3C6HA

Crystal structure of the rb49 gp17 nuclease domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
196
structure length
182
Chain Sequence
LSRLSFIDVVNDNGFYQFEKPKEGRKYVATLDCSDYHALQIIDITEFPYKQVAVYHSNTTSHFILPDIVFKYLMMYNECPVYIELNSTGVSIAKSLAMDLEYDNIICDSFIDLGMKQSKRSKAMGCSALKDLIEKDKLIINHKGTIQELRTFSEKFHDDLVMSLVIFGWLTTQEKFAEYAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Terminase large subunit
publication title The structure of the phage T4 DNA packaging motor suggests a mechanism dependent on electrostatic forces.
pubmed doi rcsb
source organism Enterobacteria phage rb49
molecule tags Viral protein
total genus 57
structure length 182
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3c6hA00
4IFEA 5M1OA 4IEIA 5M1PA 5C10A 5C15A 5M1FA 5M1NA 5C12A 5M1KA 5C2DA 4IDHA 4IEEA 3C6AA 3C6HA 5M1QA 5C2FA 3CPEA
chains in the Genus database with same CATH superfamily
1N33K 4CHZA 3THXA 3VERA 4HWIA 4FJ7A 3ENOA 3NFAA 2KZMA 3L2QA 4DR5K 4GVMA 1VRTA 1BO5O 2O8DA 2ZWHA 3T1YK 2YV0X 3VQDA 3ZX2A 4B1YB 1TUUA 1U48A 3J7AP 1XHXA 4L8RB 4FWPA 4CEOA 4RWTA 1Q9YA 4CJ5A 1RBRA 4CBXA 5C24A 3MAQA 5AQPA 4OX9K 1O13A 2FSKA 4CCHA 4KH5A 3VEWA 3GOIA 4OJRA 3SV3A 1RT7A 3LZIA 1FXXA 3QETA 3NF7A 1LW2A 2EX3A 2UYTA 5C42A 4FVUA 3CMEN 3OYEA 4ZTJA 4NXMK 4KH6A 4MDAA 3LL3A 3A5NC 4I9QA 3MN9A 4JV5K 1OVYA 1EETA 2HHQA 4IG0A 1RT5A 3QESA 1XNRK 4JK7A 1KFDA 2FXUA 2JWKA 4MLEA 4WYBA 3BY5A 1NGAA 4YORA 3TAQA 3MXMA 3NH1A 1HKGA 4DHYA 2ZJPL 1Q81O 2DFHA 1K9MO 3TTDA 3C6TA 3O4NA 1S1VA 2YX6A 3QDKA 5KGXA 4LF6K 2KQ2A 1TVRA 3MDQA 2OPRA 3GDQA 4HTUA 3SMPA 4B3SK 1NGEA 3AVIA 5AQXA 3UKRA 4BRDA 4DFKA 1NK0A 2HF4A 4PA1A 3U9DA 4B9UA 5A2QO 2HHHK 1X9WA 4JI1K 3H1VX 3W0LA 2NRRA 3VEOA 3KLFA 1NGFA 3S3OA 5BRFA 1JCEA 4Q5VA 4JI2K 5LY3A 3THYA 3LDNA 5FDLA 3OA9A 4DTJA 1HR0K 4NCAA 4BRAA 4H0OA 1VQ8N 2G8HA 4DTMA 1GLDG 1NJZA 3D45A 2P9NB 3I33A 3ATVA 3CG7A 1J9AA 2HHWA 3WEEB 5BPMA 3SMSA 2D0OA 1E3MA 3KK2A 1Q82O 2OANA 4DWIA 5C10A 3F9MA 3RRGA 2VQFK 4M3ZA 5BR8K 2R7YA 4M3WA 4CECA 3AVJA 3PUFA 4EZ9A 5JS1A 3AAPA 4JI3K 4KTQA 1TYQA 3EN9A 1BIUA 4H4MA 1VQPN 4AHCA 1QHTA 5HROA 1HYVA 5BR9A 2W40A 1EX4A 4DFMA 3E9PA 5JLFA 2EHGA 1NK6A 2OPQA 1X9JA 4BC5A 4CEAA 2Y1IA 2ASMA 5EOYA 4QOZB 2P9IA 4CJQA 4CK2A 5BN9A 4E0DA 5BRDA 5GIOA 5C0YA 1LWCA 3MN6A 2XY7A 3L2RA 3CM5A 2Q31A 3QICA 3OYNA 1BCOA 3P4IA 5E26A 5AQLA 3BUZB 1VSEA 2QEXN 3TTCA 2W41A 2YCHA 5GAGP 4DU3A 3ZYYX 4JS4A 3BDPA 3LANA 5CY4A 2GELA 4CZKA 4BACA 3EL2A 5LJWA 3O9QA 4DSEA 2P9LA 5AQYA 3AVLA 2KW4A 4B9SA 1S1XA 5J2PA 3HTVA 3JS6A 1EO1A 4LD0A 2GTDA 2UU9K 4DCHA 3T69A 3ZEUA 4CEQA 2QWMA 1X3MA 3HPGA 4H0PA 1O1WA 4MO4A 1LV5A 3PX4A 2KTQA 4FWQA 3F9KA 1GOAA 2HHUA 4BVOA 4BR7A 4FJHA 3AA3A 3KTQA 1IO2A 3O8MA 4FSVA 3R3LA 1VSIA 3OJSA 1SZ2A 1DLOA 4WFAL 4FJJA 1H1VA 2YNGA 4FJIA 1B9FA 1JLGA 1TKZA 1D9DA 4KHQA 2NRXA 3MEDA 1T8EA 3LP1A 1U2VA 3KD5E 2YNHA 4PUOA 4K41A 3T1HK 1U49A 3H08A 4LSLA 3AO2A 3VGMA 2CGKA 4IFEA 2RHKA 5CYQA 4YHHK 2OPSA 4JRQA 1YXQA 3AA4A 4Z4FA 3VENA 3OYGA 1FKOA 5EVZA 3VQ4A 4M7XA 3SV4A 2W42A 1BUPA 3C95A 1S9EA 3I55N 1GLEG 4KI6A 4YOUA 3CM6A 3VTHA 2O8BA 4FPBA 3UKUB 1U4BA 1C0FA 1RCHA 4M63C 1VSJA 2LSNA 3VQ5A 4W5TA 3NE6A 2HVIA 1RTHA 1Q18A 3IG1A 4CJSA 4DF4A 2UXBK 3AVFA 2Z1GA 1OKJA 3LPUA 4CF9A 4XH1A 4LFCK 3AVKA 4O5FA 3T7ZA 4OVLA 2E5LK 5KRTA 4CF8A 1WSIA 2Q2RA 3F5TA 4JK8A 4C1NK 2VWBA 2QWNA 5C15A 4HUGA 4HUEA 3NF9A 4FL9A 3O4WA 4JEPA 1ZC6A 4I9LA 1ASVA 1Z25A 1A5WA 5HRSA 3BF1A 5AQUA 4KB0A 3LALA 4I6MA 5J2NA 1HMVA 2VWJA 4OO1J 1VSLA 3QERA 3EE9A 1JKHA 4ELVA 3WQTA 4CJ4A 5AZIA 3ID6A 4FJ9A 3HRGA 4CFCA 3U8XA 1NGJA 4KV8A 3HSTB 3IKMA 5HRRA 4CEEA 3OYLA 1ESVA 4CZLA 4E7LA 3MMVA 4OLBA 2ZF5O 4B08A 4J2EA 4Q0BA 1UAXA 5I9EB 3L3VA 3LM2A 4RW8A 2PYLA 1J5EK 3BEXA 5D3GA 3AVMA 3D6RA 3WNGA 3S3MA 2G8UA 3K2PA 2X6SA 5CZ2A 2HOEA 4EHUA 4F4KA 2H3GX 1I39A 4C8LA 1E4GT 3M8QA 4YOVA 1U45A 4J2BA 1CZ9A 4CJUA 4H03B 3PIOL 3MEGA 1TKTA 2IOCA 4CD3A 5GADP 4I2PA 3B8AX 4X64K 4FLWA 4FK4A 2KHOA 4PKIA 4O44A 3H45C 2PFUA 1L3SA 3DLEA 4JLHA 1QZ5A 1WB9A 4GV3A 3TAFA 2QWQA 5M1PA 5CZ1A 2V7YA 1DGKN 5BPNA 4LF4K 1QQOA 3O5BA 2RE2A 2QWOA 1VSDA 3OJUA 4FWNA 5BN8A 3SYZA 5HOOA 3V1QA 1SV5A 3AGKA 1TGOA 1MU2A 2P1JA 3L6QA 4RCHA 1QSSA 3DLLL 1J5OA 1RT4A 1W0HA 1K8KB 1ZBLA 4JI8K 4Y1DA 5EY4A 2O8FB 3EKSA 3D7EO 4RG8A 1S1TA 3ATUA 1VQ5N 4BQZA 2HMIA 1NK9A 3HVTA 4AHSA 4CZIA 3WXIA 3K5LA 1TUYA 4H5VA 2QWLA 4FLZA 2ITGA 3UE5A 2KFZA 2E1YA 4CE9A 1VQNN 3KZBA 3CJ9A 3IUCA 3WQUA 2FBYA 2PY5A 1WBBA 4CJEA 2VCPA 1BL3A 1GLFO 4JI6K 3SAGA 4FK0A 1C0MA 1SKRA 1Q9XA 2QWPA 4KHNA 3AVNA 2FC0A 1TL3A 2HHSA 3OBYA 3ID8A 4IBNA 2VGMA 2IS3A 2HNYA 3ZSZA 2HMPA 3OS2A 1BGXT 4BGAA 5C2DA 2DTUA 1XUPO 4CEBA 2O8EB 3PX0A 3C6HA 4Z4CA 1Z6RA 4BRPA 4AHRA 4FWRA 3J8AA 2VQEK 3WEEA 2V52B 1NJIO 3EY1A 3CERA 3CIPA 2B4JA 2W6LA 1EWQA 1YVNA 5M1QA 4FZYA 4F3OA 2HHXA 3C65A 3M6GA 3CJ1A 4FWOA 2ASPA 1ZXOA 2P9UB 4BC3A 4I7FA 4JN4A 1T3VA 2F7TA 4FM0A 2YJFA 3WXLA 1JCFA 4IXCA 2WUSA 1VSFA 4AM6A 4B9VA 1T05A 3DRSA 2UUBK 3IMXA 4J2AA 1WSGA 3AA5X 4ID1A 4IZ9A 4DUYK 5LL6Z 3CD6N 1CZBA 4E89A 1U6ZA 1TL1A 2YKMA 4YOWA 3D2EA 3CI5A 3NAEA 4XIUA 3L2VA 4B1WB 2E8AA 4A5BA 3CCSN 3DXMB 3I8DA 4JI0K 3G0ZA 2GWJA 3LWMA 4CJWA 4DQPA 4CGGA 3JXUA 4PHTX 2WC9A 3VETA 1NMDA 3HL8A 5ADXH 4O0JA 4YFUA 3LDLA 5M1OA 2F9TA 1QZ6A 2A1SA 3HYFA 3GE1A 2P9SB 4A57A 4YY3K 3OYDA 1BI4B 1DTTA 3FFIA 1KQSM 3ZT2A 2OA8A 2QXFA 4BC4A 4X65K 1HX1A 4B9TA 3QO9A 3V1OA 4DS4A 3C94A 4DV5K 2QTDA 3ENBA 5AQNA 3KK1A 3AO1A 3TAMA 1IKVA 4JRPA 1HNZK 1GLBG 4DTXA 3G10A 4E7JA 4IEEA 3VF4A 2A5XA 2HSTA 1KLMA 1REVA 2WOMA 4DQSA 4H4OA 4XEIA 1IG9A 3WXMB 1VRUA 4FOIA 4CK1A 1VQKN 2E1ZA 3GBTA 4BY9C 3SAHA 2I7NA 3CCRN 4DG1A 3P31A 3ZCMA 4CHPA 2FBVA 3AA2A 5LJVA 5HRNA 2YNIA 3PLAA 3L2WA 4OKJA 4OLAA 3AY9A 1T03A 1QQCA 3ZT4A 4CZFA 5B8HA 2QKKA 4FJLA 1MWMA 4MLHA 3HM9A 3M1FA 4DV2K 3K0SA 5JMVA 5AQIA 3VEVA 2QKBA 1BDGA 1XI1A 3BZCA 3MXIA 2FBTA 3D2FB 4PY5A 4CZJA 4GKJK 4DSKA 1RDCA 1UA0A 4JKEA 4FLVA 4N56A 4IFYA 4ELTA 1XWLA 2D1KA 3WXJA 2NLXA 2OZMA 3KJVA 4DU4A 3P5JA 4KO0A 2UXCK 3GL1A 2GBZA 3DXKA 3H6EA 1X1PA 1XMQK 3TR8A 3VQ7A 3V6DA 5EX5A 1U04A 3UKUA 3ULEB 3SUQA 3BGRA 2FF3B 4WE1A 4TSXA 2Y1JA 4DTNA 1T7PA 4DTRA 4FK2A 4F2RA 3VQCA 2O8CB 2NUBA 4DR6K 4LF5K 4MO5A 3VMFB 4DV1K 1KC8O 1NU0A 1KTQA 1A5XA 2E2OA 1SQKA 3HPHA 1HNXK 3DLHA 1NK4A 1KXPA 4PWDA 4CFAA 3CPWM 5J1EA 2QK9A 5AQJA 1VSMA 2A1RA 1P8ZA 3O1WA 2IVPA 1KVAA 2P9PB 2E20A 3LWLA 4OPAA 3QEXA 1WBDA 4DSFA 2HBJA 1NKBA 4BC2A 1WUAA 4B8CA 2ZJQL 4R79A 4NLCA 3VGLA 5J2MA 3A5LC 2J4RA 2UUAK 4CERA 3KVGA 3RWUA 5AQMA 4X66K 4Z94A 4IJAA 3V81A 3CYMA 4XH5A 1HPZA 2E88A 2YNFA 4YOXA 5AQRA 1L3TA 4M3UA 3OYBA 2AP1A 4H8KA 4LY7A 3KLEA 1BHLA 2QA4N 2JWLA 3QB0A 3TARA 1KRPA 3T19A 4LF7K 1HJRA 3THVA 1QSLA 1ILYA 4IG3A 4ELUA 3AO5A 4FJGA 3V9XA 4CEZA 4CEDA 3O4QA 3ZSVA 4CESA 4CHQA 5KPRA 1UOCA 1HKCA 1VSKA 4NCGA 4NO7A 3OYFA 2Q3SA 1JLEA 1SL0A 3HOSA 3PIPL 3KWGA 4CZHA 1KVCA 3O9UA 4JKAA 4PL7A 4U67L 1ZBHA 4FWMA 3LAKA 1TAUA 5BRHA 3T3FA 1E4FT 3VA3A 1NGDA 1HYSA 5IT9O 1SAZA 4CGJA 1BISA 3CCJN 1S1UA 4CIFA 3THWA 5DM6L 5JLHA 3DLRA 2IVNA 1ZBFA 2IVOA 1C1BA 3V9WA 3B6OA 3OS0A 2QI2A 1VQ9N 2XRIA 3C6UA 2ZE2A 3HJFA 3EO3A 1S9GA 4WQ5A 2FLOA 4BDYA 1YITN 3K9KA 1HUXA 5AZJB 4H0YB 5SZTA 4KRFA 1RNHA 1RFQA 4H0VB 3DLGA 4DF8A 3LDSA 1BWFO 1K8KA 2O8FA 1ATRA 4EFHA 4F3TA 2NNWA 2GWKA 3ZSXA 4CBUA 5KQ8A 5C2FA 3O3FA 1T44A 1HQUA 3RTVA 3NVKA 2RN2A 2BDPA 1NK8A 5T7BA 3L4IA 3DRRA 3CCMN 2NRTA 3RSEA 4DV0K 4AM7A 4H0XB 3CCEN 1VHXA 3N4QA 4A61A 3EZ5A 1M90O 3THXB 5JS2A 2F8SA 4QS9A 1YJNN 1CXQA 5E84A 3CJ7A 1LOTB 3IS9A 1VQON 4BRFA 4DMNA 2O8DB 4BE2A 3TTFA 4IWVA 4FJNA 5JICA 4JKGA 1KFSA 1OH7A 1EWRA 5M1KA 1IV0A 4BWMA 3ZT3A 4KH4A 3SQ2A 1N36K 1IBMK 4M41A 2HNZA 2QM1A 3C0BA 4B3RK 4NCBA 2A3ZA 2O8EA 4W5NA 2VGNA 5AQSA 5AQTA 4BR0A 1NK5A 3SPYA 3RMBA 1ASWA 3HOTA 4WQ4C 3LP3A 3DYAA 5MLCQ 1QVFM 3F2KA 3SUNA 4GV9A 4B9MA 4FCYA 4E3SA 2GV9A 4IO9L 3TPQA 3FFKB 1D9FA 3LDQA 1QS4A 3VEZA 2P9KA 3KK7A 5C12A 4FWLA 4O0IA 3QFPA 1T6DA 1WSFA 3C7NA 3ZETA 4BQLA 2DFFA 2V51B 4KI4A 2ZM6K 3K9JA 4K42A 5AQZA 3IDHA 4FWSA 2PAVA 4DTUA 3K5MA 3CFPA 3DLKA 3FZHA 3VQ8A 3PSIA 1JLQA 2UUCK 1D4XA 5F0XA 2FBXA 3AAQA 3AVAA 4DS5A 1XC9A 3FZMA 5FPDA 4K0KK 2A41A 4BE1A 1HNIA 4FJKA 1IKXA 3VQBA 1QTMA 2KLAA 4CJPA 3NF6A 4B9NA 1YJWN 4EIAA 2E2NA 3FZFA 3IRXA 3E9OA 4C23A 3VGKA 3MN7A 3VQ9A 1FKPA 4OKKA 1I3AA 3DXMA 1RBUA 5KPTA 1T6CA 4CEFA 4JI5K 3R1XA 2RPIA 4KFBA 3NH2A 1ITGA 4CIEA 3V9UA 3VTIA 4CHNA 3THYB 4JKDA 4GMJB 2YHWA 4KTWA 3OYAA 4CBWA 4DQQA 2P9SA 3CCLN 3O1BA 3MX2A 3CMAN 1RBTA 3VF6A 1BI4A 1X9SA 2DFEA 1L5UA 3KLHA 1JCGA 3VQQA 1C1AA 3QLHA 1KD1O 3EYZA 3FZKA 5F1XA 1WSEA 4DV3K 1S22A 4FJXA 4BR2A 5CHIA 4U7BA 2KZZA 4GVEA 2VG5A 1ASUA 4BRNA 2Q0RA 3V4IA 1IH7A 4BDPA 3NHGA 1VQ7N 1KAYA 1QQNA 4Z4IA 3S9HA 2BH1A 2YI1A 3QFUA 1TYQB 2HBKA 4MFBA 4BR4A 3TABA 4JD2B 4HTLA 3M8PA 3O9TA 3OW2M 4AILC 4Z4EA 1RDAA 4WQ4A 2CGLA 3AVHA 1UWBA 4FO0A 3EEQA 2DPNA 2WONA 3SNNA 3ALYA 1K6YA 5LMUK 3M8RA 4DB3A 5I42A 3EE8A 4B8AB 4CZMA 3RVCA 1M1KO 3DWLA 4AHVA 4N5SA 4UY8O 3D2FA 3SK3A 4RW7A 5KQDA 1FJGK 5JVGL 4EAHD 2OTLN 2EWSA 3Q7CA 4NLBA 2ETJA 4JK9A 4O5BA 5KPZA 4B9QA 3SQ1A 2HVHA 4HCCA 4NXNK 2D5RA 3BF3A 4DSLA 3RMDA 4BROA 5C25A 3OYHA 3ULEA 3SPZA 3ZX3A 2P9LB 3MK6A 3O9SA 1VQMN 1JL2A 3HPOA 3SBTA 2O8CA 4H5NA 4NB4A 2JLEA 2ZJRL 5AFUA 1Z26A 4UQGA 2QW9A 5CYMA 2V7ZA 2YHBA 5HL7L 1XQSC 3OYMA 3CC4N 1RDUA 3FR0A 4ID5A 5DM7L 1Q86O 4FLXA 4DKWA 4AHTA 3E66A 3R8EA 4ISGA 4ILHA 3HT3A 1WAJA 3O6WA 5AQVA 1BQMA 4KHPK 2XY6A 1NNEA 3CFOA 4DU1A 2Q1NA 4HHTA 3CJBA 2A6AA 2P9NA 4IOAL 4CF2A 4B3TK 3N4PA 1YHQN 3RR7A 3R9PA 5DMRA 3VQEA 2B5JA 3TAEA 5HRPA 1HNVA 3CCUN 3BP8A 4DR2K 4IFVA 3SCXA 3CF5L 3L3UA 1SUQA 3WXKA 4CJTA 1W7AA 2ITMA 4DR1K 1I94K 2OPPA 4BREA 4CJ3A 5AQKA 1RBVA 3ZT1A 3NGIA 3EZWA 1WN7A 2KFNA 3CJCA 2HF3A 1MWKA 1VQ4N 3PSFA 4K8XA 5GAHP 3QIOA 1NKEA 3DLBA 1RTDA 4F2SA 3JAMO 1RILA 1FK9A 4GY2B 2VG6A 1TKXA 1IKWA 4CIGA 1CXUA 2E2QA 2YHYA 4QAGA 3ISNC 3ITHA 3DI6A 1G15A 3VQ6A 4OPKA 1OH5A 3AVGA 2XY5A 4PKGA 1NGBA 2AJQA 2ZGZA 2QWRA 2NZTA 3OVNA 4CFBA 4OPJA 4DQIA 1KAZA 1IG8A 2VYPA 3SZ2A 4OGEA 4FJ8A 1U47A 2X6NA 3TSPA 4Z4GA 1J53A 2D0CA 4KHWA 3EKUA 3M8SA 3ASMA 4FLYA 4FXDA 1W97L 2VWKA 4RTFD 4M3TA 3ZSRA 2CH6A 3U3YA 4HVJA 3HVRA 3RMAA 3HM8A 4BRGA 1LAVA 1NBWA 2NRVA 3QEWA 4E19A 5H1SQ 5AZJA 3SI6A 2D0BA 4E7HA 4BR5A 3VQAA 4BDZA 3PO4A 5HBMA 4KPYA 4OKEA 2D4WA 1VK0A 1C6VA 1NOYA 3SLCA 3ZSQA 1JXEA 3VEXA 5HP1A 3ULDA 4DTPA 3A5MC 1ZBSA 3ENHA 2XHBA 1JJ2M 2YHAA 4JKFA 1NK7A 1TK0A 2XY8A 5BREA 1X9MA 4N76A 3H3NO 3K57A 3HSCA 4KAZA 1X3NA 3HK2A 3TAPA 1RGIA 1WAFA 4L3QA 1S3XA 4E7IA 3KLGA 1NG9A 3E01A 3QINA 3KD1E 4IDHA 3VA0A 2HNDA 4DFJA 1RT1A 2G8WA 1IBKK 1XC3A 4LH5A 3K59A 5AQOA 1BA1A 1C0UA 4BVPA 1WOQA 1S72N 1JLAA 4YNQA 4CVNE 1LWEA 4QCLA 1GLAG 3TU5A 5BPLA 2E6MA 5IWAK 1NMNA 1QE1A 3DM2A 3J80O 3SJJA 4DUZK 3K5NA 4K8ZA 5DK5A 4OPHA 3MCAB 5E41A 1S1WA 5KRSA 4AF1A 1RTIA 2HBLA 3TWHA 1GLJO 3O3HA 3T1AA 4FVMA 1KLNA 3L2UA 3OYIA 4WQ5C 3KKRA 2NRHA 4FOEA 3LPTA 3VF2A 3CQYA 4H5TA 3AV9A 3KKSA 2XO7A 2PBDA 3P39A 3QEPA 5J2QA 4CHOA 1DEJA 4CFDA 4BRLA 2X78A 3BZKA 1BCMA 1NWKA 3CQXA 1D8YA 4ISFA 3HXMA 4WFNL 4LF8K 4DTSA 1BOTO 2G8IA 3WNHA 2BE2A 1C0TA 1HYZA 1ZYQA 4E1MA 4FJMA 3J7ZO 1OVQA 3SJHA 1YAGA 4NYNA 4ICLA 3NBPA 4N41A 4BRMA 1TAQA 1YIJN 4RW9A 2PYJA 3H46O 1DTQA 4YOTA 4E7KA 4B1UB 5FPEA 3ZX0A 1B9DA 1YF5L 2B6AA 2ZD1A 3U6FA 3U4LA 4EHTA 1J6ZA 3F73A 3ZSWA 1NLVA 3HP9A 3CFRA 5FRNA 4JHDB 3OYJA 4C8OA 4IO8A 4BRQA 4DV4K 1OH6A 3O08A 1KCFA 1RT6A 2CH5A 1XHZA 1Y97A 3DAWA 1QHAA 1IBLK 2Z1IA 2P5OA 4CW7B 2E4LA 1L3VA 1YTUA 4OGCA 5FRMA 3I8BA 2A40A 4B1VA 4JD2A 4WFBL 4DLEA 4H5WA 4E1JA 3DJCA 3J7YP 3KK3A 4O8UA 3G4SN 1JLBA 4BRKA 3HZ6A 3WUHA 3OS1A 4RW6A 4N47A 3NGZA 1DKGD 3SBGA 1Y64A 2WBNA 3D2EB 2HW3A 1OH8A 2NRZA 4BR9A 3AVBA 3A0IX 3AO4A 3DOKA 4FPAA 3ZLJA 4JKHA 3ZSOA 1XNQK 3NMUA 3OBWA 1HPMA 2RKIA 3LM9A 3CCQN 4KB1A 4IKFA 4MDBA 4K43A 3FLCO 1C1CA 2E6LA 2BANA 3FZLA 2HHVA 1TK5A 1HKBA 1LWFA 4CJ7A 3I56N 4FM2A 1NJWA 1NGGA 3NH0A 4FJ5A 1YUWA 3NVMA 4DSIA 1XMOK 5FROA 4CGDA 3OY9A 4B3OA 2D0AA 4Y0WA 5FPNA 3M5RA 1W2BM 3A2FA 1LW0A 3CC2N 4GV6A 2FSJA 3LDOA 3VQPA 4BGBA 4BE0A 3CQ8A 2HB5A 1QVGM 1NM1A 3MX5A 1VQ6N 1CZAN 3I0RA 4WF9L 4JKBA 3TAGA 4WCEL 4E1NA 4FLUA 3G25A 4V19S 4B9LA 1CLQA 3B6PA 3QNNA 1YJ9N 1HRHA 2ZGYA 3PO5A 2O4GA 4Z4HA 1EXQA 4A5AA 1Z05A 4O8KA 3HP6A 1LAWA 4M3YA 2Q36A 3Q7BA 4CJVA 3V1RA 2P5GA 3QEIA 4DSJA 5ELZA 3CCVN 3S3NA 5LMNK 4G1QA 1BA0A 3SQ0A 1NKCA 3W3DA 4DR4K 2E2PA 1JLCA 2P9UA 4AQYK 4GKKK 1QQMA 1TV6A 1B92A 3K5OA 3OHRA 3WNFA 3TANA 1UA1A 5F2RA 4PL8A 5AQGA 3VEYA 1VAZA 1WSJA 4M42A 1D5AA 3AVCA 3TSQA 1YT3A 3DXKB 3HO1A 3AARA 4LC9B 4KTZA 1HNWK 4B1XB 4YDUC 4H0TB 4CJLA 2IIRA 4FYDA 3QBXA 2O4IA 4M7YA 1P90A 4M45A 2IDOA 2Z1HA 4DR3K 3MECA 3OTOK 3UKRB 3UIQA 3LAMA 2HBMA 4FLTA 3VPZA 2Z1JA 3AGRA 1HQEA 4Y1CA 1ZBUA 4A62A 3D0PA 4DV7K 4CF1A 4JI4K 4J8FA 4BG8A 1BIZA 1NOZA 3OYCA 1N34K 1EQYA 3HI0A 2ZQBA 4I2QA 4CGHA 1N6QA 3IAYA 3J81O 3E1YA 2G8FA 3O3GA 4EP5A 2RF2A 1FW6A 4J2DA 1BQNA 3NDKA 1KVBA 1S5JA 3TSUA 4C1NI 5KI6A 4C8KA 4W5OA 4KREA 2YJEA 2NRWA 1KSPA 1LCUA 3MCPA 2JGUA 3VESA 4KHUA 4AHUA 3G71N 3PX6A 3QIPA 3L8BA 3IFRA 1SKSA 3CJAA 3KWIA 4AH9A 1JXBA 3O80A 4CGIA 4X62K 3FGUA 2VG7A 3KLIA 2ATQA 1HJOA 4DR7K 2P51A 3KHYA 4HUFA 1YVUA 3TI0A 4KHYA 4A2AA 1GOCA 4O55A 2WFBA 2F8TA 2HHTA 4ILJA 3H1QA 2IC3A 1F21A 5CE3A 4LF9K 1SKWA 1G99A 4IDKA 4IOXA 4JYAK 5GIPA 1IJJA 1K73O 5CR4A 4FZZA 1NGHA 4MQ3A 3HBTA 4KBOA 3MXJA 3S41A 3ZT0A 3L0QA 1SL2A 2BUPA 2P9IB 1ATNA 3K58A 5I3UA 4FW1A 3DRPA 4BRCA 4CJFA 1S6QA 3JYTA 2FF6A 3I0SA 4M3RA 4JKCA 3RRHA 2G8VA 1GOBA 5M1NA 2Q97A 3A5OC 3DMJA 4JAXA 1L3UA 1JL1A 4CF0A 1GLCG 3PV8A 1DT9A 1NJXA 3ZSYA 1GLLO 1RDWX 2D0PA 3PY8A 4FZXC 3THWB 4YOYA 2OYQA 5ADXA 4GNIA 3NF8A 1N8RO 4YDUA 4DV6K 4ILGB 4JI7K 1VSHA 1RDBA 3CHWA 1SL1A 2YHXA 5HLFA 3LDPA 1SS6A 2A42A 5AJ3K 3VN5A 4CGFA 4CJKA 2BTFA 1A5VA 3U3GA 1W9HA 5AR0A 3JSMA 1S6PA 3E9LA 3NCIA 4DQ8A 1YI2N 3ZEUB 3SUOA 2F96A 4F9OA 1NGCA 2GX9A 4JNEA 1MA9B 4HCBA 1WSHA 4BRIA 4KHSA 3P1GA 3SUPA 5AQFA 4M3XA 2AA4A 4CHYA 5AQWA 5GINA 1ATSA 3FE1A 1VQLN 2W6KA 2CGJA 2GEMA 3RSEB 3WNEA 1RDDA 3P83D 4PKHA 2OZSA 1K8AO 1RBSA 2IAJA 3R6MA 3LP0A 3UB5A 1Q8IA 1TK8A 2P9PA 4FW2A 2ASOA 3MEEA 1HLUA 1JLFA 4XH4A 4FM1A 1U2VB 3O9RA 2WTUA 4JKGB 1ZBIA 4Z0UA 4CI6A 1Q7YO 1RT2A 2I5JA 3QNOA 4O4GA 1EKEA 4IOCL 3G6EN 3QMLA 3LP2A 3CXCM 4G9ZA 1V4TA 4RW4A 5GAEP 1NGIA 2X74A 5KTQA 5KGWA 5EXWA 1TKDA 2YKNA 3WT0A 1BG3A 3A8YA 1J54A 3C6AA 3RMCA 3MWTA 4JHDA 2KKZA 3RR8A 5JVHL 4PQUA 5TKYA 3M3ZA 2P9KB 2G8KA 3QEVA 4W5RA 1R0AA 4CZEA 1C0GA 4C8MA 4BRHA 1YTAA 2FSNA 2O8BB 4ZHRA 4QS8A 4IJNA 3C7NB 3ZETB 4DTOA 4FWKA 1V4SA 4ISEA 4CK3A 4R5PA 1RTJA 1WLJA 4F8RA 4KKOA 4K25A 5TKWA 4EZ6A 4C8NA 2QXLA 3OYKA 4LFAK 4CZGA 4LH4A 2PZSA 4QS7A 2OCEA 3H3OB 1EP4A 4JS5A 3SQ4A 1NJYA 5AQQA 1BU6O 3MN5A 4DFPA 3CETA 3CC7N 2OTJN 4CJRA 5SWMA 3AO3A 3MWPA 1IKYA 4A2BA 4IEIA 1KAXA 1RT3A 4A59A 4CD1A 2DY4A 1N32K 4B1ZA 5EU7A 3V9ZA 3L4QA 3DOLA 5FLXO 2GUPA 5FPMA 4DLGA 5K14A 3GG4A 2Q0UA 2I7PA 1MDUB 4I6MB 4BWJA 3U9ZA 4BG9A 4H5RA 1N5YA 3NGYA 4GW6A 3P38A 1R59O 2F4VK 4ZTFA 5M1FA 5AQHA 2UXDK 4DQRA 4B3MK 5AZIB 1QSYA 2F9WA 2BGGA 1WNSA 4LFBK 4W5QA 4NYFA 2GUIA 3CPEA 3V9SA 3QBWA 2IGIA 3LZJA 3SAFA 4LSNA 5AFUH 3VOVA 3KIOA 4EP4A
chains in the Genus database with same CATH topology
3FZHA 4CZIA 3WXIA 1TUYA 3VERA 4HWIA 1VQ5N 3ENOA 4H5VA 2QWLA 1D4XA 3UE5A 3I8BA 2E1YA 1VQNN 2A40A 4B1VA 1BO5O 5F0XA 3KZBA 2ZWHA 3CJ9A 3IUCA 3AAQA 3WQUA 4JD2A 4WFBL 3FZMA 4H5WA 5FPDA 4E1JA 3ZX2A 4B1YB 2A41A 1TUUA 3DJCA 2VCPA 1GLFO 4FWPA 4RWTA 4O8UA 2KLAA 3G4SN 3SAGA 1YJWN 4BRKA 4EIAA 2E2NA 2QWPA 3FZFA 3E9OA 4C23A 4CBXA 3VGKA 3MN7A 3HZ6A 3WUHA 5AQPA 3DXMA 3OBYA 5KPTA 3ID8A 1DKGD 3SBGA 1Y64A 2WBNA 2VGMA 1T6CA 1O13A 2FSKA 2HMPA 3R1XA 3D2EB 4KH5A 3GOIA 3VEWA 2NRZA 4BR9A 4BGAA 5C2DA 1XUPO 3VTIA 4JKDA 3A0IX 3C6HA 1Z6RA 4FPAA 2YHWA 3NMUA 4JKHA 4CBWA 4BRPA 2UYTA 3OBWA 1HPMA 4FWRA 3J8AA 3LM9A 3CCQN 3WEEA 4FVUA 2P9SA 3CMEN 2V52B 1NJIO 3CCLN 3CERA 3O1BA 3MX2A 3CIPA 4MDBA 3CMAN 4K43A 4KH6A 3VF6A 4MDAA 3FLCO 3LL3A 3A5NC 3FZLA 1YVNA 5M1QA 1HKBA 3MN9A 1OVYA 4CJ7A 1JCGA 3I56N 1NGGA 4JK7A 2FXUA 1KD1O 2JWKA 3C65A 3FZKA 3M6GA 3CJ1A 4FWOA 4MLEA 2ASPA 4WYBA 1YUWA 1ZXOA 5F1XA 1NGAA 1S22A 3NVMA 4YORA 2P9UB 1HKGA 4BR2A 4BC3A 4DHYA 5CHIA 4U7BA 2ZJPL 1Q81O 4GVEA 4JN4A 1K9MO 1T3VA 2F7TA 3TTDA 2YJFA 4BRNA 4Y0WA 2Q0RA 3WXLA 1JCFA 2YX6A 3QDKA 2WUSA 4IXCA 5FPNA 3M5RA 4AM6A 1W2BM 1KAYA 1QQNA 3MDQA 1VQ7N 3CC2N 4GV6A 2BH1A 3GDQA 2FSJA 3LDOA 3SMPA 2YI1A 3IMXA 1NGEA 4BGBA 3QFUA 5AQXA 1TYQB 2HBKA 3UKRA 4BRDA 1QVGM 4BR4A 1NM1A 4JD2B 2HF4A 3MX5A 1VQ6N 1CZAN 3O9TA 4HTLA 4IZ9A 4JKBA 4WF9L 3OW2M 3U9DA 4WCEL 3CD6N 4WQ4A 2CGLA 3H1VX 3G25A 3W0LA 1U6ZA 4FO0A 2NRRA 2DPNA 4YOWA 3VEOA 1NGFA 3D2EA 1YJ9N 3CI5A 5BRFA 1JCEA 4B1WB 5LY3A 2E8AA 2ZGYA 4A5BA 3CCSN 3LDNA 3DXMB 4A5AA 4DB3A 1Z05A 2GWJA 3OA9A 3EE8A 3JXUA 4O8KA 2WC9A 4PHTX 3VETA 1NMDA 4BRAA 4H0OA 1VQ8N 4CZMA 5ADXH 3RVCA 1GLDG 1M1KO 2Q36A 3DWLA 4UY8O 3D2FA 3Q7BA 2P9NB 3I33A 3ATVA 3LDLA 5M1OA 3SK3A 5KQDA 2F9TA 1QZ6A 4EAHD 5JVGL 2EWSA 3Q7CA 4NLBA 5ELZA 2OTLN 3WEEB 5BPMA 3GE1A 2P9SB 4JK9A 3SMSA 4A57A 2D0OA 3CCVN 5KPZA 1BA0A 3W3DA 2E2PA 1KQSM 1Q82O 2P9UA 4B9QA 4BC4A 2OANA 1QQMA 1HX1A 3F9MA 5C10A 3BF3A 4BROA 3OHRA 5F2RA 4PL8A 5AQGA 3VEYA 1VAZA 2QTDA 3ENBA 5AQNA 3ULEA 3ZX3A 2P9LB 3TSQA 3DXKB 3MK6A 3O9SA 1VQMN 3AARA 3AAPA 1GLBG 4LC9B 1TYQA 3SBTA 4B1XB 3EN9A 4H0TB 4YDUC 2IIRA 4IEEA 3VF4A 1VQPN 2A5XA 2HSTA 3QBXA 4H5NA 4NB4A 4M7YA 1P90A 2ZJRL 5AFUA 2QW9A 5BR9A 2V7ZA 2W40A 5HL7L 1XQSC 3CC4N 4XEIA 3WXMB 3E9PA 3UKRB 1RDUA 5JLFA 2HBMA 4FOIA 3FR0A 5DM7L 1X9JA 1Q86O 2E1ZA 1VQKN 3GBTA 4BC5A 4DKWA 3VPZA 3E66A 3SAHA 2I7NA 4BY9C 3CCRN 3R8EA 3P31A 3AGRA 4ISGA 4ILHA 5AQVA 3O6WA 5LJVA 2ASMA 5EOYA 2P9IA 4A62A 3PLAA 3AY9A 4J8FA 5BN9A 4BG8A 5B8HA 4CZFA 5BRDA 2Q1NA 5GIOA 5C0YA 1EQYA 3HI0A 3CJBA 3MN6A 1MWMA 2A6AA 2P9NA 4MLHA 4IOAL 2Q31A 3M1FA 3QICA 5JMVA 3E1YA 5AQIA 3VEVA 1BDGA 3N4PA 1YHQN 3R9PA 3P4IA 5E26A 5AQLA 3BUZB 2QEXN 3TTCA 2W41A 3D2FB 4CZJA 2YCHA 5GAGP 3ZYYX 3TSUA 4C1NI 3CCUN 3BP8A 3CF5L 4JKEA 2YJEA 2NRWA 3WXKA 1LCUA 3MCPA 3VESA 2ITMA 2GELA 4BREA 4CZKA 2D1KA 3WXJA 3EL2A 2NLXA 5AQKA 5LJWA 3G71N 3EZWA 3O9QA 2P9LA 3CJCA 3GL1A 3DXKA 5AQYA 2HF3A 1MWKA 3IFRA 3H6EA 1VQ4N 3CJAA 3KWIA 5EX5A 3HTVA 5GAHP 3JS6A 1EO1A 3ULEB 3UKUA 2GTDA 3O80A 4DCHA 3FGUA 2FF3B 3T69A 3ZEUA 2QWMA 1X3MA 4H0PA 4MO4A 1HJOA 3KHYA 4FWQA 4GY2B 4A2AA 4BVOA 4BR7A 2WFBA 2E2QA 2YHYA 3O8MA 4FSVA 4MO5A 3VMFB 1KC8O 3R3LA 4ILJA 3H1QA 2E2OA 1SZ2A 5CE3A 1SQKA 1G99A 4IOXA 5GIPA 1IJJA 1KXPA 4WFAL 1K73O 4PKGA 1H1VA 5CR4A 1NGBA 1NGHA 2ZGZA 3HBTA 3CPWM 4KBOA 3S41A 2QWRA 2NZTA 3L0QA 5AQJA 1KAZA 2BUPA 2P9IB 1ATNA 1IG8A 2VYPA 4BRCA 2NRXA 2FF6A 1P8ZA 1U2VA 3TSPA 3O1WA 4JKCA 2IVPA 2P9PB 2E20A 4K41A 4OPAA 5M1NA 2Q97A 3A5OC 3EKUA 2HBJA 4JAXA 3VGMA 4BC2A 1WUAA 2CGKA 2ZJQL 4IFEA 4R79A 1GLCG 2RHKA 4NLCA 1DT9A 1W97L 1GLLO 1RDWX 1YXQA 4RTFD 2D0PA 3VGLA 4YOYA 5ADXA 3VENA 2CH6A 3A5LC 4GNIA 2J4RA 1N8RO 3HM8A 4BRGA 5EVZA 3KVGA 4M7XA 4YDUA 1NBWA 5AQMA 4ILGB 2NRVA 4Z94A 5H1SQ 4IJAA 3CHWA 1BUPA 5AZJA 2YHXA 4XH5A 2E88A 3LDPA 1SS6A 2A42A 5AQRA 4BR5A 4YOXA 2AP1A 2BTFA 3I55N 1GLEG 2D4WA 5AR0A 4YOUA 2QA4N 2JWLA 3QB0A 3VTHA 4FPBA 3E9LA 3SLCA 3UKUB 4DQ8A 1YI2N 3VEXA 1C0FA 3ZEUB 3A5MC 1ZBSA 4M63C 3ENHA 1JJ2M 4F9OA 1NGCA 2GX9A 4JNEA 1ILYA 1MA9B 4JKFA 4BRIA 5BREA 1Q18A 5AQFA 3H3NO 2AA4A 5AQWA 3HSCA 1X3NA 5GINA 1ATSA 3FE1A 1VQLN 1OKJA 1RGIA 4XH1A 2CGJA 5KPRA 2GEMA 4O5FA 3T7ZA 4L3QA 1HKCA 1S3XA 3RSEB 4NO7A 4PKHA 1K8AO 3R6MA 4IDHA 2Q2RA 3UB5A 3HOSA 3PIPL 3KWGA 4CZHA 2P9PA 3F5TA 4JK8A 2ASOA 3O9UA 4JKAA 1HLUA 4XH4A 1XC3A 5AQOA 1BA1A 4U67L 4C1NK 4PL7A 2VWBA 4BVPA 1WOQA 1S72N 4FWMA 2QWNA 5C15A 1U2VB 3O9RA 5BRHA 1E4FT 4FL9A 4JKGB 3O4WA 4JEPA 4CI6A 1NGDA 1Q7YO 1SAZA 1ZC6A 1GLAG 3TU5A 5BPLA 3CCJN 4IOCL 3G6EN 3QMLA 3CXCM 3BF1A 5AQUA 4G9ZA 4I6MA 1V4TA 5DM6L 5JLHA 2IVNA 1NGIA 5GAEP 2IVOA 4OO1J 2QI2A 1VQ9N 3EE9A 5EXWA 3WQTA 3WT0A 1BG3A 3A8YA 3C6AA 3EO3A 4OPHA 5AZIA 3ID6A 3MWTA 4WQ5A 3MCAB 4JHDA 2KKZA 2FLOA 3HRGA 1YITN 3K9KA 1HUXA 5AZJB 5JVHL 5TKYA 1NGJA 4H0YB 3M3ZA 2P9KB 3U8XA 4AF1A 1RFQA 2HBLA 3IKMA 4H0VB 1GLJO 1BWFO 1K8KA 1ESVA 4CZLA 1C0GA 1ATRA 4CZEA 4EFHA 3MMVA 4BRHA 2FSNA 2ZF5O 2GWKA 2NNWA 4QS8A 4CBUA 5KQ8A 4IJNA 4WQ5C 5C2FA 1T44A 2NRHA 3C7NB 3ZETB 4FOEA 3NVKA 5I9EB 4FWKA 3LM2A 1V4SA 3VF2A 3BEXA 3CQYA 3L4IA 4H5TA 4ISEA 3D6RA 3CCMN 2NRTA 3RSEA 2PBDA 3P39A 4H0XB 4AM7A 3CCEN 3N4QA 4K25A 5TKWA 4A61A 1M90O 1DEJA 2HOEA 4BRLA 2QXLA 4EHUA 4QS9A 4CZGA 2H3GX 1YJNN 1NWKA 4QS7A 1E4GT 3CQXA 5E84A 4YOVA 3CJ7A 1LOTB 4ISFA 3H3OB 1VQON 4BRFA 4H03B 5AQQA 3PIOL 1BU6O 3MN5A 3TTFA 4IWVA 5JICA 4JKGA 4WFNL 5M1KA 1BOTO 3CETA 4CD3A 5GADP 3CC7N 2OTJN 4KH4A 3B8AX 3J7ZO 2KHOA 4PKIA 3SJHA 2QM1A 3C0BA 3MWPA 3H45C 4A2BA 1YAGA 2PFUA 4IEIA 1KAXA 2A3ZA 1QZ5A 4GV3A 4A59A 2VGNA 5AQSA 4BRMA 4CD1A 5AQTA 2QWQA 4B1ZA 4BR0A 1YIJN 5M1PA 3L4QA 3HOTA 2V7YA 4WQ4C 1DGKN 3H46O 5BPNA 2GUPA 5MLCQ 5FPMA 1QQOA 3F2KA 3O5BA 4GV9A 2RE2A 1QVFM 2QWOA 3GG4A 2Q0UA 2I7PA 1MDUB 4I6MB 4YOTA 4B1UB 3U9ZA 4BG9A 4H5RA 3TPQA 3FFKB 3ZX0A 1YF5L 4FWNA 5FPEA 4IO9L 5BN8A 3P38A 1R59O 3LDQA 5HOOA 3VEZA 2P9KA 3AGKA 3U4LA 4EHTA 5M1FA 1J6ZA 3KK7A 5AQHA 5C12A 1NLVA 3L6QA 4RCHA 5AZIB 2F9WA 4FWLA 4JHDB 3DLLL 3QFPA 1T6DA 4IO8A 4BRQA 3C7NA 3ZETA 4BQLA 2V51B 3CPEA 3O08A 1K8KB 3QBWA 3K9JA 5EY4A 4K42A 2CH5A 3SAFA 3EKSA 5AQZA 3DAWA 1QHAA 3D7EO 5AFUH 3ATUA 3IDHA 4FWSA 3VOVA 4BQZA 2PAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFE A;  5M1O A;  4IEI A;  5M1P A;  5C10 A;  5C15 A;  5M1F A;  5M1N A;  5C12 A;  5M1K A;  5C2D A;  4IDH A;  4IEE A;  3C6A A;  3C6H A;  5M1Q A;  5C2F A;  3CPE A; 
#chains in the Genus database with same CATH topology
 1N33 K;  4CHZ A;  3THX A;  3VER A;  4HWI A;  4FJ7 A;  3ENO A;  3NFA A;  2KZM A;  3L2Q A;  4DR5 K;  4GVM A;  1VRT A;  1BO5 O;  2O8D A;  2ZWH A;  3T1Y K;  2YV0 X;  3VQD A;  3ZX2 A;  4B1Y B;  1TUU A;  1U48 A;  3J7A P;  1XHX A;  4L8R B;  4FWP A;  4CEO A;  4RWT A;  1Q9Y A;  4CJ5 A;  1RBR A;  4CBX A;  5C24 A;  3MAQ A;  5AQP A;  4OX9 K;  1O13 A;  2FSK A;  4CCH A;  4KH5 A;  3VEW A;  3GOI A;  4OJR A;  3SV3 A;  1RT7 A;  3LZI A;  1FXX A;  3QET A;  3NF7 A;  1LW2 A;  2EX3 A;  2UYT A;  5C42 A;  4FVU A;  3CME N;  3OYE A;  4ZTJ A;  4NXM K;  4KH6 A;  4MDA A;  3LL3 A;  3A5N C;  4I9Q A;  3MN9 A;  4JV5 K;  1OVY A;  1EET A;  2HHQ A;  4IG0 A;  1RT5 A;  3QES A;  1XNR K;  4JK7 A;  1KFD A;  2FXU A;  2JWK A;  4MLE A;  4WYB A;  3BY5 A;  1NGA A;  4YOR A;  3TAQ A;  3MXM A;  3NH1 A;  1HKG A;  4DHY A;  2ZJP L;  1Q81 O;  2DFH A;  1K9M O;  3TTD A;  3C6T A;  3O4N A;  1S1V A;  2YX6 A;  3QDK A;  5KGX A;  4LF6 K;  2KQ2 A;  1TVR A;  3MDQ A;  2OPR A;  3GDQ A;  4HTU A;  3SMP A;  4B3S K;  1NGE A;  3AVI A;  5AQX A;  3UKR A;  4BRD A;  4DFK A;  1NK0 A;  2HF4 A;  4PA1 A;  3U9D A;  4B9U A;  5A2Q O;  2HHH K;  1X9W A;  4JI1 K;  3H1V X;  3W0L A;  2NRR A;  3VEO A;  3KLF A;  1NGF A;  3S3O A;  5BRF A;  1JCE A;  4Q5V A;  4JI2 K;  5LY3 A;  3THY A;  3LDN A;  5FDL A;  3OA9 A;  4DTJ A;  1HR0 K;  4NCA A;  4BRA A;  4H0O A;  1VQ8 N;  2G8H A;  4DTM A;  1GLD G;  1NJZ A;  3D45 A;  2P9N B;  3I33 A;  3ATV A;  3CG7 A;  1J9A A;  2HHW A;  3WEE B;  5BPM A;  3SMS A;  2D0O A;  1E3M A;  3KK2 A;  1Q82 O;  2OAN A;  4DWI A;  5C10 A;  3F9M A;  3RRG A;  2VQF K;  4M3Z A;  5BR8 K;  2R7Y A;  4M3W A;  4CEC A;  3AVJ A;  3PUF A;  4EZ9 A;  5JS1 A;  3AAP A;  4JI3 K;  4KTQ A;  1TYQ A;  3EN9 A;  1BIU A;  4H4M A;  1VQP N;  4AHC A;  1QHT A;  5HRO A;  1HYV A;  5BR9 A;  2W40 A;  1EX4 A;  4DFM A;  3E9P A;  5JLF A;  2EHG A;  1NK6 A;  2OPQ A;  1X9J A;  4BC5 A;  4CEA A;  2Y1I A;  2ASM A;  5EOY A;  4QOZ B;  2P9I A;  4CJQ A;  4CK2 A;  5BN9 A;  4E0D A;  5BRD A;  5GIO A;  5C0Y A;  1LWC A;  3MN6 A;  2XY7 A;  3L2R A;  3CM5 A;  2Q31 A;  3QIC A;  3OYN A;  1BCO A;  3P4I A;  5E26 A;  5AQL A;  3BUZ B;  1VSE A;  2QEX N;  3TTC A;  2W41 A;  2YCH A;  5GAG P;  4DU3 A;  3ZYY X;  4JS4 A;  3BDP A;  3LAN A;  5CY4 A;  2GEL A;  4CZK A;  4BAC A;  3EL2 A;  5LJW A;  3O9Q A;  4DSE A;  2P9L A;  5AQY A;  3AVL A;  2KW4 A;  4B9S A;  1S1X A;  5J2P A;  3HTV A;  3JS6 A;  1EO1 A;  4LD0 A;  2GTD A;  2UU9 K;  4DCH A;  3T69 A;  3ZEU A;  4CEQ A;  2QWM A;  1X3M A;  3HPG A;  4H0P A;  1O1W A;  4MO4 A;  1LV5 A;  3PX4 A;  2KTQ A;  4FWQ A;  3F9K A;  1GOA A;  2HHU A;  4BVO A;  4BR7 A;  4FJH A;  3AA3 A;  3KTQ A;  1IO2 A;  3O8M A;  4FSV A;  3R3L A;  1VSI A;  3OJS A;  1SZ2 A;  1DLO A;  4WFA L;  4FJJ A;  1H1V A;  2YNG A;  4FJI A;  1B9F A;  1JLG A;  1TKZ A;  1D9D A;  4KHQ A;  2NRX A;  3MED A;  1T8E A;  3LP1 A;  1U2V A;  3KD5 E;  2YNH A;  4PUO A;  4K41 A;  3T1H K;  1U49 A;  3H08 A;  4LSL A;  3AO2 A;  3VGM A;  2CGK A;  4IFE A;  2RHK A;  5CYQ A;  4YHH K;  2OPS A;  4JRQ A;  1YXQ A;  3AA4 A;  4Z4F A;  3VEN A;  3OYG A;  1FKO A;  5EVZ A;  3VQ4 A;  4M7X A;  3SV4 A;  2W42 A;  1BUP A;  3C95 A;  1S9E A;  3I55 N;  1GLE G;  4KI6 A;  4YOU A;  3CM6 A;  3VTH A;  2O8B A;  4FPB A;  3UKU B;  1U4B A;  1C0F A;  1RCH A;  4M63 C;  1VSJ A;  2LSN A;  3VQ5 A;  4W5T A;  3NE6 A;  2HVI A;  1RTH A;  1Q18 A;  3IG1 A;  4CJS A;  4DF4 A;  2UXB K;  3AVF A;  2Z1G A;  1OKJ A;  3LPU A;  4CF9 A;  4XH1 A;  4LFC K;  3AVK A;  4O5F A;  3T7Z A;  4OVL A;  2E5L K;  5KRT A;  4CF8 A;  1WSI A;  2Q2R A;  3F5T A;  4JK8 A;  4C1N K;  2VWB A;  2QWN A;  5C15 A;  4HUG A;  4HUE A;  3NF9 A;  4FL9 A;  3O4W A;  4JEP A;  1ZC6 A;  4I9L A;  1ASV A;  1Z25 A;  1A5W A;  5HRS A;  3BF1 A;  5AQU A;  4KB0 A;  3LAL A;  4I6M A;  5J2N A;  1HMV A;  2VWJ A;  4OO1 J;  1VSL A;  3QER A;  3EE9 A;  1JKH A;  4ELV A;  3WQT A;  4CJ4 A;  5AZI A;  3ID6 A;  4FJ9 A;  3HRG A;  4CFC A;  3U8X A;  1NGJ A;  4KV8 A;  3HST B;  3IKM A;  5HRR A;  4CEE A;  3OYL A;  1ESV A;  4CZL A;  4E7L A;  3MMV A;  4OLB A;  2ZF5 O;  4B08 A;  4J2E A;  4Q0B A;  1UAX A;  5I9E B;  3L3V A;  3LM2 A;  4RW8 A;  2PYL A;  1J5E K;  3BEX A;  5D3G A;  3AVM A;  3D6R A;  3WNG A;  3S3M A;  2G8U A;  3K2P A;  2X6S A;  5CZ2 A;  2HOE A;  4EHU A;  4F4K A;  2H3G X;  1I39 A;  4C8L A;  1E4G T;  3M8Q A;  4YOV A;  1U45 A;  4J2B A;  1CZ9 A;  4CJU A;  4H03 B;  3PIO L;  3MEG A;  1TKT A;  2IOC A;  4CD3 A;  5GAD P;  4I2P A;  3B8A X;  4X64 K;  4FLW A;  4FK4 A;  2KHO A;  4PKI A;  4O44 A;  3H45 C;  2PFU A;  1L3S A;  3DLE A;  4JLH A;  1QZ5 A;  1WB9 A;  4GV3 A;  3TAF A;  2QWQ A;  5M1P A;  5CZ1 A;  2V7Y A;  1DGK N;  5BPN A;  4LF4 K;  1QQO A;  3O5B A;  2RE2 A;  2QWO A;  1VSD A;  3OJU A;  4FWN A;  5BN8 A;  3SYZ A;  5HOO A;  3V1Q A;  1SV5 A;  3AGK A;  1TGO A;  1MU2 A;  2P1J A;  3L6Q A;  4RCH A;  1QSS A;  3DLL L;  1J5O A;  1RT4 A;  1W0H A;  1K8K B;  1ZBL A;  4JI8 K;  4Y1D A;  5EY4 A;  2O8F B;  3EKS A;  3D7E O;  4RG8 A;  1S1T A;  3ATU A;  1VQ5 N;  4BQZ A;  2HMI A;  1NK9 A;  3HVT A;  4AHS A;  4CZI A;  3WXI A;  3K5L A;  1TUY A;  4H5V A;  2QWL A;  4FLZ A;  2ITG A;  3UE5 A;  2KFZ A;  2E1Y A;  4CE9 A;  1VQN N;  3KZB A;  3CJ9 A;  3IUC A;  3WQU A;  2FBY A;  2PY5 A;  1WBB A;  4CJE A;  2VCP A;  1BL3 A;  1GLF O;  4JI6 K;  3SAG A;  4FK0 A;  1C0M A;  1SKR A;  1Q9X A;  2QWP A;  4KHN A;  3AVN A;  2FC0 A;  1TL3 A;  2HHS A;  3OBY A;  3ID8 A;  4IBN A;  2VGM A;  2IS3 A;  2HNY A;  3ZSZ A;  2HMP A;  3OS2 A;  1BGX T;  4BGA A;  5C2D A;  2DTU A;  1XUP O;  4CEB A;  2O8E B;  3PX0 A;  3C6H A;  4Z4C A;  1Z6R A;  4BRP A;  4AHR A;  4FWR A;  3J8A A;  2VQE K;  3WEE A;  2V52 B;  1NJI O;  3EY1 A;  3CER A;  3CIP A;  2B4J A;  2W6L A;  1EWQ A;  1YVN A;  5M1Q A;  4FZY A;  4F3O A;  2HHX A;  3C65 A;  3M6G A;  3CJ1 A;  4FWO A;  2ASP A;  1ZXO A;  2P9U B;  4BC3 A;  4I7F A;  4JN4 A;  1T3V A;  2F7T A;  4FM0 A;  2YJF A;  3WXL A;  1JCF A;  4IXC A;  2WUS A;  1VSF A;  4AM6 A;  4B9V A;  1T05 A;  3DRS A;  2UUB K;  3IMX A;  4J2A A;  1WSG A;  3AA5 X;  4ID1 A;  4IZ9 A;  4DUY K;  5LL6 Z;  3CD6 N;  1CZB A;  4E89 A;  1U6Z A;  1TL1 A;  2YKM A;  4YOW A;  3D2E A;  3CI5 A;  3NAE A;  4XIU A;  3L2V A;  4B1W B;  2E8A A;  4A5B A;  3CCS N;  3DXM B;  3I8D A;  4JI0 K;  3G0Z A;  2GWJ A;  3LWM A;  4CJW A;  4DQP A;  4CGG A;  3JXU A;  4PHT X;  2WC9 A;  3VET A;  1NMD A;  3HL8 A;  5ADX H;  4O0J A;  4YFU A;  3LDL A;  5M1O A;  2F9T A;  1QZ6 A;  2A1S A;  3HYF A;  3GE1 A;  2P9S B;  4A57 A;  4YY3 K;  3OYD A;  1BI4 B;  1DTT A;  3FFI A;  1KQS M;  3ZT2 A;  2OA8 A;  2QXF A;  4BC4 A;  4X65 K;  1HX1 A;  4B9T A;  3QO9 A;  3V1O A;  4DS4 A;  3C94 A;  4DV5 K;  2QTD A;  3ENB A;  5AQN A;  3KK1 A;  3AO1 A;  3TAM A;  1IKV A;  4JRP A;  1HNZ K;  1GLB G;  4DTX A;  3G10 A;  4E7J A;  4IEE A;  3VF4 A;  2A5X A;  2HST A;  1KLM A;  1REV A;  2WOM A;  4DQS A;  4H4O A;  4XEI A;  1IG9 A;  3WXM B;  1VRU A;  4FOI A;  4CK1 A;  1VQK N;  2E1Z A;  3GBT A;  4BY9 C;  3SAH A;  2I7N A;  3CCR N;  4DG1 A;  3P31 A;  3ZCM A;  4CHP A;  2FBV A;  3AA2 A;  5LJV A;  5HRN A;  2YNI A;  3PLA A;  3L2W A;  4OKJ A;  4OLA A;  3AY9 A;  1T03 A;  1QQC A;  3ZT4 A;  4CZF A;  5B8H A;  2QKK A;  4FJL A;  1MWM A;  4MLH A;  3HM9 A;  3M1F A;  4DV2 K;  3K0S A;  5JMV A;  5AQI A;  3VEV A;  2QKB A;  1BDG A;  1XI1 A;  3BZC A;  3MXI A;  2FBT A;  3D2F B;  4PY5 A;  4CZJ A;  4GKJ K;  4DSK A;  1RDC A;  1UA0 A;  4JKE A;  4FLV A;  4N56 A;  4IFY A;  4ELT A;  1XWL A;  2D1K A;  3WXJ A;  2NLX A;  2OZM A;  3KJV A;  4DU4 A;  3P5J A;  4KO0 A;  2UXC K;  3GL1 A;  2GBZ A;  3DXK A;  3H6E A;  1X1P A;  1XMQ K;  3TR8 A;  3VQ7 A;  3V6D A;  5EX5 A;  1U04 A;  3UKU A;  3ULE B;  3SUQ A;  3BGR A;  2FF3 B;  4WE1 A;  4TSX A;  2Y1J A;  4DTN A;  1T7P A;  4DTR A;  4FK2 A;  4F2R A;  3VQC A;  2O8C B;  2NUB A;  4DR6 K;  4LF5 K;  4MO5 A;  3VMF B;  4DV1 K;  1KC8 O;  1NU0 A;  1KTQ A;  1A5X A;  2E2O A;  1SQK A;  3HPH A;  1HNX K;  3DLH A;  1NK4 A;  1KXP A;  4PWD A;  4CFA A;  3CPW M;  5J1E A;  2QK9 A;  5AQJ A;  1VSM A;  2A1R A;  1P8Z A;  3O1W A;  2IVP A;  1KVA A;  2P9P B;  2E20 A;  3LWL A;  4OPA A;  3QEX A;  1WBD A;  4DSF A;  2HBJ A;  1NKB A;  4BC2 A;  1WUA A;  4B8C A;  2ZJQ L;  4R79 A;  4NLC A;  3VGL A;  5J2M A;  3A5L C;  2J4R A;  2UUA K;  4CER A;  3KVG A;  3RWU A;  5AQM A;  4X66 K;  4Z94 A;  4IJA A;  3V81 A;  3CYM A;  4XH5 A;  1HPZ A;  2E88 A;  2YNF A;  4YOX A;  5AQR A;  1L3T A;  4M3U A;  3OYB A;  2AP1 A;  4H8K A;  4LY7 A;  3KLE A;  1BHL A;  2QA4 N;  2JWL A;  3QB0 A;  3TAR A;  1KRP A;  3T19 A;  4LF7 K;  1HJR A;  3THV A;  1QSL A;  1ILY A;  4IG3 A;  4ELU A;  3AO5 A;  4FJG A;  3V9X A;  4CEZ A;  4CED A;  3O4Q A;  3ZSV A;  4CES A;  4CHQ A;  5KPR A;  1UOC A;  1HKC A;  1VSK A;  4NCG A;  4NO7 A;  3OYF A;  2Q3S A;  1JLE A;  1SL0 A;  3HOS A;  3PIP L;  3KWG A;  4CZH A;  1KVC A;  3O9U A;  4JKA A;  4PL7 A;  4U67 L;  1ZBH A;  4FWM A;  3LAK A;  1TAU A;  5BRH A;  3T3F A;  1E4F T;  3VA3 A;  1NGD A;  1HYS A;  5IT9 O;  1SAZ A;  4CGJ A;  1BIS A;  3CCJ N;  1S1U A;  4CIF A;  3THW A;  5DM6 L;  5JLH A;  3DLR A;  2IVN A;  1ZBF A;  2IVO A;  1C1B A;  3V9W A;  3B6O A;  3OS0 A;  2QI2 A;  1VQ9 N;  2XRI A;  3C6U A;  2ZE2 A;  3HJF A;  3EO3 A;  1S9G A;  4WQ5 A;  2FLO A;  4BDY A;  1YIT N;  3K9K A;  1HUX A;  5AZJ B;  4H0Y B;  5SZT A;  4KRF A;  1RNH A;  1RFQ A;  4H0V B;  3DLG A;  4DF8 A;  3LDS A;  1BWF O;  1K8K A;  2O8F A;  1ATR A;  4EFH A;  4F3T A;  2NNW A;  2GWK A;  3ZSX A;  4CBU A;  5KQ8 A;  5C2F A;  3O3F A;  1T44 A;  1HQU A;  3RTV A;  3NVK A;  2RN2 A;  2BDP A;  1NK8 A;  5T7B A;  3L4I A;  3DRR A;  3CCM N;  2NRT A;  3RSE A;  4DV0 K;  4AM7 A;  4H0X B;  3CCE N;  1VHX A;  3N4Q A;  4A61 A;  3EZ5 A;  1M90 O;  3THX B;  5JS2 A;  2F8S A;  4QS9 A;  1YJN N;  1CXQ A;  5E84 A;  3CJ7 A;  1LOT B;  3IS9 A;  1VQO N;  4BRF A;  4DMN A;  2O8D B;  4BE2 A;  3TTF A;  4IWV A;  4FJN A;  5JIC A;  4JKG A;  1KFS A;  1OH7 A;  1EWR A;  5M1K A;  1IV0 A;  4BWM A;  3ZT3 A;  4KH4 A;  3SQ2 A;  1N36 K;  1IBM K;  4M41 A;  2HNZ A;  2QM1 A;  3C0B A;  4B3R K;  4NCB A;  2A3Z A;  2O8E A;  4W5N A;  2VGN A;  5AQS A;  5AQT A;  4BR0 A;  1NK5 A;  3SPY A;  3RMB A;  1ASW A;  3HOT A;  4WQ4 C;  3LP3 A;  3DYA A;  5MLC Q;  1QVF M;  3F2K A;  3SUN A;  4GV9 A;  4B9M A;  4FCY A;  4E3S A;  2GV9 A;  4IO9 L;  3TPQ A;  3FFK B;  1D9F A;  3LDQ A;  1QS4 A;  3VEZ A;  2P9K A;  3KK7 A;  5C12 A;  4FWL A;  4O0I A;  3QFP A;  1T6D A;  1WSF A;  3C7N A;  3ZET A;  4BQL A;  2DFF A;  2V51 B;  4KI4 A;  2ZM6 K;  3K9J A;  4K42 A;  5AQZ A;  3IDH A;  4FWS A;  2PAV A;  4DTU A;  3K5M A;  3CFP A;  3DLK A;  3FZH A;  3VQ8 A;  3PSI A;  1JLQ A;  2UUC K;  1D4X A;  5F0X A;  2FBX A;  3AAQ A;  3AVA A;  4DS5 A;  1XC9 A;  3FZM A;  5FPD A;  4K0K K;  2A41 A;  4BE1 A;  1HNI A;  4FJK A;  1IKX A;  3VQB A;  1QTM A;  2KLA A;  4CJP A;  3NF6 A;  4B9N A;  1YJW N;  4EIA A;  2E2N A;  3FZF A;  3IRX A;  3E9O A;  4C23 A;  3VGK A;  3MN7 A;  3VQ9 A;  1FKP A;  4OKK A;  1I3A A;  3DXM A;  1RBU A;  5KPT A;  1T6C A;  4CEF A;  4JI5 K;  3R1X A;  2RPI A;  4KFB A;  3NH2 A;  1ITG A;  4CIE A;  3V9U A;  3VTI A;  4CHN A;  3THY B;  4JKD A;  4GMJ B;  2YHW A;  4KTW A;  3OYA A;  4CBW A;  4DQQ A;  2P9S A;  3CCL N;  3O1B A;  3MX2 A;  3CMA N;  1RBT A;  3VF6 A;  1BI4 A;  1X9S A;  2DFE A;  1L5U A;  3KLH A;  1JCG A;  3VQQ A;  1C1A A;  3QLH A;  1KD1 O;  3EYZ A;  3FZK A;  5F1X A;  1WSE A;  4DV3 K;  1S22 A;  4FJX A;  4BR2 A;  5CHI A;  4U7B A;  2KZZ A;  4GVE A;  2VG5 A;  1ASU A;  4BRN A;  2Q0R A;  3V4I A;  1IH7 A;  4BDP A;  3NHG A;  1VQ7 N;  1KAY A;  1QQN A;  4Z4I A;  3S9H A;  2BH1 A;  2YI1 A;  3QFU A;  1TYQ B;  2HBK A;  4MFB A;  4BR4 A;  3TAB A;  4JD2 B;  4HTL A;  3M8P A;  3O9T A;  3OW2 M;  4AIL C;  4Z4E A;  1RDA A;  4WQ4 A;  2CGL A;  3AVH A;  1UWB A;  4FO0 A;  3EEQ A;  2DPN A;  2WON A;  3SNN A;  3ALY A;  1K6Y A;  5LMU K;  3M8R A;  4DB3 A;  5I42 A;  3EE8 A;  4B8A B;  4CZM A;  3RVC A;  1M1K O;  3DWL A;  4AHV A;  4N5S A;  4UY8 O;  3D2F A;  3SK3 A;  4RW7 A;  5KQD A;  1FJG K;  5JVG L;  4EAH D;  2OTL N;  2EWS A;  3Q7C A;  4NLB A;  2ETJ A;  4JK9 A;  4O5B A;  5KPZ A;  4B9Q A;  3SQ1 A;  2HVH A;  4HCC A;  4NXN K;  2D5R A;  3BF3 A;  4DSL A;  3RMD A;  4BRO A;  5C25 A;  3OYH A;  3ULE A;  3SPZ A;  3ZX3 A;  2P9L B;  3MK6 A;  3O9S A;  1VQM N;  1JL2 A;  3HPO A;  3SBT A;  2O8C A;  4H5N A;  4NB4 A;  2JLE A;  2ZJR L;  5AFU A;  1Z26 A;  4UQG A;  2QW9 A;  5CYM A;  2V7Z A;  2YHB A;  5HL7 L;  1XQS C;  3OYM A;  3CC4 N;  1RDU A;  3FR0 A;  4ID5 A;  5DM7 L;  1Q86 O;  4FLX A;  4DKW A;  4AHT A;  3E66 A;  3R8E A;  4ISG A;  4ILH A;  3HT3 A;  1WAJ A;  3O6W A;  5AQV A;  1BQM A;  4KHP K;  2XY6 A;  1NNE A;  3CFO A;  4DU1 A;  2Q1N A;  4HHT A;  3CJB A;  2A6A A;  2P9N A;  4IOA L;  4CF2 A;  4B3T K;  3N4P A;  1YHQ N;  3RR7 A;  3R9P A;  5DMR A;  3VQE A;  2B5J A;  3TAE A;  5HRP A;  1HNV A;  3CCU N;  3BP8 A;  4DR2 K;  4IFV A;  3SCX A;  3CF5 L;  3L3U A;  1SUQ A;  3WXK A;  4CJT A;  1W7A A;  2ITM A;  4DR1 K;  1I94 K;  2OPP A;  4BRE A;  4CJ3 A;  5AQK A;  1RBV A;  3ZT1 A;  3NGI A;  3EZW A;  1WN7 A;  2KFN A;  3CJC A;  2HF3 A;  1MWK A;  1VQ4 N;  3PSF A;  4K8X A;  5GAH P;  3QIO A;  1NKE A;  3DLB A;  1RTD A;  4F2S A;  3JAM O;  1RIL A;  1FK9 A;  4GY2 B;  2VG6 A;  1TKX A;  1IKW A;  4CIG A;  1CXU A;  2E2Q A;  2YHY A;  4QAG A;  3ISN C;  3ITH A;  3DI6 A;  1G15 A;  3VQ6 A;  4OPK A;  1OH5 A;  3AVG A;  2XY5 A;  4PKG A;  1NGB A;  2AJQ A;  2ZGZ A;  2QWR A;  2NZT A;  3OVN A;  4CFB A;  4OPJ A;  4DQI A;  1KAZ A;  1IG8 A;  2VYP A;  3SZ2 A;  4OGE A;  4FJ8 A;  1U47 A;  2X6N A;  3TSP A;  4Z4G A;  1J53 A;  2D0C A;  4KHW A;  3EKU A;  3M8S A;  3ASM A;  4FLY A;  4FXD A;  1W97 L;  2VWK A;  4RTF D;  4M3T A;  3ZSR A;  2CH6 A;  3U3Y A;  4HVJ A;  3HVR A;  3RMA A;  3HM8 A;  4BRG A;  1LAV A;  1NBW A;  2NRV A;  3QEW A;  4E19 A;  5H1S Q;  5AZJ A;  3SI6 A;  2D0B A;  4E7H A;  4BR5 A;  3VQA A;  4BDZ A;  3PO4 A;  5HBM A;  4KPY A;  4OKE A;  2D4W A;  1VK0 A;  1C6V A;  1NOY A;  3SLC A;  3ZSQ A;  1JXE A;  3VEX A;  5HP1 A;  3ULD A;  4DTP A;  3A5M C;  1ZBS A;  3ENH A;  2XHB A;  1JJ2 M;  2YHA A;  4JKF A;  1NK7 A;  1TK0 A;  2XY8 A;  5BRE A;  1X9M A;  4N76 A;  3H3N O;  3K57 A;  3HSC A;  4KAZ A;  1X3N A;  3HK2 A;  3TAP A;  1RGI A;  1WAF A;  4L3Q A;  1S3X A;  4E7I A;  3KLG A;  1NG9 A;  3E01 A;  3QIN A;  3KD1 E;  4IDH A;  3VA0 A;  2HND A;  4DFJ A;  1RT1 A;  2G8W A;  1IBK K;  1XC3 A;  4LH5 A;  3K59 A;  5AQO A;  1BA1 A;  1C0U A;  4BVP A;  1WOQ A;  1S72 N;  1JLA A;  4YNQ A;  4CVN E;  1LWE A;  4QCL A;  1GLA G;  3TU5 A;  5BPL A;  2E6M A;  5IWA K;  1NMN A;  1QE1 A;  3DM2 A;  3J80 O;  3SJJ A;  4DUZ K;  3K5N A;  4K8Z A;  5DK5 A;  4OPH A;  3MCA B;  5E41 A;  1S1W A;  5KRS A;  4AF1 A;  1RTI A;  2HBL A;  3TWH A;  1GLJ O;  3O3H A;  3T1A A;  4FVM A;  1KLN A;  3L2U A;  3OYI A;  4WQ5 C;  3KKR A;  2NRH A;  4FOE A;  3LPT A;  3VF2 A;  3CQY A;  4H5T A;  3AV9 A;  3KKS A;  2XO7 A;  2PBD A;  3P39 A;  3QEP A;  5J2Q A;  4CHO A;  1DEJ A;  4CFD A;  4BRL A;  2X78 A;  3BZK A;  1BCM A;  1NWK A;  3CQX A;  1D8Y A;  4ISF A;  3HXM A;  4WFN L;  4LF8 K;  4DTS A;  1BOT O;  2G8I A;  3WNH A;  2BE2 A;  1C0T A;  1HYZ A;  1ZYQ A;  4E1M A;  4FJM A;  3J7Z O;  1OVQ A;  3SJH A;  1YAG A;  4NYN A;  4ICL A;  3NBP A;  4N41 A;  4BRM A;  1TAQ A;  1YIJ N;  4RW9 A;  2PYJ A;  3H46 O;  1DTQ A;  4YOT A;  4E7K A;  4B1U B;  5FPE A;  3ZX0 A;  1B9D A;  1YF5 L;  2B6A A;  2ZD1 A;  3U6F A;  3U4L A;  4EHT A;  1J6Z A;  3F73 A;  3ZSW A;  1NLV A;  3HP9 A;  3CFR A;  5FRN A;  4JHD B;  3OYJ A;  4C8O A;  4IO8 A;  4BRQ A;  4DV4 K;  1OH6 A;  3O08 A;  1KCF A;  1RT6 A;  2CH5 A;  1XHZ A;  1Y97 A;  3DAW A;  1QHA A;  1IBL K;  2Z1I A;  2P5O A;  4CW7 B;  2E4L A;  1L3V A;  1YTU A;  4OGC A;  5FRM A;  3I8B A;  2A40 A;  4B1V A;  4JD2 A;  4WFB L;  4DLE A;  4H5W A;  4E1J A;  3DJC A;  3J7Y P;  3KK3 A;  4O8U A;  3G4S N;  1JLB A;  4BRK A;  3HZ6 A;  3WUH A;  3OS1 A;  4RW6 A;  4N47 A;  3NGZ A;  1DKG D;  3SBG A;  1Y64 A;  2WBN A;  3D2E B;  2HW3 A;  1OH8 A;  2NRZ A;  4BR9 A;  3AVB A;  3A0I X;  3AO4 A;  3DOK A;  4FPA A;  3ZLJ A;  4JKH A;  3ZSO A;  1XNQ K;  3NMU A;  3OBW A;  1HPM A;  2RKI A;  3LM9 A;  3CCQ N;  4KB1 A;  4IKF A;  4MDB A;  4K43 A;  3FLC O;  1C1C A;  2E6L A;  2BAN A;  3FZL A;  2HHV A;  1TK5 A;  1HKB A;  1LWF A;  4CJ7 A;  3I56 N;  4FM2 A;  1NJW A;  1NGG A;  3NH0 A;  4FJ5 A;  1YUW A;  3NVM A;  4DSI A;  1XMO K;  5FRO A;  4CGD A;  3OY9 A;  4B3O A;  2D0A A;  4Y0W A;  5FPN A;  3M5R A;  1W2B M;  3A2F A;  1LW0 A;  3CC2 N;  4GV6 A;  2FSJ A;  3LDO A;  3VQP A;  4BGB A;  4BE0 A;  3CQ8 A;  2HB5 A;  1QVG M;  1NM1 A;  3MX5 A;  1VQ6 N;  1CZA N;  3I0R A;  4WF9 L;  4JKB A;  3TAG A;  4WCE L;  4E1N A;  4FLU A;  3G25 A;  4V19 S;  4B9L A;  1CLQ A;  3B6P A;  3QNN A;  1YJ9 N;  1HRH A;  2ZGY A;  3PO5 A;  2O4G A;  4Z4H A;  1EXQ A;  4A5A A;  1Z05 A;  4O8K A;  3HP6 A;  1LAW A;  4M3Y A;  2Q36 A;  3Q7B A;  4CJV A;  3V1R A;  2P5G A;  3QEI A;  4DSJ A;  5ELZ A;  3CCV N;  3S3N A;  5LMN K;  4G1Q A;  1BA0 A;  3SQ0 A;  1NKC A;  3W3D A;  4DR4 K;  2E2P A;  1JLC A;  2P9U A;  4AQY K;  4GKK K;  1QQM A;  1TV6 A;  1B92 A;  3K5O A;  3OHR A;  3WNF A;  3TAN A;  1UA1 A;  5F2R A;  4PL8 A;  5AQG A;  3VEY A;  1VAZ A;  1WSJ A;  4M42 A;  1D5A A;  3AVC A;  3TSQ A;  1YT3 A;  3DXK B;  3HO1 A;  3AAR A;  4LC9 B;  4KTZ A;  1HNW K;  4B1X B;  4YDU C;  4H0T B;  4CJL A;  2IIR A;  4FYD A;  3QBX A;  2O4I A;  4M7Y A;  1P90 A;  4M45 A;  2IDO A;  2Z1H A;  4DR3 K;  3MEC A;  3OTO K;  3UKR B;  3UIQ A;  3LAM A;  2HBM A;  4FLT A;  3VPZ A;  2Z1J A;  3AGR A;  1HQE A;  4Y1C A;  1ZBU A;  4A62 A;  3D0P A;  4DV7 K;  4CF1 A;  4JI4 K;  4J8F A;  4BG8 A;  1BIZ A;  1NOZ A;  3OYC A;  1N34 K;  1EQY A;  3HI0 A;  2ZQB A;  4I2Q A;  4CGH A;  1N6Q A;  3IAY A;  3J81 O;  3E1Y A;  2G8F A;  3O3G A;  4EP5 A;  2RF2 A;  1FW6 A;  4J2D A;  1BQN A;  3NDK A;  1KVB A;  1S5J A;  3TSU A;  4C1N I;  5KI6 A;  4C8K A;  4W5O A;  4KRE A;  2YJE A;  2NRW A;  1KSP A;  1LCU A;  3MCP A;  2JGU A;  3VES A;  4KHU A;  4AHU A;  3G71 N;  3PX6 A;  3QIP A;  3L8B A;  3IFR A;  1SKS A;  3CJA A;  3KWI A;  4AH9 A;  1JXB A;  3O80 A;  4CGI A;  4X62 K;  3FGU A;  2VG7 A;  3KLI A;  2ATQ A;  1HJO A;  4DR7 K;  2P51 A;  3KHY A;  4HUF A;  1YVU A;  3TI0 A;  4KHY A;  4A2A A;  1GOC A;  4O55 A;  2WFB A;  2F8T A;  2HHT A;  4ILJ A;  3H1Q A;  2IC3 A;  1F21 A;  5CE3 A;  4LF9 K;  1SKW A;  1G99 A;  4IDK A;  4IOX A;  4JYA K;  5GIP A;  1IJJ A;  1K73 O;  5CR4 A;  4FZZ A;  1NGH A;  4MQ3 A;  3HBT A;  4KBO A;  3MXJ A;  3S41 A;  3ZT0 A;  3L0Q A;  1SL2 A;  2BUP A;  2P9I B;  1ATN A;  3K58 A;  5I3U A;  4FW1 A;  3DRP A;  4BRC A;  4CJF A;  1S6Q A;  3JYT A;  2FF6 A;  3I0S A;  4M3R A;  4JKC A;  3RRH A;  2G8V A;  1GOB A;  5M1N A;  2Q97 A;  3A5O C;  3DMJ A;  4JAX A;  1L3U A;  1JL1 A;  4CF0 A;  1GLC G;  3PV8 A;  1DT9 A;  1NJX A;  3ZSY A;  1GLL O;  1RDW X;  2D0P A;  3PY8 A;  4FZX C;  3THW B;  4YOY A;  2OYQ A;  5ADX A;  4GNI A;  3NF8 A;  1N8R O;  4YDU A;  4DV6 K;  4ILG B;  4JI7 K;  1VSH A;  1RDB A;  3CHW A;  1SL1 A;  2YHX A;  5HLF A;  3LDP A;  1SS6 A;  2A42 A;  5AJ3 K;  3VN5 A;  4CGF A;  4CJK A;  2BTF A;  1A5V A;  3U3G A;  1W9H A;  5AR0 A;  3JSM A;  1S6P A;  3E9L A;  3NCI A;  4DQ8 A;  1YI2 N;  3ZEU B;  3SUO A;  2F96 A;  4F9O A;  1NGC A;  2GX9 A;  4JNE A;  1MA9 B;  4HCB A;  1WSH A;  4BRI A;  4KHS A;  3P1G A;  3SUP A;  5AQF A;  4M3X A;  2AA4 A;  4CHY A;  5AQW A;  5GIN A;  1ATS A;  3FE1 A;  1VQL N;  2W6K A;  2CGJ A;  2GEM A;  3RSE B;  3WNE A;  1RDD A;  3P83 D;  4PKH A;  2OZS A;  1K8A O;  1RBS A;  2IAJ A;  3R6M A;  3LP0 A;  3UB5 A;  1Q8I A;  1TK8 A;  2P9P A;  4FW2 A;  2ASO A;  3MEE A;  1HLU A;  1JLF A;  4XH4 A;  4FM1 A;  1U2V B;  3O9R A;  2WTU A;  4JKG B;  1ZBI A;  4Z0U A;  4CI6 A;  1Q7Y O;  1RT2 A;  2I5J A;  3QNO A;  4O4G A;  1EKE A;  4IOC L;  3G6E N;  3QML A;  3LP2 A;  3CXC M;  4G9Z A;  1V4T A;  4RW4 A;  5GAE P;  1NGI A;  2X74 A;  5KTQ A;  5KGW A;  5EXW A;  1TKD A;  2YKN A;  3WT0 A;  1BG3 A;  3A8Y A;  1J54 A;  3C6A A;  3RMC A;  3MWT A;  4JHD A;  2KKZ A;  3RR8 A;  5JVH L;  4PQU A;  5TKY A;  3M3Z A;  2P9K B;  2G8K A;  3QEV A;  4W5R A;  1R0A A;  4CZE A;  1C0G A;  4C8M A;  4BRH A;  1YTA A;  2FSN A;  2O8B B;  4ZHR A;  4QS8 A;  4IJN A;  3C7N B;  3ZET B;  4DTO A;  4FWK A;  1V4S A;  4ISE A;  4CK3 A;  4R5P A;  1RTJ A;  1WLJ A;  4F8R A;  4KKO A;  4K25 A;  5TKW A;  4EZ6 A;  4C8N A;  2QXL A;  3OYK A;  4LFA K;  4CZG A;  4LH4 A;  2PZS A;  4QS7 A;  2OCE A;  3H3O B;  1EP4 A;  4JS5 A;  3SQ4 A;  1NJY A;  5AQQ A;  1BU6 O;  3MN5 A;  4DFP A;  3CET A;  3CC7 N;  2OTJ N;  4CJR A;  5SWM A;  3AO3 A;  3MWP A;  1IKY A;  4A2B A;  4IEI A;  1KAX A;  1RT3 A;  4A59 A;  4CD1 A;  2DY4 A;  1N32 K;  4B1Z A;  5EU7 A;  3V9Z A;  3L4Q A;  3DOL A;  5FLX O;  2GUP A;  5FPM A;  4DLG A;  5K14 A;  3GG4 A;  2Q0U A;  2I7P A;  1MDU B;  4I6M B;  4BWJ A;  3U9Z A;  4BG9 A;  4H5R A;  1N5Y A;  3NGY A;  4GW6 A;  3P38 A;  1R59 O;  2F4V K;  4ZTF A;  5M1F A;  5AQH A;  2UXD K;  4DQR A;  4B3M K;  5AZI B;  1QSY A;  2F9W A;  2BGG A;  1WNS A;  4LFB K;  4W5Q A;  4NYF A;  2GUI A;  3CPE A;  3V9S A;  3QBW A;  2IGI A;  3LZJ A;  3SAF A;  4LSN A;  5AFU H;  3VOV A;  3KIO A;  4EP4 A; 
#chains in the Genus database with same CATH homology
 3FZH A;  4CZI A;  3WXI A;  1TUY A;  3VER A;  4HWI A;  1VQ5 N;  3ENO A;  4H5V A;  2QWL A;  1D4X A;  3UE5 A;  3I8B A;  2E1Y A;  1VQN N;  2A40 A;  4B1V A;  1BO5 O;  5F0X A;  3KZB A;  2ZWH A;  3CJ9 A;  3IUC A;  3AAQ A;  3WQU A;  4JD2 A;  4WFB L;  3FZM A;  4H5W A;  5FPD A;  4E1J A;  3ZX2 A;  4B1Y B;  2A41 A;  1TUU A;  3DJC A;  2VCP A;  1GLF O;  4FWP A;  4RWT A;  4O8U A;  2KLA A;  3G4S N;  3SAG A;  1YJW N;  4BRK A;  4EIA A;  2E2N A;  2QWP A;  3FZF A;  3E9O A;  4C23 A;  4CBX A;  3VGK A;  3MN7 A;  3HZ6 A;  3WUH A;  5AQP A;  3DXM A;  3OBY A;  5KPT A;  3ID8 A;  1DKG D;  3SBG A;  1Y64 A;  2WBN A;  2VGM A;  1T6C A;  1O13 A;  2FSK A;  2HMP A;  3R1X A;  3D2E B;  4KH5 A;  3GOI A;  3VEW A;  2NRZ A;  4BR9 A;  4BGA A;  5C2D A;  1XUP O;  3VTI A;  4JKD A;  3A0I X;  3C6H A;  1Z6R A;  4FPA A;  2YHW A;  3NMU A;  4JKH A;  4CBW A;  4BRP A;  2UYT A;  3OBW A;  1HPM A;  4FWR A;  3J8A A;  3LM9 A;  3CCQ N;  3WEE A;  4FVU A;  2P9S A;  3CME N;  2V52 B;  1NJI O;  3CCL N;  3CER A;  3O1B A;  3MX2 A;  3CIP A;  4MDB A;  3CMA N;  4K43 A;  4KH6 A;  3VF6 A;  4MDA A;  3FLC O;  3LL3 A;  3A5N C;  3FZL A;  1YVN A;  5M1Q A;  1HKB A;  3MN9 A;  1OVY A;  4CJ7 A;  1JCG A;  3I56 N;  1NGG A;  4JK7 A;  2FXU A;  1KD1 O;  2JWK A;  3C65 A;  3FZK A;  3M6G A;  3CJ1 A;  4FWO A;  4MLE A;  2ASP A;  4WYB A;  1YUW A;  1ZXO A;  5F1X A;  1NGA A;  1S22 A;  3NVM A;  4YOR A;  2P9U B;  1HKG A;  4BR2 A;  4BC3 A;  4DHY A;  5CHI A;  4U7B A;  2ZJP L;  1Q81 O;  4GVE A;  4JN4 A;  1K9M O;  1T3V A;  2F7T A;  3TTD A;  2YJF A;  4BRN A;  4Y0W A;  2Q0R A;  3WXL A;  1JCF A;  2YX6 A;  3QDK A;  2WUS A;  4IXC A;  5FPN A;  3M5R A;  4AM6 A;  1W2B M;  1KAY A;  1QQN A;  3MDQ A;  1VQ7 N;  3CC2 N;  4GV6 A;  2BH1 A;  3GDQ A;  2FSJ A;  3LDO A;  3SMP A;  2YI1 A;  3IMX A;  1NGE A;  4BGB A;  3QFU A;  5AQX A;  1TYQ B;  2HBK A;  3UKR A;  4BRD A;  1QVG M;  4BR4 A;  1NM1 A;  4JD2 B;  2HF4 A;  3MX5 A;  1VQ6 N;  1CZA N;  3O9T A;  4HTL A;  4IZ9 A;  4JKB A;  4WF9 L;  3OW2 M;  3U9D A;  4WCE L;  3CD6 N;  4WQ4 A;  2CGL A;  3H1V X;  3G25 A;  3W0L A;  1U6Z A;  4FO0 A;  2NRR A;  2DPN A;  4YOW A;  3VEO A;  1NGF A;  3D2E A;  1YJ9 N;  3CI5 A;  5BRF A;  1JCE A;  4B1W B;  5LY3 A;  2E8A A;  2ZGY A;  4A5B A;  3CCS N;  3LDN A;  3DXM B;  4A5A A;  4DB3 A;  1Z05 A;  2GWJ A;  3OA9 A;  3EE8 A;  3JXU A;  4O8K A;  2WC9 A;  4PHT X;  3VET A;  1NMD A;  4BRA A;  4H0O A;  1VQ8 N;  4CZM A;  5ADX H;  3RVC A;  1GLD G;  1M1K O;  2Q36 A;  3DWL A;  4UY8 O;  3D2F A;  3Q7B A;  2P9N B;  3I33 A;  3ATV A;  3LDL A;  5M1O A;  3SK3 A;  5KQD A;  2F9T A;  1QZ6 A;  4EAH D;  5JVG L;  2EWS A;  3Q7C A;  4NLB A;  5ELZ A;  2OTL N;  3WEE B;  5BPM A;  3GE1 A;  2P9S B;  4JK9 A;  3SMS A;  4A57 A;  2D0O A;  3CCV N;  5KPZ A;  1BA0 A;  3W3D A;  2E2P A;  1KQS M;  1Q82 O;  2P9U A;  4B9Q A;  4BC4 A;  2OAN A;  1QQM A;  1HX1 A;  3F9M A;  5C10 A;  3BF3 A;  4BRO A;  3OHR A;  5F2R A;  4PL8 A;  5AQG A;  3VEY A;  1VAZ A;  2QTD A;  3ENB A;  5AQN A;  3ULE A;  3ZX3 A;  2P9L B;  3TSQ A;  3DXK B;  3MK6 A;  3O9S A;  1VQM N;  3AAR A;  3AAP A;  1GLB G;  4LC9 B;  1TYQ A;  3SBT A;  4B1X B;  3EN9 A;  4H0T B;  4YDU C;  2IIR A;  4IEE A;  3VF4 A;  1VQP N;  2A5X A;  2HST A;  3QBX A;  4H5N A;  4NB4 A;  4M7Y A;  1P90 A;  2ZJR L;  5AFU A;  2QW9 A;  5BR9 A;  2V7Z A;  2W40 A;  5HL7 L;  1XQS C;  3CC4 N;  4XEI A;  3WXM B;  3E9P A;  3UKR B;  1RDU A;  5JLF A;  2HBM A;  4FOI A;  3FR0 A;  5DM7 L;  1X9J A;  1Q86 O;  2E1Z A;  1VQK N;  3GBT A;  4BC5 A;  4DKW A;  3VPZ A;  3E66 A;  3SAH A;  2I7N A;  4BY9 C;  3CCR N;  3R8E A;  3P31 A;  3AGR A;  4ISG A;  4ILH A;  5AQV A;  3O6W A;  5LJV A;  2ASM A;  5EOY A;  2P9I A;  4A62 A;  3PLA A;  3AY9 A;  4J8F A;  5BN9 A;  4BG8 A;  5B8H A;  4CZF A;  5BRD A;  2Q1N A;  5GIO A;  5C0Y A;  1EQY A;  3HI0 A;  3CJB A;  3MN6 A;  1MWM A;  2A6A A;  2P9N A;  4MLH A;  4IOA L;  2Q31 A;  3M1F A;  3QIC A;  5JMV A;  3E1Y A;  5AQI A;  3VEV A;  1BDG A;  3N4P A;  1YHQ N;  3R9P A;  3P4I A;  5E26 A;  5AQL A;  3BUZ B;  2QEX N;  3TTC A;  2W41 A;  3D2F B;  4CZJ A;  2YCH A;  5GAG P;  3ZYY X;  3TSU A;  4C1N I;  3CCU N;  3BP8 A;  3CF5 L;  4JKE A;  2YJE A;  2NRW A;  3WXK A;  1LCU A;  3MCP A;  3VES A;  2ITM A;  2GEL A;  4BRE A;  4CZK A;  2D1K A;  3WXJ A;  3EL2 A;  2NLX A;  5AQK A;  5LJW A;  3G71 N;  3EZW A;  3O9Q A;  2P9L A;  3CJC A;  3GL1 A;  3DXK A;  5AQY A;  2HF3 A;  1MWK A;  3IFR A;  3H6E A;  1VQ4 N;  3CJA A;  3KWI A;  5EX5 A;  3HTV A;  5GAH P;  3JS6 A;  1EO1 A;  3ULE B;  3UKU A;  2GTD A;  3O80 A;  4DCH A;  3FGU A;  2FF3 B;  3T69 A;  3ZEU A;  2QWM A;  1X3M A;  4H0P A;  4MO4 A;  1HJO A;  3KHY A;  4FWQ A;  4GY2 B;  4A2A A;  4BVO A;  4BR7 A;  2WFB A;  2E2Q A;  2YHY A;  3O8M A;  4FSV A;  4MO5 A;  3VMF B;  1KC8 O;  3R3L A;  4ILJ A;  3H1Q A;  2E2O A;  1SZ2 A;  5CE3 A;  1SQK A;  1G99 A;  4IOX A;  5GIP A;  1IJJ A;  1KXP A;  4WFA L;  1K73 O;  4PKG A;  1H1V A;  5CR4 A;  1NGB A;  1NGH A;  2ZGZ A;  3HBT A;  3CPW M;  4KBO A;  3S41 A;  2QWR A;  2NZT A;  3L0Q A;  5AQJ A;  1KAZ A;  2BUP A;  2P9I B;  1ATN A;  1IG8 A;  2VYP A;  4BRC A;  2NRX A;  2FF6 A;  1P8Z A;  1U2V A;  3TSP A;  3O1W A;  4JKC A;  2IVP A;  2P9P B;  2E20 A;  4K41 A;  4OPA A;  5M1N A;  2Q97 A;  3A5O C;  3EKU A;  2HBJ A;  4JAX A;  3VGM A;  4BC2 A;  1WUA A;  2CGK A;  2ZJQ L;  4IFE A;  4R79 A;  1GLC G;  2RHK A;  4NLC A;  1DT9 A;  1W97 L;  1GLL O;  1RDW X;  1YXQ A;  4RTF D;  2D0P A;  3VGL A;  4YOY A;  5ADX A;  3VEN A;  2CH6 A;  3A5L C;  4GNI A;  2J4R A;  1N8R O;  3HM8 A;  4BRG A;  5EVZ A;  3KVG A;  4M7X A;  4YDU A;  1NBW A;  5AQM A;  4ILG B;  2NRV A;  4Z94 A;  5H1S Q;  4IJA A;  3CHW A;  1BUP A;  5AZJ A;  2YHX A;  4XH5 A;  2E88 A;  3LDP A;  1SS6 A;  2A42 A;  5AQR A;  4BR5 A;  4YOX A;  2AP1 A;  2BTF A;  3I55 N;  1GLE G;  2D4W A;  5AR0 A;  4YOU A;  2QA4 N;  2JWL A;  3QB0 A;  3VTH A;  4FPB A;  3E9L A;  3SLC A;  3UKU B;  4DQ8 A;  1YI2 N;  3VEX A;  1C0F A;  3ZEU B;  3A5M C;  1ZBS A;  4M63 C;  3ENH A;  1JJ2 M;  4F9O A;  1NGC A;  2GX9 A;  4JNE A;  1ILY A;  1MA9 B;  4JKF A;  4BRI A;  5BRE A;  1Q18 A;  5AQF A;  3H3N O;  2AA4 A;  5AQW A;  3HSC A;  1X3N A;  5GIN A;  1ATS A;  3FE1 A;  1VQL N;  1OKJ A;  1RGI A;  4XH1 A;  2CGJ A;  5KPR A;  2GEM A;  4O5F A;  3T7Z A;  4L3Q A;  1HKC A;  1S3X A;  3RSE B;  4NO7 A;  4PKH A;  1K8A O;  3R6M A;  4IDH A;  2Q2R A;  3UB5 A;  3HOS A;  3PIP L;  3KWG A;  4CZH A;  2P9P A;  3F5T A;  4JK8 A;  2ASO A;  3O9U A;  4JKA A;  1HLU A;  4XH4 A;  1XC3 A;  5AQO A;  1BA1 A;  4U67 L;  4C1N K;  4PL7 A;  2VWB A;  4BVP A;  1WOQ A;  1S72 N;  4FWM A;  2QWN A;  5C15 A;  1U2V B;  3O9R A;  5BRH A;  1E4F T;  4FL9 A;  4JKG B;  3O4W A;  4JEP A;  4CI6 A;  1NGD A;  1Q7Y O;  1SAZ A;  1ZC6 A;  1GLA G;  3TU5 A;  5BPL A;  3CCJ N;  4IOC L;  3G6E N;  3QML A;  3CXC M;  3BF1 A;  5AQU A;  4G9Z A;  4I6M A;  1V4T A;  5DM6 L;  5JLH A;  2IVN A;  1NGI A;  5GAE P;  2IVO A;  4OO1 J;  2QI2 A;  1VQ9 N;  3EE9 A;  5EXW A;  3WQT A;  3WT0 A;  1BG3 A;  3A8Y A;  3C6A A;  3EO3 A;  4OPH A;  5AZI A;  3ID6 A;  3MWT A;  4WQ5 A;  3MCA B;  4JHD A;  2KKZ A;  2FLO A;  3HRG A;  1YIT N;  3K9K A;  1HUX A;  5AZJ B;  5JVH L;  5TKY A;  1NGJ A;  4H0Y B;  3M3Z A;  2P9K B;  3U8X A;  4AF1 A;  1RFQ A;  2HBL A;  3IKM A;  4H0V B;  1GLJ O;  1BWF O;  1K8K A;  1ESV A;  4CZL A;  1C0G A;  1ATR A;  4CZE A;  4EFH A;  3MMV A;  4BRH A;  2FSN A;  2ZF5 O;  2GWK A;  2NNW A;  4QS8 A;  4CBU A;  5KQ8 A;  4IJN A;  4WQ5 C;  5C2F A;  1T44 A;  2NRH A;  3C7N B;  3ZET B;  4FOE A;  3NVK A;  5I9E B;  4FWK A;  3LM2 A;  1V4S A;  3VF2 A;  3BEX A;  3CQY A;  3L4I A;  4H5T A;  4ISE A;  3D6R A;  3CCM N;  2NRT A;  3RSE A;  2PBD A;  3P39 A;  4H0X B;  4AM7 A;  3CCE N;  3N4Q A;  4K25 A;  5TKW A;  4A61 A;  1M90 O;  1DEJ A;  2HOE A;  4BRL A;  2QXL A;  4EHU A;  4QS9 A;  4CZG A;  2H3G X;  1YJN N;  1NWK A;  4QS7 A;  1E4G T;  3CQX A;  5E84 A;  4YOV A;  3CJ7 A;  1LOT B;  4ISF A;  3H3O B;  1VQO N;  4BRF A;  4H03 B;  5AQQ A;  3PIO L;  1BU6 O;  3MN5 A;  3TTF A;  4IWV A;  5JIC A;  4JKG A;  4WFN L;  5M1K A;  1BOT O;  3CET A;  4CD3 A;  5GAD P;  3CC7 N;  2OTJ N;  4KH4 A;  3B8A X;  3J7Z O;  2KHO A;  4PKI A;  3SJH A;  2QM1 A;  3C0B A;  3MWP A;  3H45 C;  4A2B A;  1YAG A;  2PFU A;  4IEI A;  1KAX A;  2A3Z A;  1QZ5 A;  4GV3 A;  4A59 A;  2VGN A;  5AQS A;  4BRM A;  4CD1 A;  5AQT A;  2QWQ A;  4B1Z A;  4BR0 A;  1YIJ N;  5M1P A;  3L4Q A;  3HOT A;  2V7Y A;  4WQ4 C;  1DGK N;  3H46 O;  5BPN A;  2GUP A;  5MLC Q;  5FPM A;  1QQO A;  3F2K A;  3O5B A;  4GV9 A;  2RE2 A;  1QVF M;  2QWO A;  3GG4 A;  2Q0U A;  2I7P A;  1MDU B;  4I6M B;  4YOT A;  4B1U B;  3U9Z A;  4BG9 A;  4H5R A;  3TPQ A;  3FFK B;  3ZX0 A;  1YF5 L;  4FWN A;  5FPE A;  4IO9 L;  5BN8 A;  3P38 A;  1R59 O;  3LDQ A;  5HOO A;  3VEZ A;  2P9K A;  3AGK A;  3U4L A;  4EHT A;  5M1F A;  1J6Z A;  3KK7 A;  5AQH A;  5C12 A;  1NLV A;  3L6Q A;  4RCH A;  5AZI B;  2F9W A;  4FWL A;  4JHD B;  3DLL L;  3QFP A;  1T6D A;  4IO8 A;  4BRQ A;  3C7N A;  3ZET A;  4BQL A;  2V51 B;  3CPE A;  3O08 A;  1K8K B;  3QBW A;  3K9J A;  5EY4 A;  4K42 A;  2CH5 A;  3SAF A;  3EKS A;  5AQZ A;  3DAW A;  1QHA A;  3D7E O;  5AFU H;  3ATU A;  3IDH A;  4FWS A;  3VOV A;  4BQZ A;  2PAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...