3C6LB

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
236
structure length
227
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDAWGYEQYFGPGTRLTVLEDLRDVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEKPVTQDISAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
molecule keywords TCR 2W20 alpha chain
total genus 42
structure length 227
sequence length 236
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6lB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6lB02
3DGGA 4PJIA 3RBSA 4EN3B 4NM8L 4K71C 4RIRB 4XAWL 2MNUA 4BQBA 4P5KA 2ICES 4KC3B 5F7FA 5DJZB 4HKBB 1Q94A 3WNPA 1LO3L 1MI5E 1BBDL 4G8EA 2VTFA 4X9IA 3MNZA 5DVNA 1EMTH 3RWFA 1DL7L 4RZCA 2NY5C 5DD1L 5BS0D 1RU9H 4FXLA 2PKDA 1NMBL 3SHSA 1MCPL 1A9EA 1R5WB 4GXUN 4ZPVB 3VXUB 2JJSA 1M7IB 2PO6B 4BFIA 2ERJB 5K59E 4PFEA 3SO5A 1FC1A 4AT6B 1WWAX 5JUEL 4MS8C 3CXHJ 4ODUB 3OAYH 4DZBB 1A8JH 2Z31C 3N1PC 1Q9KB 4RFNC 4ORGB 3M07A 1H3VA 3GMRB 3BP7A 4WWKA 4GG8B 4NFDA 3STBA 4IRJC 3TO2B 3EO9L 2EDNA 4GJTB 3HAEB 5DD3H 1V7ML 4KZEL 1G7IB 3IDNB 5HYSG 1T04A 4NNXB 1RZ7L 2J5LC 1T7YA 1I7TB 3CVHH 4ODXB 4JO3L 1CD8A 3P30H 4GRWE 3WLBA 2UZYB 4PJFF 1WEJH 2X4QA 4K07A 3L6FA 3D6GA 5IVXE 5KW9H 4HBQA 3TNNA 1OQOA 5E8EA 1UKSA 1TQCB 1U3YA 2AABL 5F3BA 1M7DB 3ZSSA 4POUB 3H42L 5IW1A 4NDMB 4AJ0A 1WISA 3MOAH 5C8JA 1X3DA 4OF0A 1T04B 2JCCA 4P4KA 3QUKB 3U7WH 1S5HA 2Y23A 1CGVA 1IARB 5F9OH 1AXTH 4S1DC 5MEND 3BH8A 2F54E 5F7NC 3LEXA 4TUOB 2YD5A 3T2PA 5EOCJ 2OXGA 1DQML 4LRNL 5DMIL 5CKGA 3LY6A 3D2UB 1T03L 1KACB 1F11A 3DSFH 2FRGP 3DV4B 4PLKD 1F6LL 3R1GL 1K6QH 1UWXH 4KMTH 5D2LE 3P9WB 1G6VK 2BY1A 5CJQL 3S9DB 2XWJB 5DK3A 2IH3B 5D8JL 1AXSB 1BVKA 5J6GA 3MRMB 3QUMA 1OSPL 3OKNA 1MH5B 4M7LT 1AQKH 3FT2A 1NC2B 3AS0A 3VD4A 1QLRA 3FN9A 2GKIA 4GRLB 3VRJA 3D3VA 3DMMB 5IB2A 1FNSL 1WIUA 2A74B 3HAEA 4XNZC 5FYJU 2PTVA 4DK3A 1MCQA 1A4JA 5C3LD 4NJ9L 3PL6A 3U2SA 5AZEH 3X13A 5EO1B 3HPLB 4LF3B 3K80A 1AGEB 3GMOA 2APBA 5IP4A 4HWNA 3BZFB 4K94H 5KSBB 2FX9L 2F9BT 5KVFL 4KRLB 1L7IH 4NC1E 2R1XA 3QIBD 5A43C 3RY4A 3LCYA 4TTGA 1F11B 2VQ1A 5L2JB 1CXEA 3OHXB 1HXYA 4FQJH 4OCYL 3SOBH 4HLJA 4N0UB 3R4DA 5MI0C 3FFDA 2ADGB 4K3DH 3CXDL 3GNMH 4DW2H 8FABA 2PW1A 1HHJA 4X7DC 3NZHL 4O58L 1OF2A 3QQ9D 5A40E 3OKLA 1IEAB 1MFNA 3SDYH 2M2DA 1INQA 1JRHL 3FOLA 3K7UA 5ADOL 5T3XH 3RUGA 2YEZB 1PSKH 1AD9A 3X14A 1L6ZA 1KB9K 2VRAA 2RQ8A 5I15L 3BKYH 4MQ7A 5HD8C 3I50L 4K7PX 5LVEA 1HKLL 3P11H 4EIZC 2GJZB 3L6FB 2IAMA 2CDGA 3TH4T 2AK4B 2VE6B 2YKLH 1CR9L 4FG6D 1X9QA 4M8VA 2YBRB 4MJ5B 3RVVD 3RVWD 3LV3B 3GB7B 4AQ1B 2HN7A 4NQSA 1IT9L 1S7XA 5H94A 1QSEA 5DD5H 4I77L 4P9HC 3P2TA 3BQUA 1T1ZA 2AXHA 2IF7A 2PXYC 3NFSL 4ORGA 3MJ7B 4FNLH 1KEML 3HNSL 2D9QB 2QHRL 2KQMA 3KPSB 4XTRC 3P4LA 1J1PL 4X4XA 1A21A 3IFLH 4JFHE 2EO1A 1AHWC 4FTVA 4ZUTA 1VHPA 4LPUA 5DR5L 1ND0B 1T1WB 1UH3A 4Y4HA 5K9QG 3TM6A 3ZT5A 4P9ML 3NCFB 5KANG 4R4BA 5BO1H 3CH1A 1VACA 4IRSB 5FGRA 4MNQD 4XC1H 3F6LA 1E4WL 3B43A 1XF3A 4NZJA 2XZCH 4LHUB 3P4NA 1D5IL 1FP5A 1TENA 2W60A 3BSZH 3QJFB 4JB9L 5E8PA 2DKSA 4PJFA 1XZ0B 3WNNA 3CFJB 5DJ0B 1ZLUH 3U9UB 1JF6A 3OF6D 4HAFA 5CJOL 5D1QC 5IJKA 5DJDB 3VH8A 5A3IC 1QYGH 3QEQA 4H5SA 4X4YA 2HJLA 4ODWB 2AVGA 5FDWA 5IQ9A 3X3FH 4TVPD 2G60L 2OTPA 2BRRL 3MLWL 4WV1B 5KSBE 2YMXL 4CJ0A 4WEBL 3T08A 3QQ4B 5C0CB 1FG9C 1NBYA 3T0EA 3AAZA 3QXWA 3D85D 4YO0B 4C56E 2BNQD 5HI3C 1VEOA 4YIQB 1TVHB 1T83C 4IIQA 2ILLA 3PHQB 5MHSD 5GGVY 5EU7C 4PGZA 4BH7A 4LMQI 4EQ3A 1I1YB 2CDEB 2LE9A 5C0ND 1BPVA 1AY1L 2VDLH 4NUGL 3F5WB 3U4BL 1I7RA 4MNQA 4PY7A 5EO9B 1JPTL 3QYCA 4ZOEA 2AQ2A 5LBSL 1QFPA 3G5ZA 4K7PH 1HHIB 5CBAA 4LVNB 4QT5A 4MNGA 3PDOB 2WBKA 3DO7B 3CFDB 4HLZH 4HX1A 4OZFB 1MREL 1TETL 3B8SA 1IQWL 5IF0A 4D2NA 2F54B 1I3GH 4RGND 3UZQA 1KIRA 1YQVL 4OZIE 4PGCB 4AL8L 1K85A 2QSTA 4X99B 4GOSA 3HI1B 1FV1B 4NPYB 3C60C 3QUYA 2Q76A 3H9HA 3T09A 2VXQH 4KGLA 3AU1B 3TP4A 5ID1A 2ZUWA 2DQUH 1HDMA 4PJEF 4Y1AD 4N0YH 1Z3GH 4HHAB 2A6DA 1CLZL 3P30L 4PGBA 3W0WE 2VDMH 2CPCA 1I1AC 4RGNE 3RY6A 4HD9A 3RVUC 1A1MB 4XVJH 2J4WH 4M9PA 5E8PB 1CICA 1W72B 3N1FC 3QG6B 3P73A 2HT3D 3U30B 3QAZC 2DDQH 1AD0A 3VXSB 2QADB 3LKPB 4MA8H 2BSRB 4JQVC 4HAGA 5DRWA 4QYOA 1GC1C 1N6QL 1CTNA 4UZGA 3I75B 2DQDL 4R4FH 3GBML 3H9SB 4ALAL 2UZIH 3KPOB 4KUZL 1IAMA 4K71B 5I2IB 4M5ZL 3MV8A 4FZ8H 4NQED 5TF0A 3KYNB 3BHBA 4LIQH 2OP4H 1Q0XH 4X4XB 4XCCL 4HIHA 3FCTB 3RNQA 1ZLVH 2H1PL 1IM3B 3I84A 5FYJH 1ZLUK 3GM0A 4LSQL 4UU9A 3WN5B 4CJ1A 3MRGB 5FGBA 5GRVL 2YK1L 2YA1A 2YUWA 4FN0A 4JM2B 3MA9H 1B0RB 5DTFB 1Y6NR 3T77A 5BS0E 1MLCB 4KKBC 2DBLL 5C86A 2I5YL 3O45B 5T33H 1ZA3B 4JZNB 1JNLH 1CGXA 1LGVA 2X70A 5DHYB 1S7SB 1A7QL 1HSAA 3VFUA 3U83A 2ADFH 2MQCA 3D18A 1FLTX 2JB6B 4S1SL 4PRHB 4AZ8A 4ODHH 5IOPB 4EJ1C 3CDCA 5JW5B 4YXHH 3KG5A 4OSUL 1GZQB 3T1FB 3M8OL 2XA8L 1BHGA 5GRUL 4ZAKB 1PKOA 4O2EB 3CFIC 2NXZB 3LQAH 7CGTA 3TZVC 4E42B 3PGDA 4OBRA 3E6FA 1MCWM 3FQXB 4TVPE 5FEBA 5L2KE 2VDML 3GKZA 3A6CL 3HG1B 1Q38A 2LABA 1Y6MR 1E6OH 1XF5A 2CUHA 4M1DL 3QBTB 4Y5VB 5EUOE 3ZZ1A 1XF2B 2AJXL 5MENA 3LMJL 3NFNB 1BIHA 4FTVD 1Q0YH 3AS2A 1ED3B 1S78D 2WWMD 5HXMA 1JBJA 1KUMA 4J1UB 4UINL 1JNLL 4U1KA 1MWAA 1WFNA 2GK0B 3T04D 3DX8A 4HV8A 4WDIB 3DX6B 5GISH 1UM6L 2HT2D 1NGYA 3GMQB 3MA9L 4RMSA 1G0DA 5BV7B 3WS6C 4L3ED 5HHNA 4ZXBA 1JMZA 2DQCH 4FQ2H 4PS4L 5E2TL 5ACZA 4DGIH 1BZ7B 3FT2B 1B6UA 5GS0H 4UDUB 3BE1L 3U0TB 2SEBB 4W6XB 3IDMB 4NIKB 4F9PA 4TPRL 5DZLA 4I18B 3L3OB 4HIJA 4JZJA 2X4PB 2YA2A 4ZNEE 3OPZL 5D2LB 1W2KT 3VXPA 4YZFF 4YHML 5E6IB 3TLRA 3GSOA 4PJ9B 4PRID 2V7NB 3MACH 1ZANL 1PZ5B 3MV8D 1BQSA 1OQXA 2DWDB 4ZS6D 3ARTA 2DQEL 3S37H 3TBSB 2VB5A 1GZPA 2BVQA 2O61A 3UTTE 1OTTD 3MV7E 3UTSB 3KWWA 4M62H 5BVPH 3PV6A 4KXZH 5C9KA 3T0WA 5K59F 3FQRB 1RZKL 1H3PH 4ZUWA 5F3BB 3LD8B 4H8WL 1XGTA 4JFFE 1SJHB 4JPIA 4NQDD 1V8HA 2ZPKL 3EDKA 4EEEA 4NZTL 5JTWA 1U8HB 5F96L 4D9LH 3MRIB 4XNZB 2IGFH 5DJYA 1G7IA 4RMVA 3W9EA 1IM9B 5HYQB 3HTLX 1LNUA 4GRMA 2IFFH 4F9LC 2VIRA 4ONHA 3MGAA 4MJ4A 4OZ4A 4U6TA 2IPTL 4K7PL 4FQQB 5F7YC 3VFSA 4NN6B 1D5ZA 1ZLSH 2P5EB 1G9ML 1NUDA 1XH3B 4UMGA 2QHRH 4WUUB 4JJ5B 1Z0MA 1C16A 3MLYL 4O51A 3TVMC 2ZCKH 3WFCH 4YBLC 5IGXL 2NY6C 1I4FA 1WTGT 3H0TA 1DUYB 3IXAB 4NZUL 4OKDA 5KTEH 4K9EH 5T1DH 4U7KA 3U2SB 3WLBB 2OL3H 3LPWA 3VWJD 4R2GC 2PNDA 2R56L 1FZKA 4CNIA 3BYTA 5HJ3A 3PIQA 1KLGB 2E9JA 1UH2A 4KZDH 1TMCB 3WIHL 4KQ4H 3AGVA 4XP6L 1Y0LB 1MHEB 1MRFH 4LCYA 1LO0H 4EN3A 1I3UA 4WWKB 9CGTA 3HN3A 3QPXH 3V7AG 5DZNA 5JQHC 4KK5C 3MJ8B 1M1SA 3QDJA 2A0LD 2E3VA 1EEYB 1CFTA 3MV01 5CJOH 1MJJA 2HFEA 4NQDA 2UYLA 3RFZC 2X4TA 1MFAL 3MRPB 4QHLB 5I1DA 1FAIL 4L4VA 1TITA 1HIML 1UA6L 4H25B 3QWRD 3NZHH 4O58H 2VL4A 1BFVL 3V4PL 5IBUG 1RUML 5J3HD 2OL3B 4P59H 5CD3B 1PY9A 1E4XI 1VFBB 3G6AA 5C0JB 1XR9A 3BPCB 3KDMB 1FGVH 2XRAH 4GRLC 2AKRA 5AZ2H 3QUMH 3RDTA 1KLUB 4ZPTA 2J88H 5HHNB 5EZJA 5TGBA 1P84K 3CD4A 4GAGL 1FZOA 4PP2B 4QHUB 1QEWA 1CF8H 1YY9D 3QO1B 4O9HH 4C56D 4P2OC 4YDKH 2C3XA 5GRJH 4EZMA 3B6SB 4QOKD 4J3XA 2HLFD 3T2QA 4Q97A 1ITCA 2YD7A 4G8FB 1YJDH 3TC9A 4D8PB 1JPSL 4R97B 3BP7B 4FZEL 3SQBA 4G7YH 3CGTA 3CFCL 3M45A 4QRUA 2Y36H 4FQLL 3ULUC 1T03H 1X4ZA 3ES6A 3KHQA 1T5WB 4ZTOH 1NBZB 1M71B 4HXAL 4YEFA 4M7LL 1GHFL 3Q5OA 2HG5B 3RL2B 3LAFA 2XWBB 4RGOL 1J7VR 5L7XL 1QFWI 1YEFH 2ZNXA 4OQ1A 4OGYL 3GHEL 3P4MA 4WRLA 1T2QH 2JB6A 4NWTH 2CO7B 3CVHA 4I0KA 4QHNA 4UT6L 5CSGA 5IVOA 2QR0A 2J7LA 2X4NB 5EU5B 3EOTL 3GSXB 2IAND 3K8MA 2OTUA 2EDTA 4X9HA 5GZNC 1BECA 5E08H 5GGTL 4MAYA 3H2WA 1A0QL 1FIGL 1WEJL 4ZSOB 3ULVD 1KTRL 4N0FA 3O45A 3PJSB 1UCTA 2ICEB 2MTPA 2HLAA 4Z7UE 1EUTA 1P7KA 4LP5A 3UDWC 1CD1B 5ADPH 3PDGA 2V2WA 1S7VB 4PRDA 3IF1A 3QCUH 2DRUA 4XCEA 2B7DT 2K9UA 3H3PH 3O11B 4ODSL 1Y18B 4H26A 5CP3A 4OF5A 1RZGB 3S37L 3RY5A 3NA9H 4IRSD 4OV5A 3OKOA 4ZOCA 3W11D 1ADQH 4X6FB 1JTPA 3VXOB 1OSPH 3D39A 3SGDH 4AMKH 3EOBA 5FYLE 1NAMH 5L9DH 4P49A 1AGCA 2CRMA 1YEDA 5F1IA 4IOIB 1KIPB 4OLWL 3SDCD 3KLDA 2VSDA 3QXAA 1JGDA 4ERSH 1VB9A 5KVEL 1P6AB 4Z76B 4R96A 3U6RA 4NQTA 2OZ4H 2Q3AA 5SWZA 4RRPA 1RU9L 1S9VB 1D6EA 3PWJA 3OR6B 2G5BA 1J87A 1KIQA 4MAUL 1F4WH 1LO2L 4WHDA 1UQSA 2PTTB 1MWAB 5F7EL 3PXHA 2XV6B 1A7NH 5ACLA 1E4KA 2CXGA 1K8DB 2F58H 2YC1B 3BYYA 2GSIB 2J8UE 4NRXB 1BOGA 1AGBA 2X9YA 2EC8A 5DD0H 3SDDA 5J13B 3EDDA 1AI1L 3KPSD 1KCUL 2D4FA 3OBAA 4LBEA 3IB4A 4HMDA 3TIDA 3FQXA 2IC2A 1GVIA 5I76B 3V6FA 4HXBL 4PUBL 5KZCB 4Z77A 2W0FA 1XGRA 4X7TB 1G6RA 4J6RL 3MC0A 4PJGF 4XTRD 3K3QA 5LJYH 1W0YT 1R3HA 4WY7L 5T1LA 1S7UA 1JVKA 3CZFB 5CBEA 1QD0A 1B0GB 2EH7H 1YNLL 4QT5B 4KI5F 2OJEB 4IMLA 5HDBF 4EI5A 1TVBA 1I9RL 2UWEF 3OB8A 1G7PA 5I1HL 3O4LD 1ONQA 3WMSA 5INDA 1G84A 1MAKA 4NYLB 3ARGB 2IFFL 1YEDB 1C08A 5KS9A 3IDIA 3QG7L 1JE6A 3GI9L 2HJFB 4OV6F 4MA1B 2ADJB 4AM0A 2AGJL 4KKLC 1I8LC 4PRBA 4N8CH 1D9KD 1NBYB 2FBJL 5EU4A 4PTTA 3E0GA 3SDCC 5FOBA 3BWAA 1RQ5A 5F1KC 1N5YH 2OSLB 5HYFA 1JZ6A 2ZG2A 1PJ9A 2E8ZA 3BWAB 5CSZA 3KPTA 5T3XE 5FECA 5HSFA 1AIFB 1BEYH 5HHMD 4F33B 3F7YA 5DD6B 4AIOA 2NZIA 1DN0A 1HYSD 5IVXA 4JKKA 4D0DA 5E5RB 2PYFA 2P7TB 5CHNA 4YHKL 3LKNB 1D5MA 4PJBF 3ULVF 5C09E 3O41B 1S9XB 3FFCB 1MQKL 2UUDK 3OZ9H 2NY2D 3RWGB 2DQDH 1JGLL 1FL6A 5T5FL 2Q8AH 1G9NH 1NSNH 1DBKL 1R3HB 1N64H 4LPXA 2YPLA 3PWLA 3RL2A 4WFGE 2HRPL 2QSQA 1NC4D 1NCUA 2IQAA 5EZOL 5JORA 2APXA 1P7QA 2L7JA 1NDGB 2YZ8A 4HJJL 2VR5A 3DHJA 5DFVC 2Y5EA 5IMLA 1VFAB 2NTFA 5D2NB 4XNMA 4BK4A 5MENE 4KVCH 5D1ZB 3ZDXF 3GMMB 5FF6A 3Q6GH 5L2KA 2E5EA 1KG0B 2XT1B 1ORSA 3SKMB 1U3HA 4JRXD 1FNEA 1AGDB 5CHNB 1GOGA 1REIA 2X4RB 4Y4FD 5DJCB 4L8CB 1FG2B 4PJCB 3STZB 3LS5L 3RZWA 3MREA 2FWOB 1FZOB 3A6OA 3LN4B 1H0DB 4JR9L 4Z7UA 3G5ZB 4HKXB 2AJVL 3LDBB 3EBAA 4PLJD 4NQEA 2NY6B 5D7JA 5J13C 2ENSA 5DMGD 1VCAA 3QNYA 5BMFH 1JZ4A 4E0RB 1PD6A 3ZT7A 4RGNC 3P9LA 4HFUL 4Q2ZB 4LLQA 4WUUE 1CBVL 5FFLA 1R0AL 3EOBB 3G6AB 5B38A 1CU4L 1U0QA 2BDNH 5LXGH 2R1YA 1ZA6A 5T5FH 3C09B 4O02H 2MQ3A 2ADGA 4NO0A 5D7LD 4H26B 5INCA 1QR1A 1S7RA 1RIHH 3JV6B 1YPZF 1JK8A 4OCSH 5I71C 2YMXH 4MLIA 5T5NG 4DEPC 3P0YH 4X98B 2VLRE 3CZFA 1MPAL 4L3CA 5JNYA 5L0QB 1BJMA 4MDIB 1P1ZA 5BRZA 7FABL 4NNPH 1KLGA 2R69H 3QDGD 3UTOA 3V6FB 1WIPA 1NLDL 4QHNB 3MQIA 1P4IL 2VISA 4C4KO 4G6FB 4Y4HB 3NFPB 5D6DC 1TNNA 2YD8A 4JFHD 3GI9H 4RMUA 1K8DA 3LSOB 4KJWC 1MCFA 3D69A 4HSQA 4K3JH 4QRPD 3WIHA 1K2DA 2DJSA 3B5GA 1J1PH 3WNOA 5ALBH 5F93C 1MF2H 5IHUL 4GBXB 3K2UH 3C8DA 3VDCA 2FEDD 3C5ZB 2PF6A 1IM9A 5HYQA 1QBML 3T3PF 5DMKA 2HN7B 4I77H 3MRBB 2GUOA 3UJIL 4GAJH 4TVSa 3NIGF 3OMZA 2WP3T 4FXKB 4Y8AA 4TQEH 4DK6A 1IBGL 3QDGA 3KYAA 4U6XB 1XCTA 1VPOL 3PQYE 4JE4B 4QTIL 3FQUB 3LKOB 3VXTB 5D1XA 4KJPD 4LRIA 3DXAA 2O93L 5D1ZC 4F37K 3LQAC 1TJGL 3IVKB 3RVWC 3MGTB 5GS2D 3BPCA 1NANI 2IPKA 4A2MA 2R2BB 1ZGLP 3EYQC 5T3XD 2A83A 4PJ8C 3RGHA 3HZKA 3SY0B 1KLFA 4MHHI 2FHBA 4EUPA 2EXWC 4G6FD 2DWDA 4Y4HD 2P5WE 2P8PA 4E41B 3DETD 2W0LA 4OD1L 5HHOE 1FVCA 5IFAH 5EOCH 3GNML 4HG4K 4XVTL 3W0WB 4RA3A 1NCDH 4M7JL 2X4TB 4XBEL 1TIUA 3H6JA 2F19H 4LKCB 3P4MB 3BZFA 3ORJA 3MLVH 5DA4A 2A6KB 4XC3H 4LCCB 2AJ3A 1KB5A 1FDLH 2YOCA 5F7LB 3ZKXB 5C0IA 5KSAB 3OJMB 3RWCA 3THMH 5HY9A 4CU7A 2EE9A 1FO0H 3ES6B 3ZKSD 4CW1B 2BOCA 3FB8A 5J8OA 3KPSE 3U1SL 2Z4QB 3WFHB 1WBYB 5AD0A 2H6PA 1N5AA 2G60H 2LFGA 1A64A 1T7ZA 1E27B 2W91A 5HHOD 1NBVL 4UAOB 1AXSA 1U91B 1QKZL 1U8NA 3QPQD 4FQPA 3FL7A 1TFHA 4WUUA 3D2UA 3WUWG 5D93B 1B4JL 2FD6H 1K6QL 3IETA 3ARUA 3TV3L 5CJBA 1J5OH 2PUQT 3CVIH 1V3JA 2WWMC 1NGWB 1RJYB 3B3IA 3FTGB 1FYTA 1MRCL 3HMXH 5CILH 1TZIB 5I1IH 4Y4HC 4QHKJ 5HI4C 4OI7A 5ICZB 4JREB 5CEZH 5L8KB 4L4VD 4PLKC 2BNQB 3GSVB 4ZO9A 5D72L 1XIWA 3DX7A 3DX9B 4GKZA 2EKJA 3HLAA 3MFFB 2BRQA 5EPMB 1FL5B 3M17A 4W4OC 3PGFL 4PJGE 1R5VA 4QRRB 2GJ6D 5FHBL 1RJZB 5FUCE 1GGIL 4QTIH 2DKMA 2G9HB 5E2VH 5AYQA 4QWWD 1IGTB 3I6KA 3KS0H 5GRVK 4RNRB 3BPOC 4G42A 3GMLA 2NYYC 4WFFD 3GRWH 4GAJL 3GMMA 5FF6B 5JQ6H 1BBJB 4J7RA 4HJGB 3ARDD 3FB6A 1PKQB 2DI7A 5C7XL 3TT1H 1XCQB 1WUNT 2J88L 5EZLB 1KGCE 4AIXA 2YPVL 5E6IA 4Z5RB 1C1EL 1OW0A 5CIPH 5CJ5A 5K9QI 5I8KL 4DVRL 1U8PA 1XCTB 3HUJA 4M5YH 5CEZL 1V5JA 4YDJA 1MVFA 2YPLB 2FLBT 3A67H 3OG6B 3SDAC 4IRJD 3WJJA 3CUPA 3KJ4C 5IVNA 4YDIL 4LCWE 2DM3A 3FONA 3L1OH 1ZE3C 3TO4A 3MO1A 3C5ZA 4ZFZB 4P0DA 2D31A 1KENH 4F7TA 1T2JA 5C0CD 1N2RA 1M05B 4OCYH 4LCIH 4G8IA 1ITBB 35C8H 2HFFB 4HCRH 3VW3H 2D3VA 3WDHA 3DHMA 4FQQA 3SDXB 4YBQD 3T4AB 3CCHA 3K46A 1KT2A 3VG9C 1U3HD 1P4LA 3OJ2C 1QKZH 1F3DJ 4YFLF 3WEXA 3BPLC 3L3JA 3V6OC 3TBTA 5GS0D 4I3SL 2JCCF 3MRQB 5JHDE 3L3HB 1WCBA 4R0LC 4OLVL 4LVEA 4CVZB 5KG9B 2XYCA 3MJ9A 4FP8H 4AYFA 2B4CH 2GCYA 5HDLA 4OIBA 1FN4B 5EZIL 2XTJC 4OZFA 2CIIA 3H7BA 3GSNL 4NYLA 2Y6SC 3O6LH 5AUMA 2B2XH 3DSFL 4U1NA 1GH7A 4PJ8A 3JWOL 3T0AA 4JRYA 3RIFF 3WLWD 3VXQA 1MRDH 1S7RB 1HH9B 1OGTB 2WUCL 3D5OF 4BZYA 1YYML 4ZFGL 1HOCA 1OPGH 1AXTL 5C2BH 3L3KA 3UBXB 3KXFB 4LQFL 5JOPE 3ZTJH 4UUJA 1MCCA 5ISZA 3MV9E 3DUUA 2XNAA 3MBXL 1G7LA 1JZ5A 5HGGS 1V7NL 3G6DL 3CMGA 3B9EA 5HYSA 1MLCA 4XAKD 3JZ7A 3L3HA 3AXLB 4L8SA 1NBQA 4MDJB 4LSUL 4JCLA 3K8KA 5D7KE 5L88L 1T3FB 3EZ8A 1RFDL 3IDMA 3HS0A 2DQIH 2NY7H 3OX8A 3U82B 1JGUL 3FQWB 1NDMA 3GSNA 1I8MB 1QSFB 2EDBA 2Q6WA 1P4LB 1DEEA 1ZT7B 1SYVA 5IB4B 4GW4B 2NY1C 3MREB 1CICC 2WNGA 1C5CL 3IJHA 1KIQB 3QUZB 3BO8A 4KKAD 4M62L 5BVPL 1G0YR 3OB0K 4U33A 3DVIA 1X6NA 4J3SA 3P0VH 4JY4A 4MMXC 4H20L 4NJAH 1MCOH 4PJXF 2H2SC 3FONB 1IGYA 3NFNA 5F9DC 2FATH 4IIQC 5IESH 3GGWB 5C0DA 2F5BL 4YBLB 3ZYOA 1KIPA 3CAFA 4JFEB 2NXYB 4P5TD 4OM1H 3V6ZB 5BVJA 2JB5L 3S98A 3D25A 2VLKE 2ATKB 1AP2B 1HXMA 1U8PB 1LE9B 5EU6A 4BKLB 1H3XA 5D70L 5H2BA 4FQHB 5KVMC 1IEBA 4NQUA 1HDMB 4FQCL 4RISL 4DUWA 4XPFL 5KVGH 3MCLH 5JZ7C 2EICA 1CT8A 4I48B 4J4PA 1C8PA 1X5GA 1CDJA 5EIIA 4PREB 4XCEB 5T1KD 4UOJA 4I4WA 1S7XB 4U6VH 3UTPE 2F8VA 3PWPA 3R0NA 3VFTA 4CVXA 2GTZA 3O9WA 4XAWH 4Z0XA 1WAAF 3S4SA 1MPAH 3CZJA 1FL3B 4GKNB 4KMLB 4M03A 5SX5K 3AB0C 5KS9F 2YR3A 3CFDA 4PPTA 1EGJH 4YHLL 1A14H 3O3UN 3OKEB 4P2RE 4QHMA 2VLJB 1LO5A 5F7UA 3M17B 1FL5A 3LD8C 2K1MA 4NKOA 2QR0B 1B0RA 4PV9B 4FG6C 5HVFB 1MHHA 1F58H 4OQTA 1JYNA 2Z8RA 4ODTH 4NHUB 2KZWA 1F97A 3BFOA 3GIZL 4M1GL 2XWBA 2FBOJ 4OZHB 4WU5A 2XTJB 2AXFB 2RIKA 1DBJH 4XVJL 2A1WL 5FYKH 1A4KA 4DCQB 3GMPB 4YR6B 5TQ2L 4F7PA 3SKOB 1UM5L 1KB5L 2VO5A 3ARGA 1F4AA 1FHGA 3VCLB 5C08E 4OD1H 1CFQB 4HIEA 3FZUD 4JJHA 3GHBH 2NY0C 5DD0L 1IC5H 2BOBA 4GKSB 3C8KA 3AFLA 3JWDH 4LSSL 5J11B 5JIHA 5C2UB 4JCMA 2Y72A 5EO1A 4ELMF 4KHTL 4Z95H 2AK1H 2W60B 1AHWA 2NY4C 3TO4D 5CZVH 4U3XA 2EDDA 3BIBX 3D3VB 1VEPA 1LO2H 3OGOE 4GAYB 4JFFD 3FFCD 5EZJB 5TGBB 1LDPL 5AAMA 1RIUH 4JFDB 1IGJA 5IG7B 3ZMRA 4HEPG 3O2VL 2Z35A 5FYJL 3EYOB 1KEGH 2XA3A 1MJUL 3P77A 2OMNA 3KDMA 2NX5B 2A6KA 1AGBB 2DTSA 3PL6D 4OAWB 4WHYG 4MAYD 4Z0BH 3LZFH 3ET9F 1DSFL 3WO4B 4LSTH 3DV4A 3W81A 3FJTA 2DOCA 2LU4A 3AM8C 4NP4H 1QOKA 5DUPH 1C5BL 1ZHLA 2ZCLL 5TE6H 3MODL 3DUHA 1EEZB 3KPLB 2DIAA 1HI6A 4WUUD 1D6EB 1K4DA 3BH8B 3ARWA 4MD0B 3NTCH 3MRPA 2JJVA 2IQ9H 1IL1B 1KULA 3GB7A 5FO8B 2IPKB 4LSTL 3WUWA 2DL9A 4OCNC 1I7RB 1C5CH 4P3DB 3CK0L 4YAQB 1QRND 2MQ0A 4BZ1H 2J3SA 1AGCB 2QQLL 3AY4A 5T1MA 2CDGB 3QEQD 3OWEA 4QF1A 4YIQA 4X6FA 1UM4H 3EIFA 4HUVB 4DKDC 4LLVA 4PJIF 1J10A 4Y19B 3HE7C 3SE8L 4N8CL 3OXRB 1HZHL 1FH5L 1V7NH 3TA3D 3FOLB 4PLJC 1I4FB 2XFXA 1E0OB 1SEQH 2C4FU 4CN4A 4UAOC 5CLWA 4OFYA 2EDKA 1HHJB 4AEFA 5ANME 2JJTC 1NUNB 1PX3A 2NX5D 4MJIB 5D5ME 1OTSD 4IRZH 5MERB 1RIHL 4MAYB 3L5XH 1PX4A 1QG3A 4KROD 4P4RA 4X6DF 4XNXH 2D31B 3HB3D 4LAQH 3W9EB 5J57B 4JFYB 1N3NB 4HK0A 4OLZH 3F7VB 2QSCL 4OLZL 2FECI 2AV7B 3SGJA 2MSPA 5B8CB 1H3WM 1A9BB 3MLZH 4MB4A 1IAOA 4P2QD 4JAMB 3GIZH 4NO5A 1A4JB 3O3EB 5I73C 5CD5D 3BWUC 5IK3B 3NCBB 2HH0H 1YEKH 2XN9B 3S4SG 2AI0L 3QHZL 5K9JL 1K5NA 5CFHA 2YD2A 1I1AB 4QRTB 1ETZA 2E9IA 1BFTA 2AEQH 1L0YA 3BQUB 1QYGL 4X4MA 3MBED 3RTQB 4Q9QL 4IS6A 3NIFF 4NFBA 1UJTA 1IL1A 4C58B 5L6YL 4PJDB 1L0XA 2FIKA 1I7UA 4LSVL 1HSBA 3GBLA 3OB0H 3SE8H 4NQEE 3MUY1 5C70A 1SMAA 1YEJH 5CZXC 2JJSC 4L4TD 2XPGA 3LB6C 4G6KH 4KK9C 1RJZA 1ZA6B 3KHOA 5HDOA 3CXDH 3E1F1 4H88H 4A6YA 4ZO6A 4XPHL 3RDTB 2AK4D 2C1PA 3WIIL 3I9GL 1RZJL 5JIKA 1U36A 2ZUQC 4JZJC 4YDLB 2WUBH 3IFLL 1F2QA 1SMOA 4GSDH 5CEYB 1LEGA 2YRZA 3DNKA 2X42A 2GJ6B 4XVUD 5MEPA 4NQXA 5E8EB 3E6HA 1FYTB 4JFDA 2JIXB 4EDXA 4X5WB 3U4EB 5F7DB 4NGHH 3PABA 4KQ3L 2E7LC 1TQBB 1FGNL 1ODAA 2ZOKA 5KSVA 1E28B 1XGQA 1S7QA 3IDYB 5HPMA 5EU3B 3ROLA 2EDEA 4AG4H 2V5SA 3BMWA 4PIRF 1P7HL 3QDJB 1CFVL 3HFMH 3OGCA 1G7MA 4HS3B 4LARL 4PBVC 4X8XA 1BX2B 4K23L 4QRTA 1LDPH 4DAGL 3R1GH 2KDGA 3QDMD 3LEYL 3QNXB 2Z92A 1FLRH 4YR6A 5ITFA 1ZGLB 2B4CC 4RRPG 2MHAB 1TTUA 1YEFL 5C0IB 3OKNB 2NY0D 3TZVB 3IGAB 1QRNE 2AV7A 3VWKD 4AIZB 3MOAL 3O41A 32C2A 2D7OA 4WGWB 3QI9C 1HINH 3RZCA 4WI7A 3WYRA 1JMXA 2OLDA 1F4YH 3PP3H 4PRHE 2Y1VA 2CKBB 3ARDB 2YXMA 3VD3A 5IEKA 1PVHA 5T3ZL 5MERA 1EA9C 4D0DB 5JDSA 4YGVB 3EHBD 1DE4B 4H8WH 3D2UD 4Y5XC 2ENYA 3NIFE 3SY0A 3O6MH 3S4SB 4JANA 4OCMC 5DC4B 5C6WH 4XP5H 1JWSA 2O5XL 3QZWA 1DFBH 1NEZA 4L8BA 4BSWA 1T83A 1IE5A 3O2DA 4PYGA 5GJSL 1LDSA 1CFBA 1SJHA 2ATKA 4JPIB 4XMLH 4LASH 3D25B 5E6YA 3KYNA 2FJGB 1RZIA 5BZDB 1MIML 3NBNA 1QLFA 4EI5C 3B9DA 4KMTL 3VFWA 2PTUA 2VWEC 4PRPA 1IGYB 3DVGA 1X5HA 3MLTB 4KVNH 1RSFA 4QRRD 5I8CA 3PV6B 1UXWB 2YPKB 2FX7L 4M3JA 1H5BB 4PLOB 3ULVC 2D7TL 5DQJA 5EBMB 1DLFH 4NN5B 4RWYH 3S36L 3VFOB 2I9LA 3QPQC 3QB7C 4PS4H 3ZHKA 2CRIA 3ULUL 5KVEH 4JO4H 2IH1B 1MFAH 3C5ZC 2IG2L 1IQDB 4CU6A 5L2KD 4YUEL 4X7TA 4Y4KB 1UM6H 5FYKE 4XNYH 5F8RC 4HIJB 3KPQA 4JZJB 1A3RH 2JK5A 1Y6KR 4NT6B 4XP6H 1Q0YL 4NPYA 4MJIE 3TT1L 1HCVA 1LD9A 2BY2A 3WNKA 4ZXBB 4G8EB 1ZT4A 1CICD 3ARGD 2KKQA 3ULUD 4PJEA 3DSNA 3LVEA 1IQDA 3T1WA 4R3SB 4HFWB 2O5ZH 4NQCA 4APQD 1BZQK 1HH9A 4JM2F 1DZBA 2BHZA 5ALCH 4L8DB 5JW4Q 1WBXA 2C7UA 1OP5H 1PG7H 2J2ZA 4WNQA 4ZOAA 4LHUD 3NIGE 4HG4J 4OZIB 1T89A 1KC5L 2X7LA 4WWID 4MXVF 3MRJB 5EU7E 4Z7WB 5ABDE 3LRSA 3Q5YA 2HTLD 3RPIA 4L4TE 1EO5A 2C4FT 2MCPH 3IDUA 4X5LA 1FE8H 1OPGL 3GM8A 1FVEA 4D0CA 4JM4L 2YD1A 2CJUH 5HDQH 2I5YH 1UEYA 2ZPKH 1FCGA 2BCKA 3VFMA 1F90L 4OCWH 4OLYH 5LGJB 3RWJB 1BM3L 3DTXB 2ZG1A 4XH2A 4CUCA 1FAKT 1LO5B 2GTWB 4QHMB 5TE7H 4WHTB 2FIRT 3S88H 4HH9A 3EYSL 1SQ2N 2FJHB 2XICA 4LLDA 1YEIH 4XNUH 3ZE2F 5IJKC 1BFOB 1M6OA 2ZUXA 5E2UL 5LGHL 1N59B 3P4NB 2RJMA 3GSQB 3X11B 4XMKL 3QHFL 3FB7A 4F7TB 4Y16D 5E8NB 5AWNH 4DOHB 3CFEA 4NGHL 5KN5B 2C3VA 3NVQA 4U1GC 1Z9LA 4B53A 4L9LC 2D7QA 4UU9B 3WN5A 2H32B 1PFCA 2E6PA 4UIMB 3TZVA 1GJIA 3BAEH 2AXJA 1NDGA 4FTVB 3ZDXE 4Y4FB 2CDFB 4XC3L 2DDQL 4LCUA 5DJAB 1A7OL 4OIAA 3B2VH 1V3LA 2VH5L 5C0BD 4EOWL 1ZLWH 3ZDZE 3CFKB 3QXDB 5FYKD 3CJJA 4HQQH 4V1DA 4XX1E 3TT3H 4ZODA 1F3JB 3V8OA 5TH2A 2PXYA 5I8CB 4OZHE 1KN2H 1T0MB 3DVGB 3MLTA 5DT1L 3WXVL 1QBAA 1E4KC 3Q1SL 3C60D 4R9HA 1TPXB 4O00A 3V7MA 5I8KH 1FJ1A 1KPVB 4LNVA 2B5IB 1VKXB 4U1MA 5EN2B 1MRFL 3L3GA 5MEPB 3L5IA 4GKZB 1E6OL 2AXGB 1P9MC 1R5IB 2NYYD 5F6IB 3VA6A 5LBSH 4C57C 5M94B 3DARA 2Q3ZA 2VXTH 5FM5M 1A6VH 2ZSVA 4BM7A 1Q9WB 2PR4H 3BI9X 2D7MA 1JNHB 2XY2A 4XVSH 5GRUH 1L9MA 2KUTA 1WAAA 2GSGB 3UJIH 4HF5H 3MLSH 4CVWA 4JRYD 3BZDA 4HGKC 1RJLB 5EUKB 1VGEH 3JSSA 1ES0A 2CXKA 5JA9A 4HMCA 4GW1B 4U1JB 5IHUH 5INDB 3IDXL 2ED8A 4G6AC 3D3VE 2EEAA 3NH7L 1CDHA 5F7HA 1OAKH 4WNQB 3KPRB 1HHHA 4U1NB 3WIIH 1GCFA 2DYPD 2GT9A 5FGBC 4O4YL 4PJBE 5EA0H 1RK1B 1E27A 4YE4L 5T1LB 3MJ9L 4LCYB 3PL6B 3INUH 1WZMA 4D9LL 2Y06H 3ZL4H 3FO9B 2YK1H 2W0FB 5HVWA 4JB9H 3N0PB 4GG6A 5FUZH 2JELL 3MRQA 2Z0BA 5C0CA 2OS7A 1KB5B 3C5ZD 3UBXG 4HUWB 4NOBA 4JFXB 3INUL 3IDJA 4HKJA 4N68A 3JTSA 2XKNB 4YE4H 3WIFB 1H3PL 3MCG1 2I24N 1MOEA 1KT2B 3A6BH 3ZLQC 1S7QB 4R26L 5A2LH 1KN4H 1CI5A 4QOKA 1XR8B 1J0ZA 3NH7H 1FVCB 3LEXB 4TUOA 3THML 4OD2B 5MEOB 4HDIA 1VGKA 1FQ9C 3TBYA 2FB4H 3E8UL 3MODH 1CDBA 4DZ8B 4MJ6A 5IBLC 2Q8BH 4FQXA 4NKIL 4YPGB 3MLZL 3AREC 2EH7L 1VGEL 2NTSP 3C9NA 4JGJA 2R2EB 5GGVL 4G80A 2FX8L 4PJBA 3HE6D 2AQ1A 3IU4H 3UTTA 1D6VL 3QIUB 4WW1A 1RIVH 2MKWA 1I8KB 4JPWH 3DXAB 4U7SA 4XRCB 5ICXB 3FAXA 4C83B 1W0VB 1C12A 2BMKA 25C8L 5D1XC 2DLFH 4J3WA 1DCLA 2B1AL 5I1CL 4ELKA 3ZTJG 1PKQA 5TJWK 1BQHA 3ARFC 3T0ED 1WV7T 1RULL 1S7VA 3RWEB 4ZMAT 1NL0L 3C6LC 4UILH 4DKAA 5HI5C 1ZK9A 5E9DA 4TSBH 2X05A 1MHCA 4WVRA 2DLTA 3Q1SH 2VSCA 5DRZA 4TNWF 4U1LB 4GBXA 1YJDC 4IRJA 2V9TA 3FAWA 2DJ4A 3EYFB 2XN9E 4BZ2L 5MEQB 1OGAA 2GFBA 2DYPB 5ECJE 5IBLD 1R3KB 4H0GA 4H8WC 1IRAY 1YYLH 2QBWA 1AR1D 3UTZA 1I8IA 4NUGH 5EPMA 4XRCA 1M7IA 2PO6A 3MV9D 2DWEA 3MR9B 3FB5B 4YGAB 2VDQH 3BT2L 1K8IB 2V2XA 4PTUB 1QBMH 2P42B 1CGYA 3RUGB 1UFUA 1G9NL 5IG7A 2C3GA 1OF2B 3AMLA 1KTLA 3WHE0 1YMMD 1G7QB 4F7MA 1KN4L 3ULVH 3QXTA 3O6KL 5ICYB 1BX2A 1MI5B 3B9KB 4JFQA 2VKWA 5LGHH 4D8PA 2AV1B 5E4EC 3TCLA 1OWRM 1I3RB 4M93C 4PJXB 4G9FA 1JNNL 1I3RA 1MCKA 4P2OB 1KJVA 1VESA 4Y5XB 3SJVB 5CJQH 5KSBA 5TE7L 5C71A 1TJHH 2WANA 1SJEB 1QLEL 3IFNH 1ROWA 5E5MA 1T0NB 2GI7A 3HE6B 1FYTD 1MEXL 4KJQD 3GMPA 2AK1L 4LP4A 4TSCL 2Q7YA 2VLME 4NCC1 1ZMYA 2ARJA 5KSAA 5DA0B 2AKRB 1IC5L 1R24A 3LIZL 3GHBL 3NACH 2XOTA 4PRHA 1KCVH 3HR6A 3WUWB 3BOVA 1TCRB 2ITCA 1FBIL 4LDLB 5TFSL 1X6LA 2DIJA 5ANMA 1I1FB 2W9EH 5C0BA 1GAFL 3C09C 3JV4A 2VLJA 5K9OB 2H3NA 1MSPA 1P5VA 1P2CA 4IOFD 4JN1L 1XGPB 4MWFA 4BQ8A 3NCJH 4X6CB 1NCCL 4BSJA 1U6AH 3IFOA 1GGYA 3TYGL 4QHLA 1FNEB 2YWZA 3HI6L 2G5RA 5I75B 1KB9J 2J8UA 5ESVA 4CMHB 3TEUA 5IW1B 1FZJA 5HHOA 1ETZB 5GGTA 3UZEA 2Z35B 1OAYL 3TNMA 4U05A 3V5DA 5FGSA 2M26A 2IALA 4QHKI 1A6WL 2Z31D 4Y4FC 4KUCD 3C5JB 3ARFB 4NKDA 1NEZG 4NO5B 3BIKA 5DDHB 2FYYA 2OCFD 5F9WB 1KN2L 2YA0A 1WF5A 3OV6A 4F8TA 2E9BA 2A9MH 3HR5B 4YHIB 2OI9B 1QA9B 3BRDA 4L5FL 4HZLB 5DMKB 1FORH 2ZZUT 5T3ZE 4WO4D 5GZOC 3MOBH 4P9HL 5IT2L 2HLFC 1MRDL 3RIFK 1F3JA 2Y07H 4I9WD 4H1LA 3GMRA 3SDXF 3UJTH 1Q9KA 3EZJB 2V7HB 5ENWA 4YJZL 4P2OD 1LO3H 3BDXA 3SJVD 3JBG7 3T0VA 2VDLL 3O3DB 1S7TB 1QQDB 1L0QA 5KBNC 1IKFH 3SDDD 1RUPH 4AMKL 3OKMA 3QRGH 1AQDA 2VR9A 2N4IA 3PG2A 4XMLL 3GBNH 4UV4H 1IGFH 1MQKH 5GSVB 5GXBB 5J1SC 1NGZB 2HVJB 2FGWH 3QISA 1A7RL 2CQVA 2R0ZL 3H9ZA 5C6TL 4Y19A 2HT4D 3LKQB 4PRBB 4MXWL 2QQKL 5I66A 4NKOB 1KIRB 3AREA 1AQKL 4PYHA 1DANT 5JXED 4FQXC 4P2CG 3QFDA 2BRRH 2W65B 3ZDZF 2O26U 1XGTB 2YRLA 4EKXA 3UBXA 5B39G 4JO2H 2PXYD 4CADA 2LVCA 1O7VA 3ZTNH 8CGTA 4UQ2A 4YAQA 2E7HA 1S3KH 4JN2A 2WM0A 2FL5B 5E8DH 1IFHL 5HI5D 5ERWB 3QA3A 2DI9A 4QXUL 2EDJA 2Y07L 1F4YL 3JV6A 4S1QL 2O61B 4MNQB 1VENA 3V4UH 3MRFA 2A0LC 3NCEB 3QWQB 3HG1E 4JM4H 1IAIM 1PZ5A 5F1SA 2XIDA 3HMWH 3QH3A 3BP6B 4OGYH 5IKCB 4JPVH 4BKLA 3C6LA 1BD2A 4RQQB 1QFWL 2IBBA 4OQTL 1TZHB 1RZ8B 4QRQA 1Q9WA 4MNHA 4LBEB 4R2GD 1NANH 4X8JA 1X4XA 2ZOLA 2R4RL 4LGRB 3HE7B 1NKRA 1I9RH 2P4AB 1I1RA 3QO0B 2GHWB 5HGAB 2LTQC 3KLHD 2A6JA 5LWYH 4PJCE 3MFGB 3V5HB 2AW2A 1BREA 5C09D 4JFED 4UV7L 3PWPE 2IANB 5DJDA 1JI1A 4WO4B 3K1KC 2V6HA 1NGYB 4NQCB 4PB0L 3CLEH 4QGTA 4WDIA 2HMIC 2HFFA 5B3JE 3J8F7 4OLVH 3RY6C 1RZFH 5DMJB 5IUSA 3BP4B 2YWYA 3QIBC 4GKSA 1DEEB 3EKCA 1KCUH 3BUYA 3HI5H 5F1OB 4CBPA 4FXGB 1I8MA 3CH1B 4HS6B 2PXYB 3SO3B 3PWUA 1F3DH 2APVA 4KJYB 4OLXH 3QRGL 4GMSH 4U1IB 4EN3C 3K0WA 4UTAH 1WWBX 3AXLA 4L8SB 3VXMA 1H3TA 4PB9L 2CSPA 2WQRA 3LKRA 2QEJA 3F58L 2AXFA 4JRXB 4EI5D 3I9GH 3UJTL 3EOAA 4YHZH 1F45A 2CKNA 4W70A 4NFCA 4XCNB 5JXAH 3MYJA 4YLQT 5D7JC 5EC2A 5IFJB 1GZQA 2H32A 2PYED 1CXIA 2Q1EA 4XCYB 4LEOA 3VFOA 1U8KA 1KXVC 4AH2A 5JOPD 5B4MD 1B4JH 3SOBL 1YEGH 1BFSA 1F5WA 1G0XA 4PJ8B 4LL9A 3SBWA 3TGXA 3OKEA 5T5NF 3O2DL 3RA7H 3VFWB 2VE6A 4NZRH 5KVFH 2JJTA 1QSFD 4JZNA 1MCHA 3O9WB 5C09A 1WCBB 1MFEL 5C08B 2O5XH 4MXQD 1U8KB 2WP3O 3AMKA 4HUUB 4Q0XL 2Q86A 3KS0J 2HVJA 1NCAL 2K7QA 3QQ3A 5FK9A 4DGYL 4DN4H 2CH8A 4OFKA 4N5ED 4R7NB 4ZAKC 1F02I 5T3ZH 3L7EB 4JRYE 1II4E 3HZMB 4LAQL 3JWNC 3U0PB 3FFDB 2ERJC 1T6WA 2VITA 3MRJA 4YZFE 3BZ4A 3LKSA 4RFOL 4V2BA 3KPOA 5IFAL 1HEZA 5JPNA 2NW3B 1YN6B 2EDHA 2H45A 1BWMA 3HC3L 3FO1A 4AQOA 4X80H 1GGBH 1TVBB 4KRMB 1E6JH 3HMXL 3NOIA 1QRNB 4UILL 4YWGH 1OVZA 3BO8B 4LQ1A 5GGUA 1NQBA 3DVFA 4WO4A 5DJ6A 2IANE 1KIUA 3H42H 1G6RB 4FQLH 5ELIA 1I8LA 3BPLB 5DGRA 4NZTH 4Y2OA 1ACZA 4KI5D 1EHLL 4HZAA 2XACC 1GYAA 1V3KA 4OM0H 5KW9L 2ZUQB 3JUZA 1G7HB 4RFEB 3EDJA 3MV7A 2VC2L 4X8JB 2LAAA 4LKXB 3C2SA 2X40A 3U48A 3BDBA 2EEDA 2BVPB 4BZ1L 3MMEA 3MLRL 1RVFL 3MSPA 4R4ND 5JOEA 5J1AA 4RQQA 1RZ7H 4S2SA 3WLWC 3KPRE 3EYVA 1UQSB 1IGTA 1YZZA 4NM4H 1FO0L 2B1HH 5JW4M 4HX1B 1I9JL 5I19H 3DO7A 5JW3L 2L7UA 1B6DA 3CH8A 5TDOA 5E2WL 3WCYA 1MLBA 1ERNA 1RURL 5IW3A 2WUBL 4JHZA 1AC0A 4Z76A 1QTYT 4FMKA 4KUCF 4UT9H 4JHBA 3BDYL 1A1NA 1NCDL 5J3HC 1I1YA 1RZIB 5BZDA 1CN4A 4PG2A 4XVTH 1TVHA 3N85L 4NWUH 3V4PH 2Z8WC 1K4CA 3HNVH 4JG0H 1Z9SA 3MJGX 4P3CH 2XKUA 1B3JA 4QRSA 1P69B 3QUXD 4G9DA 2F8OA 1Y18A 2DLGA 1I7TA 1AE6H 4V2CB 3BKCL 2Y5TA 2IALB 1JWSB 1U8LA 1OAUL 1BF8A 4Y5XA 2QQQA 3L5JA 5IHZB 4O4YH 1BIIB 4G9FB 4O5LH 2GY7B 1S8DA 5FV2A 3LQMA 3ARBB 4YHNA 4APQC 1P5UA 1U91A 2XZQL 3VMOA 3HC3H 2OYPA 4KQ4L 2FHFA 3RAJL 4OCSL 5DI8A 2DQHL 1P4BH 3VMPA 1ZAGA 4ZUVB 3LMJH 4OZ4B 3VFSB 4JPWL 4RCAA 4MHHG 3T0EE 4AT6A 3IJYB 1I1AD 3LSOA 4IDJL 1UYWL 5EULV 3QIUC 4LVOC 1OTSC 2NY6D 2EDYA 2NY4B 3LQAL 5LAXA 4TTDD 3EGSA 1JGVL 1I3VA 1XGYL 1J8HB 1WGOA 5DHVH 5I1AA 4ETYA 4NKDB 3G6JE 1PLGH 3C5JA 4YHOL 5LKNA 3O0RH 1EFQA 3IDGB 1WJ3A 5CJXA 1OGAB 2DMCA 2ZUSA 4RIRA 5BS0A 1EEQA 4O5LL 5E1HB 5DLMH 4PJAE 3W0WD 4YHLH 1C7TA 3FQRA 4XPTL 2EC9T 2IGFL 3F65A 4ENEC 15C8L 1FH5H 2VXVL 2XFXB 1JF1A 1J1OL 3LRHA 3L5WA 2ITDB 4JGMA 3LH2L 5CGMA 3TJEL 1YNTA 3DOSA 3ULSA 2VXUH 2V7NA 5CWSB 4XXDA 2WBJA 2D7PA 2FSEB 3ILPA 1A1OB 3TCLB 2R0KL 2NY5H 3MFFA 3O8XA 5HI3D 4EIGB 4FABH 5E70A 4P46D 3ZYZA 2KZ1B 3VA2C 3O4OB 4KROB 4NO2A 1GGCH 1I1CA 1IC1A 3W82A 3WFBL 4XNQB 3U0TA 4W81A 4UTAL 5C0JA 4LAJH 5E8OB 4URTB 5IMOA 3VFNA 3IRZA 4FQXB 5FYLD 4LPWA 1C5BH 2ZCLH 2ZG3A 3J7HA 4OKVB 8FABB 1F13A 4LCWA 3C8HA 1DQJA 2V2TB 4HF5L 4WI5A 3EGSB 5IB1B 4YHMH 5LAXB 1A47A 3OPZH 4JQIL 4WWKD 4OCRH 1CG9A 1IAII 2WK2A 4GBXD 4P46B 1BOYA 5D5MF 4J1UA 1YEIL 4XNUL 2HMID 2R1XB 1TPXC 5ILTL 2CGRH 5GRXG 3RIAF 5TPWL 4X5XA 4IHOB 1JGUH 2NZ9C 5GHWL 2H6PB 1XMWA 4OF8A 1HKLH 1T21B 5FYLL 4UQ3B 3L7FA 3QCVL 4PJGB 1T7VA 1AFVH 3IDGA 2DAVA 4GRLA 2FBJH 4NQDE 5B8CC 4MNGE 5ACMA 1AKJD 2P5EE 1PG7W 4M8QA 3VG0L 5FO9B 3ARXA 3P9MA 2KBGA 4LVHC 4N8VA 4QRSB 3MLXL 3KLHC 2AJ3B 3V0WL 4Q6IC 4F8QA 4FMFA 5GQBA 1J8HA 1IAKB 4MNQE 3T2NH 3QHTC 2C1OA 4AEHH 1CGUA 3FT4A 4ZFGH 1I8IB 4JZOA 2ESVD 3T3PE 3HC4H 3WSQL 3MV7D 3O0RL 5INCB 5D71L 1QR1B 3RVVC 1PG7L 3AB0B 1QP1A 4ZUVA 5DSCA 3ZKND 4W6YB 1JGEA 1WZLA 4E9LA 4G3YH 4XWGH 3IFPA 4M1GH 2O5YH 5FOJA 1RUAL 4OI9A 1NSNL 4RAUA 1S8DB 4XCFL 1HK6A 1VGKB 3SO3C 1JGLH 1SY6A 2H32H 2KL6A 1TTGA 3BXNA 5GGSB 2K3TA 4RGNB 2DTMH 1ZXQA 2R8SH 2BC4B 4CN1A 1U8HA 2YD6A 3W39A 3QNYB 4G9DB 4E0RA 5IR1B 3TJHD 4S2SB 3DJ9A 4M61A 4WEBH 5C08A 5J1AB 4JG1H 3FCTA 3RNQB 1JFQL 4Q7DA 3G08A 1KPRB 3KJ6L 5T1KA 4JFXA 1W0VA 2B8OT 5ICXA 1N7ML 4C83A 2IEPA 5F88B 2VDPH 5FA3A 1BQHG 2I9TA 4PG9B 1CLYH 4LPYA 3UTSE 3UTTB 4ZFOB 5I8OH 3VGAC 2QV2A 4J23A 4TUJB 4MAUH 4JVPA 5AAWA 3HNTH 1YEEL 3VXSD 1NCTA 1D5IH 4DWHA 2OBGA 5D1QA 4XI5C 1SYSA 1R3IL 4DZ8A 4FTVE 5FYJD 1DN2A 1HI6B 1V05A 1B0GA 1R3JA 3KPLA 5D70H 2H2SD 2BNRB 3FO1B 1K2DB 2X41A 1CLYL 3QEUA 3EFDH 2FO4A 2BP3A 1DBMH 2ZCHH 3N50A 2J5LB 3JTSB 3VXUA 4PJ5B 4OAWA 2FATL 4ZPVA 4BK5A 5IESL 5HHQA 2KPNA 1FV1A 3UMTA 2VISB 3HB3C 1BOGB 4Y8DC 1ZSDA 3TFKC 3FO2B 3O3AA 5GS2H 1BQUA 1JNHA 4JY5H 3TVMA 3QQ3B 5FK9B 1B2WH 2M8XA 1RMFH 3GSUA 3ZKQD 1BFOA 2PN5A 1PYWA 4JFOA 4JKPH 4U6YA 3MNWB 1MJ8L 1RPQA 3VH8G 2VLKA 1KJMB 1EX0A 1ZVSB 4J8RA 5E2VL 1NLBL 2HTKC 4NKMB 4PJ5E 4JFDE 1F8TH 5DEGB 5EUOB 3NCYS 1DLHA 2P24A 3S3SA 1NCBH 5ETUB 1CFQA 3QJHB 3X12A 4XPGL 3VFMB 1OARH 1ULVA 3G6JB 3JTTB 5BXFB 4G6MH 1FBIH 2YPLE 1DBML 5IB3B 1EO8L 4HULB 2C9AA 3VJ6B 1MIEH 1BAFH 1U95A 4LQFH 1RUKH 1FFPA 4HGMA 1E6JL 2YN5A 4U3CA 3SKJL 3SCMC 4R7NA 4O2EA 2HJFA 4ODVH 1CDIA 1ZS8A 4G8GD 4HXAH 3KXFE 4Z7WA 4Y2DB 2ZSVB 5JXEA 2PYEE 1HYRC 1G6RL 4NHUA 3VGFA 4EXPX 4BFEA 5I74B 2AXGA 3D18B 5DVKA 1INDH 3MROB 1QZ1A 4NQEB 1OTUC 5IQ9B 1QBLL 1AY1H 4V1DE 3NIDE 3W5MA 4M43L 4RMTA 3D85A 5L9DL 4JN2B 1DDHB 5C0FA 4KK6C 3G5VB 1JFQH 1AGFA 3NABH 1ZA3A 5AZEL 2HKHH 1CFSB 3UTSD 1U3HB 2R0ZH 3AREB 3O6FD 4GAFB 5F3HB 5DTFA 4FQIL 3TIDB 2X2YA 5IM7A 1MNUL 2FDBP 3KXFD 1RUPL 2EE3A 3CSBA 3QUZD 3V5HA 1UJ3C 1AQDB 3FMGL 4IM8A 4G3YL 1DBAL 4RMQA 3PNWB 3T0XA 1MHPL 5D9SB 4ZUUB 3QEUB 3SDAD 1EDQA 5GGTH 3UAJC 2AJUL 1CE1H 1U8QB 2A77H 3V5KA 1DVFC 4JFEA 1QHOA 2ICWI 1Q9LA 3L1OL 1IZKA 5E4IA 1S9VA 3QI9B 2CLVB 5GGSY 5HYEA 4JFFB 2X1WL 2A9ML 3AS1A 3ZKMD 3C6LB 2NQCA 1U95B 3MZTA 4JFPA 3ARDC 4R96B 4ZUSB 3LV3A 1QA9A 5DR5H 3ALPA 4MJ5A 1OP3H 2NXZD 4JY6B 3GEWB 5BXFA 1HHGB 3O4LE 4PB9H 3U7WL 2HKFL 1A6WH 4NHCH 5DVLA 4Z6AT 1WLHA 2FYYB 1YMHB 4TUKL 3MXVL 4CRPA 4G6ML 1KCRH 4GW4A 3QCVH 1SYVB 1KEMH 3HNSH 5DC0A 4PGBB 2ZSWA 4J8RB 3UROR 5BV7C 2AI0H 4K3HA 1H15A 5A2FA 3VXMD 4UQ2B 5HGAA 4RA0C 4WTXA 3VDAA 5DJ8A 3C6LD 3O9WD 1JHKL 4X6EB 4OB5L 3O6FB 1XR9B 3E3QC 5C0EA 3CVHL 5DVMA 2EDFA 4Z9KB 2Z8SA 4PRIE 1NMCB 1DQQB 1JGVH 2PW1B 3V52L 3WFCL 5E56A 1JGEB 3KXFA 4Z7WE 3EO9H 5BJTB 5D7IE 5HHQB 3L3KB 1YNKL 1XGPA 1FSKB 4MWFB 1MCSA 2X7LB 4P4KD 5DQDL 2AJYL 3UC0H 3RUGE 3S5LG 3UO1L 2XY1A 2X4NA 5EU5A 2IPTH 4PJ7F 5JUEH 3RHWK 3QQ9C 2CK0L 2NY5L 4FABL 4KRPC 5J6HA 3UBXI 1T5XA 3RVXC 2I9LB 4FFVD 3GSWB 3HMWL 4LVOB 4P5TB 5CGYC 5FO9A 2YPKA 3ILQC 1NMBH 1HZHH 1NFDB 2D2OA 3G9AB 4PBWD 2BHYA 4CVZA 2ZUVA 4Z7QE 3GJFH 5GRZA 4RDQG 4WV1C 5IFHH 3IXTB 1NUFA 2BNUB 1FAIH 3FHQA 3LKQA 2HRLA 4UQ3A 4XHJD 1T21A 4OIIL 4JDZA 3ARFA 3O8XC 4OZFG 5IMKA 1N0XH 5F6HJ 3K1DA 2HFGH 3BEVA 4CAGA 2AAVA 3KPQB 4X7CC 3SGKC 3DROA 5A16B 3S5LA 3D3VD 3TN0B 4KTEH 3RNKB 3NZ8A 5JHDB 2EDXA 1A3QA 3VH8B 5HGHA 1CG9B 3QHZH 5E4EB 1OAKL 1FNSH 4JG1L 4ZFFB 4G43B 4PRPD 1ZLVK 3Q48A 4K3GA 4PJHA 5C6TH 3UC0L 4I5BA 1A7RH 2NR6D 4YHYB 4P46C 5DRNA 3UCRA 2XZZA 5EBMA 2GK2A 2VLJD 5SWZB 1DE4A 1EH9A 1VACB 4IRSA 4OT1L 2GJ6A 3WFDH 4BSVA 5EO0B 4M43H 5SWSB 2WWKT 3S3JA 5IEKB 4MB3A 1CU4H 2BSSA 5JOFA 2PR4L 1T1WA 5CIPB 2H2PC 3KYKL 4HUXB 4YDJB 1CQKA 1IC4L 2FJGA 2BX5A 2F74A 4TPRH 5M95B 1ZOXA 5J12C 1A1OA 3RAJH 3ILPB 3KPSA 3ZHLA 2DYPA 2FEEI 4S1DD 5GRYA 2R0LL 4KJPC 3HRPA 1RUKL 5HHOB 1MAMH 2EIDA 5B3JF 3O11A 4U1LA 4MD5B 2ESVA 4UNTA 3UPRB 3MV9B 4LHUG 1ZWIB 2CR6A 3GMLB 1CD1A 3LEVL 4M3KB 4NQSB 5JHLH 3VGDA 1OARL 4UINH 5I1CH 3CDGB 5DEFB 4ZSOA 1BQHB 4X5XB 1URLA 5EOQH 3UX9B 4P2QB 3SE9H 2PW2A 1RZKC 3HNVL 4YK4C 3BUTA 4DZBA 4U49A 4JKPL 4ONGL 1BLNB 1LEIB 1I1FA 4X6DB 5ITBL 5EZOH 4JFQB 4DN3H 3A0OA 3DX7B 4JAMA 4I18A 2VJXA 3QIWA 3X14B 3MZGB 4RMRA 1DBAH 3VXRE 1G7QA 4F7MB 3OAZK 3I6GB 4PJBB 3C5SA 3RDTC 2R2EA 2GUOB 3STLA 4F7EA 4HIXH 5ESQB 3FTGA 5JW3H 3ZDYF 1LK2B 2Y4SA 1J8HE 2CLZB 4NRYA 3HE6A 4FRWA 2R23B 4GMTL 4ELMA 3TA3B 4HW6A 4M4PA 5JHDD 3SCMA 3BW9A 1JRHI 4PJIB 3O3BB 3WS3B 4N90E 4G9FD 4HS3A 5HGHB 3CU1A 3H9YA 3ARBA 4Z7WF 1CL7I 1X5ZA 3JV0A 1YY8A 2H41A 3MGOA 3RDTD 5K33A 1RZJC 1QVOB 1IJ9A 2GFBB 3S88L 1DUZB 5DJXA 1IAIH 5TQ0H 4QXGL 2P1YA 4LVNC 1NAKH 5D2NE 5MENB 1W0WB 5F70A 1S9YA 4GRLD 1ZEAH 5D93C 1QEWB 3TJEH 5DK0A 3MV9A 4WW2A 4LCCC 3L95B 1HQRB 1J8HD 2CK0H 1IEHA 2X4OB 2YPLD 1FE8L 4P5TA 3F58H 3GSWA 4ZS7H 3S34H 2DM7A 3N1MC 2IH3A 2UWEB 3FRPG 4LLUA 1ZLWK 3O6KH 4Y7MA 5FUOH 5IK3A 5CMAA 3KPRA 4WHYH 2AJXH 1NC2D 1T1XA 2F74B 3QIWC 1HNFA 2ZUUA 1UENA 4MJID 3PWVA 4G80B 2O5YL 2QKIB 4OF6A 2XWTB 5F9JA 2CK2A 4DTGH 4JLRB 1HSBB 4KI5C 2J4WL 1MHCB 2FIKB 4Q9RL 4HFUH 4DQOH 3MRRB 3LN9A 2G2RA 4ONGH 4LKXA 4G43A 4G7VL 2DN7A 3QULB 3ARGC 3CXHK 3W2DL 4KV5F 1O7SA 4RAVA 4N0YL 4WFHE 3OG4B 2LAGB 4YHNB 2DQIL 2NY7L 4JR9H 4ETQB 1IGJB 3PWNA 5LQBH 2E7CA 1UACL 2XZQH 4WTZG 2Y7QA 3BEVB 3S35L 3BN9C 1F3RB 4HC1H 1YQVH 5J1TC 1QNZL 3SPVB 5J4MA 2DBLH 1QRNA 3OSKA 4U1KB 1KTKE 4Q58C 4KVCL 3WFZA 5KAQF 4LSQH 5T1MB 4HQQL 5I17A 1CE6B 3U4AA 1OD7A 2AJUH 1RK1A 1Q9LB 3N85H 5KJRL 3HNTL 1JZ3A 1PG7X 3DIFA 4LMQE 1RIVL 3Q2CA 4MX7A 5DMYA 1T4KA 3IU4L 2QLVB 2APTA 5IJVA 2OTWB 3BH9A 3VGHA 4BELD 3ILQD 1D5BB 4JO2L 3CSYA 6FABL 4HUKB 1U58B 4R4FL 5I1LA 5JA8B 3HUJF 5E94B 2FH8A 4R6UA 3NAAH 3HPJA 2ICWA 2GSGA 4HPYL 5SWZE 1H8OA 1RHHA 1IC7H 2X4SA 4RZCB 5H37H 3MMEB 3EJYD 5C09B 5FM4A 5DEZA 1CZ8H 3FB7B 4PJXE 3WE6B 3O4LB 2EECA 2VDOL 3RGVC 3MLRH 5JNYB 4ZS6C 1KJ2A 5DHVA 3RTQC 3VRLE 1T20B 1N0XL 3L3GB 4PJ8D 5HPOA 1YEHL 4WHTA 3T4YB 4L4JA 2GY5A 3ESVF 1MCEA 4OTXH 2DMKA 5D71H 3GDBA 5CGTA 4XPAL 4XC1L 3EFFA 3O9WC 2MOVA 3ARVA 3JWDC 5DUBB 3G6DH 5IFJA 3EHBC 2Z93B 2ADIB 3PHQA 4MSWB 3S35X 1IEBB 5LCVL 3T2NL 4IIQB 3ROOA 4HIHB 1RJLA 5EUKA 5LGKA 3R06B 4HIEB 1EXUA 3UEZA 3DYMA 4JDTH 3VXPB 2M1KA 4QGYA 3TPKA 1JHTB 1QHPA 1KJ3H 3QQ4A 3RWDB 2NXZC 3IDXH 3BP5B 4LGPB 4YHOH 1JPTH 3V7AE 4UDUA 1D5XA 3NGBC 3PWUB 1NLBH 3ZKMC 1S3KL 2Y25A 4I8DA 4LARH 2DQFB 4ZDHB 2Z93A 5F9WC 4OZIF 3GI8L 1EAPB 1S7UB 4DN4L 2Q86B 2W9DH 5FHAH 5TF1H 1PYWB 4JFOB 2DQTL 2C3VB 4YC2C 3I2CH 4D9RD 3VI3E 4FQ1L 2EDOA 3V6OE 2PYEB 2JE8A 2YS4A 5KSBF 3BKYL 1ND0A 2GITB 1INEH 4KU1A 4QRQB 1MCDA 3O2DH 3RA7L 1A6ZA 4F57L 3HCVA 5ADOH 5E6ZA 3SDYL 3HPJB 4I48A 4P3CL 2VYRE 4KK6D 2F53B 1PEWA 4TSCH 4P59L 2NY2B 1CXHA 2VZUA 1P9MA 2HWZH 1UG9A 2R29L 4FQHA 4OCXL 3W11C 2AJZB 3FOMA 3TH3T 3VFUB 5BOZG 5DK2A 1TJHL 5IBTH 4F80A 3CPLB 4I0PB 4XBPB 1NAML 2E6QA 4OGAD 1J0HA 1TCMA 15C8H 2PYFB 3BAEL 3BJLA 5I6XC 2A6IB 1F4HA 4XBGA 1NGXB 1C1EH 5DURB 1NMAH 1WQVT 2P24B 4JVUA 5FYJE 3BJ91 1FL3A 4GKNA 2C7UB 5I18L 3H8NA 3SDDC 2GYSA 2CO6B 5I66B 4MB5A 2DTML 2R8SL 5GZND 1RZGA 1KTDA 2JKXA 4N1HB 2HKHL 5IWLC 3HZYA 4Y89A 5D6CB 2DD8L 4JKLA 1WIOA 2OSLA 4U31A 3OAYK 1WWWX 3L3JB 4PRDB 4WJ5A 5E99H 2BFVL 2V17L 1CR9H 3QDJE 4K9EL 3CSYB 4HPOL 2G75B 1ZT1B 3C60B 3Q3GB 5D7IA 3LRSB 1CFNB 4L9LA 5T1LD 2I26N 1C08B 2LTQB 5IV2A 1KCRL 5IHLB 2R4RH 1IGIL 3PXJA 1NFKA 3H9SA 1G7LB 4ISVA 1G7PB 3VXRA 3V2AR 4TNWK 5C0AA 2DS4A 4HZLA 3RKDC 2IH1A 1J86A 3DBXA 4AIZA 4H0HB 3HR5A 4YHIA 3RL1B 2DJUA 4QXTB 4JPVL 2A9NH 5LCVH 1K3IA 1GOFA 3IJHB 3JV5A 2A74A 1TJGH 3D1MC 2Z91A 3QA3B 1CQYA 3CX5K 2XTLA 5GHWH 4ZSOE 1QLEH 1D7FA 4HHAA 4U0QB 4F15C 1JPSH 4WFHD 1U93A 1U8MA 5E00A 5I1JH 5ALCL 3QCTH 1VPOH 3QUMB 3FB6B 4IBLT 3RKPA 1WT5C 2VLRA 2OR7A 4PJFE 4PJ9D 2C3WA 1QFUL 1JHLH 2V9QA 4JO3H 5CAYB 4U1HA 5HBBA 2LU3A 3B6SA 1T0PB 3PV7A 1X5AA 3CC5B 3MRDA 3NPSC 3VGEA 4F2MA 2WWKO 2B0SH 2IQ9L 3RX5A 1IC7L 1RURH 2QKIA 1Q72L 2VXSH 5IB1A 5GGSA 5DJXB 5E2WH 1HYSC 2V2TA 5EOTB 4MCYA 1U3JA 3K2UL 2JJWA 3OR6A 3B9VA 1MF2L 1I9EA 4KKCC 5DQJB 3E6HB 6FABH 3LHPL 3QR2A 1NEUA 4NQXB 1JPFA 4P4KB 1UGNA 5GGQL 1JGDB 4MQSB 4I2XE 1XEDA 4XBEH 5DQ9B 3KPPA 3DYPA 2WW8A 3OXSB 4L4TA 1KJ2H 5TDNB 1CE6A 2WBWB 4KKLD 3ETBF 1MCPH 3TO4B 2VC2H 2GCYB 3STLB 3CFBB 4PV8B 4G6KL 3L9RA 1P4IH 2D7TH 3CLFL 3IYLW 3ZE0E 3N06B 2FSEA 2DQCL 4FQ2L 4P23D 5FUZL 5D1QD 4BSWB 1OW0C 3I6LE 5I1DB 2P5ED 2NY4D 2VDPL 3WEXB 4OJFL 3QNXA 1CIUA 2HJLB 4ODWA 4Y19E 4XWOC 1WAAE 1YC8A 4HJ0D 3DRQB 4A2LA 4LFHG 4HJGA 3WNMA 4ZFOL 5B39B 5JDSB 1GL4B 1OAYH 4X6BA 5F44A 5ICYA 1IILE 1VADA 1TNMA 3VWKA 3MRLB 3MTRA 1R3LB 3KAAA 5JO5B 2R56H 4D9QD 4XP5L 2DM4A 5ESQA 4MMZC 2QTEA 1XGYH 4LDOB 1MH5A 4L4VE 1XIWD 1A9EB 1PEZA 2VZ3A 4K7FB 3U79A 5LWYL 4PTUA 2H3NB 3U4EA 1J0JA 4XGZB 4HK0B 3VFRA 5F21B 1TXKA 3OTTA 4IMKA 4XP9L 1LEIA 3MJ6A 3DX9A 1BLNA 3ARYA 5J9PB 4EVNA 2EIBA 4JJ5A 3JVGC 4N9GB 1XH3A 1QFWH 4UTBH 4MLSA 3R8BB 1A7QH 4P2YA 1JNJA 1OAXH 2ICWJ 3N9GH 5BW7A 3RJQB 1BBJA 1JWMB 3RRQA 5IHZA 5CWSA 2XPGB 2RHEA 4PJHB 3VWJB 4QXUH 1YEGL 4TVPH 3MRDB 2ZOKB 3VWJA 2GEEA 1TVDA 5DO2D 5CEZE 1YEHH 2Y9RT 4QRRA 3V0VB 1L7TL 4JRWA 1CYGA 1DQTA 1IKNC 4U6XA 2X4QB 4S10A 3ZT6A 1QACA 3DI2B 3SCMB 4Q6IA 1A7OH 1A1NB 4PP1D 3UYRH 4N9GA 1NGQL 4FFZH 3OAUH 1FGNH 5JZ7D 2DQEH 4KQ3H 3C9NB 3U0WH 1BGXH 3UTSA 1OL0A 4WU7B 1EZVX 2QJDA 2V2XB 1EK3A 5HHME 5KOVC 1IVLA 3F7VA 4LKCA 2BDNL 1N3NA 3LZFL 1J05A 5C0AB 4CL7A 1B88A 3B4NA 1RVFH 1UXSA 4KKAC 4HMEA 4QEGA 5I0ZA 3CLEL 3NZ8B 5CS7A 1BMGA 4KMQA 3HC0B 3I85A 4OB5H 3Q6FA 1EEYA 4XMPH 4HGWA 1UCBL 1EPFA 2R0KH 4JQXA 1CLZH 4L9LB 1CLOH 3DRQA 3P77B 1V3MA 1OB1B 5SWQB 4I0CC 3WFHA 3RGVA 2G75A 1DQQA 1K5NB 1Y0LA 3UJJL 3LH2H 5CZVL 3AY4C 3B5TA 3VG0H 5FIEA 1NFDA 4OQTH 1VERA 3DX6A 4XT1C 3VGBA 3MRMA 4WENB 1UACH 3Q0HA 4LLVB 5DLML 5B8CA 3QQNA 3MRHA 5M7QA 4U0RB 3TWCL 1SJXA 4Z7OE 3E2HB 4JFZL 1MAJA 4M6OH 1ZHNB 5I1HH 3QIUA 2GJJA 1MCIA 1LHZA 4KGJA 2X9XA 4P3DA 2P5EA 3B2VL 5DS8B 5EFIA 1MHPH 1DQLH 3BZEA 3VI3F 1O5DT 1A4KB 4DCQA 4F7PB 5C07D 1AO7E 1JUFA 3CDYA 5TDOB 2A83B 5EZIH 4R8WL 1EHAA 3DWTA 3V0AC 4YX2L 3V5KB 3KNBB 3BISA 2AEPL 1GAFH 3IRPX 4XNXL 2NXYC 3OXRA 1C5DA 1UJ3B 4XMKH 5D1XB 5D96C 4HKJB 5IWLA 3VI4F 1H0DA 4Z7UB 1S7SA 1NMCC 2VKXA 3SJVE 3BQUC 3K74B 4ZUWB 3DMMC 1M4KA 1I85A 3U7YL 2NY1B 4Z0XB 2IADB 3PHOA 3FQTA 4NUJA 2JELH 3KWWB 1FYTE 4N0RA 5GGUB 1UM4L 2F53E 4TRPL 1LK3H 5I6XB 4V1DB 1LQSR 5EC2B 5BCAA 3QP3A 4JHWH 4XPTH 4ODUA 2BOBB 1KPUA 1MCNA 4OFDA 4MGXA 3N9GL 3PF2A 5F7KC 3VMNA 1KGCD 1JP5A 5F1NB 2F5BH 3KPNB 2BVOA 3QEHB 3TBVB 4XP9H 4R7DB 1JV5A 3UTQB 3Q3GA 1OWWA 3L3IB 4XPBH 2ID5A 4XX1G 3ARQA 3R06A 1YNLH 5F71A 4WJ5B 2JTDA 1DSFH 5IB3A 4JM2D 2P7TA 4ZTPH 4X6EA 1B4RA 3ARRA 3QG6A 2NXYD 1R5IA 4HUUA 4L3CB 2IBGA 2VXTL 5IVXB 4GW5B 4BZ2H 4AENA 1KEGL 2DLIA 3U9PH 3T4YA 5CLTA 5E08L 1EJ6A 1JF5A 3MRNA 4WGVB 1YMHA 3NCCB 4B0MM 1FG2A 4AL8H 5TFSH 1HN1A 3FRUB 3HI1A 3CPLA 4I0PA 2C4XA 4CVXB 1EEUA 1EFXA 1T0MA 5GSRA 1TZHA 5CEZD 3R8QA 1IKNA 4ONFL 3FOMB 4JO4L 3G5YA 1EXUB 4JHAL 5C0NC 2WUCH 3CSPA 5D2NA 4M7LH 3RPIB 3IDIB 3SDCA 4M02A 3MYJB 4NWUL 4Q2ZA 1IGIH 3CVIL 5JW5A 4HUMB 5IROC 3C6SA 3VXUD 1MVUB 1UB5B 4S0TD 5EWIH 2EYTA 5DJAA 3TN0C 1OTTC 1A6ZB 5CUSL 4PJ5D 2CRZA 1U8JA 1WBXB 2VAAA 3HFML 4HCRA 5GGQH 4NN6C 4NKIH 5C0GA 5GRJL 1KXQE 2CDEA 2X4UB 4FP8L 1U8IB 2NR6C 3CFEB 3GSUB 3TCXA 2W65A 3VGGA 4JY4B 3TESA 1CGSL 3GSQA 4ZFOA 1LD9B 4JM2A 2CMRL 4PBXA 3T77B 5SX5H 4R26H 1U8OB 3G5VA 3GBNL 1UWGH 3QHFH 5D1ZA 4KDWA 1NAMA 1NGZA 1GOHA 5JW4R 4HS8L 5D96B 4RMWA 3FRPA 1L4IA 2DQFA 2YRPA 3O8XD 1QSFA 3WUZA 1NDMB 3GSNB 2BY0A 3RWJA 4ETQA 4KRPD 3IKCB 1FNHA 4JQXC 2VERN 5IBTL 1QBLH 3BP5A 4P3WA 2ZOLB 3PWLB 2BC4A 1E4WH 4PP1C 3ZO0A 4GRWB 3TYFA 1R3JB 2HWZL 3MO1B 1YDPA 5AEAA 4AY0A 5GSRB 4POZC 3GKWH 4QYOB 3BZEB 2UVEA 3FN3A 1RY7B 4W4NA 2EXWD 1FNGA 4N5UA 4G8GA 4RGOH 4X0KA 4GO6B 5D6DA 5L6YH 5DVOA 3PP4H 1FPTH 1BAFL 1MIEL 4LLMB 2I27N 3QEQE 2EZ0C 1RULH 4D9RE 4K8RC 2ARJQ 4W68A 4DUVA 5ISZD 3DURB 1BD2E 4GMSL 5KS9E 3DETC 5T1KB 4M7KL 3G08B 4Q9BA 1WFUA 3V5DB 5K9JH 1LE5B 2VDRL 5D1ZD 4N8VB 3U9PL 3P9MB 3EYQD 3EJZD 3HS0B 2HJKA 3K4DA 5J12B 4D9QE 4E5XB 2UUDH 1JL8A 5ESVB 4A6YL 3QFDB 1J0IA 3TYGH 4A6YH 5D7LB 4QRPE 3BXNB 1D6VH 4RSVA 1FO0B 1MCWW 1P7KB 4OFVA 1JIBA 2X4SB 1NCWL 3V6BR 5ISZB 1S9YB 2VDRH 1JV5B 3HHRB 4GAGH 5FB8B 5GGRA 3F7QA 3WFEL 2EYRB 5E2JA 3C87A 1TZGL 4NRXA 1RFDH 5FGCE 5I15H 4M6MH 4ORZC 4LLYB 4TUKH 2FO4B 1ZLSL 1QQDA 2QADC 4ZNEA 1FPTL 3PP4L 3RZCB 3CCHB 3HLAB 4MX7B 5CMAB 4FFYH 3DRTA 4QY8B 3UAJD 1QSEE 3F5WA 4NBYB 2UWEA 2G5BB 3BKMH 1I7ZA 1CIDA 1YPZB 5C92A 3LN5A 1INQB 4RGMB 1SYSB 4OUOA 1P84J 5EC1A 4P23B 5JMRA 3FQTB 4K3DL 2VXUL 4PRPB 4Z7NF 2FD6L 1UH4A 2R69L 4PG9A 3FKUS 1T7WA 2DBJA 3TBTB 1DBBL 4HWEH 2C26A 2VQ1B 2E7MA 4GRWF 4WV1A 4G8FA 3VFPA 1KPRA 2YC1A 1KCKA 1T66C 4PJXA 3QEQB 1UWGL 4H5SB 2P8LA 4FS0A 5EDXA 4XVUC 2HT3C 5HYJE 3EW3B 4RAVB 3WS3A 2QQKH 3I3BA 4EUPH 1OTUD 3NTCL 4DVBA 1WC7A 4PRIA 3NAAL 2AEIT 3I2CL 1PLGL 4G5ZH 3SGEH 2DQTH 2AEPH 1ZANH 3QIBA 2RB8A 4JLRA 3PQYB 1HWHB 3VFNB 2VDQL 2H8PA 3I6GA 2XQYK 1H3GA 4XVSL 1P2CB 3CUPB 4IDJH 5D4QA 1BM3H 4M7JH 3WXWH 4YBHA 1PDKA 5ANMB 4HC1A 3K8LA 1G9MH 4PRAB 1S5IH 4FHBD 5EH1A 3HC4L 1XF4B 2NY3C 1FORL 4K7FA 1T89C 3SKJH 5K9KB 1SEQL 2HTKD 1IMHC 2DF3A 3P0GB 3GJEB 3IF1B 3IJYA 1UADC 3ARSA 3REWA 5F96H 4OFIA 5DMGC 4I5BB 1NH6A 3S35H 2B1AH 3ARPA 5DT1H 4QRPB 3WXVH 4GLRI 5FYKU 4JG0L 3UJJH 1JJUA 5JHDA 1MHEA 4H1LH 4M48L 2OTUB 3DECA 4G7VH 3IS0X 3K4AA 4X7SH 1YMME 3PIQB 1RV6X 2CGRL 4EOWH 3F8UB 3WJLA 4Y5YA 4HUXA 1B2WL 1K9TA 4NO3A 3CSGA 4NCDA 4LPVA 1ZHBB 1NPUA 3REVA 3RX7A 2CLZA 5SWSA 2WAHA 1K4CB 4MXVE 5FCUL 1GGIH 4PJHE 1QFOA 5DFVD 4Z8FL 1OLLA 3JVGA 1NBZA 4NP4L 4RBPK 5C0AD 2NY2C 2NX5E 3D9AH 1IZJA 5E6IC 2EDRA 4N0UA 1J9CT 3ARBC 1EGJL 4ZS7L 3S34L 5ESAB 2P47B 5J89A 2J6EL 2XKNA 1DLFL 4RWYL 4LRIC 4NN7B 4DGIL 2X1QA 5BJTA 2YXFA 5E2TH 1CDYA 4BJLA 1JWUA 3ALWA 3L5WB 2FO1A 4QKXB 1TTFA 3P3YA 4JDZB 1G9NC 4YXLL 4Z7OF 1Z5LB 1UC6A 3TJHC 1AR1C 4CMHC 4XB8A 3DMMA 5IB2B 5B3NA 1N8ZA 5D7LA 5CSBA 3GJEA 3H3KA 4E5XA 2X09A 3MV7B 3IVKA 4HC1L 4QLRA 5HYJA 5F7WC 1U8MB 5E00B 3SGEI 4LCCA 4NC1C 5DO2C 1XF4A 5EB9A 1GIGL 1KYOJ 3ULUE 4RFOH 4KI1A 1FZKB 1CDGA 1LP9E 3MLUH 2XKSA 1D9KC 3T0EC 1UKTA 4QCIA 5DYOB 4ALAH 5I1AB 4LLMA 4TNVK 2BVYA 3UPCA 4HIXL 1TJIH 4XCFH 1HHGA 1EEZA 2ZJSL 4H20H 2A1WH 4NJAL 5FYKL 1MWAH 4NO0B 5EO0A 5CINL 1OSZA 3ZKNC 2OJZL 1KOAA 5HD8D 3BD3A 4AEIH 3MLVL 3M8OH 3BT2H 5HHVL 1XF1A 2R1YB 1CBVH 3MUHL 3LKSB 1MJJB 2HFEB 3BZ4B 3QUKA 4C56B 4YH6A 1ZTXH 5ITBH 2JCCB 5I75C 3HE6C 3SQOL 2YD9A 5KVDL 2IWGA 3SGDI 3TWCH 4AEHL 1JYXA 1P4BL 2EXYC 1A14L 5EOQL 3RNKA 5A16A 3IDJB 3WIFA 4R0LB 5BV7H 1EVUA 2Y5TB 2FLRT 4BUGA 1H8NA 1AHWB 1F6FB 4ZXBC 1OAUH 4PJCA 4Y5YB 2FZ3B 1KFAH 2VUYA 3IAPA 2NZ9D 4MA7H 3Q6GL 1SJVA 4WWKC 3M1BA 3PUCA 4APQB 1YUHA 4O51B 1CLOL 2P49B 1IAIL 5TQ0L 1C16B 2FX7H 4DGVH 1IGCH 1I7ZB 1RHFA 2R4SL 2GQHA 3AVEA 4AG4L 4XCCH 4GBXC 3ISWA 3D85B 2VITB 1X5LA 3GFUA 3PHSA 3BDYH 5JORB 4UT9L 4DKEH 4AH2B 2VWEE 4MD0A 2RAMA 1MIMH 1N64L 1NFDF 3MV8E 4U1GB 2B4CL 5D5MA 4NRZB 1VSCA 4G5ZL 3BEWA 5GJSH 3IJSA 4Z8FH 5ALBL 1GSMA 2I60H 3PDDA 1SVCP 3FFCA 3WFBH 1S9XA 4MA8L 3TH2T 4ODSH