDO A;  5T7B A;  2XY5 A;  3BUZ B;  3HOT A;  2V51 B;  1SUQ A;  4BRL A;  3HL8 A;  2F4V K;  1C0T A;  4DLE A;  2QKK A;  4NCB A;  2HHQ A;  4B9Q A;  4UQG A;  2QKB A;  4C23 A;  4CGG A;  3DLH A;  3B6O A;  4ILH A;  2XHB A;  3O9U A;  4JI2 K;  1E4G T;  4KH5 A;  3VES A;  2P9L B;  1U45 A;  4KH4 A;  4M45 A;  3VQ9 A;  4CBU A;  4FJX A;  5HRN A;  4FLY A;  3S3N A;  1WAJ A;  4CJ7 A;  4KHS A;  4CHQ A;  1ZXO A;  3ULE A;  1U49 A;  3K5N A;  3DOL A;  3SV3 A;  3AGR A;  4BR5 A;  4HTU A;  2ZWH A;  1UA1 A;  4DR6 K;  3MXJ A;  3CFP A;  2KFN A;  1TUU A;  2YHB A;  4CHY A;  1YIJ N;  3SLC A;  4RW9 A;  5HP1 A;  4HTL A;  1BIZ A;  4CBW A;  4H5N A;  1NU0 A;  1HPM A;  1OH7 A;  2O8D B;  1VQP N;  4FWR A;  4JRQ A;  4CD1 A;  5GIN A;  2WC9 A;  1UAX A;  2QW9 A;  1S6P A;  3AA4 A;  1F21 A;  1YVU A;  3TAN A;  4I9Q A;  3QML A;  2G8V A;  1TL1 A;  3HPG A;  1NK9 A;  3OS0 A;  4OLA A;  1ZBI A;  4PA1 A;  1HNW K;  4B1Z A;  4DUZ K;  1X9M A;  5LJV A;  5KRS A;  1BOT O;  2E2Q A;  4DR1 K;  1S9G A;  4CJ5 A;  1MWM A;  4FZY A;  1VQ7 N;  4BVO A;  3MXM A;  1HKB A;  4C8K A;  1YF5 L;  4PKI A;  3CPW M;  5M1P A;  3HJF A;  3AV9 A;  4FJ9 A;  4JK9 A;  5BRF A;  4O5B A;  4GY2 B;  2BUP A;  2VWJ A;  3OYF A;  1RBS A;  3WXL A;  4CER A;  4EP5 A;  3NDK A;  4CF2 A;  1ASW A;  4GW6 A;  4HUF A;  4FVM A;  1JLQ A;  1BL3 A;  1TKT A;  5AQH A;  1H1V A;  3L4I A;  3AVG A;  2VWB A;  4FJM A;  5AQG A;  2O8C B;  2JGU A;  3CCQ N;  3OJU A;  4DV0 K;  4IO9 L;  3L6Q A;  4CES A;  5I3U A;  4CJL A;  5HL7 L;  3I8D A;  2HNZ A;  3LDQ A;  3D45 A;  4G9Z A;  3BY5 A;  1BG3 A;  3P38 A;  3ZEU B;  2HBJ A;  3DXK A;  3KWI A;  3MEC A;  3K59 A;  1QVF M;  4DU3 A;  1TV6 A;  2BE2 A;  4DR2 K;  3MCP A;  4DTM A;  4RW6 A;  4QOZ B;  3A2F A;  4JKA A;  2FSN A;  1N36 K;  1XHZ A;  4BE0 A;  4IBN A;  1L3U A;  4DTO A;  3OYC A;  3DOK A;  4DG1 A;  1RBV A;  2QWR A;  4CFA A;  3L3U A;  3CCL N;  1Q81 O;  4JI7 K;  1QHA A;  4ZHR A;  3TSP A;  3R1X A;  3V1R A;  1JXB A;  4B1Y B;  4Z4I A;  1MDU B;  3MN5 A;  2NZT A;  3CJB A;  4FO0 A;  4CZK A;  4LFC K;  3P39 A;  5KGX A;  3AVN A;  2ZJP L;  3I0R A;  3O9S A;  4ISF A;  4GV9 A;  3J8A A;  3NF7 A;  1NJW A;  1BGX T;  5BN9 A;  4RW8 A;  4QAG A;  5CZ2 A;  4LFB K;  3CQY A;  2FLO A;  4LSN A;  3KD5 E;  1Z6R A;  4N76 A;  1WLJ A;  3T7Z A;  3WNH A;  2G8W A;  1N6Q A;  4F8R A;  3VEN A;  3NVK A;  2HW3 A;  3AA3 A;  2OPR A;  1EKE A;  3ZSQ A;  4YHH K;  4CW7 B;  1YIT N;  1HRH A;  1VSK A;  2VGN A;  4BDP A;  1G99 A;  4OKE A;  4IFV A;  4DSF A;  2FF3 B;  3HRG A;  4Q5V A;  3THX B;  4C8M A;  3TR8 A;  2RHK A;  3VQ4 A;  3EKU A;  5AQU A;  3IMX A;  1GLA G;  1Y97 A;  3KHY A;  3OA9 A;  3L8B A;  1Q9X A;  2D4W A;  1NBW A;  1KAX A;  1T05 A;  3OYM A;  4W5R A;  3VGK A;  4FWO A;  3ATU A;  3DLK A;  3O9T A;  1KC8 O;  4FM0 A;  3J81 O;  4FLT A;  4B3M K;  2RE2 A;  3H1V X;  4JNE A;  4PKG A;  3AA2 A;  5JVH L;  2WON A;  3ZT0 A;  3CPE A;  4H5R A;  4JD2 A;  4W5T A;  3TAE A;  4KTZ A;  4E1M A;  3K9K A;  4MDB A;  5HLF A;  3RMA A;  2PYJ A;  4MLH A;  1B9D A;  3PUF A;  3P31 A;  3TSU A;  1IBK K; 
#chains in the Genus database with same CATH homology
 3CD6 N;  1QQO A;  5BPN A;  4A2A A;  3AAR A;  4MLE A;  3WXI A;  1NJI O;  4BG8 A;  5KQD A;  2J4R A;  4Z94 A;  1ZBS A;  2P9S B;  3LDP A;  2F9T A;  3DXM B;  5KPT A;  3VMF B;  4DKW A;  5KPZ A;  1T3V A;  5AQM A;  4B1X B;  3C7N A;  3VEX A;  4JK7 A;  1NGI A;  1SS6 A;  2E20 A;  4H0X B;  3CIP A;  5BRD A;  2A6A A;  3SK3 A;  3CJ9 A;  5AQZ A;  1KAY A;  4NLB A;  2NNW A;  5AZJ A;  3BF3 A;  5I9E B;  1GLB G;  1P8Z A;  3ID8 A;  2E2P A;  3QB0 A;  5F1X A;  4H0P A;  4JKF A;  4K43 A;  1EO1 A;  1NMD A;  4IEI A;  4WFB L;  5H1S Q;  4C1N K;  4M63 C;  4FPA A;  1WUA A;  1YXQ A;  1KXP A;  4WQ5 C;  4BR4 A;  4BRC A;  4XH1 A;  3C6H A;  5C0Y A;  4L3Q A;  2NRV A;  3F9M A;  4BC4 A;  2NRH A;  1XC3 A;  3D7E O;  3VF6 A;  1TYQ A;  4AF1 A;  5ADX A;  5AQT A;  2P9P A;  4QS8 A;  1S3X A;  4CBX A;  3GG4 A;  5HOO A;  2D0P A;  4YDU A;  4H03 B;  2E2N A;  4QS7 A;  1W2B M;  1NGG A;  4KBO A;  3CCE N;  3A0I X;  3FFK B;  2QWL A;  3GDQ A;  3FZL A;  2GWJ A;  3M1F A;  3N4Q A;  3HM8 A;  1IG8 A;  4WYB A;  3I55 N;  3VET A;  5GAD P;  1OVY A;  4BR2 A;  1VQ4 N;  4YOT A;  5AQW A;  1W97 L;  2HF4 A;  3MCA B;  4DHY A;  2E1Y A;  2E8A A;  2NRZ A;  3IFR A;  5AZI B;  2QWP A;  3O80 A;  4ISE A;  4JKG B;  3EKS A;  3RSE B;  2YCH A;  4BRK A;  5GAH P;  1YJN N;  1MWK A;  2YJF A;  3L4Q A;  4K41 A;  3E66 A;  1Q82 O;  1CZA N;  1N8R O;  4H5T A;  3UE5 A;  3FZH A;  4FWN A;  3AGK A;  3MN7 A;  3MDQ A;  2Q97 A;  4E1J A;  4U7B A;  1BUP A;  1Q86 O;  2HF3 A;  3H45 C;  3SMS A;  4A57 A;  5AQK A;  3ZX0 A;  1ESV A;  2A3Z A;  3HZ6 A;  4IZ9 A;  1YJW N;  3D2E A;  2V7Y A;  1TUY A;  2P9I B;  1WOQ A;  3DJC A;  3LM9 A;  3QBX A;  3U9D A;  3I56 N;  2QEX N;  1KAZ A;  3EE8 A;  4FVU A;  3E9O A;  3I8B A;  1VQL N;  2NRW A;  2P9S A;  4NO7 A;  3G25 A;  3DXM A;  1VQN N;  4BRQ A;  1ATS A;  2GUP A;  3FZM A;  2Q36 A;  3CME N;  3R3L A;  1HUX A;  3LL3 A;  3WXM B;  3FE1 A;  2I7N A;  3U4L A;  3CF5 L;  1ILY A;  4MO4 A;  3H3O B;  5AZJ B;  1BA0 A;  2PBD A;  1DEJ A;  2QWN A;  2FSJ A;  3CC2 N;  3C6A A;  3ZET B;  1Z05 A;  4QS9 A;  1RDW X;  2E2O A;  1QVG M;  4DQ8 A;  3JXU A;  4EAH D;  3OBY A;  3WXK A;  2GEL A;  1DGK N;  2Q2R A;  3UB5 A;  4LC9 B;  4A61 A;  4BRD A;  2P9N B;  4JKB A;  5C15 A;  1RDU A;  2Q0R A;  5E84 A;  4RTF D;  3VTH A;  3SAF A;  3TU5 A;  3OW2 M;  1GLC G;  2QXL A;  3G4S N;  2OTL N;  2GTD A;  4BRM A;  4O8K A;  2JWL A;  3J7Z O;  4H0Y B;  3F2K A;  3FGU A;  1SQK A;  3N4P A;  2IVO A;  4KH6 A;  4WFA L;  1KQS M;  5BR9 A;  3VPZ A;  5AQY A;  1EQY A;  5KPR A;  1HLU A;  3FLC O;  2AP1 A;  4BY9 C;  2D0O A;  4AM7 A;  1X3N A;  2YHW A;  3GL1 A;  3MX5 A;  4I6M B;  2F9W A;  4JKD A;  5BRH A;  5FPE A;  4B1W B;  3ID6 A;  3CCM N;  3CER A;  4JHD B;  5AZI A;  2W40 A;  3B8A X;  4BRO A;  2ASM A;  4JKG A;  4CI6 A;  3RSE A;  3LM2 A;  3T69 A;  4BG9 A;  5DM7 L;  5MLC Q;  4CZM A;  3VGM A;  5GAE P;  3VEW A;  2EWS A;  5GIP A;  3ZX3 A;  1VQ9 N;  2GWK A;  2OTJ N;  2IVN A;  2QWQ A;  4H5W A;  3C0B A;  1C0F A;  3FZF A;  3WEE A;  3E9L A;  4R79 A;  3NMU A;  1GLE G;  5F0X A;  2P9I A;  2KHO A;  4A5A A;  3VEZ A;  3D2E B;  2H3G X;  1ZC6 A;  4IJA A;  5AQI A;  2HOE A;  1NGE A;  2WBN A;  3ULE B;  3KK7 A;  5FPD A;  5E26 A;  4M7X A;  4PKH A;  1NGF A;  3VEY A;  3SBG A;  2P9K B;  4BRI A;  1HKC A;  4GVE A;  5AQO A;  1NWK A;  3DWL A;  3VEV A;  4JK8 A;  2HBK A;  4FOE A;  2HMP A;  4FOI A;  3WUH A;  1DKG D;  3QBW A;  4FSV A;  3GBT A;  4CZE A;  3ZET A;  3HSC A;  4FWQ A;  5EXW A;  3WT0 A;  3SAH A;  3VF2 A;  3CJA A;  2A40 A;  4J8F A;  3LDL A;  2WFB A;  2IVP A;  4ILG B;  5AQN A;  4A59 A;  2VGM A;  2P9N A;  4CZL A;  4EHT A;  2VYP A;  3ENO A;  3LDO A;  3MX2 A;  5GAG P;  3BUZ B;  2GEM A;  3HOT A;  2V51 B;  2A5X A;  1RFQ A;  2Q31 A;  3G6E N;  2QI2 A;  4BRL A;  5LJW A;  3G71 N;  1D4X A;  3R6M A;  4B1V A;  4DCH A;  5EY4 A;  4WCE L;  3E1Y A;  2W41 A;  4M7Y A;  1HJO A;  4JAX A;  2QWM A;  5C2F A;  2P9U B;  3K9J A;  3QFU A;  4HWI A;  4PL7 A;  5CHI A;  5AQV A;  4A62 A;  4B9Q A;  4I6M A;  1QZ6 A;  2D1K A;  2OAN A;  3HI0 A;  4JHD A;  4C23 A;  4K42 A;  4WQ4 C;  3VOV A;  4ILH A;  3CQX A;  4IOX A;  3O9U A;  1E4G T;  2WUS A;  3A8Y A;  1IJJ A;  3KZB A;  4KH5 A;  3CCV N;  4YOX A;  3VES A;  2P9L B;  5LY3 A;  3FR0 A;  4OO1 J;  1ATN A;  1V4S A;  4KH4 A;  4NLC A;  4CZI A;  4XH5 A;  3IDH A;  1K73 O;  2QTD A;  3MN6 A;  3WEE B;  4CBU A;  4WQ5 A;  4BRE A;  3S41 A;  5FPM A;  4UY8 O;  4BRF A;  2YX6 A;  3C65 A;  3CHW A;  3PIO L;  4YOW A;  1HX1 A;  1BDG A;  4IOA L;  4CJ7 A;  3O1B A;  4JEP A;  1DT9 A;  1K9M O;  1YJ9 N;  1ZXO A;  5M1K A;  3O8M A;  2KLA A;  1T44 A;  3ULE A;  5JLF A;  4IEE A;  5AFU H;  1NGH A;  1QZ5 A;  3TTC A;  1QQN A;  1NLV A;  2P9K A;  3QFP A;  3TTF A;  4FWM A;  3AGR A;  5JMV A;  3R9P A;  4BR5 A;  3QIC A;  5AQR A;  3H3N O;  2ZWH A;  2FXU A;  1VQO N;  4A2B A;  3Q7B A;  5AQF A;  1TUU A;  4BRN A;  2AA4 A;  3EL2 A;  4OPA A;  5AR0 A;  3QDK A;  1M90 O;  4YOU A;  3VF4 A;  3IUC A;  1YIJ N;  3MWT A;  2CGK A;  2UYT A;  4CZJ A;  1VQ8 N;  4GV3 A;  3SLC A;  4HTL A;  4CBW A;  4H5N A;  4GNI A;  4XH4 A;  5M1Q A;  4FWK A;  2VCP A;  1HPM A;  4JN4 A;  3P4I A;  2A41 A;  3MK6 A;  3U9Z A;  3UKU B;  3CCS N;  1VQP N;  4H5V A;  4FWR A;  3VGL A;  3ENH A;  3HBT A;  2ASP A;  3DXK B;  2ZGY A;  3D2F B;  4CD1 A;  3EO3 A;  2WC9 A;  5GIN A;  2DPN A;  4YOV A;  4BR0 A;  4WF9 L;  2P9U A;  2QW9 A;  3CET A;  3TTD A;  1V4T A;  2ZGZ A;  1BA1 A;  2GX9 A;  3O1W A;  2BTF A;  4PHT X;  5F2R A;  1NGD A;  1YAG A;  3QML A;  2QA4 N;  4ISG A;  1GLJ O;  2YI1 A;  3BEX A;  2HBM A;  2PFU A;  3U8X A;  4EFH A;  1QQM A;  2P9L A;  4IDH A;  5M1F A;  1U2V B;  3EZW A;  1C0G A;  4YOR A;  4B1Z A;  4BRG A;  1YHQ N;  4BQL A;  4MO5 A;  1YVN A;  4MDA A;  5LJV A;  1BOT O;  2E2Q A;  4BRH A;  5JVG L;  3L0Q A;  4DB3 A;  1MWM A;  3PIP L;  1SAZ A;  1VQ7 N;  3IKM A;  4BVO A;  5JIC A;  1HKB A;  2V7Z A;  1YF5 L;  4PKI A;  1XQS C;  2I7P A;  3CPW M;  2CGL A;  5M1P A;  5KQ8 A;  3TPQ A;  2NRR A;  4CZG A;  5AQL A;  4JK9 A;  1K8A O;  5BRF A;  4GY2 B;  2BUP A;  4YOY A;  3CC7 N;  3WXL A;  4BRP A;  4BC2 A;  3SMP A;  4FWL A;  1OKJ A;  2ASO A;  1LCU A;  3CJ1 A;  1XUP O;  4C1N I;  4OPH A;  4FPB A;  5AQH A;  1H1V A;  3L4I A;  3MMV A;  2VWB A;  1Y64 A;  3WQT A;  5AQG A;  4AM6 A;  3CCQ N;  1VQK N;  4IO9 L;  3L6Q A;  5AQQ A;  3M6G A;  1P90 A;  3VTI A;  2IIR A;  5HL7 L;  3UKR B;  4FL9 A;  3LDQ A;  5M1O A;  3KWG A;  2ITM A;  4G9Z A;  1S72 N;  1NM1 A;  3UKU A;  1JCE A;  1BG3 A;  1HKG A;  3P38 A;  5TKY A;  3ZEU B;  5C12 A;  2HBJ A;  3DXK A;  3D2F A;  3KWI A;  3M5R A;  1YUW A;  1X9J A;  4EIA A;  1QVF M;  2A42 A;  1JJ2 M;  1U6Z A;  3CCU N;  1O13 A;  2Q0U A;  4EHU A;  3MCP A;  5C2D A;  1Q7Y O;  5ADX H;  3O9Q A;  4H0O A;  3ZYY X;  5AQJ A;  1VQM N;  2ZJR L;  4JKA A;  1JCG A;  2FSN A;  3ENB A;  5AQP A;  3CC4 N;  5AQX A;  3A5M C;  3OHR A;  2NLX A;  3TSQ A;  2E88 A;  2ZJQ L;  3A5O C;  1E4F T;  1K8K B;  4FWP A;  1VQ5 N;  1U2V A;  3KVG A;  4JKE A;  2QM1 A;  5FPN A;  2QWR A;  4U67 L;  3LDN A;  4H0T B;  4JKC A;  5AQS A;  3SJH A;  3CCL N;  3WQU A;  1Q18 A;  3MN9 A;  4CZH A;  1Q81 O;  1QHA A;  1NGA A;  3TSP A;  3R1X A;  3R8E A;  3AAQ A;  4B1U B;  2NRX A;  5M1N A;  3M3Z A;  4B1Y B;  2Q1N A;  1M1K O;  3CXC M;  2YHY A;  5EOY A;  5EX5 A;  1MDU B;  3MN5 A;  2NZT A;  3BP8 A;  2NRT A;  3CJB A;  4FO0 A;  3P39 A;  4CZK A;  5B8H A;  2ZJP L;  3O6W A;  3CCR N;  4A5B A;  5CE3 A;  3O9S A;  3HOS A;  4ISF A;  4IXC A;  4GV9 A;  3J8A A;  5BRE A;  2PAV A;  4IOC L;  4JD2 B;  5BN9 A;  4PL8 A;  3CMA N;  1BWF O;  2ZF5 O;  3WXJ A;  1ATR A;  3DAW A;  5AFU A;  1R59 O;  3H6E A;  1JCF A;  3CCJ N;  1NGJ A;  4IJN A;  4WQ4 A;  5TKW A;  3CQY A;  3I33 A;  3RVC A;  3A5L C;  2FLO A;  4NB4 A;  1NGB A;  5BPL A;  5DM6 L;  1Z6R A;  4XEI A;  3CJC A;  4K25 A;  3T7Z A;  4RCH A;  1KD1 O;  3FZK A;  1RGI A;  1SZ2 A;  3UKR A;  3VEN A;  3NVK A;  3D6R A;  3H1Q A;  2E1Z A;  3A5N C;  3F5T A;  5EVZ A;  4H0V B;  3ZEU A;  3C7N B;  3MWP A;  3AY9 A;  1YIT N;  2VGN A;  1T6D A;  3VER A;  2YJE A;  1J6Z A;  4O5F A;  1GLF O;  4GV6 A;  5JLH A;  4WFN L;  1G99 A;  2CGJ A;  4IO8 A;  1S22 A;  4Y0W A;  1GLD G;  3JS6 A;  1MA9 B;  2V52 B;  2FF3 B;  3CJ7 A;  3SBT A;  3HRG A;  4BRA A;  3DLL L;  3O9R A;  5ELZ A;  2RHK A;  4IFE A;  4F9O A;  2CH6 A;  4RWT A;  3CI5 A;  3HTV A;  3NVM A;  3EKU A;  5AQU A;  3IMX A;  2KKZ A;  3GOI A;  1GLA G;  1K8K A;  4BR7 A;  1TYQ B;  3EN9 A;  3OBW A;  4BR9 A;  2P9P B;  3KHY A;  3OA9 A;  3W0L A;  2D4W A;  3W3D A;  1NBW A;  2JWK A;  1KAX A;  2F7T A;  4BGA A;  1GLL O;  3ATV A;  3H46 O;  4CD3 A;  3VGK A;  4BC5 A;  3SAG A;  5BPM A;  4BGB A;  4BVP A;  2HBL A;  3ATU A;  4FWO A;  3O9T A;  4ILJ A;  1BU6 O;  4IWV A;  1KC8 O;  5GIO A;  1LOT B;  2FF6 A;  1T6C A;  2RE2 A;  1VAZ A;  3H1V X;  4JNE A;  4CZF A;  1YI2 N;  4PKG A;  3GE1 A;  5BN8 A;  3PLA A;  5JVH L;  2FSK A;  1BO5 O;  1VQ6 N;  1NGC A;  4O8U A;  2BH1 A;  3O08 A;  3VEO A;  3BF1 A;  3CPE A;  4H5R A;  5C10 A;  4JD2 A;  4BQZ A;  3ZX2 A;  3K9K A;  4MDB A;  3Q7C A;  4JKH A;  4FWS A;  2YHX A;  3O4W A;  1X3M A;  3AAP A;  3O5B A;  4BC3 A;  3EE9 A;  2QWO A;  2CH5 A;  5CR4 A;  4MLH A;  4YDU C;  3E9P A;  3P31 A;  3TSU A;  2HST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...