3C6HA

Crystal structure of the rb49 gp17 nuclease domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
196
structure length
182
Chain Sequence
LSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSDYHALQIIDITEFPYKQVAVYHSNTTSHFILPDIVFKYLMMYNECPVYIELNSTGVSIAKSLAMDLEYDNIICDSFIDLGMKQSKRSKAMGCSALKDLIEKDKLIINHKGTIQELRTFSEKFHDDLVMSLVIFGWLTTQEKFAEYAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the phage T4 DNA packaging motor suggests a mechanism dependent on electrostatic forces.
pubmed doi rcsb
source organism Enterobacteria phage rb49
molecule tags Viral protein
molecule keywords Terminase large subunit
total genus 57
structure length 182
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3c6hA00
5M1PA 3C6HA 4IFEA 5C10A 4IEEA 5M1OA 5M1QA 5C15A 5M1NA 5M1KA 5M1FA 5C2DA 3C6AA 4IDHA 4IEIA 5C12A 5C2FA 3CPEA
chains in the Genus database with same CATH superfamily
3ALYA 3D6RA 3L4QA 4ILHA 1KFSA 3A8YA 3VQ8A 3K59A 4ELUA 4O8KA 1KVCA 4OPAA 1XMQK 2VG5A 1IBLK 1U4BA 2H3GX 4H0XB 3UE5A 1YJNN 4BRKA 3AVNA 5AZIA 3SAFA 2OTJN 2GUIA 3LDOA 5M1NA 3SJJA 3DI6A 3TARA 4BWMA 3DRPA 3JXUA 1Q8IA 4DWIA 3QMLA 5IT9O 4HWIA 2Q97A 3CCEN 4GV9A 2F96A 1N5YA 3VETA 3VF4A 1QQOA 3CJ9A 1EXQA 3ZSWA 1RTDA 3M8RA 1WB9A 4B1XB 3TAMA 3KTQA 5LL6Z 3L3VA 5M1PA 2PZSA 2AJQA 3R6MA 3KWGA 3RMDA 3MMVA 4LFBK 4C23A 4YOWA 5F2RA 3VEYA 2P9UA 2D4WA 3AO1A 4JNEA 1SQKA 3E9PA 1N8RO 2NLXA 5BR8K 4PY5A 4E19A 4BC2A 4CBUA 4KTWA 4HTUA 1S9EA 3O9RA 4E89A 2KZMA 4M3YA 4JN4A 3L2VA 4FWNA 4ISFA 5HP1A 3TAEA 1QZ6A 2JWLA 4NCGA 4EAHD 4ISEA 4RW6A 4Z94A 4JKAA 3C6HA 4BE1A 1Q9YA 3VQQA 1I39A 3RMCA 4BRDA 2O8BA 5F0XA 2O8BB 1L3SA 4H5VA 4F3TA 1VQ8N 1S1XA 2P9KB 3I8DA 4WFNL 1GLJO 3SI6A 1IG8A 2QM1A 3A5LC 1NGIA 3SAHA 4JS5A 4IO8A 3OS0A 4CERA 4FLYA 2QWRA 1S72N 4Y0WA 3VA0A 3WXMB 1WSEA 4YHHK 2FSKA 3CMAN 1WOQA 4MO5A 4FZYA 3HK2A 3HVRA 4K43A 3UKRB 2IIRA 4BY9C 3THVA 2GTDA 3I8BA 1S9GA 3ULEA 1NGFA 1OH6A 3PSFA 4DTSA 4GV3A 3VA3A 3U4LA 1NK6A 4LSLA 4QS9A 3P83D 3CI5A 5AFUA 1RT6A 2P9UB 4FJMA 2FBXA 4Z4FA 1JCGA 4EFHA 4CZJA 3WNFA 1TKDA 3MWPA 2YHYA 3IDHA 5JS2A 5AQVA 3T7ZA 3O6WA 4HHTA 3DLEA 3D0PA 3KD1E 4WQ4C 5AQUA 3KLHA 4FOEA 4BVPA 1NGBA 3VQ6A 2G8IA 4DTPA 5EX5A 4CJLA 3GDQA 4B9UA 4I9QA 3O80A 3KWIA 1HNWK 5KQDA 2KHOA 3E9LA 4BRIA 1YJWN 4BG9A 3CJ7A 3C6AA 2ZM6K 2JLEA 2RE2A 1RTJA 4B9QA 2JWKA 1REVA 4ZTJA 2ZF5O 4PUOA 1NOYA 2HF3A 4N76A 4PKHA 4DLGA 2QWNA 3VQAA 1TKXA 4H5WA 1QZ5A 1SKSA 4DR4K 3O9QA 1X3NA 4FJKA 5J2NA 3VEXA 5J1EA 3LP0A 3UKRA 1NK0A 5EVZA 1JXBA 1S6PA 3W3DA 4Q5VA 1LAWA 3KZBA 4E7KA 3ZCMA 4FO0A 1BCMA 1KSPA 1KVAA 4NB4A 3HTVA 4HUFA 3L4IA 4M42A 3TU5A 4YORA 4CHQA 3QO9A 3LP2A 3N4QA 5I42A 1VHXA 1WNSA 1FJGK 4C8NA 4MFBA 2A3ZA 3I56N 1YF5L 1NKBA 2W6LA 5ADXA 5LMUK 4K25A 1VSLA 4YFUA 1VSMA 4JK9A 2F9TA 4NXMK 4N5SA 3RMAA 3LP1A 3J7AP 4DQIA 3OY9A 5J2MA 4K41A 4CEZA 3CF5L 2A42A 4OJRA 1HQEA 4JK8A 4IEEA 2QWPA 4DFPA 3DOKA 3BY5A 4B3TK 4BR0A 3LANA 4I7FA 4LF9K 5AQFA 1QVFM 2WBNA 2IGIA 1LWCA 1Z25A 2WOMA 1C0GA 1YT3A 5CR4A 2XO7A 2YKMA 5AQTA 4BRGA 2FBYA 1BGXT 3UKUB 4CZFA 2GX9A 1A5XA 1SV5A 3D45A 1JLEA 4B9TA 3QNNA 4BG8A 3AA2A 4K0KK 4CZGA 4FJJA 4IG0A 4BREA 4BACA 4CK2A 1BIZA 3NH1A 3MWTA 1ZBFA 3D7EO 3D2EB 4U7BA 4TSXA 2ZJQL 3SPYA 4QS8A 3AVFA 4CGJA 3CCJN 3PSIA 1J5OA 1BOTO 4DLEA 1NGDA 1P90A 2BGGA 5GAEP 2HHSA 1ZBLA 3KHYA 4H0PA 3MXJA 3ENBA 5I9EB 4IEIA 5E84A 2XY6A 4GW6A 4CHNA 2D0CA 2VQFK 2UU9K 1KVBA 2HMPA 1HRHA 2HVHA 1KLMA 1C1AA 3OA9A 3K57A 4NLBA 4CGDA 3OYHA 3TAQA 1TAUA 4FJLA 2KZZA 2ZQBA 4B1YB 4CEAA 3OTOK 1TAQA 4BRPA 1NK8A 4YOYA 3ASMA 1HYZA 2IVOA 3KK3A 3IS9A 2I5JA 4JD2B 3K0SA 2HBMA 3U9DA 4ID1A 3HO1A 4B3SK 4JI6K 3ZLJA 4CJRA 3MCPA 4KRFA 3SBTA 4CJTA 2HHQA 4R79A 3AGRA 3OVNA 4YDUA 3M3ZA 1A5WA 1BUPA 1BQNA 1QTMA 3C0BA 3V1OA 4KB0A 4EIAA 4JI0K 5LMNK 5F1XA 4G9ZA 3EEQA 3CQYA 3SZ2A 4YOUA 3FZHA 4FM2A 1NK5A 5HRRA 1NKEA 4BGBA 4CEQA 3ZEUB 4YNQA 1Z6RA 1S1TA 3TAFA 1O1WA 3P5JA 1NKCA 2EX3A 3RSEB 5HROA 3RSEA 3CQXA 4CK1A 3AVLA 2P9PB 3VPZA 4KTZA 4DQQA 2DTUA 1KAYA 3KLGA 4CFCA 4FJHA 4GKJK 4B9SA 3PX6A 5CZ2A 2UXBK 2GELA 4LSNA 3SAGA 2GUPA 1VK0A 1JKHA 5FRMA 4L3QA 3LZIA 4FOIA 4E0DA 2VWJA 1NK9A 3UKUA 1Q81O 2G8KA 3JSMA 2WONA 2AA4A 3T1AA 4IFYA 1HNVA 2E5LK 1NU0A 1RNHA 3MK6A 2VWKA 4ILJA 1HKCA 4CJ3A 3D2EA 1K73O 3P1GA 1IJJA 2DY4A 3QEIA 3SQ4A 4DHYA 4IWVA 1EP4A 1XNRK 1YTUA 4Z4HA 4DTOA 4DSKA 3H6EA 3E01A 4IBNA 3J7ZO 1NNEA 4DQRA 4NYNA 1NJIO 2O8EA 2NRTA 3NVMA 3LDNA 2VCPA 4Z4CA 5CE3A 3P38A 1R59O 1YITN 1CZ9A 2YNGA 1WSJA 1B9DA 4M41A 3T1HK 3AVKA 1MA9B 2JGUA 3LAMA 1S1VA 3FZLA 4WQ5A 3ZEUA 4UY8O 4JYAK 3AA5X 3AARA 1OVQA 3EKUA 1NJYA 3AO4A 1GOCA 5EY4A 5GADP 2KLAA 1G15A 1NGHA 4WYBA 3LZJA 5EOYA 1S22A 2OA8A 4FZZA 2WFBA 1XC9A 3ZT3A 4A5BA 2XY8A 3BEXA 3NBPA 1LW0A 4PKGA 2X6SA 4XH5A 4F3OA 3VERA 1LWEA 1KAZA 4E7JA 1WAFA 3P31A 3SV4A 5LJWA 4GMJB 4H5NA 4M45A 4JV5K 1MWMA 4C8MA 1UA0A 3MEEA 3B6PA 3KLEA 3PO5A 5FROA 1BI4B 2HNZA 4U67L 1HR0K 5KQ8A 2HBKA 5C12A 2VYPA 2J4RA 1TK0A 2ITGA 2DFEA 4H5RA 2NRXA 4RG8A 1QQNA 3OYCA 4IO9L 2QW9A 2Y1JA 3H46O 1C6VA 5C42A 4OGCA 3CJ1A 4BRCA 3EZ5A 4HUGA 4AH9A 1IKVA 4LH5A 3SMPA 2QK9A 3HVTA 1Q86O 3CJCA 3MN5A 5AQQA 4FWPA 4A5AA 1RCHA 2VGMA 3CJBA 2RN2A 5AQHA 5AQMA 1C0MA 3VQPA 4DTMA 1ASUA 3O9UA 1VSEA 3ZSVA 5DM6L 3ATUA 1D4XA 1JLQA 3DRRA 3C94A 4PA1A 3L8BA 3CM5A 4FL9A 2O8CB 4BR9A 2CH6A 1WBDA 3U3GA 5DK5A 4FWLA 3ID6A 4FK2A 1SS6A 3FLCO 1VSDA 1N32K 3MEGA 4CF2A 3OYDA 2NNWA 5BN9A 2QWLA 3U8XA 4JKFA 3QERA 1RFQA 4FWMA 4AHTA 3LP3A 1ITGA 1NMNA 3J80O 3OYJA 4I6MA 4FW1A 1FKPA 1VSHA 2E1YA 5LY3A 3KIOA 2FSJA 3W0LA 3AVHA 5E26A 2FF6A 3IAYA 5K14A 2ASOA 2Z1JA 3O9TA 1TK8A 3QDKA 4CEEA 1TUUA 1UA1A 1ZXOA 3DRSA 3NF7A 1BWFO 3TTCA 4JK7A 3OJUA 4I2QA 3CXCM 1W97L 3KLFA 4XEIA 4BRQA 1U2VB 1XUPO 3ATVA 5KRSA 3O1BA 3OYNA 4H03B 3RWUA 5EU7A 1W7AA 1RDAA 4DFJA 4J2DA 4CHYA 2XY5A 1BHLA 2E6MA 2YV0X 5GIPA 2W42A 1LV5A 3DM2A 4IG3A 4FWOA 5TKWA 4XIUA 1T44A 3KVGA 3ZX0A 4CJ5A 4HTLA 3SJHA 3S3MA 1SKRA 2HNDA 3K58A 1Q7YO 2O8CA 4GKKK 1HPZA 2YHAA 4DR1K 2YNHA 5BPLA 2HBJA 4FPBA 4CGFA 4DTJA 4C8KA 4N56A 4WFAL 5AQRA 4DU1A 3FFIA 2OANA 2F8TA 1KD1O 4OKEA 1BA1A 3AVCA 1B9FA 2I7NA 1IKYA 4M3TA 4RW9A 3JAMO 5FRNA 5J2PA 2HMIA 3PUFA 4DR7K 2BUPA 2O8FB 4DCHA 5BR9A 4JRQA 4CF1A 3G6EN 2BE2A 2W6KA 2O8DA 4G1QA 3S41A 4PL8A 1GLDG 3S3NA 1TUYA 2B5JA 2X78A 3CM6A 3SCXA 4HVJA 3D2FA 2HNYA 5HOOA 3UB5A 3SLCA 5BREA 1YUWA 3OS2A 3A2FA 4WFBL 2QWOA 4AHSA 1ZBIA 3F73A 4FM1A 3TSQA 1MDUB 3QEWA 4WQ5C 4QOZB 4E7LA 1NOZA 2RPIA 4DSEA 3S9HA 1NJZA 3U9ZA 3LALA 4DFKA 3EY1A 3IFRA 2P9NB 1YVNA 4OVLA 4WCEL 3B6OA 4FLTA 3O3FA 1EO1A 3DXMB 4KTQA 1ATNA 1R0AA 4KV8A 4LFCK 4I2PA 3KJVA 3DMJA 3S3OA 4M3XA 4M7YA 5FLXO 1XI1A 1KLNA 4DSLA 3V6DA 4GY2B 3T3FA 3TAPA 4CW7B 4DSFA 3J7YP 3RR8A 3R8EA 4X62K 1X9MA 4AHUA 4DV3K 4YOVA 4BROA 5BPMA 1EQYA 4LD0A 2KKZA 1OH7A 4Z4IA 5EXWA 3NGIA 3JYTA 4A57A 2UXCK 2B6AA 2GV9A 4ILGB 2V51B 3OYFA 1T8EA 4IZ9A 5CYQA 4DV6K 4E3SA 4FVUA 3MDQA 4CZKA 3ZSOA 2XY7A 1JL1A 2ITMA 1MWKA 2OPQA 4J2EA 1U6ZA 1K6YA 5AQGA 5BRDA 3LDLA 4C1NK 4DU4A 4H0TB 3J8AA 3CD6N 3HSTB 1EWRA 3O5BA 2G8WA 1IKXA 4Z4EA 3CFOA 3ZETA 2VG6A 3FFKB 4YDUC 3SUNA 4JKHA 5AZJB 2P9IB 5AQXA 3WNEA 3M8QA 3AVBA 3WQUA 2ZJPL 1XWLA 3L2WA 3O08A 4KI4A 4O8UA 1L3VA 3LM9A 5ADXH 4IKFA 3ITHA 5SWMA 1EKEA 2WUSA 3HJFA 3THXA 3ZT1A 3DJCA 5LJVA 4DG1A 2D0OA 3HM9A 2ETJA 3CC2N 3OYBA 4ZHRA 4DS4A 3M5RA 1JCEA 5AZIB 1NGGA 4H5TA 3D2FB 4CJKA 3DOLA 1LOTB 1GLBG 1RDWX 4QAGA 1QSYA 5BRFA 2HHXA 3PX4A 1KCFA 1SAZA 2FSNA 3PO4A 4H8KA 1IBKK 4JEPA 4LF5K 4DB3A 1S3XA 4OO1J 1V4TA 2Q3SA 4Y1DA 1RT1A 2OYQA 2RKIA 4FWSA 3AAPA 4CI6A 1RBTA 3DLRA 1X1PA 4IXCA 4CJUA 4F8RA 1RTHA 2E2OA 4H0YB 1E3MA 1JL2A 1CXUA 2UUBK 4KO0A 1ZBUA 1K8KA 3OYLA 4MLHA 5AQLA 3VMFB 3SNNA 4C1NI 4CZMA 5IWAK 4DTUA 3O4NA 1RBSA 3SBGA 3SMSA 3WT0A 4OKKA 4DUYK 4BQLA 3EKSA 1DKGD 4EP5A 2HBLA 3THWA 4OPJA 3HP9A 3HRGA 1Q82O 4CFDA 2NUBA 4FM0A 4EZ6A 3HI0A 1RDCA 4DU3A 1RTIA 4JI8K 4W5RA 4H4MA 2F4VK 2V7YA 4JI4K 1M90O 3HBTA 3THXB 4BRNA 3ZSQA 1LCUA 3CCRN 4BR2A 4GVMA 1RILA 4GV6A 4RW7A 3T1YK 4BC3A 3K5MA 3V4IA 4K8XA 1GLLO 3RMBA 4BR4A 4DS5A 2UXDK 1J53A 2PY5A 3C7NB 4BQZA 4YY3K 4JI7K 1NLVA 3C7NA 3DLLL 1QS4A 5AQWA 1J9AA 5DMRA 4W5NA 2KW4A 3NF6A 1HNIA 4AF1A 4M3RA 3V9XA 1S6QA 3QETA 3V9SA 1KRPA 3I0RA 3ZSYA 3FGUA 3KKRA 2NRRA 4NCAA 1RT4A 4FPAA 1U47A 5M1KA 4KH6A 5JVGL 2Z1IA 4ELVA 1VAZA 2YJEA 2Y1IA 3CCMN 5BN8A 1TKZA 2IS3A 3O3GA 1W0HA 4C8LA 5KRTA 2EWSA 1G99A 2P1JA 4BDZA 3OS1A 3AAQA 2QI2A 1GLCG 4L8RB 4CD3A 4CIFA 2IAJA 4IFVA 2BTFA 3ZYYX 5AQZA 1C0FA 1K8AO 4CZEA 4YOTA 2E1ZA 1ZYQA 3H3OB 4K42A 5AQJA 1YHQN 4FYDA 1T05A 1C0TA 4CK3A 4LF6K 2W40A 3OYMA 1F21A 3RRHA 2NRZA 3RVCA 5E41A 4E7IA 1XQSC 4X65K 2HHUA 2ZE2A 3DLGA 2DFHA 4MDBA 3L2UA 2P9KA 3MX2A 1QQCA 1BDGA 3IUCA 2E2PA 1BA0A 5FPNA 5KI6A 3NGYA 1ASWA 4IFEA 4KAZA 2YNFA 4FJIA 2QA4N 2WTUA 4MDAA 3EL2A 1HYVA 4RW4A 4DF4A 3DLBA 5B8HA 5AZJA 3RRGA 4IDKA 3LWLA 4QS7A 1HX1A 4FWKA 4CE9A 3HYFA 3CCVN 3ZT2A 4Y1CA 3ULEB 2QKKA 1CZAN 4B9LA 5GIOA 3VQDA 3M1FA 4WQ4A 2QXLA 4CGHA 4CJ7A 3FZFA 3E66A 1OKJA 2FC0A 4AM6A 4MQ3A 4BVOA 2GWKA 4CHOA 3K2PA 5C25A 2G8VA 4OGEA 4JRPA 4DF8A 3LAKA 2NRHA 3QIOA 2G8FA 3QFUA 5JLHA 1T03A 3CG7A 3SQ0A 4HCBA 1Q18A 2AP1A 4EP4A 5C24A 4XH1A 4BRHA 2V52B 3GE1A 3MAQA 3L6QA 4CIGA 5AQSA 5AQIA 4CGGA 3TWHA 3V9ZA 4RTFD 1U04A 2A5XA 3NCIA 1YJ9N 1KFDA 4E1JA 1FW6A 4B08A 1U48A 4OPKA 3G10A 2ZGZA 4A62A 5C2FA 4E1NA 2HVIA 4OKJA 3OJSA 1HNZK 2HB5A 3MCAB 1KQSM 1Y64A 1HJOA 4AQYK 3GOIA 1O13A 3H1VX 2V7ZA 4BRFA 4KBOA 5T7BA 3CCSN 3AVGA 4FW2A 5FDLA 4JKBA 4JKDA 4CFBA 3VQ9A 3EZWA 1A5VA 3TANA 1IKWA 4O55A 1KAXA 3FR0A 3ZX2A 4KH4A 1U49A 1VQKN 2A40A 4BE2A 2Z1HA 2IOCA 2O4IA 2NRWA 4CBXA 5KPZA 3V9UA 4CECA 3QESA 3ULDA 3PIOL 3MEDA 4PHTX 4KB1A 4BGAA 1RDDA 2A6AA 4J2BA 5CZ1A 3HOTA 3VF2A 2OCEA 1WLJA 3F9KA 1JLAA 5FPMA 4OPHA 3EE9A 1ZC6A 3LM2A 4NCBA 3KLIA 4FJ8A 1HKGA 1KXPA 3H45C 1TL3A 3VTHA 5KPRA 3TTFA 2OTLN 3Q7CA 4FWRA 1QSLA 3VQBA 1X3MA 4FVMA 3PV8A 4KH5A 2KFZA 1NGAA 1YIJN 4FLUA 1VQNN 1BQMA 4BRAA 4JD2A 3VQ7A 4CZLA 1SKWA 4H0VB 3MXIA 1DEJA 4IOAL 4CVNE 3TTDA 3DXKA 3QICA 4LH4A 3DAWA 3WXKA 4B9MA 3VTIA 1HQUA 3V9WA 1RT3A 1FXXA 3AO5A 4MO4A 3ZX3A 4B9VA 4CJWA 1VQ6N 1XMOK 4BRMA 2I7PA 5DM7L 4UQGA 3QBXA 1L5UA 5JICA 5JLFA 1D9FA 5CY4A 3NF9A 3M8SA 3AA3A 4KPYA 4KKOA 3VESA 1P8ZA 1QQMA 1GLFO 5JS1A 3TSUA 2Q2RA 1E4FT 3R9PA 3K5OA 1TKTA 3QLHA 1L3TA 1S1UA 4J2AA 4PQUA 3NFAA 4CJQA 3CETA 4GNIA 3O3HA 1DLOA 3SYZA 1T6DA 1ASVA 3LDSA 3OYEA 1CXQA 3G25A 3C6UA 2IVNA 3CQ8A 2A1RA 1GOBA 3OYIA 3MXMA 4F4KA 1VSKA 3P4IA 1H1VA 4KHSA 5AQPA 1VQMN 3DWLA 3VF6A 1WBBA 3HPHA 3LWMA 3R3LA 1TK5A 5FPDA 4JI5K 4FXDA 1OH5A 1WSHA 2HOEA 2HHHK 3AO3A 3ZT4A 1NGEA 4BWJA 3HPOA 3HSCA 4CIEA 4DMNA 4GVEA 1JLFA 1X9SA 3WXIA 4C8OA 3KK7A 3NF8A 4I9LA 4IOXA 4CEOA 3VQCA 4E7HA 4HCCA 1BIUA 1RBVA 3SV3A 3DXKB 4CEFA 4LF8K 3QB0A 4CZHA 3OYGA 3BZCA 2E20A 4FJ7A 3WEEB 3WXJA 2DFFA 3WEEA 4KHNA 2PYLA 3VN5A 5GINA 1CLQA 4EZ9A 1X9JA 4M7XA 4DQSA 3SPZA 2YHXA 2G8HA 4CZIA 4Z0UA 4RCHA 4CJSA 2G8UA 3VEVA 4CESA 3QINA 2KTQA 3CPWM 1BI4A 2KFNA 3O1WA 1K9MO 1U45A 1WN7A 4CHZA 3HT3A 3I0SA 2XHBA 4AHRA 4Q0BA 1JLGA 2A41A 2D5RA 2BH1A 1TVRA 3BDPA 4B1UB 2Q0UA 2D0PA 2P9PA 2P5OA 1UAXA 2E2NA 2IDOA 3BUZB 3KK1A 1VQPN 4OLBA 2VQEK 3EE8A 3IKMA 2Z1GA 1JXEA 1YXQA 1VQON 3CC4N 2YI1A 3ZSZA 4A2BA 1J6ZA 3VQ4A 3V81A 4B3RK 2EHGA 3SK3A 3CMEN 3KK2A 1YI2N 2F8SA 2IVPA 1IV0A 5C0YA 2CGJA 4DQPA 5ELZA 4JAXA 2HHVA 4O5FA 4AHCA 4B1WB 2RHKA 4DTRA 1VSFA 1M1KO 2ZD1A 1GLAG 4JHDA 3WNGA 4JHDB 3A0IX 3DYAA 4PL7A 2YKNA 1TV6A 4WE1A 4RW8A 5AQYA 4BC5A 5HRPA 3HXMA 3MN6A 3H08A 3HZ6A 1TYQA 3PLAA 1BL3A 3PIPL 2O8EB 1RDUA 3I55N 3L2QA 1NGCA 4NO7A 2O8FA 4DV2K 3BP8A 3LDQA 4CEBA 4CD1A 3SQ2A 3H1QA 4M3UA 3F2KA 1T6CA 2FXUA 3PX0A 1OVYA 5KGXA 3AVAA 3JS6A 1WAJA 3CCUN 3I33A 3G4SN 4KHPK 4KHUA 4DSIA 1NGJA 2XRIA 2PAVA 4A59A 1SL0A 3AA4A 2O4GA 5C15A 4DV5K 3SUPA 3TI0A 4BE0A 1NWKA 3NH0A 2FBTA 1J54A 3FE1A 3J81O 4J8FA 5TKYA 2ZJRL 1J5EK 2FBVA 4DR5K 1HNXK 3QFPA 3AVJA 2QWMA 2W41A 4DR6K 4RWTA 4AM7A 4JI1K 2FF3B 1N36K 4FJNA 3DLHA 4O0JA 3VQ5A 5HRNA 2DPNA 3NDKA 1C0UA 1VSIA 3WQTA 2VWBA 3AGKA 3ENHA 3ZT0A 4DTNA 1I3AA 2GEMA 1EX4A 1Z05A 1XC3A 4FWQA 1BCOA 3U6FA 2ZGYA 5SZTA 4BDPA 2NZTA 5KPTA 2GWJA 3FZKA 4KHQA 2RF2A 3CFRA 1SL2A 5I3UA 4B3MK 3THYA 1QHTA 2YJFA 2PBDA 4OLAA 1JCFA 4CF0A 2CGKA 4F9OA 3R1XA 5AQOA 3CYMA 5M1QA 3LPUA 3E9OA 4PKIA 4FJ5A 4DR2K 1BU6O 3U3YA 2Q0RA 3VGLA 1IH7A 1HPMA 1DT9A 4BRLA 3ID8A 4IDHA 1WSGA 3E1YA 3O4QA 5GAGP 4ZTFA 1N33K 3L2RA 2OPPA 4F2SA 3ENOA 4MLEA 2D1KA 2PFUA 3AVIA 3EN9A 5AFUH 3HP6A 2YHWA 3ZSXA 3GL1A 1NJWA 3CC7N 3OW2M 3RR7A 2E88A 1NM1A 2P9IA 2CGLA 3OHRA 4KREA 1VQ9N 2P9LA 3MN9A 3O8MA 4H4OA 2P9NA 3A5OC 1TYQB 4DSJA 1WSFA 3VOVA 1IO2A 1HKBA 2ZWHA 1E4GT 2E4LA 5HRSA 3K5LA 3L0QA 1LAVA 3BGRA 3TR8A 2R7YA 2F9WA 4JLHA 1EWQA 1HYSA 4X64K 3K5NA 5KGWA 4M3WA 5KTQA 4EHUA 4DR3K 3SQ1A 2HW3A 3IRXA 1N6QA 4QCLA 1WUAA 3HM8A 4JI2K 4A61A 3OBYA 3THYB 1NK7A 1RT2A 1NBWA 2A1SA 2UUAK 2UYTA 2QTDA 4DV7K 4B8AB 4ID5A 3WUHA 3F5TA 1LW2A 4CF9A 1BISA 5HL7L 3SUQA 3Q7BA 4BC4A 3UIQA 5AR0A 2HHTA 5AQKA 3KD5E 1RT5A 5C2DA 4JI3K 4PWDA 1Y97A 2OPSA 2X74A 1W9HA 1SZ2A 3LL3A 3NAEA 4B1ZA 4R5PA 3H3NO 2Q36A 1GOAA 1RDBA 3NMUA 4W5QA 3ISNC 5C10A 1N34K 4LF7K 4CJ4A 2IC3A 4FLVA 1IG9A 1DTQA 4KFBA 3CCQN 3MN7A 4IJNA 4WF9L 1NG9A 4M3ZA 2ATQA 2GBZA 2VG7A 1LWFA 1RBRA 1DGKN 3FZMA 3TSPA 5MLCQ 3O4WA 3CFPA 3QEXA 4FK4A 2P9LB 4NYFA 1SUQA 1TGOA 4KHWA 4CJVA 3P39A 3OBWA 1UWBA 5CYMA 2P5GA 4JKCA 2B4JA 4DKWA 1KC8O 1V4SA 2D0AA 3RTVA 3QBWA 1HUXA 2QKBA 3QEPA 3OYKA 4FLXA 4BR7A 4JS4A 4JKGA 2O8DB 1T3VA 2Q1NA 4DV1K 4NXNK 1XHZA 1GLEG 1HMVA 3SUOA 4OX9K 1S5JA 3KKSA 3NVKA 5AQNA 1ATSA 2FLOA 2VGNA 4Z4GA 3GBTA 1VQ5N 3CCLN 1T7PA 3LPTA 2E6LA 3OYAA 4CJPA 3VGMA 3VQEA 4DQ8A 3AY9A 4EHTA 4FSVA 3TAGA 4FK0A 3T69A 3HOSA 2BDPA 5BRHA 4DV4K 1FK9A 2P9SA 2QEXN 1XNQK 2HF4A 1Z26A 1RGIA 5J2QA 1S1WA 4FCYA 4H0OA 4F2RA 3ZSRA 3V1QA 1FKOA 3AV9A 1D5AA 2UUCK 3C95A 3BZKA 4AHVA 4V19S 3T19A 3K9JA 3PY8A 4LFAK 4A2AA 4W5OA 1VQ4N 1NMDA 2Q31A 4ICLA 4XH4A 5FPEA 3F9MA 3EO3A 1SL1A 4FJXA 4KHYA 3CJAA 5D3GA 4FZXC 1VSJA 5HBMA 4LY7A 1EETA 4M63C 4O5BA 1VQLN 1NK4A 4FJ9A 3CERA 4B1VA 2OPRA 5A2QO 4NLCA 4IJAA 1QHAA 5BPNA 2HSTA 5AJ3K 1Q9XA 1JLCA 3THWB 3TABA 2NRVA 3G0ZA 1QE1A 3A5MC 2BANA 5M1OA 1OH8A 1ESVA 5M1FA 1YAGA 3VENA 4E1MA 3AVMA 2ASMA 3HL8A 1DTTA 4X66K 4CFAA 2E8AA 5HLFA 1JLBA 3CIPA 4CBWA 2P51A 4FJGA 1MU2A 2LSNA 1CZBA 4CCHA 3QEVA 3NH2A 4LF4K 2CH5A 1QSSA 4ELTA 1IBMK 4CJEA 1K8KB 1RT7A 3GG4A 2OZSA 4N47A 1TL1A 1HLUA 3VEWA 2QXFA 4CEDA 3EYZA 3M8PA 3NHGA 2P9SB 1ILYA 4B9NA 4CGIA 1W2BM 4BDYA 4DFMA 1QVGM 3CHWA 3M6GA 1B92A 3C6TA 3L3UA 4LC9B 4JKEA 1C1CA 1ATRA 1WSIA 3MECA 2ASPA 2X6NA 2D0BA 3AO2A 4B8CA 3DXMA 5JMVA 4I6MB 4B3OA 1YTAA 3N4PA 1VRUA 4CF8A 4IOCL 3TPQA 3G71N 4DTXA 4JKGB 1BG3A 3B8AX 5JVHL 2KQ2A 1D9DA 4CHPA 1YVUA 4AILC 1VRTA 4HUEA 3BF1A 4O44A 3DLKA 4FLWA 3LDPA 3QIPA 3CPEA 4YOXA 4W5TA 4N41A 1RBUA 3IMXA 4O0IA 3C65A 1BO5O 1HJRA 2YX6A 4KI6A 3BF3A 1VQ7N 2YHBA 3QNOA 2E2QA 3MX5A 1NJXA 3HPGA 3WXLA 3VEOA 1X9WA 1U2VA 1KTQA 3VGKA 4ISGA 3K9KA 2QWQA 5CHIA 5H1SQ 2WC9A 4DUZK 4K8ZA 2HHWA 4O4GA 4DV0K 3IG1A 3WNHA 2PYJA 2YCHA 3V1RA 1UOCA 1C1BA 5GAHP 3NGZA 1I94K 1XHXA 3NE6A 1ZBHA 4BR5A 2YNIA 3O9SA 4FLZA 1JJ2M 1L3UA 2OZMA 3VEZA 3ZETB 1D8YA 1ZBSA 2F7TA 3A5NC 4CJFA
chains in the Genus database with same CATH topology
3MN6A 1Q82O 3HRGA 3HZ6A 3D6RA 3L4QA 3HI0A 4ILHA 3H6EA 1TYQA 3PLAA 3PIPL 3A8YA 3J7ZO 1RDUA 1NJIO 2NRTA 3NVMA 3LDNA 2VCPA 4O8KA 4OPAA 2V7YA 1NGCA 3P38A 4NO7A 1R59O 3HBTA 5CE3A 1YITN 1M90O 3BP8A 3LDQA 4BRNA 1LCUA 3CCRN 4BR2A 2H3GX 4H0XB 3UE5A 1YJNN 4CD1A 3H1QA 4GV6A 1MA9B 3F2KA 1T6CA 2FXUA 1OVYA 3FZLA 4WQ5A 4BC3A 4BRKA 5AZIA 3ZEUA 3SAFA 4UY8O 3JS6A 3CCUN 2OTJN 3I33A 3AARA 1GLLO 3EKUA 3G4SN 3LDOA 5M1NA 4BR4A 1NGJA 5EY4A 5GADP 2KLAA 2PAVA 1NGHA 4WYBA 3JXUA 4A59A 5EOYA 3QMLA 1S22A 3C7NB 4HWIA 4BQZA 2WFBA 5C15A 1NLVA 3C7NA 3DLLL 2Q97A 5AQWA 3CCEN 1NWKA 4GV9A 4A5BA 3BEXA 3FE1A 4J8FA 5TKYA 2ZJRL 3VETA 3VF4A 4PKGA 1QQOA 4AF1A 3CJ9A 4XH5A 3QFPA 3VERA 2QWMA 3FGUA 1KAZA 2W41A 2NRRA 3P31A 4RWTA 4AM7A 5LJWA 2FF3B 4B1XB 4H5NA 1MWMA 4FPAA 5M1PA 2DPNA 5M1KA 3WQTA 3R6MA 2VWBA 3KWGA 4KH6A 3MMVA 3AGKA 5JVGL 4C23A 4YOWA 3ENHA 5F2RA 3VEYA 2P9UA 1VAZA 2D4WA 2GEMA 2YJEA 1Z05A 4JNEA 3CCMN 1SQKA 1XC3A 5BN8A 4FWQA 3E9PA 1N8RO 2NLXA 2ZGYA 4U67L 5KQ8A 2HBKA 5C12A 4BC2A 2NZTA 5KPTA 2VYPA 2GWJA 2J4RA 3FZKA 4CBUA 3O9RA 4H5RA 2NRXA 2EWSA 1G99A 1QQNA 2PBDA 2YJFA 4IO9L 4JN4A 3AAQA 2QW9A 1JCFA 4FWNA 2CGKA 2QI2A 3H46O 1GLCG 4F9OA 4CD3A 3R1XA 4ISFA 5AQOA 3CJ1A 5M1QA 4BRCA 2BTFA 3ZYYX 5AQZA 1C0FA 3E9OA 1K8AO 1QZ6A 4CZEA 3SMPA 2JWLA 4PKIA 4YOTA 2E1ZA 3H3OB 1BU6O 4K42A 5AQJA 4EAHD 1YHQN 2Q0RA 3VGLA 3CJCA 4ISEA 1Q86O 3MN5A 4Z94A 4JKAA 5AQQA 1HPMA 3C6HA 1DT9A 4FWPA 4A5AA 4BRLA 2VGMA 3ID8A 2W40A 4IDHA 4BRDA 3CJBA 5F0XA 2NRZA 3RVCA 3E1YA 4H5VA 1XQSC 5GAGP 1VQ8N 5AQHA 5AQMA 4MDBA 4DHYA 2P9KB 4WFNL 1GLJO 2P9KA 3MX2A 3O9UA 1IG8A 3IUCA 1BDGA 2QM1A 2E2PA 3A5LC 3ENOA 4MLEA 5DM6L 1NGIA 3SAHA 3ATUA 2D1KA 1BA0A 2PFUA 3EN9A 1D4XA 4IO8A 5FPNA 5AFUH 2QWRA 4IFEA 4Y0WA 1S72N 3WXMB 4FL9A 2YHWA 4BR9A 3GL1A 2QA4N 2CH6A 2FSKA 4MDAA 3EL2A 3CMAN 1WOQA 4MO5A 4FWLA 3CC7N 5B8HA 3ID6A 5AZJA 3OW2M 2E88A 1NM1A 2P9IA 2CGLA 3OHRA 1HX1A 1SS6A 3FLCO 4FWKA 2P9LA 4K43A 4QS7A 2IIRA 3UKRB 3MN9A 1VQ9N 4BY9C 3CCVN 3O8MA 2GTDA 2NNWA 2P9NA 3I8BA 3ULEB 1CZAN 3A5OC 5BN9A 5GIOA 3ULEA 1TYQB 1NGFA 2QWLA 4GV3A 3U8XA 4JKFA 3VOVA 3M1FA 4WQ4A 3U4LA 1RFQA 1HKBA 2QXLA 2ZWHA 1E4GT 4CJ7A 3FZFA 4FWMA 4QS9A 3E66A 1OKJA 3CI5A 5AFUA 4I6MA 3L0QA 4AM6A 4BVOA 2GWKA 2P9UB 2F9WA 1JCGA 2E1YA 4EFHA 4CZJA 5LY3A 2NRHA 3MWPA 2FSJA 2YHYA 3IDHA 3QFUA 3W0LA 5AQVA 5E26A 2FF6A 5JLHA 4EHUA 2ASOA 3O9TA 3T7ZA 1WUAA 3HM8A 3O6WA 1Q18A 2AP1A 3OBYA 3QDKA 4A61A 1TUUA 4XH1A 4WQ4C 5AQUA 2V52B 3GE1A 4BRHA 1NBWA 1ZXOA 3L6QA 4FOEA 4BVPA 1BWFO 1NGBA 2UYTA 5AQSA 2QTDA 5AQIA 4JK7A 3TTCA 5EX5A 3GDQA 3WUHA 3F5TA 3CXCM 1W97L 4RTFD 3O80A 3KWIA 4XEIA 2A5XA 5HL7L 4BRQA 1YJ9N 3Q7BA 1U2VB 1XUPO 3ATVA 5AR0A 4BC4A 5KQDA 2KHOA 3E9LA 4BRIA 3O1BA 4E1JA 5AQKA 1YJWN 4BG9A 4H03B 3CJ7A 5C2DA 3C6AA 2ZGZA 4A62A 5C2FA 1SZ2A 3LL3A 4B1ZA 2RE2A 3MCAB 1KQSM 1Y64A 1HJOA 5GIPA 3GOIA 1O13A 3H3NO 3H1VX 2V7ZA 4BRFA 4KBOA 2Q36A 3CCSN 4B9QA 2JWKA 3NMUA 3I55N 5C10A 2ZF5O 4FWOA 4JKBA 4JKDA 5TKWA 3EZWA 1T44A 3KVGA 2HF3A 3ZX0A 3CCQN 1KAXA 3FR0A 4HTLA 4PKHA 4KH4A 3SJHA 3ZX2A 1VQKN 3MN7A 4IJNA 2A40A 2QWNA 4WF9L 1Q7YO 2NRWA 4CBXA 5KPZA 4H5WA 1QZ5A 5BPLA 3O9QA 2HBJA 4FPBA 1X3NA 4WFAL 3VEXA 1DGKN 3FZMA 3TSPA 5AQRA 3O4WA 5MLCQ 3UKRA 2OANA 2P9LB 1KD1O 5EVZA 3PIOL 1BA1A 2I7NA 3W3DA 3P39A 3OBWA 3KZBA 4PHTX 4BGAA 4FO0A 2A6AA 3HOTA 4JKCA 3VF2A 2BUPA 4DKWA 1KC8O 1V4SA 4NB4A 3HTVA 3L4IA 4DCHA 5BR9A 3TU5A 3QBWA 5FPMA 1HUXA 4OPHA 3EE9A 1ZC6A 3LM2A 4YORA 4BR7A 3G6EN 4JKGA 1T3VA 3N4QA 1HKGA 1KXPA 2Q1NA 3S41A 3H45C 4PL8A 1GLDG 3VTHA 1TUYA 5KPRA 1GLEG 2A3ZA 3TTFA 3I56N 3D2FA 2OTLN 1YF5L 3NVKA 5AQNA 3Q7CA 1ATSA 4FWRA 2FLOA 3SLCA 3UB5A 5BREA 1YUWA 5ADXA 2VGNA 5HOOA 4K25A 3GBTA 1X3MA 1VQ5N 3CCLN 4JK9A 4WFBL 2QWOA 2F9TA 4KH5A 1NGAA 3TSQA 1YIJN 1VQNN 1MDUB 4K41A 4WQ5C 3VGMA 3CF5L 2A42A 4DQ8A 3AY9A 4IEEA 2QWPA 4FSVA 4JD2A 4JK8A 4BRAA 4CZLA 4EHTA 3T69A 4BR0A 3HOSA 4H0VB 5BRHA 1DEJA 5AQFA 1QVFM 2P9SA 2QEXN 2WBNA 4IOAL 2HF4A 3DXKA 3QICA 3TTDA 1RGIA 3WXKA 3DAWA 3U9ZA 3VTIA 4H0OA 1C0GA 3IFRA 5CR4A 2P9NB 4MO4A 5AQTA 3ZX3A 4BRGA 1VQ6N 4BRMA 1YVNA 2I7PA 3K9JA 3UKUB 5DM7L 4CZFA 2GX9A 3QBXA 4WCEL 4A2AA 5JICA 1EO1A 5JLFA 3DXMB 1VQ4N 1ATNA 4BG8A 1NMDA 2Q31A 4XH4A 3VESA 1P8ZA 1QQMA 4CZGA 3F9MA 5FPEA 3EO3A 4BREA 1GLFO 2Q2RA 1E4FT 4M7YA 3CJAA 3MWTA 3R9PA 3TSUA 3D7EO 3D2EB 4M63C 4U7BA 1VQLN 3CERA 4B1VA 2ZJQL 4GY2B 4NLCA 4IJAA 1QHAA 5BPNA 2HSTA 3CETA 4GNIA 4QS8A 3R8EA 3CCJN 2NRVA 4YOVA 1T6DA 4BROA 1BOTO 3A5MC 5BPMA 5M1OA 1EQYA 3G25A 1ESVA 2KKZA 5M1FA 1NGDA 1YAGA 1P90A 2IVNA 3VENA 2ASMA 5GAEP 5EXWA 3KHYA 4H0PA 3P4IA 3ENBA 4A57A 1H1VA 5I9EB 2E8AA 4IEIA 5AQPA 1VQMN 3CIPA 3DWLA 4CBWA 3VF6A 4ILGB 2V51B 5E84A 4IZ9A 3R3LA 4FVUA 5FPDA 3MDQA 2HMPA 4CZKA 2HOEA 2ITMA 2CH5A 1MWKA 1U6ZA 3OA9A 1NGEA 1K8KB 4NLBA 3HSCA 4GVEA 5AQGA 5BRDA 3WXIA 3GG4A 3KK7A 3LDLA 4B1YB 4IOXA 4BRPA 1HLUA 3VEWA 4YOYA 2IVOA 4C1NK 4H0TB 3J8AA 3CD6N 3O5BA 4JD2B 2HBMA 3ZETA 3U9DA 2P9SB 1ILYA 3FFKB 4YDUC 3DXKB 4JKHA 5AZJB 2P9IB 3QB0A 5AQXA 1W2BM 1QVGM 3CHWA 4CZHA 3M6GA 2E20A 3MCPA 3WQUA 2ZJPL 4LC9B 3SBTA 3O08A 4JKEA 3WEEB 3WXJA 4O8UA 1ATRA 3WEEA 4R79A 2ASPA 3AGRA 3LM9A 4YDUA 5ADXH 3M3ZA 5GINA 1X9JA 1BUPA 4M7XA 2WUSA 3DXMA 5JMVA 4I6MB 2YHXA 3C0BA 4CZIA 3N4PA 4RCHA 3DJCA 4EIAA 3TPQA 4IOCL 5F1XA 5LJVA 4G9ZA 2D0OA 3CQYA 4JKGB 1BG3A 3VEVA 3G71N 4YOUA 3CC2N 3FZHA 3CPWM 3B8AX 3O1WA 5JVHL 1K9MO 3M5RA 4BGBA 1JCEA 5AZIB 3ZEUB 1NGGA 1Z6RA 4H5TA 3BF1A 3D2FB 1LOTB 1GLBG 1RDWX 3LDPA 4YOXA 2A41A 3CPEA 5BRFA 2BH1A 3IMXA 1SAZA 3RSEB 3C65A 2Q0UA 2FSNA 1BO5O 3RSEA 4B1UB 2D0PA 2YX6A 3CQXA 2P9PA 3VPZA 2P9PB 3BF3A 4JEPA 1VQ7N 2E2NA 1KAYA 4DB3A 1S3XA 2E2QA 3BUZB 3MX5A 4OO1J 1V4TA 1VQPN 3WXLA 3VEOA 3EE8A 3IKMA 4FWSA 1U2VA 2GELA 4ISGA 3K9KA 2GUPA 2QWQA 3AAPA 3VGKA 4CI6A 3SAGA 1YXQA 5CHIA 4IXCA 5H1SQ 2WC9A 1VQON 3CC4N 2YI1A 4L3QA 4A2BA 4FOIA 4H0YB 2E2OA 1J6ZA 2YCHA 3SK3A 3CMEN 5GAHP 3UKUA 1YI2N 2IVPA 1Q81O 5C0YA 1K8KA 2CGJA 4BC5A 5ELZA 4JAXA 4O5FA 4B1WB 2RHKA 4MLHA 5AQLA 4BR5A 1M1KO 2AA4A 3VMFB 3O9SA 4C1NI 4CZMA 1JJ2M 1GLAG 4JHDA 3MK6A 4ILJA 3SBGA 1HKCA 4JHDB 3VEZA 3SMSA 3WT0A 3D2EA 1K73O 3ZETB 3A0IX 4PL7A 1ZBSA 1IJJA 4BQLA 3EKSA 5AQYA 2F7TA 1DKGD 3A5NC 4IWVA 2HBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1P A;  3C6H A;  4IFE A;  5C10 A;  4IEE A;  5M1O A;  5M1Q A;  5C15 A;  5M1N A;  5M1K A;  5M1F A;  5C2D A;  3C6A A;  4IDH A;  4IEI A;  5C12 A;  5C2F A;  3CPE A; 
#chains in the Genus database with same CATH topology
 3ALY A;  3D6R A;  3L4Q A;  4ILH A;  1KFS A;  3A8Y A;  3VQ8 A;  3K59 A;  4ELU A;  4O8K A;  1KVC A;  4OPA A;  1XMQ K;  2VG5 A;  1IBL K;  1U4B A;  2H3G X;  4H0X B;  3UE5 A;  1YJN N;  4BRK A;  3AVN A;  5AZI A;  3SAF A;  2OTJ N;  2GUI A;  3LDO A;  5M1N A;  3SJJ A;  3DI6 A;  3TAR A;  4BWM A;  3DRP A;  3JXU A;  1Q8I A;  4DWI A;  3QML A;  5IT9 O;  4HWI A;  2Q97 A;  3CCE N;  4GV9 A;  2F96 A;  1N5Y A;  3VET A;  3VF4 A;  1QQO A;  3CJ9 A;  1EXQ A;  3ZSW A;  1RTD A;  3M8R A;  1WB9 A;  4B1X B;  3TAM A;  3KTQ A;  5LL6 Z;  3L3V A;  5M1P A;  2PZS A;  2AJQ A;  3R6M A;  3KWG A;  3RMD A;  3MMV A;  4LFB K;  4C23 A;  4YOW A;  5F2R A;  3VEY A;  2P9U A;  2D4W A;  3AO1 A;  4JNE A;  1SQK A;  3E9P A;  1N8R O;  2NLX A;  5BR8 K;  4PY5 A;  4E19 A;  4BC2 A;  4CBU A;  4KTW A;  4HTU A;  1S9E A;  3O9R A;  4E89 A;  2KZM A;  4M3Y A;  4JN4 A;  3L2V A;  4FWN A;  4ISF A;  5HP1 A;  3TAE A;  1QZ6 A;  2JWL A;  4NCG A;  4EAH D;  4ISE A;  4RW6 A;  4Z94 A;  4JKA A;  3C6H A;  4BE1 A;  1Q9Y A;  3VQQ A;  1I39 A;  3RMC A;  4BRD A;  2O8B A;  5F0X A;  2O8B B;  1L3S A;  4H5V A;  4F3T A;  1VQ8 N;  1S1X A;  2P9K B;  3I8D A;  4WFN L;  1GLJ O;  3SI6 A;  1IG8 A;  2QM1 A;  3A5L C;  1NGI A;  3SAH A;  4JS5 A;  4IO8 A;  3OS0 A;  4CER A;  4FLY A;  2QWR A;  1S72 N;  4Y0W A;  3VA0 A;  3WXM B;  1WSE A;  4YHH K;  2FSK A;  3CMA N;  1WOQ A;  4MO5 A;  4FZY A;  3HK2 A;  3HVR A;  4K43 A;  3UKR B;  2IIR A;  4BY9 C;  3THV A;  2GTD A;  3I8B A;  1S9G A;  3ULE A;  1NGF A;  1OH6 A;  3PSF A;  4DTS A;  4GV3 A;  3VA3 A;  3U4L A;  1NK6 A;  4LSL A;  4QS9 A;  3P83 D;  3CI5 A;  5AFU A;  1RT6 A;  2P9U B;  4FJM A;  2FBX A;  4Z4F A;  1JCG A;  4EFH A;  4CZJ A;  3WNF A;  1TKD A;  3MWP A;  2YHY A;  3IDH A;  5JS2 A;  5AQV A;  3T7Z A;  3O6W A;  4HHT A;  3DLE A;  3D0P A;  3KD1 E;  4WQ4 C;  5AQU A;  3KLH A;  4FOE A;  4BVP A;  1NGB A;  3VQ6 A;  2G8I A;  4DTP A;  5EX5 A;  4CJL A;  3GDQ A;  4B9U A;  4I9Q A;  3O80 A;  3KWI A;  1HNW K;  5KQD A;  2KHO A;  3E9L A;  4BRI A;  1YJW N;  4BG9 A;  3CJ7 A;  3C6A A;  2ZM6 K;  2JLE A;  2RE2 A;  1RTJ A;  4B9Q A;  2JWK A;  1REV A;  4ZTJ A;  2ZF5 O;  4PUO A;  1NOY A;  2HF3 A;  4N76 A;  4PKH A;  4DLG A;  2QWN A;  3VQA A;  1TKX A;  4H5W A;  1QZ5 A;  1SKS A;  4DR4 K;  3O9Q A;  1X3N A;  4FJK A;  5J2N A;  3VEX A;  5J1E A;  3LP0 A;  3UKR A;  1NK0 A;  5EVZ A;  1JXB A;  1S6P A;  3W3D A;  4Q5V A;  1LAW A;  3KZB A;  4E7K A;  3ZCM A;  4FO0 A;  1BCM A;  1KSP A;  1KVA A;  4NB4 A;  3HTV A;  4HUF A;  3L4I A;  4M42 A;  3TU5 A;  4YOR A;  4CHQ A;  3QO9 A;  3LP2 A;  3N4Q A;  5I42 A;  1VHX A;  1WNS A;  1FJG K;  4C8N A;  4MFB A;  2A3Z A;  3I56 N;  1YF5 L;  1NKB A;  2W6L A;  5ADX A;  5LMU K;  4K25 A;  1VSL A;  4YFU A;  1VSM A;  4JK9 A;  2F9T A;  4NXM K;  4N5S A;  3RMA A;  3LP1 A;  3J7A P;  4DQI A;  3OY9 A;  5J2M A;  4K41 A;  4CEZ A;  3CF5 L;  2A42 A;  4OJR A;  1HQE A;  4JK8 A;  4IEE A;  2QWP A;  4DFP A;  3DOK A;  3BY5 A;  4B3T K;  4BR0 A;  3LAN A;  4I7F A;  4LF9 K;  5AQF A;  1QVF M;  2WBN A;  2IGI A;  1LWC A;  1Z25 A;  2WOM A;  1C0G A;  1YT3 A;  5CR4 A;  2XO7 A;  2YKM A;  5AQT A;  4BRG A;  2FBY A;  1BGX T;  3UKU B;  4CZF A;  2GX9 A;  1A5X A;  1SV5 A;  3D45 A;  1JLE A;  4B9T A;  3QNN A;  4BG8 A;  3AA2 A;  4K0K K;  4CZG A;  4FJJ A;  4IG0 A;  4BRE A;  4BAC A;  4CK2 A;  1BIZ A;  3NH1 A;  3MWT A;  1ZBF A;  3D7E O;  3D2E B;  4U7B A;  4TSX A;  2ZJQ L;  3SPY A;  4QS8 A;  3AVF A;  4CGJ A;  3CCJ N;  3PSI A;  1J5O A;  1BOT O;  4DLE A;  1NGD A;  1P90 A;  2BGG A;  5GAE P;  2HHS A;  1ZBL A;  3KHY A;  4H0P A;  3MXJ A;  3ENB A;  5I9E B;  4IEI A;  5E84 A;  2XY6 A;  4GW6 A;  4CHN A;  2D0C A;  2VQF K;  2UU9 K;  1KVB A;  2HMP A;  1HRH A;  2HVH A;  1KLM A;  1C1A A;  3OA9 A;  3K57 A;  4NLB A;  4CGD A;  3OYH A;  3TAQ A;  1TAU A;  4FJL A;  2KZZ A;  2ZQB A;  4B1Y B;  4CEA A;  3OTO K;  1TAQ A;  4BRP A;  1NK8 A;  4YOY A;  3ASM A;  1HYZ A;  2IVO A;  3KK3 A;  3IS9 A;  2I5J A;  4JD2 B;  3K0S A;  2HBM A;  3U9D A;  4ID1 A;  3HO1 A;  4B3S K;  4JI6 K;  3ZLJ A;  4CJR A;  3MCP A;  4KRF A;  3SBT A;  4CJT A;  2HHQ A;  4R79 A;  3AGR A;  3OVN A;  4YDU A;  3M3Z A;  1A5W A;  1BUP A;  1BQN A;  1QTM A;  3C0B A;  3V1O A;  4KB0 A;  4EIA A;  4JI0 K;  5LMN K;  5F1X A;  4G9Z A;  3EEQ A;  3CQY A;  3SZ2 A;  4YOU A;  3FZH A;  4FM2 A;  1NK5 A;  5HRR A;  1NKE A;  4BGB A;  4CEQ A;  3ZEU B;  4YNQ A;  1Z6R A;  1S1T A;  3TAF A;  1O1W A;  3P5J A;  1NKC A;  2EX3 A;  3RSE B;  5HRO A;  3RSE A;  3CQX A;  4CK1 A;  3AVL A;  2P9P B;  3VPZ A;  4KTZ A;  4DQQ A;  2DTU A;  1KAY A;  3KLG A;  4CFC A;  4FJH A;  4GKJ K;  4B9S A;  3PX6 A;  5CZ2 A;  2UXB K;  2GEL A;  4LSN A;  3SAG A;  2GUP A;  1VK0 A;  1JKH A;  5FRM A;  4L3Q A;  3LZI A;  4FOI A;  4E0D A;  2VWJ A;  1NK9 A;  3UKU A;  1Q81 O;  2G8K A;  3JSM A;  2WON A;  2AA4 A;  3T1A A;  4IFY A;  1HNV A;  2E5L K;  1NU0 A;  1RNH A;  3MK6 A;  2VWK A;  4ILJ A;  1HKC A;  4CJ3 A;  3D2E A;  1K73 O;  3P1G A;  1IJJ A;  2DY4 A;  3QEI A;  3SQ4 A;  4DHY A;  4IWV A;  1EP4 A;  1XNR K;  1YTU A;  4Z4H A;  4DTO A;  4DSK A;  3H6E A;  3E01 A;  4IBN A;  3J7Z O;  1NNE A;  4DQR A;  4NYN A;  1NJI O;  2O8E A;  2NRT A;  3NVM A;  3LDN A;  2VCP A;  4Z4C A;  5CE3 A;  3P38 A;  1R59 O;  1YIT N;  1CZ9 A;  2YNG A;  1WSJ A;  1B9D A;  4M41 A;  3T1H K;  3AVK A;  1MA9 B;  2JGU A;  3LAM A;  1S1V A;  3FZL A;  4WQ5 A;  3ZEU A;  4UY8 O;  4JYA K;  3AA5 X;  3AAR A;  1OVQ A;  3EKU A;  1NJY A;  3AO4 A;  1GOC A;  5EY4 A;  5GAD P;  2KLA A;  1G15 A;  1NGH A;  4WYB A;  3LZJ A;  5EOY A;  1S22 A;  2OA8 A;  4FZZ A;  2WFB A;  1XC9 A;  3ZT3 A;  4A5B A;  2XY8 A;  3BEX A;  3NBP A;  1LW0 A;  4PKG A;  2X6S A;  4XH5 A;  4F3O A;  3VER A;  1LWE A;  1KAZ A;  4E7J A;  1WAF A;  3P31 A;  3SV4 A;  5LJW A;  4GMJ B;  4H5N A;  4M45 A;  4JV5 K;  1MWM A;  4C8M A;  1UA0 A;  3MEE A;  3B6P A;  3KLE A;  3PO5 A;  5FRO A;  1BI4 B;  2HNZ A;  4U67 L;  1HR0 K;  5KQ8 A;  2HBK A;  5C12 A;  2VYP A;  2J4R A;  1TK0 A;  2ITG A;  2DFE A;  4H5R A;  2NRX A;  4RG8 A;  1QQN A;  3OYC A;  4IO9 L;  2QW9 A;  2Y1J A;  3H46 O;  1C6V A;  5C42 A;  4OGC A;  3CJ1 A;  4BRC A;  3EZ5 A;  4HUG A;  4AH9 A;  1IKV A;  4LH5 A;  3SMP A;  2QK9 A;  3HVT A;  1Q86 O;  3CJC A;  3MN5 A;  5AQQ A;  4FWP A;  4A5A A;  1RCH A;  2VGM A;  3CJB A;  2RN2 A;  5AQH A;  5AQM A;  1C0M A;  3VQP A;  4DTM A;  1ASU A;  3O9U A;  1VSE A;  3ZSV A;  5DM6 L;  3ATU A;  1D4X A;  1JLQ A;  3DRR A;  3C94 A;  4PA1 A;  3L8B A;  3CM5 A;  4FL9 A;  2O8C B;  4BR9 A;  2CH6 A;  1WBD A;  3U3G A;  5DK5 A;  4FWL A;  3ID6 A;  4FK2 A;  1SS6 A;  3FLC O;  1VSD A;  1N32 K;  3MEG A;  4CF2 A;  3OYD A;  2NNW A;  5BN9 A;  2QWL A;  3U8X A;  4JKF A;  3QER A;  1RFQ A;  4FWM A;  4AHT A;  3LP3 A;  1ITG A;  1NMN A;  3J80 O;  3OYJ A;  4I6M A;  4FW1 A;  1FKP A;  1VSH A;  2E1Y A;  5LY3 A;  3KIO A;  2FSJ A;  3W0L A;  3AVH A;  5E26 A;  2FF6 A;  3IAY A;  5K14 A;  2ASO A;  2Z1J A;  3O9T A;  1TK8 A;  3QDK A;  4CEE A;  1TUU A;  1UA1 A;  1ZXO A;  3DRS A;  3NF7 A;  1BWF O;  3TTC A;  4JK7 A;  3OJU A;  4I2Q A;  3CXC M;  1W97 L;  3KLF A;  4XEI A;  4BRQ A;  1U2V B;  1XUP O;  3ATV A;  5KRS A;  3O1B A;  3OYN A;  4H03 B;  3RWU A;  5EU7 A;  1W7A A;  1RDA A;  4DFJ A;  4J2D A;  4CHY A;  2XY5 A;  1BHL A;  2E6M A;  2YV0 X;  5GIP A;  2W42 A;  1LV5 A;  3DM2 A;  4IG3 A;  4FWO A;  5TKW A;  4XIU A;  1T44 A;  3KVG A;  3ZX0 A;  4CJ5 A;  4HTL A;  3SJH A;  3S3M A;  1SKR A;  2HND A;  3K58 A;  1Q7Y O;  2O8C A;  4GKK K;  1HPZ A;  2YHA A;  4DR1 K;  2YNH A;  5BPL A;  2HBJ A;  4FPB A;  4CGF A;  4DTJ A;  4C8K A;  4N56 A;  4WFA L;  5AQR A;  4DU1 A;  3FFI A;  2OAN A;  2F8T A;  1KD1 O;  4OKE A;  1BA1 A;  3AVC A;  1B9F A;  2I7N A;  1IKY A;  4M3T A;  4RW9 A;  3JAM O;  5FRN A;  5J2P A;  2HMI A;  3PUF A;  4DR7 K;  2BUP A;  2O8F B;  4DCH A;  5BR9 A;  4JRQ A;  4CF1 A;  3G6E N;  2BE2 A;  2W6K A;  2O8D A;  4G1Q A;  3S41 A;  4PL8 A;  1GLD G;  3S3N A;  1TUY A;  2B5J A;  2X78 A;  3CM6 A;  3SCX A;  4HVJ A;  3D2F A;  2HNY A;  5HOO A;  3UB5 A;  3SLC A;  5BRE A;  1YUW A;  3OS2 A;  3A2F A;  4WFB L;  2QWO A;  4AHS A;  1ZBI A;  3F73 A;  4FM1 A;  3TSQ A;  1MDU B;  3QEW A;  4WQ5 C;  4QOZ B;  4E7L A;  1NOZ A;  2RPI A;  4DSE A;  3S9H A;  1NJZ A;  3U9Z A;  3LAL A;  4DFK A;  3EY1 A;  3IFR A;  2P9N B;  1YVN A;  4OVL A;  4WCE L;  3B6O A;  4FLT A;  3O3F A;  1EO1 A;  3DXM B;  4KTQ A;  1ATN A;  1R0A A;  4KV8 A;  4LFC K;  4I2P A;  3KJV A;  3DMJ A;  3S3O A;  4M3X A;  4M7Y A;  5FLX O;  1XI1 A;  1KLN A;  4DSL A;  3V6D A;  4GY2 B;  3T3F A;  3TAP A;  4CW7 B;  4DSF A;  3J7Y P;  3RR8 A;  3R8E A;  4X62 K;  1X9M A;  4AHU A;  4DV3 K;  4YOV A;  4BRO A;  5BPM A;  1EQY A;  4LD0 A;  2KKZ A;  1OH7 A;  4Z4I A;  5EXW A;  3NGI A;  3JYT A;  4A57 A;  2UXC K;  2B6A A;  2GV9 A;  4ILG B;  2V51 B;  3OYF A;  1T8E A;  4IZ9 A;  5CYQ A;  4DV6 K;  4E3S A;  4FVU A;  3MDQ A;  4CZK A;  3ZSO A;  2XY7 A;  1JL1 A;  2ITM A;  1MWK A;  2OPQ A;  4J2E A;  1U6Z A;  1K6Y A;  5AQG A;  5BRD A;  3LDL A;  4C1N K;  4DU4 A;  4H0T B;  3J8A A;  3CD6 N;  3HST B;  1EWR A;  3O5B A;  2G8W A;  1IKX A;  4Z4E A;  3CFO A;  3ZET A;  2VG6 A;  3FFK B;  4YDU C;  3SUN A;  4JKH A;  5AZJ B;  2P9I B;  5AQX A;  3WNE A;  3M8Q A;  3AVB A;  3WQU A;  2ZJP L;  1XWL A;  3L2W A;  3O08 A;  4KI4 A;  4O8U A;  1L3V A;  3LM9 A;  5ADX H;  4IKF A;  3ITH A;  5SWM A;  1EKE A;  2WUS A;  3HJF A;  3THX A;  3ZT1 A;  3DJC A;  5LJV A;  4DG1 A;  2D0O A;  3HM9 A;  2ETJ A;  3CC2 N;  3OYB A;  4ZHR A;  4DS4 A;  3M5R A;  1JCE A;  5AZI B;  1NGG A;  4H5T A;  3D2F B;  4CJK A;  3DOL A;  1LOT B;  1GLB G;  1RDW X;  4QAG A;  1QSY A;  5BRF A;  2HHX A;  3PX4 A;  1KCF A;  1SAZ A;  2FSN A;  3PO4 A;  4H8K A;  1IBK K;  4JEP A;  4LF5 K;  4DB3 A;  1S3X A;  4OO1 J;  1V4T A;  2Q3S A;  4Y1D A;  1RT1 A;  2OYQ A;  2RKI A;  4FWS A;  3AAP A;  4CI6 A;  1RBT A;  3DLR A;  1X1P A;  4IXC A;  4CJU A;  4F8R A;  1RTH A;  2E2O A;  4H0Y B;  1E3M A;  1JL2 A;  1CXU A;  2UUB K;  4KO0 A;  1ZBU A;  1K8K A;  3OYL A;  4MLH A;  5AQL A;  3VMF B;  3SNN A;  4C1N I;  4CZM A;  5IWA K;  4DTU A;  3O4N A;  1RBS A;  3SBG A;  3SMS A;  3WT0 A;  4OKK A;  4DUY K;  4BQL A;  3EKS A;  1DKG D;  4EP5 A;  2HBL A;  3THW A;  4OPJ A;  3HP9 A;  3HRG A;  1Q82 O;  4CFD A;  2NUB A;  4FM0 A;  4EZ6 A;  3HI0 A;  1RDC A;  4DU3 A;  1RTI A;  4JI8 K;  4W5R A;  4H4M A;  2F4V K;  2V7Y A;  4JI4 K;  1M90 O;  3HBT A;  3THX B;  4BRN A;  3ZSQ A;  1LCU A;  3CCR N;  4BR2 A;  4GVM A;  1RIL A;  4GV6 A;  4RW7 A;  3T1Y K;  4BC3 A;  3K5M A;  3V4I A;  4K8X A;  1GLL O;  3RMB A;  4BR4 A;  4DS5 A;  2UXD K;  1J53 A;  2PY5 A;  3C7N B;  4BQZ A;  4YY3 K;  4JI7 K;  1NLV A;  3C7N A;  3DLL L;  1QS4 A;  5AQW A;  1J9A A;  5DMR A;  4W5N A;  2KW4 A;  3NF6 A;  1HNI A;  4AF1 A;  4M3R A;  3V9X A;  1S6Q A;  3QET A;  3V9S A;  1KRP A;  3I0R A;  3ZSY A;  3FGU A;  3KKR A;  2NRR A;  4NCA A;  1RT4 A;  4FPA A;  1U47 A;  5M1K A;  4KH6 A;  5JVG L;  2Z1I A;  4ELV A;  1VAZ A;  2YJE A;  2Y1I A;  3CCM N;  5BN8 A;  1TKZ A;  2IS3 A;  3O3G A;  1W0H A;  4C8L A;  5KRT A;  2EWS A;  1G99 A;  2P1J A;  4BDZ A;  3OS1 A;  3AAQ A;  2QI2 A;  1GLC G;  4L8R B;  4CD3 A;  4CIF A;  2IAJ A;  4IFV A;  2BTF A;  3ZYY X;  5AQZ A;  1C0F A;  1K8A O;  4CZE A;  4YOT A;  2E1Z A;  1ZYQ A;  3H3O B;  4K42 A;  5AQJ A;  1YHQ N;  4FYD A;  1T05 A;  1C0T A;  4CK3 A;  4LF6 K;  2W40 A;  3OYM A;  1F21 A;  3RRH A;  2NRZ A;  3RVC A;  5E41 A;  4E7I A;  1XQS C;  4X65 K;  2HHU A;  2ZE2 A;  3DLG A;  2DFH A;  4MDB A;  3L2U A;  2P9K A;  3MX2 A;  1QQC A;  1BDG A;  3IUC A;  2E2P A;  1BA0 A;  5FPN A;  5KI6 A;  3NGY A;  1ASW A;  4IFE A;  4KAZ A;  2YNF A;  4FJI A;  2QA4 N;  2WTU A;  4MDA A;  3EL2 A;  1HYV A;  4RW4 A;  4DF4 A;  3DLB A;  5B8H A;  5AZJ A;  3RRG A;  4IDK A;  3LWL A;  4QS7 A;  1HX1 A;  4FWK A;  4CE9 A;  3HYF A;  3CCV N;  3ZT2 A;  4Y1C A;  3ULE B;  2QKK A;  1CZA N;  4B9L A;  5GIO A;  3VQD A;  3M1F A;  4WQ4 A;  2QXL A;  4CGH A;  4CJ7 A;  3FZF A;  3E66 A;  1OKJ A;  2FC0 A;  4AM6 A;  4MQ3 A;  4BVO A;  2GWK A;  4CHO A;  3K2P A;  5C25 A;  2G8V A;  4OGE A;  4JRP A;  4DF8 A;  3LAK A;  2NRH A;  3QIO A;  2G8F A;  3QFU A;  5JLH A;  1T03 A;  3CG7 A;  3SQ0 A;  4HCB A;  1Q18 A;  2AP1 A;  4EP4 A;  5C24 A;  4XH1 A;  4BRH A;  2V52 B;  3GE1 A;  3MAQ A;  3L6Q A;  4CIG A;  5AQS A;  5AQI A;  4CGG A;  3TWH A;  3V9Z A;  4RTF D;  1U04 A;  2A5X A;  3NCI A;  1YJ9 N;  1KFD A;  4E1J A;  1FW6 A;  4B08 A;  1U48 A;  4OPK A;  3G10 A;  2ZGZ A;  4A62 A;  5C2F A;  4E1N A;  2HVI A;  4OKJ A;  3OJS A;  1HNZ K;  2HB5 A;  3MCA B;  1KQS M;  1Y64 A;  1HJO A;  4AQY K;  3GOI A;  1O13 A;  3H1V X;  2V7Z A;  4BRF A;  4KBO A;  5T7B A;  3CCS N;  3AVG A;  4FW2 A;  5FDL A;  4JKB A;  4JKD A;  4CFB A;  3VQ9 A;  3EZW A;  1A5V A;  3TAN A;  1IKW A;  4O55 A;  1KAX A;  3FR0 A;  3ZX2 A;  4KH4 A;  1U49 A;  1VQK N;  2A40 A;  4BE2 A;  2Z1H A;  2IOC A;  2O4I A;  2NRW A;  4CBX A;  5KPZ A;  3V9U A;  4CEC A;  3QES A;  3ULD A;  3PIO L;  3MED A;  4PHT X;  4KB1 A;  4BGA A;  1RDD A;  2A6A A;  4J2B A;  5CZ1 A;  3HOT A;  3VF2 A;  2OCE A;  1WLJ A;  3F9K A;  1JLA A;  5FPM A;  4OPH A;  3EE9 A;  1ZC6 A;  3LM2 A;  4NCB A;  3KLI A;  4FJ8 A;  1HKG A;  1KXP A;  3H45 C;  1TL3 A;  3VTH A;  5KPR A;  3TTF A;  2OTL N;  3Q7C A;  4FWR A;  1QSL A;  3VQB A;  1X3M A;  4FVM A;  3PV8 A;  4KH5 A;  2KFZ A;  1NGA A;  1YIJ N;  4FLU A;  1VQN N;  1BQM A;  4BRA A;  4JD2 A;  3VQ7 A;  4CZL A;  1SKW A;  4H0V B;  3MXI A;  1DEJ A;  4IOA L;  4CVN E;  3TTD A;  3DXK A;  3QIC A;  4LH4 A;  3DAW A;  3WXK A;  4B9M A;  3VTI A;  1HQU A;  3V9W A;  1RT3 A;  1FXX A;  3AO5 A;  4MO4 A;  3ZX3 A;  4B9V A;  4CJW A;  1VQ6 N;  1XMO K;  4BRM A;  2I7P A;  5DM7 L;  4UQG A;  3QBX A;  1L5U A;  5JIC A;  5JLF A;  1D9F A;  5CY4 A;  3NF9 A;  3M8S A;  3AA3 A;  4KPY A;  4KKO A;  3VES A;  1P8Z A;  1QQM A;  1GLF O;  5JS1 A;  3TSU A;  2Q2R A;  1E4F T;  3R9P A;  3K5O A;  1TKT A;  3QLH A;  1L3T A;  1S1U A;  4J2A A;  4PQU A;  3NFA A;  4CJQ A;  3CET A;  4GNI A;  3O3H A;  1DLO A;  3SYZ A;  1T6D A;  1ASV A;  3LDS A;  3OYE A;  1CXQ A;  3G25 A;  3C6U A;  2IVN A;  3CQ8 A;  2A1R A;  1GOB A;  3OYI A;  3MXM A;  4F4K A;  1VSK A;  3P4I A;  1H1V A;  4KHS A;  5AQP A;  1VQM N;  3DWL A;  3VF6 A;  1WBB A;  3HPH A;  3LWM A;  3R3L A;  1TK5 A;  5FPD A;  4JI5 K;  4FXD A;  1OH5 A;  1WSH A;  2HOE A;  2HHH K;  3AO3 A;  3ZT4 A;  1NGE A;  4BWJ A;  3HPO A;  3HSC A;  4CIE A;  4DMN A;  4GVE A;  1JLF A;  1X9S A;  3WXI A;  4C8O A;  3KK7 A;  3NF8 A;  4I9L A;  4IOX A;  4CEO A;  3VQC A;  4E7H A;  4HCC A;  1BIU A;  1RBV A;  3SV3 A;  3DXK B;  4CEF A;  4LF8 K;  3QB0 A;  4CZH A;  3OYG A;  3BZC A;  2E20 A;  4FJ7 A;  3WEE B;  3WXJ A;  2DFF A;  3WEE A;  4KHN A;  2PYL A;  3VN5 A;  5GIN A;  1CLQ A;  4EZ9 A;  1X9J A;  4M7X A;  4DQS A;  3SPZ A;  2YHX A;  2G8H A;  4CZI A;  4Z0U A;  4RCH A;  4CJS A;  2G8U A;  3VEV A;  4CES A;  3QIN A;  2KTQ A;  3CPW M;  1BI4 A;  2KFN A;  3O1W A;  1K9M O;  1U45 A;  1WN7 A;  4CHZ A;  3HT3 A;  3I0S A;  2XHB A;  4AHR A;  4Q0B A;  1JLG A;  2A41 A;  2D5R A;  2BH1 A;  1TVR A;  3BDP A;  4B1U B;  2Q0U A;  2D0P A;  2P9P A;  2P5O A;  1UAX A;  2E2N A;  2IDO A;  3BUZ B;  3KK1 A;  1VQP N;  4OLB A;  2VQE K;  3EE8 A;  3IKM A;  2Z1G A;  1JXE A;  1YXQ A;  1VQO N;  3CC4 N;  2YI1 A;  3ZSZ A;  4A2B A;  1J6Z A;  3VQ4 A;  3V81 A;  4B3R K;  2EHG A;  3SK3 A;  3CME N;  3KK2 A;  1YI2 N;  2F8S A;  2IVP A;  1IV0 A;  5C0Y A;  2CGJ A;  4DQP A;  5ELZ A;  4JAX A;  2HHV A;  4O5F A;  4AHC A;  4B1W B;  2RHK A;  4DTR A;  1VSF A;  1M1K O;  2ZD1 A;  1GLA G;  4JHD A;  3WNG A;  4JHD B;  3A0I X;  3DYA A;  4PL7 A;  2YKN A;  1TV6 A;  4WE1 A;  4RW8 A;  5AQY A;  4BC5 A;  5HRP A;  3HXM A;  3MN6 A;  3H08 A;  3HZ6 A;  1TYQ A;  3PLA A;  1BL3 A;  3PIP L;  2O8E B;  1RDU A;  3I55 N;  3L2Q A;  1NGC A;  4NO7 A;  2O8F A;  4DV2 K;  3BP8 A;  3LDQ A;  4CEB A;  4CD1 A;  3SQ2 A;  3H1Q A;  4M3U A;  3F2K A;  1T6C A;  2FXU A;  3PX0 A;  1OVY A;  5KGX A;  3AVA A;  3JS6 A;  1WAJ A;  3CCU N;  3I33 A;  3G4S N;  4KHP K;  4KHU A;  4DSI A;  1NGJ A;  2XRI A;  2PAV A;  4A59 A;  1SL0 A;  3AA4 A;  2O4G A;  5C15 A;  4DV5 K;  3SUP A;  3TI0 A;  4BE0 A;  1NWK A;  3NH0 A;  2FBT A;  1J54 A;  3FE1 A;  3J81 O;  4J8F A;  5TKY A;  2ZJR L;  1J5E K;  2FBV A;  4DR5 K;  1HNX K;  3QFP A;  3AVJ A;  2QWM A;  2W41 A;  4DR6 K;  4RWT A;  4AM7 A;  4JI1 K;  2FF3 B;  1N36 K;  4FJN A;  3DLH A;  4O0J A;  3VQ5 A;  5HRN A;  2DPN A;  3NDK A;  1C0U A;  1VSI A;  3WQT A;  2VWB A;  3AGK A;  3ENH A;  3ZT0 A;  4DTN A;  1I3A A;  2GEM A;  1EX4 A;  1Z05 A;  1XC3 A;  4FWQ A;  1BCO A;  3U6F A;  2ZGY A;  5SZT A;  4BDP A;  2NZT A;  5KPT A;  2GWJ A;  3FZK A;  4KHQ A;  2RF2 A;  3CFR A;  1SL2 A;  5I3U A;  4B3M K;  3THY A;  1QHT A;  2YJF A;  2PBD A;  4OLA A;  1JCF A;  4CF0 A;  2CGK A;  4F9O A;  3R1X A;  5AQO A;  3CYM A;  5M1Q A;  3LPU A;  3E9O A;  4PKI A;  4FJ5 A;  4DR2 K;  1BU6 O;  3U3Y A;  2Q0R A;  3VGL A;  1IH7 A;  1HPM A;  1DT9 A;  4BRL A;  3ID8 A;  4IDH A;  1WSG A;  3E1Y A;  3O4Q A;  5GAG P;  4ZTF A;  1N33 K;  3L2R A;  2OPP A;  4F2S A;  3ENO A;  4MLE A;  2D1K A;  2PFU A;  3AVI A;  3EN9 A;  5AFU H;  3HP6 A;  2YHW A;  3ZSX A;  3GL1 A;  1NJW A;  3CC7 N;  3OW2 M;  3RR7 A;  2E88 A;  1NM1 A;  2P9I A;  2CGL A;  3OHR A;  4KRE A;  1VQ9 N;  2P9L A;  3MN9 A;  3O8M A;  4H4O A;  2P9N A;  3A5O C;  1TYQ B;  4DSJ A;  1WSF A;  3VOV A;  1IO2 A;  1HKB A;  2ZWH A;  1E4G T;  2E4L A;  5HRS A;  3K5L A;  3L0Q A;  1LAV A;  3BGR A;  3TR8 A;  2R7Y A;  2F9W A;  4JLH A;  1EWQ A;  1HYS A;  4X64 K;  3K5N A;  5KGW A;  4M3W A;  5KTQ A;  4EHU A;  4DR3 K;  3SQ1 A;  2HW3 A;  3IRX A;  1N6Q A;  4QCL A;  1WUA A;  3HM8 A;  4JI2 K;  4A61 A;  3OBY A;  3THY B;  1NK7 A;  1RT2 A;  1NBW A;  2A1S A;  2UUA K;  2UYT A;  2QTD A;  4DV7 K;  4B8A B;  4ID5 A;  3WUH A;  3F5T A;  1LW2 A;  4CF9 A;  1BIS A;  5HL7 L;  3SUQ A;  3Q7B A;  4BC4 A;  3UIQ A;  5AR0 A;  2HHT A;  5AQK A;  3KD5 E;  1RT5 A;  5C2D A;  4JI3 K;  4PWD A;  1Y97 A;  2OPS A;  2X74 A;  1W9H A;  1SZ2 A;  3LL3 A;  3NAE A;  4B1Z A;  4R5P A;  3H3N O;  2Q36 A;  1GOA A;  1RDB A;  3NMU A;  4W5Q A;  3ISN C;  5C10 A;  1N34 K;  4LF7 K;  4CJ4 A;  2IC3 A;  4FLV A;  1IG9 A;  1DTQ A;  4KFB A;  3CCQ N;  3MN7 A;  4IJN A;  4WF9 L;  1NG9 A;  4M3Z A;  2ATQ A;  2GBZ A;  2VG7 A;  1LWF A;  1RBR A;  1DGK N;  3FZM A;  3TSP A;  5MLC Q;  3O4W A;  3CFP A;  3QEX A;  4FK4 A;  2P9L B;  4NYF A;  1SUQ A;  1TGO A;  4KHW A;  4CJV A;  3P39 A;  3OBW A;  1UWB A;  5CYM A;  2P5G A;  4JKC A;  2B4J A;  4DKW A;  1KC8 O;  1V4S A;  2D0A A;  3RTV A;  3QBW A;  1HUX A;  2QKB A;  3QEP A;  3OYK A;  4FLX A;  4BR7 A;  4JS4 A;  4JKG A;  2O8D B;  1T3V A;  2Q1N A;  4DV1 K;  4NXN K;  1XHZ A;  1GLE G;  1HMV A;  3SUO A;  4OX9 K;  1S5J A;  3KKS A;  3NVK A;  5AQN A;  1ATS A;  2FLO A;  2VGN A;  4Z4G A;  3GBT A;  1VQ5 N;  3CCL N;  1T7P A;  3LPT A;  2E6L A;  3OYA A;  4CJP A;  3VGM A;  3VQE A;  4DQ8 A;  3AY9 A;  4EHT A;  4FSV A;  3TAG A;  4FK0 A;  3T69 A;  3HOS A;  2BDP A;  5BRH A;  4DV4 K;  1FK9 A;  2P9S A;  2QEX N;  1XNQ K;  2HF4 A;  1Z26 A;  1RGI A;  5J2Q A;  1S1W A;  4FCY A;  4H0O A;  4F2R A;  3ZSR A;  3V1Q A;  1FKO A;  3AV9 A;  1D5A A;  2UUC K;  3C95 A;  3BZK A;  4AHV A;  4V19 S;  3T19 A;  3K9J A;  3PY8 A;  4LFA K;  4A2A A;  4W5O A;  1VQ4 N;  1NMD A;  2Q31 A;  4ICL A;  4XH4 A;  5FPE A;  3F9M A;  3EO3 A;  1SL1 A;  4FJX A;  4KHY A;  3CJA A;  5D3G A;  4FZX C;  1VSJ A;  5HBM A;  4LY7 A;  1EET A;  4M63 C;  4O5B A;  1VQL N;  1NK4 A;  4FJ9 A;  3CER A;  4B1V A;  2OPR A;  5A2Q O;  4NLC A;  4IJA A;  1QHA A;  5BPN A;  2HST A;  5AJ3 K;  1Q9X A;  1JLC A;  3THW B;  3TAB A;  2NRV A;  3G0Z A;  1QE1 A;  3A5M C;  2BAN A;  5M1O A;  1OH8 A;  1ESV A;  5M1F A;  1YAG A;  3VEN A;  4E1M A;  3AVM A;  2ASM A;  3HL8 A;  1DTT A;  4X66 K;  4CFA A;  2E8A A;  5HLF A;  1JLB A;  3CIP A;  4CBW A;  2P51 A;  4FJG A;  1MU2 A;  2LSN A;  1CZB A;  4CCH A;  3QEV A;  3NH2 A;  4LF4 K;  2CH5 A;  1QSS A;  4ELT A;  1IBM K;  4CJE A;  1K8K B;  1RT7 A;  3GG4 A;  2OZS A;  4N47 A;  1TL1 A;  1HLU A;  3VEW A;  2QXF A;  4CED A;  3EYZ A;  3M8P A;  3NHG A;  2P9S B;  1ILY A;  4B9N A;  4CGI A;  1W2B M;  4BDY A;  4DFM A;  1QVG M;  3CHW A;  3M6G A;  1B92 A;  3C6T A;  3L3U A;  4LC9 B;  4JKE A;  1C1C A;  1ATR A;  1WSI A;  3MEC A;  2ASP A;  2X6N A;  2D0B A;  3AO2 A;  4B8C A;  3DXM A;  5JMV A;  4I6M B;  4B3O A;  1YTA A;  3N4P A;  1VRU A;  4CF8 A;  4IOC L;  3TPQ A;  3G71 N;  4DTX A;  4JKG B;  1BG3 A;  3B8A X;  5JVH L;  2KQ2 A;  1D9D A;  4CHP A;  1YVU A;  4AIL C;  1VRT A;  4HUE A;  3BF1 A;  4O44 A;  3DLK A;  4FLW A;  3LDP A;  3QIP A;  3CPE A;  4YOX A;  4W5T A;  4N41 A;  1RBU A;  3IMX A;  4O0I A;  3C65 A;  1BO5 O;  1HJR A;  2YX6 A;  4KI6 A;  3BF3 A;  1VQ7 N;  2YHB A;  3QNO A;  2E2Q A;  3MX5 A;  1NJX A;  3HPG A;  3WXL A;  3VEO A;  1X9W A;  1U2V A;  1KTQ A;  3VGK A;  4ISG A;  3K9K A;  2QWQ A;  5CHI A;  5H1S Q;  2WC9 A;  4DUZ K;  4K8Z A;  2HHW A;  4O4G A;  4DV0 K;  3IG1 A;  3WNH A;  2PYJ A;  2YCH A;  3V1R A;  1UOC A;  1C1B A;  5GAH P;  3NGZ A;  1I94 K;  1XHX A;  3NE6 A;  1ZBH A;  4BR5 A;  2YNI A;  3O9S A;  4FLZ A;  1JJ2 M;  1L3U A;  2OZM A;  3VEZ A;  3ZET B;  1D8Y A;  1ZBS A;  2F7T A;  3A5N C;  4CJF A; 
#chains in the Genus database with same CATH homology
 3MN6 A;  1Q82 O;  3HRG A;  3HZ6 A;  3D6R A;  3L4Q A;  3HI0 A;  4ILH A;  3H6E A;  1TYQ A;  3PLA A;  3PIP L;  3A8Y A;  3J7Z O;  1RDU A;  1NJI O;  2NRT A;  3NVM A;  3LDN A;  2VCP A;  4O8K A;  4OPA A;  2V7Y A;  1NGC A;  3P38 A;  4NO7 A;  1R59 O;  3HBT A;  5CE3 A;  1YIT N;  1M90 O;  3BP8 A;  3LDQ A;  4BRN A;  1LCU A;  3CCR N;  4BR2 A;  2H3G X;  4H0X B;  3UE5 A;  1YJN N;  4CD1 A;  3H1Q A;  4GV6 A;  1MA9 B;  3F2K A;  1T6C A;  2FXU A;  1OVY A;  3FZL A;  4WQ5 A;  4BC3 A;  4BRK A;  5AZI A;  3ZEU A;  3SAF A;  4UY8 O;  3JS6 A;  3CCU N;  2OTJ N;  3I33 A;  3AAR A;  1GLL O;  3EKU A;  3G4S N;  3LDO A;  5M1N A;  4BR4 A;  1NGJ A;  5EY4 A;  5GAD P;  2KLA A;  2PAV A;  1NGH A;  4WYB A;  3JXU A;  4A59 A;  5EOY A;  3QML A;  1S22 A;  3C7N B;  4HWI A;  4BQZ A;  2WFB A;  5C15 A;  1NLV A;  3C7N A;  3DLL L;  2Q97 A;  5AQW A;  3CCE N;  1NWK A;  4GV9 A;  4A5B A;  3BEX A;  3FE1 A;  4J8F A;  5TKY A;  2ZJR L;  3VET A;  3VF4 A;  4PKG A;  1QQO A;  4AF1 A;  3CJ9 A;  4XH5 A;  3QFP A;  3VER A;  2QWM A;  3FGU A;  1KAZ A;  2W41 A;  2NRR A;  3P31 A;  4RWT A;  4AM7 A;  5LJW A;  2FF3 B;  4B1X B;  4H5N A;  1MWM A;  4FPA A;  5M1P A;  2DPN A;  5M1K A;  3WQT A;  3R6M A;  2VWB A;  3KWG A;  4KH6 A;  3MMV A;  3AGK A;  5JVG L;  4C23 A;  4YOW A;  3ENH A;  5F2R A;  3VEY A;  2P9U A;  1VAZ A;  2D4W A;  2GEM A;  2YJE A;  1Z05 A;  4JNE A;  3CCM N;  1SQK A;  1XC3 A;  5BN8 A;  4FWQ A;  3E9P A;  1N8R O;  2NLX A;  2ZGY A;  4U67 L;  5KQ8 A;  2HBK A;  5C12 A;  4BC2 A;  2NZT A;  5KPT A;  2VYP A;  2GWJ A;  2J4R A;  3FZK A;  4CBU A;  3O9R A;  4H5R A;  2NRX A;  2EWS A;  1G99 A;  1QQN A;  2PBD A;  2YJF A;  4IO9 L;  4JN4 A;  3AAQ A;  2QW9 A;  1JCF A;  4FWN A;  2CGK A;  2QI2 A;  3H46 O;  1GLC G;  4F9O A;  4CD3 A;  3R1X A;  4ISF A;  5AQO A;  3CJ1 A;  5M1Q A;  4BRC A;  2BTF A;  3ZYY X;  5AQZ A;  1C0F A;  3E9O A;  1K8A O;  1QZ6 A;  4CZE A;  3SMP A;  2JWL A;  4PKI A;  4YOT A;  2E1Z A;  3H3O B;  1BU6 O;  4K42 A;  5AQJ A;  4EAH D;  1YHQ N;  2Q0R A;  3VGL A;  3CJC A;  4ISE A;  1Q86 O;  3MN5 A;  4Z94 A;  4JKA A;  5AQQ A;  1HPM A;  3C6H A;  1DT9 A;  4FWP A;  4A5A A;  4BRL A;  2VGM A;  3ID8 A;  2W40 A;  4IDH A;  4BRD A;  3CJB A;  5F0X A;  2NRZ A;  3RVC A;  3E1Y A;  4H5V A;  1XQS C;  5GAG P;  1VQ8 N;  5AQH A;  5AQM A;  4MDB A;  4DHY A;  2P9K B;  4WFN L;  1GLJ O;  2P9K A;  3MX2 A;  3O9U A;  1IG8 A;  3IUC A;  1BDG A;  2QM1 A;  2E2P A;  3A5L C;  3ENO A;  4MLE A;  5DM6 L;  1NGI A;  3SAH A;  3ATU A;  2D1K A;  1BA0 A;  2PFU A;  3EN9 A;  1D4X A;  4IO8 A;  5FPN A;  5AFU H;  2QWR A;  4IFE A;  4Y0W A;  1S72 N;  3WXM B;  4FL9 A;  2YHW A;  4BR9 A;  3GL1 A;  2QA4 N;  2CH6 A;  2FSK A;  4MDA A;  3EL2 A;  3CMA N;  1WOQ A;  4MO5 A;  4FWL A;  3CC7 N;  5B8H A;  3ID6 A;  5AZJ A;  3OW2 M;  2E88 A;  1NM1 A;  2P9I A;  2CGL A;  3OHR A;  1HX1 A;  1SS6 A;  3FLC O;  4FWK A;  2P9L A;  4K43 A;  4QS7 A;  2IIR A;  3UKR B;  3MN9 A;  1VQ9 N;  4BY9 C;  3CCV N;  3O8M A;  2GTD A;  2NNW A;  2P9N A;  3I8B A;  3ULE B;  1CZA N;  3A5O C;  5BN9 A;  5GIO A;  3ULE A;  1TYQ B;  1NGF A;  2QWL A;  4GV3 A;  3U8X A;  4JKF A;  3VOV A;  3M1F A;  4WQ4 A;  3U4L A;  1RFQ A;  1HKB A;  2QXL A;  2ZWH A;  1E4G T;  4CJ7 A;  3FZF A;  4FWM A;  4QS9 A;  3E66 A;  1OKJ A;  3CI5 A;  5AFU A;  4I6M A;  3L0Q A;  4AM6 A;  4BVO A;  2GWK A;  2P9U B;  2F9W A;  1JCG A;  2E1Y A;  4EFH A;  4CZJ A;  5LY3 A;  2NRH A;  3MWP A;  2FSJ A;  2YHY A;  3IDH A;  3QFU A;  3W0L A;  5AQV A;  5E26 A;  2FF6 A;  5JLH A;  4EHU A;  2ASO A;  3O9T A;  3T7Z A;  1WUA A;  3HM8 A;  3O6W A;  1Q18 A;  2AP1 A;  3OBY A;  3QDK A;  4A61 A;  1TUU A;  4XH1 A;  4WQ4 C;  5AQU A;  2V52 B;  3GE1 A;  4BRH A;  1NBW A;  1ZXO A;  3L6Q A;  4FOE A;  4BVP A;  1BWF O;  1NGB A;  2UYT A;  5AQS A;  2QTD A;  5AQI A;  4JK7 A;  3TTC A;  5EX5 A;  3GDQ A;  3WUH A;  3F5T A;  3CXC M;  1W97 L;  4RTF D;  3O80 A;  3KWI A;  4XEI A;  2A5X A;  5HL7 L;  4BRQ A;  1YJ9 N;  3Q7B A;  1U2V B;  1XUP O;  3ATV A;  5AR0 A;  4BC4 A;  5KQD A;  2KHO A;  3E9L A;  4BRI A;  3O1B A;  4E1J A;  5AQK A;  1YJW N;  4BG9 A;  4H03 B;  3CJ7 A;  5C2D A;  3C6A A;  2ZGZ A;  4A62 A;  5C2F A;  1SZ2 A;  3LL3 A;  4B1Z A;  2RE2 A;  3MCA B;  1KQS M;  1Y64 A;  1HJO A;  5GIP A;  3GOI A;  1O13 A;  3H3N O;  3H1V X;  2V7Z A;  4BRF A;  4KBO A;  2Q36 A;  3CCS N;  4B9Q A;  2JWK A;  3NMU A;  3I55 N;  5C10 A;  2ZF5 O;  4FWO A;  4JKB A;  4JKD A;  5TKW A;  3EZW A;  1T44 A;  3KVG A;  2HF3 A;  3ZX0 A;  3CCQ N;  1KAX A;  3FR0 A;  4HTL A;  4PKH A;  4KH4 A;  3SJH A;  3ZX2 A;  1VQK N;  3MN7 A;  4IJN A;  2A40 A;  2QWN A;  4WF9 L;  1Q7Y O;  2NRW A;  4CBX A;  5KPZ A;  4H5W A;  1QZ5 A;  5BPL A;  3O9Q A;  2HBJ A;  4FPB A;  1X3N A;  4WFA L;  3VEX A;  1DGK N;  3FZM A;  3TSP A;  5AQR A;  3O4W A;  5MLC Q;  3UKR A;  2OAN A;  2P9L B;  1KD1 O;  5EVZ A;  3PIO L;  1BA1 A;  2I7N A;  3W3D A;  3P39 A;  3OBW A;  3KZB A;  4PHT X;  4BGA A;  4FO0 A;  2A6A A;  3HOT A;  4JKC A;  3VF2 A;  2BUP A;  4DKW A;  1KC8 O;  1V4S A;  4NB4 A;  3HTV A;  3L4I A;  4DCH A;  5BR9 A;  3TU5 A;  3QBW A;  5FPM A;  1HUX A;  4OPH A;  3EE9 A;  1ZC6 A;  3LM2 A;  4YOR A;  4BR7 A;  3G6E N;  4JKG A;  1T3V A;  3N4Q A;  1HKG A;  1KXP A;  2Q1N A;  3S41 A;  3H45 C;  4PL8 A;  1GLD G;  3VTH A;  1TUY A;  5KPR A;  1GLE G;  2A3Z A;  3TTF A;  3I56 N;  3D2F A;  2OTL N;  1YF5 L;  3NVK A;  5AQN A;  3Q7C A;  1ATS A;  4FWR A;  2FLO A;  3SLC A;  3UB5 A;  5BRE A;  1YUW A;  5ADX A;  2VGN A;  5HOO A;  4K25 A;  3GBT A;  1X3M A;  1VQ5 N;  3CCL N;  4JK9 A;  4WFB L;  2QWO A;  2F9T A;  4KH5 A;  1NGA A;  3TSQ A;  1YIJ N;  1VQN N;  1MDU B;  4K41 A;  4WQ5 C;  3VGM A;  3CF5 L;  2A42 A;  4DQ8 A;  3AY9 A;  4IEE A;  2QWP A;  4FSV A;  4JD2 A;  4JK8 A;  4BRA A;  4CZL A;  4EHT A;  3T69 A;  4BR0 A;  3HOS A;  4H0V B;  5BRH A;  1DEJ A;  5AQF A;  1QVF M;  2P9S A;  2QEX N;  2WBN A;  4IOA L;  2HF4 A;  3DXK A;  3QIC A;  3TTD A;  1RGI A;  3WXK A;  3DAW A;  3U9Z A;  3VTI A;  4H0O A;  1C0G A;  3IFR A;  5CR4 A;  2P9N B;  4MO4 A;  5AQT A;  3ZX3 A;  4BRG A;  1VQ6 N;  4BRM A;  1YVN A;  2I7P A;  3K9J A;  3UKU B;  5DM7 L;  4CZF A;  2GX9 A;  3QBX A;  4WCE L;  4A2A A;  5JIC A;  1EO1 A;  5JLF A;  3DXM B;  1VQ4 N;  1ATN A;  4BG8 A;  1NMD A;  2Q31 A;  4XH4 A;  3VES A;  1P8Z A;  1QQM A;  4CZG A;  3F9M A;  5FPE A;  3EO3 A;  4BRE A;  1GLF O;  2Q2R A;  1E4F T;  4M7Y A;  3CJA A;  3MWT A;  3R9P A;  3TSU A;  3D7E O;  3D2E B;  4M63 C;  4U7B A;  1VQL N;  3CER A;  4B1V A;  2ZJQ L;  4GY2 B;  4NLC A;  4IJA A;  1QHA A;  5BPN A;  2HST A;  3CET A;  4GNI A;  4QS8 A;  3R8E A;  3CCJ N;  2NRV A;  4YOV A;  1T6D A;  4BRO A;  1BOT O;  3A5M C;  5BPM A;  5M1O A;  1EQY A;  3G25 A;  1ESV A;  2KKZ A;  5M1F A;  1NGD A;  1YAG A;  1P90 A;  2IVN A;  3VEN A;  2ASM A;  5GAE P;  5EXW A;  3KHY A;  4H0P A;  3P4I A;  3ENB A;  4A57 A;  1H1V A;  5I9E B;  2E8A A;  4IEI A;  5AQP A;  1VQM N;  3CIP A;  3DWL A;  4CBW A;  3VF6 A;  4ILG B;  2V51 B;  5E84 A;  4IZ9 A;  3R3L A;  4FVU A;  5FPD A;  3MDQ A;  2HMP A;  4CZK A;  2HOE A;  2ITM A;  2CH5 A;  1MWK A;  1U6Z A;  3OA9 A;  1NGE A;  1K8K B;  4NLB A;  3HSC A;  4GVE A;  5AQG A;  5BRD A;  3WXI A;  3GG4 A;  3KK7 A;  3LDL A;  4B1Y B;  4IOX A;  4BRP A;  1HLU A;  3VEW A;  4YOY A;  2IVO A;  4C1N K;  4H0T B;  3J8A A;  3CD6 N;  3O5B A;  4JD2 B;  2HBM A;  3ZET A;  3U9D A;  2P9S B;  1ILY A;  3FFK B;  4YDU C;  3DXK B;  4JKH A;  5AZJ B;  2P9I B;  3QB0 A;  5AQX A;  1W2B M;  1QVG M;  3CHW A;  4CZH A;  3M6G A;  2E20 A;  3MCP A;  3WQU A;  2ZJP L;  4LC9 B;  3SBT A;  3O08 A;  4JKE A;  3WEE B;  3WXJ A;  4O8U A;  1ATR A;  3WEE A;  4R79 A;  2ASP A;  3AGR A;  3LM9 A;  4YDU A;  5ADX H;  3M3Z A;  5GIN A;  1X9J A;  1BUP A;  4M7X A;  2WUS A;  3DXM A;  5JMV A;  4I6M B;  2YHX A;  3C0B A;  4CZI A;  3N4P A;  4RCH A;  3DJC A;  4EIA A;  3TPQ A;  4IOC L;  5F1X A;  5LJV A;  4G9Z A;  2D0O A;  3CQY A;  4JKG B;  1BG3 A;  3VEV A;  3G71 N;  4YOU A;  3CC2 N;  3FZH A;  3CPW M;  3B8A X;  3O1W A;  5JVH L;  1K9M O;  3M5R A;  4BGB A;  1JCE A;  5AZI B;  3ZEU B;  1NGG A;  1Z6R A;  4H5T A;  3BF1 A;  3D2F B;  1LOT B;  1GLB G;  1RDW X;  3LDP A;  4YOX A;  2A41 A;  3CPE A;  5BRF A;  2BH1 A;  3IMX A;  1SAZ A;  3RSE B;  3C65 A;  2Q0U A;  2FSN A;  1BO5 O;  3RSE A;  4B1U B;  2D0P A;  2YX6 A;  3CQX A;  2P9P A;  3VPZ A;  2P9P B;  3BF3 A;  4JEP A;  1VQ7 N;  2E2N A;  1KAY A;  4DB3 A;  1S3X A;  2E2Q A;  3BUZ B;  3MX5 A;  4OO1 J;  1V4T A;  1VQP N;  3WXL A;  3VEO A;  3EE8 A;  3IKM A;  4FWS A;  1U2V A;  2GEL A;  4ISG A;  3K9K A;  2GUP A;  2QWQ A;  3AAP A;  3VGK A;  4CI6 A;  3SAG A;  1YXQ A;  5CHI A;  4IXC A;  5H1S Q;  2WC9 A;  1VQO N;  3CC4 N;  2YI1 A;  4L3Q A;  4A2B A;  4FOI A;  4H0Y B;  2E2O A;  1J6Z A;  2YCH A;  3SK3 A;  3CME N;  5GAH P;  3UKU A;  1YI2 N;  2IVP A;  1Q81 O;  5C0Y A;  1K8K A;  2CGJ A;  4BC5 A;  5ELZ A;  4JAX A;  4O5F A;  4B1W B;  2RHK A;  4MLH A;  5AQL A;  4BR5 A;  1M1K O;  2AA4 A;  3VMF B;  3O9S A;  4C1N I;  4CZM A;  1JJ2 M;  1GLA G;  4JHD A;  3MK6 A;  4ILJ A;  3SBG A;  1HKC A;  4JHD B;  3VEZ A;  3SMS A;  3WT0 A;  3D2E A;  1K73 O;  3ZET B;  3A0I X;  4PL7 A;  1ZBS A;  1IJJ A;  4BQL A;  3EKS A;  5AQY A;  2F7T A;  1DKG D;  3A5N C;  4IWV A;  2HBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...