3C6TB

Crystal structure of hiv reverse transcriptase in complex with inhibitor 14
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
423
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 103
structure length 404
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6tB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6tB04
1RA7A 3H5XA 1QE1B 1TKZA 4XO0A 3OL6A 3BSNA 2R8GA 1JIHA 1FK9A 5HP1A 5KG3A 4TYBA 1NHUA 3HKWA 5KFAA 5KFUA 2W9CB 1S0MA 4I2PA 4KHMA 4DL4A 3IN5A 4ECVA 5KFDA 2W9BA 4J9NA 1KHVA 1SH3A 3MFIA 3Q8PB 4F4WA 5KFLA 1RT3A 1LW0B 3CDUA 3EPGA 1CSJA 3KHRA 1HPZB 3NAHA 1UWBB 2XCPA 5K14B 5KG6A 5C25B 1HNVA 4R0EA 4YQWA 3ICLA 2RDJA 1DTQA 3H4BA 3PW7A 3T5LA 2V9WA 2XI2A 3M8QB 3I0SA 5KG0A 2E9TA 2XCAA 4ED1A 1IKYA 3UPFA 3GQCA 4EYIB 4RNOA 2R8KA 2XWYA 5KT3A 1IKVA 1N56A 4KFBB 3QIPA 1JLBA 5DQIA 3TAMA 2RDIA 3NBPA 3T19A 3V6HA 4EEYA 4ED6A 5J2PB 2HAIA 3IG1A 3HVTB 3QIDA 1RTHB 4TY8A 4ZMMA 1N6QA 4IRCA 4O3SA 2C2EA 2J6TA 1S9GA 2ATLA 2RF2A 1RT7B 2ZKUA 3MFHA 4LQ3A 4EO6A 3KHGA 2E9RX 2WONB 2O5DA 1RTIB 3KHLA 4G1QA 4O3RA 2RKIA 1BQMB 4QWAA 2V4RA 1QAJA 2D7SA 1S1XA 2ASLA 3PW5A 3GIJA 4ZHRA 4KAIA 2W8LA 1TV6A 1XR5A 2AGPA 5C42B 2UVWA 4IFVB 4KHRA 4O4RA 2GIQA 1T3NA 1S0NA 5EWGA 4F4ZA 2D3ZA 3C6UB 4KBIA 1BQNA 2OPRA 1TVRA 3V6DA 2OPQA 4FS1A 3QZ8A 2JEFA 4R5PB 3KK3B 1S0OA 1RT2B 1LWEA 3BGRA 3E01A 3MEDB 4J9QA 1W25A 5CYQB 3KLHA 3KJVA 2I1RA 4ID5B 4RW8A 1KLMA 5HLFB 3DLEB 5KG5A 3OSPA 1C0UA 1RTDB 4NLYA 2BR0A 5C24A 1RYRA 1ZTTA 3PJXA 2CJQA 1ZETA 1NHVA 2YKNA 3G86A 4WZMA 1JLQB 2IM1A 1S9EA 3UDLA 4I2QA 2FVQA 3DI6A 5KFWA 1R0AA 3QYYA 2D41A 5KFXA 2R8JA 2FVRA 4PWDA 1JLCB 3G6VA 3KNAA 1HQUA 1C0TA 4O4GB 3V81B 4Q0BB 4J9LA 4J9PA 2HWIA 1D1UA 4NRUA 3DMJA 3NAIA 1IKXB 2BQ3A 2OPPA 3I5BA 1S6QA 4IH6A 4LSLB 5KFTA 2W7OA 5KFOA 2BRKA 4FBUA 2VG7A 4TYAA 5F8JA 4O3PA 5KG7A 4WFZA 1HQEA 4IG0B 2HNDB 5KFQA 4NLPA 4H4OB 4QW8A 3MEEA 4ECWA 2B5JA 1S6PA 3NGDA 4RW9A 4J9RA 2ZD1A 5KFGA 4ECSA 1TL3A 4I7FB 1T05B 2AX1A 3BQ1A 5CYMA 2IMWP 5JXSA 1YVFA 3NL0A 4IFYB 5J2QA 3V4IA 4NLOA 2FJWA 5KFFA 5KT4A 3OL8A 3C6TA 2YNHB 1SV5B 1RT1B 3RB4A 3FDSA 4DG1B 1RYSA 2BQRA 3KLIA 5F8GA 5J2MA 3DLKA 4WFXA 4Q8EA 1C2PA 3T1AA 2YNIA 4KV8A 5L1JA 5KG1A 3EZUA 4IQXA 4I2PB 5J1EA 1TQLA 2JLEA 3GIKA 3DRPA 4KO0A 5FDLA 2W9BB 4JUZA 5KFEA 4PUOA 5EWFA 1MMLA 4EYHB 3ISND 3I0RA 4IOBA 4WYWA 4Y2CA 3JYTA 5T14A 2ILYA 3I5CA 2IC3A 3SFGA 1RT6B 2FVSA 3RB0A 1S97A 4IR1A 2YKMA 2CKWA 1QUVA 1HNVB 4NLWA 3CVKA 5L9XA 1K1SA 2W8KA 4GC7A 1RDRA 4JV0A 5KT6A 3OHAA 1JX4A 1DTQB 2FLNA 4PQUA 3LANA 5KFBA 1SH2A 2R2TA 3HVAA 4RNMA 1IKYB 1C1CA 2AQ4A 1SUQB 3DRSA 1XR6A 3M9NB 3KMQA 1IKVB 2WTFA 2OPSB 4NLDA 4LSNA 3MTKA 3CDEA 2WHOA 3PR5B 2XGPA 1RT5A 5KG4A 5HBMA 1N6QB 5KFZA 1TL1A 1C1BA 1JKHB 4NLRA 2YNFA 4YR0A 4DL6A 1S1VA 1N5YB 4ED7A 1EP4B 2IAJA 2R2SA 4QWEA 3H98A 2YNGB 3MECB 1U09A 5DGBA 4K4SA 2IBKA 2R2RA 1S1XB 3CDWA 3QZ7A 3IGNA 3IRXA 4IRDA 3JSMA 4WZQA 1TV6B 4DL2A 4RNFA 1REVA 1DTTA 3DM2A 3QGGA 3LP0A 4RW7A 2C2RA 1LWFA 4B3OB 2UUWA 1OS5A 2R8IA 1J5OA 3DDKA 1TVRB 3V6DB 2AX0A 1HMVA 1JLFA 2OPQB 2IM2A 4WYLA 4U7CA 4J9SA 4F50A 4IR9A 3KLFB 3CIZA 1LW2A 3M9MB 1TKTA 2C2DA 3BGRB 3DRRA 3DLGB 3N6NA 2BQUA 1S49A 1JLEA 1KHWA 3KJVB 4RW8B 1KLMB 2HMIB 5EDWA 3GV7B 1VRUB 3DOLA 5D3GA 1FKPB 2D3UA 3KK1A 4QWBA 2FJVA 5KT7A 1RTJA 4M95A 1TKXA 1QE1A 5J2NA 2YKNB 3CJ0A 5DG9A 3OL9A 1S9EB 5I3UB 2AWZA 2QV6A 4KSEB 3CWJA 4I2QB 4RW4A 3DI6B 3HHKA 1R0AB 5DQHA 5KT5A 2W9CA 4Y34A 3PVXA 2UVUA 3ITHB 4ZP7A 4ECRA 2I5JB 2FVPA 4ED0A 2ZE2A 3T5JA 2DPIA 1NNDA 4IKAA 3T5KA 2FLPA 3DMJB 5KT2A 3PJWA 2VA3A 2OPPB 3D28A 1S6QB 4NCGB 4J9KA 4FS2A 2JEJA 4RUCA 1HPZA 4ZPAA 4RW6B 1UWBA 4MFBB 4O44B 3PW0A 4K4ZA 3MR5A 1VRTB 3KK2B 1RAJA 4NLXA 4R8UB 4K4WA 4K4YA 2R8HA 4DL3A 5DGAA 4H54A 3DYAB 3M8QA 5I42A 1S1UA 2ZD1B 5F9NA 3MR3A 5JUMA 2B6AB 2IM3A 3PZPA 3ISNC 5CYMB 2XC9A 4YP3A 4Y2AA 1RT4B 3N6LA 5J2QB 4ED2A 3IS9B 1Z4UA 3OLBA 1HNIB 4ICLB 3M8PA 3DOKA 3LAMA 2ASJA 4IG3A 1IKWA 5J2MB 3DLKB 5J2PA 4MK7A 4EO8A 4H4MB 3HVTA 1RTHA 1GX5A 2YNIB 2BRLA 2ILZA 3KLGB 1DLOA 2VG6B 1EETB 2GIRA 5J1EB 1RT7A 1MU2B 3PHEA 5DQGA 5F8NA 3LP1B 3BR9A 3LALA 2VG5B 2WONA 4KO0B 5FDLB 5KFKA 4YR2A 3IGVA 4ECQA 2WOMB 4KE5A 4YR3A 4NYZA 4DEZA 2IC3B 5HROA 5F8IA 1HYSB 1T03A 3N6MA 4QWCA 3C6UA 1TP7A 3I5AA 5DG7A 1FKOB 4ZP6A 3QO9A 2VA2A 3RB6A 2HNYB 4MK8A 3H40A 1LWCB 3QLHA 2QE5A 2HWHA 4IDKA 4RUAA 4R5PA 4NLTA 3KK3A 1TKZB 4ECTA 3MEDA 3NKYA 3HVWA 1FK9B 5HP1B 4TXSA 3V6JA 5CYQA 4WXWA 3Q8SB 3CJ2A 2JC0A 3FQKA 4WE1A 1S48A 2WB4A 4TQRA 3FFIA 2ALZA 1RT5B 4F4XA 3OL7A 3KOAA 1JLQA 1RT3B 5KFYA 3FRZA 2W9AA 2BANA 5C5JA 4NLVA 2JEIA 3H59A 2YNFB 2OH2A 1S1VB 3H5UA 1JLCA 2GC8A 5KFIA 4EBCA 3E51A 3BJYA 2XI3A 4O4GA 3V81A 4Q0BA 4U6PA 4NLSA 1S1WA 3BQ2A 3I0SB 3RAXA 1XR7A 1JLGA 3LP2A 3H2LA 3JSMB 2HNZA 4TY9A 4TLRA 4RW7B 1K1QA 3QIPB 1JLBB 1LWFB 4URQU 4HKQA 3GYNA 3TAMB 3QGIA 4NRTA 4Q43A 5L1LA 4F4YA 3NBPB 3MEGA 2AGQA 2UVRA 1HMVB 1JLFB 4RNHA 2WK4A 3KLVA 3FQLA 1T05A 4HYKA 3IG1B 4WXOA 3RB3A 1LW2B 2JC1A 1TKTB 4TY8B 3SFUA 4ZPCA 4ED3A 2FLLA 1S9GB 1JLEB 2RF2B 4ZPDA 4IFYA 4MIBA 2BE2A 5KFHA 1S1TA 2YNHA 1SV5A 1RT1A 5KFJA 4DG1A 3BSOA 3DOLB 5D3GB 4G1QB 2IM0A 1RTJB 1S10A 1TKXB 2RKIB 5J2NB 3Q8QB 5DLFA 3BSCA 4ZHRB 4JV2A 4ECUA 4RW4B 4ZVEA 5L1IA 4KKOA 4NLQA 2ZE2B 5EUHA 1BQNB 2OPRB 5KFSA 3MR6A 4ECXA 1JLAA 3KLEA 4ZVFA 3T5HA 4NZ0A 4MH8A 4YMEA 4RZRA 1LWEB 1RT6A 3E01B 3CJ3A 2IA6A 4EBDA 4O3QA 3KLHB 3UR0A 3GIIA 1S9FA 1C0UB 5F9LA 3EPIA 5C24B 4KB7A 2WCXA 5I42B 1S1UB 4OL8A 4IH5A 1SUQA 2OPSA 2E9ZA 3V6KA 2V4QA 4PWDB 3M8PB 3DOKB 4IG3B 1IKWB 1HQUB 1C0TB 1S4FA 5F8HA 3H5SA 3MR2A 1LW0A 3KHHA 4Q8FA 2V0NA 4TQSA 1DLOB 2JEGA 1JKHA 4URSA 1WNEA 1N5YA 2F8EX 2VG7B 5DG8A 1EP4A 5K14A 3GV8B 5C25A 1HQEB 2YNGA 3MECA 1RA6A 3RAQA 3MEEB 4J9OA 2B5JB 1S6PB 5L1KA 2IJFA 4RW9B 3OLAA 2J6SA 2J6UA 3BQ0A 4K4XA 1TL3B 2AGOA 2UVVA 2W7PA 5HROB 1IM4A 5KFMA 3D5MA 1T03B 4KFBA 3V4IB 3CJ5A 4XPCA 5KFPA 4B3OA 4TN2A 3C6TB 5KG2A 3QO9B 4ZVGA 3GV5B 4K4UA 3M9OB 3QLHB 3KLIB 3G6XA 4IDKB 4JV1A 3KLFA 4KV8B 3QGHA 3DLGA 5KFRA 5F8MA 3H5YA 4M94A 4IH7A 3MF5A 2HMIA 4QWDA 4Y3CA 3DRPB 1VRUA 1RTIA 4WE1B 4PUOB 1FKPA 3FFIB 1BQMA 3I0RB 5KFCA 2R2UA 5I3UA 2BANB 3JYTB 1GX6A 4Q45A 5C42A 4Q44A 4IFVA 4O3OA 2YKMB 3ITHA 4ZP9A 3GILA 2I5JA 3LAKA 2DPJA 1I6JA 4ECZA 4WFYA 4PQUB 5KFVA 4DL5A 1S1WB 1T94A 1SH0A 5EWEA 1JLGB 3LP2B 2C28A 1C1CB 2HNZB 4NCGA 4NLUA 1RT2A 2XGQA 3DRSB 2UUTA 4RW6A 4MFBA 4O44A 3TVKA 4LSNB 3PR4A 4ID5A 4X2BA 1VRTA 3KK2A 5HLFA 3DLEA 4R8UA 4K4TA 1RTDA 4IRKA 3H4DA 3MEGB 3Q8RB 4URGA 3DYAA 4EBEA 3BREA 4K50A 2FJXA 2B43A 1ZTWA 3KMSA 4DL7A 2B6AA 4MKAA 3VQSA 3PW2A 5HBMB 2C22A 1RT4A 3PW4A 1TL1B 1C1BB 4NLGA 3NMAA 2BE2B 3IS9A 2ASDA 1HNIA 1S1TB 3TQ1A 4ICLA 4GC6A 2IAJB 3UQSA 4QW9A 1JXLA 4MK9A 1N48A 4FBTA 4K4VA 2IJNA 4ZPBA 4H4MA 4ECYA 1QAIA 3RBEA 1IKXA 5F8LA 3IRXB 3G6YA 3KLGA 3SI8A 2VG6A 1EETA 4LSLA 1N4LA 4ED8A 3RBDA 1REVB 1MU2A 4MIAA 1DTTB 3DM2B 3FSIA 4KKOB 3LP1A 3GIMA 4G3IA 2VG5A 3LP0B 4IG0A 2FVCA 2HNDA 4LQ9A 3OSNA 4H4OA 2EC0A 4O3NA 1J5OB 1D0EA 4ZP8A 1JLAB 5DLGA 4RNNA 3KLEB 5KFNA 3CO9A 2WOMA 4I7FA 4J9MA 3DRRB 1HYSA 4QPXA 4RU9A 2AU0A 1FKOA 2WRMA 1HARA 3CJ4A 3OHBA 2HNYA 3BSAA 4ZVHA 1LWCA 4MKBA 3KK1B 4XPEA
chains in the Genus database with same CATH superfamily
5J1PA 1TKZA 2ZOFA 1S0MA 2AZ1A 1PKUA 1VQYA 2DCUB 3WDOA 2W9BA 3LW5C 2ZVIA 2RUSA 2KM8B 4L72B 3BDPA 3ICLA 2R4FA 4FF1A 2R8KA 2E5LF 2GVDA 3PIPQ 2M70A 2GHVC 3V6HA 1DHMA 2PE8A 3NGSA 1SQEA 2RF2A 2E5HA 1HBUA 4LF9J 3MUVP 4TNOA 4QIFA 1SL2A 4PQAA 2J7KA 1TV6A 1XR5A 3G9CA 2PN6A 4DR2J 1BQNA 2Y1RI 5B0DA 1KVJA 3QZ8A 3Q23A 3MEDB 5HQLA 4K7QA 2F3JA 5A76A 2K8GA 1C0UA 3PJ9A 1CPZA 2MKCA 3F44A 1WHWA 5FJ4A 5ETVA 2MSSA 3VGVA 2KRBA 3LA0A 1S6QA 1A6LA 5G4DA 4OLOA 3QT7A 2W4PA 4DJBA 5HVGA 5AJ3J 4JI8F 3V4IA 5KFFA 2E1AA 3TVYA 1Y9OA 3DRXA 4DV5J 3T1AA 2MKIA 4IOCQ 2CWXA 1X4FA 3OTOF 3UNGC 3ZNJ1 4P9SA 2UP1A 3DLJA 4UOCA 1MMLA 2WBRA 1Z2ZA 1S76D 4GO7X 4ZVOB 3ZTRA 4JI6J 1FEEA 3SFGA 1FTCA 3DNCA 3M2RA 2GMLA 1K1SA 5IV3A 3BBCA 3P6YC 3WIVA 1AZSA 4CLSA 3J7ZT 1N6QB 3HFKA 2LDIA 3RTVA 2QLFB 3RBZA 2I9SA 3MPVA 1PILA 1QSLA 3LP0A 2V2VA 2VHGA 3DDKA 3V6DB 3S6EA 5BYRA 1OMSA 3BGRB 2BEFA 2P9GA 2HMIB 1RHRB 2FJVA 3KTQA 2VC1A 2UVUA 4ZP7A 2ZE2A 3VF0B 3T5KA 5CQGA 4UZCA 3R2DJ 1MN9A 2HLUA 3MR3A 2XLIA 3QJLA 1Q81T 3NWGA 2MMYA 2ZBCA 1DY3A 2MEWA 3CSKA 4QCLA 1V9OA 3HD2A 2QLWA 2ILZA 3MWBA 1YZ6A 2GIRA 5F8NA 2VPZB 2LLZA 2VG5B 3MMCB 2RUGA 2V69A 4JB8B 3H20A 5HROA 1Y7PA 1WC1A 5THWA 5DG7A 2JWNA 1LWCB 3KJQB 1TMMA 2HG4A 2XYPB 4F2RA 3R9LA 2R7XA 1MSWD 1M5KC 3BBFA 4CM2A 2Q6BA 3G8TA 3H5UA 5HSPA 5E0OA 3U1MA 2HURA 2MY8A 2CJ9A 4N5SA 3RAXA 1G7CB 2MQMA 1G2EA 5GAGU 4NX9A 2N3OA 4NEYA 3E3XA 3KLVA 2FZCB 1SBRA 4O0NA 3G8QA 2F8MA 2KZZA 1WWHA 2LCWA 2NQPA 3OTDA 1S10A 1WUUA 1QTMA 5A0YB 2RQKA 2KJVA 3K0JA 4YMEA 1X9MA 1OQ3A 3EPIA 2FY1A 2OPSA 1RACB 1NJZA 7FD1A 3AB2B 3P49B 4J9OA 3NRBA 3OLAA 1CULA 4YDXA 3H7HB 2XLJA 1U48A 2O66A 2XWXA 4Y2KA 3C6TB 4DR3F 2EPIA 4HR2A 2P2CB 2V2ZA 4FDFA 3VAHA 3MD1A 2DO4A 4FVCA 2POKA 1FKPA 4WIIA 1UVMA 3JYTB 2H3EB 1X4AA 2H9ZA 3PHTA 1HKAA 2JL9A 2XQCA 4ECZA 3ADAC 1JLGB 2MLXA 2DH9A 4K4TA 4TVAB 4NCBA 1TU0B 4URGA 2JVRA 2EKNA 4OMFG 1VK8A 4QW9A 1NLKL 4CYUB 3SEOA 4H4MA 2Y1LB 4F25A 4LQ9A 4IG0A 1DURA 4OHVA 4P2SA 1KVIA 1RB0A 1Q8BA 1FWPA 2HNYA 4NI2B 3SDEA 2DK2A 4DR5J 4AD6A 2ACYA 1O6XA 2AW0A 2Q1LA 5JJBA 3WQPA 2MZRA 3H4BA 3DHXA 3QWUA 5ETTA 4QU7A 2RVJA 3TAMA 2G2ZA 6AT1B 2XS7A 2DEIA 5D0GA 4JI2J 1RWVB 3R5GA 4PEOA 4QWAA 4RLEA 4RX6A 1V3ZA 2AYEA 3AD9C 2HVIA 2OPRA 2QLJB 5BXIA 1B7YB 3O6QA 4ANEA 4JV5F 5CYQB 1SQFA 3UFCX 1T7PA 4M5GA 3J7A1 1CC8A 3FKBA 5KFWA 3HULA 2R8JA 2FVRA 1CJVB 3PYDA 3GMGA 4J90A 1O51A 3P5BP 2HWIA 3M1VA 1KONA 2ZWOA 2VG7A 2YQ3A 5AE3A 2PI4A 1F60B 1WTBA 5D77A 1P8GA 4DU8A 1DRZA 1RLCL 4KV8A 4HH1A 1EARA 1TQLA 2VIHA 2NSBA 5T14A 3POTA 4NZ7A 3V4MA 5IWAF 2NLWA 1DTQB 4X4QA 4PQUA 1RWMB 1I5OB 3QFHA 2QFJA 3TW0A 1CJUA 1Q8KA 1RI7A 2G1HA 2AJ0A 2NREA 4ZVUB 2IDLA 5KFZA 1C1BA 1N33F 1D9FA 4A48A 1PJ6A 3M30B 5D4NA 4DL2A 1HNXF 2ZZNA 4RW7A 1LWFA 4LFBF 2V8DA 2FJEB 1TKTA 2JLFA 1S49A 1JLEA 4OZ0A 2Y3YA 1UETA 2D3UA 4QWBA 5DG9A 5DQHA 1R0AB 3GCWP 1R27B 2I5JB 2DPIA 1B70B 2FLPA 1YX2A 5A8WB 3SCIE 3MAAB 4PKDB 5ETQA 1U1LA 1O8BA 5E41A 4O44B 1K73T 2R7WA 4DPOA 1X9WA 1FJGJ 3N6LA 4LRAA 4NEZA 5HAOA 1HNIB 2HBZB 1IKWA 4UZBA 3UO0A 3LF0A 4DLEA 3AODA 3CNQP 4LBIA 3MI7X 3CXCR 1FDAA 1T11A 2D74B 3PV8A 2XY7A 4K5SA 2WOMB 1BGXT 2CNOB 3N6MA 4DV6J 2BJ7A 3QO9A 2NCKL 4NLTA 1V6HA 2VFVA 1T9YA 2AZ3A 2GQ2A 1TAQA 5C5JA 2MQ8A 1NAQA 2FGCA 2OH2A 4LREA 2OELA 1WG1A 1S1WA 1H73A 2AYGA 3JXOA 4NRTA 3Q22A 5A6PA 1VQPS 4U7UD 4MIBA 2BE2A 3PX0A 2DIVA 3BSOA 1RTJB 5EHHA 4M5LA 4DSLA 2K1RA 4USUA 3PYEA 3G87A 2LEBA 4ZVSB 3KLEA 1LWEB 1NRKA 5F9LA 3A3PB 3R8YA 3GSDA 1S99A 2DR8A 2EBGA 4C0OC 4PWDB 3M8PB 3GJQB 4F2SA 1VISA 4G1IA 5C25A 3CJKA 1RBOB 4WJBA 2QN6B 5L1KA 2VONA 1TL3B 4KQZA 2BDPA 3BGLA 5IT9Y 2M52A 4B3OA 4YS2A 1KC8T 1TL7B 1X4EA 1KBRA 4M94A 3MF5A 1M5PC 1V3SA 3X3UA 4AYBD 2UXBJ 2Y8YA 1NPKA 1F5BA 1GX6A 4RU2A 8ATCB 4Q44A 1PYSB 2DB1A 4USIA 2BOPA 3LP2B 2VQEJ 2J0WA 3KK2A 2W2MP 1RISA 3C15B 1H7XA 3TNVA 5DJBA 1U1KA 1ZM9A 2JOQA 2FGOA 1PJ7A 4ICLA 4N77A 3UQSA 1VI7A 2IJNA 1REVB 2DIUA 3DM2B 2QYGA 4C8NA 2DD8S 2V68A 4ZLNA 4DPUA 4RNNA 4MJKA 4HTIA 1HQ2A 1XNRJ 3T5LA 1ELOA 1H7WA 3CCWA 3HKWA 4LFCF 4V19J 4DL4A 3W8GA 2V4JB 4CO0A 2DGTA 4IO9Q 1I94J 4ZCMA 4DUZJ 2PMZD 4B02A 1ZZNA 2FUG9 1HD1A 2ATLA 1RT7B 1RTIB 3M6UA 1FEHA 2QFIA 3C3LA 1KEKA 4HH0A 4X62J 1S0NA 2D3ZA 1UWAA 2N7YA 2CQBA 1S57A 2CPYA 4KGVB 5C24A 3W5XA 1PO6A 1GMVA 4YFUA 5D4OA 1HI1A 2KFNA 5C7PA 4I2QA 3TAPA 5CZXA 1JLCB 3G6VA 5ETKA 5KFTA 4CZCA 2YXLA 4NLPA 2D9PA 1X4DA 3R5AA 3CD6S 3CB4A 2IYGA 4ZLLA 2YNHB 3RB4A 3DLKA 1O0PA 3O1LA 2YNIA 3KXDA 3M8ZA 5J1EA 3GIKA 3DRPA 2LQJA 3Q83A 1MMDA 4KGMA 3I5CA 4LBPA 3RB0A 4M8LA 5KFBA 1U1QA 1WEYA 2ZZTA 4WK3A 4JI1F 1IKVB 4LSNA 3W2WA 3BR8A 3UVJB 3Q8YA 1PAUB 5IV4A 1FXDA 2OO4A 4QJVA 4B9TA 1WOOA 3H98A 2HFSA 3EVMA 3KG1A 2L3MA 3QZ7A 3IGNA 1XMOJ 4CM0A 3KLFB 4AL6A 1SCJB 2LMIA 4LF6F 3CJ0A 1SKUB 1NM2A 1F9FA 2MGZA 3AOAA 1BXNA 1HBOB 4M5IA 5KT2A 2VA3A 2FD2A 1VHFA 3MDFA 4DWIA 3FCHA 3K5NA 2ZD1B 1U2CA 1QAXA 1NDCA 4USMA 2HZVA 2LQ5A 3PRBA 3UDEA 1KVKA 1EETB 3CCZA 5HMXA 3LP1B 2KZMA 1FNMA 3DOMB 4OYPA 3DLHA 5E5NA 3IGVA 1YBTA 1UKUA 3MM7B 5F8IA 1T03A 3IXQA 3RB6A 2ZNYA 3MHYA 4OHZA 2NUUG 4DI6A 3CJ2A 3O5TB 3A13A 4XIUA 4K0KF 4A8KA 4F4XA 4P2FA 4P72A 2OHDA 2XMVA 3OTEA 1VQ5S 3A8IA 1DAXA 2XI3A 2OSRA 1EX8A 4Q43A 1P1TA 4QIWD 2ERRA 4WXOA 4TY8B 1SC6A 4EGLA 3NNHA 5KFHA 2XNQA 4CTAB 4B3MJ 4X64J 4P73A 4RR5A 2G4BA 1TUVA 4QZVB 2KJWA 3T5HA 1BHNA 3D9BA 3E01B 2DJWA 3TRGA 1WKLA 2KDOA 2EBEA 2KVIA 1U47A 3FK4A 2Z2MA 1UAWA 1EKSA 4NYPA 1T9WA 4TQSA 4V19X 4URSA 2KFYA 1N5YA 5DG8A 1MROA 1EP4A 2HRUA 3MECA 3IMQJ 2BJEA 1RWOB 2QA4S 2WVEA 4AL7A 1R8PA 3NCRA 3AQOA 2R7UA 5F8MA 3DN9A 3HMJG 4LBHA 5KFCA 3W3SA 3H0PA 2DGUA 2VOOA 1V5IB 3K89A 4GKJF 2QMWA 1I6JA 2BW2A 3PKYA 1UZHA 1JNZB 4RW6A 4MFBA 4MT1A 2XZTB 1VOMA 2B43A 2VBXA 4Y65A 4CO3A 1E6YB 2C22A 1LXNA 2DH8A 1N48A 4N7TA 1XN9A 1RWNB 1SKRA 3KLGA 3SI8A 4LSLA 2I8EA 1DTTB 5HANA 4OI1A 1P1LA 1KP6A 3OJSA 1IJFB 5HMZA 2CG8A 4RU9A 1SJ4P 4N47A 1OPZA 2IRYA 3N0VA 2VFRA 4I2PA 3W64A 1RHJB 2XMJA 4DX5A 3VTIA 5HMYA 5DZ6A 3KHRA 1T0TV 1F5AA 3KUHA 2XCPA 5K14B 1RZMA 1HNVA 1X60A 3PW7A 3M8QB 1Q5VA 1LK5A 1F2HA 4DV3F 5IT9U 2DNHA 2NYHA 3N5BA 3TUJC 4ZIVA 2J76E 2ZKUA 2E1CA 1BQMB 4ZHRA 1Q0NA 3QRPA 1WHYA 3ENVA 3MPYA 3ZC4A 2CA9A 3GU0A 4RW8A 2JNJA 3HSJA 2NR0A 1RTDB 4U9RA 2HZAA 1WOSA 2MZTA 2YKNA 2IM1A 3HHNB 1C0TA 4UTGA 2YX7A 3DMJA 1HWUA 3I5BA 5DZ7A 5LJ3Y 2PFFB 2GV1A 2VKRA 4AQYJ 4O3PA 5KG7A 2C3PA 4OYWA 4DV4F 3PNIA 2IHR1 5E3PA 1SV5B 4CNYA 1RWXB 4DG1B 4CLLA 1H2UX 4OZ2A 4WF9Q 2J7UA 1K9MT 2PO4A 2W9BB 3KDNA 4EYHB 5H9EJ 1HNZF 3IM8A 1S4EA 1S97A 1HD0A 2DY1A 2IBOA 2W8KA 3D68A 2V8GA 1Q95G 1N0UA 3HXMA 2Y9HA 4NA2A 2XGPA 5KOXA 2YWGA 3GR1A 4DBQA 1DQ8A 3MCNA 3I9V9 5LM7E 1TV6B 4RNFA 4C8LA 3PO4A 2GAHC 2XHWA 2C2RA 1OSDA 2HHSA 2V8PA 2IM2A 2K7KA 1XJWB 5B0GA 1RAIB 2OTJS 2BKNA 3CIZA 3RAMA 1FI4A 3DC2A 5D3GA 4M95A 3G4SS 3OL9A 2CQIA 5CH7B 4JI4F 2DT9A 1NNDA 2BJ8A 2DYAA 1WG5A 3D28A 1S6QB 4DSFA 3QT5A 4OYBA 1VRTB 4R8UB 1NJIT 4FN5A 1KN6A 2X3GA 4ATNA 2OAUA 1UMJA 1WHXA 1UJ5A 1WELA 3TQEA 4LF2A 1IR2A 2HHHF 3TZYA 3O8WA 1URRA 4A8WA 2J9EA 3UE2A 1HYSB 3K8VA 1OWXA 3Q24A 2HWHA 3T9NA 2XB2D 4ERDA 3K58A 3MEDA 3HVRA 1JJ2R 4U8VA 3SYZA 1AZSB 3OL7A 1RT3B 4X4VA 4C97A 2RT3A 2GC8A 5GADU 3BJYA 1YKWA 4ER8A 2V67A 3I0SB 2JZ5A 4P2MA 3GIRA 1FRXA 4FZVA 2GGPA 2WK4A 1RCXB 1S9GB 4DR6F 4O0IA 4G1QB 4ZA1A 1FHTA 4AXJA 3VHQA 2VQFF 3VAFA 4Q7AA 2B4VA 2ZE2B 5EUHA 3WHIA 4YEAA 3HCXA 3AA8A 3PYGA 4O3QA 2FJAB 4OHWA 3AOBA 1ZBTA 4QR1A 2I2YA 2ZH3A 3BKFA 2RS2A 3BDEA 1UJ6A 1WI8A 4OYZA 1TL5A 4M5JA 1Q82T 1FD2A 1S6PB 1SC3B 1W26A 5HROB 3CJ5A 3KYLA 3FNNA 4B3TF 1RBAA 1XMQF 1E6VB 3Q8VA 5IM0A 2KG1A 2HMIA 4PUOB 1OY9A 1IWGA 3OVSA 4Q45A 5F3ZA 4HHHA 4HLBA 2YVSA 4E2FB 1PIEA 5ETOA 4QR2A 5JVHQ 4UOGA 1KOOA 4TU8A 5HLFA 1IQZA 2F4VJ 4X66F 5GAEU 3T1HF 3RBEA 1WEZA 5F8LA 3J7Z5 4MIAA 4ENOA 4ELVA 4KY3A 2VG5A 4W90B 1HL6A 1J5OB 1D0EA 4PG5A 3G8SA 2Z8QA 1BLUA 5CCMA 4DLGA 1VQKS 1LWCA 3E51A 3ULHA 3NS7B 2W9CB 2ROEA 1VFJA 1TK0A 4F4WA 1L3KA 3CDUA 3L7UA 1XNQF 1UWBB 3SQGA 2V9WA 4CNZA 1ZH5A 4WTYA 5KG0A 3GQCA 1FJ7A 2XWYA 2BMBA 3HSGA 2Y1IA 1Q4RA 1VLYA 3HVTB 3QIDA 4ZMMA 1R31A 5HQ8A 2QA4G 3OR1B 4J7CA 4A8OA 2IVFB 2WVDA 2OPQA 2B7BB 3KK3B 1L3SA 1TFWA 4PPDA 4IO1A 3UNYA 2Y0SD 1L5UA 4QYRA 1RWPB 1ZTTA 3H8YA 4LF4J 1NXIA 3Q0AA 2O3DA 4ZKAA 3EXYA 2GJ2A 3C66A 1SL0A 2LKZA 4HT5A 4IG0B 1CG2A 2BX6A 4Y2IA 1GNKA 3AB4B 4LF8F 4I0WA 5HK4A 2KI2A 2FJWA 3C6TA 4DX7A 2OLWA 3SDEB 1BE4A 2ZOGA 2HZCA 1YJRA 4JUZA 3H2UB 1A0OB 3IWNC 3JYTA 4NA1A 4IOAQ 3IWXA 2CKWA 4ZK7M 4NLWA 5L9XA 1V3RA 3AH6A 1RDRA 3HVAA 1N32F 4C2MA 5D6GA 2PMHA 1JB0C 3PFOA 5M2RA 2YNFA 4DL6A 3X1LB 5LSOA 4MMOA 4B3RF 2KTQA 4K4SA 4CYUA 4DZDA 4WZQA 2HHVA 5DRKA 1OS5A 1WD6A 4IR9A 3LO3A 3DLGB 3AJ2A 2QMUB 4J5OA 1RWKB 2F9DA 5KT7A 3MOJB 5KT6A 1KWMA 5KT5A 4DS5A 2WZ1A 3T5JA 1FD8A 3PJWA 1H6KX 3M1VB 3IA0A 1U6ZA 4NLXA 2R8HA 2CJBA 3UD4P 2ZH5A 3AJ1A 3IS9B 3BKTA 3OLBA 2ZOMA 3DOKA 2LFVA 1RKJA 4FYVB 2AD9A 2CADA 4C8KA 3QFWA 2W2PP 1GX5A 2D1CA 3TEGA 4ELUA 5A2QY 3T41A 3PIOQ 4PR6A 4EK2A 5LJ5Y 4CT9A 3POTB 1ACMB 5LOQA 2Y8WA 1BY9A 4Y0FA 4J9UE 5CYQA 1GQEA 3FQKA 3CE8A 3H59A 2H4WB 1LWXA 1U0SA 4OI2A 1CJVA 1FFWB 4OX9F 3G82B 3HSDA 3HZEA 1R3NA 1U4BA 4M5HA 4RW7B 1JLBB 1LWFB 4URQU 3GYNA 3QGIA 4F4YA 3NBPB 2VFUA 4RNHA 5U47A 2PD1A 1TKTB 2DY9A 2EK6A 4P52A 1JLEB 4XTTA 2U2FA 1S7HA 5DLFA 2VBYA 4JV2A 1ZM4A 5L1IA 5LSLA 2VKZG 3NWRA 2CAJA 1K47A 3ZTPA 2KU7A 3PACA 2VH7A 4I6YA 3W5YA 4LVOP 3KG0A 1S9FA 2XULA 3DLLQ 4OJHA 2BJ3A 3V6KA 3GZ7A 2CPJA 1IKWB 1IBKF 3H5SA 1FRKA 4CLUA 4CIOA 3BH7B 2XO7A 3H25A 3HHLB 2M8DB 4C48A 1X9SA 2B5JB 2FHKA 4PYAA 4RW9B 2UUBJ 2UUCJ 4Q2MA 3G2XA 5HJYA 1U1NA 4NWBA 3MPWA 4XPCA 5I4MA 4K4UA 3QO9B 3UI3A 3KLIB 4UUWA 3SMZA 2NPIA 2VBWA 4GKKF 2J0QD 3K5LA 5A6WA 5C42A 2I5JA 4I68A 5KFVA 1S1WB 2CPZA 5A8WA 3MAAA 2C3MA 3EVOA 4O44A 1NBEB 3RG6A 3QGPA 2C2ZB 4CLFA 4ES3A 3Q8RB 2X51A 3VQSA 4MKAA 1XMBA 1SJRA 2BE2B 1HNIA 4DR4J 3IBCB 2HAFA 4LF7F 3IRXB 2CVIA 4GO5X 2K1RB 3FSIA 4ZLPA 4WKYA 2V8VA 4FYWB 1SIWB 3KLEB 2WOMA 5LXRA 2BA9A 1KTQA 3MMJA 4YHHJ 2ZBQA 2ALYB 1QE1B 4QBUA 1JIHA 3VVUA 2WW8A 5ETLA 1WJ9A 1WDTA 5ETMA 3IWLA 3MFIA 2NXCA 3TAQA 1W2BR 4NE9C 2MSTA 2R7VA 3DGPB 5C25B 1H0HB 3CJKB 4J37A 1UA1A 4DFMA 1VQOS 1N5TA 2Z2YB 1OYDA 3CMAS 3TJAA 2QJ3A 4OYAA 3THPA 2C2KB 2C2EA 2MZQA 2VB6A 2WONB 1U0HB 2P9CA 1HWLA 1QAJA 1N34J 1UW4A 5ITHA 2L48A 1LWEA 2XMUA 4NLYA 2JFKA 2OD4A 3EGNA 4RWWA 4HEA9 4LF9F 3NXZA 4PWDA 2HQDA 2DRDA 4J9VA 1RWWB 5KFOA 4DR2F 2GA7A 4A8SA 4PG4A 1TL3A 4USTA 2G1DA 1WSRA 2VFSA 4ZOSA 3OXGA 3HK2A 5F8GA 1TL7A 1WF2A 4CLYA 1SIZA 2HK3A 2CZ9A 4Y2CA 1RT6B 2FVSA 2DGOA 3BYRA 1T9TA 2GNKA 1XEZA 5AJ3F 3OHAA 2WVBA 4RNMA 2L9WA 3RBXA 3EDQB 3C15A 4DV5F 1RT5A 3L9ZA 1CVJA 2VFTA 4P10A 1S1VA 3MPUB 1ZPWX 2C42A 2ZJRQ 3R3TA 2AIRB 3J81Y 4DQRA 4JI6F 4NOHA 1RU2A 3JSMA 4AUKA 1REVA 3DM2A 3C16A 1HI0P 3A8JA 1BMQB 2C2DA 1GXTA 5T41A 1HWJA 2A3JA 3KJFB 2NZ4A 3H5YA 5I3UB 3CWJA 2Q66A 3IBWA 4I2QB 2HIQA 3I9ZA 3QWPA 4ZVTB 1HI8A 2V4JA 4ED0A 2CQPA 1WKKA 4NCGB 1RAJA 3S1TA 4H54A 5F9NA 1RT4B 1KFDA 1IXKA 3DLKB 2YNIB 2DNRA 1DLOA 5J1EB 1RT7A 5K20B 3DKDA 5C2GA 4LSZB 1NKBA 2HGLA 4CH0S 1FKOB 4W98A 1XC9A 1NDLA 2CDQA 1VQMS 3W2WB 1WOPA 3AQPA 3AHPA 3SZ2A 3TVZA 3FFIA 2P6SA 3VGTA 3D6FB 5HN0A 4ZVRB 2H48B 2JEIA 2FTRA 1JLCA 4B3SJ 5LMUJ 4NL5A 4C0HA 4C6AA 3TO8A 4LRDA 5DDQC 5L1LA 1NK5A 4ZPDA 2OIHA 2YNHA 5E7OB 2QG9B 2MGZB 3RR7A 1L3UA 4P74A 4DDFA 1SL1A 4CRJA 1UFLA 2FY8A 3SCJE 5CD4A 3UD5A 1JXEA 2AMCB 2EG1A 1X8DA 1GAOA 2VF3A 3P4UB 3BO2A 2HRYA 3UVJA 3N01A 3K8WA 1HQUB 4ZCKA 2N82B 3KHHA 3MR2A 4Q8FA 4X4OA 2HS3A 1WNEA 5K8PA 1Y5IB 5A2QU 1G6BA 3OVAA 1HQEB 2RU9A 4JI3J 1H2TZ 4RBVA 3TOQA 2W7PA 1T03B 3GV5B 4I67A 5G0RB 1ZPVA 1MW7A 3KLFA 2L9DA 4ALZA 2CQHA 4L75A 3MAHA 2QT7A 3BN7A 1HNWJ 3CJTA 4IFVA 1VIOA 3CCMS 4DL5A 4EI2A 4CCHA 5ETSA 4NLUA 2CFXA 2U1AA 4D3HA 4ID5A 3TZZA 2R9LA 2VPXB 4ETZA 3GG1A 2H5JB 1ZA2B 2ATCB 3SIPB 2V5HG 1RU1A 1JXLA 4B9VA 4V1Ak 4ZLJA 2K7JA 1EETA 4ED8A 3LP1A 2MKKA 5D15A 1XK8A 2IIHA 2DNQA 2XZDB 3SCKE 3RRKA 2DXEA 4DCOB 1UEVA 2LDYA 2XNRA 4KTQA 2ZJQQ 3PXGa 3GLJA 3IN5A 1RCOB 1R6VA 2MKSA 1TFYA 3IR5B 1MROB 1P6TA 4YQWA 2E9TA 1R89A 3D7SB 2XCAA 2L08A 1NJXA 1HIYA 3OTBA 3NCQA 2HAIA 4TY8A 2BW7A 1OQ6A 5HVHA 2J6TA 4PZVA 4BWJA 3TA2A 4CTAA 4DR5F 3ZZ0A 3K5OA 2E1RA 4WKRA 1OY6A 1JK9B 1TTHB 4XK8C 2ASYA 4F4ZA 1KD1T 3HT0A 3O3LA 2CJYB 4DUYJ 3W9HA 2XSFA 2JEFA 4R5PB 3E01A 1IR0A 1R8CA 4C9DA 3LGHA 3NOCA 3KJVA 2HRTA 3QMQA 2H4YB 2CNNB 2ZM6J 1JLQB 4JI2F 2LU2A 2Q79A 5D4LA 4A8MP 1OYEA 3TEHB 4DUTA 2F4FA 2UXDJ 4LSLB 4WCEQ 3GB0A 2RQ4A 2DNOA 5L38A 4UQTA 4QW8A 4CO5A 4F4AA 5GAGI 3LGMA 4ED4A 1AUSL 2BXJA 5BR8J 5KT4A 4LFCJ 1CS4A 2E7VA 5KG1A 4I2PB 2JLEA 2LECA 2O67A 4F0HA 2QGFB 3GWCA 1HNVB 4P71A 3CEDA 4N56A 2AQ4A 3W1YC 1JXVA 1F3FA 3FMBA 4WWSA 1X4GA 3MPDA 2V2QA 1E6YA 4XAKA 2XY6A 3GR0A 1UVKA 1Q16B 4QPTA 4HVZA 1DTTA 5L46A 4KC5A 1ZAVA 2ZUAA 2BJ9A 2HYIB 3VAJA 1JLFA 1HHTP 4W4MA 2E7XA 4RW8B 3QSIA 2YKNB 4HDHA 3EICA 5SUHA 1CBKA 3M7VA 2XZWA 4ECRA 1SKWA 2VDIA 2V50A 3DMJB 2PMWA 3VV2B 3EX7B 3PW0A 3CW2C 3M8QA 4CH1A 2IM3A 2ASJA 4IG3A 2ZITA 2B4OA 3IBFB 4YB5A 2N4DA 3HHDA 4DR1J 1YHQS 4LRCA 2O1PA 1J27A 4ES2A 1LOUA 4KE5A 4NYOA 1FNXH 2OSQA 3I5AA 3W7BA 2YH1A 1FJGF 3NKYA 1FK9B 5HP1B 2HHPA 4TQRA 2ZH7A 5KFYA 3MM6A 5CHCB 3MAQA 1YJNS 3J81U 2CJXB 2HNZA 4DV6F 3W8PA 3BGOP 4X4PA 3QIPB 2OMOA 3MEGA 3OR2B 1NSPA 4C7QA 3K5MA 3S7RA 4HYKA 4A4JA 1V5VA 1SV5A 4ZITA 5KFJA 4DG1A 5D3GB 3HD1A 1Q5YA 4KKOA 3WX4A 1PJ5A 1HBNB 3T1YJ 1KDNA 2AKWB 3CJ3A 2IA6A 1QVFR 1PBUA 1KFSA 4KB7A 1RK8A 2W01A 5MLCV 4LF5J 5EGYA 3R7BB 1B4SA 3CIMA 2BBEA 3MEEB 1NK9A 2J6SA 1YZ7A 1RTZA 3D5MA 2LQ9A 5KG2A 2HBRB 3UCGA 3E2EA 1GFWB 4F8RA 2RE1A 2QL7B 2IVYA 2MLZA 1VK3A 2YKMB 4IUFA 3LAKA 1FESA 2DPJA 2XYGB 3HHEA 1C1CB 2GVZA 5H9FJ 5CAAA 1T9XA 5ETRA 2FZKB 4AXIA 1VRTA 4R8UA 3H4DA 1Q78A 2GGPB 4EBEA 1NKEA 2FJXA 3BPSP 4JI5J 3MD3A 2WSCC 5EN1A 2UXBF 1F5CA 1PYTA 2VBZA 1SQGA 2MQOA 3T3FA 1N4LA 1X4HA 2HNDA 4KHPJ 2HQFA 4B17A 1P9QC 1LEOA 2VQEF 4KGKA 1HYSA 3AAWB 3LQVA 4OV1A 4NXNF 1HARA 2Z57B 2E7WA 2MPUA 2GIFA 3OL6A 4XO0A 2BKOA 3L7PA 5D8HB 1MNEA 3ETOA 3ZZOA 1IUJA 2PEHA 3D1QA 5KFLA 1RT3A 1X0FA 1CSJA 2FJDB 1HPZB 2Z2LA 3DCAA 2IFXA 2GJFA 3I0SA 2ZH1A 4FF4A 2MDAA 1XNRF 4M1KA 5J2PB 4OX7A 1U6FA 5LXYA 1S9GA 3A8KA 1PG5B 5IM0B 2OMLA 1WG4A 3MZIA 4G1QA 5LSRA 2WAQD 1IWAA 2V4RA 2OJ3A 3W9IA 4R0JA 3CDBA 1I94F 1ROFA 4KBIA 2DHHA 1VQNS 3CCTA 4DUZF 3VZHA 3R1HA 5HLFB 1ZETA 3QYYA 2R7TA 2KH9A 3RU0A 1I1GA 3Q89A 4X62F 3ZXWA 1S6PA 1YVFA 2M0GB 4NLOA 2VPYB 1NH7A 1C2PA 3O2IA 1E6VA 1RAOA 4IQXA 4KO0A 2ZH2A 4PUOA 3B4DA 1JQGA 1Q79A 3BGUA 2UU9J 2KT3A 3ZZUA 3CVKA 3SQGB 4GC7A 1CEZA 2HQ3A 3KMQA 3GFHA 4NLDA 1U1RA 4USWA 4PXDA 1UFKA 2B0GA 3OQ2A 4OJ3A 5C2CA 3WIUA 2EVZA 1YBAA 1JJHA 3FBBA 3DXBA 5F41A 2CUYA 4C98A 1J5OA 3NGUA 2OPQB 2PGCA 2CPXA 1OPIA 5GAHI 1R8BA 3IR7B 4RPFA 2AWZA 2W9CA 3ZO7A 3MM9B 2G2YA 4J9KA 1XMOF 3RJMB 1UWBA 2DGQA 1LFPA 5AT1B 1FKAF 3ISNC 4PAAA 3L3CA 4EO8A 3HVTA 1MWZA 1M1HA 2BRLA 4PCQA 3OR1A 2HK2A 2FZGB 8AT1B 4DEZA 1GMUA 4QYZJ 4UOHA 1S79A 4TLQA 2OEKA 2R3VA 2QE5A 3OV7A 3KUGA 4RUAA 3KK3A 3ENQA 1NK7A 1BQXA 4CO4A 4OJGA 3M32B 2YNFB 2HVDA 5AXNA 2AF6A 2KHDA 1EJ7L 4JOUA 3H2LA 1M1KT 4Y28C 1EB0A 4WFBQ 4DV7F 2UVRA 3VAGA 1EKRA 1J2VA 4MIWA 1BC6A 5MAOA 2DR6A 2YX1A 2JC1A 3LWLA 1FJEB 3R27A 4Z2XA 4JI7J 5DETA 3ILIA 2K3IA 3PDNA 4DFJA 2F5GA 1O5JA 4ECXA 1IBMJ 2H5EA 4NZ0A 2HFOA 2HFUA 4DQSA 3D3CJ 1FT8A 1J5EJ 1AT1B 2DNZA 3UR0A 4K8RA 1WC3A 2RJZA 4OL8A 3KNGA 4LR9A 4JI0J 4B3MF 4X64F 3AJDA 3DOKB 3FBFA 1S4FA 3V5RA 3OFFA 3CC2S 3FEXB 2V0NA 2Z0GA 4C8YA 1R8AA 1LK7A 3WC0A 4C3LA 4K4XA 1B64A 1NB2A 5BYSA 2GCFA 4YOEA 3DLGA 4DQPA 2GO9A 1HR0J 5B0FA 3KUEA 1AXQA 1SB6A 5M2PA 4ZP9A 5J1NA 1DJ0A 5EWEA 3HHLC 3PM9A 1XBWA 3TVKA 3M2VA 3D0GE 1ZTWA 3IS9A 2FHOB 4HI1A 4NZ6A 3OUYB 1IKXA 2QL9B 3FSXA 2DRAA 3FRYA 2DH7A 2LQ8A 4BS2A 2HPUA 4I69A 1LKZA 2BUNA 3QJJA 3HHLD 2XBPA 4L3NA 5KFDA 1NDKA 1ZOTA 4WTOB 5E3CA 1DBDA 3G82A 2W7AA 4ED1A 1IKYA 4RJVA 1R43A 2ADBA 3QPIA 2X1AA 2EWHA 1JLBA 2RQMA 3NBPA 2MLYA 2IDEA 4LQ3A 4EO6A 4QQBA 3BF4A 2ZBIA 4QIGA 4P7VA 5C42B 3VGUA 2FC9A 2RAQA 4A46A 1VYAA 2VOPA 3LPYA 3WZ0A 4ZVQB 4OV6A 4J9QA 1KLMA 4HACB 3CUNA 1FWKA 5ADZA 1XERA 2KRRA 3D0IE 3TARA 3DI6A 2D41A 2DXDA 2V9KA 3J81j 3TUIC 4O4GB 3BM7A 2CNLB 4RWXA 2CQ1A 3MM8B 2BRKA 1NZ8A 4FNHA 3HHLA 5KFQA 2B5JA 4RW9A 3J7AN 2FQQB 1N5QA 2RSQA 1U1OA 3FDSA 5F0WA 3KLIA 5J2MA 3PRDA 3VQTA 5FDLA 3HM9A 1RAGB 2QZ8A 1SJ1A 4AQYF 2MZSA 1QUVA 2PC6A 2GMJA 2EW9A 1YRXA 1T8EA 4LJMA 2B9YA 1EQ0A 1UVIA 2GQCA 3UDCA 1NHKL 3TYTA 3WBZA 2G2OA 2YKOA 2QC3A 5L39A 3IRXA 5DO2A 2C1EB 5HQMA 1TELA 1K0VA 3QGGA 5H1SV 2R8IA 1R6YA 4U7CA 4AL5A 3NS5A 4FXVA 1H38A 4CT8A 4BDPA 3DU5A 1QE1A 2C2NA 4Y34A 3ITHB 2G13A 3TUPA 1N36J 4CH7A 2CQCA 4P6QA 2DEJA 3DGPA 4DFKA 5B0EA 1S1UA 3TX8A 1NKCA 2B8PA 1S12A 2HBYB 1YJTA 3B82A 1Z4UA 1PGZA 5GAHU 2AJ2A 5E3AA 2D69A 4FYXB 4DU7A 1MU2B 2HWTA 2WONA 3BH6B 1U0HA 4ZJOA 2EEYA 5AE1A 1VBKA 3IR6B 2DTJA 3R5JB 2W2QP 2C3OA 4WU3A 1R0CB 3RW6A 2E66A 3PG9A 4C11A 2DBBA 3AFGA 1XWLA 2VZ9A 4ILLA 4UOFA 4A8YA 4RL1A 1S48A 1RT5B 4FYDA 2W9AA 2GZOA 2MXYA 3DXSX 1S1VB 4DFPA 4U67Q 4L6V3 3LTOA 1M5OC 1Q8IA 2VL1A 3JSMB 4PXCA 1RXOB 3C16B 1XIQA 1YIJS 3KFWX 4DN9A 2Z56B 4ED3A 4NMLA 1S6OA 1MWYA 1S1TA 2YBVA 2B56A 3MGJA 4OZJA 1DQ9A 4ZVEA 1D8ZA 5KFSA 1JLAA 4RZRA 1RT6A 4EBDA 4ED5A 2ABYA 2E1PA 1X4BA 1SC4B 3TP2A 4LRFA 1HHSA 1KLNA 1UL3A 1L3TA 1DLOB 2F8EX 4HHJA 3B4MA 3EMTA 3NMRA 3A3OB 5IQ6A 4OFZA 4DMZA 2HFVA 3M9OB 2W4DA 4M5NA 3GFYA 4LRBA 4Y3CA 3M2UB 2AV5A 3FFIB 1EHWA 2LYVA 5K8MA 4MTPA 5I3UA 3ILJA 1VC0A 4O3OA 3GILA 4WFYA 1SH0A 4OI3A 3JQMA 4NCGA 5B09A 5L8RC 1VQ8S 3DLEA 4IRKA 4YB1P 4UY8T 5HBMB 3R6LB 1RT4A 3VWSA 2IAJB 2ZHBA 1AFJA 4FBTA 3AOCA 3C14B 2XYHB 3CCJS 3RBDA 1WC5A 1F9HA 3AD8C 1YSJA 1NO8A 2EC0A 3NOGA 2VICA 1WF0A 2E29A 1U26A 4I7FA 1FKOA 3TA1A 4ES1A 3BSAA 1ZA1B 4MKBA 3NCPA 3M8YA 2R8GA 2F4VF 4ECVA 1X5OA 3Q8UA 7AT1B 2B4UA 3N5FA 3MMBB 3EPGA 4X65J 4R0EA 3KWMA 1VBXA 1U6BA 4NCAA 2XI2A 2EFVA 3G6ES 4LFAJ 3I56S 3TJ9A 1WTFA 2NXEA 3RZAA 8RUCA 1VHIA 4DV1J 4DS4A 4MYTA 3KHLA 4O3RA 1S1XA 3PW5A 1NDPA 2ZHOA 3CD0A 4IFVB 3VAMA 1IN0A 3W60A 4P2XA 5LMNJ 2HS0A 1GMWD 2FIUA 3C8YA 1GXLA 4ID5B 1UVLA 5KG5A 2BR0A 2M7SA 4USHA 2AYBA 1S9EA 1A7GE 3F56A 2F63A 3KNAA 1HQUA 4Q0BB 3B6BA 2BQ3A 2CVEA 4FKXA 2I38A 5GADI 4FBUA 4TYAA 2RHSB 1HQEA 4ECWA 3TA0A 4X84A 3JTNA 3BQ1A 2PEBA 3SV3A 5J2QA 2MJUA 3HJFA 4LF4F 1RYSA 5G0RA 2BQRA 5IT4A 2FLOA 4TU9A 1VBYA 5L1JA 4N41A 5KFEA 3JSYA 3M6VA 1G1XA 2ILYA 4IR1A 3L4BC 2QO3A 4J91A 3LANA 1SH2A 3HJVA 2WTFA 1GH8A 3MTKA 3CTRA 3CMQA 2KFZA 1Y3KA 2QX0A 3HFVA 4ILRA 1WC6A 4X4SA 4ED7A 2YNGB 4F3QA 2WVCA 5DGBA 1FDDA 1GMWA 4OIXA 5CYJA 1QLNA 4K2XA 2DNLA 2AX0A 1HMVA 1B0PA 1FXRA 1QM9A 1X0PA 4E98A 3HDSA 3KJVB 3GV7B 4WBFA 2WB1D 4CI0B 4RBUA 5J2NA 3JAMY 4RW4A 1QD1A 2LXFA 2RS8A 2FVPA 2V63A 1CJTB 3U02A 1MG7A 4IKAA 1AROP 2YQ1A 3NP5A 3MR5A 4DL3A 3Q86A 5DGAA 4KT0C 1YJUA 2YWHA 1JJ4A 2HVEA 2X3DA 4OYMA 1CS4B 3N79A 3W5ZA 1GEHA 2VG6B 5AE2A 5GAEI 5B0BA 2OKQA 4F0KA 3FVYA 3MMAA 2BACA 2IRXA 2K2PA 3BB5A 3QLHA 4R5PA 3M8RA 4Y2MA 3CCUS 4C8MA 4CWBA 2GQQA 4EFAC 4WE1A 2DNKA 4DXLA 1H98A 1MMNA 1JLQA 1U2RA 4Y00A 5H9EK 1RBLA 1RAHB 2VDHA 1N8RT 1Q53A 2C3YA 1REGX 4CQ1A 2KXFA 2CZ4A 5IOLA 4GVLA 4USKA 1JLFB 4GRSA 3OTCA 2DGSA 2IM0A 2FJBB 3BSCA 1NSAA 3EE3A 3MR6A 4KJIA 4ZVFA 3C2PA 4MH8A 2XSJB 1FRHA 2LEPA 1HLWA 4DR7J 4OI6A 1X5TA 4IH5A 3T6BA 3Q2SC 1PAEX 4IG3B 1KKHA 1LW0A 2H51B 5E33A 4C8OA 3VCDA 2QSWA 4FF3A 3CCQS 2MYFA 2KXHA 2AGOA 3W63A 1IM4A 3LWMA 4KFBA 5K8OA 3TX0A 4NXMJ 2QEXS 5KFRA 1FA0A 2K06A 3I87A 2RRNA 3M8WA 1UP1A 3MM6B 2M88A 4U8YA 2IYIA 4BC9A 2UUBF 3ENWA 2UUCF 2HNZB 4OJ1A 4B9SA 4R25A 2LA6A 2Y0BB 5FLXY 4X2BA 5KAKA 4DV2J 3MEGB 3BREA 1F2GA 1PSDA 1TL1B 3NMAA 2J9CA 2Z2ZA 2OFGX 1B0VA 2JFDA 4K2JA 3G6YA 4WFNQ 4KKOB 1WDDA 2EC2A 4B9NA 4O3NA 4HHUA 4RBTA 2CQGA 4N8OA 1B7FA 3KK1B 4XPEA 2ZNZA 2R7RA 1FK9A 5HP1A 1WHVA 3SSSA 1M5HA 2EFGA 4KHMA 4DR4F 4RO0A 2AP6A 2F1FA 1NK6A 4NASA 4ZCLA 7FDRA 2XTJP 4RNOA 4WP3A 4K5RA 2HHWA 3QIPA 5DQIA 4YHHF 2JLGA 3OR2A 1NU4A 3CJRA 2RQCA 2UXCJ 2I6WA 2ASLA 6FD1A 4C8ZA 3GE9A 1KRPA 2M2BA 1L3VA 3C6UB 1VDHA 1HBNA 4ZN1A 2OFHX 3OVBA 2EFPA 1RUSA 3BYPA 2GVZB 1FX4A 1JNRB 3PJXA 2QMXA 4WZMA 3U1LA 2KB2A 5D0EA 4ZPTR 3V81B 1SJFA 1Y00A 1N34F 4W92B 1IBCB 2HNDB 3MEEA 1KNZA 4ECSA 2X1GA 3R5DA 1DZ5A 3D67A 2R7OA 1RT1B 2FHJD 3ILOA 4Q8EA 3GJSB 3BV8A 2YPZA 4B9LA 2JH3A 3KKFA 3EZUA 4DCJB 2M9KA 1BD6A 3ZFVA 4IOBA 3D1OA 2YKMA 2DHSA 4DV0J 2R2TA 1NK4A 1C1CA 4ZJQA 2HQCA 2CJAA 2G0JA 1ZM2A 3CDEA 3PR5B 1FDBA 2E5GA 1PCAA 3P5TL 2W25A 2B9EA 1KTVA 2W1BA 1NPPA 1JKHB 2GX8A 1C4CA 4IRDA 3EVWA 4FPIA 3CMES 2E5IA 4QU6A 4OLPA 1X4CA 3IFEA 4F50A 4L74A 2ZH9A 4J9SA 1YJ9S 2JDJA 3QJPA 1RAFB 3VGSA 4QR0A 3EWGA 2HQGA 2AJ1A 1HPZA 4ZPAA 2FHJA 3JQKA 4K4WA 5I42A 2DR7A 2B3TB 3MOZA 4X4RA 3HI9A 1S0VA 2DGWA 1IBLJ 5J2PA 4OX8A 1EAYC 3N4WA 2YX4A 4OZNA 4KPCA 4KO0B 5AXMA 1U8WA 3NGKA 2VJVA 4ECQA 1FCAA 3ISZA 1QAYA 2XLKA 2NXUA 4QWCA 2DVIA 1CJKA 2B4PA 2XMTA 3AA9A 3CC4S 3HVWA 4WXWA 2V6AA 4M5MA 4KH1B 2YWFA 2ALZA 2XMMA 2BANA 2CQ3A 1TUWA 4NLVA 1Q86T 1NSQA 3JQJA 3EJMA 1XR7A 3UR3C 1GXUA 2LXIA 4GMKA 2MHNA 3G71S 1RGVA 1KOHA 4G6VB 3IG1B 3AXMA 1PBAA 1BWVA 3MURP 3MEKA 2F40A 2RKIB 4F02A 3IRWP 3JAMU 4DPYA 4NLQA 1NEEA 4HDGA 4B3SF 5LMUF 3W2VA 3D6MB 4PG7A 4H4KC 2HVHA 3KLHB 2BKPA 3CULA 2UUAJ 1T95A 3FZBA 3BS9A 1VQ6S 5F8HA 1S5ZA 2RDDA 3CCES 4OQJA 3IP0A 3BO4A 4L73A 2IJFA 4CDIA 2AHOB 2XM3A 2DRBA 5KFMA 4TN2A 1QDUB 1CQNA 3CJSA 4EZ9A 1OY8A 4ANDA 3GJTB 3I96A 4P7TA 4DN0A 2HVZA 1KQFB 1EZZB 1VIXA 2E44A 3JTPA 1LXJA 4JI3F 3MM9A 4YY3J 4ZPWR 4JYAJ 3CDAA 3QQCD 1UA0A 1DARA 2C28A 1VCTA 1RAAB 1YITS 2XGQA 2UUTA 2CNKB 1F1BB 1YTYA 4D3GA 2ZZMA 4JP8A 1F0XA 4I1TA 4DL7A 1M90T 3EGZA 2NZCA 3PW4A 3TQ1A 1F9EB 1FO1A 2EK1A 4GC6A 3LPEA 1HNWF 1QAIA 3KG4A 1VC5A 2J0XA 1KSPA 4ZP8A 5DLGA 5KFNA 3H42A 3HLUA 2APOA 3BGFA 3DRRB 1X5SA 2E5LJ 3PTWA 2ZH8A 1Y5LB 3CJ4A 1U02A 1RA7A 3H5XA 3I55S 4KPYA 3FC9A 5KG3A 4TYBA 1KHVA 4C3KA 4L3KA 4EUVA 1T02A 3M32A 2NYIA 3GYGA 4H4KA 3CGIA 3NS6A 5KT3A 4F4KA 3T19A 5KOWA 3SQOP 4IRCA 2ZBRA 2A6MA 4FXDA 4DQQA 3BN4A 2C2MB 2UVWA 4O4RA 3BPDA 1TVRA 5IFMA 4XDCA 4PG8A 1K44A 2FPHX 2MHEA 2V94A 3M2VB 5FLXU 3G96A 1U8SA 3P45B 3W66A 4JI8J 1RYRA 1NK8A 2QLBB 1UPMB 3OTOJ 3UN5A 4CO2A 4DPXA 4JBCA 4J9LA 3HO1A 1IKXB 2FC8A 2OPPA 4FPRA 4DSJA 4DUYF 4NXNJ 4J9RA 5KFGA 5CYMA 1WSVA 2ZM6F 1SJ3P 1KQKA 2WSEC 1UPPA 2UXDF 2YKPA 4G1PA 1SPBP 2IC3A 3T9ZA 4USVA 4CLPA 1HWKA 1JX4A 2FLNA 1NPRA 1IKYB 4HT7A 5BR8F 2ROPA 3RW7A 3HZGA 5GMKa 2D9OA 3D2WA 1VJQA 1RHKB 4QWEA 1VQ7S 3OUYA 2MQPA 3W61A 4TU7A 3OBIA 3HF5A 4WYLA 1S72S 4C4WA 1LW2A 3P3DA 4CLKA 1KLMB 2Q3PA 3DOLA 3F41A 2CPIA 2OD6A 1ZM3A 3DI6B 3PVXA 2KL8A 1AB8A 3M8SA 5A8KA 3JB9k 2UZAA 2MKJA 4MYUA 4KH0B 2NXJA 3R97A 3DYAB 5B0CA 2VODA 2FB0A 3L09A 3QAUA 4KRWA 4LUBA 1UVNA 2B6AB 5LL6d 2XC9A 5A8RA 1TMJA 1AW0A 2CQDA 5J2MB 3GFZA 2IMOA 3TANA 3AD7C 2HFZA 3JSBA 3PHEA 2VU5A 5FDLB 5CABA 1URNA 4ETXA 4ZS6A 2J9DE 2MKHA 4KGZB 2ROGA 4GVBB 4PWWA 4HACA 1Q1KA 3A12A 3BO3A 3KOAA 2CXEA 3SXLA 4EU0A 4DR1F 1YI2S 3RYLA 3UDVA 4O4GA 2VUGA 3CF5Q 3E8OA 4TY9A 3MM8A 1RHUB 2H65B 1JJCB 4HKQA 1FRJA 3RB3A 4ZJLA 2PSZA 1T9UA 1G3OA 4TKTA 4YDDB 4ECUA 2HBQB 3AXKA 2XO6A 1UW9A 2OTLS 1YQHA 2CQ2A 1DQAA 4BCAA 4DR3J 1S1UB 1MLAA 1TL4A 3L95X 1FDNA 2E9ZA 1PC4A 3FBEA 1FRIA 3I4HX 3PX4A 3HFZB 1APSA 2Z58B 3RAQA 3DRYA 2BYCA 3T1YF 3ETMA 2MQQA 1D9AA 1WC4A 4OZ1A 1HW9A 4EWTA 4C11B 4JV1A 2XMWA 3QGHA 5HL7Q 4OX6A 2XY5A 4ELTA 2HHTA 4K59A 3RGIA 3VALA 4LF5F 1QTNB 1K8AT 1HBMB 3I0RB 1YGYA 2R2UA 3J7YI 3JTOA 2RHQB 2GW8A 3ITHA 4ANCA 5HO4A 3TZXA 4DV7J 3I32A 1AUDA 4RUBA 1RT2A 5HATA 1NK0A 3DRSB 1M0SA 3SV4A 4FF2A 4K50A 2EG2A 3CD7A 1HW8A 3WC2A 1NMEB 4NLGA 1S1TB 4MK9A 2PFDA 4M5DB 1MU2A 2JSXA 1U7LA 3OSNA 4B08A 1LQ9A 4H4OA 1GTHA 2RRBA 3PY8A 1JLAB 1FNOA 2HGNA 3JS9A 1EQMA 4OYOA 3OT9A 2QYCA 2AU0A 4OYIA 3TI0A 3MM5B 3QT8A 5E3QA 4JI5F 5KFUA 3Q8PB 3W65A 4KHPF 2AJFE 3PEHA 3D66A 3UPFA 2KN4A 4JV5J 2F7VA 1WORA 2FDNA 1IR1A 2A2CA 3LUYA 3Q2TC 3M6XA 1Q7YT 3K5PA 1RTHB 4IQMA 4O3SA 1N5VA 2ZKTA 3D1HA 3RRGA 5JMNA 2E9RX 3VAKA 2A2DA 1FFSB 2V2KA 2L9NA 2GHPA 1T3NA 2HSEB 1VR6A 2J8AA 2PT0A 5CCLA 2Z30B 5SZTA 4NMXA 2H5IB 3DLEB 3FJ2A 2AT1B 2CZVC 1B0TA 3G86A 1FRMA 2LQBA 4NRUA 1QUPA 3CCLS 3IO1A 1NUEA 4YN3B 2J0SD 1UZDA 5IWAJ 2P8IA 1T05B 4I7FB 2AX1A 2F8HA 3UN2A 4PXEA 4IFYB 1SC1B 4NPOA 3CJ8A 3ZTQA 3EUNA 5T7LB 5HMWA 2YWEA 2MQLA 1WF1A 1RHMB 1VS3A 1N33J 2OEJA 3M2UA 4WYWA 2YY3A 3UN3A 1HNXJ 2MZ1A 4LFBJ 1Y4ZB 1KR4A 1SUQB 3CCRS 3EM1A 4C0BA 1TR0A 2ZUGA 2LU1A 4ID8A 5HBMA 2GMHA 1QJHA 2ZBPA 3D0HE 2DXFA 2IAJA 2R2SA 1SVDA 1TZ0A 1S1XB 3C14A 5HI7A 2UU9F 5RUBA 2ZJPQ 3SBMA 1ZAWA 2LEAA 4X4NA 3ET6A 2I0XA 5D4PA 1TK8A 2QIFA 4HTJA 1RQ0A 2H54B 5EDWA 1VRUB 4DPWA 1TKXA 1S9EB 3A3NB 2QV6A 1N56A 1FVSA 3LGNA 2IPOB 1N0VC 4ZVPB 2HGMA 1H72C 1M5VC 3MMBA 2KM8C 3FCWA 2M8HA 5DDPC 4RUCA 2N3LA 5L9NA 1VRQC 1S7IA 4E0DA 4WU2A 4AE5A 3OXLA 5LT5A 2E5JA 1T9VA 4YP3A 4DF8A 5J2QB 4ED2A 2CPFA 3IAM9 2NSCA 1AA1B 2ZH4A 4UY85 3OW2R 2ADCA 2ZWPA 1PYOB 3EGVA 2CRLA 4YR3A 4NYZA 4PYDA 2W24A 2DITA 4ZP6A 4Z37A 1OJ4A 2O01C 3H40A 4IDKA 1TKZB 1YJ7A 2W2OP 2ZVSA 1IQTA 3T6JA 3V6JA 1Z2LA 1UJ4A 4UQGA 1NSKL 2ACMA 2FHMA 3FSYA 2OEMA 1H2VZ 3B8HA 4Q0BA 4Q5VA 1G4CA 2EFOA 4M5KA 5ETPA 4TLRA 2DNNA 3GPAA 4OHYA 2EXUA 1D9DA 2B9WA 2GVDB 1AYEA 1K1QA 1NCLA 1HMVB 3FEZA 5IC6B 3FQLA 4ZPCA 1NJWA 2RF2B 5GMDA 1HBUB 2KVQE 5GVQA 5J2NB 2A0FB 3Q8QB 1A9NB 3SSRA 4RW4B 1WI6A 1BQNB 2QSFA 3U27A 2AYMA 2IY5B 4PG6A 1YDLA 5BYQA 3LH2S 5IS2A 3M6WA 3MCOA 1C0UB 4EZ6A 1YLXA 4ZDNA 3R5BA 2RMLA 4JI7F 2J8SA 4KR0B 3DDIA 1JMTA 3K7RA 1IVZA 1RSCA 2NXNA 3GSIA 2YNGA 1RA6A 1IBMF 4HL9A 1SJQA 2J6UA 1J5EF 3MMAB 2UVVA 2J7WA 2QLXA 3V4IB 5KFPA 3QLHB 3G6XA 4QIVA 4JI0F 1OSCA 1W2IA 2CJKA 1FE0A 3UW1A 4IH7A 3HX9A 4WE1B 5E2QA 1VBZA 1ITPA 1ZAXA 3M2RB 1CJTA 2XHCA 5FD1A 4DHVA 2NS1B 2RB7A 1X5PA 2XS5A 1FVQA 1HR0F 3MCMA 4K4VA 4ECYA 1GK8A 3CCVS 4F26A 2VG6A 3J7YU 3EXCX 3GIMA 3LP0B 4BBYA 3QAEA 3CO9A 4J9MA 1FRLA 2WRMA 2LXUA 3M05A 4A8XA 3BEGB 3BSNA 1WKJA 1BWEA 2LP4A 1SH3A 1T3OA 1LW0B 4MKVA 3NAHA 4CP5A 1XQIA 2OI2A 3J80Y 2B9XA 2YWWA 3H90A 2R7SA 4KFBB 2NUHA 4ED6A 5DDOC 2UV8G 3K59A 4IYQA 1N6QA 1Z1ZA 3TWZA 3GTYX 3KHGA 4KAIA 3CJQA 2AGPA 1X31C 2GIQA 2WBMA 2JVOA 3V6DA 3B78A 3MCSA 4M63A 3BGRA 1S0OA 2XSJA 5F3TA 4RKUC 2GHWA 1NHVA 2HHXA 1N5SA 4X4UA 2DNGA 3BKUA 4J9PA 2XEXA 4FYYB 1H3DA 5H9FK 3QBCA 2FYXA 3NGDA 4OZ3A 2KT2A 1XTZA 2V8HA 4PPZA 4F7VA 2IMWP 4JI1J 4I64A 1FXLA 3N9UC 3PYFA 2QL5B 5HJXA 4Z7YA 4KGXB 3MMCA 2VASA 1DFDA 3DU6A 2DNYA 5IT0A 3F0NA 5K5MA 3OXFA 1N52B 3M4XA 3M9NB 2CPHA 2OPSB 5IQQA 3NG8A 1R8HA 1OO0B 4LF6J 1TL1A 4DQIA 3MR7A 2AEFA 3L7OA 3ZZPA 2IBKA 1MWQA 3IC1A 1CULB 3LOUA 3PFEA 3PX6A 4C3MA 3M9MB 1KHWA 2QRRA 1FKPB 3KK1A 1TK5A 1FTRA 4KSEB 1VGYA 2BV3A 5A0YA 2XG8A 2KT5A 2JEJA 4LT6A 4K4ZA 1ZYQA 1U49A 1W7WA 3PZPA 4L76A 3HP6A 1Y3JA 4DSKA 3EZOA 4MK7A 4H4MB 2ZDPA 3NNAA 4K0KJ 4OYXA 4YB7A 5DQGA 1N36F 3LALA 4DL0C 4AT1B 3ZZRA 2M4MA 2CG4A 4PXBA 3DHWC 2BE7D 3C6UA 5K8NA 1UFWA 2HNYB 4MK8A 4ECTA 4LIRA 3CC7S 1UVJA 4B9MA 1CLFA 2RIJA 4WIQA 1U2FA 3FRZA 1YRUA 1B99A 1WACA 4EBCA 3V81A 1JLGA 2OGUA 4ZPVR 1VJWA 3TAMB 1Q7LB 2ZFHA 3GFXA 4I4BA 4BC7A 3P8BB 1RT1A 2HS4A 3ILLA 5FIIA 1YG0A 2VPWB 1FERA 4CLZA 2GFFA 2KYZA 3R7NB 1ICEB 2OPRB 1IJEB 5DS7A 3AT1B 1YWXA 5CXTA 3ZZTA 2BZ2A 2CWKA 4NI2A 5I42B 1M5SA 1UEKA 2RH3A 2ZH6A 2V4QA 4A8FA 3GYXB 2HEKA 1U1PA 3P96A 1RP5A 1HFEL 4BWMA 3MUTP 1JKHA 2J9DA 4F0MA 4GKJJ 2VG7B 4N8NA 3I31A 2YPYA 1VC6A 1RHQB 5I3PA 2MKYA 3BQ0A 4DF4A 3TR5A 1UEUA 4WP8A 1CJKB 1LNQA 5K9FA 5D0RA 2KXNB 2BVZA 4KV8B 4PRFA 3ONQA 3UCZP 2BANB 3ZZYA 4QYZK 3I4PA 3HKZD 4FKYA 4PQUB 3CT9A 1BUXA 3DFEA 4DSEA 3MUMP 1R0BG 3C19A 4FVMA 3O44A 1CJUB 1VQSA 3PR4A 2Q6CA 2BOAA 2VD3A 2KKHA 5B7WA 1LV5A 3PW2A 2DGXA 4F04B 1C1BB 3THVA 4OZLA 2W2NP 3D6TB 3R6GB 4UT4A 2N7CA 3V2UC 1U25A 3C46A 3W2VB 2OUGA 3VAIA 4I6WA 4DV3J 4O23A 1U1MA 1QSYA 2JRSA 4J9NA 2J5AA 2E1MC 4HI2A 1F3VA 5KG6A 4A8QA 3K57A 1DTQA 2QA1A 2CYYA 2JX2A 4EYIB 2ZC4A 2D3O1 4NA3A 2RDIA 1ZS6A 4B9UA 4U95A 3IG1A 1HWIA 2BE9B 4WK1A 1SI9A 4UUXA 5JVGQ 2X1FA 4U7UK 4LR8A 2RKIA 2HLTA 2IVMA 1YJVA 2D7SA 3M30A 4X65F 2W8LA 3EDRB 4KHRA 2Y1JA 5EWGA 4LMZA 2WW4A 3ZTOA 3DGVA 2BABA 5B0AA 4LFAF 4DV4J 1Y0HA 3GONA 1M1GA 3KLHA 2I1RA 3U1NA 2YKQA 4PABA 1D09B 1HHQA 2GS8A 2D3OR 2CJQA 3FUYA 4DV1F 2FVQA 1U45A 1R0AA 1RADB 5KFXA 2P5VA 3EGWB 1D3WA 2JHEA 3NAIA 2LA4A 3PKMA 1HNZJ 3PO5A 2B51A 4UW2A 5LMNF 5ETNA 1P27B 5JXSA 5IZHA 3MXHP 2H1YA 2A10A 3NNCA 2VC0A 4WFXA 3IAS9 2R7QA 5DDRC 2XMKA 1WEXA 3A4TA 3EZ5A 3R2CJ 1RAEB 3GP9A 4OZ5A 3S01A 5EWFA 2DO0A 2DHGA 3ISND 1P9YA 3FEYB 2BJDA 2EKYA 2BM1A 2K3KA 3R7SB 2PA8D 3MTJA 4JV0A 1C4AA 3J80U 1B3TA 1TUGB 3RR8A 3F73A 3A1YG 2Z4PA 2P9EA 3ELHA 2KO1A 1UTAA 5KG4A 4JI4J 4NLRA 3VVTA 4USJC 3JSRA 3FMWA 3FZ2A 2R2RA 3HPOA 3CDWA 2DKOB 1S59A 1KS2A 2HFNA 1F6TA 2W4CA 2RD5C 1VMBA 2JJ4D 4B3OB 2UUWA 1TVRB 2EFNA 1YK9A 1H74A 3DRRA 3PRVA 4DX6A 3W62A 2QA2A 1RTJA 4DOZA 3HHKA 3QRRA 2HQIA 5GMEA 4OI4A 4BHQA 4DCPB 2AJ4A 2NPFA 2X7IA 2HHHJ 2DISA 2OPPB 4FS2A 3WX8A 3QATA 3KK2B 4K4YA 3A8EA 3AY0A 4YB6A 2ZEJA 1QSSA 5JUMA 5CYMB 4Y2AA 4ICLB 3M8PA 3GG0A 3CO0P 3DDNA 3HSZA 1FF2A 2C3UA 4LVNP 2RRAA 3N28A 2HKEA 3D54A 2RU3A 4YR2A 3OD2A 3NLCA 2IC3B 4MKYA 2N4CA 1TP7A 2CPEA 4YUDA 4TXSA 3Q8SB 4I6AA 4X4TA 4DR6J 2JC0A 4DPTA 2VQFJ 5KFIA 5CD4H 5IC4B 4Z7CA 4U6PA 4NLSA 1FJCA 3LP2A 5HVFA 1LW2B 3UWTA 3SFUA 5M2UA 5F0UA 3ZNUA 3EYZA 1PC5A 3CCSS 2PA3A 3DOLB 3K2YA 1QY7A 2IJRA 1KQGB 3QRQA 2CQ4A 5A8KB 1I51B 1YJWS 3GIIA 5DM6Q 4AFFA 5C24B 3D6HB 2YTCA 4B3TJ 3U7JA 5A8RB 5AXLA 1XMQJ 1FX2A 2DNMA 3KJNB 1Y10A 3D3BJ 3GV8B 2ZC3A 4I56A 3OFEA 1FFGB 6FDRA 4DR7F 1Y11A 3GCXP 2DCLA 2YH0A 3B54A 3DRPB 1RTIA 4X66J 3OJUA 3T1HJ 1SKSA 5D0HA 4MAKA 2HW3A 4CLWA 1QVGR 1JWWA 1T94A 2A6OA 3D4JA 3UCUP 3I6PA 1RKIA 1VQ4S 1GT8A 4LSNB 3CPWR 1IM6A 4OI0A 2EI5A 4NXMF 3DYAA 3KMSA 2B6AA 3PEJA 5E3RA 2IA0A 4Y6IA 2ASDA 1GTEA 1TAUA 5EX0A 2BJ1A 4ILMA 4FXWA 4G3IA 1XNQJ 1YRTA 4DV2F 3OHBA 1RE1B 3H2VE 4GVBA 1AFIA 2ZDOA 1NHUA 5KFAA 1UCNA 3TZWA 2AEMA 1MN7A 3US5A 2RDJA 2YWKA 3PCOB 2AEJA 1R7IA 1IKVA 3R1LA 1NH8A 4DX8H 2DGVA 4EEYA 3MFHA 2O5DA 3QSYB 3S8SA 2UV8A 3GIJA 2M5YA 3BZQA 4FS1A 4F67A 3SSQA 1RT2B 4LF8J 1W25A 3K17A 5DM7Q 2GO8A 2UXCF 1WC0A 3UDLA 3QNWB 4DZ6A 1HBOA 1D1UA 1NJYA 1FE4A 1X7VA 4IH6A 2W7OA 3FGVA 5F8JA 1NB7A 4WFZA 4H4OB 2ZD1A 5BJRA 1N32J 2M3DA 2X1BA 2XMAA 3NL0A 4QIEA 3OL8A 4F36A 3I82A 5D78A 3BBBA 1RJJA 5CA5A 3THTA 2OP5A 2F9JA 1RWUA 3DOMA 1HBMA 3RUBL 4B3RJ 3I0RA 4LIWA 2YKAA 3MM7A 1CQMA 9ATCB 2CPDA 2VJUA 4F3OA 2KG0A 3VR1A 4KYZA 1XR6A 3DRSA 4CO1A 2RNEA 2WHOA 3HT3A 2A1BA 3UD3P 2VV5A 4YR0A 1N5YB 1EP4B 4ITSA 3MECB 1U09A 3DLBA 4LF1A 3OFGA 4E8UA 4M5DA 4DV0F 3NGRA 4WFAQ 2ZHAA 1SXLA 1YBUA 2CDRB 2Q43A 3N6NA 2BQUA 2WSFC 4EMDA 2V34A 3MM5A 3OSPA 2BM0A 4UF4A 3FCVA 2MJNA 1S6UA 2P6TA 4P75A 4RW6B 4MFBB 2HIYA 1CC7A 4F3MA 4WPAA 4BLGA 2DR9A 5CZVA 1RABB 5B08A 3LAMA 3NEKA 3CD5A 5KTQA 4FNIA 1VQLS 4G65A 1RTHA 1Y5NB 3KLGB 2G9OA 2KYXA 2QTWA 3BR9A 2G0CA 1N88A 2LVWA 3KDOA 4A47A 5KFKA 2MY7A 4OX9J 2MTLA 2HHUA 4S0MA 5AXKA 2VA2A 2R42A 2KHCA 4U96A 4Q2LA 1IBLF 2WB4A 3ZTSA 1HA1A 2WVFA 2YQ0A 3BQ2A 4CLTA 2A18A 4PWUA 2AGQA 1I3OB 2COLA 3ET6B 1T05A 2FLLA 2IRUA 4IFYA 1TKDA 3TJ8A 5T7LA 3NY0A 1KQSR 1TKXB 1IBKJ 1NZAA 2C2OB 4ZHRB 4DSIA 5IXUA 3ENAA 2DR5A 3OPKA 4RUHA 1K0TA 1FWLA 4ZIWA 1EIYB 2DHAA 1OIAA 1RLDA 4QOTA 1VLOA 2DNPA 2DHXA 2RILA 2MZJA 2WCXA 3IM9A 3SCLE 1ZZFA 1SUQA 2MQNA 2B8QA 3OFHA 1Q8LA 2CIMA 1C0TB 4GKKJ 3W9JA 2JEGA 5K14A 3RRHA 3TUZC 1U24A 3FBCA 2L41A 2XS2A 2EFQA 4ZVGA 1N54B 3VZIA 4IDKB 2UUAF 2GJIA 2CQ0A 4KIAA 5EX3A 3R5CA 2PIIA 4QWDA 1VRUA 4ZCIA 1BQMA 4LF7J 2MB0B 2HHQA 4OHXA 3GJRB 4ZN3A 1LFWA 1RTDA 1VQ9S 4WP9A 4FP9A 4LR7A 1ULRA 4N76A 4ZPBA 2B7CB 3ZZZA 5I3QA 4YY3F 1D8YA 4JYAF 2FVCA 2G0IA 1S77D 2SXLA 2GAGC 3QT6A 9RUBA 2AJQA 4QPXA 2F65A 4XDDA 2PI5A 4ZVHA 2PDAA 3NGTA
chains in the Genus database with same CATH topology
5J1PA 1TKZA 3ULHA 3MM5B 2ZOFA 5E3QA 4JI5F 1S0MA 5KFUA 2W9CB 2ROEA 2XBPA 1VFJA 1VQYA 2DCUB 4L3NA 3WDOA 5KFDA 2W9BA 3LW5C 3Q8PB 1TK0A 4F4WA 1L3KA 1ZOTA 3CDUA 5E3CA 1DBDA 1XNQF 1UWBB 2KM8B 4KHPF 2AJFE 4L72B 3SQGA 3BDPA 3ICLA 3PEHA 4CNZA 2V9WA 4WTYA 1ZH5A 5KG0A 2R4FA 2W7AA 4FF1A 4ED1A 1IKYA 3UPFA 3GQCA 1FJ7A 2R8KA 2E5LF 1R43A 2KN4A 2XWYA 2ADBA 3QPIA 2X1AA 2EWHA 3PIPQ 1JLBA 2F7VA 2M70A 2RQMA 2GHVC 2Y1IA 3NBPA 1DHMA 2FDNA 3V6HA 2A2CA 1Q4RA 3LUYA 2PE8A 3Q2TC 1SQEA 1VLYA 3M6XA 1Q7YT 3HVTB 3K5PA 1RTHB 3QIDA 4IQMA 4ZMMA 1N5VA 4O3SA 2RF2A 2ZKTA 2E5HA 1R31A 1HBUA 5HQ8A 3D1HA 2QA4G 3OR1B 3MUVP 4EO6A 3RRGA 4LQ3A 2E9RX 3VAKA 4TNOA 4QIFA 4QQBA 2A2DA 3BF4A 2ZBIA 1SL2A 4PQAA 4QIGA 2V2KA 2J7KA 1TV6A 4P7VA 4A8OA 1XR5A 2L9NA 5C42B 2IVFB 2FC9A 2GHPA 1T3NA 3G9CA 4A46A 2PN6A 1BQNA 2Y1RI 5B0DA 1KVJA 2J8AA 2OPQA 2VOPA 3LPYA 2PT0A 2B7BB 3QZ8A 3Q23A 5CCLA 3KK3B 3WZ0A 5SZTA 1L3SA 1TFWA 4PPDA 3MEDB 4J9QA 4IO1A 2Y0SD 2F3JA 1L5UA 1KLMA 2K8GA 3DLEB 3FJ2A 4QYRA 1C0UA 3CUNA 1ZTTA 3H8YA 5ADZA 1XERA 2CZVC 1B0TA 2KRRA 2MKCA 3G86A 1CPZA 3D0IE 3TARA 1FRMA 3Q0AA 3DI6A 2O3DA 2D41A 3F44A 4ZKAA 1WHWA 2V9KA 5FJ4A 3EXYA 3TUIC 2MSSA 4O4GB 2GJ2A 3BM7A 2LQBA 3C66A 1SL0A 2KRBA 4NRUA 1QUPA 4RWXA 3CCLS 2CQ1A 1S6QA 3IO1A 3MM8B 1A6LA 2BRKA 2LKZA 5G4DA 4FNHA 4HT5A 3HHLA 2J0SD 4IG0B 1CG2A 4OLOA 4Y2IA 5KFQA 1GNKA 2W4PA 2B5JA 4DJBA 3AB4B 4RW9A 1T05B 4I7FB 2AX1A 2F8HA 4I0WA 4LF8F 1N5QA 2RSQA 4PXEA 2KI2A 4JI8F 4IFYB 3V4IA 4NPOA 5KFFA 2FJWA 1U1OA 3C6TA 2E1AA 3TVYA 3FDSA 5F0WA 3EUNA 5T7LB 3KLIA 5HMWA 5J2MA 3PRDA 2OLWA 1Y9OA 3DRXA 3T1AA 2YWEA 3VQTA 2MKIA 3SDEB 2MQLA 4IOCQ 1WF1A 1X4FA 3OTOF 2ZOGA 1VS3A 2HZCA 3UNGC 1YJRA 5FDLA 3HM9A 3M2UA 3H2UB 4JUZA 3DLJA 2UP1A 4UOCA 1MMLA 2WBRA 3IWNC 2QZ8A 4WYWA 1Z2ZA 1S76D 4GO7X 2YY3A 3JYTA 1SJ1A 4NA1A 4AQYF 4IOAQ 1FEEA 3SFGA 3IWXA 2CKWA 1FTCA 3DNCA 2MZSA 1QUVA 2GMLA 2PC6A