3C6LA

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
185
structure length
185
Chain Sequence
QQVRQSPQSLTVWEGETAILNCSYEDSTFDYFPWYHQFPGESPALLIAIRPVSNKKEDGRFTIFFNKREKKFSLHIADSQPGDSATYFCAASDNRIFFGDGTQLVVKPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR 2W20 alpha chain
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
total genus 21
structure length 185
sequence length 185
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6lA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6lA02
3TT1L 4PRBA 4DKEH 5C09B 3KPSD 3MV8B 3OR7A 3MACL 1KBGH 3H9SA 3EOBA 3P77A 5C07D 3NPZB 5A3ID 5DMYA 4M8QA 3RPIB 5EOCL 4K3DH 3FONB 1WITA 4MNQB 3MR9A 3O9WD 2R29H 5E0QA 3TN0B 3ZSTA 4U7SA 1J1PL 3VFWB 2A9ML 3RBSA 3GI9H 3UROR 3EYUL 4M6ML 4I0KA 1NGQL 4AQ1B 4HK0B 4DN4H 1ADQL 3ARGA 4LSQL 4YR6A 4UOW1 4OTXL 4HWBA 1KGCD 4PRDA 5DMGD 4E9LA 5DA0B 3QIWC 4JRXE 2XPGA 1BFVL 1JPTH 4P5TB 1EO5A 4UT7H 3WD5H 3LRSA 25C8L 5J6HB 4RQQA 2GTZB 1HQ4A 4G80A 4JR9L 5JHDA 4M5YH 2WBKA 1JZ4A 5DD3L 1A8JH 5BS0B 3WS3A 3MXVL 2ZSVA 3VE0A 1VFAA 1RUQL 1RMFL 4Q7DA 3WIHH 2QQLL 2J8UF 3CDYA 2LE9A 4LPCA 1F58L 3I85A 4AEIH 4QHNB 4ZMAT 5EZIL 1HI6A 4GG8A 4WTZG 3UTSD 3BQUB 2Z31B 5FDWB 2J3SA 1A14H 2HTLD 4Y4KB 1MHHA 5ITBH 3FRUB 3RWIA 1S5HB 1IAIL 1KCLA 3D85B 1A6ZB 3DIFA 4FFWD 5HYJD 5I8OH 3V0AC 1YDPA 3TO2B 3FKUS 4CN6A 2X89A 4BH8A 4CW1B 2IJ0C 4P49A 5FYKE 2EYRA 2I60H 3IDJB 4NZRL 3Q3GA 5DVMA 4XPBL 3MLZL 4PJAF 4FXKA 1JZ8A 1WGOA 4KXZI 4QXUL 3GB7B 1NMBH 4PRPA 5TE6L 4X4ZA 4HWBH 3ARBD 4LCWA 3C2SA 3IS0X 4PLJD 3QZWB 1F97A 1MFDH 2PKDA 4GG6A 1M05B 1A7NH 3GSQA 1P84J 3LKNB 1F11A 3G5VA 1B4RA 1VGKB 1EEYA 5EOQL 3MBED 4CUCA 4IEFB 3KXFA 3H7BB 1ZWIB 4G42A 4R7DB 4JPVH 2ESVE 5D9SB 1QLRA 2WNGA 2GHWB 4AZ8A 5C0AD 4R2GB 2A2QT 5HGBB 1U92B 2ADGA 2QSQA 1XGRA 3HB3C 3TNNA 1IC1A 4PTTB 1T6VN 3CFCL 1HINL 3IDNA 1T5WB 5D7KD 4F7MB 1IGML 3U7YH 4JKWA 1NMCB 1WFOA 2YPVH 1TJIL 3SGKC 2HJFB 5TFSH 4G6AC 4KRNA 1IM9A 3HAEB 3BP7B 1S9XA 3HFML 4CMHB 4D8PA 3FB7A 1IGYB 1N59B 4HIEB 4QOKD 2EXWC 4NPYB 3O4LA 4G9FD 2B4CH 3GO1L 2EIZB 4R4NC 4GRWE 4IRJC 5DVNA 1JN6A 1F02I 4J3WA 3FN0H 4F8QA 4U2YA 3DMMA 3X14B 5DFVC 4JDTL 1BVKA 4FTVE 4O4YH 2J5LC 2Q7YA 3U6RA 5ICXA 1FAKT 4APQA 4QXGH 3CSGA 3PUCA 2DQCH 3VXRA 2FX8H 3QDMB 1BF8A 4NO2A 1E6OL 1JHTA 3SPVA 4L29B 1WWCA 3I75B 3O2DL 3NIDF 3MTRA 3IDGA 1FZKA 3L9RA 4NYLB 3L5WA 4RX4D 5HVFB 1SEQH 4LVHB 3KPMA 3O0RL 3GMRB 4Y16A 5DTFA 3M45A 3GJEB 2XTLA 3MNWA 1MRCH 1UJ3C 4PJDF 1S7XA 4U7KA 4ZO9A 5MI0C 2ADIA 4O58L 4HAFA 1CFBA 2CDFA 5DC4B 1YYML 3E3QC 3QIWD 4KJYA 4PJGE 3IFLL 2IANB 1PLGL 4GW4A 2J6EL 4ZFOL 2AV7B 4ONOA 2HFFA 1BQHG 1KELL 1ONQA 1MOEA 1JRHL 4KKCC 3EYVA 2GSIB 4LLVA 4AT6A 1QBLL 2BOBA 4XC3L 4OLZH 3WJJC 1QPPA 2XN9E 4LRNL 3RI5F 3FRPG 5EU6A 1IGCH 4L4VA 1F3JB 3BEWA 4G5ZH 4I3RL 4HWEL 2UWEA 1O7SA 3QDGB 1AKJD 1QSFB 4DW2H 4XRCA 2VLRB 5IB3A 3EW3B 4XXCC 1OP9A 3U30B 4HG4K 1N26A 3QQNA 3KR3H 3FO0L 3HRPA 1U58B 3B9KA 1TVHB 4HBCH 1F8TH 2R23A 4LEOA 2PW2A 1JPSL 4XVTL 4X5XA 1CGSL 1KJVB 2APBA 1DUZA 3IU4L 5J9PA 1U8JA 3EHBC 1QSVA 3BKYL 5EPMB 1KB9J 1MFEL 4HLZH 4K7PX 3KLSA 3BRDA 5L88L 3I6LE 3UJIL 2JIXB 3HNSL 3OAYK 2CK0H 2IAMB 3RZCC 1ZSDA 3O41A 1MCBA 4LPXA 5DRWA 3KYNA 1MAJA 3HPLB 4BYHA 1QKZL 1AIFA 2XWTA 4S1DD 3OKDB 1X44A 3IDXL 4PGZA 4EBQL 4KI5E 1RUKL 5HGAA 3HC3H 3FO9B 4OM0H 1TJHL 5E9DB 5ISZE 4ODXA 4D9RD 5E6IA 5C3LD 3OKOA 4I3SH 2CXKA 3HMWH 2EEAA 4YDVB 5GJSH 1AJ7H 5T5FL 1FN4A 4PB0H 1PKOA 5LBSH 3CMOH 4KRPB 1SYVB 43CAA 1GVIA 1B90A 3JWOC 3PL6A 5DFTA 5FGCE 5I1DB 4ODVH 1QLEL 5H2BA 4MZ2A 3I02B 4OIAA 3CNKA 3GIVA 4GUPA 3B8SA 4G6AD 3KPRA 5I66B 2R9HC 4GMSL 2V6HA 1I9RL 1XGQB 1U3HB 3AAZA 4HKZA 5ETUA 3LS4H 2G2RA 4MMZC 3RAJH 3W82A 5J13B 2VLLB 2Y7QB 5DHVA 3PXHA 3W5NA 2EXWD 5E00B 3FQWB 5B38B 1K4DB 5KW9H 1R24B 3HUJB 1TNMA 4F15B 1E4WH 2JJTC 4R4ND 4IRJD 5L0QB 1SQ2N 4PJ7A 4U6XA 1MVUB 3D6GA 2HRPH 1EFXA 3T4YA 5C0BE 1I3RA 4FOMA 5T3ZH 2R0WL 3I2CH 1J5OH 4NKOA 3IAQA 1C5BL 2JJSA 4PRAA 1KIUA 4LFHD 3ROOA 1PYWA 5IFJA 5FM5O 3T0AA 2P5EB 4KI1A 1Q8MA 1KTLB 2X10A 2A6IA 1LO4H 4NWTH 2XZQL 1PAMA 2AQ1A 2B0SH 3IDIA 4N0YL 3PABB 1Z3GH 2R4SL 4P2RD 1JNNH 3FQXB 1R3JA 3MPCA 3NIDE 4CBPA 1KPUA 3CDGB 3NCEB 2VDMH 1QVOA 1SBSL 4JJ5B 4Z0XA 2ICES 3MCKA 3NGBB 3TNMA 4OLXH 3UBXI 2X4QB 1SJEB 1GZQB 4NDMA 4CDHA 3FTGB 3IFOA 2Y06L 4LPVA 3BPCA 3QUMB 2Y1VA 3MRQA 2HFTA 5TJWK 3ALWA 4PJDE 2DRUA 4EQ2A 4KKCD 5F7KC 1SBBA 3KYMA 4PJIA 3K7UA 2GUOA 4EOWL 1UVQB 5F7LB 3SKJH 3BIAX 4GAFB 1ZV5A 3VFRB 3HE6A 1XF3B 3GSOA 5HSFA 1FL3B 1PG7W 3MRHB 1ZLVK 3PF2A 4NKQB 5B3JE 4X7TA 2ICWJ 4BQ9A 3LH2L 1OTUC 3W5MA 1FFPB 3JSSA 4EN3B 5ERWA 3VGHA 1VKXB 5BOPA 5KSVA 3WNKA 3JWOL 1OCWH 5L2JB 5DJ2A 5C0JA 4K8RL 4PD4J 3S5LA 2FNBA 1GGIH 1T83C 5MP6L 3QHTC 3AU1B 2F5BL 1EEZA 5HVWA 4YHYC 4NC0B 3K2MC 3WE6B 2DL2A 3EHBD 4N0UB 3AREB 5BRZB 1UWGL 3QFJB 4QRPA 5IMLB 3S35X 3ZKXC 1AH1A 4PGDB 1C1EL 1I1FB 1A1OA 5CJ5A 4YQXH 1IGIH 4PJ8B 4JFPB 1Y0LB 3RZCD 3C5SB 5CZKA 1FBIH 5I17A 5DI8B 4FQ2H 1KXQE 5JDSB 4N90D 2VDLH 2WP3T 4JM4L 1B0WA 3FT2B 4YBLC 1ZT1B 3V4PH 4OFVA 2P43B 3VMPA 1KIPB 1QYGH 4RCAA 4LLMA 2CO6B 4OGAC 3QEUA 3AB0B 5F9OL 1FO0L 3O3BB 5C6TH 4Y1AA 3FB6B 4DQOH 1P7HL 2PXYB 4EXKA 1KEMH 3QO0B 1T4KA 3HR6A 4OCWH 1DEEB 5F3HA 1AFVH 2CRMA 3U36A 3GMNB 3SDDC 3F7VA 2MHAA 5KANI 4OKVA 4Q0XH 2R9HD 1MJJB 5L9DH 1NC4A 1J1OH 5DEGB 5EZLA 3DXAE 3U46A 3NMEA 4TUJB 5TQ2H 2MPAH 1KENH 1F4WH 3WEXB 3THML 2XA8L 3T2QA 4KUCF 3MBXH 1HKLL 3GHBL 4L8DB 5HJ3B 5IM7A 4RMRA 2XZAH 4P3WA 3TCXA 5I8CA 4X4ME 4WHDA 4JFDA 3RL2A 3G6JA 5HTSA 2EH8H 1MIMH 3IS1X 2BSRA 1U8NB 1AXSA 4GW1A 3ZYZA 2VH5L 4RMVA 3F58L 4KHXL 4G6FB 2R4RH 4RA0C 5TH2A 1CCZA 3C5JB 1JWUB 4XP9L 4JN1H 4LVOB 2DTML 4DFHA 4JCLA 1OLLA 1YEDB 3QEQB 1DL7L 3MLRL 2W9LA 3MNZA 4JY5H 2NXYC 1Z9SA 1TTFA 1OAXH 3BAEL 4ZTOH 2VZSA 1RK1A 3RHWK 3KPNB 5A2LH 1T7YA 4PY8J 5T1LA 3QH3A 5FECB 5I1EH 3KS0H 1NCCL 3NTCH 5EOTB 2R8SL 4ZFZB 4HQQL 5H94A 3K1DA 5T5NF 3SDAC 3DX7A 4PRBB 1P7QD 2OM5A 1A1NA 3OR7B 4UB0L 5FAAA 3H9SB 3EOBB 3K80A 3P77B 1FNHA 1RURH 5F6HI 4M8QB 1BOYA 4ZUUA 2C1PA 3GJFA 4FP8L 4Y2DC 5TF1H 3VFUA 3IAGC 4KROB 3MR9B 1OOAA 5L2KD 1Z9MA 5I19L 2EH7H 5BMFL 4FN0A 3IDMA 2IG2L 5TQ0H 4KPHH 3HNTL 5DQDH 1CS6A 3ARGB 4YR6B 2P5WA 1FAIL 4PRDB 2O26U 1B2WL 2DL9A 2XPGB 1Z0MA 1MWAA 5IB1A 3LRSB 3DVFA 3KPOA 4U2ZA 3GK8H 4RQQB 1P9MA 2C7UA 1AXTL 3BZFA 4FQCH 1HQ4B 4G80B 5B8CA 1KJ2A 1QRNA 4ONGH 1OTUD 2I27N 5JHDB 3WS3B 3VDCA 1SY6H 2ZSVB 1BHGA 3VE0B 1VFAB 4LHQB 2M26A 4PGCA 1NUDA 2DI9A 5DWUL 1GIGL 3OKLA 3ZT5A 2AQ3A 4LGSB 1JGUH 4NM8H 4HJJL 5CGMA 5D1XC 1Q94A 2CSPA 4PRID 1HI6B 4GG8B 1NAMA 4FZ8H 4AY0A 1G6RH 1QHPA 1M7IA 1MHHB 2FB4H 5DF0A 2N7BA 3RWIB 1BAFL 1CFQA 2JKXA 4NJ9L 2VDRH 4LEXL 3DIFB 1YDPB 4U49A 5GS3A 3QNXA 2YA2A 1MF2H 2PYEA 4BH8B 4PPTA 3BSZL 4I5BA 4WO4A 2OP4L 1RUPH 2EYRB 1I4FA 2K7QA 3GJFH 4BUHA 2EC9T 3Q3GB 2AK4E 4XPHL 4OD1H 4FXKB 2BVOA 4KMTL 3OKEA 1Z0NA 1PZ5A 4NJAH 4OGAD 2W60A 4PRPB 1OWRM 4BZ1H 4LCWB 1PBYA 4NNPH 4LSVH 5E99H 1W72L 1YEJH 4GG6B 3CPLA 1MWAH 1LNUA 3GSQB 5ACLA 1F11B 1RU9L 5HPOA 3G5VB 3SDDD 4PLNC 1EEYB 2OK0H 2WUCL 4KWUA 1UA6H 4J6RL 4YZFF 4L1DA 1KJ2H 1AHWA 3KXFB 4OV6F 4FQIL 4UZGA 4G42B 4B0MM 2CO7B 1DQMH 3WMSA 1QLRB 3ZKQD 2XWJA 5T3XH 4MA1C 2ADGB 2FIRT 5GSRA 1XGRB 3LIZL 4XNYH 1J8HA 2IQ9L 3TNNB 3IDNB 4OFIA 3L3OA 3V6FA 5DVKA 3W0WE 3EOTL 3DPBA 1NAMH 3CH8A 3TPUA 3A6OA 3S98A 1E6JH 2DWEA 1IM9B 5J89A 3A0OA 3FO1A 1S9XB 5IJKC 4WFFD 2UVEA 5ID0A 4D8PB 5IK3A 1NFKA 1DANT 2CDEA 4GAGL 1MI5E 4U6TA 3GHEL 5IT2H 3BN9C 4GAJH 1G0XA 4WV1C 2NXYD 4DVRL 2VXTL 2BERA 4RSVA 3N50A 3CFDA 3O4LB 4G7VH 1FFRA 1JN6B 3DHJA 3LD8C 2NCMA 5K9KA 4KVNH 5I8KL 1BVKB 3SCMC 2Q7YB 3U6RB 5ICXB 5IROC 2RIKA 4APQB 3T0EA 4NGHL 3VXRB 4XB8A 4YX2L 2Z9TA 3SDAD 4NO2B 1UWXH 4X99A 4P2QD 1JHTB 3LDBC 3SPVB 5IB4A 3IJSA 5FF6A 2M2DA 1O7VA 2E27H 4KTDH 4Y2DD 3LKRA 3SE8H 1FZKB 3L9RB 3L5WB 5SX4H 2FATH 4ISVA 3KPMB 2IBZX 2FJGA 4GXUN 5SWSD 5ACZA 4RZCA 2RQ8A 4NQDE 3NN8A 4YGVA 4Y16B 5DTFB 3VJ6A 3KJ6H 3MNWB 3IDYB 1L0XA 1S7XB 3VGBA 1PG7L 2ADIB 2CDFB 4KJYB 5FCUH 5DURD 4D9LH 3RY6A 3PHSA 2NW2A 1NFDA 3QUKB 4PJ9C 2YD9A 5LG1A 4LNRA 4GW4B 1KCSH 4Q9CA 3WYRA 2HFFB 1ZLWK 4JM2A 4JB9L 4Z95L 5GGRY 4ZS7L 1ONQB 4LQ1A 2Q87A 1IARB 2YKLL 5IVXA 3EYVB 3QRGL 3DUHA 4LLVB 4BK5A 4AT6B 2YPLA 4KQ4H 2KQMA 2BOBB 4JRXD 2CMRL 3J7HA 1OP3K 5D1XD 3KPQA 5EU6B 4IHOA 4L4VB 5EU4A 3BEWB 5A2IH 3MLSH 4N1CA 2UWEB 5IFAH 4DGVH 3FAXA 4XRCB 1SYSA 3ARPA 5IB3B 3UJJL 1JMZA 5I0ZA 4WFHE 1MEXH 3PHQA 3B5HA 2BXZA 1JNLL 3UC0L 4JHZA 2X4UA 3B9KB 2ZOLA 1F4XH 4ZQKA 3RGHA 2R23B 4LEOB 2PW2B 4Y89A 4EIZC 2BVPB 4X5XB 1DUZB 2ZUWA 5J9PB 4DTGH 1U8JB 3MLWL 2UUDH 1MPAH 3LEVL 2ICEA 1KCUH 4X9BA 5J1AA 3BH9A 2FWOA 1A7OL 1CBVH 1RZFH 1ZSDB 3O41B 5DRWB 1HE7A 3KYNB 4J1UA 4OZFA 4P2YA 5IHUL 1OT2A 1AIFB 1JFQH 2XWTB 4WI8A 4QYOA 2DQIL 5HGAB 4PJEF 1XZ0A 3GUTA 5E1HB 3KGRA 5F7EH 3OGCA 4ODXB 2L7JA 5E6IB 3OKOB 4R0LC 4NQEE 3Q0HA 4JQVA 1Q9LA 2IADA 1FN4B 3SJVA 43CAB 3HG1D 1GC1L 2H26A 3PL6B 4PV9A 4YZFE 5I74C 5H2BB 3BDYH 3T4AA 4GUPB 3MRKA 4KI5C 3KPRB 3KPPA 2Z92A 2F54A 2ESVD 4GW5A 4HKZB 4XP4H 5ETUB 2G2RB 5SWZA 5DHVB 2J7LA 3BN9D 1N8ZB 3HC4L 3O2VH 4KHTH 3CLFL 3CU1A 4HC1A 3NCMA 2FJFA 4XGZA 4PJ7B 5D5MA 4U6XB 1MREL 4JGUA 1EFXB 3T4YB 5JOPE 1SM3H 4GBXC 1I3RB 4LAJH 5DEZA 3SCMD 4PJ7F 4BZYA 2J8HA 1U8QA 2ADFL 4AG4L 4NKOB 1A7PH 3EO9H 4PRAB 3VI4F 3MV01 5D2LE 3ROOB 1PYWB 5IFJB 4DFIA 4L8CA 5BO1L 5ABDE 2A6IB 1DZBA 4OZFH 3BZ4A 3SGEH 4PG2A 5FYJL 5I73B 3IDIB 1F42A 4Z6AT 3OZ9L 3EZ8A 4F7TA 2F58H 1XR8A 4M02A 4EI5C 2J88L 1R3JB 3AXLA 1XEDA 5FUZL 3FOMA 2V5MA 1MCPL 1KPUB 2VXVH 4W4OA 2E5EA 1QVOB 4UTAH 2NTSP 4W70A 3UTZA 3VXME 4Z0XB 4I13B 4PJ9D 3MCKB 3TNMB 4FABL 5AD0A 2DKSA 4NDMB 5FDYA 3IFOB 4M6NL 1CXFA 4XCEA 3ARWA 3BPCB 3MRQB 4KY1L 1TENA 2AABH 3I3DA 3HC0A 1B6DA 4E5XA 3KYMB 2XQBH 4PJIB 2GUOB 4LSTH 3ZTJH 2QQNL 3HE6B 3R1GL 4XWOC 5HI4C 3S3PA 3GSOB 3NPSB 3MRCA 2B7DT 5FYLL 2IC2A 3UPAA 4NN5C 4X7TB 1GPOL 1IC4L 4KZEL 4NKIH 2QJDA 3VU2A 4P57A 2JF1A 5ERWB 5C0CE 1GHFL 5EC2A 3H3PH 5KSVB 3TH3T 4HIXH 5DJ2B 5C0JB 2XN9D 3ZE0F 1RJCA 3S5LB 3MLUH 1EEZB 4UV4H 2YD6A 4NKMA 4QRUA 4QRPB 3NCBB 3LHPH 3U0PA 3RA7L 3F6LA 1A1OB 2WLZA 2RFXA 4WTWA 5EBGA 5MEPA 4RGMB 2V2XA 2VSCA 1TXKA 5I17B 3KPLA 4HWZA 3IDUA 4HMCA 5CEXA 3TZVC 5D2NA 2DQTH 4U1LA 5TPWH 4F9PA 4LLMB 2DQDL 4RFOL 3L6FA 4MZ3A 4S2SA 3X3GH 3QEUB 5JQ6H 4XMLH 3HE7C 1YNLL 2BNUA 4Y1AB 1J0ZA 4LSRH 5E8EA 3BN3B 1T4KB 1C16A 3WN5C 2HAZA 5F3HB 4HUWA 4LU5L 4QHMA 4JPWL 4XNMA 3S34H 5B21A 4XTRC 3U36B 4J7RA 2WZPD 1C7TA 1QBBA 2LU3A 4PJEE 1FYTA 4Z7UE 3F7VB 3MA9H 2F8VA 2MHAB 4KI5D 4H26B 4OKVB 4LCUA 4J2XA 1NC4B 5GGUA 5EZLB 3U46B 5IB5A 5IOPA 4G6ML 3TVMC 5ISZD 3QJHA 2VL4A 1VPOH 4OIIH 2CRIA 4KMQA 1CR9H 5JORA 2ZSWA 4HPYH 4Q6YA 3BGFB 5IM7B 5FK9A 5I8CB 3TYGH 4FQLH 1VB9A 4JFDB 3RL2B 3G6JB 4YHKH 1C5CL 2BSRB 3VD7A 1AXSB 2A77H 4GW1B 3W9DA 2DM7A 4AEFA 3QWRA 4GBXD 4FFZH 3VXOA 5TH2B 3G6JF 3DHMA 4M1GL 1BECA 2ZWLT 3MNZB 4PB9H 1RZJL 3CSBA 2AEIT 4CJ0A 3G5XA 5DGRA 1IC7L 1RK1B 4OFPA 2BDNL 1NC2D 2ITCA 5T1LB 3QH3B 4ONHA 5EZOH 5CD3A 5C0BD 1G9NC 1OGAA 5F7MC 5HDQH 3VI4E 3BT2H 2B2XH 4X8JB 3DX7B 3GKZA 1XIWA 1A1NB 3U9UA 4E42A 1AE6L 3OB0H 3ULVL 3OAUH 5ADPL 4ZUUB 4WRLA 2C1PB 3GJFB 5FHAL 3BZEA 3VFUB 2NX5E 2G9HA 3P30L 1J18A 4YLQT 4XP6L 3IDMB 1FVEA 1LK3H 4O02L 4MAUH 1KJ3H 4OZGA 4ZD3H 1Q9KA 4QF1A 3D1MC 4C56E 2P5WB 5DK0A 2J2ZA 4JHAH 1NDGA 3H9ZA 4MJ6A 3QG6A 2HJKA 4RGNE 4WGVB 3AS3A 4XWOD 3GDBA 4MAYC 5F93C 1MWAB 5HI4D 5IB1B 3DSNA 1CDBA 3KPOB 3FFCA 2C7UB 3IGAA 4YBQC 3BZFB 4GMTL 5J11B 5B8CB 3QDJD 1QFWL 1KJ2B 1QRNB 4I0PC 1DN2A 5C7XH 3KPSA 5C07A 4PGCB 3LS5H 5CJQH 5KSBF 4Y19E 2AEPH 4XMKL 3OKLB 2AXGA 2YOCA 2AJXL 3O9WA 5JA9A 3CFEA 4LBEA 1Q94B 1RFDH 5BW7A 5MEOA 3U0WH 5B39A 1KLUA 1NAMB 2LTQB 3NGBC 3O6KH 4JY4A 1M7IB 1TQBB 4IBLT 5I1LA 5F72S 3HI5H 1CQYA 1QACA 1CFQB 3U4AA 3X12A 2CH8A 5DR5H 3QNXB 5BVJA 3T65A 2PYEB 5KZCB 2A6JA 3LN9A 2AEQH 4I5BB 1YEFH 4WO4B 1RZKC 4KDWA 3V0VA 4YHNA 1EHLH 1I4FB 1QBAA 1UM6L 3ZDZF 1G7JA 1MCOL 1BX2A 1I7ZA 4M93B 5I6XB 2BVOB 1UADC 3ARDC 3OKEB 3VWJC 1PZ5B 1V8HA 4XPAH 4P3DA 5CZXC 2W60B 4CVXA 3HE7D 5D6DC 3OXRA 3RWJA 2RHEA 5E2UH 2V17H 5SV4A 3UTSA 1AQKH 3BJLA 2EDEA 2ZP0T 1QPXA 5DZOA 3O6ML 2ED8A 5A2JH 3CPLB 4XTRD 1R0AH 1LNUB 3MV9E 4G3YH 4M1DH 1DJSA 1NCNA 1QD0A 5CINL 5CEZE 1CK0L 4JRWA 3AM8A 3ARYA 5I9QC 2XKUA 5L8JB 1AHWB 5HYJA 4S1QH 5JW5B 4BZ2H 4M7ZC 4MA3A 1L7TH 3OJ2C 2XWJB 3TVMD 2DLIA 3UO1L 3K8KA 5GSRB 2X4SA 1QZ1A 5E5RB 1J8HB 4YXKL 3PGCA 5I15L 3V6FB 3L3OB 4G6JH 3L3JA 3TPUB 2J8OA 3VD5A 2ERJB 1HOCA 2DWEB 4YHIA 3FO1B 4J3VA 4L4TE 3GSUA 1RVFL 3ARBA 5C09E 4XPGH 3SE9L 3DXAD 5IK3B 5ID0B 1U8PA 4G7YL 1CI5A 2CDEB 5IMKA 4MGXA 4F2MA 2X9XA 1FYHB 1I1RA 2PXYC 5AEAA 1LP9F 1BVLA 2XI9A 1F90L 1HHIA 1KTRL 3CFDB 4AH2A 3DGGA 3MBEA 1C12A 4XPFH 4JVWA 5K9KB 5C0AA 2B1AH 1DLFH 1JGLL 1UB6A 2YRZA 4PUBL 3RWGA 5BVPL 3T0EB 5F97E 2YD8A 3BPNB 4WW2F 3QFDA 4X99B 4YDLB 5IB4B 3BP5A 3MACH 5DGQA 5CJXC 4NUJA 3IJSB 3BDXA 5FF6B 5HHOE 4S11A 5EOCH 3LKRB 4HSQA 3DWTA 2IGFL 4ISVB 3EO1A 2WAHA 1J0YA 3STBA 2FJGB 1J1PH 5ACZB 4RZCB 3NN8B 4YGVB 2A9MH 3EYUH 4M6MH 3VJ6B 5JPNA 4QOKA 3U1SL 1NGQH 1UM5L 3O6FC 4LSQH 5ESVA 1RZKL 4X6CA 3ZSSA 4G9FA 3JV4A 4H1LH 1BFVH 2NW2B 4MAYD 1NFDB 1ZLSL 3SGJA 1YEEL 5TE7L 5EWIL 25C8H 3VDAA 3B4NA 4LNRB 3UEZA 4YBQD 3AROA 4O2CA 4XX1G 1KSRA 4JM2B 5EA0L 4JR9H 4I0PD 5DMIH 3MNVA 1CD8A 3U2SA 5DD3H 4JG1L 3MXVH 1N64L 5IVXB 4TULL 1RUQH 4PIRF 2YPLB 1IKFL 1RMFH 2QQLH 4UINL 4RX4A 3HMXA 3WV0A 3KPQB 1AR2A 4IHOB 5EZIH 5EU4B 5I30L 2LU4A 4NN7B 3U4EA 2VZ1A 1JZ5A 1SYSB 5J8OA 5KSBE 5FUOH 4BFIA 3QIWA 1IAIH 3PHQB 5FO7A 4LLAA 1KNOA 5EU7E 5CD5D 3QHFL 4ACPA 2X4UB 2ZOLB 5CAYB 3IAPA 1TNNA 3MV7D 4ZQKB 3V7MA 5CEYA 1R3KA 5CILL 1WQVT 2VLME 1CF8H 3G5YA 1ETZA 4NZRH 4XPBH 3MLZH 1LILA 1NCDL 4M6OL 2ICEB 4QXUH 3ARDD 4H8WC 3VWJD 3BD3A 5J1AB 4M3JA 3BH9B 3HNVL 5CZXD 2FWOB 1WCQA 1KBGL 1UCTA 4BQBA 3DX8A 5TE6H 1WWAX 3CX5K 5C2BL 5KN5A 3FN3A 3JVGC 3ZDZE 1AKJA 2NR6C 4OJFL 1E0OB 1ED3A 4J1UB 4OZFB 5D8JL 4QYOB 5JMOC 2AK4D 3TT3L 5EOQH 1GH7A 3S6CA 4HX1A 4DUVA 1XZ0B 2FBJH 3GUTB 5JQHC 3FQTA 3RWFA 2BP3A 3OGCB 4X7SL 1M71B 2CLVA 2DKMA 3LQMA 5CSGA 2A9NH 3WD5L 1FNSL 5JPMA 1Q9LB 2IADB 3TO4C 3ARQA 2W91A 4WNQA 4DWHA 5IG7A 3HMXH 1KCRL 1HINH 3CFCH 3RVTC 4K94L 3SJVB 1IGMH 2X1WL 3PGDA 2H26B 4PV9B 4XVSL 3VXSE 5HBBA 2HLAA 3T4AB 3MRKB 1J12A 3OHXA 3KPPB 2Z92B 5CJ8A 3HFMH 2F54B 3WCYA 3R0MA 2CQVA 4GW5B 1YECL 1TZIA 5HYSA 5SWZB 2LVCA 4O5LH 2MWCA 4Y5XC 2EDTA 2OR8A 2FJFB 3GJFK 1TMCB 5DHYA 3GO1H 3QIUD 4XGZB 5D5MB 4AENA 3BOVA 3CK0L 1GL4B 4QRQA 1X5AA 5L8LB 1ZVSA 4JDTH 1IBGL 1QQDA 2APWA 5I8OL 2APXA 1U8QB 1U8OA 1ZGLM 5E2WL 5BV7C 4KUCD 1MI5D 3DX9A 4TQEH 1E6OH 4DOHB 3SGKA 5JXEC 3QQ4A 3LPWA 4CL7A 4L8CB 1RULL 3MRRA 3O2DH 1A02N 2R56L 1TDQA 3BZ4B 4TPRL 5EH1A 3EDKA 3CFJA 3O0RH 1YQVL 4F7TB 4H25A 1BLNA 2X9YA 2PNDA 1XR8B 2YD1A 3O6FD 4YUEH 1IMHC 1S7VA 1Z5LA 3AXLB 1BVZA 3MCG1 4L3EE 5F7DB 3SE3C 3AS1A 3FOMB 4IRJA 4O58H 1WBXA 5BZWA 2NZ9D 5DJCA 1VEPA 4F9LC 4TSAL 2B1HL 5SX5H 3IFLH 4YJZL 5D93B 3UTZB 1MCRA 1QFOA 5AD0B 1PLGH 1G7PA 3DMMC 4XCEB 4NQDD 2GK0A 1KELH 3HC0B 4HDIA 4C4KT 4E5XB 5A40E 1GOHA 1JRHH 4LVEA 4DN3L 1B4JL 4OGYL 2CKNA 5E95B 2JB6A 3VGDA 3ZDXE 2WWKT 4XC3H 3LSOA 4AIZA 4JFFE 4Z0BH 3OTTA 3MRCB 3FCTA 4DZBA 4I3RH 4HWEH 4P2RA 4R26L 2NY2B 1UJ3A 3SHSA 3KVQA 1TTGA 1K85A 2ZUTA 1D6VL 2YK1L 4OI8A 2AERT 3P40A 4YDKL 4P57B 1UWXK 3FO0H 5EC2B 4OQTL 5ELIA 4AQOA 3TBWA 3GSXA 2J1KA 2F15A 1EPFA 5CP3A 1JPSH 4XVTH 1CGSH 1FSKC 3RL1A 3IU4H 2OMBA 4NKMB 4HF5L 4QRUB 4QXGL 3UBXG 3BKYH 2FX8L 2WSKA 4H88L 1YPZF 1MFEH 5F7UA 3U0PB 3QR2A 1R6VA 2G60H 4N1HB 1N6UA 5L88H 3WJJA 2OBGA 4JZNA 3UJIH 2RFXB 3HNSH 5ANME 1PVHA 3BPOB 5MEPB 2W92A 2V2XB 5I75C 4PRHE 3KPLB 5C0RH 1SEQL 1EAJA 2NR6D 4HWZB 5CEXB 2A73A 5D2NB 4XXCA 1SMAA 1QKZH 4HEME 5HY9A 3O4OC 4L3CA 1ZT7A 4U1LB 4OUUA 1N5YH 4EBQH 1KB5L 2EEBA 5BV7L 5C08E 1MRCL 3L6FB 3U0TA 2RCSL 4S2SB 2BNUB 4ZYKA 2A38A 4DUWA 5E8EB 1C16B 2AKRA 4HUWB 4QHMB 5F8RC 4XNMB 5T5FH 3TO4D 2FX7H 2ZCLL 4POYA 2GSGA 2B8OT 2BMKA 1AGEA 1QLEH 3QUYC 1FYTB 2H45A 5GJTL 4NHCH 4LCUB 3V6ZA 1T0MA 1T7ZA 5GGUB 4GMSH 5IB5B 5IOPB 1I9RH 3RZCA 2O5ZL 2VLKE 3QJHB 5IEKA 3PWLA 1WICA 4NQED 5JORB 2ZSWB 4G5ZL 3EAKA 4XP5L 3G6DL 5FK9B 5CP3H 1MFAL 1JI1A 1NANI 3W9DB 2UUDK 3JXAA 3CXHK 1ZMYA 3VXOB 3ORJA 4E0RA 1TCMA 1L9NA 2R0WH 3KR3L 3LN4A 4EEEA 5EB9A 5DUBA 3CVIL 4HBCL 3SEPA 1WK0A 5I2IA 4WY7L 1C5BH 4BQ6A 5KOVC 1PDKA 3BUTA 3G5XB 1JF5A 5JXED 3RJQB 3PWUA 4HLZG 2C3GA 3EJJX 4XCCH 1CIUA 3IT8D 2H6PA 4OI9A 2ITCB 2NY1B 1BREA 2XZQH 4ONHB 1KACB 2FECL 2YHGA 5CD3B 5JOPD 1OGAB 3PJSA 4N0YH 2CGRL 1MCWW 2R4SH 3HCVA 4OCNC 4Z77A 2ZUQB 1PSKH 1XIWB 3U9UB 4K3GA 2JJTA 4E42B 1SEBA 1UT9A 1EXUA 1F00I 4ZSOA 1I9EA 1SBSH 3BZEB 3UPCA 2G9HB 2EICA 5EN2A 3WHE0 1HEZA 4M03A 2VZUA 4OM0L 1G1YA 2Y06H 3EOAA 3MRBA 4X6DF 1FVEB 2L4OA 3U83A 4F37F 4XX1E 4YWGL 4OZGB 1Q9KB 3MRGA 3MUJA 4QF1B 2RBLA 4LARL 1AJ7L 2BNRD 3BD4A 5DK0B 2A1WL 4Z7QF 4MJ6B 1NDGB 2R2EA 4ORZC 4EOWH 3QG6B 2HJKB 5IEHA 2D4DA 2VDPH 1U8LA 1KJMA 4U1GB 3VXMD 1NQBA 3FFCB 3IGAB 1TPXC 2G5RA 4LL9A 1X4XA 1P7QA 3MLPA 3KPSB 1T2XA 5C07B 3O3DA 4ZFFA 4M43L 5KW9L 1G9MC 2AXGB 3JWOH 3O9WB 5L2KA 3CFEB 4LBEB 2HG5A 5MP6H 3SDXF 1JRHI 5F6HJ 2HRPL 5MEOB 2F5BH 1KLUB 5B39B 1NBQA 4JY4B 2V2WA 4TNWF 4YEFA 5JHLL 5I1LB 1T1YA 1UWGH 4LLUA 1G7HA 4TVPE 2W38A 4EUPG 4R97C 1KG0A 2DD8L 1C1EH 3SDCC 1NUFA 2E9WA 4U6VL 4GT7A 1OF2A 3X12B 1F13A 4OZIF 5C0CD 1IKNC 4M00A 4XI5C 5BVJB 3T65B 3CCHA 2A6JB 3IKCA 4NWTL 1UACL 3V0VB 4YHNB 1FNAA 1G7JB 1BX2B 1I7ZB 1YPZE 4JM4H 5F1KC 4UNUA 5BQ7A 3C09C 3ZKMC 3TJHC 1MCDA 1H8SA 3RWDA 2WP3O 3V9FA 4HIIA 2YXFA 4CVXB 3C8KA 1E27A 3LRHA 4HFWA 4P3DB 3VH8A 5MENE 1WZKA 3OXRB 5F9OH 3RWJB 5LCVH 1T83A 4PRIA 1KF9B 3L7FA 3UTSB 3I6GA 4PLOB 3LAFA 3NZHL 5FM4A 3NIFF 1MNUL 1N0XL 3QUYD 1YA5A 2CIIA 1RUAL 1G6VK 3L95A 1WUNT 4YAQA 5HYJB 3DTXA 2Q76A 5HGHA 3SO3C 4R4BA 4MA3B 1X5KA 3SKJL 3B3IA 3L3GA 4ZO7A 2X4SB 3ULUF 4DGIL 2WMPA 2QHRH 2V7HA 4HK3N 3THMH 2XA8H 3DV6A 3PGCB 4M7KL 2VIRA 3GHBH 1EEQA 3I84A 5K59F 1ODAA 2HN7A 5DYOA 3L3JB 1HOCB 4YHIB 2VH5H 3F58H 4KHXH 2HT4C 3VG9C 1JPGA 3GSUB 3ARBB 1YYLL 1ZHKA 1U8PB 4XP9H 2DTMH 3OF6D 1Q1JL 5IMKB 3ARTA 4OB5L 4F2MB 1DL7H 1P1ZA 5FM8A 1BVLB 5GPRA 3SDDA 4AH2B 1HHIB 4GKZA 3BAEH 2AXFA 3DGGB 3MBEB 1OAKL 4WFED 1C12B 4G8IA 5HGGS 2VQTA 1KN2L 4LK4A 2IPUK 1FC2D 3HZYA 5E8NA 2O93L 2R15A 5TGBA 5C0AB 1NCCH 3V95A 3RWGB 1UB6B 3QEGH 3MJ8A 1EJOL 4HQQH 3QXAA 3QFDB 3BP5B 2EDOA 4NUJB 2JCCF 3UXFA 3LMJH 2F8XC 1OB1A 1IGFL 1S8DA 4FP8H 5D7LD 1ZEAL 3EO1B 4Y4FC 5I19H 1T5XA 5BMFH 3QUXC 4YDJA 1O5DT 1IQWL 2IG2H 3LPGA 4DQOL 4X7EC 5JPNB 1NCWL 4QOKB 4ZPVA 2FSEA 1PQZA 3HNTH 5ESVB 3DNKA 5CWSA 4X6CB 4G9FB 4J23A 4U1IA 3JV4B 3RVXC 2WIMA 4HWUA 3DV4A 4X6CF 4HFUL 3VRLF 1YN6A 1IZKA 4HZLA 4Q0XL 4X6DE 1DVFC 3D0LA 3EIFA 4O2CB 1AXTH 3WFDL 1WT5C 1WVZA 4YPGA 3SDAA 3MNVB 4JG0L 4OFYD 3U2SB 4P2QA 3V79C 3KHQA 3S5LG 4OF0A 4LSSL 3MBXL 2C1OA 4C56D 2XV6B 4XVJH 4EDXA 4Y2DA 5DWUH 3C60C 2XZAL 3BGMA 1GIGH 1B6UA 3FT4A 4UAOC 3LQZA 4NSKA 3PV6A 4HJJH 3B9VA 5SWSA 4PJFA 2J12B 4NP4L 5IESL 2B39A 1KTDA 2EDDA 1XGUA 2X09A 3U4EB 3WDJA 3RP1A 4JN1L 2FEEL 2W59A 1BAFH 4BFIB 3QCTL 3SDCD 3QIWB 5FO7B 4NJ9H 2D3VA 1JL8A 1KNOB 4LEXH 2Z4QA 4ZTOL 4XI5D 3SDXE 2O5YH 3OB0K 1I8KA 1T66C 5CEYB 1CT8A 1R3KB 1NSNL 3G5YB 5I1EL 3B6SA 1ETZB 3EFDL 3O11A 4OT1L 4XPHH 1JE6A 5FGSA 3TJHD 3ZKMD 4KMTH 4OZIE 4U05A 4ZXBC 4JRXA 2MNUA 5EU7C 3DX8B 5D1XA 4Q9QL 3LQAC 1S9VA 4NQUA 2AJYL 5KN5B 2VQ1A 3RKDC 1W72H 4NNXA 1AKJB 5FYJU 1ED3B 2VERN 3WLWC 1NGYA 1RU9H 4KPHL 2A0LC 2WW8A 3CX5J 4J6RH 5L7XH 1MLBB 4HX1B 2YBRA 4FQIH 4BSJA 5DQJA 3FQTB 5E94A 3RWFB 2BJML 2DYPD 1NAKH 4DK3A 2PCPA 1UGNA 2CLVB 3EO0A 3SE4C 4MS8C 5JPMB 1HH6A 2IQ9H 3ZTNL 1IAKA 4WNQB 4YFEA 5IG7B 2X1OA 4QTHA 4NNYA 3PGDB 3MV9D 4ONGL 3EOTH 4CU8A 4D0CA 2HLAB 5CEZD 4I48A 3VXRE 3OHXB 2HT4D 1R3HA 5I0DA 1Q0YL 1KFAL 1NCTA 4HUUA 3ULUE 4V2CB 1NJ9B 5HYSB 1TZIB 1S7WA 1JGUL 4GSDL 4GAGH 5F21B 5E8OA 3GHEH 4DVRH 5K59E 2VXTH 4Z78A 4W6XB 1WIUA 3WDIA 5JW4R 4J8RA 5DHYB 4AENB 3TBSA 2AEWA 1OAYL 4QRQB 4HUMB 1ZVSB 2V9TA 5I8KH 1QQDB 4L4TD 1IGTA 1T7WA 4W68A 1SMOA 1EVUA 1RZIA 1XCQA 1U8OB 5IF0A 4V2BA 4NGHH 4YX2H 1ZAGA 1E4XL 3DX9B 5E03A 3KG5A 3HG1A 2C4XA 4M9PA 3QQ4B 2W9EL 5EZJA 2EDBA 3MRRB 2V5YA 4OD1L 4L8SC 2P44B 1MCQA 1MH5A 2OL3L 5IJKA 1Y6NR 4Y4FD 2ESVA 3MRIA 3N0PB 3MYJA 1XH3A 2DF3A 2G75A 3CFJB 1U6AL 3QUXD 4KZDL 2VABA 1BLNB 4H25B 4WV1A 1GGBL 4OD2A 4CU6A 2JCCE 1S7VB 1Z5LB 1PG7H 1YQ2A 1MWAL 4IRJB 4L4VE 5BZWB 1WBXB 3REWA 3RVXD 2VTFA 5DJCB 5HHOD 4ZNEA 5HHXH 5CS7A 3D18A 4ZNCD 3D69A 1UA6L 3K2UL 4KKLC 3SCMA 3WBDA 2J5LB 1DVFD 5IROA 1OWWA 1QO3A 4OFDA 3LKQA 1G7PB 4HLJA 2E7CA 2GK0B 3I6KA 3IXTA 4JB9H 4WW2C 4Z95H 4ZS7H 4HDIB 1WIPA 1EO7A 2ZCHL 2NY5C 3QRGH 3AMKA 3TA3C 1MCFA 2JB6B 5CGTA 4LSUH 3C60D 4AEHL 1IEAA 3HN3A 3LSOB 3VRLE 5I1IL 4OCYL 4AIZB 2CMRH 1FZJA 1DQQA 1F45A 4DZBB 3FCTB 4IRSC 3GMMA 1GAFL 4P2RB 3TF7C 3DVNA 5D7IA 1UJ3B 3FN9A 5MI0B 1RSFA 3UJJH 1WZ1L 4MD5A 1OAQL 4Q58C 1WEJH 1JNLH 1OSPL 3UC0H 5D96C 3KWWA 2CR6A 1GZPA 4PJ9A 2VXSL 1LD9A 3QDHA 3TBWB 3PWPE 1T66D 3GSXB 3WHE1 4YFLI 1IEBA 5CUSL 5DJXA 3WKNA 2EIEA 2H32A 3G04A 1JJUA 3RL1B 3VGFA 4HIHA 3MLWH 3QXUA 3LEVH 2GIYA 4ZXBD 4LLDA 4JZNB 4PJGA 4BFEA 3MUY1 5F1NA 1VFUA 1YEKL 2VLJE 3RKDD 5F6IC 3T3PF 4BK4A 3AY4C 2VLMD 4OCLC 2A73B 4XAWL 2FIKA 5DD6A 3WLWD 5IHUH 1UH3A 4KJWC 5HY9B 2XKNA 4L3CB 1AO7E 1ZT7B 2A0LD 5EBMA 4OUUB 4WW1A 3U0TB 4MD4A 4FMKA 2XN9A 4ZYKB 1CFTA 1YC7A 1MUJA 3WFBH 3UJTL 2AKRB 4TSBL 1G0DA 5FFLA 2GSGB 2BMKB 2MMXA 3EUUA 1AGEB 5FB8A 2J8UA 5JW4M 1VSCA 3QEHA 1PFCA 3V6ZB 4PBVC 2IMMA 1T0MB 4KQ4L 2R2BA 3RZCB 3DLQR 5IEKB 3PWLB 2OX5A 1BMGA 3HC4H 3CLFH 3U7WL 1DQDL 3V52L 3VXSD 1VDGA 2AGJL 1MEXL 2NY5L 4XNUH 4E0RB 3LN4B 4P3CL 4R0LA 2ADFH 2V5TA 4P59L 5DUBB 4AG4H 5I2IB 3OSKA 1ORSA 5JOEA 3TFKD 3QO1A 1WBYA 4PJAA 5C92A 3PWUB 2MFNA 5F1OB 4Z7NE 1EAPA 35C8L 4MB3A 2CRYA 1BBDL 5BO1H 4NOBA 5ACMA 1MPAL 4P99A 3MRNA 2H6PB 4JFHE 3JZ7A 4EDWL 1CDHA 5ISZA 2R39A 3PJSB 3ZLQC 1N6QL 3OZ9H 1R3LA 3HCVB 4Z77B 4J12A 1RZFL 5I1KL 4IIQA 2PTVA 5F7FA 3UCRA 4LAQL 5FUZH 1SEBB 1EXUB 2V2TA 1MCPH 4ZSOB 3RX5A 2ITDA 5J7CC 1ZVHA 4K7FA 3ME0A 4KKLD 4GBXA 5EN2B 5E8PA 5IMOA 4FABH 1HEZB 3RIAK 2GCYA 4NBZB 4M6NH 5C8JA 3EOAB 3MRBB 4PJXE 1D5IL 3MZTA 4KY1H 1JK8A 3MRGB 5ADOH 4JKMA 5E2VL 3TA3D 4L3ED 4FNLL 2R2EB 3H7LA 5CP7A 5IEHB 1NC2A 1V5JA 1U8LB 1KJMB 1NGZA 5CFHA 1E4JA 3R1GH 2ZJSL 4OCXH 5C0BA 2LQRA 1GJIA 4IRSD 5E5UB 4L4JA 5FYLH 1ZHLA 3WFCL 2QL1A 4PG2C 4UOJA 5DRZA 1IC4H 1P7QB 4KZEH 4J3OC 1U93A 3O3DB 3O2VL 3B8YA 2CPCA 4ZFFB 1GHFH 4JFFD 5L2KB 1BQUA 2HG5B 4TUKL 4GRLC 3V2AR 4JFEE 1SM3L 3UTOA 1U8HA 2LFGA 2V2WB 1MJ8L 5J3HC 1F3DJ 1T1YB 4LLUB 1G7HB 3S36L 1KG0B 5CJBA 1FZMA 3RA7H 4IRZL 1OF2B 3AC0A 1I8MA 5A16A 3CCHB 4JEGB 3IKCB 4AYFA 1YJDC 2DQFA 4RFNC 2CKBL 3QIBC 4B7IA 3QDJA 5GISL 4KJWD 4PJDA 3F7PC 2PR4L 2F58L 4XNZC 5BQ7B 5KS9F 4OSUL 3RWDB 3WLBA 2DQDH 4NQSA 1WWBX 3MRPA 4HIIB 4RFOH 1GYAA 3C8KB 1E27B 4HFWB 3VH8B 8FABA 1YNLH 3E1F1 4PRIB 3T3PE 3L7FB 4D0BA 4PGEA 3L3HA 4H0IA 4YHYB 3I6GB 4LU5H 4JPWH 4PRHD 5JO5A 5JR1L 2DICA 1BP3B 4LRIA 5JOFA 2JJWA 3NCCB 2YUVA 2WQ8A 1CLZL 3ZKXB 4P2OC 2CIIB 3GSRA 3PP4L 2E8ZA 3ZTJG 3L95B 4YAQB 5C08D 2VSDA 4K55A 4LVNC 3DTXB 2Q76B 5HGHB 4R4BB 2XWBA 3S37L 4G6MH 3B3IB 1RI8A 2V7HB 4HC1L 2XG5A 3TZVA 1CDCA 2VIRB 3NIGF 3ZHKA 1VGEH 4YBLB 4P46C 4IDJL 3MJ9L 2HN7B 5DYOB 5C9JA 3UX9B 1C5CH 2AV1A 5IW3A 1UH4A 1M4KA 3HE7A 1QR1A 1LK2A 2BVTA 2DQEL 2VDOH 1JPGB 1JHLH 1PY9A 3V7AG 3WN5A 4A6YL 4M1GH 2VLKD 1ZHKB 4TVSa 1D5ZA 1X7QA 1P1ZB 4JDVA 2BRRL 1RZJH 3SDDB 4F58L 4FXGA 4CN4A 4GKZB 1KIRA 2AXFB 4P5MA 5BZDA 2PTTA 1OTSC 4G8IB 4KK5C 5E8NB 5F70A 3TPKA 5TGBB 3TVMA 5C0FA 1ZA3A 1HNGA 1P4IH 4X83A 3MJ8B 1DSFL 1DLHB 3QXAB 2IPUG 1I1AC 3ULVH 5DD5L 1OB1B 5ADPH 1T20A 1S8DB 4PP1C 4U0RC 1Z9OA 5B22A 3DXAA 1T5XB 4I3GA 4GXUM 3VW3H 5JQ6L 4YDJB 4XP6H 2X44D 3WIIL 4O02H 4D94A 1AGBA 4ZPVB 2MCPH 2FSEB 2NXYB 4X7CC 1PQZB 4L8BA 4NKDA 3TBTA 1YJDL 5CWSB 3A67L 2HFEA 4DJMA 1P7KA 4NZJA 4U1IB 4X8XA 4G8GE 1H5BC 2EDRA 2HFGL 4X4MA 2C3VA 3DV4B 3S88L 4OF3A 1GGUA 5DZLA 4DCQA 1YN6B 4HGMA 4HZLB 2NY6C 4KTEL 4OZHF 3BIBX 3ES6A 3D0LB 1JI2A 4N0RA 4GMTH 4JFOA 1QFWH 5IFHL 3BEVA 4YPGB 3SDAB 3FHQA 1WBZA 1WISA 4P2QB 2PYEE 4LDEB 1S7QA 4Q6IC 3FZUD 2C1OB 3QCVH 4EDXB 1S9WA 4Y2DB 3BGMB 4XMKH 4FQLL 4NSKB 3PV6B 2AJXH 2P1YA 4YHKL 4GRLD 5SWSB 3EFFA 4PJFB 4HWNA 3D5OF 4N1EA 2COQA 2XY2A 1KTDB 3LKPA 1XGUB 3IFPA 5J3HD 2ZZUT 3VFTA 4ESKA 4XHJC 2VAJA 3KYOA 5KVGL 3HR5A 5DURB 3VD3A 3F65A 4MAYA 2Z4QB 3BD5A 3TIDA 4P48A 1I8KB 4ODHL 3V4UL 1CT8B 3MODL 3QIBD 2DAVA 3RTQC 3B6SB 1I75A 4I0PA 1UM6H 2WBJC 3O11B 2GJZA 2Z8WC 2X4TA 1BOGA 4R90L 1K8DA 4WI3A 1KPRA 5MERB 1OGTA 4TVPD 5SV3A 2VDQL 2MQ0A 5E08L 4K3JL 2QSCL 1BFSA 4JRXB 1EMTL 4LDOB 1CWVA 5D1XB 1S9VB 1NEZG 2GTWA 2PW1A 3B9AA 2VQ1B 1OVZA 4RNRA 4NNXB 3O6MH 3QISA 2Q7NA 5ESAA 1NGYB 5KS9E 1JWSA 4P2OD 1KJ3L 1CK0H 3ARRA 2B20A 2YBRB 4HS8L 4I18C 4OGZA 2P46B 5DQJB 5E94B 1A6WH 3R8BB 4RFEA 5MEND 4JHAL 2PCPB 5CLTA 3MV7A 3UO1H 3EO0B 2VWEE 4NN6C 4M4RA 1HH6B 1HILA 5GRXG 1IAKB 4JZJC 4JKKA 4QTHB 4NNYB 4P46D 2YRPA 3KPTA 2YN3A 3W2DL 4D0CB 3ARDA 3VWJA 3AUVA 4I48B 2RGSA 5D6DA 4EXPX 3UZQA 1R3HB 2GAZA 3C9NA 1RVFH 4HUUB 3SE9H 1S7WB 4G7YH 3G9AB 5F7WC 4GRMA 4NCC2 1YN7A 5ALCL 3T77A 1Z6JT 5E8OB 3NIGE 2OQJA 3ROLA 5E2JA 1UZ8A 4Z78B 4NO5A 1F90H 4PBWD 3S96A 2AK4A 2C3WA 5E4IA 5K33A 1OTSD 4J8RB 3TBSB 5EDXA 4KK5D 2WM0A 4MA1B 1IGTB 1JGLH 4FZEL 5BVPH 4PUBH 1RZIB 4MNGE 1XCQB 5I1GL 3ULUC 3H3KA 5LGHL 5IF0B 1U42A 2EIBA 2AEQL 5FHBL 4BKLA 1I1AD 3HG1B 4CNIA 4OUOA 1T2QL 5EZJB 1FPTL 4TTDC 4PP1D 2BOCA 1MH5B 2IGFH 2ESVB 3MRIB 4U0QB 2YUWA 3MYJB 1EFQA 4XPAL 1XH3B 2G75B 1HIMH 2Y4SA 3HI6L 4TYUA 2VABB 1QLFA 2KUTA 5K93A 4WV1B 3U1SH 1UM5H 4OD2B 4KK9C 2X4NA 1RZKH 1NPUA 5DUPL 3QIUA 3REWB 2Q8AL 5LWYL 2EC9U 1FL5A 3LD8B 3D18B 2DJSA 4JFYA 3D69B 1ZLSH 3F12A 1YEEH 2JB5L 5AZEL 5TE7H 3SCMB 3U82B 1WF5A 3EDEA 2NY6D 1AD0A 1QO3B 1X4ZA 1L7TL 3LKQB 1MI5A 5EA0H 3I6KB 3IXTB 4KQ3L 3LDBB 1CTOA 1DUYA 1N64H 4TULH 2QSTA 3HHRB 1IKFH 1QNZL 3BXNA 4QY8A 5ITFA 1EHNA 1IEAB 4UINH 3ARFC 1FZJB 4OZHE 1DQQB 4MJIE 1TFHA 4GRWF 4HV8A 4KDTC 1EUUA 5I30H 3GMMB 3DVNB 5D7IB 3WO3B 3O6FA 4XHJD 1KXTB 5J6GA 1H3PL 4MD5B 2R0ZL 4Z7VF 3KWWB 3QHFH 1GZPB 4PJ9B 2FYYA 1HSBA 4XMPL 1ORQA 1LD9B 5DUMH 4XPFL 2Q8BL 5JUEL 1IEBB 5CILH 5DJXB 4N8VG 3RTQD 2H32B 3G04B 4NQDA 1UQSA 3BH8A 4HIHB 2WBJD 2W0KA 3CD4A 4HGKC 5DJ6A 4FQ1H 1DANU 4YK4C 1FH5L 4JY6A 4R7NA 1NCDH 2VDNL 3HNVH 1AC0A 4LLDB 2NY3C 4PJGB 5F1NB 3P4OA 4MLSA 4UI2A 5C2BH 4PJGF 1CGYA 4OJFH 3VD9A 5DD6B 2FIKB 2APFA 2ICWA 5D8JH 3GMQA 2XKNB 3ULUL 5EBMB 3TT3H 2XYCA 2FO4A 4H1LG 2E7HA 2EYTA 4WW1B 1I8LC 4F7CA 4MD4B 4ZUTA 4X9IA 4S1SH 1KCKA 2XN9B 1CFTB 4X7SH 4LMQE 1X3DA 3SBWC 1MUJB 1UG9A 2IFGA 4LPTA 5KVDL 3OKYA 1FNSH 1I3UA 1IILE 3DSFL 4KC3B 4NUGH 1KCRH 4K94H 4Y4HC 5FB8B 4XVSH 5DMIL 1DEDA 4FQXC 2J8UB 5LGKA 3QEHB 1DN0A 5D72L 2X42A 2NYYC 4KRMB 2A74A 2H3NA 2R2BB 4DOHE 2EDQA 1YECH 3JVGA 3V7AE 2AK1L 4HCRA 4Q97A 3R06A 1SJVA 3PP3K 2OZ4L 3CLEL 5HVHC 1FVDA 1OP5H 4L5FL 3BFOA 3RY4A 4K9EC 3B9DA 4WUUE 3CK0H 2F19L 5F7HA 5FUOL 3VXRD 4EJ1C 5ECJE 1IBGH 2AJUL 4R0LB 2DMCA 3NACL 3PQYE 5HDLA 1MCSA 3ZDYF 3PWVA 4X4YA 3ULUD 1CD1A 3LZFL 2FRGP 5E2WH 3TO4A 4NQVA 1ORSB 4NQXA 4OQTA 3QO1B 5HYEA 1CF8L 4FFYL 4ODBD 5I74B 5GGVL 1WBYB 3CUPA 4PJAB 4AJ0A 3VRIA 2EDLA 3VWKC 1R3IH 2Q6WA 2QR0A 1EAPB 4TTDD 3QNYA 1RULH 4ZUSA 3TCLA 1X5HA 3MRNB 2R56H 2I9TA 4TPRH 3O2WL 3LCYA 1MQKH 4OLUL 4LQFL 1XAUA 4KI5F 5ISZB 2WLYA 2IWGA 4OV5A 1RJLA 1YQVH 4NQEA 1R3LB 4OF8A 3ZT6A 4Y5XA 2DTSA 3A6BL 4KK9D 3F6IA 3GSWA 5FGCB 2X1PA 3CMGA 3UP1A 2V2TB 1MRFL 4TSAH 2B1HH 4S1DC 2ITDB 1WAAF 4KK8C 4K7FB 4GBXB 4F7PA 2GKIA 2FBJL 2H2SC 2UYLA 5E8PB 1MAML 5IMOB 5DO2C 4H8WH 2MJWA 1JTOA 5HVGB 2GCYB 1MCIA 4LF3A 5GS2D 1KB5A 5C8JB 3QAZC 5GSVA 1JK8B 2A9NL 4JHBA 3MSPA 5JXEA 4DN3H 1B4JH 4OGYH 1U9KA 2BVYA 3HMXL 4C4KO 5CP7B 1NC2B 3ARFD 1NGZB 5CKAA 5C0BB 1NGPL 2WWKO 4NQCB 1ZHLB 2F8OA 4NZTH 4LSPL 4WCYL 1LGVA 4R26H 3F62A 5DRZB 4EI5B 2E9IA 4O5LL 5D2LA 5J12C 3D87B 4GOSA 1U93B 3SE3A 3F7QA 4PJBF 3BHBA 1D6VH 2YK1H 1CDYA 4F9LA 4YDKH 1DBKL 4OQTH 4EKXA 1YMME 1JGVL 3QT2A 3ZHLA 3S4SG 2ZKHL 5FV1L 4U3CA 3RWCA 1U8HB 4HF5H 1CXIA 4U4BA 1RIHL 2BNRA 2P7TA 3GI8H 4H88H 4TQEL 4L9DA 1FZMB 4Z7VE 5FGBC 2NY3D 3QXWA 1HYSC 3VXMA 2AXJA 1I8MB 5A16B 3GSNA 3PWPD 2DQFB 5K9JH 2PO6C 1NBVL 2CLRA 2R0LL 3QDJB 4NN5B 5TDNA 2P8PA 2F53E 4OQ1A 2NPLX 5E70A 2I9LA 3E2HC 4PJDB 1NGXA 1EBPA 2DQHL 2BVEA 3OB8A 1KB5H 5IR1A 5BV7H 3WLBB 4YUEL 4NQSB 3MRPB 2FGWL 1OD7A 2RCSH 8FABB 3VFMA 1FIGL 4YHOH 4ZTPL 3S35L 5E2TL 3DVIA 4HUNB 5E4EC 5C6WH 4D0BB 5DDHA 3L3HB 4LP4A 2VLJD 5JO5B 3OKNA 2ZCLH 2CIKA 1MCWM 5JOFB 4Y4HD 5F88A 2JJVA 1U2HA 4QHUA 3OAZH 1AO7D 3MROA 4FQXD 5B3JF 3GSRB 4JANA 2BHZA 4G8FA 4PJ5E 5GJTH 5C0CA 2NYYD 3IRPX 1X5XA 3GRWL 3VRJA 3VG0H 2XWBB 2O5ZH 1BD2D 5D7JC 4Z0BL 3TZVB 4GH7B 3RDTC 1JYWA 4XP5H 3G6DH 1IRAY 5C9JB 1MJ7H 1MFAH 1I85C 1MFCL 3RUGF 2AV1B 3HE7B 3BMWA 3ZT7A 1QR1B 1LK2B 3KNBA 2ATKA 1FLRL 3WN5B 1X5IA 2Y07L 1D5ZB 1WJ3A 1X7QB 3CVIH 4M7JL 5GRJL 4WTXA 4WY7H 4JDVB 4LSDA 4WI4A 2F5AL 1EERB 2DLTA 3GSNH 4FXGB 3QUYA 3VWKD 4JLRA 1KIRB 4MD0A 4P5MB 5BZDB 2PTTB 1LEGA 3MZGB 5INDA 2BX5A 4WDIA 2G60L 3RRQA 3TVMB 3ZDYE 5C0FB 1ZA3B 3H9YA 4A2MA 2CGRH 2Z91A 1UFUA 3MRLA 4LKCA 2EKJA 1HHGA 2CJUL 2Q20A 3U4BL 3P4MA 4JJHA 1CU4L 5C0RL 3RIFF 4WWID 3FFCE 4PJEA 3UYRL 1T20B 4KK8D 4P4KC 1RJZA 1UB5A 4LFHG 1N5YL 1A6TA 4OIBA 4X5WA 4JFHD 1OARL 2H2SD 3VFSA 1DQLL 5DO2D 3DXAB 3SKMA 2VUYA 3OF6A 1FZOA 1P4BL 4YWGH 1AGBB 4L8BB 4NKDB 3TBTB 4LARH 2HFEB 2FX7L 2A1WH 4M7LL 1P7KB 4MWFA 4BJLA 1WAAE 4UNVA 2C3VB 3IVKA 5ALBL 3GMOA 3Q2CA 2LV4A 5KVFL 4ZOCA 4DCQB 4NHCL 2DDQL 2FD6L 3ES6B 2D0HA 4ERSL 1UXSA 3LEYL 1JZ3A 4JFOB 1V3JA 1A6AA 2BSTA 3BEVB 3I3BA 1WBZB 4U7MA 1KIQA 4MB5A 1KTKE 1S7QB 3VDBA 2XNAA 4U1HA 2NLJA 4M43H 5KJRH 1S9WB 2VDKL 5D7LA 5HHVL 1NUGA 4CDGC 2AW2A 1S5IL 2AQ2A 3KYKL 4M61A 3EFFB 4Y2OA 3AGVA 4I2XE 1JNJA 4MNHA 2C4FU 4F7EA 3LKPB 2H2PC 3IFPB 3SQOH 3VFTB 4O51A 5JHLH 2APTA 4PJBE 3BVNA 3K0WA 3KYOB 2FBOJ 4ELMF 4W4NA 3HR5B 2DD8H 4U6VH 2R69H 1HYSD 4MAYB 2VN7A 2YMXL 3TIDB 2P4AB 4XCCL 1UACH 2PO6D 4JFED 1MIEL 4I0PB 4OFYA 2GJZB 2X4TB 4X9GA 2QBWA 1K8IA 4YO0A 1BOGB 5INCA 4RBPH 1K8DB 5T33H 4RWYL 1KPRB 1M7XA 4C56A 1OGTB 3P11L 1PSKL 7FABL 2YSSA 4R3SA 4WHYG 2GTWB 2PW1B 3P9LA 4PTUA 2C3HA 5AZ2L 4RNRB 3C6SA 3NZHH 1YEHL 5ESAB 1MNUH 5A43C 1N0XH 1DE4A 4GKSA 3LKSA 1JWSB 4QWWC 5E8DL 3SDCA 1RUAH 2ZUUA 1IKNA 5DHVH 4RFEB 4HD9A 3MV7B 4YXLL 2R1WA 2E9BA 2VDPL 3O3AA 1YEGL 5D7JD 4DGIH 2AI0L 3MYZA 3RDTD 1F2XK 1HILB 4M7KH 3CU7A 1KYOK 3ARDB 4KFZC 3VWJB 3EDFA 1RIVL 4H20H 5F9JA 2GAZB 3ZHDA 1YYLH 4PY8I 4U1JA 2HKFL 3H0TA 4GRMB 1YN7B 3T77B 1Q1JH 5DJYA 2Y9RT 2HRLA 4OB5H 2VWEC 4XC1L 3ROLB 4RMTA 4TN9A 1XGTA 1UZ8B 1XT5A 4TSCL 4NO5B 4XNQA 3S96B 1H3WM 4URTB 1JWMA 3RUGE 5I9QB 1OAKH 3C5ZC 1KN2H 2P8LA 4LGPB 3VFPA 4M7ZB 4HGWA 4QOKE 2DYPA 4FQHA 1BIHA 2ID5A 1N6VA 3N1FC 1EJOH 1FNGA 3CJJA 3HZVA 2XIDA 3BWUC 4BKLB 1NDMA 3MV9A 4WGWB 2GJ6E 5ICZA 2ZOKA 2QKIA 2D7PA 1IGFH 4P4KD 2BOCB 1QFUH 1ZEAH 2RAMA 3WL9A 2XOTA 1EH9A 1IQWH 5LCVL 2Z8SA 1QLFB 3KHOA 1NCWH 4EQ3A 3OGOE 2X4NB 4OCSL 4CGTA 2FECI 1T89C 3QIUB 3HZMA 2VQUA 1FL5B 4AEEA 4JFYB 3F12B 4HFUH 3GBNL 4DKDC 1X5JA 4KV5F 3TBVA 4L4TA 1AD0B 2XQYK 3WFDH 5LGJA 1MI5B 4JG0H 2QHRL 1T80A 3H9HA 1DUYB 3GNML 4LSSH 3BXNB 4QY8B 4G8GD 5ITFB 2HKHH 5HGDA 4Y4FA 1SHMA 5CCKL 3EGSA 3QUXA 4HV8B 5IGXH 3HRZA 4GKNA 4NP4H 5IESH 3ESVF 2H2PD 3NABL 5EU3A 3O6FB 5CLWA 1U3JA 2QLVB 1Y18A 4QRTA 5J6GB 1BEYH 3QSKB 3QCTH 5HHOA 2BNQE 4LDLB 5CHNA 3DX6A 5F3BB 2FYYB 1OAZL 1HSBB 1ORQB 1NUNB 1DVFA 43C9A 3JTTA 3EJYC 1WT5A 4RMWA 4U1KA 1NSNH 4U3HA 4NQDB 4LNVA 1UQSB 3BH8B 3VH8G 1HHHA 3EFDH 3QEGL 4OT1H 1OSZA 5DJ6B 4ELME 2VE6A 4JY6B 4R7NB 3S7GA 3RI5K 3C60A 1MCKA 4LOUC 1M7DA 3LMJL 1UWEL 4Q9QH 3F7YA 3P4OB 3QXVA 2AJYH 4QEGA 5EIVA 1Q38A 1UKTA 1WFUA 4NCDA 2OL3A 2ICWB 3GMQB 1BM3L 5M94B 4QWWD 5J06A 2BVQA 2UZXB 5GZOC 2EYTB 3WJLC 4F7CB 1J86A 3KDMA 1T21A 4ZUTB 1VA9A 2BJMH 3CH1A 2Q3ZA 3K4DA 4MSWA 3VGEA 1NMAL 3VXUD 4F8TA 5LXGL 2KQNA 4KAQL 5IBTL 1P84K 1OT1A 3ZTNH 5ESQA 1QUNA 1ZA6A 5F96H 5I18L 5IBUG 4X6BA 5KSBA 1D9KC 1JP5A 3AS0A 4ZXBA 5KSAC 1DN0B 5C6PB 4XVJL 1S7RA 1Q0YH 2A74B 1CGVA 1KFAH 2H3NB 3EYSH 5DC0A 1Q0XL 3BYTA 4GSDH 3R06B 2AXHA 3BKCL 2NQCA 2UY6A 1FVDB 1V7ML 2VXUL 1L0YA 2QADC 3BZDA 5D9SA 4IM8A 3C5ZD 5D1ZC 4HH8A 1OAYH 2IPKA 1LO0L 2X4PA 1ZHNA 4F7MA 3SE4A 4X4YB 3PWVB 2O5YL 4JQIL 3TO4B 4CU7A 4NQVB 1E4XH 1OD9A 4NQXB 5IW1A 5GQBA 3F5WA 2DM3A 4AIXA 3CUPB 4DKFL 3EYFA 3VRIB 2HMIC 4RISL 2Q6WB 2QR0B 2W9EH 2Y5TA 1GCFA 4P0DA 3QNYB 4ZUSB 3TCLB 4MXWH 2I9TB 1HWGB 2OL3H 2V9RA 3RJDA 4OV5B 2JTDA 5DZNA 4N9OB 1RJLB 1U6AH 4KZDH 4NQEB 1BIIA 4R96A 4WEBL 4Y5XB 1GGBH 1TCRA 1X4YA 5DVLA 3GSWB 1I7RA 1EHXA 3VXSA 1C7SA 4FS0A 3J8F7 1I8IA 5IQ9A 4P2RE 5L7XL 3K2UH 4F7PB 1VESA 1K5NA 2UYLB 1NAKL 1VEMA 1KB5B 3E3QE 4LF3B 4ZUVA 5BV7B 5GSVB 1LO3L 1PGRB 4JGJA 4J3UA 2ZCHH 3MLVH 1S7UA 4L8SA 4NT6A 4AEHH 3ZYJA 4KV5E 2BK8A 5I1IH 4OCYH 4PS4L 1I3VA 1CE1L 3P0YL 1FG9C 3MGTA 4PGJA 1ES0A 2NMSA 4P9ML 1KV3A 1GAFH 5E24E 4Y88A 1LP9A 3MUHL 3FB7B 5T1DL 1AGDA 5D2LB 4HUXA 5GGSY 4JO4L 5DJ0A 1WZ1H 3BHBB 1OAQH 3MUZ1 4QHKI 1A7QL 4U1MA 5D2LF 1OSPH 3QQ3A 2OS7A 3RY5A 1MQ8A 2VXSH 1QEWA 4MJID 3EJYD 3IKKA 3DMMB 5CUSH 5HYIA 3VXNA 3EBAA 4WW2A 5EORL 1EUTA 3RWCB 4AK1A 4I9WD 1CXLA 1MJUL 5CGYC 3KJ4C 2BNRB 2P7TB 5C0EA 3SGDH 3TA3A 4L3EA 2QV2A 5DK2A 3TYFA 4LOUD 1CDJA 3P0VH 4B53A 3VXMB 3GSNB 3IDGB 1S78C 2FEEI 1YEKH 4IRSA 2CLRB 5TDNB 2P8PB 3UTTD 4XAWH 3VA6A 3MRMA 1WLHA 2I9LB 1NGXB 2OXGA 3RU8L 5EUOF 4OI7A 4I0CC 5GZOD 3D39E 2W1NA 1ZGLP 3O8XC 1QA9A 4LHUG 4YFLF 5IR1B 1TQCC 3UYOD 3VFMB 2EDHA 4C57C 4JFFA 4HHAA 5JLZA 5HHXL 3ULSA 5DXWA 3KLHC 3UJTH 4WIQA 1FSKB 2OR9L 5DDHB 4TSBH 5DJZA 3MC0A 3OKNB 1V3MA 2CIKB 4P4RA 2P8MA 3MGAA 2YN5A 3MCLL 5F88B 4QHUB 1D9KD 3MROB 4JANB 4G8FB 3BE1L 3EOYG 5KSAD 5C0CB 5E7BA 4JPKH 3VRJB 1CL7L 2ZG3A 4LSUL 5FYKL 4CADA 5I75B 4QT5A 4XBEL 3NFNA 3AY4A 3CFBA 1T3FA 2QADD 3O4OB 2QQQA 2KH2B 3U7WH 1DQDH 2WANA 5HHME 3V52H 2VZ3A 5D1ZD 2AGJH 2K9UA 2DQJL 2VRAA 2GITA 3KNBB 2NY5H 5ANMA 1WEJL 4P3CH 3DURA 4P59H 3K1KC 4PRHA 1A6VL 5D70L 4WJ5A 2HMID 4P2CG 3QUYB 3C8DA 3BPLC 4JLRB 4JN2A 1CFSA 3OMZA 4MD0B 4HG4J 35C8H 1A6UL 1BBDH 1LEGB 4QGYA 5C08A 4WUUD 5INDB 3T1WA 4EDWH 1J1XL 4WDIB 5E00A 1BGXL 4YNYA 1N6QH 3PQYD 2Z91B 5K9QI 3MRLB 4LKCB 3TJEH 1HHGB 2X4OA 4MYWB 3P4MB 3D2UD 3ZZ1A 5I1KH 5FYKD 4LAQH 4Y5VC 1I9IL 2N4IA 1OY3B 1DBAH 4PJEB 4JO3H 1YY8A 4NM4L 2CKBA 3QPQC 4ODWA 4PP2A 5EO9A 1RJZB 1UB5B 1A6TB 4X5WB 1E4XI 4GKOA 4Z7UF 3VFSB 2FGZA 2I25N 3SKMB 2VLKA 2JK5A 1KOAA 1FZOB 1QG3A 2WQRA 1D5IH 3D3VE 5D6CA 3WFBL 2E7LC 2D7TH 5E2VH 4MWFB 2OLDA 4FNLH 4MHHI 4G9DA 1OP5K 1CGTA 2LU7A 3IVKB 3GMOB 2G5BA 1I3GL 4JHWL 3GIVB 1PKQE 5SWQA 2ZJSH 1UXSB 3WFCH 1CGWA 4UDUA 1A6AB 2BSTB 3AAZB 2FHCA 5I71C 1KIQB 1KLGA 1TITA 2UV3A 2B5IC 2XNAB 4U1HB 1QSEE 1S9YA 2NLJB 3IJHA 5D7LB 4IIQC 3JUZA 1N0LA 3IYLW 4PLKC 4XBPA 1EJ6A 4TUKH 4M61B 2DLEA 3MJ9A 4MNHB 1L0QA 4XNUL 4F7EB 5TE4L 3I3EA 4GS7C 1MJ8H 5CGYD 4O51B 3BVNB 4A6YA 3S36H 2KDGA 3PDDA 4IRZH 3VFNA 3K81A 4YHML 4PD4K 1YMMD 1S78D 2DLFL 1TPXB 4NO0D 2CKBH 4H0GA 1Q72H 5GISH 4P23C 4Q2ZA 5TF0A 4FTVD 1INEL 1VKXA 2KL6A 3TP4A 1K8IB 2PR4H 4YO0B 5INCB 2ENSA 2NY4C 4C56B 3GSVA 3O8XD 2FX9H 3WSQL 4JREC 4JFQA 4OSUH 3N1MC 3UTPE 1Z2KA 2D7OA 3QWQB 3PGFL 2YSSB 2WIIA 2FH8A 1WC7A 4GRLA 4R3SB 5D1QC 3KLHD 1CICD 3MFGB 4BQ8A 2XT1B 3P9LB 4PTUB 3SGDI 1EBAA 1AXIB 3C6SB 5JR1H 2ARJA 5EUOE 2F53D 1IAMA 1DE4B 4GKSB 1IE5A 3LKSB 1DDHA 5I1AA 4HXBH 4R97B 1CLZH 4QRRE 3SDCB 4HIJA 5GRUL 4JO1L 5ADOL 3PP4H 5DJDA 5SX4I 1F5WA 2ZNXA 3S37H 2R1WB 1LE5A 3QIBA 3O3AB 3MRDA 2VC2L 3C6LC 4HC1H 4OLVL 3NAAL 4OCXL 1I7TA 5DMKA 3BI9X 1KXVC 4G6KL 1FE8L 2P48B 3C09B 3DUSA 4IDJH 3FB6A 3MJ9H 5EU5A 5FKAA 4UV7L 4PJ5D 5GGQL 5F9JB 5C70A 2DQEH 2GW5A 4U1JB 4A6YH 2R2HA 3H0TB 5DJYB 1LHZA 4NRYA 3RPKA 1VADA 2BRRH 3T0BA 3BKJL 1XGTB 3C08L 3RWEA 4XNQB 4F58H 1YPZA 1F4YL 4ODSL 4P2OA 3DVGA 1JWMB 1Q9WA 3STLA 1LDPL 1CN4A 3X11A 2VL5A 3K74B 4LRIC 4E41E 3VFPB 2P8LB 4UMGA 3SO3B 3QZWG 4HGWB 3VXTA 5MENA 2DYPB 4FQHB 2VN4A 4YEEA 1WFNA 4NFBA 5FA4A 3GMPA 4LCCC 1INDL 1FNGB 1DSFH 3V6OE 3HZVB 5ID1A 1WTLA 1NDMB 3MV9B 2X70A 4P46A 3QPXL 5E6YA 5DFWH 5ICZB 5DD5H 2ZOKB 3QPQD 2QKIB 4XCYA 1HXYA 3ESUF 3WIHA 3VG9B 3OAZK 3WL9B 1X5ZA 4ZDHA 3I6LD 1P2CA 3WIIH 3QUZC 3HS0A 4KJPC 4U33A 5BOZG 1UCBL 1EO8L 2W9DL 3C8HA 2D2OA 1W0WA 1YJDH 3A67H 3IJYA 4S10A 1QFPA 3HAEG 4PJCF 2HFGH 3ZE2F 3HZMB 5IMMA 3S88H 1DQTA 2EKSA 4JFXA 3TBVB 4L4TB 4KTEH 4TVPH 1G0YR 2C4FT 5LGJB 3RNKA 5IFHH 5F1IA 3EDDA 1I1AA 5DJAA 2W65A 3H9HB 4KJQC 1T0PB 1ZKAA 2Z35A 5HI3C 2XQYG 3ZO0A 3OL2A 3FJTA 1VGEL 4Z7WE 5IKCA 1HZHL 3T2NL 4P5KA 5HGDB 4Y4FB 4PLKD 4J3XA 1KLFA 3EGSB 3QUXB 1OAUL 3HRZB 4GKNB 1YY9C 4ELKA 2VDOL 4UT9L 1JHLL 5EU3B 3W9EA 1Y18B 2A6KA 4QRTB 2E6QA 3OKKA 1H5BA 5KVGH 2ARWA 5HHOB 3BW9A 1TLKA 5CHNB 2XTJE 3DX6B 1JV5A 5H37G 1DVFB 43C9B 4ODHH 3JTTB 3V4UH 1GOGA 4U1KB 3CZFA 3MODH 4UT6L 4P23D 4QXWA 1B88A 2FL5A 4YHPA 4M5ZL 1HHHB 1P4IL 3Q1SH 1OSZB 2CUMA 2VE6B 4Q6IA 2NY4D 4R90H 3DECA 5H94B 3JBG7 3DUUA 2JJUA 4UUJA 2X2YA 3WHXA 2VDQH 1V05A 4JO2L 3C60B 5E08H 4K3JH 2QSCH 1EMTH 4UAOB 1M7DB 3JV5A 3F7YB 2F9BT 1KEGL 1II4E 1KC5H 5D1QD 4CMMA 4X6DA 3D48R 3D25A 3VGAC 2MKWA 4X80L 4HKXA 3N9GL 3VW3L 4YIQA 2OL3B 1J0JA 3IRZA 2BVQB 5DD1L 1YNTA 2MCPL 4HS8H 3SGEI 3KDMB 1T21B 2VZOA 2AS5M 2ED9A 3NCJL 3CH1B 4QRSA 2DI8A 4MSWB 3C6LD 3L1OL 3Q6GH 3RTQA 2P47B 4GXVL 2WBJA 2N1KA 5ESQB 4HUKB 3SOBL 1GXEA 5C3TA 1IAOA 1ZA6B 4MCZA 3UBXA 4X6BB 3W2DH 4YHZH 5KSBB 3P9MA 3PE9A 1WCBA 4ZXBB 2OMNA 4C59B 5IHBA 4QHLA 1YMHA 3QCVL 1S7RB 3SKUD 3SDXA 3HG1E 4RIRA 5FO8A 4LCIL 3I50L 5ALCH 2YUXA 2NY0C 4N9GA 5C2UB 4DEPC 3INUH 1H0DA 1NLBL 4V1DE 3WO4C 1CIDA 1S7SA 4LIQE 5C1MB 4I18A 3JUYA 4Q74A 4OZIA 4LMQI 2IPKB 4RBPK 2X4PB 3DYOA 4KMLB 5HHQA 1ZHNB 5GRVL 4FZEH 5CSBA 5CZVL 5I1GH 5CD5C 1IT9L 4PG9A 5LGHH 1D6EA 4ZNEE 4NWUH 4JZJA 5IW1B 5FHBH 3F5WB 4JGMA 3EYFB 1GGYA 3FMGL 1I9JL 1T2QH 2DB8A 1FPTH 2Y5TB 4JRYE 4UILL 3SDYH 5EO1A 3OJDA 1ITBB 2FR4A 3OBAA 3WFZA 2H9GA 2APVA 2YS4A 3HI6H 3QUZD 1BIIB 4R96B 4KJPD 1TCRB 5DC9B 1FFOA 1I7RB 5DUPH 4JE4B 1DQJA 1XCTA 2GJ6D 3VXSB 1MY5A 2Q8AH 5J0BA 1G9NL 4HZAA 5LWYH 1I8IB 2R1XA 5IQ9B 4PJHE 5AZEH 2JB5H 5D7IE 1JYXA 2XRAL 3TWCL 1K5NB 1CFNA 1NKOA 3DETC 4OAWA 1T6WA 1A21A 1A6WL 1CVRA 1HDMA 5B38G 5HHPA 4ZUVB 3A6CH 4OD3L 4ALAL 2GEEA 4ZS6C 4KQ3H 4YHLL 4KJQD 4PJCE 3ZE2E 2VR5A 5F44A 5IVZA 5HI3D 1QNZH 1S7UB 2MQCA 5KAQG 4L8SB 4NT6B 1Z9LA 3Q5OA 2XG4A 1UH2A 1JIBA 2V5RA 3M07A 1YY9D 5GIRA 3MGTB 4HMDA 1ES0B 3ZE1F 3MV8E 1LP9B 1A1MA 3CXDL 1AGDB 4HUXB 5FIEA 3QUKA 5DJ0B 1H3PH 4MNQE 4U1MB 4K2UL 2R0ZH 3ULVF 2ZPKL 3RHWF 2OZ4A 3QQ3B 2PTUA 3GM8A 4XMPH 3QIUC 5DRNA 5FYJE 1QEWB 2Q8BH 5JUEH 5F7YC 1X6LA 2HH0L 2FLBT 3VXNB 1GGCH 4WW2B 4LASL 1A4JA 1BFOA 2NNAA 2JCCA 1FH5H 5C0EB 1S7TA 3TA3B 4L3EB 4L3AA 4HUVA 3FQNA 5DK2B 4LLWA 2VDNH 3TYFB 2A6DA 3ARFA 2BNQD 1QOKA 5FUCE 4KDTA 4PV8A 5D7SL 1GRWA 4IRSB 2J8UE 5BS0E 4HAGA 6FABL 5I1CL 1HIML 3MRMB 1HN1A 5F7NC 4XXDA 1AGCA 1QTYT 3ULUH 5IHZA 5KBNC 3EJZC 3BGAA 2D9CA 1QA9B 3X3FL 5I16A 5D96B 2PETA 2BVPA 2X5PA 3SO5A 1BFTA 2JELL 5KVEL 4K7PH 4JFFB 2NZ9C 4HHAB 5JLZB 1XMWA 3ULSB 2IPTL 3ZDXF 1CFVL 5KVDH 5I1HL 2EYSA 4POZC 5DJZB 1ZVYA 1REIA 5FYLE 5C0NC 3DSFH 4P4RB 2P8MB 2DWDA 3JWDC 4EUPA 5D72H 1KT2A 1I7UA 4CADB 4PJAE 1FL6A 1T22A 2KBGA 3PWPA 4QT5B 1BJ1J 2AK1H 3NFNB 5F6IB 3CFBB 2NY0D 5ILTL 1T3FB 2HYMA 4RDQG 2OZ4H 1H8OA 3CLEH 1N7ML 1U91A 5JIPA 4L5FH 3RWHA 4JKLA 1P6AB 5GS2H 4EVNA 1I8LA 1LVEA 2F19H 3EZJB 3HB3D 1DBBL 2GITB 3P0GB 2UZYB 5ANMB 3L5XL 3SBWA 4RRPG 1CXEA 2AJUH 3B5GA 2XFXA 3NACH 4X9HA 3BMVA 3DURB 2VYRE 4K8RC 2VLJA 3LZFH 4PRHB 5DUML 1U8KA 3CDFA 4IS6A 5H35A 4WJ5B 4Y4HA 4FFYH 5GGVH 1S3KL 2D03L 3MUGA 1ZHBA 1XGYL 4JN2B 2OCFD 3MRJA 1AO7A 1CFSB 4FQXA 2DQUH 4M48H 4FQ1L 4RGOH 5C08B 5DSCA 1WZMA 4WWKC 3O2WH 1FG2A 3DRQA 4HJGA 1N8ZA 4OLUH 4LQFH 3ZYOA 5I1JL 4BQCA 4YNYB 2BC4A 1BD2A 4L9LC 3NVQA 5BXFA 2X4OB 3HUJF 5FGRA 3A6BH 4EI6A 1IVLA 5DFVD 1YY8B 5AG9A 2CKBB 1MRFH 2DI7A 4NQCE 4ODWB 4PP2B 2DBLL 5EO9B 5KAQF 3DETD 1MAMH 3G5ZA 1A64A 2VLKB 2JK5B 4S1SL 4QLRA 4EUPH 3LRGA 4ZO6A 6CGTA 1IEHA 5D6CB 4ZS6D 5AAWA 3VWKA 1LO5A 1FNLA 2IH1A 4NUGL 4G9DB 1MHCA 3DYMA 4Q9RL 2G5BB 3SKOA 3CVHL 4FQPA 5SWQB 1NGPH 4UIMA 3QDME 4R4FL 3WUZA 1BZ7A 4TUOA 4UDUB 5E6ZA 1BZQK 4RAUA 4LSPH 4WCYH 3IF1A 1HH9A 3GRWA 4TRPL 1KLGB 1GOFA 1RIUL 1S9YB 2OJZH 3CFKA 3QDJE 3IJHB 3OJVC 5T5NG 1DBKH 1GGTA 3W0WD 1JGVH 3MOBL 4WI6A 2EDWA 4Y8AA 4XBPB 1KN4L 3JWDL 1EZVY 2ZKHH 3ZE1E 1EX0A 3F8UB 5DK3A 3BRFA 1G7IA 1RIHH 3QG7L 1FGVL 5D4QA 1NGWA 5FKPA 4A6YB 2IANE 3ULVE 3NH7L 1FNFA 3OG6B 3VFNB 1R3IL 2AJVL 2VKXA 4KU1A 4K9EH 2EO1A 3WNOA 1MQKL 1XFPA 3QDAA 1NBVH 2R0LH 4MA7L 3UPRA 4PJXA 2ZUXA 4Q2ZB 1K3ZA 4K23L 5GRZA 3PWNA 2DQHH 3PIQA 3EJZD 2XZCH 3GSVB 1HKFA 1UENA 4JFQB 4DAGL 2FGWH 3N06B 5J4MA 4BSWA 1FIGH 3PDOA 4ZTPH 2WIIB 3S35H 5E2TH 1WC7B 1HNFA 4GRLB 4HT1L 3QDGE 1QSFE 4POZD 1PX4A 2VLRE 5C0ND 5DS8A 4H8WL 2ARJB 4XP1L 1V7NL 2F74A 4OLYL 4RDQF 1DDHB 5I1AB 3T8XA 3CSYA 3QCUL 3D39D 4HIJB 4IMKC 5FGBA 5DJDB 3R8QA 1J10A 3GRWH 2DLHA 3BESR 4HCRL 2IF7A 2I26N 4ODTL 2PO6A 3QIBB 4RFNB 1LE5B 3MRDB 4HK3J 4IJ3C 5T1KD