3C6UA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6uA05
3VQ4A 1C1AA 2P51A 3DRSB 3NAEA 3BQ1A 3MR5A 3T1AA 3PW7A 2O4GA 4DU3A 5KG2A 4BDPA 4MK8A 1QUVA 4WFXA 1NOYA 1UWBA 4KB1A 1WSGA 1RT5A 4CIFA 2HB5A 3SQ0A 4ELVA 4CK3A 2FBXA 4HCCA 4QWEA 3SUPA 4J9RA 4CHNA 2BANA 3CVKA 3C94A 3DRPA 1C0TB 4KHYA 3QO9B 2JEFA 3OS2A 4FBTA 3VA3A 4IQXA 4F4ZA 1ASVA 4FLYA 3RRGA 2HNDA 4RW8A 3K2PA 5J2QB 3KJVB 2G8WA 2FC0A 4IFVA 3QETA 2HHUA 1TK0A 3O3FA 1RTJB 5CYQA 1RA7A 3D5MA 1JL1A 3AO1A 3ZSOA 4M3YA 1TVRA 4K4TA 3VQ9A 4NYFA 4F3TA 4PY5A 4I2QA 2ZE2A 4AILC 3SNNA 2OZMA 4MKBA 3NF6A 4LY7A 2XGQA 2Y1IA 3TWHA 1N48A 4CJLA 3MEDB 4MH8A 5DK5A 5C42A 2FJXA 3LDSA 4NCGA 2FBYA 3VQSA 1K1SA 4KB7A 4RW6A 4K4WA 4KV8B 3CFPA 1J53A 1TL3A 1LWCA 4OKEA 2J6SA 2BQUA 1HRHA 2FLLA 3CO9A 1HNIA 4DF8A 1XR7A 4ED8A 4BDZA 4CJTA 1W25A 4EZ9A 4ECRA 4ICLA 1YVUA 4H8KA 4WE1B 1RT2B 3SPZA 1U48A 2HMIA 2BRLA 2VG5B 2HVIA 5KG1A 4PQUA 3GYNA 2IA6A 3H98A 3ZT2A 4LH5A 4NLQA 3TQ1A 4IH7A 3QNNA 3M9MB 2I1RA 5DQIA 3SCXA 1JLCB 4O4GA 3OL7A 2GIRA 1C0MA 4CF8A 5E41A 1GOBA 3V4IA 1S9EA 1GOAA 2F8SA 2YNIA 1EX4A 1D0EA 4O44A 1TQLA 1TKXB 3RBEA 2XY7A 1N5YA 1S1UA 4UQGA 1WSJA 4CHZA 2I5JA 1RT4B 2B43A 4JV1A 2BDPA 4C8MA 2IC3B 3VQ7A 1C6VA 4IBNA 3WNEA 1BQNA 5HROA 1K1QA 1QSYA 5DLFA 3U6FA 5KTQA 1LW0B 4ZP8A 1HNVB 4H4MB 3KHLA 2B5JA 3GIKA 3RR8A 3MR2A 2NUBA 1QTMA 1FKPB 4F3OA 4H54A 3SV3A 4M3UA 3HT3A 3FSIA 3NAHA 4G1QB 4CIEA 2PZSA 4QW9A 3QEVA 4KI6A 3SYZA 3H5UA 1CXUA 4Z4IA 3PHEA 1BGXT 2DFFA 3IGVA 3OYEA 1VSHA 5KG5A 1ZETA 3T5KA 4C8OA 4LSLA 3MR6A 2GUIA 1TKDA 1YTUA 3N6NA 1B9FA 4FJ7A 3TAMB 1S4FA 1WAJA 2FVRA 3LP2A 3PZPA 4FJGA 3O3HA 2C2EA 3U3YA 3TAQA 3V9SA 4Y34A 5KGXA 5I3UA 3HVWA 5DGAA 1TKZB 4J9MA 4ID5B 3MEEA 3KMQA 4RW4A 3DYAB 3TABA 1JX4A 3LAMA 4WYLA 1S6QB 2UUTA 1KVAA 3SJJA 4FK0A 4BE2A 3KLIA 4URSA 5CYMA 3V6DB 3M8PB 3RAQA 1RILA 3LALA 2BE2A 4CECA 1SH3A 1QE1B 1KSPA 4JS5A 1LW2B 2IAJB 3AVLA 4FLVA 2IMWP 3E01B 4NLOA 2PYLA 4CJPA 2HAIA 3DLKB 4FJLA 5FRMA 1FXXA 2HWIA 5F9NA 2G8HA 2XWYA 2D5RA 2QE5A 3HKWA 1TL1A 3TVKA 3BJYA 2VA2A 2BANB 1Q9YA 5HRPA 3DRPB 2A1RA 3S9HA 3V9WA 1RBVA 1WNSA 2FJVA 4RG8A 1VSDA 4NLDA 3A2FA 4ZPDA 2B6AA 5CZ2A 2HNDB 4RW8B 4DL2A 1KLMA 2ZD1A 4NLTA 4DTRA 2V4QA 1Z26A 2W8KA 3LP1A 3T5LA 1JLGA 4IFVB 4KHRA 1VRUB 1IM4A 3M8SA 4DFPA 3OL8A 4QOZB 3PV8A 1IKVA 1U47A 3DMJB 3BDPA 5J2MA 5HLFB 4IFYA 3V9XA 2R8IA 4FJNA 4CGFA 3P5JA 3VQDA 1HQUA 3KK1B 3F9KA 3KHRA 2WHOA 4K4ZA 3HPGA 2HHSA 4CGIA 4RW9B 4CEAA 1JKHB 4RW6B 5C24A 2OYQA 3QZ8A 1TL3B 1LWCB 4O0IA 5KFMA 3OHBA 2D0BA 2VG7A 3PJXA 3PW4A 4FS1A 1SL1A 4J9SA 5HBMB 4XIUA 2BRKA 3ASMA 4ICLB 3PX0A 5F8NA 2HMIB 3GV7B 4FLZA 3MXMA 1JXBA 5EDWA 1S0OA 2E9RX 3Q8RB 1BIZA 4DL3A 3IAYA 4KHNA 3JYTB 4J9LA 3HVAA 1C0TA 2Z1HA 1GX6A 4CK2A 1BQMB 3HP9A 1S1WB 2WONB 3OYIA 4W5QA 3DLBA 3L2RA 2YKNB 3V4IB 5KFTA 3V9UA 1RBTA 3KJVA 4O44B 4M3ZA 5EWEA 4NZ0A 5KFAA 3TAPA 3ISNC 1RTJA 1S1UB 2E6LA 4FZYA 3OY9A 2X6SA 4ZVFA 3PX6A 4GW6A 2R8HA 3TAEA 2I5JB 2Z1JA 4J2BA 4QWDA 4OVLA 4FJHA 3BGRB 3AVIA 3H2LA 4DL4A 3FFIB 3ZCMA 1L3TA 3LZIA 4OGEA 4O0JA 3SI8A 4ECUA 3MEDA 1RCHA 4AHSA 4HUEA 3PR5B 3I0SB 5CY4A 3QIDA 1I39A 2ALZA 1C2PA 4OL8A 3NGYA 3KMSA 4DF4A 5L1KA 2AGPA 4KV8A 5KT6A 5KFCA 4B9UA 1XR5A 4WE1A 3SUOA 1RTHA 4XPCA 4O3NA 3OS1A 1TKTB 1RDDA 3VA0A 1ZTTA 2XC9A 3BR9A 2JLEA 4E0DA 4B08A 1JLCA 2IOCA 5JXSA 1JLQA 3DI6B 3K58A 3MEEB 4RW4B 1NK0A 1GOCA 1TKXA 3DOLA 2ASJA 2YHAA 3V6KA 4EO6A 2E9TA 3LAKA 4AHUA 4DQIA 5KT4A 3MAQA 2RDJA 1VSKA 1RT4A 4NRUA 4QW8A 1W9HA 3PJWA 1XR6A 2IC3A 4R5PA 5DMRA 4IRDA 5F8JA 4ED2A 4KSEB 1VSIA 1LW0A 3ZSQA 1TV6A 4CEDA 3K5LA 4FJ5A 1HNVA 3D28A 4H4MA 1NKCA 4EBDA 4RW7A 1RBRA 2IGIA 2G8KA 3MXIA 4ECSA 4J9NA 3OYBA 4O3PA 5I42B 1SL0A 1FKPA 1L3SA 5KG7A 3KHGA 4QPXA 4G1QA 3AVMA 3NCIA 4DQSA 4DTPA 4IG0B 4MKAA 4OLBA 1J5OB 3PW0A 3RB3A 1RAJA 5SWMA 3OYGA 2YNGA 5HRSA 2B6AB 4K4UA 4NLGA 3NH2A 3AVNA 4WFZA 3OYMA 3CJ5A 2UVWA 1KLMB 2VWJA 2WOMB 3GQCA 2Q3SA 4Q5VA 3K59A 5KFVA 1K6YA 1RYSA 2HHXA 3NBPB 1WNEA 4ID5A 4WZQA 3DYAA 3AA2A 4LQ3A 1X9WA 4EBEA 1S6QA 4IR9A 5T7BA 3ZT0A 3RAXA 4B3OB 3KOAA 3V6DA 4FJ9A 3M8PA 4FCYA 5KFUA 3IG1B 4ZTJA 3Q8QB 1LWEB 5C24B 2DPJA 5HRRA 2YNHB 1LW2A 3CQ8A 2IAJA 2VG7B 4G3IA 4FW1A 4EZ6A 3E01A 4ECVA 4DTUA 1XWLA 3TR8A 2W9AA 3BQ0A 3DLKA 4O3RA 5FDLB 1L3UA 4H4OB 5KFOA 1NHUA 5J2NA 2RKIB 2X78A 3QLHB 4QCLA 3ZSWA 2R2UA 3CFRA 1D9FA 3VQPA 3I8DA 3PO5A 3NF8A 4KO0A 4ZP9A 2XHBA 3ISND 3SFUA 4ECWA 4HVJA 1S0MA 4F50A 4LH4A 1QQCA 4KE5A 5KFKA 2D0AA 1C1CA 4AHTA 4NLVA 5CZ1A 4JUZA 2C2DA 1S97A 1TK8A 3H5SA 1VRUA 4ELTA 1MMLA 2AQ4A 1RYRA 2O4IA 4IR1A 4Z4FA 4RNFA 3DMJA 1VSLA 2VG6A 4RNNA 4KHUA 1NKBA 3IN5A 5HLFA 2J6TA 4QWAA 2AX1A 3M8QB 2XY5A 2IJFA 3KK1A 1XI1A 3LP3A 2DTUA 1LWFB 4ZVGA 4E3SA 2XO7A 2CKWA 4RW9A 1JKHA 1S9GA 1S1VA 3OJSA 2J6UA 4CEZA 4MQ3A 3QINA 3MFHA 1QSSA 5HBMA 3ICLA 4U6PA 1RTHB 3O3GA 3KD1E 1RT6B 4EBCA 4JV0A 3AO5A 1J9AA 1ZBIA 4NLSA 3KLEA 2OPRA 3MEGA 3JYTA 5J2PB 4IOBA 4ZMMA 4Q45A 3AVHA 1IKYA 2R7YA 1WLJA 4O3SA 1RT1B 3DRRA 1BQMA 4CFDA 4J9QA 3T5JA 1S1WA 3N6LA 2WONA 3OSNA 3RMBA 1SKWA 2IDOA 3CJ0A 4J2EA 1JLQB 2ILYA 2IBKA 1T8EA 2YKNA 2IS3A 4K4XA 1NK9A 2D41A 5KRSA 1DTTA 4Q8EA 2V9WA 3DOLB 1WAFA 2R8KA 3C6UA 2WB4A 4ECQA 4FYDA 4RNOA 1ASWA 5DLGA 2HHVA 2HHWA 3AV9A 4F4KA 4GC7A 4FLWA 4R5PB 3G6VA 3BGRA 2FLNA 3KNAA 3VQQA 4J9PA 2G8IA 3FFIA 3QGHA 1YTAA 1TV6B 1TAQA 4RW7B 3I0SA 3LZJA 3MF5A 4CJ4A 3RTVA 4MFBA 4NLYA 1REVB 1VSFA 3RMCA 1NKEA 4IG3B 4OLAA 1QHTA 4ID1A 3T3FA 3LP0B 1RT3A 4QAGA 5JS2A 5C5JA 3ZT4A 3TI0A 4XO0A 2YNGB 4IDKA 3PUFA 1C1BB 3NH1A 1TKTA 1NHVA 4I9QA 1HMVB 3DLEA 4Q44A 4DSIA 4YMEA 3V1QA 5KFHA 4PA1A 5KFPA 3OYFA 1JLEB 3O4NA 5KFDA 1S48A 2E6MA 4DQPA 4B9SA 5KG6A 3DI6A 4M45A 2KZMA 2JEJA 4EO8A 4KTWA 5KG4A 1BISA 3HK2A 4XPEA 1IKXA 5T14A 4CFCA 3NDKA 4M3RA 1Z4UA 1J54A 3OYDA 1DTQB 4FLXA 4GC6A 3C6TA 4YP3A 4PWDA 1X9MA 3KKSA 1LV5A 4JLHA 4WXWA 3HO1A 3OVNA 4DQRA 4HUFA 4IH6A 3D0PA 2YHBA 2W9CA 5KFQA 3NGDA 5I42A 1S0NA 3ITHB 2E4LA 3G6XA 1XHZA 1SKSA 4ECYA 1JXEA 2HVHA 4E1NA 4Q8FA 5J2NB 3G0ZA 2QK9A 4CGHA 5KFWA 4IG0A 2GIQA 1J5OA 2OPQA 1S49A 4KHMA 4TY9A 4IRCA 1VK0A 4KO0B 3ALYA 3H4DA 3L2VA 2FLPA 4TYBA 2BGGA 4B9VA 1I6JA 4OPJA 2V0NA 1MU2B 3IS9B 3KK3B 2KZZA 1C1CB 2ITGA 2WOMA 2D3UA 4M3WA 3I5CA 2C2RA 4B9MA 2VWKA 3CG7A 1VSJA 3NBPA 2VG6B 5J1EB 4FM2A 5KFRA 5KFXA 3UQSA 4HHTA 4URGA 2DFEA 1SL2A 4Y3CA 4KHQA 4ZVHA 4DLGA 1R0AB 1D9DA 4N56A 3QERA 2AJQA 3AVJA 4B3OA 1WSIA 4E7LA 4Z4HA 3IG1A 4W5TA 3MR3A 3OYHA 4ZPCA 1BHLA 1LWEA 1QS4A 2IM0A 1S9GB 3PY8A 1S1VB 4MIBA 2YNHA 1SH0A 2FJWA 5F8HA 1O1WA 4DL7A 1T7PA 3OSPA 4DTXA 2D0CA 1F21A 4NYZA 4KHSA 3CM5A 3FQKA 5FDLA 2W7OA 2XI3A 2G8VA 4H4OA 3CJ2A 3Q8PB 3KLEB 2OPRB 3MEGB 5D3GA 3NAIA 1IG9A 2RKIA 1Q8IA 3QLHA 3HYFA 1UA1A 4E7KA 1IKYB 1SKRA 2KQ2A 3NFAA 3KK2B 2IM2A 5DG9A 4C8LA 1T03B 3DRRB 3M9OB 1YVFA 3V6JA 4NLRA 2UVRA 1S6PB 5L1JA 3ZSVA 4N41A 4FLUA 4U7CA 2P1JA 3OYNA 2V4RA 3SFGA 1JIHA 3KLGA 1DTTB 4FVMA 2R8GA 1B92A 3DM2A 3LWMA 5F8LA 1HQEB 2BQRA 3C6UB 3KLFA 2FBVA 3L8BA 5L9XA 4CHPA 4DU1A 2Z1IA 3L2QA 5DQHA 4DTMA 3MXJA 1IKWB 2AGOA 3M8QA 4YQWA 2ILZA 4CEQA 3OYKA 3IRXB 4ED0A 1RNHA 3LWLA 1IH7A 1ASUA 1LWFA 4MFBB 4K4YA 4I9LA 1KFSA 3VQEA 5KT5A 4DSEA 2OPSB 2XCAA 4YNQA 1JLFB 5KFNA 2ASLA 1KFDA 4RU9A 3SZ2A 1ZYQA 1TAUA 4QWBA 4K8ZA 4O3QA 5KFGA 5L1IA 3V1OA 4I7FA 4ZVEA 2HWHA 3G6YA 1U49A 1S10A 3AO4A 1RT3B 3SQ2A 1RT6A 4Q43A 4DTOA 4Y1CA 3NGIA 4IDKB 3CDEA 3V6HA 1OS5A 2G8UA 3RB4A 5J2PA 3V9ZA 3DLEB 1U04A 4YFUA 2HHQA 2W8LA 1RT1A 4DS5A 4CF2A 4KKOB 3TARA 1NK5A 4CF0A 3M8RA 1RTIB 3NMAA 3AA5X 4PUOB 5F9LA 3RB6A 4Z4GA 3H08A 1N6QA 4DEZA 4CJKA 5KFSA 4JV2A 3Q8SB 1IKXB 1T05B 3EZUA 3OS0A 4B9TA 5KFLA 3P83D 1ZBUA 2JGUA 1HJRA 2PYJA 3C6TB 3G86A 4E1MA 3NL0A 4FJXA 4YR2A 1NK7A 4W5OA 4KHWA 2AU0A 3EY1A 1D1UA 4QWCA 4DG1A 4PWDB 3K5NA 5KFIA 3KLVA 1KCFA 2X74A 4B8AB 4KFBB 4DTSA 3WNHA 3OL9A 2W9CB 3FRZA 3CFOA 3BSOA 5KRTA 1REVA 3TAGA 4AHRA 4J9KA 4JRPA 4M3XA 1RBSA 5HP1B 4TQRA 4IG3A 1SH2A 2LSNA 3CYMA 5KGWA 2OPQB 3LP0A 1U09A 4KTQA 2HNZA 4J9OA 1CXQA 4ZTFA 1C1BA 2FBTA 3IGNA 3S3MA 4DSJA 4RUCA 1HMVA 1UOCA 2XY6A 2JC1A 1S9FA 3QEIA 3N6MA 1C0UB 3RWUA 3ULDA 4KTZA 1KTQA 3I0RB 3RMDA 2B4JA 2QKKA 1JLEA 4ZHRB 2RDIA 4LD0A 1A5VA 2HW3A 2OA8A 3EPGA 4CK1A 3GV5B 3V81B 3VN5A 3GIIA 5DG7A 2FVQA 2F8EX 1SV5A 2WK4A 4EP5A 3ZSYA 3AO3A 1DTQA 3KIOA 3LANA 2BR0A 4DS4A 1X1PA 1RTDB 2UUWA 1EETB 4BACA 5C25B 3CDUA 3PX4A 2EC0A 3EPIA 1QAIA 2HNYB 4ZP7A 1ZBFA 4FLTA 2R2RA 1XHXA 1NJYA 4DSLA 5K14B 4DFJA 2C22A 3ITHA 4OKJA 4TQSA 5D3GB 1FK9B 5KT2A 1S1TA 5EWGA 2WTFA 4K4SA 3CDWA 2BQ3A 5FROA 4ED3A 1XC9A 4DWIA 3V1RA 3DOKA 1KHWA 3OHAA 3B6OA 3VQ5A 4CJQA 3BREA 4URQU 1MU2A 3IS9A 3KK3A 4CIGA 3KLGB 3E51A 4M41A 3DM2B 4Y2AA 1RDCA 3QGIA 1B9DA 3ZSRA 1ZBLA 1G15A 3HPOA 1KRPA 3KLFB 1QAJA 3AVAA 4EP4A 1TP7A 1BIUA 5J1EA 2OH2A 2YKMB 5KT7A 3H59A 3SI6A 4CERA 1R0AA 4K4VA 4F2SA 4I2PB 4DTNA 2IJNA 3LPTA 3QIOA 1ZBHA 4NLPA 4KAZA 3HXMA 4C8NA 2FVPA 3SQ1A 1EP4B 2A1SA 3K5MA 4OGCA 4CJSA 2KFNA 4KAIA 3UPFA 4W5NA 4N5SA 4FK4A 3TAFA 4RNHA 3I5AA 1WSFA 4ECTA 4I7FB 5FRNA 1ITGA 3PW5A 2R2TA 1EKEA 3AVCA 1HPZB 2W9BA 2WRMA 4BDYA 5KT3A 4DFKA 1RDRA 3SUQA 3DLGB 3T19A 3KK2A 1T03A 3ZT3A 3QIPB 4F4XA 1TGOA 4OJRA 3AA3A 3QEWA 3QZ7A 1S6PA 1HYSB 4KREA 2OPPA 3MECB 4TY8B 1A5XA 1N6QB 2C28A 1N56A 4DMNA 2D3ZA 3OYJA 1NNDA 3HJFA 4Z0UA 4LQ9A 1HQEA 2ATLA 5KI6A 4N47A 5KFYA 3CIZA 1Y97A 4WFYA 1JLBB 4CJRA 3H40A 3OLAA 3SQ4A 3LPUA 5F8GA 3VQCA 2P5OA 4FJKA 4DG1B 4E7IA 4BWJA 1IKWA 4O3OA 4CJFA 1RDBA 2KFZA 5DG8A 3MTKA 1N4LA 1NJWA 3IRXA 3DDKA 3NKYA 1JLAB 3HPHA 3CJ4A 4KPYA 4EEYA 4W5RA 3EYZA 2OPSA 3DLRA 1JLFA 4HYKA 1UAXA 3WNGA 1Q9XA 3JSMA 4O5BA 2UVUA 4M42A 4CE9A 3PVXA 1S5JA 4CF1A 4YR0A 3S3OA 2HNZB 3HL8A 4IRKA 3OLBA 4JS4A 5KFFA 4TSXA 1BI4B 1DLOA 4Q0BB 3FQLA 3DLHA 4J2DA 3AA4A 4AH9A 3HVTB 3QYYA 1FKOB 4KKOA 1RT7A 2YNFB 1QSLA 1RTIA 4ED6A 2XRIA 4PUOA 5L1LA 1D8YA 4F8RA 4B8CA 1KHVA 4CEOA 1BCMA 4NYNA 4TLRA 4CJUA 1CSJA 4HUGA 4DFMA 1RA6A 3T5HA 1L3VA 4CCHA 3RB0A 1T05A 1SV5B 4R8UB 4DL5A 1CLQA 4M95A 1WSHA 4FK2A 3SPYA 1A5WA 1VRTA 3P1GA 3KLHB 3L3UA 3NE6A 2ATQA 3NF7A 4DSKA 4E7JA 3KD5E 3K5OA 1NJZA 4TXSA 2XCPA 1NK8A 2RN2A 4KFBA 3ZSZA 2W42A 4E89A 4CEBA 1SUQB 3S3NA 3FDSA 2GV9A 4WXOA 4LSNB 3OJUA 3BSAA 4M94A 4CGDA 4DQQA 3OL6A 3KKRA 1S1TB 5HP1A 4Y2CA 4ZPAA 3DOKB 4NLWA 3F73A 3HP6A 2PY5A 2F8TA 5KG0A 1UWBB 4CFBA 1VSMA 3HHKA 4X2BA 1RT5B 2JEIA 2HHTA 5KFEA 4L8RB 4DL6A 3NHGA 1EXQA 1C0UA 2ASDA 3OYLA 4KBIA 4N76A 4F4WA 3I0RA 4ZHRA 1UA0A 3I5BA 4MIAA 4ZPBA 4FJ8A 1U45A 2ZQBA 3V81A 3B6PA 2RF2A 2AX0A 4JRQA 1NK6A 4ECZA 4ELUA 4OPKA 3NGZA 3VQ6A 4IKFA 1KVBA 1L5UA 4E7HA 1RTDA 5CYQB 2IM1A 2ETJA 1TVRB 1WSEA 1LAVA 1EETA 2DPIA 4NRTA 5KG3A 4HCBA 5C25A 4I2QB 2ZE2B 3NF9A 4ECXA 4FJMA 5F8IA 1S1XA 4HKQA 3GIMA 2HNYA 4CFAA 1X9SA 5K14A 5C42B 5DQGA 4NCGB 2X6NA 2W9BB 4CJVA 3UDLA 1FK9A 3AO2A 2QXFA 1HNIB 2F96A 2Y1JA 3UR0A 3DRSA 3AVGA 1KLNA 4IKAA 1HYZA 3M9NB 5EU7A 2QV6A 4WYWA 5JUMA 4F2RA 2OPPB 4FZZA 2YV0X 4ED1A 3RRHA 4PQUB 4Z4CA 4M3TA 3L3VA 2FVCA 3UIQA 3QO9A 1T94A 4FM0A 4GMJB 2RPIA 4BE0A 4O4GB 3HM9A 4CJEA 1NJXA 1NK4A 4Z4EA 2OZSA 2YKMA 5J2QA 3NH0A 1HYVA 1S9EB 4CHYA 3BQ2A 4HTUA 2YNIB 4J2AA 4CGGA 5SZTA 4FJIA 1JXLA 3EZ5A 2Z1GA 4DU4A 4I2PA 1N5YB 3QESA 4KB0A 4CESA 2XGPA 4CHQA 4CJ5A 4MK7A 3RR7A 1EP4A 2JEGA 4DTJA 3AVFA 2UVVA 4Y1DA 2E9ZA 5KFBA 2W7PA 1BQNB 5HROB 3GILA 3HVRA 3JSMB 4FW2A 4OKKA 4CJ3A 4KI4A 3GIJA 3KHHA 2B5JB 4FJJA 1HPZA 3ZSXA 3BSNA 2DFHA 2XY8A 4GVMA 3U3GA 3PW2A 3DLGA 1DLOB 4CHOA 3C95A 2EX3A 1T3NA 3QIPA 4NLUA 3H5XA 1ZTWA 1GX5A 1RT7B 1RT2A 1HYSA 2VA3A 1U4BA 5KFZA 5DGBA 1CZ9A 4C8KA 2WCXA 4BE1A 2VG5A 4B9LA 3MECA 4TY8A 4TYAA 4LSLB 4BWMA 4NCBA 2O5DA 3HSTB 3WNFA 5HRNA 4IH5A 3PO4A 3QNOA 2DY4A 4WZMA 3LP2B 1JLBA 4F4YA 1Z25A 4DSFA 2AGQA 1YT3A 3AVBA 1VRTB 5I3UB 2ZKUA 1IO2A 3SUNA 4CEEA 4ED7A 5EUHA 1BL3A 3KLIB 4FBUA 5CYMB 5KFJA 4RNMA 1RDAA 4CEFA 1HARA 4EYIB 2R8JA 2EHGA 1JLAA 2BE2B 3ZT1A 4FZXC 4ZP6A 4FM1A 4AHVA 4NLXA 1JL2A 3D45A 3VQAA 1RBUA 3KTQA 3QGGA 1WN7A 1LAWA 3CJ3A 2XI2A 4K50A 3BSCA 4B9NA 3PR4A 4E19A 4FS2A 1KVCA 4KRFA 4FXDA 2R2SA 2KTQA 1BI4A 3QEXA 3VQBA 4TN2A 4Q0BA 1VSEA 1TL1B 4AHCA 3HVTA 4CJWA 3RMAA 3MFIA 1FKOA 3AVKA 3H4BA 4K8XA 1CZBA 2YNFA 3VQ8A 2KW4A 1BCOA 4MK9A 4R0EA 4DLEA 3GV8B 3H5YA 3RBDA 1W0HA 2RF2B 3O4QA 4O4RA 5F8MA 3THVA 3OYCA 2ZD1B 1I3AA 3QEPA 4EYHB 4NCAA 2GBZA 3TAMA 3G10A 3LP1B 2AWZA 1JLGB 2GC8A 4YR3A 2G8FA 4R8UA 3K57A 2IM3A 3CWJA 2D7SA 2P5GA 3OYAA 1NOZA 1IKVB 4CF9A 3KLHA 1TKZA 2JC0A 5JS1A 5EWFA 5J2MB 4CGJA 3L2WA 4RZRA 4IFYB 1S1XB 3CM6A 4O55A 3SV4A 2QKBA 1HQUB 3TANA 1SUQA 1TK5A 4LSNA 2FVSA 1D5AA 1QE1A 2CJQA 4RUAA 3L2UA
chains in the Genus database with same CATH superfamily
4GNIA 1FJGJ 2Z2ZA 4LF8F 3DXKA 5EX5A 3DRSB 2GZOA 3NAEA 3MR5A 3NGSA 1RI7A 5KG2A 4BDPA 2B4UA 1VQKN 4CIFA 3OBWA 2RQKA 4HCCA 3CO0P 3SUPA 2E1MC 4DX5A 4J9RA 2HVDA 2BANA 1GEHA 3CVKA 3C94A 3DRPA 2AW0A 3LTOA 3OT9A 1FERA 1HNXJ 2OEKA 1U1NA 4F4ZA 1ASVA 3K9JA 2HNDA 2R4FA 3P96A 4KGMA 3KJVB 3IDHA 4K59A 5AE2A 1TK0A 5LMUK 2UV8G 2FY8A 4LVNP 4AE5A 2LFVA 4NXNF 1RA7A 4M3YA 2JFKA 3ILJA 2B4OA 3D54A 4P10A 2UUCF 4F3TA 1RBAA 2Y1RI 3EO3A 3ILLA 4NZ6A 4AILC 3R5JB 1WEXA 1XQSC 5C2CA 1N48A 3MUMP 1VQOS 3MEDB 1T6CA 1W2BM 5DK5A 2FBYA 3DHWC 3VQSA 2HGNA 3EVOA 1U1QA 1Q8BA 2L9WA 4OI2A 2FLLA 4ED8A 3CMEN 2R7TA 3T6JA 4ZLPA 2BH1A 3CJ8A 4HVZA 4ICLA 1IBLK 4RPFA 3R9LA 3ZETB 4LT6A 2KT3A 4OYZA 3LQVA 1BU6O 2JZ5A 3UO0A 2V69A 4IH7A 4MIWA 2N3LA 3M9MB 2IYIA 2I1RA 4LF1A 4IUFA 3SCXA 3NLCA 5IQ6A 5C2DA 2GIRA 3U1NA 2KRBA 3IMQJ 1Y64A 2QG9B 2E66A 1GOBA 1IBMF 2HOEA 1GOAA 3CXCR 2F8SA 1FHTA 5BXIA 2LYVA 2YX6A 2XY7A 4DV1K 4UQGA 1P8GA 4C3LA 1DARA 4K5SA 2BDPA 4DKWA 4QR1A 4IBNA 1BQNA 2A3ZA 5KTQA 3M32B 2YI1A 2PA3A 4F26A 3KHLA 2ZH1A 2B5JA 3CIMA 1SJ3P 1OY8A 2HQGA 3T1YK 4UUWA 4TNOA 3VAJA 2GGPA 3QAEA 3DXBA 2HGMA 4H54A 4OZ5A 3BF3A 3SV3A 3B8AX 4ES3A 2ZKTA 3MCSA 2BKPA 4M3UA 1X3MA 1HWKA 4KI6A 4A8MP 3IGVA 2DNLA 2BOPA 2D0PA 3ZEUB 4A2BA 1PJ7A 4ID8A 3HZ6A 2XBPA 4DHYA 4LSLA 5JMNA 2ZH2A 2EFVA 2GUIA 2W6KA 1TKDA 1OYDA 3TO8A 4CO2A 4DR1J 2HRTA 1S4FA 3MPUB 3OFFA 4LF5F 4IFEA 4FJGA 3LP2A 3Q83A 3TAQA 4DR7K 1TUYA 1BOTO 1TKZB 5HI7A 4C3KA 1NPPA 3DYAB 3LAMA 4WYLA 5ETMA 4PXDA 3GJQB 4DI6A 3V6DB 2O8BB 3IRWP 3ENHA 4LFAJ 3MXHP 4WF9L 3IUCA 1VQPN 1QE1B 1VC5A 5IC6B 4OIXA 1IBKF 4Y6IA 1LW2B 5M2PA 1RTZA 3I96A 2AP1A 2CQ1A 2EK1A 1HWLA 5M2RA 5IT0A 3AD9C 2VDHA 1KBRA 5AQYA 2WBRA 2V8VA 1YDLA 4FJLA 2VPXB 2D5RA 2QE5A 2VA2A 5CXTA 2A1RA 2ACYA 1NDCA 3DJCA 3D4JA 3KG1A 3VPZA 2XMKA 1B0PA 2XMTA 3EUNA 3FGUA 4NLTA 3QBWA 3T69A 3T5LA 1S72S 4IFVB 1PBUA 3OW2M 3FFKB 3PV8A 3ULEA 1IKVA 3MK6A 1VGYA 4DN0A 1Q81T 2CQDA 4FJNA 3O9TA 3P5JA 4YEAA 2AIRB 5AQHA 1WUAA 5AZJA 3CMAN 1M1KT 3KHRA 2OI2A 4KGKA 1UPMB 4RW9B 1UETA 1KC8O 2OYQA 2ZZMA 3QZ8A 1TL3B 1LWCB 2IVYA 5KFMA 3OHBA 2VG7A 4X4RA 3FCWA 1SL1A 4J9SA 3CB4A 5HBMB 1TZ0A 3ASMA 4FPAA 2CQHA 1JCFA 4FLZA 1S0OA 3EICA 2NRZA 4O0NA 4OX9K 1GX6A 1BQMB 4EU0A 3RU0A 2LQ5A 1Q86O 1LNQA 1JB0C 3M7VA 3RW7A 3OYIA 3DLBA 5L8RC 3L2RA 2YKNB 5DM7L 3H1VX 2CQ3A 2C42A 2C2ZB 4M3ZA 2M8HA 2MLYA 3O1WA 1ZA2B 3TAPA 1S1UB 5J1NA 2Z2YB 2E5LJ 1U2CA 4GW6A 2I5JB 3J80Y 3BY5A 1RHRB 2W24A 5H9EK 3D2FB 4DL4A 3ZCMA 1L3TA 2YH1A 1GXUA 4O0JA 4A48A 4ECUA 3KVGA 2JWNA 2DNPA 3CPEA 4LF5J 3JTOA 4QS8A 1LK7A 3V5RA 4NPOA 3KMSA 4LR9A 2AGPA 3QMLA 2WVBA 3GFZA 4LRCA 3SUOA 5FLXY 1YJRA 1KWMA 1CZAN 3W1YC 5CABA 3OS1A 1RDDA 1GMVA 3P45B 3BB5A 1IBKJ 3BS9A 1URRA 4A8OA 4B08A 2ZUAA 1JLQA 3SSSA 4A46A 4RW4B 2VC0A 1S99A 2ASJA 3OTOF 2YHAA 1UW4A 1XMBA 1K8AO 4DQIA 2VC1A 3THWB 4JAXA 5B08A 3MAQA 2I7PA 1VSKA 2AKWB 4MYTA 4QW8A 1XR6A 2U1AA 3RVCA 4B3TK 5DMRA 3BYPA 5HVGA 1OVYA 5E5NA 4O8KA 3AODA 1VSIA 1W7AA 1TV6A 2GX9A 3BN7A 4DCHA 1NKCA 2IGIA 3MXIA 2Q79A 2DEJA 1U1PA 3FCVA 4CLFA 5ADXH 3THXA 5I42B 1FKPA 4OV1A 3UFCX 5KG7A 3VR1A 4JI3J 4DV0K 4OLBA 5MLCQ 3PW0A 3RB3A 2P9SA 1U2FA 2RHKA 3V2UC 4ERDA 3AJ1A 2DITA 3NWGA 2B6AB 2DNMA 4NLGA 3Q8YA 3NH2A 2UVWA 1H2VZ 1KLMB 4WTYA 2QRRA 3E9PA 3TA0A 4QBUA 2Q3SA 3CC4S 2MKCA 5ETLA 5KFVA 3IFEA 3ZC4A 2X1GA 5T7LB 2W41A 4B3MF 2HHXA 3NBPB 3V4MA 2EXUA 4WZQA 2BBEA 3BF1A 2G1DA 1S6QA 1N34K 4CO3A 3N9UC 2B8QA 3PACA 3HFKA 3M8ZA 4WIIA 4RUHA 5AZIB 2MPUA 5GAHU 3PM9A 3IG1B 1QAYA 5D0EA 2Z57B 2FD2A 3JTPA 3W2WA 3A5LC 4PKHA 4AQYK 3MN6A 4C98A 3TEGA 4DX6A 4WU2A 1NH7A 4ECVA 5IM0B 2W9AA 1TFYA 3DLKA 4Y2IA 2H9ZA 5FDLB 3G4SS 4H4OB 1KXPA 2DEIA 5A8KA 4ZLJA 1NHUA 1NLKL 1OH5A 5J2NA 3PFEA 3TTDA 3W65A 3DGVA 4ZPTR 2HF4A 2V50A 3I8DA 1TYQB 4KO0A 4JV5F 4JI2K 2CRLA 2NNWA 2WAQD 4RWTA 2PSZA 3AFGA 2P9LA 2D0AA 4AHTA 5CZ1A 2C2DA 5B0AA 2CQCA 2QLBB 3F5TA 4JI8F 1RYRA 2MY8A 4Z4FA 4CZLA 3VAGA 1BA0A 4JK9A 5HLFA 4ZCLA 3M1VA 1W2IA 1TR0A 1PSDA 3G82B 4UOGA 1OKJA 1HIYA 3MM7B 2JLGA 3CERA 2QWOA 2CKWA 3PDNA 5H9FK 2VBZA 3C14A 4MQ3A 3QINA 4BC7A 3PCOB 3MCPA 4EAHD 1QSSA 3SMSA 4WPAA 1CBKA 1WTFA 4YHHF 4F0HA 3POTB 4DZDA 3O3GA 4J37A 3TR5A 1RCOB 3AO5A 4NLSA 3KLEA 1FDBA 2OPRA 3MEGA 4DV3F 4IOBA 4M63A 3QRRA 4O3SA 1ZAXA 2ASOA 4G1IA 4CFDA 2J7KA 1S1WA 2FJDB 2WONA 4LRBA 1SKWA 4YY3K 3WIUA 4J2EA 2ILYA 3CCEN 2IBKA 4JBCA 1M0SA 2CVIA 4GVBB 2VWBA 3C6UA 3EM1A 4FYDA 2GO8A 3NMUA 5DLGA 1UAWA 2HHVA 3AV9A 4IQMA 1ZPWX 4ILMA 4GC7A 2FTRA 1V5IB 4R5PB 3G6VA 3BGRA 3BKFA 2FLNA 4J9PA 3G96A 5CHIA 1SQFA 4M5MA 3QRQA 3P4IA 2OMLA 2G13A 1LOUA 4F0KA 2FY1A 3MF5A 5DM7Q 3GSDA 5E2QA 4CNYA 3RTVA 5E7OB 2PE8A 4WQ4C 3I4PA 3MWTA 1T0TV 2WSFC 3ULHA 2RAQA 4L73A 4MTPA 5E3CA 3MMBA 3IP0A 5A8RB 2XMAA 3JS9A 5C5JA 2I2YA 3ZT4A 4X4VA 2ZJPL 1ZZFA 4QIWD 1RDWX 3PUFA 3NH1A 4EHTA 5EVZA 2FB0A 5DO2A 1IWGA 1G2EA 1S7IA 4AF1A 4AL5A 4GY2B 4DSIA 3MPVA 4YMEA 3V1QA 1C4CA 4LF9K 2P9KB 3KJFB 5KFDA 1S48A 1UKUA 4DQPA 5KG6A 4M45A 4EO8A 2FC9A 2PMZD 1BISA 3HK2A 1SKUB 4NEZA 3T1HK 1AUDA 2UUAJ 1Q82T 2QIFA 4JI0J 3MMVA 2NXUA 4UY8O 1LV5A 3K0JA 4LR7A 2VFVA 4WXWA 4Z7YA 3HO1A 3OVNA 4DQRA 3CXCM 5BR9A 2W4PA 1U1RA 2F4VK 2W9CA 5FIIA 1NB2A 4J91A 1S0NA 2ABYA 2C3YA 3G6XA 3ET6B 1P27B 4ECYA 1JXEA 2UU9F 2A3JA 1NBWA 2HVHA 4CD3A 4E1NA 5GAGP 4Q8FA 2A40A 1RLDA 3G0ZA 4EI2A 4CGHA 5KFWA 4KH4A 4IG0A 4IJAA 1SCJB 4YDUA 1GH8A 3R8YA 1VAZA 4XDDA 4YOEA 2APOA 2CPZA 2V67A 3L2VA 2H48B 2BGGA 1ATSA 4LF6J 2V0NA 1RAHB 3TUPA 3KK3B 3WHIA 2M8DB 2CWKA 2D3UA 4M3WA 2DB1A 3MEKA 4CWBA 3BPDA 1KAYA 3TSPA 2WW4A 4B9MA 1VSJA 3NGKA 3Q89A 2GHVC 4HLBA 4H5WA 1VMBA 3UQSA 1RFQA 4DV3J 2YHWA 1HNWF 1DKGD 5C15A 4M5IA 4N56A 3FR0A 2C1EB 3QERA 4IDHA 4PQAA 1GFWB 4K0KK 4W5TA 1BHLA 1LWEA 1QS4A 1S9GB 4WBFA 2GMJA 2JJ4D 2W2MP 2KYXA 2B0GA 4DL7A 4JYAF 1FWKA 3OSPA 2EG2A 4KIAA 1F21A 3P6YC 4KHSA 4U95A 1S5ZA 1R0CB 1R31A 4NA1A 3FQKA 1B7YB 2H3EB 2HS0A 2G8VA 1HLUA 4DR2K 5AQLA 4L6V3 1Q8IA 3HYFA 1UA1A 1FO1A 1SKRA 2DGOA 3NFAA 1LK5A 3V6JA 1YVFA 3T9NA 2O8EA 1NCLA 5L1JA 3ZSVA 4FLUA 4FDFA 4LC9B 1U02A 2G9OA 3SFGA 4BQLA 1JIHA 1S77D 2HHPA 2J8SA 1X4FA 5MLCV 3R5BA 4JI1K 2UXCF 3A3PB 3EKUA 3LA0A 3KLFA 5M1KA 3C7NA 2ZHOA 2MLXA 5TKYA 5L9XA 4OI1A 8AT1B 1VLOA 3SQGB 4DTMA 4ZITA 1IKWB 3M8QA 5E33A 2NRWA 5ETOA 2ILZA 4YQWA 3GP9A 5E0OA 3OYKA 4ED0A 3FGVA 4F25A 1RNHA 1FE0A 1J27A 2DCLA 1JLFB 4MO4A 3IWXA 4RU9A 1NBEB 1OQ6A 4FZVA 5L1IA 1T9UA 4I7FA 3ID8A 4I56A 2NZTA 4QIVA 1RT6A 4DTOA 3NGIA 2ZZNA 1YJWN 3V6HA 4ITSA 1OS5A 4WCEL 2G8UA 3T6BA 2EFOA 5J2PA 2Q6BA 3G8SA 4LFCF 5I3QA 4CF2A 3TARA 3O5BA 5EX3A 3NMAA 2GAHC 4XH5A 5I9EB 3FZMA 3FBFA 3HCXA 5LMUJ 5JVHL 4DN9A 3Q8SB 1X4DA 1T05B 2OSQA 4WFAQ 2YWGA 2VQEK 2DH8A 2JGUA 1HJRA 3G86A 3NL0A 2H51B 5BPNA 3O9QA 4HTLA 3VEYA 3UE5A 4QWCA 3B4MA 1F9FA 2ADBA 2IRXA 3K5NA 5KFIA 2HURA 2CYYA 2UXDK 9ATCB 3EDRB 4LJMA 3OL9A 3FRZA 1XMOF 3IA0A 3W2VB 3BSOA 1REVA 4AHRA 4JRPA 5F0WA 3QICA 1IBLJ 5BYRA 4TQRA 3QSIA 5ETVA 2IBOA 3DRYA 3GJTB 2OPQB 1U09A 5AQMA 3AXMA 2HNZA 2LP4A 4U7BA 3IGNA 4DSJA 2OEJA 4WFNQ 3A3NB 4PG4A 1J2VA 3QEIA 3HLUA 4X64F 1NDLA 2GQ2A 4JYAJ 4KTZA 1KTQA 2QKKA 1E6VB 2AF6A 2RDIA 5DDOC 4LD0A 3AGRA 1NGFA 4RBTA 5GAGI 4DCOB 3GV5B 2WVFA 4DV1J 3GIIA 2AYEA 1FRKA 4Y00A 1SV5A 3LANA 1XERA 4DS4A 3AOBA 1X1PA 3SJHA 3FC9A 2KG1A 1Q79A 1ZAWA 3RSEA 2UUWA 2WZ1A 5C25B 4J90A 2H3GX 3BGUA 3T1YJ 1Q0NA 3AXKA 1R8BA 2NRXA 2HNYB 1WDTA 4ZP7A 1ZBFA 4ETXA 5AQJA 1KVKA 1NJYA 3U1MA 2RH3A 2XYHB 2C22A 3ITHA 3CCZA 3VF4A 5IT9O 2FF6A 4K4SA 3CDWA 4USTA 3I33A 2OGUA 3OHAA 2VKZG 1MROB 4CJQA 1NSQA 3HRGA 4URQU 2FPHX 2DR5A 3IS9A 2R7RA 3KLGB 1HR0K 3M30A 2GCFA 4DR7J 3P5TL 1ZBLA 3W66A 4H5TA 3G25A 1XUPO 4N8NA 4EP4A 2CNOB 3O8MA 4FOIA 1VBYA 4B1XB 3OUYB 2QJ3A 4LFCJ 2IJNA 3LPTA 2EWHA 4NA2A 3J81Y 3EZOA 4W98A 3SQ1A 5AE1A 3K5MA 2DY9A 4NLCA 2KFNA 4W5NA 3C16B 4N5SA 4PRFA 4AT1B 1WSFA 1CJTA 4G65A 2P8IA 3JXUA 2HBJA 2W9BA 3U8XA 3ZXWA 3DLGB 3WQPA 2UXBK 4AD6A 1HHSA 3KK2A 1H2UX 1UZDA 4F4XA 2KXFA 1TGOA 3MUTP 5LMNK 3MPDA 4KH0B 3AA3A 1S72N 3UVJA 3QZ7A 3L6QA 2VQFK 1HW9A 3MX2A 1N6QB 3J7AN 1N56A 2V7ZA 3OYJA 4CH7A 5AXKA 7FD1A 3M8WA 4Z0UA 4RUBA 4LQ9A 2PDAA 5FD1A 4GRSA 3CIZA 1Y97A 1JLBB 1IWAA 3R8EA 1T9TA 4FWOA 3AJDA 3LPUA 3O1BA 2YXLA 2J0QD 4E7IA 1VQYA 4M5HA 5EOYA 2OSRA 1RDBA 1P9YA 5HN0A 5HMYA 4BQZA 5DG8A 1ULRA 3MTKA 4Z37A 4CLPA 1RWKB 2E1RA 4PL8A 3CJ4A 2UXCK 5M1OA 3CQXA 4A5BA 1Q9XA 1BA1A 2UVUA 4M42A 4CE9A 2KU7A 4CLTA 3EE8A 3C6HA 3NMRA 4YR0A 2ZM6F 4JS4A 5KFFA 4OX9J 1V9OA 1BI4B 1DLOA 4Q0BB 3B6BA 1GXTA 3FQLA 3DLHA 3HSCA 4AH9A 3HVTB 4FWPA 3W61A 2YNFB 1QSLA 1Q8KA 4ED6A 4UTGA 4PUOA 1M90T 4RTFD 4CEOA 1BCMA 4NYNA 4TLRA 4GVEA 4HUGA 1VK8A 3RB0A 3KWIA 1M5VC 4DL5A 2HQFA 3VAMA 5H9EJ 5DZ7A 4FK2A 3SPYA 1VRTA 1IBCB 4J9VA 1N36F 4D3GA 4E7JA 1VQMN 3WT0A 1NJZA 4BC3A 4KFBA 3ZSZA 2CPXA 2MQPA 2MZQA 3BGFA 2B9YA 2Z8QA 1H72C 2MKSA 3EGVA 4PYAA 1NGEA 4CEBA 3S3NA 3BUZB 2QM1A 2VPYB 4DQQA 1S1TB 1R8PA 1TL7B 2DNYA 3MCMA 2HRUA 2Z30B 1JWWA 1NU0A 3DXKB 2AD9A 2Y8YA 3HP6A 2XYPB 4KH1B 5KOXA 5KG0A 2F5GA 3NOCA 2NYIA 1R89A 3R1HA 3GE1A 2U2FA 5A0YA 2JWKA 5KFEA 2VGMA 2MKHA 4BBYA 1Q53A 5HL7L 4OHYA 4NMLA 2HBQB 1NGJA 2WSEC 4DV2F 1OO0B 4DR3K 2QXLA 4G6VB 4OYXA 4ZPBA 4IO9Q 2E5IA 3V81A 4DCJB 2AX0A 2HSEB 4DR5F 1IM6A 2OELA 4PPZA 1NK6A 3IWLA 4OPKA 2QL7B 4L72B 3TA2A 2AA4A 3SMPA 4B3TJ 5G4DA 2WVDA 3UDCA 4UF4A 3S8SA 3BBBA 1JJCB 4E7HA 1RTDA 4DQ8A 2BJ8A 1ZH5A 2CPDA 5KAKA 3S6EA 1XQIA 5KG3A 2K7JA 2OKQA 4HCBA 2XLIA 3HF5A 4RBUA 4PYDA 4CFAA 2Z0GA 2DNOA 3MMAB 5DQGA 2X6NA 2GHPA 2E5JA 1V5VA 1JXVA 4DV0J 5FJ4A 1WUUA 4BR0A 3FRYA 3AO2A 2E7VA 2QXFA 1SC4B 3AVGA 3DRSA 3H7HB 4NX9A 2F1FA 3TSQA 3CC4N 2GQCA 1IQTA 4P74A 1CVJA 2Z58B 3CCJS 1H1VA 1FD8A 4M3TA 3L3VA 2EG1A 2QYGA 1Q7YT 2ZH8A 1T94A 1UP1A 4JI4F 3VEVA 3N79A 2MZSA 3UD3P 1BLUA 4X62K 3HM9A 1N34J 1C0FA 4JI7K 3GPAA 3Q8UA 4FJIA 3EZ5A 4I2PA 3MWBA 3QESA 4KB0A 2FZCB 4CJ5A 2QA4G 4AQYJ 1M5PC 1GAOA 5ETQA 1EP4A 2JEGA 2BOAA 2XMVA 1BQNB 3G4SN 4LSZB 2DR8A 4KI4A 2XMUA 4L76A 2B5JB 3NRBA 1HPZA 3ZSXA 2V8GA 1WG1A 2DK2A 1EQYA 1GMWA 1J5EF 3FCHA 3FZBA 3T9ZA 4USJC 1EO1A 4BROA 1SB6A 1HYSA 4JB8B 3PEJA 1Q81O 4O5FA 1BG3A 4LSLB 3PIOL 2C3OA 2BXJA 1UMJA 3HSTB 5HRNA 4UZBA 6FDRA 1YITS 3LP2B 2ZC4A 2ZBRA 1M1KO 3IC1A 3O6QA 1Z25A 3CJCA 4USUA 3AVBA 1YRTA 1HI0P 4MKYA 2RT3A 2MGZA 2W4DA 1HI8A 3OQ2A 1YRXA 2V7YA 1RLCL 3NGTA 1RDAA 1AA1B 5H9FJ 4EYIB 1JLAA 1CC7A 3ZT1A 2Z56B 4NLXA 5ETSA 1RBUA 1ZA1B 3KTQA 3M32A 1LAWA 2E29A 5BYQA 4DU8A 5THWA 3ZTPA 4B9NA 3LL3A 4CBUA 1W26A 2E44A 2IVFB 2QA4N 2KTQA 2FGCA 1QLNA 4TN2A 3OV7A 3HHLC 4YY3J 3KNGA 4C1NK 3G2XA 2KW4A 4EUVA 3ZEUA 4CZMA 4ZVTB 4DLEA 4GKJF 3H5YA 2AJ1A 3BBCA 2YJEA 3TVYA 1GLFO 3THVA 4JKEA 4DDFA 1I3AA 3QEPA 4EYHB 2G8FA 4R8UA 4RL1A 3K57A 1RADB 1T9WA 2D7SA 1WC3A 3ULEB 1IKVB 4J7CA 2KH9A 4CF9A 3KLHA 1TKZA 2ZOGA 4OPHA 5JS1A 1UCNA 2DO4A 4H03B 2VICA 4RZRA 1MSWD 4FO0A 2QKBA 2VBWA 2XS5A 4BLGA 3BKUA 2O8BA 2HFZA 1SUQA 4JI6K 4LSNA 2ZUGA 5HJYA 2FHKA 1QE1A 3BO2A 3LPEA 3VVUA 2VODA 2A41A 2P51A 3D1QA 3ZZTA 3FVYA 3PW7A 3GCWP 5JMVA 4AUKA 1U0HA 3NCQA 1WORA 1YWXA 5I3PA 3R2DJ 1UVIA 2Q0RA 1RT5A 4ELVA 3SQ0A 2FBXA 3M2UB 1H2TZ 4CHNA 1ZM2A 4LF9J 3W9JA 2PFUA 5E3PA 4FNIA 3QJLA 4YOVA 5AQWA 2KN4A 2JEFA 3QFUA 2ZZTA 5CCLA 4IQXA 1ESVA 2RU9A 3MM9B 2QWLA 4JI5F 4NASA 1HD1A 2NREA 2G8WA 1GLBG 3T1HJ 4USVA 4IFVA 1T44A 2HHUA 3Q8VA 2NLWA 4WP9A 5HL7Q 1JL1A 3D5MA 1TVRA 3NS7B 2DJWA 2W25A 3HHDA 2Q1LA 2ZE2A 2F4VJ 1QHAA 3I56N 1XC3A 1YZ6A 3G9CA 2RQCA 4MH8A 3WX8A 3LDSA 3UKUA 3PHTA 1G3OA 1U2VA 1CLFA 3OD2A 3UN5A 3CQYA 4PR6A 1J53A 3L7UA 1TL3A 1LWCA 2J6SA 2BQUA 3VAHA 2YX1A 4DF8A 5JVGL 1XR7A 1U1MA 4CJTA 1W25A 1BUPA 3E9LA 4H8KA 1RT2B 3WXIA 4R0JA 2BRLA 2EW9A 3IBFB 5D0HA 4B1VA 4A8WA 3GYNA 3H98A 3DFEA 3RAMA 4NLQA 4NWBA 1DGKN 1WC4A 3I55N 1FDNA 5H1SQ 2KL8A 3TJAA 3QSYB 5DQIA 3NG8A 2BJ1A 1EKRA 4P71A 4O4GA 3OL7A 4CF8A 5D15A 3DCAA 4M7YA 1EX4A 2BM0A 4C0HA 4K0KJ 2E2QA 3RBEA 4U67L 3MURP 1N5YA 2EFNA 5AQQA 1S1UA 2KM8B 3OVAA 4OX6A 2I5JA 3HZGA 2W2NP 4GKJJ 1GQEA 3D2FA 3FZHA 5HROA 3EGWB 1NGBA 5AQRA 5DJBA 4ZP8A 3ZZZA 1NG9A 4DR2J 3GIKA 4QR2A 3RR8A 3THXB 1QTMA 1FKPB 1Q5YA 2CWXA 4YS2A 1P1LA 1HJOA 3NEKA 1KKHA 1CXUA 4Z4IA 2P9SB 1R7IA 1ZETA 3AAPA 5L39A 2ERRA 2RRAA 3T5KA 2IY5B 3OTCA 4JI1J 3M6VA 1YTUA 1B9FA 4FJ7A 4PXBA 3PZPA 3Q2TC 2C2EA 3U3YA 4Y34A 1N5QA 5KGXA 1U1LA 5DGAA 2POKA 1ICEB 4E98A 4RW4A 2RU3A 3TABA 1S6QB 3U9ZA 4OZ0A 1WC6A 3SMZA 3CT9A 3P49B 1KVAA 3THWA 3PIOQ 1RJJA 1CG2A 3AA8A 5KPZA 3W2WB 1SH3A 3CD0A 1HBOA 4PABA 1N54B 2KHOA 2ADCA 2XO6A 2VOOA 2LXUA 1KD1O 3DRXA 2PYLA 2EFGA 2HAIA 3DLKB 5FRMA 4CT9A 1X4GA 2HWIA 2G8HA 2C3MA 2J0WA 3HKWA 5A2QY 5A8KB 3BJYA 1Q9YA 4AM6A 3KJQB 3TW0A 3V9WA 5E84A 3BBFA 4NMXA 1NZAA 2PFFB 5D0RA 4ZPDA 2B6AA 4RW8B 2ZGYA 1UWAA 4Y28C 4UY85 1K0TA 2P9LB 1KLMA 2ZD1A 4DTRA 2V4QA 3LP1A 1NJIO 1JLGA 5JICA 1VQ4S 2ZGZA 5IOLA 3M8SA 4DFPA 5T7LA 5IZHA 3OL8A 3H1QA 3IBWA 4XH4A 1HKAA 1OYEA 2F40A 2JFDA 1PC4A 3TWZA 5HLFB 3KJNB 4IFYA 3V9XA 3M1VB 2ZBQA 2PD1A 3WC0A 2L9DA 5AZIA 1HQUA 1DEJA 3F9KA 2WHOA 4OZ3A 3HPGA 4DOZA 4FL9A 4NO7A 5GAHI 1HNZF 2ASPA 2K2PA 1KQKA 4CEAA 2AJFE 4YB1P 3C14B 2DBBA 3PJXA 1FNOA 4FS1A 5IM0A 1O51A 3OFGA 2BRKA 2HMIB 3GV7B 2A2DA 2E9RX 5GADP 3FMBA 4DL3A 2LQJA 2YPZA 3HVAA 1C0TA 2Z1HA 3AAQA 4CK2A 1S1WB 3VEZA 1TYQA 2WONB 3PSIA 1A7GE 1X7VA 1Q82O 3V4IB 2E7XA 3ZX3A 3TOQA 3LO3A 2VHGA 4O44B 1Y11A 4EIAA 4CW7B 4NZ0A 4FPIA 3ISNC 1RTJA 2CNLB 4M5LA 4HEA9 2E6LA 3OY9A 2X6SA 1NNEA 4FZYA 4ZVFA 1F9HA 4OQJA 3PX6A 2R8HA 4AM7A 4X66K 3THPA 4OVLA 4FJHA 3BGRB 1GMUA 2CG4A 3OHRA 3A8IA 4B3SK 3L0QA 1KAXA 2GNKA 3J80U 1RCHA 4AHSA 4K41A 2NRHA 4DV4F 2AJ2A 5HMZA 3QIDA 3QFWA 4ZPWR 2ALZA 4F02A 4AYBD 4OL8A 3M2RA 2ROEA 3UWTA 5L9NA 3CCRS 2HZAA 1PBAA 1XR5A 4WQ4A 4OYBA 1RHQB 4X65K 4WE1A 3MMBB 4XPCA 3JQKA 1EQMA 1S59A 4O3NA 1HR0J 1YAGA 2JVRA 2WC9A 3M6UA 5FLXU 2P9NA 2KJWA 3VA0A 2XC9A 3BR9A 3GWCA 2CQ4A 3GYXB 4ZDNA 3K89A 1JLCA 2HFUA 3QNWB 2IOCA 5JXSA 5JVGQ 1OSCA 2LMIA 4WFBL 3R5DA 2CFXA 5HVHA 1Q7LB 3NOGA 2QYCA 1NK0A 2XMMA 4FWLA 1TKXA 3V6KA 2E9TA 3A5OC 2RDJA 3ILOA 3QDKA 1RT4A 4ZVOB 4PAAA 3HOTA 4NRUA 1W9HA 3VETA 4R5PA 2V52B 4IRDA 5F8JA 1K73T 1LW0A 2ZH4A 3K5LA 1QVGR 4FJ5A 1HNVA 4H4MA 4OLPA 2ZNZA 1A9NB 4EBDA 4KY3A 3KWMA 4J9NA 3OYBA 2A6MA 3NGRA 1IXKA 3QQCD 4CQ1A 1SL0A 2UXBJ 2G1HA 5GMEA 5LMNJ 4QPXA 2DYAA 2LQ8A 1VQ8S 5ADZA 4K8RA 3AVMA 3NCIA 2MJUA 4CNZA 4IG0B 2VQFJ 1F0XA 3CCUS 1YTYA 4DUTA 2VBXA 1U6ZA 5SWMA 1Q4RA 1MWZA 3BKTA 5HRSA 1V3ZA 3CC7S 2BACA 3OYMA 3GG1A 1GTEA 2EKYA 1S57A 1QAXA 4Q5VA 2FZGB 3CCVS 2GIFA 4HI1A 2NRTA 1N32F 1FRHA 1RYSA 2PMHA 1WNEA 3AA2A 1R8HA 3DU5A 6FD1A 5K20B 1W2BR 5H1SV 3Q24A 2CQIA 2MZ1A 2DRBA 1CQNA 1X5PA 5IWAK 2RUSA 3O2IA 3KOAA 3M8PA 3CIPA 1S12A 4CDIA 2DXDA 1LWEB 4A62A 1V3SA 4DB3A 4DR6K 3CQ8A 4G3IA 1B4SA 3R1LA 2ZDOA 4DTUA 1I5OB 3TR8A 2HQ3A 4RO0A 4FF1A 4O3RA 2QEXS 1VHIA 1L3UA 3FLCO 1O5JA 1TMJA 2X78A 4QCLA 4FOEA 4NXMF 2R2UA 5LXRA 2O8EB 2RRBA 1D9FA 3VQPA 1OMSA 3MUVP 4PEOA 4ZP9A 2HGLA 2A18A 3QMQA 4DPOA 5HVFA 3NY0A 5D4OA 1S0MA 2FXUA 5D8HB 1AB8A 1NZ8A 1VQ5S 3F41A 4RX6A 3D7SB 1I94F 3HSJA 4P7VA 2BEFA 1NM2A 2KT2A 1MMLA 2AQ4A 1WKLA 2MQOA 3C7NB 3ZTQA 5ETRA 4KPCA 4IR1A 1NGHA 3SEOA 4RNFA 1VSLA 1UFKA 4KHUA 1PGZA 3IN5A 4RU2A 4CT8A 2BX6A 1CEZA 1FRLA 3M8QB 2QLWA 3FMWA 2HBZB 3UN3A 1P6TA 4LFBF 2IJFA 3MCAB 2H65B 1XMQF 1NRKA 5EGYA 4E3SA 2XO7A 1C4AA 4OZJA 1JKHA 1S9GA 3AQOA 3OJSA 2BE7D 2J6UA 4B3RK 2VJVA 3MFHA 1RTHB 3IMXA 1RT6B 2MHNA 1GLAG 1NLVA 3PTWA 3F0NA 1J9AA 2GO9A 5HAOA 3MN5A 4DR3J 3JYTA 3TP2A 5J2PB 5CQGA 5DETA 3VV2B 3CD7A 1WLJA 3W0LA 2QTWA 3RUBL 4DV7K 3RMBA 3P38A 2IDOA 3VESA 4LBPA 4K4XA 1HKGA 1NK9A 2DNHA 5KRSA 1A0OB 2PBDA 4CLYA 1LOTB 2IA0A 2OO4A 4CI6A 2IJRA 2WB4A 5SUHA 2GMHA 1BHNA 3L4QA 2CGLA 2D3OR 5J1PA 4ISEA 4IWVA 1SXLA 5HMXA 3VERA 3VALA 2RMLA 1GLLO 4X4TA 4BC2A 2EFQA 3SQGA 2JRSA 3FFIA 1YTAA 1HBUA 3J7YU 3TA1A 5BR8F 4RW7B 5FLXO 1XNQF 1HWJA 2KHCA 3LZJA 4DV6J 4CJ4A 1Z2LA 1REVB 3L4IA 2X3DA 4X4NA 4FVUA 1VSFA 1BQXA 3NXZA 4DU7A 3CCJN 3MOZA 1NKEA 4ZCIA 1T9VA 3JQMA 2DVIA 2HFSA 3T3FA 1U26A 4FF2A 4QAGA 3TI0A 2M2BA 4XO0A 3JTNA 3KUEA 2B56A 2O8FA 3D9BA 4I9QA 4K2XA 4DR4K 3OW2R 2JDJA 4X62J 4S0MA 5KFPA 4JI7J 3O4NA 5MAOA 2E6MA 2DT9A 4B9SA 3DI6A 2KZMA 4QYRA 4KTWA 3K9KA 5A6PA 2DIUA 2GJIA 4M3RA 1Z4UA 1RUSA 2SXLA 5AQTA 3ELHA 4JKAA 4H4KA 1CS4B 1M5HA 3QT7A 1MA9B 3RSEB 1K8KA 4YP3A 1X9MA 4XDCA 1YG0A 4QIEA 1VFJA 2CPFA 4LF7K 3JS6A 4DHVA 2ZHAA 2HFOA 1DAXA 3A13A 4IH6A 2MQ8A 4WFBQ 3J7AP 3ZTSA 3LH2S 3W2VA 2HQCA 4DZ6A 2OTJS 4QS7A 3ITHB 3A12A 1SKSA 2EC2A 2D3O1 2CPYA 3CE8A 3FZLA 1YJ9S 4U7UD 1WTBA 1J5OA 4NEYA 2OPQA 4KHMA 2EK6A 4K2JA 1VK0A 3IAM9 1YITN 1RWMB 3PIPL 1FD2A 4CH0S 3LGMA 2GVDA 3IS9B 3OVBA 2HHHF 4O8UA 1FVQA 2ITGA 2WOMA 3M30B 3SQOP 5BREA 1FDDA 3I5CA 2WBNA 1FXRA 1GNKA 5EX0A 2E1AA 2VWKA 3CG7A 3AJ2A 4V19J 2BJ3A 3N28A 4URGA 2DFEA 3U9DA 4KHQA 4ZVHA 3AOCA 2X1FA 4B3OA 1FRIA 1BC6A 3WC2A 3LDPA 2IM0A 1PJ6A 4LRDA 2FJWA 5F8HA 1O1WA 5AQXA 1N5SA 4Q2MA 4DJBA 3O6WA 4JHDB 5E26A 1FKAF 3WZ0A 2W7OA 2XI3A 5IXUA 2NCKL 1M90O 1DBDA 3CJ2A 3KYLA 5F3TA 1U7LA 2RKIA 4C3MA 1IKYB 1OH7A 1RU1A 5DG9A 4C8LA 3KK2B 2A0FB 2BUNA 3DRRB 1VI7A 4BCAA 5BR8J 4NLRA 4OI0A 2IVPA 3UVJB 1U2RA 3MDQA 2CJKA 3PYGA 5CAAA 2B9EA 4TU8A 3OYNA 2A6AA 1VHXA 3KLGA 1RB0A 3MX5A 2FHJA 5F8LA 2IIRA 4I6WA 1NSPA 3A8KA 3Q7BA 4FWNA 4BRMA 2FBVA 3L8BA 2Z1IA 2DHXA 4CYUA 1FJGF 5DQHA 2V4JB 3MXJA 2VL1A 2AGOA 4JI6J 1LXNA 4M1KA 2BJDA 4Y65A 5HMWA 2QT7A 3D6HB 1AT1B 3KFWX 1ASUA 1LWFA 2Q43A 3B8HA 1KFSA 3R7BB 3W64A 4DSEA 2XCAA 5KFNA 2O67A 2ASLA 4FYXB 4K8ZA 2CH6A 4O3QA 4GKKK 3F56A 3V1OA 3D1OA 1U49A 1S10A 2ITMA 3SQ2A 4Y1CA 4IDKB 1Q8LA 3MZIA 2J0SD 3BO3A 5LXYA 2HQIA 3TNVA 4F7VA 1RT1A 4DS5A 1BWFO 2D0OA 2LQ9A 4CF0A 1YUWA 4MO5A 3K17A 4PUOB 2FUG9 5F9LA 3CPWR 3RB6A 4Z4GA 2W40A 2HVZA 3GG0A 3H08A 3H2VE 1N6QA 4DEZA 1SAZA 5KFSA 3OTDA 2QLFB 1IKXB 4UZCA 2MZTA 1ZBUA 2YH0A 1W7WA 3CJAA 3C6TB 4DUYK 4W5OA 4KHWA 4OHXA 2H4YB 3G87A 2N4CA 4LIRA 4L75A 5GIOA 2HHHJ 2RRNA 4OI4A 2VFRA 4KFBB 3A1YG 3R7NB 3GR0A 4ZVRB 2AV5A 4M3XA 3CCLS 2J7UA 3AAWB 2CDRB 2LEBA 1Q7YO 1VJQA 2L9NA 4HDHA 3TUJC 1ZXOA 4H0PA 2NSCA 2Q97A 2AEFA 4J9OA 1CXQA 3C19A 3ISZA 1C1BA 3ZZRA 3P5BP 3S3MA 2HZCA 2JC1A 3HSGA 2Q1NA 1YHQS 3N6MA 3R9PA 3RMDA 1WC5A 2B4JA 3TQEA 1CJVA 5DZ6A 2HW3A 5K8MA 3VAIA 3V81B 3IAS9 5C10A 4FSVA 2NYHA 1PG5B 1DTQA 3C15A 2G0JA 2HK3A 5IT4A 1RTDB 4XEIA 1FX2A 1OY9A 3W5YA 2QX0A 2EC0A 1E3MA 1RWOB 2CPIA 4DUZK 3CJKA 3U1LA 3JAMY 2R2RA 1WHVA 2BKNA 2UUBK 4C23A 4OKJA 2NUHA 1WSVA 3MMCB 2LDYA 1S1TA 1TL7A 2WTFA 1S6UA 2ROGA 2CPHA 5FROA 4DR1F 1RAIB 4UOCA 1JCGA 1KHWA 1KR4A 2Z4PA 4BR7A 1VQSA 5F0UA 1QVGM 2E2PA 2E8AA 3VAKA 2W2QP 2VD3A 3QB0A 3R1XA 4EWTA 4M41A 4ES2A 3QGIA 5CZXA 3ZSRA 1APSA 1OJ4A 5AR0A 1QAJA 4LFAF 3NS5A 3AVAA 3HM8A 1DJ0A 1TP7A 5J1EA 3CJBA 2WB1D 4YOWA 2R7OA 1R0AA 4OX7A 2MDAA 1VIXA 4QPTA 4I2PB 3AA9A 4U8VA 3UR3C 1TMMA 4DMZA 2J76E 1EP4B 4IOAL 4NZ7A 1G7CB 3J81U 3MTJA 3UPFA 4FK4A 3TAFA 4CO5A 3I5AA 3MMAA 1ITGA 1HPZB 1FE4A 4BDYA 3EKSA 4F3QA 3MR7A 3T19A 3UE2A 2EI5A 3CF5Q 1EARA 2NR0A 2XULA 3ZT3A 2O8DA 3O8WA 1RSCA 1HYSB 1VQ4N 4KREA 1U1KA 2J7WA 1A5XA 2CZ9A 3MCOA 3LDQA 3N5BA 5BRFA 1D09B 4JKHA 4DMNA 2D3ZA 3PG9A 1TELA 1HQEA 5A8WA 3EN9A 4RLEA 3H6EA 4ZA1A 1DZ5A 3LW5C 4BR4A 4WFYA 5HATA 3H40A 5M2UA 3OLAA 3SQ4A 4KHPF 1B70B 2CAJA 2PAVA 2XHWA 2MGZB 1JJ2M 4JKDA 4TKTA 3LDLA 2Q0UA 2BV3A 2E1PA 3A5MC 3IRXA 3DDKA 3VF6A 3QWUA 4LVOP 5FPMA 2QFJA 1Y0HA 1JLAB 3HPHA 4F0MA 2BJEA 1JJHA 4HYKA 1UAXA 2B3TB 4DX7A 3WNGA 1H7XA 1HPMA 1R59O 3ZZUA 4K43A 3HL8A 4OYWA 1NSKL 5LOQA 4UW2A 2XZDB 4J2DA 2V63A 2BTFA 5K8PA 2Q66A 3KXDA 1PKUA 2LXIA 2I38A 1ZPVA 1VC0A 4KKOA 3HHLA 2E5LF 5AJ3K 4Z7CA 1FT8A 1D8YA 2XRIA 4F8RA 4B8CA 1KHVA 1HNXK 3PLAA 2E2OA 1CSJA 1Y5LB 1L3VA 2HQDA 1N0VC 3MM6A 4R8UB 1RKIA 4X66J 2WBMA 3MM8A 3G8TA 1XBWA 4B3SJ 2PA8D 1TTHB 3KLHB 3N4PA 3NF7A 2XCPA 3CCRN 1SC1B 2W42A 3NWRA 2YKPA 2ZJQL 1SUQB 3FDSA 4LSNB 2YWWA 4X65J 3KKRA 5HP1A 5BPMA 3DOKB 2M88A 2PY5A 1U0HB 2VKRA 4RWWA 1RT5B 3CMES 4L8RB 2CADA 2PEHA 2B4VA 3UB5A 4KBIA 4F4WA 4ZCKA 4WYBA 3KDNA 4BC5A 3OBIA 1H74A 4L3NA 2RD5C 1AXQA 2NXNA 3ZNUA 2A5XA 3H90A 1P90A 4ELUA 1Z2ZA 3W60A 2NLXA 1HKCA 4OYAA 5LJVA 4IKFA 2PMWA 4I1TA 1OH6A 2RS2A 4PHTX 1TVRB 4CM2A 1LAVA 4A61A 2KVQE 2ZE2B 4ECXA 4JI3F 5F8IA 4HKQA 3TZWA 2QL5B 3TUIC 2D74B 1VQ8N 4CLUA 1X9SA 5K14A 2CJ9A 3QT6A 3NNCA 2J8AA 2BA9A 1MWQA 3UKUB 3CCUN 4UOHA 5I4MA 1U2VB 7FDRA 3WQTA 1ZBSA 4KHPJ 2X51A 3K0SA 3GU0A 5D4LA 1FK9A 3CC7N 3EXCX 3Q86A 3UR0A 1KLNA 2HMPA 1HYZA 4LF4K 3GSIA 3PYDA 3QBXA 2QV6A 2RE1A 3M2UA 3MAAB 2YJFA 2Y3YA 3W5ZA 2W7AA 1YIJS 2VZ9A 3ZZYA 3J81O 2KKZA 3M2VA 5BRHA 4BE0A 4O4GB 4LF8K 3MM9A 2ZHBA 1MDUB 4CJEA 1DFDA 4Z4EA 4OV6A 2YKMA 1HYVA 1Y00A 5IWAJ 2HK2A 4YB6A 1FX4A 1X5SA 1HI1A 5SZTA 2R7XA 1JXLA 2Z1GA 4DU4A 1N5YB 4C1NI 4EFHA 4ZPVR 1SJ4P 3DHXA 3DLLL 4OYMA 4CESA 5KQDA 2XGPA 1GLJO 4CHQA 3W9HA 1GXLA 4MK7A 4DR6J 2XG8A 3AVFA 2E9ZA 1AFJA 2QEXN 2W7PA 3F2KA 5HROB 5ELZA 3K8VA 3JSMB 1F9EB 3KHHA 3MM5A 3TZZA 1M5KC 1H0HB 4E2FB 4KBOA 2PFDA 3BSNA 3KUGA 4GVMA 1RAEB 3VGVA 4B1ZA 3PW2A 2GTDA 1ZOTA 1QM9A 4CHOA 4NXNK 4BG8A 2DGSA 1LEOA 4A8QA 2UUCK 4B17A 3H5XA 3DDIA 2YVSA 1VQ5N 4KRWA 4L3KA 1T3OA 1YVNA 4QYZK 1RT7B 2VOPA 1RT2A 3SDEB 4C8KA 4ZIWA 1CZ9A 2WCXA 3CDBA 2ATCB 1N33F 2LVWA 2WW8A 3GG4A 4NCBA 2O5DA 3WNFA 3K2YA 3UDVA 3PO4A 2YKOA 3E1YA 4F4YA 2FLOA 4DSFA 2AGQA 2ZKUA 4BVPA 3I9ZA 1IO2A 2QLXA 3SUNA 2NZ4A 4C2MA 1KQSM 5EUHA 1Q78A 4FBUA 1P8ZA 5KFJA 4RNMA 4CEFA 1HARA 3QAUA 4B3RJ 1RP5A 4OHWA 1V6HA 1G1XA 4FZXC 4ZP6A 3S7RA 4WTOB 2DGUA 3D45A 4UQTA 1HBOB 2BKOA 1SS6A 3QGGA 2NUUG 3CMAS 1QJHA 4E19A 1IBMK 4QU6A 4FS2A 4KRFA 3MD3A 2R2SA 5AE3A 4FF4A 2BMBA 2QMXA 3LDOA 1YXQA 2P9IB 3VQBA 5D4PA 3CCSN 4AHCA 4DV7J 1AZSB 3MFIA 2J9DE 1HBMA 1ZAVA 1FKOA 2XB2D 3H4BA 3G8QA 1BCOA 4MK9A 2FZKB 4R0EA 2QC3A 3O4QA 4O4RA 5F8MA 2XEXA 3X1LB 5CHCB 2ZD1B 4NCAA 2GBZA 3LP1B 1JLGB 2IM3A 2P5GA 2GA7A 3OR2A 3OYAA 1NOZA 2I7NA 4OYPA 2E5LK 3K8WA 2L41A 4CGJA 5FPNA 2ZVSA 4IFYB 3AB4B 3CPWM 3AD8C 2AMCB 4I6YA 4U7UK 3SV4A 3I8BA 1HQUB 3TANA 3BZCA 4BRAA 5D6GA 2XYGB 3GONA 4LF2A 4LF5K 1XIQA 4KQZA 1NB7A 1KVIA 1FXDA 3L2UA 2R7SA 2GELA 2HFVA 3QT8A 4KGVB 3M5RA 3T1AA 2O4GA 4MK8A 1UWBA 4DR4J 1VR6A 2HB5A 4CK3A 4QWEA 1SJ1A 1URNA 1C0TB 2COLA 4FN5A 4KHYA 4CLZA 2Y0SD 4C9DA 3OS2A 3VCDA 4WF9Q 4FBTA 1F2GA 1IBKK 2UUAF 4BY9C 5DM6L 3RRGA 4RW8A 3DKDA 4JI0F 3K2PA 1FFSB 1VK3A 1UEVA 1ATRA 1YGYA 2FC0A 2JHEA 3B4DA 3WEEB 2MXYA 3O3FA 1RTJB 2AHOB 4JK7A 5CYQA 3AO1A 3RGIA 4XK8C 2E5HA 4K4TA 4LF7J 4NYFA 2NRRA 4I2QA 1N33J 2OTJN 3BYRA 4P6QA 3TVZA 4MKBA 3NF6A 2V5HG 4I68A 2XGQA 2Y1IA 3D66A 3H8YA 1YJ9N 1VCTA 4IYQA 1NSAA 2FJXA 4NCGA 1XNRF 3E3XA 1WEYA 5BRDA 1K1SA 4KB7A 1N8RT 2K7KA 2HEKA 4O23A 4LF6F 3M2RB 3GBTA 3CFPA 3MHYA 1WF0A 3AARA 3TJ9A 1HNIA 5CD4A 3SIPB 1U48A 1YVUA 4WE1B 3GIRA 2HMIA 2V8HA 2KFYA 2VG5B 2HVIA 3AOAA 5KG1A 2P9GA 2IA6A 1Q95G 1Y3JA 2HAFA 2D4WA 2VCPA 3ZT2A 4LH5A 1CC8A 2P9NB 1ZZNA 2BJ7A 1PYSB 2F8MA 2QO3A 3DDNA 4V19S 1RACB 1JLCB 4LUBA 1C0MA 2F9WA 5E41A 1R6VA 5GAEU 2J0XA 2K8GA 3V4IA 1WACA 1S9EA 2YNIA 1D0EA 4O44A 2VH7A 3W8GA 1TKXB 1RBLA 5D0GA 3MGJA 1WSJA 4BC9A 4DV5F 1KVJA 3O08A 2RIJA 4CHZA 1RT4B 3U27A 4JV1A 4C8MA 1K9MT 3VQ7A 1FF2A 3TJ8A 3WNEA 1K1QA 1QSYA 3U6FA 1LW0B 2OEMA 1HNVB 4H4MB 1TL5A 4BHQA 2OMOA 1TUVA 1R8AA 1IQZA 2J9DA 1F6TA 1WOSA 1L3KA 3U7JA 4F3OA 1U6BA 1NH8A 1EZZB 3DLLQ 1RZMA 3NAHA 3ENQA 4ANDA 4QW9A 2HG4A 3H3OB 5KPRA 1KP6A 3H5UA 1JJ4A 2XLKA 3PHEA 2D69A 1U24A 4FYWB 1VSHA 1VQNN 5KG5A 3MR6A 3N6NA 4A8SA 3NNAA 1U8WA 1RHJB 3LGHA 3J7YP 3O3HA 3V9SA 3L7OA 2OCEA 5I3UA 1WG5A 2GVZA 2QTDA 4BE2A 3KLIA 4URSA 3M8PB 4ZS6A 5GMKa 3LALA 2BE2A 2M7SA 3NGUA 3M05A 1UL3A 4GKKJ 3R3LA 3SSQA 4ZJLA 4HH1A 2CG8A 2VIHA 4YOXA 4FLVA 2IMWP 3IR5B 4NLOA 1KQGB 2BVZA 3QJJA 2G4BA 1WB9A 3OTOK 4CJPA 1FXXA 4CLSA 5F9NA 1BXNA 2XWYA 5LMUF 1SJRA 3TVKA 4QOTA 2DY1A 1Y5NB 4NB4A 1NGIA 2O01C 1VQLS 5A2QU 2YQ3A 1WNSA 1VSDA 4EFAC 4NLDA 1XNRJ 3A2FA 3CSKA 5IC4B 3CD6S 3W8PA 4BRQA 4DL2A 3TEHB 1Z26A 3K7RA 2W8KA 4DUYJ 3ATUA 2KXNB 3MD1A 4CO0A 2KG0A 1LCUA 1S76D 2JWLA 1IM4A 9RUBA 5IT9U 2GAGC 1EIYB 4QOZB 4EHUA 1IBLF 3R2CJ 4CGFA 2K1RA 1EWQA 3CCLN 5ETKA 4K4ZA 4HACB 2NZCA 2BABA 3HFZB 3FSYA 2ZVIA 4CM0A 3IR7B 1JKHB 4RW6B 3H25A 1SZ2A 4B3MK 3TPQA 2GWKA 2G0CA 4DXLA 3PW4A 1YRUA 3CJ7A 4XIUA 1RDUA 4OLOA 3PX0A 4RWXA 2ASMA 4DV5J 1JXBA 3MXMA 5EDWA 4J8FA 4DCPB 2HPUA 3LM9A 4DV1F 2G0IA 4HH0A 5C12A 5AQSA 3JYTB 3IWNC 1H38A 2XMJA 3HULA 5DDPC 1U1OA 2VYPA 4MLEA 5CA5A 4FYYB 4PCQA 4TVAB 1A6LA 4KH5A 1UZHA 4ER8A 2FHOB 4W5QA 1EQ0A 1X4AA 3V9UA 3T1YF 1SJFA 5KFAA 2DR7A 3FJ2A 3UW1A 2R3VA 2Z1JA 3Q0AA 1GMWD 4DUZJ 4QWDA 4J2BA 3H2LA 3C0BA 1QZ5A 4JV5K 3FFIB 3CETA 1HBUB 2UUBJ 3LZIA 4OGEA 3SI8A 2C3UA 3ZNJ1 2DNQA 1SBRA 2AJ0A 4ZVUB 1FTRA 4HHJA 3PR5B 5CY4A 4B1UB 1MNEA 1I39A 3QRPA 3I6PA 4DF4A 5L1KA 4JI8K 4KV8A 5KT6A 5KFCA 2F65A 3SCKE 1OIAA 2X1AA 4DR7F 1NUEA 4R25A 1RTHA 3AQPA 2D1CA 4CTAA 1YJTA 1AROP 2UV8A 4ED4A 2O8FB 2F3JA 1F5BA 1I51B 3Q23A 2V2ZA 1RAGB 2D9PA 2NPFA 2VPWB 2FYXA 1F3VA 1PO6A 1WC0A 4CI0B 4HHHA 3SXLA 4DPWA 3DI6B 4USHA 4YHHK 3K58A 2KLAA 3MEEB 4M5DB 2YTCA 1NDPA 2PEBA 4EO6A 2P9UB 3A5NC 4F4AA 4DV3K 1FRJA 3E2EA 1TUUA 3LPYA 1VQON 4PG5A 1FEEA 4RBVA 2IC3A 1B7FA 1K8KB 1PILA 1M1HA 4ED2A 1F5CA 4CLLA 4LBHA 4RW7A 1IN0A 3EGNA 1RBRA 3RYLA 3J7YI 4ECSA 5U47A 1WOPA 1PYTA 2BYCA 2W6LA 1M5OC 1L3SA 5BYSA 1UVMA 4G1QA 4DQSA 4DTPA 3GJSB 4MKAA 1J5OB 3VENA 3OYGA 3UI3A 2NXCA 4K4UA 2YWKA 2Q36A 1NPKA 1R27B 2GVDB 3CJ5A 2WOMB 3CD5A 3H3NO 3GQCA 2E7WA 1W97L 2MKJA 3VVTA 1WKKA 2LKZA 3S1TA 1K6YA 3TRGA 1RCXB 4ETZA 4ID5A 5AXLA 4LQ3A 1X9WA 4EBEA 2FC8A 3EE3A 2M3DA 3UNGC 5T7BA 3ZT0A 3H45C 2ZJPQ 4JKFA 4B02A 3RAXA 4B3OB 4YOTA 2JL9A 4FCYA 2QL9B 3KG0A 1CS4A 5A2QO 4OX9F 3Q8QB 5C24B 4C8ZA 4M7XA 2IAJA 4FWMA 1FJEB 2JLFA 3E01A 3I4HX 1XWLA 2LU1A 3M6GA 1NHKL 3UNYA 2O3DA 2AP6A 3LGNA 5KFOA 2RKIB 5AJ3J 2YBVA 5LM7E 3ZSWA 2YQ1A 1YQHA 1YJWS 2QMUB 2GV1A 2XHBA 4I64A 3SFUA 3QFPA 5GMDA 2ZBCA 4LH4A 5HK4A 2MQMA 5KFKA 5HO4A 3H46O 2F9DA 4HTJA 1TK8A 5CD4H 2UU9K 3H5SA 1VRUA 3ID6A 4GO7X 3MI7X 2O4IA 4FVCA 4CO1A 4OJ3A 3DMJA 4RNNA 4PL7A 4LRFA 3DAWA 2QWRA 2J6TA 2B8PA 4CYUB 1WOQA 1LFWA 2DH7A 3AY0A 4QWAA 2Q3PA 2AX1A 2JSXA 3BN4A 3KK1A 4FXWA 1VRQC 1LWFB 4ZVGA 2WFBA 3N0VA 2LEAA 5AQUA 1Y5IB 1VOMA 2VF3A 2W2PP 5D4NA 4JHDA 1VDHA 3ZZ0A 3ICLA 1HNWK 2OHDA 3KD1E 2CJAA 4EBCA 4OZ1A 4QR0A 4Q45A 3AVHA 2XSFA 4NL5A 1IKYA 2A42A 1NMDA 1RT1B 3DRRA 2YWHA 4B3TF 3T5JA 5A76A 3N6LA 5CYJA 4JYAK 2LEPA 2N7YA 1T8EA 1YSJA 4MLHA 2D41A 3PYEA 1DQAA 2R7VA 4R79A 3DOLB 4GMKA 1WAFA 4ECQA 2RILA 1ASWA 3EE9A 1WKJA 4F4KA 4LBIA 4FLWA 4DV0F 3I32A 3KNAA 3CCMS 1O0PA 4N8OA 2V4JA 3VEOA 2H54B 3CJ1A 1TAQA 4CIOA 3I0SA 5M1FA 4PWUA 4EMDA 3R5GA 1FA0A 1ZS6A 2R7UA 4H0TB 5C2FA 4LF4J 3HBTA 3RMCA 2BJ9A 3Q22A 4V19X 4OLAA 1QHTA 2M70A 4ID1A 4N77A 1YIJN 1IR0A 1N34F 2OAUA 2YNGB 4IDKA 1QUPA 4OHVA 1C1BB 1TKTA 1NHVA 1UJ6A 2FQQB 3GJRB 1BUXA 3OVSA 1ROFA 4LF8J 3ATVA 1REGX 4Q7AA 5KFHA 3T7ZA 1IV0A 3OYFA 1M5SA 1T9XA 1CJVB 4YOYA 4AQYF 2QA1A 3W9IA 4CZHA 4DPXA 1V3RA 4XPEA 1IKXA 2FIUA 3VGUA 5T14A 4CFCA 4CVNE 1J54A 4QQBA 3OYDA 1DTQB 3C15B 4FLXA 4WCEQ 1FFWB 3C6TA 3VF0B 5B0CA 4LFCK 2XS2A 4V1Ak 3A0IX 4JI2F 3D6RA 4FF3A 3CJKB 1RQ0A 2XZWA 4WK1A 3D0PA 4E8UA 5JVHQ 2VJUA 1UEUA 4NXNJ 2GWJA 2UUCJ 3GR1A 2J5AA 4QYZJ 2QK9A 3H42A 3BGOP 2GIQA 1WHXA 3VZHA 1S49A 2I0XA 1WF2A 1S79A 3H4DA 2FLPA 4TYBA 2JX2A 4B9VA 2R7QA 1CJKB 2CQGA 1XMOK 2KZZA 1C1CB 4I6MB 1X4BA 3US5A 1OPZA 2OJ3A 5E3AA 1D3WA 1FJCA 4CLWA 2G2ZA 1S7HA 1NGGA 2VG6B 5J1EB 1HL6A 1AW0A 5KFRA 3HSZA 1SL2A 4DLGA 1R0AB 3UD5A 2NQPA 1NGDA 3E66A 2V8DA 2AJQA 3AVJA 4J9UE 2OFHX 4Z4HA 4X64K 1VBXA 4ILLA 3MR3A 4ZIVA 4BRNA 2XSJA 4PKIA 3M8YA 4BR5A 1IBMJ 3PY8A 1S1VB 4MIBA 2YNHA 1SH0A 3HHEA 4CZKA 5KQ8A 4YY3F 2BW7A 4NYZA 1RHKB 4ZVQB 3CM5A 3TTFA 4BGAA 1SIWB 3CJRA 3Q8PB 1XN9A 4C4WA 3MMCA 3NAIA 1IG9A 3QLHA 3I82A 2RS8A 3QFHA 1NWKA 3FK4A 2KQ2A 3J7ZT 3M9OB 2O8DB 2UVRA 1LKZA 1OSDA 4KGXB 4Y2MA 2E1CA 4U7CA 2V8PA 1TUGB 5D77A 1DTTB 1WG4A 4FVMA 4F9OA 4OI3A 1B92A 2PI5A 3LWMA 3SBTA 1RE1B 5K8NA 1HQEB 5A8WB 2CJXB 5LSOA 1EKSA 4WJBA 3NCRA 3W62A 3ZX2A 2B9XA 1S0VA 4CHPA 4X4UA 1CPZA 3L2QA 1WF1A 1RAFB 3ZYYX 5JLFA 5CH7B <