3C6HA

Crystal structure of the rb49 gp17 nuclease domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
196
structure length
182
Chain Sequence
b'LSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSDYHALQIIDITEFPYKQVAVYHSNTTSHFILPDIVFKYLMMYNECPVYIELNSTGVSIAKSLAMDLEYDNIICDSFIDLGMKQSKRSKAMGCSALKDLIEKDKLIINHKGTIQELRTFSEKFHDDLVMSLVIFGWLTTQEKFAEYAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Terminase large subunit
publication title The structure of the phage T4 DNA packaging motor suggests a mechanism dependent on electrostatic forces.
pubmed doi rcsb
source organism Enterobacteria phage rb49
molecule tags Viral protein
total genus 57
structure length 182
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3c6hA00
3CPEA 4IFEA 4IDHA 5M1OA 5C2FA 5C15A 5C10A 5C12A 5M1NA 4IEEA 4IEIA 5M1PA 5M1QA 5M1FA 5C2DA 3C6HA 5M1KA 3C6AA
chains in the Genus database with same CATH superfamily
4IOAL 2P51A 3AVHA 1L3TA 2YHXA 1D9DA 2OPQA 1U48A 3G4SN 1RT4A 3RRGA 1X9WA 4LF6K 2HNZA 4KO0A 1C1AA 3QB0A 4NXMK 4CEQA 4B9SA 3QICA 3DRSA 4BQLA 4JI0K 2NRWA 5E84A 2VWJA 3QEPA 2XY8A 3QIPA 4M3RA 2UU9K 1JXBA 5M1KA 1C0GA 3ZX3A 3CJCA 4FJMA 3NMUA 2UXCK 4WE1A 5AQWA 3SUPA 3RVCA 5A2QO 1YUWA 4CW7B 4RW4A 3BEXA 3HXMA 2D0CA 1RTIA 3S3NA 1OH8A 3ZETB 4JKAA 3K5NA 3IUCA 5AZJA 2Q97A 4JKBA 3P39A 4FZXC 1I94K 1NMDA 2G8WA 1SZ2A 4CEEA 1IG8A 2HBJA 1WNSA 3QEXA 2Q2RA 3LM9A 4Y0WA 4FLTA 3J7AP 3QERA 3DLLL 3FE1A 4M3WA 5HP1A 4BR5A 4LF8K 2RPIA 1NWKA 4NB4A 3SAHA 4CHPA 4Y1CA 3KLHA 3M5RA 4K25A 1YJWN 4C8NA 1S9EA 1D5AA 3UKUA 4DQQA 3NFAA 2DFHA 4M7YA 4DMNA 1KC8O 3KK1A 3EYZA 1JLBA 4E7LA 1NGIA 2P1JA 3U9ZA 4BRIA 2CGKA 3C94A 2KLAA 2HW3A 2UUBK 2WC9A 3MWTA 2P9SA 3AA2A 3H45C 3K5LA 4IFYA 4PA1A 4DTSA 4DFKA 4DV5K 2P9IA 3TTCA 3VENA 2Q3SA 2RHKA 5E26A 3AVMA 4M45A 1RFQA 2O4IA 4CZFA 1QSLA 3F9KA 5FPDA 4IG0A 4YY3K 1VQ4N 4CBXA 5SWMA 3SNNA 3LP3A 5ELZA 4F2RA 1XMOK 4WFBL 1D9FA 5FRMA 4B1VA 4FLXA 4E89A 3TAGA 1ASWA 3ZSWA 2ZM6K 3L4QA 3MXIA 1UWBA 2YHYA 3WUHA 4QS9A 4E7KA 4BE2A 4DSFA 4PL8A 2DY4A 4H5TA 4DTPA 3K57A 3W3DA 3KWIA 4NLBA 4GKJK 1QZ6A 3G25A 3I8BA 4H0PA 1U47A 1VQPN 1RDCA 4AHUA 4Z4EA 1VSEA 5JVGL 4IG3A 1NKBA 3HRGA 2QI2A 4RW9A 1W7AA 4NCBA 4MQ3A 1YHQN 3CXCM 4JD2A 4DB3A 4EFHA 1X3NA 1ZXOA 1YVUA 5DM7L 3ZETA 3LAKA 1Q7YO 4FM0A 4CGGA 4CHNA 1VSLA 4A59A 5M1FA 2ZF5O 3VQ6A 3O5BA 5SZTA 2IOCA 2HHUA 4BR9A 1E3MA 3A5OC 5AR0A 4OPHA 5LL6Z 4I9LA 3LZIA 4BC3A 3WXJA 3SUOA 1QHAA 2Z1HA 3OYDA 4FLYA 1GLAG 3NF8A 2G8FA 1VSHA 1BHLA 3SYZA 4DSJA 2VGMA 3WXKA 5C24A 4XH4A 1K73O 1EO1A 1TKDA 4FJGA 5GADP 1HYSA 4PWDA 2F7TA 1EETA 1RDWX 1RT3A 2O8CB 1QS4A 1EWRA 1ZYQA 1S1UA 3CPEA 3LDNA 4H4MA 1NK7A 2VG7A 3PIOL 1OKJA 5AQQA 4CIFA 4NCGA 2P9NA 3F9MA 2QK9A 3ZX2A 4CGFA 1O1WA 2KHOA 2O8EB 2I5JA 1YTUA 1K8KB 1IBLK 2G8HA 1XQSC 3K9JA 2JLEA 5GIOA 4K8XA 4CJEA 4DV3K 4KTQA 5AQOA 3V1QA 4XEIA 4W5TA 3SJJA 4W5QA 2QWPA 4C8KA 1FJGK 4G1QA 1EQYA 1QE1A 4HUGA 4AM6A 4Z4FA 3FR0A 2KW4A 2X78A 3SPYA 3QMLA 4J2BA 3TANA 4CIEA 1VQMN 2B5JA 2J4RA 3OYNA 3VQBA 1ZBIA 3VF4A 4B3SK 3F2KA 1BU6O 4PUOA 2YHBA 3AGRA 1KSPA 4KH5A 4FW2A 4DU3A 3T7ZA 3OA9A 1P90A 3T1YK 1NGFA 4YDUA 4FJLA 1NK8A 3S3MA 1DTTA 3GE1A 4DTJA 4KHWA 1YT3A 4QS7A 2EWSA 3E66A 5AQIA 3QO9A 2P5OA 3FZHA 4KREA 3ZSYA 2P9LA 4X66K 1NJXA 4BDZA 5AFUH 4KV8A 3SBGA 2FBTA 4V19S 1N36K 4KB1A 3IFRA 2UXDK 1MDUB 5I9EB 4DV1K 3DLEA 4X64K 4QOZB 4PQUA 3OVNA 4A61A 5AZIB 3L2QA 4JKHA 1D8YA 3D2EB 3H3NO 5TKWA 5BRHA 1LWFA 1HNZK 4CJ3A 3F73A 5LY3A 1QSYA 1B92A 3R9PA 4CEZA 4W5RA 5HOOA 3CMAN 4GKKK 4C8MA 3ZT4A 3LDQA 2D4WA 2YJEA 4FK0A 1QQMA 2F8SA 4M63C 4JKDA 3DLBA 3MWPA 3BDPA 4OGEA 4DV7K 4EHTA 3QEIA 4E7JA 3R8EA 2X6SA 4N76A 1WLJA 1RBRA 3V9SA 4N41A 4FWKA 2GUIA 4J2AA 3D2FB 3CFRA 4OGCA 3VQPA 2E88A 2O8CA 4K8ZA 4EHUA 2QXLA 4GV6A 3Q7BA 4WQ4A 2LSNA 2KFZA 3AO5A 1C1BA 1YTAA 1RNHA 4IKFA 4L8RB 3VQDA 1D4XA 4CZLA 1LV5A 5BRFA 1C0TA 4FJ5A 1K8KA 3C0BA 4GVMA 4E1NA 2IVPA 3PIPL 3DLHA 3PO5A 2A5XA 3MEDA 4ISFA 4QCLA 4I7FA 3ZSQA 1SQKA 4H0TB 4DWIA 1QSSA 3EL2A 1XHXA 1VQ6N 3ZEUA 4IJAA 3U6FA 2O8DB 4BG9A 4IXCA 2CGLA 1VQON 1T03A 4JI3K 2KZMA 5CZ1A 3BP8A 2Y1IA 4CHZA 2WTUA 3VQ5A 2FSNA 3WXIA 3D7EO 4C1NI 1YI2N 1TKXA 4DUYK 4DLEA 4BRCA 4O44A 1EP4A 2OA8A 3NVKA 4FK4A 3NVMA 2NUBA 1Q18A 3EZWA 3SK3A 4H0VB 3M8PA 1U04A 1BA0A 3TTDA 1C0FA 4IEIA 3V9UA 4EZ9A 4Y1DA 3O3FA 4JKCA 4OKEA 1MU2A 1IH7A 4HTLA 4BRMA 1UA1A 3WEEA 2WFBA 1MWKA 3TAQA 4CBUA 4BRDA 3L2RA 2RN2A 2WOMA 4JS5A 3CERA 4TSXA 1JKHA 1N32K 2QXFA 3CCEN 1TV6A 4KH4A 2NRZA 4O8UA 3KKSA 5AQSA 4AM7A 4X65K 1S1XA 3CI5A 4NO7A 4Z0UA 2F8TA 1KAYA 3AV9A 4A2AA 1N5YA 2HMIA 3FLCO 4EIAA 2HNDA 5EY4A 3EKSA 3I0RA 3HP6A 3FFKB 4C8OA 2Q1NA 3R3LA 1S6PA 4YNQA 4IOCL 4RTFD 2O4GA 2JWLA 4FWSA 3AARA 4C1NK 2OCEA 2P9KA 3CQYA 1S72N 4JI2K 3HO1A 4M3XA 4FLWA 2QKBA 2YNFA 4RCHA 1RTDA 3TAMA 3NF9A 4KHSA 4B3MK 3UE5A 2FC0A 3DXMB 4KKOA 4B9TA 4IO9L 5AZJB 3HOSA 1OH7A 1L5UA 3D2FA 3V81A 2PZSA 2ZGZA 4PKGA 1GLCG 3FFIA 4CJLA 4DTNA 2E20A 4FM1A 1JL2A 4GV3A 4FLZA 5FRNA 2D0BA 3ITHA 1K6YA 3CC2N 5ADXA 5BREA 3NAEA 1WOQA 4FVMA 5AQKA 4HUEA 3WQUA 1KAZA 3AO4A 4DTXA 1KXPA 4H03B 4DTUA 1Z6RA 2HVHA 5HRPA 3K58A 1YITN 2W41A 4FJ9A 4F9OA 3NHGA 1HUXA 4BGAA 4FK2A 3ZLJA 1Q82O 2OTLN 2PFUA 1HQEA 2A1SA 4CF2A 2F4VK 2O8DA 3D6RA 4FZZA 3OY9A 1U45A 1JLEA 4J2EA 3R6MA 1IBKK 3ZSOA 1TVRA 2Q0UA 4FWPA 3P38A 2A1RA 4CFCA 4DSEA 3L4IA 1L3SA 4MLEA 4KTZA 3RTVA 1VRUA 4H5NA 1NJWA 3CG7A 1HR0K 4WFAL 3V9ZA 3KIOA 4BY9C 1FXXA 3I0SA 4FZYA 1CZAN 3MXJA 2I7PA 3NH1A 1J5OA 2KQ2A 3PO4A 4CECA 2QW9A 4PY5A 2BTFA 3AAQA 4BRAA 1TL1A 2V7YA 4DQSA 4ILGB 2YV0X 3QEVA 1ATNA 2DPNA 3OS1A 2A3ZA 4KHYA 3DRRA 4QAGA 3SQ2A 1YJNN 4CZGA 3BZKA 3CCMN 5M1QA 1TKTA 3VTIA 2RF2A 4DHYA 1HLUA 3IKMA 4CJTA 3P5JA 1BCMA 2BANA 2E1YA 3O4QA 4A2BA 1B9DA 2OPSA 4CIGA 3MK6A 2GTDA 1REVA 3VGMA 4JNEA 4DKWA 3C95A 3NE6A 2P9PB 4H8KA 1I3AA 3LDSA 3HOTA 2X6NA 3V6DA 4WQ5C 4MLHA 1Q81O 2GWJA 1TK5A 2E1ZA 3VQ8A 3VQ7A 5DMRA 4JD2B 4JI1K 3ZT0A 4MO5A 4F3TA 3NH0A 2XY7A 3DXMA 3WXLA 3QINA 4CGHA 2FSJA 4FPAA 4CJRA 3QFPA 2GUPA 3CJ7A 3O9QA 1KLNA 3O9UA 5HBMA 4O0IA 1Q9YA 1IO2A 2YNHA 1N6QA 2O8BB 3CCJN 5H1SQ 3DM2A 3QIOA 4LF9K 4AQYK 2UYTA 4U7BA 3RMAA 1JXEA 2BE2A 3CJBA 4DCHA 4CK2A 4DQ8A 1VQKN 4IZ9A 4DQIA 5AQJA 2AJQA 1EX4A 3CETA 1BIUA 1JCGA 1OVQA 1XNRK 1UOCA 3MN7A 2NNWA 4W5NA 4CGIA 3V1RA 4CK3A 4DR4K 4WCEL 1BDGA 4H5WA 1OH6A 2VCPA 4ZTFA 2P9NB 4RW6A 5HRNA 4WF9L 1N34K 3T1HK 1L3VA 1VSJA 3VMFB 4DUZK 3O4WA 1W9HA 4YORA 5KPRA 2QA4N 3SUQA 1BIZA 4CK1A 2IIRA 2D0OA 4O8KA 4FOIA 4AH9A 4PHTX 1X9MA 4FPBA 3HBTA 3ENBA 1F21A 1VRTA 2Q36A 3T69A 5AQFA 5CR4A 3DJCA 4YOWA 2YJFA 4BACA 4MFBA 1R0AA 5C42A 2A41A 3O08A 4CJQA 1TAUA 4JKEA 1RT5A 3VQCA 4DTOA 1VQLN 2FBXA 3H1VX 2P9UA 1TYQB 4FYDA 3O9RA 3VQEA 3UKRA 4ZTJA 4B1XB 5AQYA 3J80O 2E6LA 1T6CA 5FLXO 4GV9A 3H46O 5J2NA 1NOYA 3IMXA 1U49A 3AVLA 4DFMA 1Z25A 2YNIA 1WAFA 2P9LB 2ZQBA 3HI0A 3P83D 3LDPA 3CCRN 1DGKN 4CF0A 4LFAK 2HF3A 3KD5E 3QBWA 4I2PA 2ZJPL 2P9PA 4CD3A 1M1KO 3CM6A 2XHBA 1YJ9N 3IDHA 2DTUA 1ASUA 3ZT2A 1BQMA 4LF5K 1HYVA 1JLAA 4BC5A 3SZ2A 4CD1A 4LC9B 2Z1JA 2CGJA 2HHSA 1XMQK 4BR7A 1SL2A 3ZSZA 5HL7L 2D1KA 1BGXT 3SPZA 1KVBA 2F96A 2KKZA 4H5VA 4BGBA 1QZ5A 3VGKA 3C65A 3HT3A 1QTMA 4EZ6A 1CXUA 2O8BA 4DU4A 1ZBHA 4CJUA 3KJVA 3TR8A 1G99A 3AVKA 3AVGA 1N8RO 3KK7A 4I6MB 3CHWA 3KZBA 4CGJA 3WXMB 2UXBK 3AO2A 2FLOA 2F9WA 1LOTB 4HCCA 1CXQA 4BWJA 5AQHA 4F2SA 2RKIA 4OKKA 5EX5A 1ZBFA 3QDKA 1TUUA 3Q7CA 1BQNA 3CCLN 3U4LA 1DEJA 2GV9A 1HNVA 3HSCA 2AP1A 2YKMA 4JS4A 4JK9A 3ZYYX 5I3UA 1ILYA 4OO1J 1J54A 2VYPA 1ZBUA 1LCUA 5FPNA 3QNOA 5E41A 3FGUA 1XNQK 1BISA 4FL9A 1NK4A 3CF5L 3RSEB 3M8RA 4NYFA 4F8RA 3O1WA 3ENHA 1GOCA 4K43A 3T3FA 4ISEA 1JCEA 3B6PA 4KBOA 1NGJA 4R5PA 1X1PA 3ZEUB 1NGAA 1WB9A 2BUPA 2HHTA 4JKGA 1S6QA 3BUZB 3V9XA 2Q0RA 3AVCA 4DV2K 1BI4B 1ITGA 3PUFA 4Q5VA 4MDBA 3NGYA 2EX3A 1VSDA 1RCHA 1ZC6A 1VAZA 3JXUA 2W42A 1NGCA 3HSTB 3PX0A 1TYQA 4M7XA 3EY1A 4GMJB 3THYB 3TSPA 4Z4CA 3E01A 3OYJA 3LALA 4CF9A 1W2BM 1NK0A 3E9PA 2FF3B 2ATQA 3H6EA 1IJJA 4CZIA 1WAJA 4IFVA 1FW6A 4I9QA 2HNYA 4BR2A 2GBZA 3OYMA 3WEEB 3CC4N 3V9WA 3LP1A 4CF1A 2GWKA 2ZWHA 4JN4A 5DM6L 3SJHA 3F5TA 1M90O 2BDPA 4CJPA 1KVAA 4E19A 3EEQA 3LDOA 3ULEB 4PKIA 4JHDA 5AQMA 3VEWA 1KVCA 1HJOA 4CERA 1Q8IA 4LF7K 3LPTA 2G8IA 4JEPA 5KRSA 4BC4A 4BRKA 3C7NB 1KD1O 5BR9A 4M3UA 4DSLA 2V51B 4B1ZA 3I33A 4CZKA 3WNHA 1RILA 2P9KB 1KFDA 1WSFA 4A57A 2HHQA 5AQLA 3HP9A 3BZCA 3WT0A 2ZE2A 4I6MA 2X74A 1RDDA 3A8YA 4H0OA 4JYAK 1P8ZA 2E2QA 3CCSN 3RRHA 4ISGA 4CFDA 5JLHA 3KHYA 3V4IA 4Z4GA 3HPHA 3EZ5A 4F4KA 1E4FT 2OZSA 3PLAA 2IC3A 2NRHA 4FJIA 4FWOA 1SS6A 4FJNA 1RBVA 1KCFA 2GELA 3DOKA 3AVAA 4JI6K 4CJVA 1HNWK 4DFPA 1GOAA 4MO4A 1YXQA 5EU7A 5JMVA 4M3TA 5CYQA 2QTDA 5HRSA 5KGXA 4KAZA 4A5BA 2WBNA 3QETA 2VWKA 3HTVA 3RSEA 3K59A 1ZBSA 1JLQA 3DLKA 4O5FA 3K5OA 3TSQA 4NXNK 3HM8A 5C15A 1CLQA 3CFOA 2XY5A 2HOEA 3CQXA 3ZT3A 1J9AA 2OYQA 4CZJA 1Y97A 2NRTA 3NCIA 3TAFA 3TAEA 1BI4A 1MA9B 4B9QA 4DU1A 4BRHA 4BDPA 4OJRA 4GY2B 4FLVA 3OYEA 3JAMO 3DWLA 2V52B 2JWKA 5J2QA 1WSEA 1SUQA 3NGZA 4DS4A 2ZJRL 3VQQA 3THYA 1RBUA 1NJYA 1HPZA 4F3OA 4W5OA 1RGIA 4AHVA 5AQGA 2FF6A 1K9MO 5GAHP 4BRNA 1XI1A 4B3OA 5I42A 1UAXA 3W0LA 5C2FA 2ZJQL 3ISNC 4WQ5A 4J2DA 2E2PA 3UB5A 4NCAA 2QWLA 1FKPA 3SI6A 4AHSA 4K41A 1BCOA 3QFUA 2G8UA 4FWNA 4FM2A 1JL1A 5C0YA 3VQAA 3PY8A 4DQPA 3WQTA 4B3TK 3ULEA 4BR0A 4BE0A 3I8DA 5BPLA 3ZX0A 3J7ZO 3LANA 4I2QA 4CEFA 2ASOA 4DV6K 4DG1A 3C7NA 5AJ3K 3HK2A 3KK2A 2PBDA 3PSFA 1HKBA 3DXKB 1OH5A 2Z1IA 3THXB 3AVNA 1T05A 4E7HA 4ID1A 4H4OA 1S1WA 3O80A 3DAWA 3OYGA 2UUCK 5KTQA 5C25A 2YX6A 3DYAA 2O8FB 4CJFA 2H3GX 3K9KA 4HTUA 4JRQA 1O13A 1GLDG 1G15A 1TAQA 3KLEA 5CYMA 3AA5X 1VQ7N 3VF6A 3MN9A 1HX1A 3VTHA 3LP0A 4LSNA 5AQTA 1J6ZA 2OZMA 4KPYA 1NGBA 3AO3A 4A62A 1IKYA 3MN6A 4FO0A 3A2FA 1S3XA 5DK5A 4CEBA 5K14A 4BRFA 2VG5A 5GAGP 3HYFA 4DR2K 3PX6A 3JSMA 3SUNA 5TKYA 4E1MA 4DR5K 1DT9A 5BN8A 4N47A 1WSGA 1LAVA 1Z05A 3O8MA 4BG8A 3ID8A 5CY4A 3VEVA 1LAWA 5AQNA 1B9FA 4KFBA 1VQ5N 1SL0A 3GDQA 1RT2A 3D0PA 2IS3A 2CH5A 1VSIA 3VEXA 4CHQA 3A5MC 4IWVA 3L0QA 4DR3K 1IKVA 4M3ZA 1VQNN 5HROA 1GOBA 4AHRA 5EXWA 2PYLA 1IKWA 5M1PA 1E4GT 3IRXA 4FWRA 3OYHA 3OBWA 4HCBA 4DSKA 3NBPA 3SV4A 3VQ9A 1IV0A 4CJ7A 1XWLA 4MDAA 5CHIA 4CESA 1YF5L 3FZLA 1NK5A 1R59O 3L3VA 4WYBA 4WFNL 3P31A 4WQ4C 4CVNE 1NNEA 2QWNA 5FPEA 3ZSRA 2E6MA 3U3GA 1RBTA 3AO1A 4CJ4A 1HMVA 3N4PA 4BE1A 2G8VA 2FSKA 3B8AX 3HZ6A 2ITMA 4JI7K 2P9UB 4YOYA 3DI6A 3I56N 3QEWA 3UKRB 4N56A 4DTRA 2D5RA 3AVBA 5ADXH 4XH1A 5AQRA 5CE3A 3CC7N 4FWLA 5JICA 5BN9A 1VSKA 4FVUA 3HJFA 3L2VA 5KGWA 2HHXA 1I39A 3VEOA 1DLOA 4IBNA 3DXKA 1KLMA 3RR7A 4JI8K 1UA0A 5FPMA 4CFBA 1VQ9N 4FW1A 4HHTA 4CJWA 4DFJA 3THXA 1RBSA 3NF6A 3RMCA 2Y1JA 3C6UA 3WNEA 3HVTA 1ZBLA 3TU5A 3FZFA 3KLFA 3L2WA 1X9JA 5M1OA 3DMJA 2GX9A 3PV8A 3MAQA 3MMVA 3O9TA 3DOLA 2E2OA 4BVOA 4OKJA 4FJJA 2O8FA 1IG9A 5BRDA 3A0IX 2Q31A 4R79A 3RR8A 1XC3A 4CZHA 1ATRA 1GLEG 1NKEA 4BWMA 3MCAB 2VGNA 5J2MA 4YOTA 3VOVA 1HQUA 3O9SA 3KK3A 2QWMA 1S1TA 3OYIA 1RDAA 3AVIA 3G0ZA 3OYAA 4CEAA 4LFCK 2D0PA 3EKUA 3GL1A 4H0XB 1CZ9A 1L3UA 4LH4A 4IO8A 3MX2A 2YHWA 5LJWA 3G71N 1JJ2M 1WSHA 3RMDA 3QLHA 4B1UB 4KHUA 3NDKA 3K5MA 1HNIA 3C6HA 3MXMA 4ILJA 3AGKA 4FJ8A 4ID5A 3FZMA 5MLCQ 3NGIA 3A5NC 4IOXA 4LF4K 4FJKA 4RG8A 3P4IA 3CQ8A 2QM1A 1LWCA 4KTWA 1NKCA 2ZD1A 4B9NA 2BGGA 4CJKA 1HPMA 2ETJA 3QNNA 5AQZA 4KB0A 4OPKA 3MEEA 3IG1A 2ITGA 1SAZA 4DF4A 3AVJA 1JLCA 3LL3A 2DFEA 3EE9A 1VK0A 1W97L 4JKGB 3H08A 2W40A 4K0KK 4B9MA 2B4JA 2I7NA 2HSTA 4JI4K 1J53A 1RDBA 1T44A 4Z94A 3JS6A 5JVHL 1T8EA 4CEOA 3L2UA 4LSLA 4BREA 3ALYA 5LJVA 4Q0BA 4JKFA 2IAJA 2IVNA 1KTQA 3O4NA 4ELUA 3AA4A 4B1WB 4G9ZA 1NG9A 3VEZA 4DLGA 3HVRA 1BO5O 5F1XA 5F2RA 4IFEA 1S22A 3O3HA 4H0YB 3THWB 5KPZA 3L3UA 1BL3A 2PY5A 3LP2A 4M42A 3ID6A 3LM2A 3OJSA 3VQ4A 4H5RA 3KLIA 2GEMA 3VN5A 1TKZA 4ELTA 1SL1A 4LH5A 1WN7A 3S9HA 4DS5A 4FLUA 3CMEN 4FJHA 5LMUK 1GLBG 4B3RK 4ILHA 4DR6K 4JHDB 3TI0A 1J5EK 1RTHA 5T7BA 3LAMA 4LFBK 3QESA 2NZTA 3SQ4A 4BQZA 4FWQA 3CCQN 1ASVA 4KI4A 2ASMA 3L6QA 1DKGD 3D45A 1BUPA 2P5GA 4KHPK 1V4SA 3LWLA 2HHHK 1NMNA 3SAFA 2VQFK 1CZBA 3ULDA 1WBDA 2FBYA 1ATSA 5M1NA 4DTMA 1SKRA 4UY8O 3J8AA 2E4LA 3BF1A 1GLFO 1VHXA 3KKRA 4YOUA 4FJ7A 3MCPA 1NBWA 3KVGA 5FROA 2E8AA 5CZ2A 3AA3A 2YI1A 3CIPA 5JS2A 4KHQA 1YAGA 3VERA 5AFUA 1TGOA 2A6AA 1A5WA 1BG3A 4HVJA 1U4BA 3GBTA 3KWGA 3SMPA 3OW2M 3UIQA 3VEYA 2PAVA 4B08A 1X9SA 4O5BA 3WNGA 4E0DA 1KFSA 2DFFA 4PL7A 2XO7A 1NLVA 2FXUA 3ZCMA 1Q86O 5IT9O 3SLCA 3OYKA 4YOVA 2QWRA 1T6DA 1LW0A 5AQUA 5JS1A 1MWMA 4N5SA 1T3VA 4J8FA 4AILC 4CZEA 3JYTA 2NRVA 3TAPA 5GAEP 2YHAA 4OVLA 3OYLA 2OTJN 3BF3A 2KZZA 4E3SA 1C0MA 3A5LC 1C1CA 1KAXA 2KFNA 2YNGA 3C6AA 4FSVA 3S41A 2HBMA 3THVA 4DSIA 3E1YA 1NOZA 1DTQA 3U8XA 4GNIA 1W0HA 4JV5K 4CGDA 1U6ZA 1SKSA 1EWQA 3THWA 4CI6A 5D3GA 4OLAA 4DV4K 3QBXA 1QVGM 1HRHA 1NGGA 1IBMK 3CFPA 1GLLO 1YIJN 1QQCA 3OTOK 3M1FA 4XH5A 4DR7K 4YOXA 3K0SA 1Y64A 2IVOA 4DR1K 4EAHD 3R1XA 4CHOA 3S3OA 4A5AA 2IGIA 5GINA 3U9DA 2XY6A 2W6KA 2NRXA 4KRFA 4BRLA 5KI6A 2OPPA 3T19A 3MN5A 1QQNA 2BH1A 3DRPA 4JAXA 4GW6A 1JLGA 4CZMA 4ZHRA 3B6OA 4IDHA 4DF8A 3O3GA 1QHTA 2EHGA 3SCXA 1A5XA 4YFUA 2YCHA 3TTFA 3OYCA 1QQOA 3ASMA 1RT6A 3H1QA 3ATUA 3ZT1A 4AF1A 1VSMA 2VWBA 4B9UA 1ESVA 2A40A 4B8AB 4FOEA 4BRPA 4O55A 2E5LK 2OANA 5AQXA 3M8QA 4RW8A 1HYZA 3ENOA 4CBWA 1T7PA 4M3YA 3HM9A 3J81O 2HHVA 2E2NA 4K42A 3NF7A 1XHZA 5J1EA 5HLFA 4Z4IA 1X3MA 1OVYA 4O4GA 4ELVA 4ICLA 1XUPO 1JLFA 3O6WA 4FXDA 1H1VA 1U2VB 1A5VA 4FWMA 3KLGA 4AHTA 3IAYA 2HHWA 2O8EA 3HL8A 3LWMA 2QWOA 2PYJA 3MECA 2WUSA 4FCYA 2W6LA 1K8AO 3TARA 4NLCA 2ASPA 3LDLA 4Z4HA 2QEXN 3I55N 3SQ0A 3OBYA 3M8SA 3J7YP 3OHRA 2A42A 2B6AA 2IDOA 5C10A 5GIPA 4IJNA 3OYFA 4B1YB 4CE9A 1NGHA 2D0AA 4DV0K 1TL3A 3HPOA 5EVZA 2YKNA 4OPAA 1RDUA 3KD1E 3VA3A 1YVNA 1HKCA 3CCUN 1GLJO 4NYNA 3BY5A 2NLXA 1RTJA 3MX5A 1C6VA 1NM1A 4RW7A 4E7IA 1NGDA 3L8BA 1WBBA 2UUAK 4AHCA 5BPNA 3SBTA 3IS9A 3EN9A 4X62K 3E9OA 1NJZA 2HBLA 4B8CA 5AQPA 3FZKA 3VA0A 3AVFA 3PSIA 1HKGA 2OPRA 5JLFA 4BC2A 3VF2A 3SQ1A 4UQGA 4C8LA 2AA4A 4BVPA 1Q9XA 3AAPA 3TWHA 4L3QA 1TK8A 2G8KA 2Z1GA 3VESA 4BR4A 2VQEK 4B9LA 3HPGA 4KI6A 4JK8A 4XIUA 4YHHK 1RT7A 4BRGA 5IWAK 4HUFA 1TUYA 3CYMA 5F0XA 4BROA 4KH6A 5AZIA 3NH2A 2ZGYA 3OJUA 1SV5A 4YDUC 3O1BA 3D2EA 4LD0A 1FKOA 1HNXK 4LY7A 4M41A 2F9TA 2HMPA 3MEGA 1S5JA 3CCVN 4QS8A 5KRTA 3P1GA 2WONA 5KQDA 3T1AA 1QVFM 3EO3A 1BA1A 3G10A 3CM5A 4CF8A 4RWTA 1RT1A 3V1OA 3LZJA 3K2PA 2RE2A 4HWIA 1VSFA 5BPMA 3SMSA 5C2DA 3M3ZA 5KQ8A 4CFAA 3ZSXA 2R7YA 2V7ZA 4JLHA 4OX9K 4CHYA 3GOIA 2QWQA 3CJ1A 1XC9A 1V4TA 3EE8A 3C6TA 5FDLA 3RWUA 4C23A 1BOTO 5KPTA 5BR8K 5J2PA 1WSIA 3CJ9A 1U2VA 5LMNK 3SV3A 1WUAA 4U67L 3TSUA 4IEEA 3M6GA 1NK6A 4EP4A 1S1VA 1S9GA 4DQRA 1NU0A 3MDQA 3DLGA 1NGEA 4KHNA 5AQVA 3DLRA 1WSJA 4CJSA 4GVEA 4IDKA 3UKUB 1NJIO 4CCHA 1IKXA 3TABA 1HJRA 1N33K 4PKHA 4CJ5A 1NK9A 3KTQA 4E1JA 4OPJA 4B9VA 1VQ8N 5C12A 2VG6A 2HBKA 3VPZA 5B8HA 1KQSM 2CH6A 3BGRA 1BWFO 3VETA 1KRPA 4FJXA 3AY9A 3OYBA 3OS0A 2HB5A 4JI5K 3ZSVA 3N4QA 2KTQA 2HF4A 1LWEA 2FBVA 5EOYA 3VGLA 2P9SB 4JK7A 3GG4A 1JCFA 3RMBA 3CJAA 2P9IB 3E9LA 5HRRA 4BDYA 2QKKA 3LPUA 3G6EN 3H3OB 3PX4A 3OS2A 3TPQA 4EP5A 1LW2A 2XRIA 1SKWA 2HVIA 1EKEA 3CPWM 3CD6N 4JRPA 1TK0A 4OLBA 3WNFA 2JGUA 4O0JA 3U3YA 3ATVA 4BRQA 1FK9A 2NRRA 3SAGA 1EXQA 1C0UA 4CEDA 1Z26A
chains in the Genus database with same CATH topology
4IOAL 3SJHA 2YHXA 4KH4A 2NRZA 3F5TA 4O8UA 1M90O 3G4SN 3CMEN 5AQSA 4AM7A 3LDOA 3CI5A 1GLBG 4NO7A 4ILHA 4JHDA 4PKIA 1KAYA 3ULEB 5AQMA 3VEWA 4A2AA 4JHDB 3QB0A 3FLCO 4EIAA 5EY4A 1HJOA 3EKSA 3QICA 4BQLA 3FFKB 2NZTA 2Q1NA 3R3LA 2NRWA 4JEPA 5E84A 4BQZA 4FWQA 4BC4A 4BRKA 3C7NB 3CCQN 1KD1O 4IOCL 4RTFD 5BR9A 2ASMA 2JWLA 4FWSA 2V51B 3L6QA 3AARA 1DKGD 3I33A 4B1ZA 1C0GA 3ZX3A 2P9KA 4C1NK 3CJCA 3CQYA 4CZKA 5M1KA 1S72N 3NMUA 2P9KB 1BUPA 1V4SA 4A57A 5AQWA 3SAFA 3RVCA 1YUWA 5AQLA 4RCHA 3BEXA 1ATSA 3WT0A 5M1NA 4UY8O 3J8AA 4I6MA 3UE5A 3A8YA 3BF1A 3DXMB 3ZETB 4JKAA 4H0OA 3IUCA 1GLFO 5AZJA 4IO9L 1P8ZA 2E2QA 5AZJB 4YOUA 2Q97A 3HOSA 3CCSN 4JKBA 4ISGA 5JLHA 3KHYA 3P39A 3D2FA 2ZGZA 4PKGA 1NMDA 1GLCG 2E20A 1SZ2A 3MCPA 1E4FT 4GV3A 3PLAA 1NBWA 1IG8A 2HBJA 2NRHA 4FWOA 1SS6A 3CC2N 5ADXA 3KVGA 2Q2RA 2GELA 5BREA 3LM9A 4Y0WA 2E8AA 1WOQA 5AQKA 3WQUA 3DLLL 2YI1A 1KAZA 3CIPA 3FE1A 1KXPA 4BR5A 4H03B 4MO4A 1VQ8N 1Z6RA 1NWKA 1YAGA 1YXQA 4NB4A 3SAHA 3VERA 5AFUA 5JMVA 3M5RA 2QTDA 1YITN 2A6AA 4K25A 1YJWN 2W41A 4A5BA 2WBNA 1BG3A 4F9OA 3GBTA 3KWGA 3SMPA 1HUXA 3OW2M 3HTVA 3RSEA 3VEYA 2PAVA 3UKUA 4BGAA 1ZBSA 4M7YA 4O5FA 3TSQA 1Q82O 2OTLN 3HM8A 5C15A 2PFUA 1KC8O 4PL7A 3D6RA 2HOEA 1NLVA 2FXUA 3CQXA 1Q86O 1NGIA 3SLCA 4YOVA 2QWRA 3U9ZA 1T6DA 4BRIA 2CGKA 4CZJA 2NRTA 2KLAA 5AQUA 3R6MA 1MA9B 1MWMA 2WC9A 4B9QA 2Q0UA 1T3VA 3MWTA 4J8FA 4BRHA 4FWPA 3P38A 4GY2B 2P9SA 4CZEA 3DWLA 2NRVA 3L4IA 3H45C 2V52B 5GAEP 2JWKA 4MLEA 2P9IA 2OTJN 3BF3A 4H5NA 3TTCA 4WFAL 2ZJRL 4BY9C 3A5LC 3VENA 1KAXA 1CZAN 2RHKA 5E26A 1RGIA 1RFQA 3C6AA 2FF6A 2HBMA 4FSVA 5AQGA 3S41A 4CZFA 1K9MO 5GAHP 2I7PA 3E1YA 4BRNA 5FPDA 3U8XA 4GNIA 1U6ZA 3W0LA 5C2FA 2ZJQL 2QW9A 1VQ4N 4WQ5A 4CBXA 5ELZA 2E2PA 3UB5A 2BTFA 2QWLA 3AAQA 4BRAA 4CI6A 4WFBL 2V7YA 3QBXA 4ILGB 4K41A 1ATNA 2DPNA 2A3ZA 4B1VA 3QFUA 1YJNN 1QVGM 4CZGA 3L4QA 1NGGA 4FWNA 5C0YA 1GLLO 3CCMN 1YIJN 2YHYA 5M1QA 3WUHA 3VTIA 3WQTA 3ULEA 3M1FA 4XH5A 4BR0A 4DHYA 4YOXA 4QS9A 5BPLA 1Y64A 1HLUA 3IKMA 4PL8A 3ZX0A 2IVOA 3J7ZO 2E1YA 4H5TA 3W3DA 4A2BA 3KWIA 2ASOA 4NLBA 4EAHD 3MK6A 1QZ6A 3R1XA 2GTDA 3G25A 3I8BA 4H0PA 3VGMA 4A5AA 3C7NA 4JNEA 5GINA 2PBDA 1VQPN 4DKWA 1HKBA 3U9DA 3DXKB 2P9PB 2NRXA 5JVGL 4BRLA 3HOTA 3HRGA 3MN5A 1QQNA 2BH1A 4WQ5C 4JAXA 4MLHA 1Q81O 2GWJA 4CZMA 2E1ZA 2QI2A 3O80A 3DAWA 4IDHA 1YHQN 3CXCM 4JD2A 4DB3A 4EFHA 1X3NA 2YX6A 4JD2B 3CCEN 4MO5A 1ZXOA 5DM7L 3DXMA 2H3GX 3ZETA 3K9KA 1Q7YO 2YCHA 3WXLA 1O13A 2FSJA 3TTFA 4FPAA 4A59A 1GLDG 5M1FA 3QFPA 1QQOA 2GUPA 2ZF5O 3CJ7A 3O9QA 3H1QA 3O5BA 3ATUA 1VQ7N 3O9UA 3VF6A 3MN9A 1HX1A 4AF1A 1N8RO 2VWBA 3VTHA 4BR9A 1ESVA 2A40A 5AQTA 3A5OC 5AR0A 1J6ZA 3CCJN 5H1SQ 4FOEA 4OPHA 4BRPA 2UYTA 4BC3A 3WXJA 1NGBA 1QHAA 4A62A 4U7BA 3MN6A 2OANA 1GLAG 4FO0A 5AQXA 1S3XA 3CJBA 4DCHA 4BRFA 2VGMA 4DQ8A 3ENOA 4CBWA 5GAGP 1VQKN 4IZ9A 3WXKA 5AQJA 3CETA 2E2NA 4K42A 1JCGA 4XH4A 1DT9A 5TKYA 5BN8A 1K73O 1EO1A 4BG8A 1Z05A 3MN7A 3O8MA 3ID8A 2NNWA 5GADP 3VEVA 5AQNA 1X3MA 2F7TA 1RDWX 1OVYA 1VQ5N 3GDQA 1XUPO 3LDNA 3CPEA 1BDGA 4WCEL 3O6WA 3PIOL 1H1VA 1U2VB 2CH5A 4H5WA 1OKJA 5AQQA 3VEXA 3A5MC 2VCPA 2P9NA 3L0QA 3F9MA 4IWVA 4FWMA 1VQNN 2P9NB 5EXWA 3ZX2A 5M1PA 2KHOA 2QWOA 4WF9L 2WUSA 1K8AO 1K8KB 4NLCA 2ASPA 1XQSC 1E4GT 3LDLA 3VMFB 4FWRA 3K9JA 5GIOA 3O4WA 4YORA 5KPRA 2QA4N 3I55N 2QEXN 3OBWA 5AQOA 4XEIA 3OBYA 2IIRA 2D0OA 2QWPA 4FOIA 4O8KA 4PHTX 3OHRA 1EQYA 3HBTA 4FPBA 2A42A 4CJ7A 3ENBA 4AM6A 3FR0A 4MDAA 3QMLA 5C10A 5GIPA 2Q36A 5CHIA 3T69A 1YF5L 3FZLA 1VQMN 4IJNA 5AQFA 2J4RA 5CR4A 4B1YB 1R59O 3DJCA 1NGHA 3VF4A 4YOWA 3F2KA 5EVZA 1BU6O 4WYBA 2YJFA 3P31A 4WFNL 4OPAA 1RDUA 4WQ4C 1YVNA 1HKCA 3CCUN 1GLJO 2QWNA 3AGRA 2NLXA 4KH5A 3MX5A 1NM1A 5FPEA 2A41A 1NGDA 3O08A 3T7ZA 4JKEA 3OA9A 5BPNA 1P90A 3SBTA 3N4PA 3EN9A 1NGFA 1VQLN 3H1VX 4YDUA 3E9OA 2FSKA 2P9UA 3B8AX 3HZ6A 1TYQB 2HBLA 2P9UB 3O9RA 2ITMA 4YOYA 5AQPA 3UKRA 3FZKA 3I56N 4B1XB 3UKRB 3GE1A 5AQYA 1HKGA 5ADXH 1T6CA 5JLFA 4BC2A 3VF2A 3H46O 4GV9A 4QS7A 2EWSA 3E66A 4XH1A 5AQIA 5AQRA 3IMXA 5CE3A 3CC7N 2AA4A 3FZHA 4FWLA 4BVPA 5JICA 3AAPA 2P9LA 5BN9A 4L3QA 4FVUA 2P9LB 3HI0A 5AFUH 3LDPA 3VESA 1DGKN 4BR4A 3CCRN 3SBGA 2HF3A 3VEOA 3QBWA 3DXKA 3IFRA 4JK8A 2ZJPL 2P9PA 1MDUB 4CD3A 5FPMA 1M1KO 5I9EB 4BRGA 1VQ9N 1TUYA 1YJ9N 3IDHA 5F0XA 4BROA 3TU5A 4KH6A 3FZFA 4A61A 5AZIA 1X9JA 5AZIB 5M1OA 2GX9A 2ZGYA 3MMVA 3O9TA 4JKHA 4BC5A 2E2OA 4BVOA 4LC9B 4CD1A 4YDUC 3O1BA 3D2EA 5BRDA 3A0IX 2CGJA 2Q31A 3D2EB 3H3NO 5TKWA 4R79A 2F9TA 4BR7A 5HL7L 2D1KA 2HMPA 1XC3A 5BRHA 4CZHA 1ATRA 1GLEG 5LY3A 3CCVN 4QS8A 2KKZA 4H5VA 4BGBA 1QZ5A 3MCAB 3R9PA 3VGKA 2VGNA 5HOOA 3C65A 3CMAN 5KQDA 1QVFM 4YOTA 3EO3A 3LDQA 1BA1A 2D4WA 3VOVA 2YJEA 1QQMA 3O9SA 2QWMA 4RWTA 4M63C 4JKDA 1G99A 3MWPA 2RE2A 4HWIA 5BPMA 2D0PA 3SMSA 5C2DA 3EKUA 3GL1A 3KK7A 3M3ZA 4I6MB 4H0XB 3CHWA 4EHTA 3KZBA 5KQ8A 3WXMB 3R8EA 4IO8A 3MX2A 2V7ZA 2FLOA 2F9WA 2YHWA 3GOIA 5LJWA 2QWQA 3CJ1A 4FWKA 3G71N 3D2FB 1V4TA 1LOTB 3EE8A 4B1UB 1JJ2M 5AQHA 2E88A 4C23A 1BOTO 3C6HA 4EHUA 2QXLA 4ILJA 3AGKA 5EX5A 4GV6A 3Q7BA 4WQ4A 5KPTA 1TUUA 3FZMA 3Q7CA 3CJ9A 1U2VA 3QDKA 5MLCQ 3A5NC 4IOXA 3CCLN 3U4LA 1DEJA 1WUAA 1D4XA 4CZLA 3HSCA 2AP1A 3P4IA 4U67L 3TSUA 4IEEA 3M6GA 4JK9A 3ZYYX 5BRFA 1ILYA 2QM1A 2VYPA 4OO1J 1K8KA 1LCUA 3C0BA 5FPNA 1HPMA 2IVPA 3FGUA 3MDQA 3PIPL 2A5XA 5AQZA 4ISFA 1NGEA 1SQKA 4FL9A 4H0TB 5AQVA 3CF5L 4GVEA 3RSEB 3UKUB 1SAZA 1NJIO 3EL2A 4PKHA 4E1JA 3O1WA 3ENHA 1VQ6N 4K43A 4ISEA 3ZEUA 1JCEA 3LL3A 1NGJA 4KBOA 3EE9A 5C12A 3VPZA 2HBKA 1NGAA 4IJAA 3ZEUB 2BUPA 4BG9A 4IXCA 5B8HA 1KQSM 4JKGA 1W97L 4JKGB 2CGLA 3BUZB 2CH6A 1VQON 1BWFO 2W40A 3VETA 2Q0RA 3AY9A 2I7NA 3N4QA 2HSTA 2HF4A 1T44A 4Z94A 3JS6A 4MDBA 5EOYA 3BP8A 2P9SB 4JK7A 3VGLA 3GG4A 5JVHL 2FSNA 3WXIA 1JCFA 3D7EO 4C1NI 1ZC6A 1YI2N 4BREA 1VAZA 3JXUA 3CJAA 2P9IB 3E9LA 4BRCA 1NGCA 5LJVA 4JKFA 2IVNA 1TYQA 4M7XA 3H3OB 3G6EN 3NVKA 3NVMA 3TSPA 3TPQA 4B1WB 1W2BM 1Q18A 3E9PA 3EZWA 2FF3B 4H0VB 3SK3A 3VEZA 4G9ZA 1BA0A 3TTDA 1BO5O 3H6EA 1C0FA 1IJJA 5F2RA 4IEIA 5F1XA 3CPWM 4CZIA 3CD6N 4IFEA 1S22A 4H0YB 4BR2A 4JKCA 5KPZA 4BRMA 4HTLA 3WEEA 2WFBA 1MWKA 3ATVA 4BRQA 4CBUA 3ID6A 3LM2A 3WEEB 4BRDA 2NRRA 4H5RA 3CC4N 3SAGA 2GEMA 2GWKA 3CERA 2ZWHA 4JN4A 5DM6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPE A;  4IFE A;  4IDH A;  5M1O A;  5C2F A;  5C15 A;  5C10 A;  5C12 A;  5M1N A;  4IEE A;  4IEI A;  5M1P A;  5M1Q A;  5M1F A;  5C2D A;  3C6H A;  5M1K A;  3C6A A; 
#chains in the Genus database with same CATH topology
 4IOA L;  2P51 A;  3AVH A;  1L3T A;  2YHX A;  1D9D A;  2OPQ A;  1U48 A;  3G4S N;  1RT4 A;  3RRG A;  1X9W A;  4LF6 K;  2HNZ A;  4KO0 A;  1C1A A;  3QB0 A;  4NXM K;  4CEQ A;  4B9S A;  3QIC A;  3DRS A;  4BQL A;  4JI0 K;  2NRW A;  5E84 A;  2VWJ A;  3QEP A;  2XY8 A;  3QIP A;  4M3R A;  2UU9 K;  1JXB A;  5M1K A;  1C0G A;  3ZX3 A;  3CJC A;  4FJM A;  3NMU A;  2UXC K;  4WE1 A;  5AQW A;  3SUP A;  3RVC A;  5A2Q O;  1YUW A;  4CW7 B;  4RW4 A;  3BEX A;  3HXM A;  2D0C A;  1RTI A;  3S3N A;  1OH8 A;  3ZET B;  4JKA A;  3K5N A;  3IUC A;  5AZJ A;  2Q97 A;  4JKB A;  3P39 A;  4FZX C;  1I94 K;  1NMD A;  2G8W A;  1SZ2 A;  4CEE A;  1IG8 A;  2HBJ A;  1WNS A;  3QEX A;  2Q2R A;  3LM9 A;  4Y0W A;  4FLT A;  3J7A P;  3QER A;  3DLL L;  3FE1 A;  4M3W A;  5HP1 A;  4BR5 A;  4LF8 K;  2RPI A;  1NWK A;  4NB4 A;  3SAH A;  4CHP A;  4Y1C A;  3KLH A;  3M5R A;  4K25 A;  1YJW N;  4C8N A;  1S9E A;  1D5A A;  3UKU A;  4DQQ A;  3NFA A;  2DFH A;  4M7Y A;  4DMN A;  1KC8 O;  3KK1 A;  3EYZ A;  1JLB A;  4E7L A;  1NGI A;  2P1J A;  3U9Z A;  4BRI A;  2CGK A;  3C94 A;  2KLA A;  2HW3 A;  2UUB K;  2WC9 A;  3MWT A;  2P9S A;  3AA2 A;  3H45 C;  3K5L A;  4IFY A;  4PA1 A;  4DTS A;  4DFK A;  4DV5 K;  2P9I A;  3TTC A;  3VEN A;  2Q3S A;  2RHK A;  5E26 A;  3AVM A;  4M45 A;  1RFQ A;  2O4I A;  4CZF A;  1QSL A;  3F9K A;  5FPD A;  4IG0 A;  4YY3 K;  1VQ4 N;  4CBX A;  5SWM A;  3SNN A;  3LP3 A;  5ELZ A;  4F2R A;  1XMO K;  4WFB L;  1D9F A;  5FRM A;  4B1V A;  4FLX A;  4E89 A;  3TAG A;  1ASW A;  3ZSW A;  2ZM6 K;  3L4Q A;  3MXI A;  1UWB A;  2YHY A;  3WUH A;  4QS9 A;  4E7K A;  4BE2 A;  4DSF A;  4PL8 A;  2DY4 A;  4H5T A;  4DTP A;  3K57 A;  3W3D A;  3KWI A;  4NLB A;  4GKJ K;  1QZ6 A;  3G25 A;  3I8B A;  4H0P A;  1U47 A;  1VQP N;  1RDC A;  4AHU A;  4Z4E A;  1VSE A;  5JVG L;  4IG3 A;  1NKB A;  3HRG A;  2QI2 A;  4RW9 A;  1W7A A;  4NCB A;  4MQ3 A;  1YHQ N;  3CXC M;  4JD2 A;  4DB3 A;  4EFH A;  1X3N A;  1ZXO A;  1YVU A;  5DM7 L;  3ZET A;  3LAK A;  1Q7Y O;  4FM0 A;  4CGG A;  4CHN A;  1VSL A;  4A59 A;  5M1F A;  2ZF5 O;  3VQ6 A;  3O5B A;  5SZT A;  2IOC A;  2HHU A;  4BR9 A;  1E3M A;  3A5O C;  5AR0 A;  4OPH A;  5LL6 Z;  4I9L A;  3LZI A;  4BC3 A;  3WXJ A;  3SUO A;  1QHA A;  2Z1H A;  3OYD A;  4FLY A;  1GLA G;  3NF8 A;  2G8F A;  1VSH A;  1BHL A;  3SYZ A;  4DSJ A;  2VGM A;  3WXK A;  5C24 A;  4XH4 A;  1K73 O;  1EO1 A;  1TKD A;  4FJG A;  5GAD P;  1HYS A;  4PWD A;  2F7T A;  1EET A;  1RDW X;  1RT3 A;  2O8C B;  1QS4 A;  1EWR A;  1ZYQ A;  1S1U A;  3CPE A;  3LDN A;  4H4M A;  1NK7 A;  2VG7 A;  3PIO L;  1OKJ A;  5AQQ A;  4CIF A;  4NCG A;  2P9N A;  3F9M A;  2QK9 A;  3ZX2 A;  4CGF A;  1O1W A;  2KHO A;  2O8E B;  2I5J A;  1YTU A;  1K8K B;  1IBL K;  2G8H A;  1XQS C;  3K9J A;  2JLE A;  5GIO A;  4K8X A;  4CJE A;  4DV3 K;  4KTQ A;  5AQO A;  3V1Q A;  4XEI A;  4W5T A;  3SJJ A;  4W5Q A;  2QWP A;  4C8K A;  1FJG K;  4G1Q A;  1EQY A;  1QE1 A;  4HUG A;  4AM6 A;  4Z4F A;  3FR0 A;  2KW4 A;  2X78 A;  3SPY A;  3QML A;  4J2B A;  3TAN A;  4CIE A;  1VQM N;  2B5J A;  2J4R A;  3OYN A;  3VQB A;  1ZBI A;  3VF4 A;  4B3S K;  3F2K A;  1BU6 O;  4PUO A;  2YHB A;  3AGR A;  1KSP A;  4KH5 A;  4FW2 A;  4DU3 A;  3T7Z A;  3OA9 A;  1P90 A;  3T1Y K;  1NGF A;  4YDU A;  4FJL A;  1NK8 A;  3S3M A;  1DTT A;  3GE1 A;  4DTJ A;  4KHW A;  1YT3 A;  4QS7 A;  2EWS A;  3E66 A;  5AQI A;  3QO9 A;  2P5O A;  3FZH A;  4KRE A;  3ZSY A;  2P9L A;  4X66 K;  1NJX A;  4BDZ A;  5AFU H;  4KV8 A;  3SBG A;  2FBT A;  4V19 S;  1N36 K;  4KB1 A;  3IFR A;  2UXD K;  1MDU B;  5I9E B;  4DV1 K;  3DLE A;  4X64 K;  4QOZ B;  4PQU A;  3OVN A;  4A61 A;  5AZI B;  3L2Q A;  4JKH A;  1D8Y A;  3D2E B;  3H3N O;  5TKW A;  5BRH A;  1LWF A;  1HNZ K;  4CJ3 A;  3F73 A;  5LY3 A;  1QSY A;  1B92 A;  3R9P A;  4CEZ A;  4W5R A;  5HOO A;  3CMA N;  4GKK K;  4C8M A;  3ZT4 A;  3LDQ A;  2D4W A;  2YJE A;  4FK0 A;  1QQM A;  2F8S A;  4M63 C;  4JKD A;  3DLB A;  3MWP A;  3BDP A;  4OGE A;  4DV7 K;  4EHT A;  3QEI A;  4E7J A;  3R8E A;  2X6S A;  4N76 A;  1WLJ A;  1RBR A;  3V9S A;  4N41 A;  4FWK A;  2GUI A;  4J2A A;  3D2F B;  3CFR A;  4OGC A;  3VQP A;  2E88 A;  2O8C A;  4K8Z A;  4EHU A;  2QXL A;  4GV6 A;  3Q7B A;  4WQ4 A;  2LSN A;  2KFZ A;  3AO5 A;  1C1B A;  1YTA A;  1RNH A;  4IKF A;  4L8R B;  3VQD A;  1D4X A;  4CZL A;  1LV5 A;  5BRF A;  1C0T A;  4FJ5 A;  1K8K A;  3C0B A;  4GVM A;  4E1N A;  2IVP A;  3PIP L;  3DLH A;  3PO5 A;  2A5X A;  3MED A;  4ISF A;  4QCL A;  4I7F A;  3ZSQ A;  1SQK A;  4H0T B;  4DWI A;  1QSS A;  3EL2 A;  1XHX A;  1VQ6 N;  3ZEU A;  4IJA A;  3U6F A;  2O8D B;  4BG9 A;  4IXC A;  2CGL A;  1VQO N;  1T03 A;  4JI3 K;  2KZM A;  5CZ1 A;  3BP8 A;  2Y1I A;  4CHZ A;  2WTU A;  3VQ5 A;  2FSN A;  3WXI A;  3D7E O;  4C1N I;  1YI2 N;  1TKX A;  4DUY K;  4DLE A;  4BRC A;  4O44 A;  1EP4 A;  2OA8 A;  3NVK A;  4FK4 A;  3NVM A;  2NUB A;  1Q18 A;  3EZW A;  3SK3 A;  4H0V B;  3M8P A;  1U04 A;  1BA0 A;  3TTD A;  1C0F A;  4IEI A;  3V9U A;  4EZ9 A;  4Y1D A;  3O3F A;  4JKC A;  4OKE A;  1MU2 A;  1IH7 A;  4HTL A;  4BRM A;  1UA1 A;  3WEE A;  2WFB A;  1MWK A;  3TAQ A;  4CBU A;  4BRD A;  3L2R A;  2RN2 A;  2WOM A;  4JS5 A;  3CER A;  4TSX A;  1JKH A;  1N32 K;  2QXF A;  3CCE N;  1TV6 A;  4KH4 A;  2NRZ A;  4O8U A;  3KKS A;  5AQS A;  4AM7 A;  4X65 K;  1S1X A;  3CI5 A;  4NO7 A;  4Z0U A;  2F8T A;  1KAY A;  3AV9 A;  4A2A A;  1N5Y A;  2HMI A;  3FLC O;  4EIA A;  2HND A;  5EY4 A;  3EKS A;  3I0R A;  3HP6 A;  3FFK B;  4C8O A;  2Q1N A;  3R3L A;  1S6P A;  4YNQ A;  4IOC L;  4RTF D;  2O4G A;  2JWL A;  4FWS A;  3AAR A;  4C1N K;  2OCE A;  2P9K A;  3CQY A;  1S72 N;  4JI2 K;  3HO1 A;  4M3X A;  4FLW A;  2QKB A;  2YNF A;  4RCH A;  1RTD A;  3TAM A;  3NF9 A;  4KHS A;  4B3M K;  3UE5 A;  2FC0 A;  3DXM B;  4KKO A;  4B9T A;  4IO9 L;  5AZJ B;  3HOS A;  1OH7 A;  1L5U A;  3D2F A;  3V81 A;  2PZS A;  2ZGZ A;  4PKG A;  1GLC G;  3FFI A;  4CJL A;  4DTN A;  2E20 A;  4FM1 A;  1JL2 A;  4GV3 A;  4FLZ A;  5FRN A;  2D0B A;  3ITH A;  1K6Y A;  3CC2 N;  5ADX A;  5BRE A;  3NAE A;  1WOQ A;  4FVM A;  5AQK A;  4HUE A;  3WQU A;  1KAZ A;  3AO4 A;  4DTX A;  1KXP A;  4H03 B;  4DTU A;  1Z6R A;  2HVH A;  5HRP A;  3K58 A;  1YIT N;  2W41 A;  4FJ9 A;  4F9O A;  3NHG A;  1HUX A;  4BGA A;  4FK2 A;  3ZLJ A;  1Q82 O;  2OTL N;  2PFU A;  1HQE A;  2A1S A;  4CF2 A;  2F4V K;  2O8D A;  3D6R A;  4FZZ A;  3OY9 A;  1U45 A;  1JLE A;  4J2E A;  3R6M A;  1IBK K;  3ZSO A;  1TVR A;  2Q0U A;  4FWP A;  3P38 A;  2A1R A;  4CFC A;  4DSE A;  3L4I A;  1L3S A;  4MLE A;  4KTZ A;  3RTV A;  1VRU A;  4H5N A;  1NJW A;  3CG7 A;  1HR0 K;  4WFA L;  3V9Z A;  3KIO A;  4BY9 C;  1FXX A;  3I0S A;  4FZY A;  1CZA N;  3MXJ A;  2I7P A;  3NH1 A;  1J5O A;  2KQ2 A;  3PO4 A;  4CEC A;  2QW9 A;  4PY5 A;  2BTF A;  3AAQ A;  4BRA A;  1TL1 A;  2V7Y A;  4DQS A;  4ILG B;  2YV0 X;  3QEV A;  1ATN A;  2DPN A;  3OS1 A;  2A3Z A;  4KHY A;  3DRR A;  4QAG A;  3SQ2 A;  1YJN N;  4CZG A;  3BZK A;  3CCM N;  5M1Q A;  1TKT A;  3VTI A;  2RF2 A;  4DHY A;  1HLU A;  3IKM A;  4CJT A;  3P5J A;  1BCM A;  2BAN A;  2E1Y A;  3O4Q A;  4A2B A;  1B9D A;  2OPS A;  4CIG A;  3MK6 A;  2GTD A;  1REV A;  3VGM A;  4JNE A;  4DKW A;  3C95 A;  3NE6 A;  2P9P B;  4H8K A;  1I3A A;  3LDS A;  3HOT A;  2X6N A;  3V6D A;  4WQ5 C;  4MLH A;  1Q81 O;  2GWJ A;  1TK5 A;  2E1Z A;  3VQ8 A;  3VQ7 A;  5DMR A;  4JD2 B;  4JI1 K;  3ZT0 A;  4MO5 A;  4F3T A;  3NH0 A;  2XY7 A;  3DXM A;  3WXL A;  3QIN A;  4CGH A;  2FSJ A;  4FPA A;  4CJR A;  3QFP A;  2GUP A;  3CJ7 A;  3O9Q A;  1KLN A;  3O9U A;  5HBM A;  4O0I A;  1Q9Y A;  1IO2 A;  2YNH A;  1N6Q A;  2O8B B;  3CCJ N;  5H1S Q;  3DM2 A;  3QIO A;  4LF9 K;  4AQY K;  2UYT A;  4U7B A;  3RMA A;  1JXE A;  2BE2 A;  3CJB A;  4DCH A;  4CK2 A;  4DQ8 A;  1VQK N;  4IZ9 A;  4DQI A;  5AQJ A;  2AJQ A;  1EX4 A;  3CET A;  1BIU A;  1JCG A;  1OVQ A;  1XNR K;  1UOC A;  3MN7 A;  2NNW A;  4W5N A;  4CGI A;  3V1R A;  4CK3 A;  4DR4 K;  4WCE L;  1BDG A;  4H5W A;  1OH6 A;  2VCP A;  4ZTF A;  2P9N B;  4RW6 A;  5HRN A;  4WF9 L;  1N34 K;  3T1H K;  1L3V A;  1VSJ A;  3VMF B;  4DUZ K;  3O4W A;  1W9H A;  4YOR A;  5KPR A;  2QA4 N;  3SUQ A;  1BIZ A;  4CK1 A;  2IIR A;  2D0O A;  4O8K A;  4FOI A;  4AH9 A;  4PHT X;  1X9M A;  4FPB A;  3HBT A;  3ENB A;  1F21 A;  1VRT A;  2Q36 A;  3T69 A;  5AQF A;  5CR4 A;  3DJC A;  4YOW A;  2YJF A;  4BAC A;  4MFB A;  1R0A A;  5C42 A;  2A41 A;  3O08 A;  4CJQ A;  1TAU A;  4JKE A;  1RT5 A;  3VQC A;  4DTO A;  1VQL N;  2FBX A;  3H1V X;  2P9U A;  1TYQ B;  4FYD A;  3O9R A;  3VQE A;  3UKR A;  4ZTJ A;  4B1X B;  5AQY A;  3J80 O;  2E6L A;  1T6C A;  5FLX O;  4GV9 A;  3H46 O;  5J2N A;  1NOY A;  3IMX A;  1U49 A;  3AVL A;  4DFM A;  1Z25 A;  2YNI A;  1WAF A;  2P9L B;  2ZQB A;  3HI0 A;  3P83 D;  3LDP A;  3CCR N;  1DGK N;  4CF0 A;  4LFA K;  2HF3 A;  3KD5 E;  3QBW A;  4I2P A;  2ZJP L;  2P9P A;  4CD3 A;  1M1K O;  3CM6 A;  2XHB A;  1YJ9 N;  3IDH A;  2DTU A;  1ASU A;  3ZT2 A;  1BQM A;  4LF5 K;  1HYV A;  1JLA A;  4BC5 A;  3SZ2 A;  4CD1 A;  4LC9 B;  2Z1J A;  2CGJ A;  2HHS A;  1XMQ K;  4BR7 A;  1SL2 A;  3ZSZ A;  5HL7 L;  2D1K A;  1BGX T;  3SPZ A;  1KVB A;  2F96 A;  2KKZ A;  4H5V A;  4BGB A;  1QZ5 A;  3VGK A;  3C65 A;  3HT3 A;  1QTM A;  4EZ6 A;  1CXU A;  2O8B A;  4DU4 A;  1ZBH A;  4CJU A;  3KJV A;  3TR8 A;  1G99 A;  3AVK A;  3AVG A;  1N8R O;  3KK7 A;  4I6M B;  3CHW A;  3KZB A;  4CGJ A;  3WXM B;  2UXB K;  3AO2 A;  2FLO A;  2F9W A;  1LOT B;  4HCC A;  1CXQ A;  4BWJ A;  5AQH A;  4F2S A;  2RKI A;  4OKK A;  5EX5 A;  1ZBF A;  3QDK A;  1TUU A;  3Q7C A;  1BQN A;  3CCL N;  3U4L A;  1DEJ A;  2GV9 A;  1HNV A;  3HSC A;  2AP1 A;  2YKM A;  4JS4 A;  4JK9 A;  3ZYY X;  5I3U A;  1ILY A;  4OO1 J;  1J54 A;  2VYP A;  1ZBU A;  1LCU A;  5FPN A;  3QNO A;  5E41 A;  3FGU A;  1XNQ K;  1BIS A;  4FL9 A;  1NK4 A;  3CF5 L;  3RSE B;  3M8R A;  4NYF A;  4F8R A;  3O1W A;  3ENH A;  1GOC A;  4K43 A;  3T3F A;  4ISE A;  1JCE A;  3B6P A;  4KBO A;  1NGJ A;  4R5P A;  1X1P A;  3ZEU B;  1NGA A;  1WB9 A;  2BUP A;  2HHT A;  4JKG A;  1S6Q A;  3BUZ B;  3V9X A;  2Q0R A;  3AVC A;  4DV2 K;  1BI4 B;  1ITG A;  3PUF A;  4Q5V A;  4MDB A;  3NGY A;  2EX3 A;  1VSD A;  1RCH A;  1ZC6 A;  1VAZ A;  3JXU A;  2W42 A;  1NGC A;  3HST B;  3PX0 A;  1TYQ A;  4M7X A;  3EY1 A;  4GMJ B;  3THY B;  3TSP A;  4Z4C A;  3E01 A;  3OYJ A;  3LAL A;  4CF9 A;  1W2B M;  1NK0 A;  3E9P A;  2FF3 B;  2ATQ A;  3H6E A;  1IJJ A;  4CZI A;  1WAJ A;  4IFV A;  1FW6 A;  4I9Q A;  2HNY A;  4BR2 A;  2GBZ A;  3OYM A;  3WEE B;  3CC4 N;  3V9W A;  3LP1 A;  4CF1 A;  2GWK A;  2ZWH A;  4JN4 A;  5DM6 L;  3SJH A;  3F5T A;  1M90 O;  2BDP A;  4CJP A;  1KVA A;  4E19 A;  3EEQ A;  3LDO A;  3ULE B;  4PKI A;  4JHD A;  5AQM A;  3VEW A;  1KVC A;  1HJO A;  4CER A;  1Q8I A;  4LF7 K;  3LPT A;  2G8I A;  4JEP A;  5KRS A;  4BC4 A;  4BRK A;  3C7N B;  1KD1 O;  5BR9 A;  4M3U A;  4DSL A;  2V51 B;  4B1Z A;  3I33 A;  4CZK A;  3WNH A;  1RIL A;  2P9K B;  1KFD A;  1WSF A;  4A57 A;  2HHQ A;  5AQL A;  3HP9 A;  3BZC A;  3WT0 A;  2ZE2 A;  4I6M A;  2X74 A;  1RDD A;  3A8Y A;  4H0O A;  4JYA K;  1P8Z A;  2E2Q A;  3CCS N;  3RRH A;  4ISG A;  4CFD A;  5JLH A;  3KHY A;  3V4I A;  4Z4G A;  3HPH A;  3EZ5 A;  4F4K A;  1E4F T;  2OZS A;  3PLA A;  2IC3 A;  2NRH A;  4FJI A;  4FWO A;  1SS6 A;  4FJN A;  1RBV A;  1KCF A;  2GEL A;  3DOK A;  3AVA A;  4JI6 K;  4CJV A;  1HNW K;  4DFP A;  1GOA A;  4MO4 A;  1YXQ A;  5EU7 A;  5JMV A;  4M3T A;  5CYQ A;  2QTD A;  5HRS A;  5KGX A;  4KAZ A;  4A5B A;  2WBN A;  3QET A;  2VWK A;  3HTV A;  3RSE A;  3K59 A;  1ZBS A;  1JLQ A;  3DLK A;  4O5F A;  3K5O A;  3TSQ A;  4NXN K;  3HM8 A;  5C15 A;  1CLQ A;  3CFO A;  2XY5 A;  2HOE A;  3CQX A;  3ZT3 A;  1J9A A;  2OYQ A;  4CZJ A;  1Y97 A;  2NRT A;  3NCI A;  3TAF A;  3TAE A;  1BI4 A;  1MA9 B;  4B9Q A;  4DU1 A;  4BRH A;  4BDP A;  4OJR A;  4GY2 B;  4FLV A;  3OYE A;  3JAM O;  3DWL A;  2V52 B;  2JWK A;  5J2Q A;  1WSE A;  1SUQ A;  3NGZ A;  4DS4 A;  2ZJR L;  3VQQ A;  3THY A;  1RBU A;  1NJY A;  1HPZ A;  4F3O A;  4W5O A;  1RGI A;  4AHV A;  5AQG A;  2FF6 A;  1K9M O;  5GAH P;  4BRN A;  1XI1 A;  4B3O A;  5I42 A;  1UAX A;  3W0L A;  5C2F A;  2ZJQ L;  3ISN C;  4WQ5 A;  4J2D A;  2E2P A;  3UB5 A;  4NCA A;  2QWL A;  1FKP A;  3SI6 A;  4AHS A;  4K41 A;  1BCO A;  3QFU A;  2G8U A;  4FWN A;  4FM2 A;  1JL1 A;  5C0Y A;  3VQA A;  3PY8 A;  4DQP A;  3WQT A;  4B3T K;  3ULE A;  4BR0 A;  4BE0 A;  3I8D A;  5BPL A;  3ZX0 A;  3J7Z O;  3LAN A;  4I2Q A;  4CEF A;  2ASO A;  4DV6 K;  4DG1 A;  3C7N A;  5AJ3 K;  3HK2 A;  3KK2 A;  2PBD A;  3PSF A;  1HKB A;  3DXK B;  1OH5 A;  2Z1I A;  3THX B;  3AVN A;  1T05 A;  4E7H A;  4ID1 A;  4H4O A;  1S1W A;  3O80 A;  3DAW A;  3OYG A;  2UUC K;  5KTQ A;  5C25 A;  2YX6 A;  3DYA A;  2O8F B;  4CJF A;  2H3G X;  3K9K A;  4HTU A;  4JRQ A;  1O13 A;  1GLD G;  1G15 A;  1TAQ A;  3KLE A;  5CYM A;  3AA5 X;  1VQ7 N;  3VF6 A;  3MN9 A;  1HX1 A;  3VTH A;  3LP0 A;  4LSN A;  5AQT A;  1J6Z A;  2OZM A;  4KPY A;  1NGB A;  3AO3 A;  4A62 A;  1IKY A;  3MN6 A;  4FO0 A;  3A2F A;  1S3X A;  5DK5 A;  4CEB A;  5K14 A;  4BRF A;  2VG5 A;  5GAG P;  3HYF A;  4DR2 K;  3PX6 A;  3JSM A;  3SUN A;  5TKY A;  4E1M A;  4DR5 K;  1DT9 A;  5BN8 A;  4N47 A;  1WSG A;  1LAV A;  1Z05 A;  3O8M A;  4BG8 A;  3ID8 A;  5CY4 A;  3VEV A;  1LAW A;  5AQN A;  1B9F A;  4KFB A;  1VQ5 N;  1SL0 A;  3GDQ A;  1RT2 A;  3D0P A;  2IS3 A;  2CH5 A;  1VSI A;  3VEX A;  4CHQ A;  3A5M C;  4IWV A;  3L0Q A;  4DR3 K;  1IKV A;  4M3Z A;  1VQN N;  5HRO A;  1GOB A;  4AHR A;  5EXW A;  2PYL A;  1IKW A;  5M1P A;  1E4G T;  3IRX A;  4FWR A;  3OYH A;  3OBW A;  4HCB A;  4DSK A;  3NBP A;  3SV4 A;  3VQ9 A;  1IV0 A;  4CJ7 A;  1XWL A;  4MDA A;  5CHI A;  4CES A;  1YF5 L;  3FZL A;  1NK5 A;  1R59 O;  3L3V A;  4WYB A;  4WFN L;  3P31 A;  4WQ4 C;  4CVN E;  1NNE A;  2QWN A;  5FPE A;  3ZSR A;  2E6M A;  3U3G A;  1RBT A;  3AO1 A;  4CJ4 A;  1HMV A;  3N4P A;  4BE1 A;  2G8V A;  2FSK A;  3B8A X;  3HZ6 A;  2ITM A;  4JI7 K;  2P9U B;  4YOY A;  3DI6 A;  3I56 N;  3QEW A;  3UKR B;  4N56 A;  4DTR A;  2D5R A;  3AVB A;  5ADX H;  4XH1 A;  5AQR A;  5CE3 A;  3CC7 N;  4FWL A;  5JIC A;  5BN9 A;  1VSK A;  4FVU A;  3HJF A;  3L2V A;  5KGW A;  2HHX A;  1I39 A;  3VEO A;  1DLO A;  4IBN A;  3DXK A;  1KLM A;  3RR7 A;  4JI8 K;  1UA0 A;  5FPM A;  4CFB A;  1VQ9 N;  4FW1 A;  4HHT A;  4CJW A;  4DFJ A;  3THX A;  1RBS A;  3NF6 A;  3RMC A;  2Y1J A;  3C6U A;  3WNE A;  3HVT A;  1ZBL A;  3TU5 A;  3FZF A;  3KLF A;  3L2W A;  1X9J A;  5M1O A;  3DMJ A;  2GX9 A;  3PV8 A;  3MAQ A;  3MMV A;  3O9T A;  3DOL A;  2E2O A;  4BVO A;  4OKJ A;  4FJJ A;  2O8F A;  1IG9 A;  5BRD A;  3A0I X;  2Q31 A;  4R79 A;  3RR8 A;  1XC3 A;  4CZH A;  1ATR A;  1GLE G;  1NKE A;  4BWM A;  3MCA B;  2VGN A;  5J2M A;  4YOT A;  3VOV A;  1HQU A;  3O9S A;  3KK3 A;  2QWM A;  1S1T A;  3OYI A;  1RDA A;  3AVI A;  3G0Z A;  3OYA A;  4CEA A;  4LFC K;  2D0P A;  3EKU A;  3GL1 A;  4H0X B;  1CZ9 A;  1L3U A;  4LH4 A;  4IO8 A;  3MX2 A;  2YHW A;  5LJW A;  3G71 N;  1JJ2 M;  1WSH A;  3RMD A;  3QLH A;  4B1U B;  4KHU A;  3NDK A;  3K5M A;  1HNI A;  3C6H A;  3MXM A;  4ILJ A;  3AGK A;  4FJ8 A;  4ID5 A;  3FZM A;  5MLC Q;  3NGI A;  3A5N C;  4IOX A;  4LF4 K;  4FJK A;  4RG8 A;  3P4I A;  3CQ8 A;  2QM1 A;  1LWC A;  4KTW A;  1NKC A;  2ZD1 A;  4B9N A;  2BGG A;  4CJK A;  1HPM A;  2ETJ A;  3QNN A;  5AQZ A;  4KB0 A;  4OPK A;  3MEE A;  3IG1 A;  2ITG A;  1SAZ A;  4DF4 A;  3AVJ A;  1JLC A;  3LL3 A;  2DFE A;  3EE9 A;  1VK0 A;  1W97 L;  4JKG B;  3H08 A;  2W40 A;  4K0K K;  4B9M A;  2B4J A;  2I7N A;  2HST A;  4JI4 K;  1J53 A;  1RDB A;  1T44 A;  4Z94 A;  3JS6 A;  5JVH L;  1T8E A;  4CEO A;  3L2U A;  4LSL A;  4BRE A;  3ALY A;  5LJV A;  4Q0B A;  4JKF A;  2IAJ A;  2IVN A;  1KTQ A;  3O4N A;  4ELU A;  3AA4 A;  4B1W B;  4G9Z A;  1NG9 A;  3VEZ A;  4DLG A;  3HVR A;  1BO5 O;  5F1X A;  5F2R A;  4IFE A;  1S22 A;  3O3H A;  4H0Y B;  3THW B;  5KPZ A;  3L3U A;  1BL3 A;  2PY5 A;  3LP2 A;  4M42 A;  3ID6 A;  3LM2 A;  3OJS A;  3VQ4 A;  4H5R A;  3KLI A;  2GEM A;  3VN5 A;  1TKZ A;  4ELT A;  1SL1 A;  4LH5 A;  1WN7 A;  3S9H A;  4DS5 A;  4FLU A;  3CME N;  4FJH A;  5LMU K;  1GLB G;  4B3R K;  4ILH A;  4DR6 K;  4JHD B;  3TI0 A;  1J5E K;  1RTH A;  5T7B A;  3LAM A;  4LFB K;  3QES A;  2NZT A;  3SQ4 A;  4BQZ A;  4FWQ A;  3CCQ N;  1ASV A;  4KI4 A;  2ASM A;  3L6Q A;  1DKG D;  3D45 A;  1BUP A;  2P5G A;  4KHP K;  1V4S A;  3LWL A;  2HHH K;  1NMN A;  3SAF A;  2VQF K;  1CZB A;  3ULD A;  1WBD A;  2FBY A;  1ATS A;  5M1N A;  4DTM A;  1SKR A;  4UY8 O;  3J8A A;  2E4L A;  3BF1 A;  1GLF O;  1VHX A;  3KKR A;  4YOU A;  4FJ7 A;  3MCP A;  1NBW A;  3KVG A;  5FRO A;  2E8A A;  5CZ2 A;  3AA3 A;  2YI1 A;  3CIP A;  5JS2 A;  4KHQ A;  1YAG A;  3VER A;  5AFU A;  1TGO A;  2A6A A;  1A5W A;  1BG3 A;  4HVJ A;  1U4B A;  3GBT A;  3KWG A;  3SMP A;  3OW2 M;  3UIQ A;  3VEY A;  2PAV A;  4B08 A;  1X9S A;  4O5B A;  3WNG A;  4E0D A;  1KFS A;  2DFF A;  4PL7 A;  2XO7 A;  1NLV A;  2FXU A;  3ZCM A;  1Q86 O;  5IT9 O;  3SLC A;  3OYK A;  4YOV A;  2QWR A;  1T6D A;  1LW0 A;  5AQU A;  5JS1 A;  1MWM A;  4N5S A;  1T3V A;  4J8F A;  4AIL C;  4CZE A;  3JYT A;  2NRV A;  3TAP A;  5GAE P;  2YHA A;  4OVL A;  3OYL A;  2OTJ N;  3BF3 A;  2KZZ A;  4E3S A;  1C0M A;  3A5L C;  1C1C A;  1KAX A;  2KFN A;  2YNG A;  3C6A A;  4FSV A;  3S41 A;  2HBM A;  3THV A;  4DSI A;  3E1Y A;  1NOZ A;  1DTQ A;  3U8X A;  4GNI A;  1W0H A;  4JV5 K;  4CGD A;  1U6Z A;  1SKS A;  1EWQ A;  3THW A;  4CI6 A;  5D3G A;  4OLA A;  4DV4 K;  3QBX A;  1QVG M;  1HRH A;  1NGG A;  1IBM K;  3CFP A;  1GLL O;  1YIJ N;  1QQC A;  3OTO K;  3M1F A;  4XH5 A;  4DR7 K;  4YOX A;  3K0S A;  1Y64 A;  2IVO A;  4DR1 K;  4EAH D;  3R1X A;  4CHO A;  3S3O A;  4A5A A;  2IGI A;  5GIN A;  3U9D A;  2XY6 A;  2W6K A;  2NRX A;  4KRF A;  4BRL A;  5KI6 A;  2OPP A;  3T19 A;  3MN5 A;  1QQN A;  2BH1 A;  3DRP A;  4JAX A;  4GW6 A;  1JLG A;  4CZM A;  4ZHR A;  3B6O A;  4IDH A;  4DF8 A;  3O3G A;  1QHT A;  2EHG A;  3SCX A;  1A5X A;  4YFU A;  2YCH A;  3TTF A;  3OYC A;  1QQO A;  3ASM A;  1RT6 A;  3H1Q A;  3ATU A;  3ZT1 A;  4AF1 A;  1VSM A;  2VWB A;  4B9U A;  1ESV A;  2A40 A;  4B8A B;  4FOE A;  4BRP A;  4O55 A;  2E5L K;  2OAN A;  5AQX A;  3M8Q A;  4RW8 A;  1HYZ A;  3ENO A;  4CBW A;  1T7P A;  4M3Y A;  3HM9 A;  3J81 O;  2HHV A;  2E2N A;  4K42 A;  3NF7 A;  1XHZ A;  5J1E A;  5HLF A;  4Z4I A;  1X3M A;  1OVY A;  4O4G A;  4ELV A;  4ICL A;  1XUP O;  1JLF A;  3O6W A;  4FXD A;  1H1V A;  1U2V B;  1A5V A;  4FWM A;  3KLG A;  4AHT A;  3IAY A;  2HHW A;  2O8E A;  3HL8 A;  3LWM A;  2QWO A;  2PYJ A;  3MEC A;  2WUS A;  4FCY A;  2W6L A;  1K8A O;  3TAR A;  4NLC A;  2ASP A;  3LDL A;  4Z4H A;  2QEX N;  3I55 N;  3SQ0 A;  3OBY A;  3M8S A;  3J7Y P;  3OHR A;  2A42 A;  2B6A A;  2IDO A;  5C10 A;  5GIP A;  4IJN A;  3OYF A;  4B1Y B;  4CE9 A;  1NGH A;  2D0A A;  4DV0 K;  1TL3 A;  3HPO A;  5EVZ A;  2YKN A;  4OPA A;  1RDU A;  3KD1 E;  3VA3 A;  1YVN A;  1HKC A;  3CCU N;  1GLJ O;  4NYN A;  3BY5 A;  2NLX A;  1RTJ A;  3MX5 A;  1C6V A;  1NM1 A;  4RW7 A;  4E7I A;  1NGD A;  3L8B A;  1WBB A;  2UUA K;  4AHC A;  5BPN A;  3SBT A;  3IS9 A;  3EN9 A;  4X62 K;  3E9O A;  1NJZ A;  2HBL A;  4B8C A;  5AQP A;  3FZK A;  3VA0 A;  3AVF A;  3PSI A;  1HKG A;  2OPR A;  5JLF A;  4BC2 A;  3VF2 A;  3SQ1 A;  4UQG A;  4C8L A;  2AA4 A;  4BVP A;  1Q9X A;  3AAP A;  3TWH A;  4L3Q A;  1TK8 A;  2G8K A;  2Z1G A;  3VES A;  4BR4 A;  2VQE K;  4B9L A;  3HPG A;  4KI6 A;  4JK8 A;  4XIU A;  4YHH K;  1RT7 A;  4BRG A;  5IWA K;  4HUF A;  1TUY A;  3CYM A;  5F0X A;  4BRO A;  4KH6 A;  5AZI A;  3NH2 A;  2ZGY A;  3OJU A;  1SV5 A;  4YDU C;  3O1B A;  3D2E A;  4LD0 A;  1FKO A;  1HNX K;  4LY7 A;  4M41 A;  2F9T A;  2HMP A;  3MEG A;  1S5J A;  3CCV N;  4QS8 A;  5KRT A;  3P1G A;  2WON A;  5KQD A;  3T1A A;  1QVF M;  3EO3 A;  1BA1 A;  3G10 A;  3CM5 A;  4CF8 A;  4RWT A;  1RT1 A;  3V1O A;  3LZJ A;  3K2P A;  2RE2 A;  4HWI A;  1VSF A;  5BPM A;  3SMS A;  5C2D A;  3M3Z A;  5KQ8 A;  4CFA A;  3ZSX A;  2R7Y A;  2V7Z A;  4JLH A;  4OX9 K;  4CHY A;  3GOI A;  2QWQ A;  3CJ1 A;  1XC9 A;  1V4T A;  3EE8 A;  3C6T A;  5FDL A;  3RWU A;  4C23 A;  1BOT O;  5KPT A;  5BR8 K;  5J2P A;  1WSI A;  3CJ9 A;  1U2V A;  5LMN K;  3SV3 A;  1WUA A;  4U67 L;  3TSU A;  4IEE A;  3M6G A;  1NK6 A;  4EP4 A;  1S1V A;  1S9G A;  4DQR A;  1NU0 A;  3MDQ A;  3DLG A;  1NGE A;  4KHN A;  5AQV A;  3DLR A;  1WSJ A;  4CJS A;  4GVE A;  4IDK A;  3UKU B;  1NJI O;  4CCH A;  1IKX A;  3TAB A;  1HJR A;  1N33 K;  4PKH A;  4CJ5 A;  1NK9 A;  3KTQ A;  4E1J A;  4OPJ A;  4B9V A;  1VQ8 N;  5C12 A;  2VG6 A;  2HBK A;  3VPZ A;  5B8H A;  1KQS M;  2CH6 A;  3BGR A;  1BWF O;  3VET A;  1KRP A;  4FJX A;  3AY9 A;  3OYB A;  3OS0 A;  2HB5 A;  4JI5 K;  3ZSV A;  3N4Q A;  2KTQ A;  2HF4 A;  1LWE A;  2FBV A;  5EOY A;  3VGL A;  2P9S B;  4JK7 A;  3GG4 A;  1JCF A;  3RMB A;  3CJA A;  2P9I B;  3E9L A;  5HRR A;  4BDY A;  2QKK A;  3LPU A;  3G6E N;  3H3O B;  3PX4 A;  3OS2 A;  3TPQ A;  4EP5 A;  1LW2 A;  2XRI A;  1SKW A;  2HVI A;  1EKE A;  3CPW M;  3CD6 N;  4JRP A;  1TK0 A;  4OLB A;  3WNF A;  2JGU A;  4O0J A;  3U3Y A;  3ATV A;  4BRQ A;  1FK9 A;  2NRR A;  3SAG A;  1EXQ A;  1C0U A;  4CED A;  1Z26 A; 
#chains in the Genus database with same CATH homology
 4IOA L;  3SJH A;  2YHX A;  4KH4 A;  2NRZ A;  3F5T A;  4O8U A;  1M90 O;  3G4S N;  3CME N;  5AQS A;  4AM7 A;  3LDO A;  3CI5 A;  1GLB G;  4NO7 A;  4ILH A;  4JHD A;  4PKI A;  1KAY A;  3ULE B;  5AQM A;  3VEW A;  4A2A A;  4JHD B;  3QB0 A;  3FLC O;  4EIA A;  5EY4 A;  1HJO A;  3EKS A;  3QIC A;  4BQL A;  3FFK B;  2NZT A;  2Q1N A;  3R3L A;  2NRW A;  4JEP A;  5E84 A;  4BQZ A;  4FWQ A;  4BC4 A;  4BRK A;  3C7N B;  3CCQ N;  1KD1 O;  4IOC L;  4RTF D;  5BR9 A;  2ASM A;  2JWL A;  4FWS A;  2V51 B;  3L6Q A;  3AAR A;  1DKG D;  3I33 A;  4B1Z A;  1C0G A;  3ZX3 A;  2P9K A;  4C1N K;  3CJC A;  3CQY A;  4CZK A;  5M1K A;  1S72 N;  3NMU A;  2P9K B;  1BUP A;  1V4S A;  4A57 A;  5AQW A;  3SAF A;  3RVC A;  1YUW A;  5AQL A;  4RCH A;  3BEX A;  1ATS A;  3WT0 A;  5M1N A;  4UY8 O;  3J8A A;  4I6M A;  3UE5 A;  3A8Y A;  3BF1 A;  3DXM B;  3ZET B;  4JKA A;  4H0O A;  3IUC A;  1GLF O;  5AZJ A;  4IO9 L;  1P8Z A;  2E2Q A;  5AZJ B;  4YOU A;  2Q97 A;  3HOS A;  3CCS N;  4JKB A;  4ISG A;  5JLH A;  3KHY A;  3P39 A;  3D2F A;  2ZGZ A;  4PKG A;  1NMD A;  1GLC G;  2E20 A;  1SZ2 A;  3MCP A;  1E4F T;  4GV3 A;  3PLA A;  1NBW A;  1IG8 A;  2HBJ A;  2NRH A;  4FWO A;  1SS6 A;  3CC2 N;  5ADX A;  3KVG A;  2Q2R A;  2GEL A;  5BRE A;  3LM9 A;  4Y0W A;  2E8A A;  1WOQ A;  5AQK A;  3WQU A;  3DLL L;  2YI1 A;  1KAZ A;  3CIP A;  3FE1 A;  1KXP A;  4BR5 A;  4H03 B;  4MO4 A;  1VQ8 N;  1Z6R A;  1NWK A;  1YAG A;  1YXQ A;  4NB4 A;  3SAH A;  3VER A;  5AFU A;  5JMV A;  3M5R A;  2QTD A;  1YIT N;  2A6A A;  4K25 A;  1YJW N;  2W41 A;  4A5B A;  2WBN A;  1BG3 A;  4F9O A;  3GBT A;  3KWG A;  3SMP A;  1HUX A;  3OW2 M;  3HTV A;  3RSE A;  3VEY A;  2PAV A;  3UKU A;  4BGA A;  1ZBS A;  4M7Y A;  4O5F A;  3TSQ A;  1Q82 O;  2OTL N;  3HM8 A;  5C15 A;  2PFU A;  1KC8 O;  4PL7 A;  3D6R A;  2HOE A;  1NLV A;  2FXU A;  3CQX A;  1Q86 O;  1NGI A;  3SLC A;  4YOV A;  2QWR A;  3U9Z A;  1T6D A;  4BRI A;  2CGK A;  4CZJ A;  2NRT A;  2KLA A;  5AQU A;  3R6M A;  1MA9 B;  1MWM A;  2WC9 A;  4B9Q A;  2Q0U A;  1T3V A;  3MWT A;  4J8F A;  4BRH A;  4FWP A;  3P38 A;  4GY2 B;  2P9S A;  4CZE A;  3DWL A;  2NRV A;  3L4I A;  3H45 C;  2V52 B;  5GAE P;  2JWK A;  4MLE A;  2P9I A;  2OTJ N;  3BF3 A;  4H5N A;  3TTC A;  4WFA L;  2ZJR L;  4BY9 C;  3A5L C;  3VEN A;  1KAX A;  1CZA N;  2RHK A;  5E26 A;  1RGI A;  1RFQ A;  3C6A A;  2FF6 A;  2HBM A;  4FSV A;  5AQG A;  3S41 A;  4CZF A;  1K9M O;  5GAH P;  2I7P A;  3E1Y A;  4BRN A;  5FPD A;  3U8X A;  4GNI A;  1U6Z A;  3W0L A;  5C2F A;  2ZJQ L;  2QW9 A;  1VQ4 N;  4WQ5 A;  4CBX A;  5ELZ A;  2E2P A;  3UB5 A;  2BTF A;  2QWL A;  3AAQ A;  4BRA A;  4CI6 A;  4WFB L;  2V7Y A;  3QBX A;  4ILG B;  4K41 A;  1ATN A;  2DPN A;  2A3Z A;  4B1V A;  3QFU A;  1YJN N;  1QVG M;  4CZG A;  3L4Q A;  1NGG A;  4FWN A;  5C0Y A;  1GLL O;  3CCM N;  1YIJ N;  2YHY A;  5M1Q A;  3WUH A;  3VTI A;  3WQT A;  3ULE A;  3M1F A;  4XH5 A;  4BR0 A;  4DHY A;  4YOX A;  4QS9 A;  5BPL A;  1Y64 A;  1HLU A;  3IKM A;  4PL8 A;  3ZX0 A;  2IVO A;  3J7Z O;  2E1Y A;  4H5T A;  3W3D A;  4A2B A;  3KWI A;  2ASO A;  4NLB A;  4EAH D;  3MK6 A;  1QZ6 A;  3R1X A;  2GTD A;  3G25 A;  3I8B A;  4H0P A;  3VGM A;  4A5A A;  3C7N A;  4JNE A;  5GIN A;  2PBD A;  1VQP N;  4DKW A;  1HKB A;  3U9D A;  3DXK B;  2P9P B;  2NRX A;  5JVG L;  4BRL A;  3HOT A;  3HRG A;  3MN5 A;  1QQN A;  2BH1 A;  4WQ5 C;  4JAX A;  4MLH A;  1Q81 O;  2GWJ A;  4CZM A;  2E1Z A;  2QI2 A;  3O80 A;  3DAW A;  4IDH A;  1YHQ N;  3CXC M;  4JD2 A;  4DB3 A;  4EFH A;  1X3N A;  2YX6 A;  4JD2 B;  3CCE N;  4MO5 A;  1ZXO A;  5DM7 L;  3DXM A;  2H3G X;  3ZET A;  3K9K A;  1Q7Y O;  2YCH A;  3WXL A;  1O13 A;  2FSJ A;  3TTF A;  4FPA A;  4A59 A;  1GLD G;  5M1F A;  3QFP A;  1QQO A;  2GUP A;  2ZF5 O;  3CJ7 A;  3O9Q A;  3H1Q A;  3O5B A;  3ATU A;  1VQ7 N;  3O9U A;  3VF6 A;  3MN9 A;  1HX1 A;  4AF1 A;  1N8R O;  2VWB A;  3VTH A;  4BR9 A;  1ESV A;  2A40 A;  5AQT A;  3A5O C;  5AR0 A;  1J6Z A;  3CCJ N;  5H1S Q;  4FOE A;  4OPH A;  4BRP A;  2UYT A;  4BC3 A;  3WXJ A;  1NGB A;  1QHA A;  4A62 A;  4U7B A;  3MN6 A;  2OAN A;  1GLA G;  4FO0 A;  5AQX A;  1S3X A;  3CJB A;  4DCH A;  4BRF A;  2VGM A;  4DQ8 A;  3ENO A;  4CBW A;  5GAG P;  1VQK N;  4IZ9 A;  3WXK A;  5AQJ A;  3CET A;  2E2N A;  4K42 A;  1JCG A;  4XH4 A;  1DT9 A;  5TKY A;  5BN8 A;  1K73 O;  1EO1 A;  4BG8 A;  1Z05 A;  3MN7 A;  3O8M A;  3ID8 A;  2NNW A;  5GAD P;  3VEV A;  5AQN A;  1X3M A;  2F7T A;  1RDW X;  1OVY A;  1VQ5 N;  3GDQ A;  1XUP O;  3LDN A;  3CPE A;  1BDG A;  4WCE L;  3O6W A;  3PIO L;  1H1V A;  1U2V B;  2CH5 A;  4H5W A;  1OKJ A;  5AQQ A;  3VEX A;  3A5M C;  2VCP A;  2P9N A;  3L0Q A;  3F9M A;  4IWV A;  4FWM A;  1VQN N;  2P9N B;  5EXW A;  3ZX2 A;  5M1P A;  2KHO A;  2QWO A;  4WF9 L;  2WUS A;  1K8A O;  1K8K B;  4NLC A;  2ASP A;  1XQS C;  1E4G T;  3LDL A;  3VMF B;  4FWR A;  3K9J A;  5GIO A;  3O4W A;  4YOR A;  5KPR A;  2QA4 N;  3I55 N;  2QEX N;  3OBW A;  5AQO A;  4XEI A;  3OBY A;  2IIR A;  2D0O A;  2QWP A;  4FOI A;  4O8K A;  4PHT X;  3OHR A;  1EQY A;  3HBT A;  4FPB A;  2A42 A;  4CJ7 A;  3ENB A;  4AM6 A;  3FR0 A;  4MDA A;  3QML A;  5C10 A;  5GIP A;  2Q36 A;  5CHI A;  3T69 A;  1YF5 L;  3FZL A;  1VQM N;  4IJN A;  5AQF A;  2J4R A;  5CR4 A;  4B1Y B;  1R59 O;  3DJC A;  1NGH A;  3VF4 A;  4YOW A;  3F2K A;  5EVZ A;  1BU6 O;  4WYB A;  2YJF A;  3P31 A;  4WFN L;  4OPA A;  1RDU A;  4WQ4 C;  1YVN A;  1HKC A;  3CCU N;  1GLJ O;  2QWN A;  3AGR A;  2NLX A;  4KH5 A;  3MX5 A;  1NM1 A;  5FPE A;  2A41 A;  1NGD A;  3O08 A;  3T7Z A;  4JKE A;  3OA9 A;  5BPN A;  1P90 A;  3SBT A;  3N4P A;  3EN9 A;  1NGF A;  1VQL N;  3H1V X;  4YDU A;  3E9O A;  2FSK A;  2P9U A;  3B8A X;  3HZ6 A;  1TYQ B;  2HBL A;  2P9U B;  3O9R A;  2ITM A;  4YOY A;  5AQP A;  3UKR A;  3FZK A;  3I56 N;  4B1X B;  3UKR B;  3GE1 A;  5AQY A;  1HKG A;  5ADX H;  1T6C A;  5JLF A;  4BC2 A;  3VF2 A;  3H46 O;  4GV9 A;  4QS7 A;  2EWS A;  3E66 A;  4XH1 A;  5AQI A;  5AQR A;  3IMX A;  5CE3 A;  3CC7 N;  2AA4 A;  3FZH A;  4FWL A;  4BVP A;  5JIC A;  3AAP A;  2P9L A;  5BN9 A;  4L3Q A;  4FVU A;  2P9L B;  3HI0 A;  5AFU H;  3LDP A;  3VES A;  1DGK N;  4BR4 A;  3CCR N;  3SBG A;  2HF3 A;  3VEO A;  3QBW A;  3DXK A;  3IFR A;  4JK8 A;  2ZJP L;  2P9P A;  1MDU B;  4CD3 A;  5FPM A;  1M1K O;  5I9E B;  4BRG A;  1VQ9 N;  1TUY A;  1YJ9 N;  3IDH A;  5F0X A;  4BRO A;  3TU5 A;  4KH6 A;  3FZF A;  4A61 A;  5AZI A;  1X9J A;  5AZI B;  5M1O A;  2GX9 A;  2ZGY A;  3MMV A;  3O9T A;  4JKH A;  4BC5 A;  2E2O A;  4BVO A;  4LC9 B;  4CD1 A;  4YDU C;  3O1B A;  3D2E A;  5BRD A;  3A0I X;  2CGJ A;  2Q31 A;  3D2E B;  3H3N O;  5TKW A;  4R79 A;  2F9T A;  4BR7 A;  5HL7 L;  2D1K A;  2HMP A;  1XC3 A;  5BRH A;  4CZH A;  1ATR A;  1GLE G;  5LY3 A;  3CCV N;  4QS8 A;  2KKZ A;  4H5V A;  4BGB A;  1QZ5 A;  3MCA B;  3R9P A;  3VGK A;  2VGN A;  5HOO A;  3C65 A;  3CMA N;  5KQD A;  1QVF M;  4YOT A;  3EO3 A;  3LDQ A;  1BA1 A;  2D4W A;  3VOV A;  2YJE A;  1QQM A;  3O9S A;  2QWM A;  4RWT A;  4M63 C;  4JKD A;  1G99 A;  3MWP A;  2RE2 A;  4HWI A;  5BPM A;  2D0P A;  3SMS A;  5C2D A;  3EKU A;  3GL1 A;  3KK7 A;  3M3Z A;  4I6M B;  4H0X B;  3CHW A;  4EHT A;  3KZB A;  5KQ8 A;  3WXM B;  3R8E A;  4IO8 A;  3MX2 A;  2V7Z A;  2FLO A;  2F9W A;  2YHW A;  3GOI A;  5LJW A;  2QWQ A;  3CJ1 A;  4FWK A;  3G71 N;  3D2F B;  1V4T A;  1LOT B;  3EE8 A;  4B1U B;  1JJ2 M;  5AQH A;  2E88 A;  4C23 A;  1BOT O;  3C6H A;  4EHU A;  2QXL A;  4ILJ A;  3AGK A;  5EX5 A;  4GV6 A;  3Q7B A;  4WQ4 A;  5KPT A;  1TUU A;  3FZM A;  3Q7C A;  3CJ9 A;  1U2V A;  3QDK A;  5MLC Q;  3A5N C;  4IOX A;  3CCL N;  3U4L A;  1DEJ A;  1WUA A;  1D4X A;  4CZL A;  3HSC A;  2AP1 A;  3P4I A;  4U67 L;  3TSU A;  4IEE A;  3M6G A;  4JK9 A;  3ZYY X;  5BRF A;  1ILY A;  2QM1 A;  2VYP A;  4OO1 J;  1K8K A;  1LCU A;  3C0B A;  5FPN A;  1HPM A;  2IVP A;  3FGU A;  3MDQ A;  3PIP L;  2A5X A;  5AQZ A;  4ISF A;  1NGE A;  1SQK A;  4FL9 A;  4H0T B;  5AQV A;  3CF5 L;  4GVE A;  3RSE B;  3UKU B;  1SAZ A;  1NJI O;  3EL2 A;  4PKH A;  4E1J A;  3O1W A;  3ENH A;  1VQ6 N;  4K43 A;  4ISE A;  3ZEU A;  1JCE A;  3LL3 A;  1NGJ A;  4KBO A;  3EE9 A;  5C12 A;  3VPZ A;  2HBK A;  1NGA A;  4IJA A;  3ZEU B;  2BUP A;  4BG9 A;  4IXC A;  5B8H A;  1KQS M;  4JKG A;  1W97 L;  4JKG B;  2CGL A;  3BUZ B;  2CH6 A;  1VQO N;  1BWF O;  2W40 A;  3VET A;  2Q0R A;  3AY9 A;  2I7N A;  3N4Q A;  2HST A;  2HF4 A;  1T44 A;  4Z94 A;  3JS6 A;  4MDB A;  5EOY A;  3BP8 A;  2P9S B;  4JK7 A;  3VGL A;  3GG4 A;  5JVH L;  2FSN A;  3WXI A;  1JCF A;  3D7E O;  4C1N I;  1ZC6 A;  1YI2 N;  4BRE A;  1VAZ A;  3JXU A;  3CJA A;  2P9I B;  3E9L A;  4BRC A;  1NGC A;  5LJV A;  4JKF A;  2IVN A;  1TYQ A;  4M7X A;  3H3O B;  3G6E N;  3NVK A;  3NVM A;  3TSP A;  3TPQ A;  4B1W B;  1W2B M;  1Q18 A;  3E9P A;  3EZW A;  2FF3 B;  4H0V B;  3SK3 A;  3VEZ A;  4G9Z A;  1BA0 A;  3TTD A;  1BO5 O;  3H6E A;  1C0F A;  1IJJ A;  5F2R A;  4IEI A;  5F1X A;  3CPW M;  4CZI A;  3CD6 N;  4IFE A;  1S22 A;  4H0Y B;  4BR2 A;  4JKC A;  5KPZ A;  4BRM A;  4HTL A;  3WEE A;  2WFB A;  1MWK A;  3ATV A;  4BRQ A;  4CBU A;  3ID6 A;  3LM2 A;  3WEE B;  4BRD A;  2NRR A;  4H5R A;  3CC4 N;  3SAG A;  2GEM A;  2GWK A;  3CER A;  2ZWH A;  4JN4 A;  5DM6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...