3C6UA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6uA05
1JXLA 1NJXA 1S1XA 2HW3A 4FJGA 4WFZA 5KRTA 1SUQB 1LWCB 1WSHA 4F4ZA 3I8DA 4G3IA 5HBMA 1JLQB 4RW7A 1SH0A 2BQ3A 2OPQB 4KHMA 4I9QA 3AVAA 4E7LA 3DRPB 4IFYA 3NGIA 2XC9A 4KRFA 3AVNA 3WNFA 1SV5A 4FXDA 1UWBA 3PZPA 5KFNA 4JUZA 3ZT1A 2ZE2A 4TYBA 1KRPA 3U3YA 2AX0A 3P5JA 1QAIA 4ED0A 3DMJB 4XIUA 4PWDA 3V6HA 1X1PA 1DTQB 5KT7A 2X74A 5SWMA 3LP0B 3KK2B 3HPGA 2BRKA 3NAIA 4KTWA 3IGVA 1EETA 1R0AA 2KFZA 3BQ0A 4NLTA 3DYAA 3CFOA 1JLEB 1JLFA 2C22A 2HMIB 1C1AA 3K57A 4QWBA 2QK9A 3NBPA 5KFQA 3NFAA 3KLHB 3RAQA 4ZPCA 4DQSA 1JXEA 3HVWA 1RTDB 2D3ZA 1ZETA 3BREA 4LH4A 4AHVA 5KG7A 2VWJA 1HYSA 4FVMA 2B4JA 5FDLA 4FJ8A 1RT1B 4XPEA 3OL7A 5C25A 2A1RA 2G8IA 3V4IB 1U47A 3BQ1A 1NJYA 3T5HA 1ZTTA 4B3OA 3OS2A 1J54A 4TLRA 2XGPA 4URQU 4IOBA 2C2RA 2AGOA 5DLFA 3IAYA 3OJSA 2OA8A 4EYIB 2XI3A 3EPIA 2XY5A 5KFKA 3F73A 3O4QA 3HT3A 3DLKB 5KT4A 4G1QB 1XHXA 3I5CA 4LD0A 4KHUA 4FJXA 3SUNA 1RT4B 3KMSA 5KGWA 2W9AA 4ID1A 4F8RA 1TV6B 3MFHA 1QSSA 3LWMA 1TK0A 1MMLA 3MEDA 2B43A 2KZMA 1XR5A 4YR0A 2HHXA 2YHBA 1RT5A 1S1TA 1T05B 4MIAA 3AA5X 2JEGA 3V81A 2B5JB 5KFSA 4K4UA 4KB0A 2RF2A 2IAJA 4IG0B 3OLAA 2PZSA 3NF7A 4RNOA 1BGXT 2W8LA 4JS4A 4MKBA 3IG1B 2HB5A 5F8JA 3L3VA 4EEYA 2QXFA 4CEBA 4X2BA 3S3NA 4KKOA 4QWDA 5JXSA 2HNZB 4MK9A 1N6QB 3PW0A 4OKJA 4Z4EA 3BGRA 3SUQA 2I5JA 4WYWA 1FKPB 5T14A 4RW9A 1S1UB 4M3XA 2OPRA 3JYTB 4GMJB 3KD1E 1KLMB 4CIFA 4J9PA 2FJXA 4CJRA 4OKKA 3RB3A 3Q8RB 1CZ9A 4YMEA 2AJQA 3CM6A 1NJZA 3WNGA 3HP9A 4GW6A 2D7SA 3VQBA 3SCXA 1B9FA 3AVBA 4R8UB 3ISND 4JS5A 4CHPA 3D45A 4IFVB 1FKOB 2D3UA 2A1SA 4J2DA 3L8BA 1TL3B 3BSOA 4Q8FA 3KLFB 1GOBA 4EP4A 4QOZB 3HVAA 3TAMB 3G6YA 2V9WA 4ZVHA 2P5GA 4I7FA 4EBDA 4TSXA 1REVB 1S0NA 1HYZA 1Z26A 1JIHA 1SL1A 3OYJA 1TKZA 2FLNA 4DL4A 4Z4IA 1RT3B 4J9LA 5EDWA 5K14B 1U09A 2VA3A 4PA1A 4W5OA 5KFOA 3DOKB 3IS9A 3OVNA 3MECB 4F4XA 5F8HA 4KFBA 4FW1A 3VQ7A 3NDKA 3RBEA 4XPCA 1YTUA 2F8SA 4DQQA 4Q0BB 4KHSA 5HRPA 4ECVA 3RWUA 3M8PB 3TARA 4CERA 3K2PA 4RW6B 3BSNA 3FFIB 1S9FA 5KG0A 3PO5A 5J2QA 2HVIA 3MR5A 1TL1A 3OS1A 3D0PA 3C95A 1VRUA 3SJJA 2CJQA 4OL8A 1RDCA 1D5AA 4EP5A 3AO3A 1WSEA 1HNVA 1RBUA 1YT3A 1B92A 5DQIA 1HJRA 1LWFB 4KO0B 3OJUA 1WSIA 3VQEA 1U45A 1QQCA 3JSMA 3FSIA 4I2PB 3KK1A 4WE1B 1D0EA 3EPGA 2AU0A 3LZIA 3T19A 4ECZA 4CF0A 4Q43A 1S9EB 2QKKA 4HYKA 4E89A 5I42B 4CF2A 4OLAA 3TVKA 2F96A 1K1SA 1NOZA 3KHHA 4YQWA 3ISNC 1RILA 4DG1A 3MXMA 3ZSZA 1X9WA 3MR3A 2FJWA 4MK8A 4TN2A 3KHGA 2BQRA 5KTQA 1WSFA 2PYLA 3T5KA 4RU9A 2VG7B 4YFUA 4I2QA 2XY7A 1HNIB 4ECXA 3AA2A 2VG6A 4B8CA 1T7PA 1S1WA 2ASDA 5F9LA 4YR3A 3QNOA 3RR8A 4OLBA 4ZP9A 4WZMA 3M8SA 4OPKA 5KFFA 3HHKA 4FJKA 3BSCA 1X9MA 1IKYB 3LAMA 1T94A 1S6PA 1S6QA 2E6MA 1I3AA 1TGOA 5F8NA 3V1QA 1C0UA 1KVAA 3NGZA 1YVFA 4KI4A 4DLGA 1VSEA 3HVTA 4W5NA 2YNIB 1I39A 3KOAA 1RDAA 2YNFB 1U48A 1C0TB 3U3GA 4IDKB 5L1KA 3G0ZA 3UR0A 2ETJA 5KGXA 4IRDA 1N56A 3QESA 1UA1A 1Q9XA 5DG9A 4KHYA 5FRMA 1RTJB 4CK3A 4IQXA 4M94A 1NOYA 4LSLA 4HUEA 4ZP8A 5EWFA 1RDBA 3OL9A 3M8QA 1VK0A 4O3PA 4RNMA 3OY9A 1YTAA 4LQ9A 1UWBB 2ZD1A 3MXIA 1D9FA 2AQ4A 2ZE2B 4DQRA 3QLHA 3ALYA 4TY8B 1TAQA 4R5PB 3A2FA 4ED8A 3AVGA 4GVMA 4E7KA 4RZRA 3VQ6A 2V4RA 4IG3A 4OGCA 4NLYA 4YNQA 2DFHA 4FLZA 1MU2B 4PWDB 4OVLA 3OS0A 1S1VB 1LW2B 4YP3A 2WONA 2OPPB 4K50A 4F2RA 3QEIA 4CECA 1JLFB 3V1OA 5D3GB 3GIKA 1FXXA 2NUBA 1JLAB 1A5WA 4RNHA 1IKXA 4K4XA 3V9SA 1ZYQA 4ZPBA 5KFRA 3O3FA 4BDPA 3EYZA 1KTQA 4E1NA 1C1BA 2KW4A 3ZSXA 2GUIA 2DFFA 4JV2A 3H5UA 4IBNA 4FJIA 1LW0A 4HCCA 1HMVA 3NCIA 3DRSA 4CEEA 4CEFA 2W9CB 3TI0A 4LSNA 1EP4B 4NLDA 3RR7A 3LALA 4WFXA 1NKEA 3HM9A 4ED3A 1RDRA 3GIIA 1S9GB 4J2BA 3TAGA 4ICLA 2YV0X 3L2RA 4PQUA 3OYDA 1RT2A 3Q8QB 3IRXA 1BQMA 2Z1GA 4DFMA 1NK5A 1NHUA 4ELUA 3ICLA 4CCHA 4K4VA 4PUOA 3P83D 2HNYB 1DLOA 2LSNA 3MF5A 3CYMA 1W9HA 5KFDA 3FDSA 4O0JA 5KFLA 2GIRA 1VSIA 3HK2A 1JXBA 4FJJA 2IMWP 3SFUA 2OZSA 2W9BA 3NF8A 5KT5A 2BQUA 3V6DA 3PVXA 4K8XA 4C8KA 1BI4A 3ZSYA 2FC0A 1KVCA 4NYZA 3MEGB 4AH9A 3EZUA 5DMRA 1Y97A 3AVJA 4CF8A 4KB7A 4MIBA 1HPZB 4O4RA 1RT6B 3OYCA 4RUAA 1QE1A 2HWIA 2WB4A 4CJLA 5J2MA 4KSEB 4Y3CA 5L1JA 4FS1A 3HP6A 2D0AA 3H59A 1IH7A 3H4BA 4DEZA 2CKWA 4IRCA 1XC9A 2R7YA 2JLEA 3I0SB 1JL2A 3THVA 3VQDA 4H4MA 3DLEB 5KFJA 4CJEA 3V1RA 3LWLA 1W0HA 3OHBA 4RW8A 4RNNA 4DL7A 3I0RA 2RDIA 5J1EA 4MK7A 4F4YA 4TYAA 4B9TA 1NK7A 1RT7B 1FK9A 3PW7A 4JRQA 3HYFA 3L2QA 1L5UA 1BQNA 3AVFA 4KREA 3WNHA 1QUVA 3Q8PB 2HNDA 4MFBA 4CF9A 1BCOA 1VSMA 4HVJA 2YKNB 4K4SA 2B6AB 4DTJA 1WSJA 3NE6A 1HQEB 4CEDA 4DSLA 4Z4FA 1XR6A 4J9NA 1SH3A 3KLIA 5C42A 4B9UA 4CJ3A 4I7FB 2JEFA 2OPSB 2UVUA 3LZJA 3DLGA 5KFXA 2W42A 4NLUA 3RB4A 2AGPA 2GV9A 2JC0A 3OYNA 4NCGA 3Q8SB 3LAKA 5HROA 3VQ4A 1CLQA 3FQLA 4RNFA 2IC3B 4HKQA 5J2NA 3IS9B 4QWAA 4IRKA 4ED2A 5HLFA 4KFBB 5CY4A 5CZ2A 3GIJA 5J2PA 3UQSA 1Z4UA 2IJNA 2G8HA 4MKAA 1HQUA 3RAXA 4XO0A 1TP7A 2EC0A 5KT6A 3DI6B 1KVBA 5KFZA 4ECQA 3PJXA 4DU3A 1KCFA 4HHTA 4KTQA 1JLBB 4F3OA 3IGNA 1DTTA 4OGEA 1TK8A 3RTVA 3QO9B 1RTIA 2RKIA 1OS5A 3VQQA 4ZVGA 3QNNA 2UVWA 4EZ6A 2WOMB 4DTNA 4DMNA 3H4DA 1VRTA 5KFGA 5CYMB 1JLGA 4ZMMA 3PX0A 5CYQA 3UPFA 3RB6A 3QEWA 2W7OA 1KFDA 3AV9A 3RMCA 1RBSA 1IKVB 3KLGB 3CJ0A 4O44B 1S48A 3PR5B 4CFCA 2YKMB 3ITHA 1TVRB 1ASWA 3S3OA 3CJ4A 1LWEA 4AHSA 4DSIA 3ASMA 3HPOA 1L3SA 3QGGA 4DL6A 1WAJA 3KHLA 2VWKA 3SUOA 5KFUA 1GOCA 5HP1B 2R8JA 2HHQA 1XWLA 2XY8A 1ZTWA 2XI2A 3QZ7A 3QIPA 4ECTA 2VG6B 3H5YA 2V0NA 1IKWA 4B9VA 5I3UB 3PY8A 3CFRA 1D9DA 1SUQA 4ID5A 4M3RA 1JLQA 3CJ5A 3DOLB 2OPQA 3S9HA 3HVRA 3DRPA 2VA2A 4BWMA 2QKBA 3HVTB 4M41A 3VQPA 4KV8B 4ZHRB 4KHNA 2RDJA 3AVIA 4I9LA 4ELVA 3LP2B 1TKDA 3PUFA 3MXJA 4ZP7A 1N5YB 4R0EA 2IOCA 1TKTB 3OYAA 2AX1A 4EBEA 3DMJA 3AVMA 2ITGA 5FROA 1SH2A 3PV8A 4CJFA 3KK2A 1BHLA 5DGBA 3M9OB 3KK3B 5KG1A 4CF1A 1JLEA 2HMIA 1QAJA 1XR7A 3RRHA 4IH5A 1KHVA 2ATLA 3KLHA 3KKSA 2Y1JA 1A5VA 2C2EA 1BL3A 1RTDA 4NRTA 5EWGA 4FCYA 4H4OB 1CXQA 1O1WA 3D28A 3QINA 3QEPA 2J6UA 4Q5VA 3VQAA 3V4IA 2Z1IA 3OYGA 5DG8A 3DLRA 3AA4A 1NK6A 3FRZA 5F8IA 4CJ5A 4ZTFA 5C24A 3MEEB 3CDWA 3L3UA 3IN5A 3RB0A 5DG7A 3OYEA 5CZ1A 3PW4A 3CVKA 3NAHA 3VQCA 3L2VA 1C2PA 5L9XA 1TKXB 1U04A 2JGUA 4OPJA 5KFCA 4EYHB 5E41A 1BCMA 3C6TB 1J5OA 3HJFA 3DLKA 4E1MA 4J9RA 4G1QA 3SQ4A 1CZBA 3N6LA 5KG2A 2XCAA 3SV3A 3PJWA 1TV6A 1HYVA 2YHAA 4PY5A 3DLHA 1LW0B 4ECUA 4EO6A 4FM0A 1ZBFA 1A5XA 2XRIA 3NHGA 2BANA 1SKWA 2C2DA 1RYRA 4ED7A 3BR9A 1D1UA 4JRPA 2X78A 4AHUA 1T05A 1BIZA 3H2LA 3LP1B 2HAIA 2B5JA 4LH5A 2P5OA 1XHZA 2PYJA 5KG4A 3AVKA 4Q45A 3KLEB 3QIOA 1BQMB 3QGHA 4KE5A 4BE0A 4IG0A 4CJWA 4CHYA 3IG1A 3ZCMA 2G8FA 3E01B 1KFSA 4ECWA 4FZZA 2YNGB 1RYSA 4O4GA 3DRRB 1T03A 2HNZA 1N6QA 2JEIA 1NHVA 1NK0A 1FKPA 4FK2A 2W9BB 1ZBIA 1S1UA 5EUHA 3CJ2A 3O4NA 1C1CB 3SYZA 3JYTA 4HUFA 3U6FA 1KLMA 4OJRA 4E0DA 3PO4A 2Z1HA 3ZSRA 3G86A 4CHZA 1L3VA 2AGQA 4FJMA 4RW4B 4M3TA 4CEAA 3KJVB 3P1GA 2UUTA 2XGQA 3OYKA 1S1XB 3QERA 5KFHA 5J2MB 1RBVA 3AVHA 3V9WA 2GIQA 4R8UA 3V6KA 5HBMB 3E51A 3MFIA 3QZ8A 3DM2A 4RW7B 4K4YA 4IFVA 1FKOA 1TL3A 3KLFA 4JV1A 3TAMA 4DTRA 2W7PA 3K5LA 4IFYB 3KKRA 3NAEA 1REVA 3I0RB 1SV5B 4AHRA 3KD5E 2VG5A 3K58A 1LV5A 4L8RB 2DPJA 2J6SA 4N47A 1RT3A 4TXSA 4Z4HA 2HHVA 4DLEA 5K14A 4NLOA 1ASVA 3NH0A 1S4FA 4RG8A 1N48A 3DOKA 2QV6A 4MFBB 4ED6A 3MECA 3LPTA 3AO4A 1RTHA 4CE9A 2R2UA 1Z25A 4O0IA 1EETB 1R0AB 3SUPA 4K4TA 3L2UA 3DYAB 4Q0BA 3HSTB 5KT3A 4GC6A 4NYFA 4CJUA 4QCLA 4DTUA 4DSEA 3NBPB 2FVSA 2G8WA 4NYNA 4F4KA 4CFBA 4RW6A 5DK5A 5C42B 3FFIA 2F8EX 4JV0A 3BDPA 4N76A 3CDEA 4CFDA 2F8TA 4WZQA 3M8RA 1HYSB 5FDLB 4E3SA 2ALZA 3AVLA 1NNDA 3H5SA 3KMQA 5C25B 4FYDA 2IM3A 2JC1A 2R2RA 1CXUA 2FLPA 4Z4GA 4W5RA 4CGJA 4NLVA 4B3OB 3HO1A 1LWFA 4CESA 4KO0A 2E9ZA 4CGIA 3VQ9A 4LY7A 3WNEA 1GX5A 5KG5A 1GOAA 4M3ZA 1XI1A 1K1QA 4BE2A 1T8EA 1WNEA 3LANA 3OYFA 1KHWA 3NGYA 4J2AA 3AVCA 1TAUA 1DTTB 1S9EA 3TAEA 1EKEA 4F50A 2Z1JA 4CGDA 5I42A 5KG3A 5C5JA 2RKIB 4NZ0A 4J9SA 4AILC 1KSPA 4NRUA 4EZ9A 4DL5A 2BE2A 1LAVA 3MEDB 4NLRA 4M3UA 1IM4A 4BDYA 4FM1A 1ZBHA 2BR0A 2VG7A 3EZ5A 4E7HA 3RMAA 1RT5B 3CDUA 1S1TB 1NKBA 3CQ8A 3SI8A 4DFPA 3V81B 4O3RA 1JKHA 3NKYA 4U7CA 3B6PA 3G10A 2RF2B 3ITHB 2I1RA 2RN2A 2IAJB 1IKYA 2DTUA 1S10A 4YR2A 2X6NA 3ZT3A 4DQIA 2WTFA 1NJWA 5T7BA 4DS5A 5KFAA 3UIQA 1VSHA 4FJ9A 1WN7A 4CEQA 1S97A 3N6NA 3CO9A 4FLTA 4KKOB 5KFEA 2YNFA 3G6XA 1QSYA 5F8LA 4Q8EA 2G8VA 4IDKA 4CJTA 3BGRB 2I5JB 3TANA 3QIPB 5JS1A 4RW9B 3B6OA 3C94A 2PY5A 5KFTA 2OPRB 2WHOA 1IKWB 1RDDA 4O3NA 4Y2CA 4DTXA 4ZVFA 4ECSA 1RTJA 4ID5B 4ZVEA 3SV4A 4QPXA 4F2SA 4H8KA 2HHTA 4ZP6A 4DU1A 4ECYA 4FJ5A 3QYYA 3LDSA 3UDLA 2XHBA 4O3QA 4CFAA 4C8MA 2Y1IA 4FJLA 4RUCA 4W5TA 2KTQA 4TY8A 5KFPA 4FBTA 4R5PA 4J2EA 3OYMA 4FZYA 4EBCA 3C6UA 1QS4A 3MR2A 1MU2A 1WSGA 4QWCA 3T5JA 1WNSA 4M45A 2QE5A 2FBVA 4U6PA 1S1VA 1LW2A 1S49A 2FJVA 2OPPA 4IKAA 1BISA 3QGIA 1TKZB 1GX6A 1JX4A 2R8HA 2HHSA 2C28A 5D3GA 3GQCA 2OYQA 3S3MA 3CG7A 4DSFA 1JLAA 4FLYA 3VA0A 2R2SA 3TAPA 3VA3A 3ZT4A 4GC7A 3M9NB 3AA3A 2XY6A 2R2TA 3KIOA 4CJ4A 1VSFA 4DU4A 1VSJA 2D5RA 4BDZA 2D0CA 4J9MA 3CJ3A 2W9CA 2BGGA 5C24B 5J2QB 2G8KA 2YNHA 1YVUA 3SPZA 3KTQA 2ZQBA 2GC8A 1EP4A 4CEOA 5SZTA 1TL1B 2UUWA 3MR6A 1ASUA 1VRUB 1VSDA 3PW5A 4KBIA 4DSJA 1S9GA 2XCPA 1WAFA 3BQ2A 4CGGA 1HNVB 3OL6A 3OLBA 1J5OB 3OYBA 3LP3A 4FLXA 3RMDA 3AO5A 2XO7A 4LQ3A 3AO1A 3TR8A 3JSMB 4CIEA 4DL2A 2IDOA 4Y2AA 4DTMA 3SI6A 1HRHA 3KK1B 3RRGA 2HNYA 1JLCA 2IM2A 1U49A 2BANB 5L1IA 2E4LA 2O4GA 1SL0A 4KPYA 1J9AA 2WK4A 1RAJA 3VN5A 4NLGA 4NLQA 4FM2A 4DTPA 3MTKA 2HHUA 1C0MA 1VSKA 4MH8A 4DS4A 4FW2A 4DG1B 5KFWA 4FJHA 3MEGA 4FLUA 1SKSA 4AHCA 4WYLA 2D41A 4DWIA 1HPZA 3OYIA 4I2QB 2RPIA 4FJ7A 1WLJA 3ZSQA 1RT6A 4ZTJA 4J9OA 1S1WB 5EU7A 4O55A 4Y34A 4E19A 3HPHA 2J6TA 4O4GB 1LWCA 1RA7A 1T03B 2GBZA 1S6PB 1S6QB 2WCXA 3I0SA 3H40A 3DLEA 2O4IA 1C0UB 3MAQA 1VSLA 4C8OA 2BRLA 4DQPA 3ZT0A 1UA0A 4BWJA 4O3SA 4J9QA 1RT7A 4NLPA 4K8ZA 4KHQA 1RA6A 2Q3SA 4O3OA 5F9NA 1G15A 2ZKUA 1DTQA 3LP0A 4CJKA 2YKNA 2B6AA 3OSNA 4TQSA 1HQEA 3TQ1A 3DDKA 3DM2B 4F3TA 4LSLB 4NCBA 2R8IA 3ZSVA 3M8QB 3O3GA 4CHOA 2OPSA 4B9SA 5DGAA 4CJSA 4NLWA 2VG5B 2ZD1B 1KLNA 3QLHB 4ED1A 1RT1A 4CJQA 4IG3B 2KFNA 1JL1A 3NGDA 3TABA 2IC3A 2O5DA 4DF8A 5KI6A 4M3YA 1IO2A 2EHGA 2FLLA 5HRNA 1RTHB 1LAWA 3GILA 3SPYA 4B9LA 2WONB 3G6VA 3VQ5A 4M95A 3PX6A 4DTSA 1ITGA 3H5XA 3CFPA 1F21A 2IJFA 3PR4A 4KAIA 3D5MA 3H98A 3DI6A 4M3WA 5JUMA 2FVCA 2D0BA 1IKXB 2ILYA 4URSA 1BIUA 1C1BB 1JLBA 2ILZA 1RT4A 1Q8IA 3F9KA 3GV5B 1UOCA 2FBTA 1Q9YA 3VQ8A 3QO9A 4DF4A 1HMVB 3OSPA 4FLVA 2FBXA 3DRSB 1RBRA 4B8AB 2WOMA 4JLHA 1QHTA 5KT2A 4LSNB 2FVQA 3SQ0A 3V9UA 5CYMA 3I5BA 2W8KA 1CSJA 3AO2A 2HVHA 1IG9A 5JS2A 4QAGA 4K4WA 3PX4A 4ICLB 1TK5A 5HRSA 4PQUB 2WRMA 1RT2B 3KLVA 1IKVA 3KLGA 3QEXA 4O44A 3V9XA 3PHEA 2YKMA 1TVRA 3IRXB 3DLBA 2OH2A 4BE1A 4FJNA 3FQKA 1S5JA 1HARA 3KHRA 4IR1A 2P51A 4MQ3A 4CJPA 1SL2A 2AWZA 1C6VA 4CIGA 4Z4CA 4PUOB 4FLWA 1DLOB 5HP1A 1QSLA 2E9RX 4EO8A 2BE2B 3T1AA 4FS2A 3SQ1A 3NF6A 1L3TA 4Y1CA 4QW9A 2G8UA 4QWEA 1ZBLA 4HUGA 5KFBA 4AHTA 4CK2A 5F8MA 3V6DB 3OYHA 3K5NA 5I3UA 1BI4B 3T5LA 5HRRA 4QW8A 1JKHB 5L1LA 3OL8A 4CK1A 2P1JA 3KNAA 5KFVA 2IGIA 1NK9A 3QIDA 3DOLA 2XWYA 2X6SA 1NK4A 2ATQA 3ZSWA 4W5QA 3NL0A 2HWHA 2DFEA 5KFMA 2FVRA 3BSAA 4CGHA 2KQ2A 1QE1B 3O3HA 3NMAA 3HKWA 3RBDA 4DTOA 2FVPA 4CHQA 1RBTA 4KV8A 4ZHRA 4TQRA 4BACA 3HL8A 1NK8A 3LP2A 3NF9A 4CEZA 4HCBA 2IBKA 4M42A 1N5YA 5EWEA 2FBYA 5KRSA 4UQGA 1TKTA 2IM1A 4ECRA 4H4MB 2KZZA 4FBUA 4FK0A 5FRNA 4Y1DA 4DSKA 1B9DA 4N41A 3L2WA 4RW8B 5J1EB 3ZT2A 3EY1A 2ASJA 3KK3A 3T3FA 1FK9B 2R8KA 4B9NA 4C8LA 4CGFA 4IR9A 1BQNB 3ZSOA 3OHAA 3OYLA 4CJVA 4CHNA 2HNDB 4FZXC 2JEJA 2IM0A 3BJYA 3NH1A 4ZPAA 3K59A 4ZPDA 4H54A 3CIZA 4DFJA 2E9TA 1NKCA 4H4OA 4C8NA 4F4WA 3M8PA 4WXOA 3C6UB 3CM5A 4J9KA 3KLIB 4NLSA 2DPIA 3MEEA 3LPUA 4B08A 1D8YA 3TAFA 4E7IA 3DLGB 2BDPA 1EXQA 1S0OA 4NCGB 4KHRA 1I6JA 2UVVA 2HHWA 5HROB 1SKRA 2IA6A 1TKXA 3H08A 4IH6A 4Q44A 1QTMA 4WFYA 1T3NA 5J2NB 4TY9A 4KI6A 5DLGA 1RNHA 3TWHA 5HLFB 3TAQA 3C6TA 1W25A 3SZ2A 5J2PB 1ZBUA 3VQSA 3V6JA 2OZMA 2ASLA 3NH2A 1X9SA 1HQUB 4ELTA 4URGA 3GV7B 4I2PA 4K4ZA 4HTUA 3GV8B 3N6MA 4WE1A 3PW2A 1L3UA 3K5MA 2IS3A 3SNNA 2YNHB 4KB1A 5F8GA 3QEVA 1S0MA 4Z0UA 4FK4A 2EX3A 3SFGA 3RMBA 1RTIB 3QETA 3V9ZA 3LP1A 4E7JA 4NLXA 3GIMA 4DFKA 4KHWA 2DY4A 3HXMA 2R8GA 3KLEA 4KTZA 3ULDA 1VRTB 1JLGB 5DQGA 5CYQB 1HNIA 3K5OA 1UAXA 4N56A 4NCAA 3E01A 3SQ2A 5DQHA 4WXWA 1JLCB 2YNGA 3DRRA 4DL3A 4IKFA 4N5SA 3M9MB 1K6YA 1LWEB 4B9MA 4OKEA 3CWJA 1C1CA 1EX4A 2E6LA 2UVRA 1N4LA 1J53A 1U4BA 4KAZA 2YNIA 3I5AA 1C0TA 1RCHA 4IH7A 5KFYA 4RW4A 3GYNA 4O5BA 2V4QA 5KG6A 3KJVA 1TQLA 5KFIA
chains in the Genus database with same CATH superfamily
2LA6A 3OBWA 5H9EK 1NJXA 4FJGA 3R7SB 4WCEQ 3FEXB 5KRTA 4ERDA 4G3IA 4BRKA 3JXOA 3VEWA 2HRUA 3ONQA 3OXLA 4KHMA 4I9QA 3AVAA 1ZS6A 3DRPB 3SIPB 1D4XA 4KRFA 2FJBB 2QA1A 2YQ1A 2V2KA 5KFNA 3IWNC 1DKGD 4WPAA 1KRPA 5GAHU 2CQ3A 4X4OA 2R7TA 3E8OA 3ZX2A 4XIUA 2HS3A 3C14B 4H4KA 1OH7A 3TTDA 2N82B 2HWTA 4PKGA 4CT9A 2KFZA 3DYAA 4B3MF 1C4CA 1JLEB 3K57A 2OIHA 3KLHB 4ZPCA 3VF0B 4DQSA 4ZN1A 1NDLA 4QIFA 2F9JA 1S22A 2D3ZA 4CP5A 1ZETA 1SJRA 2B51A 2B4VA 2VWJA 3PRBA 4FVMA 4HDGA 3UVJA 3W2WB 2B4JA 4I0WA 4XPEA 3S6EA 1D09B 3SBMA 4OMFG 2A1RA 4PZVA 4FWQA 4WCEL 1N32J 4BC4A 1NJYA 1FJGJ 1YJTA 5A6WA 4FXVA 3OS2A 3CCQN 1QVGR 4TLRA 4URQU 2GNKA 1SZ2A 2VQEJ 2ZVIA 3IAYA 2Y8WA 3NXZA 4C3MA 4EYIB 1PYSB 5DM6Q 3DLKB 1XHXA 4LD0A 3CC7N 1HL6A 4FJXA 4M5NA 2W9AA 4HACB 2KM8C 1PJ7A 2CIMA 3MFHA 2OLWA 1QSSA 1RWXB 2XHWA 1Y9OA 1MMLA 3TA0A 2CPDA 2HBMA 4LF6J 2A10A 2KZMA 3A8JA 3QPIA 5D78A 4WBFA 2FC8A 1NB7A 4QS7A 1T05B 4MIAA 3R2DJ 4FL9A 4XK8C 1WG4A 3V81A 3NMUA 4K4UA 4KB0A 2RF2A 1KQKA 3P5BP 2Z0GA 3I4HX 2PZSA 4MKBA 1TL7A 4J9UE 4QWDA 3J80O 1U1KA 4MK9A 1N6QB 3PW0A 1M1KO 1KWMA 2CQ0A 5DM6L 2VF3A 1S1UB 2Y1RI 4M3XA 3IBFB 1Z2LA 4OZJA 4CIFA 3THXB 4NASA 3VETA 2HK3A 5CHIA 4Q2MA 3I6PA 5HATA 5AQIA 4NE9C 2V7ZA 1WG5A 2AJQA 4RJVA 2OAUA 4DV4K 3CM6A 2WSFC 1FX2A 3HP9A 5H9FK 4LREA 4AQYF 3BF3A 1B9FA 3VGLA 1X31C 4CHPA 1XNRF 3D45A 2QLWA 1FKOB 3VCDA 2A1SA 5J1NA 2COLA 3BSOA 4X4PA 4EP4A 1N36F 3HVAA 3G6YA 2P5GA 4DV0J 4LFAK 5GAGI 2IVMA 3K0JA 1BMQB 2U1AA 3OYJA 2MKSA 4X64K 4DR3J 4B3SF 1BQXA 3W60A 4DJBA 4PA1A 1PILA 2DGTA 2WTUA 3DOKB 4FYWB 5F8HA 2L48A 2JFDA 2QLFB 2OJ3A 2VGNA 3C7NB 2NPFA 4KHSA 4ECVA 1WACA 1TL4A 1XMBA 3R7BB 4RW6B 3AB2B 5KG0A 1GLDG 3PO5A 5J2QA 1H98A 1URRA 3OS1A 2BW7A 4NEYA 3C95A 1S77D 3P5TL 2UV8G 1WSEA 2YX7A 1JJCB 4X65F 2MQNA 2P9KB 3O6WA 3VQTA 1NCLA 2VONA 3GE9A 3O5BA 3AOAA 1LWFB 1SC6A 3OJUA 2K1RA 2CWXA 3POTB 4CD3A 4LF8J 1QTNB 5C0YA 3ILOA 1YRTA 2AU0A 2HQGA 1DHMA 3RGIA 2VOPA 3T19A 2RVJA 3Q8VA 4MYTA 4DV3K 4PKDB 3TUJC 2YX6A 2QKKA 3QRQA 4E89A 5I42B 2DCUB 1RILA 4RUBA 3U27A 3MR3A 3H0PA 5A8RA 3Q7CA 3KHGA 3JTOA 4ETZA 2DNKA 4GKKF 3T5KA 2PYLA 5LM7E 4BQLA 3SDEB 3AH6A 2XY7A 4D3GA 4ECXA 1K9MT 3J8AA 1X4AA 2VG6A 1T7PA 1S1WA 5F9LA 4YR3A 4J91A 4DV7K 4F04B 4ZP9A 1GLFO 4BRMA 4FJKA 1DT9A 1T94A 3LAMA 2CWKA 5AE2A 1Q81T 2QG9B 5AQUA 2PT0A 3V1QA 1C0UA 1VR6A 1MROA 2CZ9A 1JCFA 1VQKN 3CF5Q 4NXNK 2HYIB 2D0PA 1Q8KA 1UEVA 2GVDB 3ENVA 1CJUB 3RW7A 5HVGA 2ETJA 2HBJA 2ATCB 3OUYA 5KGXA 3MCOA 1HWUA 1N56A 4I67A 3QESA 4BC7A 1CEZA 1NH8A 3TVZA 5FRMA 3OXFA 1IQTA 2OP5A 2QJ3A 3KUEA 4CK3A 4IQXA 2RB7A 1VQLS 4M63C 2LECA 3I82A 4LSLA 1RDBA 2O8DA 1VQ4S 1YJ9S 3M8QA 5DZ6A 2VICA 1SI9A 1UWBB 5E7OB 4DV6J 3MXIA 2ZE2B 3CJKB 3QLHA 3ALYA 4TY8B 1TAQA 4R5PB 2CJBA 4OGCA 2KT3A 4NLYA 5HOOA 1ICEB 4PWDB 4OVLA 3OS0A 1RXOB 4B1XB 3OTEA 2A6MA 4ID8A 1KVJA 1V3RA 4CZMA 2CQIA 5IV3A 1PG5B 1JLFB 4UOHA 5D3GB 3CF5L 7FD1A 4DCJB 4YY3K 2NUBA 1JLAB 2CJXB 2XULA 1JQGA 4K4XA 1ZYQA 4OYAA 2QW9A 5KFRA 1EHWA 4CIOA 1RAAB 2WAQD 5DZ7A 1GXTA 4JV2A 4FJIA 3H25A 3W64A 2HQFA 2W25A 1UP1A 3NLCA 3NCIA 2HFZA 3DRSA 1WDTA 2KFYA 3HSCA 3BS9A 3GFHA 4LSNA 2HBYB 2HFUA 3R3LA 3SAHA 4WFXA 3HM9A 3S01A 4ALZA 2E7WA 2G0CA 3L4BC 3TJ9A 1E4FT 1IXKA 2VUGA 4YORA 3CJ9A 3OYDA 2IA0A 1KC8T 4A2AA 3Q8QB 3IRXA 1BQMA 1VLOA 2MHNA 3ENWA 1NK5A 4J5OA 4QIWD 5BN8A 2LQJA 3ICLA 2E2OA 3IR5B 2E2PA 4CCHA 4K4VA 4PUOA 1EJ7L 4C8ZA 3CYMA 1N5TA 1ITPA 2WZ1A 3N5FA 2GIRA 2H4YB 3SFUA 2OZSA 3NF8A 4USMA 3AY9A 3PIPQ 2RD5C 2BACA 4QS9A 3HSGA 3MM8A 3TA2A 2CRLA 3C6HA 3MEGB 2FZCB 4FPAA 1Y97A 2MHEA 4MIBA 2AEFA 1HPZB 1RHKB 4B1ZA 4JI8K 2JNJA 3OYCA 3Q23A 4O5FA 1EQMA 4FS1A 3CJCA 3KG1A 2D0AA 3ETOA 4DEZA 1F9EB 4E1JA 5B09A 3G4SS 4ATNA 3MEKA 2JLEA 3VQDA 5KFJA 4FWLA 1J2VA 1W0HA 4LC9B 4MK7A 2P9PA 4PXCA 4F4YA 4B9TA 2B9YA 2E8AA 4RWXA 1FK9A 3ZX0A 3ZNJ1 2YH1A 1L5UA 4OIXA 5A8WA 2V51B 3Q8PB 4MFBA 1NAQA 1HNZF 3ENQA 5ADXH 1VOMA 4DTJA 4WFNQ 1WSJA 3NE6A 1UFLA 3PIPL 2IHR1 5IZHA 5CA5A 4J9NA 4FVCA 3VGTA 2Q6CA 5CABA 3W5ZA 2GAGC 5AQRA 2Z2ZA 5KFXA 2E88A 4NLUA 3FK4A 2R7QA 2AGPA 4FO0A 3OYNA 4LFBF 3VAFA 3VQ4A 1CLQA 4X4UA 2OTJN 4HKQA 2Q6BA 3IS9B 4QWAA 5HLFA 2R7VA 1WC3A 2PSZA 5AE3A 1X5TA 1NG9A 1Z4UA 5IXUA 3CMAS 4XO0A 1S12A 1TP7A 3SEOA 2F4FA 2HQ3A 1VIXA 3T7ZA 4BR4A 3UKRA 3GG0A 4DU3A 4X4SA 3MMAB 2GQ2A 1TYQB 3LO3A 4F3OA 3IGNA 1HUXA 3QICA 3HHDA 4ISFA 4IXCA 2D69A 3MCMA 4WFNL 2OKQA 4ZVGA 3D6RA 2ZH7A 5AQGA 3M8ZA 2E7XA 2P9LB 3PFEA 2KKHA 1JLGA 4W4MA 1VBXA 1M1KT 3PM9A 3RB6A 3QEWA 1HNXF 4CZJA 1G7CB 3AV9A 5AQPA 3W63A 3MUMP 1U1RA 2UXDK 4QBUA 4O44B 3PR5B 1KP6A 3H42A 4K2JA 4H0TB 2XWXA 3MWPA 1TUUA 3ASMA 1L3SA 3VVUA 3KHLA 5DS7A 3AT1B 4FNIA 1XBWA 4CZLA 2VJVA 3QZ7A 3QIPA 1X4BA 2Q43A 3GONA 3TO8A 3BZQA 5I3UB 3PY8A 1SUQA 4OLPA 1PC4A 2ZH4A 3CJ5A 4JKGA 3DOLB 2OPQA 3HVRA 3GYXB 1VK3A 3Q7BA 5F0UA 3A0IX 2QKBA 2V63A 3MM9B 3VQPA 1HBNB 4KV8B 3T1HK 2P9EA 3AA9A 3AVIA 1GTHA 2PI5A 3PUFA 2XMAA 3MXJA 3M2UB 1N5YB 4ZP7A 1PC5A 2UZAA 5FROA 3BPDA 4ZCIA 3H6EA 3E9LA 1RU1A 2W6KA 1FT8A 2FSKA 2QWLA 1IBKK 3ILLA 1UL3A 2LXUA 2ZM6J 3LDPA 2I6WA 5HL7Q 1YTYA 3KKSA 4ZDNA 3ULEB 4OX9J 3P6YC 2BJ7A 1RTDA 1BL3A 1CXQA 2E7VA 1O1WA 1IUJA 3D28A 3KG4A 3V4IA 3R1LA 4YB5A 4JV5J 5DG8A 3DLRA 3B78A 3FBFA 3MEEB 1WKKA 4OYMA 4PCQA 3IN5A 3K8VA 3NAHA 3CI5A 3L2VA 4I64A 5LJ5Y 2W6LA 4K41A 1C2PA 4PG5A 2YQ3A 1TKXB 3VERA 3T6BA 4EYHB 5AQYA 1ZPVA 1J6ZA 4ZVTB 4M5HA 3HJFA 2OELA 4J9RA 3NNHA 1N33J 3EZWA 3N6LA 4NX9A 2A42A 4CYUA 1TV6A 2YHAA 3DLHA 1LW0B 2NXEA 3DOMB 4FM0A 1ZBFA 2CNKB 2HBZB 1IJEB 4N8NA 1ZPWX 1RYRA 3CHWA 5HL7L 4ED7A 5DETA 3S1TA 2BW2A 2XM3A 4JRPA 2X78A 3QGPA 1BIZA 2HGMA 3LP1B 3CCWA 2CNNB 2B5JA 2PYJA 3KLEB 2EI5A 3CCQS 1B70B 1GLBG 3OTCA 3IG1A 2G8FA 2LEPA 3J7AP 4FZZA 4O4GA 4LUBA 2RHKA 1SIWB 4DN0A 2HNZA 2HZCA 2W2QP 1FKPA 2VFTA 4RBUA 1ZBIA 3DLLQ 1C1CB 2NUHA 2YKQA 3PSIA 2JRSA 1SAZA 3PO4A 5B7WA 2ZZNA 4J7CA 2NLXA 2Z1HA 3FMBA 1FJCA 3NOCA 4CHZA 4FJMA 3HTVA 3C2PA 3U9DA 2MQQA 1S7HA 2F63A 4GKJK 3GJRB 2XMKA 4LR9A 5J2MB 3TEHB 1WG1A 4JI6K 3AVHA 3V9WA 3HZGA 4W90B 1C4AA 3J7YI 3DM2A 3M6UA 3VEVA 3KJFB 1GLLO 3TAMA 4OX6A 4U8VA 3K5LA 3G2XA 2LU1A 3KKRA 3NAEA 3I0RB 3F56A 2SXLA 3L09A 3K58A 5M1PA 5M2UA 1M0SA 4L8RB 2DPJA 2J6SA 2ZH1A 1RT3A 2HHVA 4NLOA 1ASVA 4BR2A 2YWKA 1N32F 3T9ZA 2P9NA 5D0RA 4OI3A 2QV6A 3MECA 4DV7F 2ACYA 2D4WA 4ZS6A 4I68A 2R2UA 3P31A 2CQ1A 4O0IA 2HHPA 1XUPO 1GAOA 3DYAB 3DLLL 4Q0BA 2BTFA 3WXIA 5KT3A 4NYFA 1KAZA 2XG8A 4DTUA 2G8WA 4CO3A 4CFBA 5DK5A 3FFIA 2M52A 4NXNF 3J80Y 4JV0A 4NL5A 2YCHA 3BDPA 3CDEA 3A5LC 2O67A 4CFDA 5KOWA 2OEMA 3VV2B 4WZQA 3UVJB 1K0VA 4E3SA 1GEHA 1SKUB 1PAUB 2IM3A 4OPHA 2F5GA 3A12A 3DWLA 3FZFA 2V4JA 3Q2SC 4DR5J 2CGLA 2Q1NA 3HO1A 1YBTA 2E9ZA 1FFWB 4CQ1A 3BEXA 2XNQA 1FTRA 1YITN 1NSKL 3AGKA 1NGBA 1XI1A 4L3QA 3CNQP 1CBKA 1WNEA 3LANA 2UYTA 3TSUA 1KHWA 4WYBA 4K8RA 1XMOK 4ZLNA 1UAWA 1KD1O 5KG3A 4YHHF 2VDIA 2Q2RA 3RVCA 1FI4A 2RKIB 2W4CA 1KQFB 4NZ7A 2DNHA 4DL5A 4USVA 3T9NA 2BE2A 2JZ5A 1LCUA 4FM1A 1VC0A 3EZ5A 4E7HA 4KIAA 1Y3JA 1RWPB 1Q18A 2ZUAA 3I8BA 3V81B 3IA0A 1FA0A 4O3RA 2ERRA 3NKYA 4U7CA 3TTCA 2RF2B 3ITHB 1H2VZ 3PJ9A 2I1RA 1IBMJ 4RWTA 2X6NA 5SUHA 2HQDA 2DHAA 2EPIA 2DK2A 2WTFA 1TL7B 3WXMB 1NEEA 4DS5A 3UIQA 2GJ2A 4FJ9A 4KGVB 1MWQA 1WN7A 1S97A 3R5JB 4FLTA 1TUVA 5KFEA 1QSYA 3ADAC 5F8LA 2G8VA 5C15A 4V19S 3EVMA 1MDUB 2LFVA 3C94A 4FWSA 4YOYA 5F0WA 2PEBA 3TOQA 4Y2CA 3HULA 5EXWA 4QPXA 1WTBA 2VZ9A 4PYAA 4MLEA 1CG2A 2LQ8A 5FLXO 3N28A 2G0JA 4FJ5A 4LF9F 3WUHA 3LDSA 1TMJA 2YKPA 3JSYA 5M1FA 2AJ1A 3SMPA 2XHBA 2A1BA 1Q8LA 2RIJA 5KFPA 2QA4N 4CLTA 2Z57B 3VF4A 3B6BA 4EBCA 1XJWB 3BBBA 4ER8A 1U1OA 4F9OA 3GDQA 2K8GA 1M90O 4HWIA 2LDIA 5AXLA 3JXUA 1VQKS 4IKAA 3WC0A 1BISA 2QT7A 3QGIA 4M1KA 1GX6A 2HHSA 5HJXA 4JI8F 2C28A 3EJMA 3GQCA 3CG7A 2OMLA 3VA0A 2R2SA 2EKYA 1I51B 3ZT4A 4MDAA 1NSAA 2MSSA 4DDFA 2PDAA 1SQEA 2DH9A 5GAGP 4BDZA 2C3PA 3OTBA 5C24B 5J2QB 4JKDA 4C8YA 2GC8A 2HPUA 2XSJA 4BREA 4A8YA 1S9GA 4ILGB 3M05A 3BQ2A 1T44A 4X4RA 4CGGA 3TQEA 3OL6A 3OYBA 3LP3A 4FLXA 2VODA 3AD9C 3AO5A 2XO7A 2G2ZA 1OSCA 3AO1A 2X51A 2IDOA 3HRGA 3AQPA 5DDRC 2D3O1 2FGCA 3RRGA 2LCWA 4I6MA 5L1IA 1RAJA 3VN5A 3ZZRA 3QBCA 2HHUA 4IZ9A 4W98A 1C0MA 1VSKA 4DS4A 3ILJA 3O9RA 2J7UA 5AQJA 1PO6A 4A5AA 5EHHA 1AUDA 1CZAN 2VCPA 5A8RB 3IBCB 4FJHA 3W2VA 2DPNA 1YDLA 4FJ7A 2V8PA 3W65A 3EL2A 2RT3A 1TUWA 1RT6A 3DU6A 1S1WB 3HPHA 3MX5A 5L8RC 2J6TA 4CBXA 1LWCA 1RA7A 3G82A 1X5SA 5BXIA 3ZTRA 2IDEA 2QL9B 2GBZA 1X4DA 2QMXA 1V5IB 2WCXA 3I0SA 3O44A 1SC3B 1U26A 4RKUC 1C0UB 1MROB 3D0IE 1EB0A 1UA0A 4BWJA 2FYXA 4J37A 4J9QA 1YQHA 1PCAA 4P73A 1HJOA 1ZM2A 4O3OA 2P2CB 3AJ2A 2JWNA 2GV1A 2UXDF 5KOXA 1FCAA 1Q0NA 1WDDA 2YKNA 5ETVA 2B6AA 1CQNA 1Z2ZA 3OSNA 1S76D 1FNOA 4F3TA 4USKA 4LSLB 2R8IA 1EWRA 2O8DB 4G1PA 2Z4PA 3M8QB 1V3SA 5ETLA 1WKJA 2OPSA 4B9SA 4NLWA 2VG5B 1U8SA 1WI8A 1KOOA 1UTAA 4BRPA 3QLHB 1RHQB 1RT1A 2XLKA 1W26A 5HMYA 2O5DA 5GMEA 1SQKA 5HRNA 1R59O 1EX8A 2C3YA 3GILA 3SPYA 4B9LA 4IOXA 3WDOA 1ITGA 3H5XA 5IT0A 4FPBA 2N7CA 3D5MA 1VQ7S 1UW9A 3DI6A 2AJ2A 3PDNA 4URSA 3FBCA 3CD5A 3CERA 1Q8IA 2GTDA 1UEUA 2JWLA 2BKPA 4WP9A 2WFBA 2UUCK 1Q9YA 1WSRA 3VQ8A 2AMCB 3QO9A 4PQAA 4FLVA 2FBXA 3DRSB 3LPYA 1IQZA 4B8AB 1QHTA 4AFFA 4LSNB 2FVQA 3V9UA 3ZTOA 2G1DA 3I5BA 3FVYA 1NM2A 5KQ8A 4NA2A 3WXKA 1ZZNA 2VPXB 3VPZA 4HTLA 2V9KA 1IG9A 1V6HA 1VLYA 5HRSA 2M4MA 4USTA 3NCRA 3CGIA 1I94J 1IKVA 3KLGA 3KLVA 1Y64A 3V9XA 3PHEA 1HHSA 5LXRA 2XLJA 2NXCA 2YKMA 1TVRA 4Z94A 3IRXB 4EHUA 2OH2A 4FSVA 1S5JA 4KH1B 1HARA 1MN9A 4BC3A 2LVWA 2KKZA 2Q3PA 2XYPB 4PUOB 1U1MA 5AQFA 3RU0A 1XNQK 5HP1A 3SQ1A 2VQEK 4M8LA 3OVAA 2J9DE 4HUGA 5BREA 3OYHA 4FYYB 3A5OC 3ZZOA 3DXSX 3MM8B 3T5LA 5L1LA 3KNAA 3PRDA 2VIHA 3QIDA 1NK9A 3CCRN 3DGPA 1ULRA 2X6SA 2B9XA 2JJ4D 1NK4A 2ATQA 3ZSWA 2CGKA 3Q89A 4BRAA 3HKWA 4ZHRA 1YJNN 1MWYA 4LF6K 3HL8A 2C3OA 1RAOA 3B4DA 4RBVA 3M1FA 2IM1A 4FBUA 3IAM9 4Y1DA 1B9DA 1K47A 2KHOA 2ASJA 5U47A 1FK9B 1OH5A 4B9NA 4L3NA 2UUBF 4CLYA 4DUYF 5A8WB 3VENA 3OYLA 4CJVA 5DDQC 3NRBA 3GG1A 5E2QA 2ASOA 3K59A 5BPNA 4ZPDA 3WXLA 3CJRA 4H54A 5CE3A 4YDDB 4H4OA 4BLGA 1RHMB 4K0KJ 2G0IA 2V6AA 2CJKA 3C6UB 3R2CJ 1NGIA 3AODA 4U7UK 3GE1A 2HS4A 3LPUA 4LRAA 2HK2A 2BDPA 4P2SA 4KHRA 3D1QA 4GKJF 3ATVA 2IA6A 1KD1T 4CO1A 3H08A 4Q44A 1QTMA 5CAAA 4TY9A 2IRYA 5HLFB 2QTWA 4JI6F 3SSRA 2GMHA 1ZBUA 3VQSA 2J4RA 2ASLA 4AXIA 1KEKA 4DV0K 3UKRB 3QBWA 4FYVB 1FXRA 4WE1A 5LMNJ 3IM8A 3VALA 1WHWA 4DR3K 3F41A 1URNA 3SFGA 2NRHA 2LQ9A 2RS8A 3V9ZA 3T41A 4E7JA 3WXJA 3A3PB 2DY4A 3HXMA 3ULDA 2CPHA 1JLGB 4ANEA 3RRKA 2DITA 3K5OA 2PMWA 3KNGA 2EFGA 3E01A 1FVQA 3MCSA 1MG7A 5DQHA 3DRRA 4DL3A 2RDDA 2NQPA 2KM8B 3ENOA 1H0HB 4G6VB 4N5SA 3E66A 1V9OA 2VPYB 2YX4A 2GZOA 1VQ8N 5AQHA 3BGFA 3HHEA 4TKTA 3QAEA 2UU9J 2HF4A 4DXLA 2UVRA 1N4LA 3AD8C 4JYAJ 1GMWA 3DGVA 2VJUA 5GADU 4Y2MA 5L9NA 3I5AA 1C0TA 1RCHA 2V4QA 2PMZD 1GXUA 4B3RJ 1WEXA 3KJVA 2I38A 1Y10A 4CBWA 2HGNA 4LF8K 1JXLA 4GNIA 3UI3A 3AB4B 4WFZA 1M90T 1SUQB 3I8DA 2ZHBA 4JKGB 5ETTA 2BQ3A 2NYHA 2OPQB 1OKJA 4E7LA 2ZKTA 2F4VJ 1SQFA 3F9MA 1YJWN 4QQBA 3ZT1A 1NRKA 2CYYA 4TYBA 2GJFA 1EKSA 1X0FA 2Q31A 2AX0A 3CCJN 4CZFA 1QLNA 3FSXA 2ZC4A 2H5EA 3CD7A 1Y3KA 3F5TA 1DTQB 2X74A 5SWMA 2K2PA 4H5TA 1BG3A 3CETA 3HPGA 3DAWA 3IGVA 1EETA 1R0AA 3BQ0A 3CFOA 3OTOF 2C22A 1C1AA 3EZOA 5I4MA 3SK3A 4ZIVA 3NBPA 5KFQA 4BG9A 4QR1A 2DH8A 3EGNA 1RTDB 4GRSA 4NA1A 1Q95G 4GY2B 2J8SA 1BLUA 4M5MA 3OL7A 3W9JA 2G8IA 3V4IB 1U47A 2E5LK 1YUWA 2DH7A 3MUTP 2WVCA 4BRLA 3T5HA 4AUKA 2BJ1A 1BWVA 3OXGA 4DKWA 5BR8J 4IJNA 4KGKA 1J54A 2XGPA 5A6PA 3A13A 2C2RA 1KBRA 5DLFA 4LFCJ 3OJSA 2OA8A 3E3XA 3MD1A 2CAJA 2CPZA 2QM1A 3EPIA 5KFKA 5AQTA 3O4QA 3HT3A 5H1SV 2OFGX 1BUPA 4DV6K 1XQIA 4G9ZA 2V94A 2LXFA 4BRIA 5AXKA 1FFSB 1N34J 4CYUB 1TV6B 3D2EA 2MKJA 4JOUA 2KHCA 3LWMA 2W01A 3NS6A 4NXMK 1RAEB 3MGJA 1BOTO 1VAZA 2F8HA 3BN4A 4PABA 2F9TA 4X4QA 3CJAA 1WJ9A 1NDCA 1ZAVA 3HCXA 2YHBA 2IVYA 1CQMA 3D0HE 2UUAF 4JI0K 4UUXA 2FC9A 2CQHA 2Y0SD 3AA5X 1X4GA 2JEGA 3FFKB 4IYQA 2B5JB 1CS4A 2VQFK 3QFWA 1ELOA 3OLAA 1BWFO 3NF7A 5A2QU 2QX0A 4JS4A 2CA9A 1R0BG 3IG1B 2HB5A 5F8JA 1YITS 3FLCO 2QXFA 3K5PA 3S3NA 1RAFB 5JXSA 2HNZB 1XN9A 4ZLPA 4Z4EA 3VZHA 4WYWA 4BRDA 1FKPB 3SCIE 3BN7A 3KD1E 4NZ6A 4DR1J 2FJXA 4OKKA 1NPKA 4ZJOA 4JI4K 3Q8RB 5FPMA 4A8MP 2H48B 1CZ9A 4PR6A 5GIOA 5E3AA 4ES2A 2A2CA 2N4CA 2DHSA 1HWJA 2LP4A 3CXCR 1NSPA 1Q78A 3AVBA 4DX6A 2I0XA 2D3UA 2XS5A 3L8BA 4QOZB 1GOBA 3TAMB 2V9WA 1NGCA 4I7FA 3JAMU 3EXCX 4EBDA 5AFUA 4PL8A 1JIHA 4PEOA 3H1VX 2W24A 2FLNA 4Z4IA 1RT3B 4LRDA 4H5RA 2ZBQA 3CJQA 3L4IA 4W5OA 2EWHA 1RBOB 5HVFA 2P9NB 2DNLA 3OVNA 3MECB 2NXNA 4KFBA 5I3PA 1K8AO 3J7YP 1YTUA 3MUVP 4Q0BB 4P6QA 4IFEA 4YUDA 5HRPA 4LVNP 2ZITA 3FFIB 3BKFA 2HVIA 1Z05A 1LOTB 2FHJA 3PRVA 4B3MJ 3NGKA 4OL8A 2QA4S 1YJRA 2KT5A 2B8QA 1D5AA 5B8HA 4MAKA 3FBEA 1MWKA 1T0TV 2V4JB 3BY5A 2PD1A 3M6VA 2DHGA 1YT3A 3AY0A 1M5KC 3AAWB 3BF1A 5D4OA 5FLXY 3VQEA 1U45A 3GJSB 3EE8A 3JSMA 3VGVA 2FB0A 2XMJA 3AOBA 2GEMA 3VESA 1D0EA 2A5XA 4CF0A 4Q43A 5B08A 1IBMF 1OYEA 4DU7A 4EI2A 3IR7B 3TVKA 2F96A 3KHHA 3MXMA 4L75A 1YX2A 2FJWA 2ZC3A 4DR6K 2BQRA 1KAXA 1WSFA 4BR0A 3M32B 1X5OA 4RU9A 1WOSA 1HNIB 3AA2A 3VAMA 3RR8A 2CPXA 1DBDA 4OLBA 5AQLA 5E3RA 2P6TA 5ETOA 3RAMA 2UUCF 4QJVA 1S6QA 1I3AA 4GO7X 2VGMA 4CI6A 2ITMA 3HVTA 4F26A 4Y65A 4DN9A 1S72N 1RDAA 2VDHA 5L1KA 3G0ZA 2ADCA 1BDGA 2WVBA 2FHKA 3QWPA 4DR7F 4IRDA 1UA1A 2YTCA 2HBLA 4MLHA 4X84A 4KHYA 4CLFA 2GCFA 2AA4A 4P10A 2Q97A 3WX4A 3SSSA 1NOYA 4HUEA 1G6BA 2C3UA 2YJEA 1XNQF 5BJRA 1YTAA 2JL9A 4LQ9A 2ZD1A 2AQ4A 4JI1F 3FR0A 4GVMA 3VQ6A 1N0VC 4IG3A 1KN6A 4YNQA 2DFHA 4FLZA 1E6YA 2XMMA 1F9FA 2EW9A 4AQYJ 2WONA 5C7PA 4K50A 1RBAA 2GHVC 3QRRA 4PKIA 3K7RA 4YOEA 4AF1A 1XNRJ 1FXXA 1Y7PA 3H7HB 1X7VA 3DDNA 2QLXA 4RNHA 1IKXA 1N36J 2NSCA 3KDNA 3EYZA 1KTQA 2A2DA 5AQKA 2PIIA 3AJDA 2MKYA 2C1EB 1IJFB 4IBNA 3VAKA 2F9WA 4B3SJ 4HCCA 1UVNA 2O8FA 2CJAA 5EX5A 2FHOB 3TI0A 4F25A 2EBGA 1PGZA 4DQ8A 2G1HA 4BRFA 4BHQA 2XSJB 2ZM6K 1XIQA 1K8KB 2NRZA 4K7QA 1S9GB 3TAGA 2YV0X 5ETPA 4PQUA 1KNZA 1NHUA 3TUIC 4BRHA 4RTFD 1F0XA 4ELUA 2J7WA 4JV5K 3AOCA 4WK3A 4I6MB 1DLOA 4X65J 2DHHA 3MF5A 4IWVA 1W9HA 1BU6O 1JXBA 2W9BA 2DIVA 4UUWA 3V6DA 3PVXA 3ZETA 2BM1A 2FC0A 1KVCA 4AH9A 3W2VB 3EZUA 1E4GT 4O4RA 3CIMA 1RT6B 4RUAA 1QE1A 2WB4A 4KSEB 2N7YA 4ZVRB 3F2KA 3HP6A 3H59A 3G82B 3H4BA 4IRCA 3MZIA 4GKKJ 2EFOA 3I0SB 1GQEA 1RCOB 3LWLA 1H2UX 4RNNA 4DL7A 5J1EA 4B3TF 2QL7B 2EFQA 4H4KC 3HYFA 1BQNA 4KREA 2O8EB 3WNHA 2AV5A 5GINA 4UOCA 3Q2TC 1Y5NB 1BCOA 3B4MA 1VSMA 4HVJA 2YVSA 1RSCA 3SQGB 2YKNB 2UXCF 4K4SA 2B6AB 3R97A 1M5OC 4CEDA 1XR6A 2L9WA 1N88A 4ILJA 4O8UA 3KLIA 1WOOA 4B9UA 4EIAA 4A4JA 2OPSB 3BYRA 1ZAXA 2W42A 2WSEC 3MOZA 4U7BA 4PWUA 1YJNS 1KVKA 4NCGA 2CADA 5D4NA 2QA2A 5HROA 1S6UA 2QA4G 1N5VA 5J2NA 2HSTA 4DV5F 5CY4A 5J2PA 3UQSA 2IJNA 2LEAA 5IC4B 1RDUA 1HQUA 5KT6A 1WORA 4E98A 1RQ0A 4JI5J 3DI6B 1IV0A 3QWUA 5KFZA 3HSJA 4DB3A 3QFUA 2KG0A 4HHTA 4PG7A 1WF2A 2RUGA 3HD2A 2AT1B 3T1YK 2QN6B 1DTTA 4JN4A 1XK8A 1TK8A 3QSIA 3AA8A 5AQNA 3QO9B 5F41A 3VQQA 4ZCKA 1HBMA 1LOUA 2UVWA 1DARA 4DTNA 2NRWA 4DMNA 4RWWA 1VRTA 2QC3A 3KWMA 2HMPA 2Q79A 5CYQA 1PJ6A 4ZLLA 1KFDA 2W7OA 1HKAA 3RMCA 1RBSA 3OTDA 4CT8A 1IKVB 3KLGB 4NWBA 1U2VA 2YKMB 5D6GA 1TVRB 2W2NP 3IP0A 2FGOA 3ZZTA 1GMVA 4DU8A 3UFCX 1LWEA 2E5LF 4AHSA 4DSIA 2GJIA 2DNQA 3KYLA 3VAIA 4PXDA 5KFUA 4DR5K 5HP1B 2R8JA 4DHYA 3SQOP 2HHQA 4JKAA 1OYDA 4IUFA 3BZCA 1VQLN 2V50A 1VQ4N 4B1WB 1ROFA 1YJ9N 4YOUA 1HD0A 1I5OB 3H5YA 1FRIA 3LDLA 4NB4A 1IKWA 2ZHOA 3CC2N 3M1VA 4B9VA 5IQQA 3ULHA 3TVYA 5AE1A 1JLQA 5FIIA 2XBPA 3RG6A 2PAVA 3DGPB 1UVLA 1MW7A 2ZDOA 3PIOQ 4RUHA 1NGGA 4ZHRB 2RDJA 3C66A 2LQBA 3M7VA 1K8AT 4I9LA 2RU3A 4X62F 3DXKA 2XZDB 4JI0F 4R0EA 2VV5A 2MLXA 1U6BA 3DMJA 1FWPA 1VQ8S 1GLCG 3TU5A 4CJFA 3M9OB 5GAHP 1FXDA 1Q16B 3MMJA 2ZZMA 3ENHA 3GJTB 2HMIA 2V8DA 1XR7A 1RFQA 1KHVA 2VC1A 4EWTA 1WHVA 1A5VA 5C2DA 2MY8A 4NRTA 5EWGA 4RBTA 4LF7F 4FCYA 4H4OB 2M7SA 5M2RA 3MN6A 4C11A 2MZSA 4ZVSB 2J6UA 4Q5VA 3O1LA 1EKRA 3OYGA 2VD3A 2L3MA 3UDCA 3FRZA 5F8IA 2MXYA 1HNZJ 3FEYB 4ZCMA 2DGXA 3PW4A 2D1KA 3PIOL 2ZNZA 2G13A 3D4JA 1DQAA 1P8ZA 3CCJS 1KQGB 1QM9A 2M3DA 2ZJPQ 1VDHA 1CZBA 5FPDA 2W2MP 2XCAA 3SV3A 4U8YA 1HYVA 2RH3A 5K8MA 1R8HA 3UE2A 4ECUA 4LFBJ 4ZKAA 5H9EJ 2VC0A 2XRIA 3NHGA 2BANA 1Y11A 3TTFA 1SJFA 1JK9B 3BR9A 1RE1B 1O51A 4ZIWA 4B9QA 1IJJA 2BKNA 5CXTA 4L74A 4LH5A 2P5OA 1XHZA 4CVNE 3AVKA 4MKYA 3G4SN 4IG0A 1FD2A 4KY3A 2DR8A 1B0TA 4CJWA 1TUGB 2MQPA 3E01B 1RYSA 4JI7K 3DRRB 3FSYA 3KKFA 1T03A 5FD1A 3I32A 1DQ8A 3IWXA 2JEIA 4P2XA 2ZJPL 2CPIA 5EUHA 3CJ2A 1NU4A 3QMLA 4K5SA 3U6FA 4HUFA 1HNXJ 1KLMA 4E0DA 4OJ3A 3HSZA 3G86A 4MKVA 4F0HA 2FSNA 4JD2A 3KJVB 3VR1A 3PEJA 1D3WA 2E1RA 4K43A 3P1GA 1ZM3A 1RWNB 4DUZF 2GIQA 3MFIA 1YJ7A 3QZ8A 3CCUS 4H0YB 4IFVA 1TL3A 4JV1A 3GR1A 4DTRA 3M8WA 1GMWD 2ZBPA 2OHDA 3CMAN 4CZIA 2PI4A 2L9DA 1LV5A 3CJ8A 3W8GA 2XS2A 4N47A 3CDAA 2XYHB 5EOYA 2G2YA 1N5SA 4USUA 5K14A 3UD5A 3NMRA 4NOHA 1O6XA 1UJ6A 1R6VA 2ACMA 1S4FA 1DGKN 4UOGA 5I9EB 4PL7A 3CJ7A 3W8PA 1WUUA 2Z30B 3C16A 1EETB 1R0AB 3PKMA 3SUPA 1NUEA 3L2UA 4GC6A 4CJUA 4U95A 3NBPB 1OQ6A 4F4KA 5ETQA 4C48A 5C42B 3O8WA 3K0SA 3CC4S 4JKBA 2B7BB 3ATUA 3M8RA 1NZAA 3GFXA 5JICA 3LDQA 3I31A 1NNDA 3EMTA 4CZCA 4KH6A 1I1GA 5HQLA 3KMQA 3G9CA 5AQXA 3R1HA 4X4VA 3GJQB 1WBDA 4W5RA 1X4HA 3IR6B 2GVZA 4KO0A 4DX5A 1XMQK 2OFHX 3VQ9A 4LY7A 1GX5A 1HWKA 4DV1K 5AJ3K 4H5VA 1GOAA 4M3ZA 2PE8A 2WBRA 2XSFA 1T8EA 3HF5A 3R5CA 4CZEA 1REGX 5EX3A 4P52A 1Y5IB 4F50A 2Z1JA 1X9JA 3D2EB 3EVOA 1W7WA 4DV4J 1IN0A 1IWGA 4CLZA 5HSPA 5F1XA 4J9SA 4EZ9A 2DKOB 1H7WA 4NLRA 3BPSP 5LOQA 3D2FA 1ZBHA 2VG7A 5IT9O 2MQOA 5LT5A 1H6KX 3HI0A 2H5JB 1NKBA 3MCPA 4L72B 4DFPA 3TNVA 5AQSA 1JKHA 1CS4B 3KXDA 1R6YA 3G10A 2D74B 3VEZA 2RN2A 3VZIA 1IKYA 3X1LB 4UF4A 2F40A 5A2QO 2GO9A 2CVEA 4YR2A 3BH7B 4JK7A 5T7BA 4P2MA 1NZ8A 4CEQA 2P8IA 3N6NA 4CWBA 1T9XA 2AJ4A 2YNFA 4Q8EA 2GGPB 3NGUA 5HI7A 4CJTA 4ANCA 3CPEA 3HM8A 3B6OA 1JJHA 2J0XA 5CCMA 1I94K 2R7XA 4DR2F 4ZVFA 4ID5B 3MM6A 2DT9A 3SV4A 1GLEG 2V8GA 1T9WA 2HHTA 4H8KA 4JK8A 5LMUF 2PO4A 2MJNA 2HHHF 2VASA 4FJLA 1U7LA 4LBHA 2I7NA 4ILRA 1ZA2B 3VF2A 3TZYA 1J27A 1YLXA 4M45A 2CPFA 3I56N 2QE5A 4U6PA 1S1VA 1S49A 2O8CA 1DJ0A 2WSCC 3ZNUA 3DU5A 1WF0A 2R8HA 1S72S 3I9V9 4HEA9 2OYQA 3S3MA 1QHAA 4DSFA 3NEKA 3GSIA 3G25A 1RAIB 1QQMA 2LQ5A 4L73A 2J7KA 1R89A 1HIYA 2IDLA 4DU4A 3MOJB 3D6MB 3CJ3A 4LRCA 2R3VA 4DV7J 2YNHA 3ZEUB 3UE5A 1EP4A 3DLJA 2UUWA 4OHWA 3MR6A 2QWNA 2QIFA 1FEHA 3WEEB 1VSDA 1F9HA 1FHTA 1IBLK 1J5OB 4NXNJ 3S8SA 5D77A 1QDUB 3CTRA 4K0KK 3TR8A 3JSMB 4DTMA 3VAGA 1JLCA 4AT1B 2HQIA 2E4LA 1SL0A 2FHJD 4BGBA 1UEKA 2BEFA 4KR0B 4PAAA 4NLGA 4FM2A 3G8TA 4DTPA 3MTKA 3N9UC 1NGHA 4MH8A 4P7VA 4FW2A 1LNQA 1HNWF 3RJMB 1VQ5N 1CULA 2KXNB 1UFWA 1WC6A 2A0FB 3MPWA 2D41A 4ZVPB 1LKZA 1TFWA 1FX4A 4JI3F 3DDIA 2AHOB 4YHHJ 1T9VA 1WEYA 4OPAA 4YB7A 3LPEA 3T1YF 2CVIA 4ETXA 5LMNK 4A8WA 4YB6A 3QT6A 4PYDA 1NLVA 4QYZJ 1S6QB 3O08A 1JJ2M 2CFXA 4YY3J 3M30A 3H40A 3TW0A 5EGYA 3MAQA 2A3ZA 3H3NO 4C8OA 3MCAB 3G6EN 2QEXS 1S57A 4DQPA 4OX7A 5JVHQ 1OVQA 1RA6A 5IC6B 1SPBP 1EARA 3LW5C 5F9NA 1G15A 2ZKUA 1RDWX 2BJDA 3TSQA 3DFEA 4OHZA 3KHYA 2ROPA 4GV3A 1SB6A 4CJ7A 3G87A 3DDKA 2QWMA 2ADBA 3ZSVA 1FDAA 4PWWA 4MMOA 2MLYA 4DX7A 4JYAK 4CHOA 4YOTA 3R6GB 3FCVA 2H5IB 2VBXA 4DI6A 4CJSA 2ZD1B 1CPZA 4FWNA 2MSTA 3DCAA 4WFBQ 4ED1A 4C97A 4IG3B 2E29A 1JL1A 2ZZTA 3NGDA 3HMJG 2YI1A 4M3YA 2EHGA 2F9DA 2E1CA 4LF9J 1RTHB 4DMZA 2WONB 3G6VA 2I2YA 2PN6A 4DTSA 5IQ6A 3TZXA 2ZJQQ 3CFPA 4JK9A 3JS6A 1ZZFA 3OR1A 2G4BA 4IQMA 4KAIA 2FZGB 4M3WA 4A8OA 2D0BA 1NNEA 1IKXB 5JVHL 1P9YA 2F4VK 5GAEU 1LXNA 1RWMB 2RQMA 1O13A 1JLBA 2ILZA 5GVQA 2X1AA 2MB0B 3GV5B 1UETA 1X3NA 3C3LA 1UOCA 3LM9A 4JI8J 3CMQA 3KUGA 4R79A 2O8FB 2OSRA 3OSPA 4MT1A 2WOMA 1NB2A 3N4PA 3G8SA 3SQ0A 2YJFA 1CSJA 1U6FA 3AO2A 9ATCB 3ZTSA 4B1YB 3ZXWA 5JS2A 1VJQA 5GADI 1TK5A 4PQUB 4WFBL 3PNIA 2KT2A 2QGFB 3FQKA 2R7SA 3TPQA 2P51A 3ZC4A 4CJPA 1FERA 2FQQB 4BC5A 4FLWA 2ZJQL 3FC9A 3VEYA 1DLOB 2JHEA 2XHCA 3N4WA 3J80U 3T1AA 1VI7A 4JKHA 4L76A 2MZRA 4QW9A 3UDEA 1Q53A 1ZBLA 4AHTA 4CK2A 1X3MA 3V6DB 3MPVA 3ZETB 3J7AN 3THXA 2BE9B 4QW8A 1F2GA 3OL8A 4X66F 3THYA 3QSYB 1HI8A 3O1WA 2ZVSA 1R3NA 1FE4A 4LR8A 3PACA 5KFMA 2FVRA 1BXNA 3BSAA 5ETKA 2KQ2A 1QE1B 3K17A 3B8HA 3NMAA 1SCJB 1RBTA 2DXEA 3NF9A 3LDOA 5C12A 3CCLS 5ETNA 1TKTA 1OVYA 4ECRA 1VBKA 3M5RA 3NGSA 1RJJA 3L2WA 5J1EB 4L6V3 1QAXA 3A8KA 4C8LA 2XNRA 1N0UA 2Y0BB 1BQNB 1Q5VA 1HI0P 2HBRB 3ZSOA 4CM2A 3MR7A 4CHNA 5AQMA 4FZXC 1VBYA 3BJYA 2RAQA 4ZPAA 2E44A 4JI7F 3CC2S 2IVOA 3QDKA 3CIZA 4FKXA 1QZ6A 5BYRA 4JI5F 4WXOA 3OR2B 2NUUG 3CM5A 3KLIB 4NLSA 1YJUA 2OCEA 2YHWA 4E7IA 2UXDJ 7FDRA 5MLCQ 2AEMA 4NCGB 4OHYA 1I6JA 5HROB 4WFYA 5J2NB 5DLGA 2P9KA 3J81O 3TAQA 3C6TA 5J2PB 3V6JA 2OZMA 3NH2A 1X9SA 1HQUB 2NZTA 3POTA 5BRDA 4LF4F 4K4ZA 4HTUA 4C3KA 2MQ8A 3N6MA 5A8KA 4KB1A 2HSEB 2ZFHA 3RMBA 1X8DA 2RILA 3QETA 1RHRB 4EK2A 1FRHA 2CNLB 4K5RA 3LL3A 4KHWA 1YKWA 4ILMA 1VQPS 1VRTB 3JQJA 5EN1A 5DQGA 5CYQB 4KPCA 2C2ZB 3SDEA 1FESA 4N56A 2ASMA 3SQ2A 3CD6N 1U2VB 5L39A 2KRRA 4B3MK 1LWEB 3Q83A 4B9MA 4OKEA 3CWJA 2ZBIA 2EC2A 2E6LA 1U4BA 5B0GA 1Q7YO 4V19J 4YEAA 4C2MA 4KAZA 3G71S 2QSWA 1OMSA 1XMQF 1XC3A 1HW8A 4IH7A 1IR2A 2FF3B 2KVIA 4RW4A 1VC6A 2V2VA 4DV1F 4PG6A 5AJ3F 3VGUA 3Q8YA 4C0OC 1TQLA 1L3KA 2B9WA 5HK4A 4EFAC 3M1VB 2HW3A 2J76E 2ZOFA 4F67A 1ACMB 4F4ZA 2K3KA 1JLQB 1SH0A 5K8NA 3PCOB 4QIVA 2XZTB 2FY1A 3WQTA 1RWKB 4BROA 2YWWA 2M9KA 4P71A 4IFYA 3NGIA 2XC9A 3AVNA 3WNFA 1VQMN 2V34A 1SV5A 4FXDA 1UWBA 4JUZA 2ZE2A 3M2RA 1F5CA 4XDDA 3U3YA 1VQ7N 3B54A 3DXKB 2FXUA 2MTLA 5G0RA 1UVMA 3IAS9 1F60B 3DMJB 4ED0A 4PWDA 3V6HA 1X1PA 5KT7A 3GWCA 3LP0B 4HH1A 3EE3A 2BRKA 3J7ZO 2VPWB 3RBXA 2UXBK 1NBEB 5GMKa 2CPEA 4NLTA 4WU3A 2A18A 1X4EA 3D7EO 1JLFA 3I87A 2DXFA 2HMIB 1T9TA 4QWBA 2QK9A 3WIVA 1NMNA 3NFAA 3CCSS 1JXEA 1BA1A 1WKLA 3HVWA 3ZZ0A 2GHPA 2KJWA 4OYOA 1HYSA 5KG7A 3Q24A 5C25A 2UUBJ 3SCKE 1NDKA 4DUYJ 3MDFA 4DCPB 2MEWA 1ZTTA 2E5GA 3IRWP 4B3OA 4CZHA 2CQ2A 3ELHA 4IOBA 2AGOA 4UTGA 1AROP 1FRJA 4KH5A 1HHQA 2CNOB 2XI3A 3F73A 4S0MA 5KT4A 5L46A 1SJ4P 4KHUA 3NNCA 1RT4B 3JSBA 3LGNA 4PKHA 5KGWA 3RYLA 3H8YA 4GKJJ 3K89A 1T9YA 3L9ZA 1VQOS 2ASYA 1PJ5A 2DGWA 4JI6J 1FNXH 2KN4A 2B43A 2Q1LA 4UT4A 1XR5A 1XNRK 3Q0AA 4YR0A 1RT5A 1B0PA 1S1TA 2D0OA 2L08A 1HA1A 2FJAB 2GIFA 4KHPK 2YX1A 4DPWA 2KHDA 3NWRA 2IAJA 1JJ2R 4IG0B 5AZIA 4RNOA 2W8LA 4B3SK 3QT8A 2F8MA 4LBIA 3C6AA 3SSQA 4EEYA 3W7BA 1B7FA 4CEBA 4OKJA 3BGRA 2I5JA 3D6TB 5LY3A 1H7XA 1U6ZA 5T14A 3UCZP 4RW9A 2RHSB 1IBLF 2OPRA 3PKYA 1KLMB 5AQVA 4J9PA 2GWKA 3EO3A 2BX6A 3RB3A 5TKYA 3MWTA 4CH1A 3AXMA 2DRAA 4K25A 1J5EK 3HX9A 3C19A 4M5LA 2W40A 4JD2B 4YMEA 4ITSA 3MAAA 4CLKA 1QD1A 3WZ0A 4JI2K 2K06A 2ZGYA 3WNGA 4GW6A 2D7SA 3FMWA 2JFKA 3RW6A 3SCXA 1RTZA 2OUGA 1HHTP 4IFVB 4WIQA 3PYFA 1KR4A 1TL3B 4WQ4A 1X0PA 5KQDA 1Q79A 3R6MA 3A1YG 4ZVHA 1VRQC 3QJPA 4JP8A 4TSXA 1YWXA 1S0NA 1HYZA 2QZ8A 1SL1A 5FPEA 5IT9Y 4USWA 4ED4A 1TKZA 4DL4A 4PPZA 4J9LA 1HW9A 5K14B 1U09A 5IWAK 4Y0FA 3OBIA 5KFOA 3IS9A 1HBOA 3ZFVA 1DFDA 1D9AA 1ATSA 4FW1A 3RBEA 4PHTX 4XPCA 2F8SA 4DQQA 1S4EA 2E2QA 3QT5A 1GFWB 2EBEA 3M8PB 3MMCA 4IO9Q 1Y5LB 4H03B 2ZH5A 1S9FA 1ZXOA 3AHPA 3DN9A 1TYQA 3MR5A 4AXJA 2PBDA 1TL1A 3D0PA 2J8AA 4CDIA 1VQSA 1VRUA 3OTOJ 4DV4F 2M5YA 2CJQA 4AL5A 1FNMA 2J0WA 4P9SA 3AO3A 2NREA 2RHQB 2VH7A 1HR0K 1H74A 2D9PA 2BXJA 1S3XA 1F3FA 1LXJA 2E1AA 3I56S 1B92A 3O6QA 2GVZB 2P9LA 1FFGB 1HJRA 4KO0B 4CW7B 2IPOB 4XEIA 2I8EA 5B0DA 1SQGA 3J7Z5 3FSIA 3SCLE 4LFAF 5HQ8A 4I2PB 3KK1A 4TNOA 4Y00A 2ZH6A 3LZIA 4ECZA 4X64F 4IEIA 3HOSA 4NYOA 4GVLA 3U1NA 3JS9A 2F7TA 3OA9A 4CF2A 4OLAA 1HKGA 1B4SA 1K1SA 2XLIA 1NOZA 3L6QA 1X9WA 3ISNC 3UO0A 2VOOA 4OI0A 4ZCLA 4KT0C 4NYPA 4TN2A 4IO9L 5KTQA 1P8GA 3CJTA 2R7UA 1NHKL 4KBOA 3D2FB 2E5IA 4ANDA 3CE8A 2VG7B 4YFUA 4I2QA 1YAGA 4B8CA 3A8IA 5K8OA 3HHLA 3OVBA 5BN9A 1IWAA 1F6TA 4USHA 3U7JA 3EKSA 1WTFA 3M8SA 4ILHA 2BYCA 4OPKA 3HHKA 1IKYB 2QRRA 1S7IA 4P75A 8AT1B 1YI2N 1TGOA 2WC9A 1KVAA 3WHIA 4QZVB 2UUAJ 4FOIA 4KI4A 4DLGA 2M2BA 5KPTA 3NVKA 4W5NA 2YNIB 4ZA1A 2YNFB 1O0PA 4R0JA 4O8KA 1U48A 3U3GA 5IM0A 2OMOA 1MMDA 2IYIA 2C2OB 2W7AA 3D67A 2AYBA 3DXMA 1R8AA 1ATRA 1XTZA 5DG9A 3U1MA 4DV3F 3MM6B 4CZGA 3AJ1A 2OD4A 1DY3A 4HT7A 1GNKA 3CD0A 1VQ5S 2VBWA 4ZP8A 3OL9A 1VK0A 3ULEA 1W97L 4RNMA 4A57A 4BRNA 3OY9A 2F65A 1OJ4A 4DQRA 2JDJA 1U1PA 2AYGA 3LUYA 3AVGA 3TA1A 1WSVA 4E7KA 4JEPA 2V4RA 1WB9A 3BGOP 3B82A 3V4MA 1GT8A 4I1TA 1S1VB 2O8CB 3G6ES 2KH9A 1RHUB 4F2RA 4C9DA 2YHXA 3VTHA 4DR4K 5BR9A 4H0XB 2VYPA 1A5WA 1AW0A 3QT7A 4MYUA 3O3FA 2HS0A 4E1NA 1C1BA 2KW4A 1LQ9A 5HJYA 3ZSXA 1B3TA 3W3DA 2GUIA 3MI7X 3H5UA 4H5WA 1LW0A 3LH2S 1VBZA 1HMVA 1B7YB 4CEEA 3ET6A 4UY8O 4JBCA 1A9NB 2PFDA 1EP4B 3RR7A 2MYFA 2NNWA 2DY1A 5M1NA 2IIHA 3EVWA 4ICLA 3TZWA 3L2RA 3MHYA 2CGJA 4FOEA 3IFEA 3N01A 1RT2A 1QQOA 2FTRA 1Q7YT 3NP5A 4DFMA 2Z8QA 1WOPA 1XEZA 1Q4RA 5ADXA 5DM7Q 3VTIA 5ADZA 2MY7A 1U1QA 3V5RA 1HNZK 3GBTA 5JMVA 1JNRB 3AAQA 5KFLA 4E2FB 1VSIA 2YWEA 4YY3F 5KT5A 2BQUA 4TLQA 4HLBA 4OYBA 4M5GA 4MO5A 4K8XA 4KH0B 4C8KA 3M2VA 4CTAA 2WBMA 2WW8A 1U2RA 2DGOA 1CULB 3AVJA 2MKHA 4WK1A 1HBUA 3THWA 4OYZA 4WWSA 2NRVA 5JJBA 3ZTQA 5J2MA 3SJHA 3J7ZT 4AL7A 2XTJP 4HHHA 1IH7A 2B4OA 2QXLA 1U1LA 1XC9A 3R5BA 1JL2A 3THVA 3M30B 2K3IA 4CJEA 4FF3A 1VISA 4K42A 1NH7A 1VQ6S 3J81j 1FXLA 2UP1A 3OHBA 4RW8A 3I0RA 2RDIA 5DM7L 3UD4P 4C4WA 1NK7A 3PW7A 4JRQA 4CO4A 3VGKA 2UUCJ 1EO1A 1QUVA 2RSQA 2R7OA 2NLWA 3EICA 2HNDA 4CF9A 3WQPA 5MAOA 1YBAA 2MDAA 3A8YA 4M5KA 2KB2A 3MMVA 1OO0B 4P74A 2MZTA 3JB9k 1OH6A 3BF4A 5AT1B 4Z4FA 4BS2A 1SH3A 3QJLA 2MQLA 1JCEA 4B17A 1HNXK 4DR7J 4FWKA 5HMZA 4A8SA 2P9SA 3I4PA 3Q8UA 5ETRA 3DLGA 3RB4A 2DGVA 2GV9A 3A3NB 1TELA 3Q8SB 3LAKA 3EXYA 3FQLA 2JLGA 1CJKA 3I9ZA 4LF5K 1XNQJ 5CZ2A 3GIJA 2I7PA 2V67A 1XQSC 3O2IA 2G8HA 2BJ9A 3OR1B 4JI1J 4X4NA 1GK8A 1VCTA 1KVBA 4ZVQB 2C2KB 6FDRA 4ECQA 1FRKA 4USIA 1KCFA 4KTQA 1RLCL 1JLBB 1BWEA 3ZZYA 4OGEA 1P6TA 2ZWPA 1TR0A 2RKIA 1OS5A 3U9ZA 3R3TA 4DV2K 4EZ6A 2WOMB 2UXBF 3QBXA 1U02A 3H4DA 5KFGA 4ZMMA 2K1RB 3OQ2A 3JQMA 1Y00A 2DNZA 3BGLA 3DHWC 2B56A 2QWOA 5G4DA 2LDYA 3ID6A 5T7LA 1W2BM 1S48A 4CFCA 3ITHA 1ASWA 1NGDA 1LFWA 1OIAA 3O9SA 2LLZA 4FNHA 3R5DA 4TU9A 3GG4A 1T6DA 2VWKA 4RX6A 4JNEA 1FRLA 3CIPA 1ZM9A 1XWLA 2FF6A 2XY8A 3BO3A 5BYSA 1P27B 4DPXA 1V3ZA 4UY85 1T6CA 2AJ0A 2H4WB 2DY9A 3J81Y 2VG6B 5GADP 5DJBA 4OI1A 1VIOA 4QR2A 4WQ5A 4ES1A 4OHVA 2IVNA 3D1HA 1YG0A 1U0HA 4M3RA 3THYB 3QFPA 1YF5L 4KGXB 5FLXU 3S9HA 4LIRA 3FE1A 1GLAG 2ZH3A 2VA2A 4W92B 1RWOB 4MTPA 4M41A 2BV3A 4KHNA 1PKUA 4BCAA 3CD6S 3QQCD 3Q22A 3IWLA 1OY6A 1TKTB 1ILYA 3OYAA 3OUYB 2BOAA 3GCXP 2JLFA 2ITGA 3AVMA 1SH2A 4KHPF 3KK2A 5DGBA 4I4BA 1SBRA 2CQ4A 5BYQA 4F36A 2H1YA 5KG1A 2V5HG 3ENBA 1VK8A 4ZOSA 4YDUC 4CF1A 1FF2A 3RRHA 2P9CA 2ATLA 3E9PA 4F0KA 3E2EA 5B0BA 2CQBA 4B3TJ 3R6LB 3QINA 3I55S 2J9DA 3VQAA 2Z1IA 2DXDA 2XYGB 1NK6A 3AA4A 4FWMA 4ZTFA 5C24A 3CDWA 3OYEA 1J5EF 4ED5A 1VQMS 2UXCJ 3VQCA 4A61A 2AEJA 2BVZA 4JI2F 3GOIA 1U04A 2JGUA 4OPJA 2N3OA 5KFCA 3CEDA 4WU2A 3C6TB 3T1HF 5CYJA 2F1FA 3R1XA 4G1QA 2C2NA 2AKWB 3U8XA 2GA7A 5A0YA 1NMDA 1OQ3A 4X4TA 4PY5A 3IXQA 1KOHA 4BQZA 2IRXA 1A5XA 4DV5J 1SKWA 1IBKF 5A8KB 2FJDB 5IWAF 4CLUA 3KUHA 1KAYA 3BO4A 3PSFA 5FJ4A 2QMWA 4JAXA 4UQTA 4JKEA 4HI2A 3AARA 4KGZB 1HI1A 3FZBA 5KG4A 5CCLA 1RGVA 4Q45A 3QIOA 1BQMB 4DPOA 2FZKB 3WBZA 4KE5A 4BE0A 1AA1B 1O8BA 3NS5A 1H38A 3W3SA 4PG8A 4ZK7M 2KYZA 4OJHA 5C2GA 3JSRA 1KVIA 1N32K 1VMBA 2B9EA 1FJGK 1KFSA 2MQMA 1SJ3P 2LYVA 2KL8A 9RUBA 5K5MA 4D3HA 1NHVA 1NK0A 1JWWA 2HVZA 3R9LA 3UCGA 1HR0F 1U2FA 2ZWHA 5E3PA 3JYTA 3SYZA 1JMTA 3PFOA 3T69A 4OJRA 1N8RO 2EK6A 1UZDA 2GO8A 2AGQA 4RW4B 2ABYA 4M3TA 3CPWM 2E5LJ 2FDNA 2IY5B 5B0FA 2LKZA 1EQYA 1RBVA 2A40A 2D9OA 1YHQN 4R8UA 3E51A 3DXBA 3DC2A 2AD9A 3KLFA 3HBTA 1WHYA 2W7PA 3D6FB 4IFYB 3P49B 2JH3A 2DRBA 1REVA 1SV5B 2P9PB 3FUYA 2VG5A 3M2RB 1CVJA 3GYGA 4GMKA 2EFVA 4DLEA 1PAEX 3NH0A 4RG8A 4YHHK 5G0RB 1N48A 2B7CB 2WB1D 1VHFA 4MFBB 1NXIA 4ED6A 3AO4A 4CE9A 3SMZA 4UY8T 4NXMJ 2QL5B 3MPYA 4QYZK 3HSTB 4QCLA 3M6GA 3QATA 4DSEA 4NYNA 2NCKL 4BG8A 4X62J 4HT5A 4JI0J 1R8CA 2GELA 1D8ZA 4MO4A 1VS3A 4MIWA 2QFIA 2ZEJA 2VQFJ 3CQYA