3C6UA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6uA05
3QERA 3NMAA 4OKJA 5KG1A 3OSNA 1RBSA 3M9NB 4YR0A 3RB0A 5CZ2A 2BRLA 1DLOA 2HHXA 4PQUA 1S1VA 3HVTB 3VQDA 2FLNA 3AVCA 4IH6A 2D41A 4ZTJA 3FFIB 3PVXA 2AX0A 1NOZA 1RTJA 3QNNA 2XC9A 4EYHB 3AVKA 3C6TB 4ICLB 1T05B 3C6UB 4RW6A 4I7FA 2BQ3A 4IG0B 4TYBA 2KZMA 2B43A 1JL1A 3IG1A 1S5JA 4JRQA 2OYQA 5K14B 1RT1B 2ITGA 4E1MA 2QK9A 4CJKA 4CGHA 1Q9YA 2IM2A 4DLGA 2KW4A 4DS4A 3KJVB 4IR1A 4WFZA 3LP2B 4F3OA 4KHUA 4RW8A 1XI1A 4OLBA 1QSLA 2BR0A 5L9XA 1JLEA 3I0RB 4CIFA 3SUNA 3DMJB 1NHUA 3HSTB 4ZP8A 1N6QA 2HNDA 4AHCA 4NYZA 5KT3A 3QGGA 2FVQA 1QQCA 3PJXA 1HMVB 3ULDA 1DTTA 1WSJA 5F9LA 5D3GA 4IFVB 3B6PA 4M3RA 1S0NA 2HNYB 4K50A 1KLMA 3P1GA 1FKOB 2AQ4A 2HHSA 4RZRA 2HVIA 4IDKA 4TQSA 1KFDA 3RB6A 4CGJA 1T94A 2ILZA 3H5YA 1WSFA 2HHUA 4J9OA 3IG1B 3LPTA 2G8FA 1MU2A 3KOAA 4Z4EA 1S1TA 2FBVA 1X9MA 2B4JA 4QW8A 4ZVEA 2YKNA 4ECYA 3SCXA 1IKWB 3HT3A 3DYAA 3OYDA 3QINA 4K8XA 4ED7A 3PW5A 2ZE2A 3HVAA 5C5JA 4Q0BA 3AVLA 4O0JA 3DOKB 4ECTA 3OYGA 4QCLA 4CJ3A 5KFPA 1XR7A 3UQSA 2R8JA 1C0MA 5F8GA 3PZPA 1CSJA 4KHYA 3K5LA 3K5OA 4LSNA 1FKOA 3AVAA 1GOBA 1U4BA 4URSA 1W0HA 4GC6A 4M3UA 4ZVFA 1QTMA 2DPJA 4AHTA 4NLGA 4ED1A 1ITGA 4BE1A 2IAJA 5J2QB 2A1RA 1WLJA 3HVRA 4O0IA 5F8JA 2D0BA 4CFCA 3PX6A 1EXQA 4CEFA 3U6FA 2OPRA 5KFMA 2V9WA 4E7JA 2HNZA 1JL2A 1LWCA 3OYMA 4MK9A 3EZ5A 4HUFA 4ZTFA 4NRUA 4LQ3A 4EO6A 4TSXA 3G6YA 5J2PA 5DLGA 4CGDA 1IKXB 3AO1A 1BHLA 4YNQA 3KTQA 2P5GA 1SH3A 2HWHA 2OA8A 4BE0A 2E4LA 4MK7A 2OPQA 2YNFB 1ASUA 2IJFA 4EO8A 1WSEA 1D8YA 3HM9A 3HO1A 4R0EA 1HJRA 2E9TA 4LSLA 5KGXA 4QPXA 1SH0A 4H54A 1BI4B 2C28A 4NLYA 1CXUA 3C6TA 1SL0A 4FJMA 1S6PB 4NLWA 4K4YA 1RTDA 4RW4B 4E89A 1XR5A 4OGEA 4RW8B 5KFNA 3EPGA 3DI6A 1RBUA 1A5XA 2IBKA 2ALZA 3MFIA 3O4QA 4RG8A 1VSLA 4CHOA 4K4WA 4EEYA 4ED2A 4E3SA 3CJ2A 3V6KA 1S97A 3QESA 3VQ9A 2W42A 1QAIA 3D28A 3QO9A 4FCYA 4CHNA 2KZZA 3IRXA 1JLFB 4DU3A 4I9QA 3TAMA 1NKEA 4XPEA 3FDSA 1RYSA 3OYBA 4FLWA 3BSAA 1OS5A 2P1JA 1BQMB 5HRRA 3NFAA 1NNDA 4EZ6A 3RRHA 1T8EA 1S1TB 4HUEA 2BDPA 4TYAA 4O3SA 4CF2A 1J5OB 3GIIA 4DQIA 1HPZA 4WZQA 2HNDB 3LP0B 1RTHB 1WNSA 1KTQA 4NZ0A 3CO9A 3CVKA 3PW4A 5F8HA 3CM5A 2DY4A 3OLBA 5DMRA 3KLIA 3VQPA 4IRKA 5C24A 1TKXA 3E01B 3QEPA 5J2NA 1LWEB 1I39A 3I5BA 3JSMA 3AO2A 4K8ZA 2AJQA 4RNNA 4FW2A 4QW9A 3D5MA 3BDPA 4B3OB 1G15A 1UAXA 2IDOA 3QO9B 1U09A 1FKPB 3DLEB 4J9LA 4NLXA 4R5PB 2WONB 3NHGA 4O44A 4TN2A 2OH2A 3KD5E 1RT5A 3AA4A 4CJ5A 4KO0B 3KKRA 3OS1A 3CDWA 1W9HA 4RW9B 3MFHA 1IH7A 5DQHA 3LWMA 4PQUB 1NKBA 3M8SA 1NJZA 5HRPA 2HHWA 1NJYA 4O3PA 2PZSA 5HROA 3SQ2A 3MXIA 2W9AA 3CDEA 5KT6A 1HQUB 3LP3A 4UQGA 2QKKA 2BANB 3S9HA 4KRFA 2WB4A 4F4WA 4NLPA 4J9PA 5JUMA 3RMBA 4EBCA 5CZ1A 4M3YA 1S9GB 2NUBA 2IA6A 1VSIA 3NCIA 3KNAA 3F9KA 4O4RA 3MEEA 3KLGB 2DFEA 3T3FA 1KHWA 3HPHA 5DK5A 4WFYA 2IM0A 3IGNA 3V4IB 3DLKB 1JLCA 2R8KA 3KLHA 5DGAA 4H8KA 3OYAA 3AA5X 2E6MA 1TAQA 2WONA 1NJWA 4FJ5A 3FQLA 4DU1A 2HVHA 1RT3A 4J9NA 3RBDA 3MEGB 2R8HA 1EP4B 3O3FA 2Q3SA 4FJIA 5KFEA 2ZQBA 3G0ZA 4LH4A 1SV5A 1LWFB 2JLEA 4NCGB 3KLIB 4FLTA 1VSJA 2RF2B 4B9NA 3TR8A 1TAUA 3KK1B 2YNIB 2YV0X 4J2AA 3MXJA 4JLHA 1RYRA 2GIQA 3VQ8A 4O4GA 3QIPB 2F96A 4J2BA 1XHXA 2R2UA 3V4IA 1S1XA 1RA6A 4Z4GA 3DRSA 3IS9B 4FLUA 4AILC 1UOCA 3RB4A 3ZSWA 4RW4A 4QWDA 4J9RA 5KFOA 4DTSA 2YNGA 4Y1CA 5KT4A 1WSHA 1L3TA 4GMJB 4X2BA 3LP1B 1LW2B 1JLFA 4BE2A 3MTKA 1RDDA 2RDJA 3PO5A 2RKIA 2O5DA 1HQUA 2WOMB 3SFUA 3E01A 4FLXA 2XGQA 4OVLA 3KLVA 4LQ9A 4HCCA 5FROA 2XGPA 5J2NB 3ZSYA 2E9RX 1N48A 3HVWA 4JUZA 3HK2A 1TKDA 4YP3A 2QXFA 5J2PB 4AHVA 3CYMA 4DU4A 5HBMA 1YVFA 1TL3B 3HPOA 1WNEA 4Z4CA 2EC0A 3S3MA 2W9BB 1TKZA 2IGIA 3CM6A 4C8LA 4CGGA 3GIKA 1VSEA 3SNNA 2B6AA 1LV5A 4LSLB 1S4FA 1CXQA 3AVHA 3I5AA 4W5RA 3QGIA 2HWIA 4DQRA 3JSMB 1VSDA 1IO2A 4E0DA 1O1WA 1D9DA 4KKOA 4OLAA 3N6MA 1K6YA 4E7HA 3ITHB 2OZMA 4KTWA 1TK8A 4KV8B 4ED0A 2C2EA 3GYNA 1NKCA 4IFVA 5D3GB 3DM2A 2ILYA 4J9QA 3V9UA 3LPUA 3VQSA 4GW6A 5HLFB 4FJNA 3NE6A 4RUCA 2YHBA 4U7CA 3PY8A 1S1UB 4Q8FA 4DTJA 2OPPB 3DRPA 2YNHA 1RILA 2YKNB 3QYYA 1YVUA 2BQRA 1CLQA 1BQMA 2R8IA 1JXLA 3RR7A 3KLEB 4ZP7A 1JLEB 3LWLA 4Z4HA 1CZBA 3T5LA 4O3OA 4F50A 3DLRA 1C0UB 4EBDA 1C6VA 2FVPA 2I5JB 4WYLA 4RUAA 2DFFA 5KFFA 3V6DB 4DQQA 4HTUA 3SI8A 4BACA 4DSFA 3HKWA 4F2RA 1TQLA 3Q8QB 3K59A 4Q0BB 4QAGA 2OPSB 4BDPA 5KG3A 2X74A 1IKVA 2WK4A 5EU7A 3TARA 1QHTA 4CJ4A 1VSKA 1XR6A 4CGIA 2W8KA 4CECA 1LWFA 4MFBB 4CJTA 4KI6A 4RNHA 2OZSA 1QS4A 3NL0A 1JLQB 4CFBA 2D0CA 3ICLA 3E51A 2KFNA 1S1XB 2OPQB 2YNFA 4O3NA 3DMJA 4NLOA 3CJ3A 2FLLA 1TKTA 2GUIA 1T03B 2J6UA 4Y2CA 3AO4A 4ZPAA 4K4SA 1GOCA 4IRCA 1NK6A 4IDKB 4MFBA 2BE2B 4KBIA 3EPIA 5CY4A 4F4ZA 4K4VA 3SQ4A 4HYKA 3TI0A 2UVWA 4HHTA 4ZPCA 4FJKA 1BGXT 5DG9A 4C8MA 1HMVA 3HJFA 3OLAA 4TY8A 1NHVA 4FZYA 5KI6A 3AVJA 3KIOA 1QUVA 3TVKA 2ZD1A 1VSFA 3Q8SB 4NLTA 3TAFA 5I42B 3H4BA 1RTJB 5KG6A 5KFZA 3EZUA 1Z4UA 1RDAA 1DTQA 1N6QB 4DEZA 5EWEA 3V9SA 3LALA 3FFIA 2UUTA 3RB3A 2ATQA 2XI3A 1JKHA 4CEBA 3GIJA 2ATLA 5KRSA 4CEQA 1RDBA 4NLQA 3O3HA 4FJXA 4FW1A 3M8RA 3KMSA 2QE5A 2RKIB 3SQ0A 3DM2B 4O55A 3GILA 1JLGB 4DG1A 3TAPA 4K4ZA 4FK4A 4N56A 1KLNA 1U45A 1KLMB 4KFBB 3ITHA 2JEJA 3ZSRA 4I7FB 3L8BA 2HHVA 4DFMA 1RT2B 3RR8A 1C1CA 4Y1DA 1TKXB 4NYFA 4DFPA 2XY5A 4KHNA 1LAWA 4H4OA 5J2MA 3NF6A 2YNHB 4O3QA 2GIRA 3M9OB 4K4TA 4EYIB 1DLOB 2VA2A 4QWBA 3I0RA 1RTHA 4LH5A 3CJ5A 4Q45A 3P5JA 1K1SA 1HNVA 3T5KA 3BSOA 1JLAB 3KHHA 3H98A 2UVVA 4CHPA 2AGOA 2R8GA 5KFYA 4CEEA 2G8KA 1JIHA 1LAVA 5J1EA 4B9SA 4IBNA 2KQ2A 3F73A 4FJLA 3T5JA 1KRPA 3GV5B 4Z4IA 1RTIA 4PY5A 3OL8A 2FLPA 4QWEA 2HAIA 3CG7A 4JV1A 3NF7A 4EP4A 4ZPBA 5FRNA 4E1NA 4OJRA 3O3GA 4DG1B 5T14A 3QNOA 3PR4A 2UVRA 4G1QA 1HRHA 1TGOA 3AVNA 3SYZA 2XI2A 4FM2A 1SKSA 1S6QA 4PUOA 5DG8A 2FBXA 3AA3A 4FK0A 4AH9A 1NK5A 4B9UA 4IKFA 1HNIB 3AVMA 1RT5B 5KT7A 2V4QA 4DL4A 5KRTA 3ZT2A 1S6PA 1SL2A 1N5YA 4NLDA 4AHSA 4OGCA 2PYLA 5KFGA 1RT1A 2ASLA 3PO4A 1D9FA 3OVNA 2V4RA 2WOMA 3KHRA 4KB7A 1S1WB 5KFIA 3V6HA 4CHYA 4DSJA 3IAYA 4N47A 3I0SA 1VRTB 1ZBIA 4CJSA 3GQCA 4KREA 5KG7A 1EETB 2FC0A 4M95A 5EDWA 2C22A 2DFHA 2RN2A 1S1VB 3VQ5A 5C24B 5L1JA 1KHVA 1GX6A 5CYQA 3OL9A 4N76A 4NLSA 2AX1A 5JS1A 2XWYA 1X1PA 1JLBA 2VA3A 1XC9A 4N41A 4RNMA 1RBVA 4B3OA 3SV3A 4ZPDA 5F9NA 3NKYA 1S10A 4Z4FA 2O4IA 3TAGA 4DL6A 4NCGA 4BWMA 1TV6B 2VG5A 4I9LA 3HP9A 4XO0A 1IKYB 3V9WA 1HYVA 3MEGA 3OYJA 2OPSA 3NH2A 4F4YA 2ZKUA 2DTUA 4F2SA 4CCHA 3AVGA 5KFWA 5HROB 3HL8A 3OSPA 4MKAA 4FLZA 4WFXA 4I2PA 1EX4A 1I3AA 4CJWA 3RMCA 4FVMA 3DOLB 4JV2A 4OPJA 3ZT1A 4URQU 4E7IA 4KO0A 3BR9A 4RW7A 1VSHA 4FS2A 1QSSA 3AA2A 5EUHA 3M8PA 3P83D 3GV8B 4C8OA 1RT7B 4CEZA 1S9EB 1WAFA 2D0AA 1VRUB 5DQGA 3DRRA 3H4DA 4Q43A 2XY7A 5HLFA 4KHRA 2LSNA 2IC3B 4ZHRA 4FJGA 3BQ1A 2IS3A 3V6JA 1C0TB 4NLRA 3V6DA 5KT2A 3V1QA 3SPYA 1HYSA 2GV9A 3H5UA 1HYZA 1LWCB 1I6JA 4KTZA 4B8AB 5F8IA 4BDYA 5KFLA 4ELUA 4PWDB 3PR5B 3CWJA 3LZIA 4MK8A 5C25B 3OJUA 3HP6A 3L2UA 1FKPA 4H4MA 5I42A 1UWBB 2CJQA 3NF8A 4E7LA 2ZD1B 1TKZB 1S49A 3QEXA 3SZ2A 4M3TA 3QZ8A 3IN5A 1L3UA 2G8IA 1RBRA 3OS0A 1TL1B 2B5JA 3G6VA 4I2QB 3WNFA 3C94A 2VG6B 3TAEA 4DTRA 2Z1HA 4J9KA 4FBTA 3MF5A 1IM4A 3QEVA 2IC3A 4M42A 2C2RA 3OL7A 3D45A 4M45A 3NGZA 3RAXA 4KE5A 3M8QA 3MR5A 4CF0A 1WSGA 4KHQA 4FXDA 4W5OA 4QWAA 2Z1JA 3BGRA 1BL3A 3KD1E 4DSKA 1IKVB 4DQSA 3HPGA 3MR6A 4HUGA 3IRXB 1RA7A 1C1BA 2G8WA 4KFBA 3ZT3A 3ZSVA 3KJVA 4W5QA 3C95A 3TANA 4TQRA 4DF4A 3SPZA 5F8MA 3K2PA 3T19A 2WRMA 3AV9A 4MIBA 2D5RA 4ZVHA 2VG6A 4KV8A 1C0UA 4DTXA 4C8NA 3K5MA 3VQQA 4O3RA 1C1BB 4ZP9A 4IH5A 1NOYA 2XCPA 2RPIA 3T5HA 4KI4A 3V81A 3KHLA 2EX3A 1T05A 3U3YA 2BE2A 5L1LA 3M8PB 4WZMA 2W8LA 4QOZB 4CIGA 1KSPA 1BI4A 5DGBA 4ZP6A 3JYTA 1YT3A 4FJ9A 3RTVA 1BCMA 4BWJA 4M3WA 1T3NA 3DOLA 4J2DA 5I3UA 4DTNA 3IS9A 2JC1A 4I2PB 5KFTA 1D5AA 1MU2B 4YR3A 3PX0A 2IOCA 3M8QB 5KFXA 1VSMA 1QSYA 4FJ7A 1U48A 4TLRA 3PV8A 3KKSA 1TL3A 1C2PA 1X9WA 3KLGA 4EZ9A 3NDKA 3KK2A 1HARA 5DQIA 3H5XA 4NLUA 3OY9A 1S9FA 5KFSA 2FJWA 3A2FA 1ASWA 3ZSOA 4WXWA 2FBTA 1HQEB 4W5NA 4M3XA 1KVAA 1RBTA 1JLQA 3KLFA 1S1WA 4H4MB 5FRMA 1BCOA 4IFYB 4K4XA 4WYWA 4B9LA 2HMIB 3SQ1A 3G10A 1IG9A 2W9BA 2AGQA 2AWZA 3H2LA 4R8UB 4LSNB 3MEDB 4CHQA 1SKWA 4ECXA 4M3ZA 5FDLA 3HVTA 4ZHRB 2IM3A 5K14A 2W7OA 3EY1A 3QETA 1S0MA 3QIPA 3G86A 3PW7A 3QEIA 3ZT0A 3H5SA 1TP7A 4KAIA 4FYDA 3QZ7A 3OYEA 4ICLA 5KFKA 4CJQA 3T1AA 1SKRA 4CESA 2E6LA 3QLHA 1S9EA 2VG5B 1U49A 3KK1A 2FVCA 4ECWA 3SJJA 2IMWP 3K58A 2FJVA 5DG7A 1GX5A 2OPPA 3DRPB 1X9SA 1NK9A 1KVCA 3ALYA 1J9AA 4CJRA 4ED8A 3GIMA 3DLKA 4IQXA 4ECQA 3D0PA 4O4GB 1B9FA 1JLBB 1J53A 1S48A 3S3NA 2CKWA 5JS2A 1NK8A 2XY6A 1C0TA 3V1RA 4KHMA 5KFVA 1DTTB 2J6SA 3VQCA 1RT3B 1BISA 3PJWA 2D7SA 3RBEA 4FZZA 1TVRA 2B6AB 1ZBLA 1RNHA 3H59A 1FK9A 1JLCB 3RMDA 1Z26A 4CERA 3FSIA 1JXEA 3NBPB 3MR3A 4C8KA 4QWCA 4JRPA 3LP2A 3DDKA 3LZJA 5CYQB 1S6QB 4M94A 4PUOB 4FM1A 3DRSB 4H4OB 5CYMA 5J2MB 2Z1IA 3NGDA 4FM0A 3WNEA 4DS5A 4YMEA 3MEEB 4J9MA 4O44B 4CEOA 3OYHA 3OYCA 3NF9A 5KT5A 2JEGA 4CE9A 2VG7A 1UA0A 5HRSA 1SUQA 1SUQB 4IOBA 3CJ0A 4L8RB 3CQ8A 3V9ZA 4B08A 3PHEA 4YR2A 4FLYA 4DL7A 2GBZA 2PY5A 3WNGA 3KK3A 4ELTA 4CF1A 4Z0UA 1EKEA 4Q8EA 1A5VA 2X6SA 1N56A 2D3ZA 4DF8A 3AVBA 3L3VA 4G1QB 4FJHA 1ZYQA 1B9DA 1A5WA 1RTIB 2FVRA 3DLEA 4WE1B 5J2QA 2X6NA 1N4LA 4OPKA 2WCXA 4RNOA 3VQAA 4RU9A 4IH7A 1ZTTA 4ECZA 4KB1A 3QLHB 5EWFA 4E7KA 3BSCA 2YKMB 4Y2AA 4CK3A 3UIQA 1JXBA 2F8EX 3PUFA 3NAHA 1HPZB 5JXSA 2IJNA 1Q9XA 4KPYA 4XPCA 1B92A 1J5OA 2OPRB 1N5YB 3QIDA 3MEDA 2VWJA 3LP0A 3VQ6A 3HXMA 2YHAA 3FRZA 5KFJA 5CYMB 1TK0A 4DWIA 4GVMA 3I8DA 2D3UA 1XHZA 5KGWA 3TAMB 3Q8RB 3NGIA 2WHOA 1VRTA 1U47A 3VQBA 1DTQB 1KFSA 2VWKA 1REVB 1UA1A 3V81B 4CJUA 4Q44A 3OYNA 1C1AA 4HCBA 1YTAA 5F8NA 4DFJA 1Q8IA 4O5BA 1L3VA 4KB0A 3ISNC 5FDLB 1JKHB 3AVFA 4ECSA 2ETJA 4CJLA 4OKKA 4NCBA 3OYKA 1R0AA 2W9CA 2E9ZA 1IKXA 4TY9A 1LW0A 1QE1A 2AU0A 2G8HA 4LD0A 4YFUA 5EWGA 1XWLA 1IKWA 3B6OA 4HVJA 4MKBA 1TKTB 4EP5A 4MH8A 5HP1A 4ECRA 3LDSA 3THVA 3KLFB 3OS2A 3TABA 3ZSZA 4CJPA 2G8VA 4LY7A 3WNHA 1RT4B 1WN7A 2HMIA 1UWBA 5SZTA 3TQ1A 4FK2A 3CFOA 1RDCA 4E19A 1L5UA 4TY8B 1CZ9A 3BQ0A 5I3UB 2UUWA 5SWMA 3NAIA 3VN5A 1NK4A 5HP1B 1GOAA 4ECVA 3SI6A 3L2WA 4CJFA 3U3GA 1TL1A 2DPIA 5KG4A 4NCAA 3PW2A 2KTQA 2A1SA 1HNVB 1W25A 1JLGA 4OL8A 5C42A 2V0NA 1T03A 4KKOB 3UPFA 4CIEA 4AHRA 2HNZB 4CJEA 1J54A 4W5TA 4J2EA 3IGVA 3QEWA 1BQNA 3SUQA 3HYFA 1Y97A 3G6XA 3ZT4A 2BQUA 4R8UA 1JX4A 4ECUA 4ELVA 5T7BA 2YNGB 1RT2A 3LAMA 1ZBUA 4Y3CA 4IFYA 3MECB 1ZBFA 4JV0A 2AGPA 2C2DA 3QIOA 3OYFA 4F8RA 4M41A 3RAQA 3DLBA 4FJJA 1RT6B 2QV6A 4EBEA 2JEIA 4DTOA 4ED3A 4NRTA 2FJXA 4CFDA 3NH0A 4I2QA 3DOKA 2IM1A 4DSLA 3KK2B 4URGA 4FLVA 2R2RA 4GC7A 3NGYA 2I5JA 3CJ4A 3RRGA 1YTUA 3OYLA 5L1KA 2B5JB 4CK1A 2HHQA 2RDIA 4FS1A 1L3SA 3H08A 4DTMA 2R2SA 1S1UA 2QKBA 4WE1A 4DL2A 3BGRB 2FBYA 3KMQA 5KG2A 4IG3B 2IAJB 4DL5A 3BREA 4PWDA 4KTQA 3H40A 3JYTB 4DLEA 5C25A 4CF9A 5DLFA 5HBMB 1HYSB 3GV7B 4YQWA 2HNYA 1ASVA 1TK5A 3HHKA 1ZTWA 2P5OA 1IKYA 4FBUA 1VK0A 4Q5VA 4JS4A 4DL3A 4AHUA 2O4GA 4ED6A 2XRIA 3SUPA 1RT6A 4ID1A 3ZSXA 4DQPA 2R7YA 4TXSA 4FJ8A 5KFHA 4NYNA 2ZE2B 1WAJA 3KHGA 4IR9A 3OHBA 2XY8A 3CDUA 3OJSA 2F8TA 4CF8A 3DYAB 4DMNA 4U6PA 4RW6B 3KLEA 4F4XA 4PA1A 2KFZA 3L3UA 3SV4A 1R0AB 2W9CB 3NAEA 4ZVGA 4B9VA 5KFUA 3L2QA 1EETA 3NH1A 3BJYA 4MQ3A 4IKAA 3MAQA 5C42B 4IG0A 5KFQA 5KFAA 1RT7A 4MIAA 4CEAA 4HKQA 2YKMA 3DRRB 2HW3A 1RDRA 4Y34A 1LW2A 2R2TA 1SV5B 3MECA 1ZBHA 1TV6A 4DSEA 2RF2A 3AO5A 3ZSQA 3UDLA 3RMAA 4CJVA 5KG0A 3V9XA 1HNIA 3TWHA 5KFRA 3AVIA 2J6TA 1EP4A 2XCAA 1S0OA 5KFBA 1K1QA 1BQNB 3K57A 4DTUA 1RT4A 3ZCMA 2PYJA 3LANA 2XO7A 3VQ7A 1FXXA 2HB5A 1KVBA 4B9MA 4DSIA 2ASDA 2UVUA 3Q8PB 2X78A 3ASMA 1SH2A 1WSIA 1D1UA 5F8LA 2W7PA 3KK3B 3SUOA 2WTFA 2BGGA 2JGUA 1S9GA 4ZMMA 3PX4A 3VQ4A 2HHTA 4IRDA 4RNFA 1VRUA 4XIUA 2VG7B 2P51A 3LP1A 3TAQA 1NK7A 1REVA 3C6UA 1U04A 3VA0A 4KSEB 2BANA 4K4UA 3K5NA 3RWUA 4KHSA 4ID5A 4RW7B 3PW0A 3CFRA 5L1IA 3OYIA 1NJXA 1BIZA 1SL1A 3DLHA 4DTPA 1QE1B 1LW0B 4G3IA 4RW9A 4CK2A 3V1OA 3DLGB 3DLGA 2FVSA 4CFAA 2F8SA 4WXOA 3I0SB 2I1RA 3N6LA 1MMLA 4F4KA 1RAJA 3SFGA 3S3OA 5E41A 5KFDA 3CIZA 4R5PA 1QAJA 3L2VA 3CFPA 4JS5A 2JEFA 1Z25A 4OKEA 3AO3A 2ASJA 1HQEA 4KAZA 2JC0A 2Y1IA 1KCFA 1TVRB 4F3TA 2EHGA 4NLVA 1RCHA 2XHBA 2GC8A 1F21A 2G8UA 3UR0A 4J9SA 3VQEA 3DI6B 5J1EB 1JLAA 3OHAA 3NBPA 3OL6A 5KTQA 4N5SA 1RTDB 5KG5A 4CHZA 4CEDA 3L2RA 5KFCA 3FQKA 3KLHB 1FK9B 3MXMA 3I5CA 4FZXC 4ID5B 3ISND 4B8CA 3EYZA 4B9TA 4BDZA 4IG3A 4KHWA 3BQ2A 3N6NA 1BIUA 1C1CB 3LAKA 2YNIA 4DFKA 1NK0A 1D0EA 4CGFA 1LWEA 2BRKA 1ZETA 2Y1JA 2Z1GA 3VA3A 3MR2A 3O4NA 3QGHA 5HRNA 1T7PA 3M9MB 3BSNA
chains in the Genus database with same CATH superfamily
1UVIA 1NO8A 5ETKA 3QERA 3CD6N 1CJUB 3MOZA 3CCWA 2BKNA 2BJ3A 3M9NB 4DXLA 1CG2A 5LSRA 3C14B 4LSZB 2EBGA 1D3WA 3NY0A 1BG3A 5AQIA 1OQ6A 1DLOA 4RUBA 2HHXA 4EUVA 3CCUN 4PQUA 2XM3A 4K25A 3AVCA 2J9EA 3ZZYA 3IBCB 1UP1A 5GIOA 2FJDB 3QNNA 4ICLB 4RW6A 2A1BA 4B3TJ 2XMAA 1Y0HA 4PR6A 2W2PP 3ZX0A 2MMYA 2BQ3A 4JI5F 4TYBA 3QWUA 1C4AA 2E44A 3A3PB 2K1RB 1IUJA 2BBEA 2QK9A 3S1TA 2B7CB 4CJKA 1NPKA 2KW4A 5BREA 3KJVB 3LP2B 4XK8C 4KHUA 4RW8A 1XI1A 3GOIA 2YX1A 1Q8KA 3DMJB 2OEKA 1PYSB 2CNOB 5B0GA 3BZKA 2HVDA 1QQCA 5HN0A 4OJGA 4CVNE 2CPDA 3ULDA 5DM7Q 2AJ1A 1WSJA 5A2QO 4EGLA 2DNLA 4BREA 3BBBA 4KH5A 1K44A 4ZPTR 2HNYB 3C46A 2L48A 4H0YB 3P1GA 1JWWA 3NVKA 2QIFA 3CI5A 4I6WA 4RZRA 4ES2A 4TQSA 2ASOA 1MLAA 1AW0A 3QICA 2XWXA 1KWMA 2FLOA 2DPNA 2DGQA 5HJXA 1WB9A 4QW8A 5ETNA 1IKWB 3HT3A 2YWKA 3OYDA 4ED7A 4QU7A 1OMSA 2ZE2A 2CXEA 4DPWA 1NRKA 3TJ8A 2WB1D 5GIPA 1LXJA 1Q78A 4CI0B 3OYGA 4QCLA 4CJ3A 2IYGA 5AE2A 2R8JA 4KHYA 3K5OA 4LSNA 4ZK7M 2EG1A 2Z2LA 1AZSA 4PXDA 4M3UA 4B1ZA 3AOAA 3EICA 2Q2RA 4NLGA 5E3PA 1UFKA 4JYAK 1QAYA 4IDHA 4NYOA 5J2QB 4ZJQA 2FZKB 2M52A 3HVRA 2Q97A 2VFRA 5F8JA 4JI4J 3UKRA 1VQ4N 3WBZA 1XJWB 4CEFA 1MWMA 4LREA 1YJRA 2YWHA 1LWCA 4CZIA 3CCUS 1YVNA 4NRUA 4PKGA 4LQ3A 4CTAB 5C10A 4TSXA 3P96A 3G6YA 5J2PA 5DLGA 4LFCJ 1IKXB 4YOVA 1BHLA 1SH3A 2HWHA 2ZBRA 2R7RA 1TYQB 2LKZA 3B8AX 2OPQA 4UUXA 1RTZA 4IO9L 2XYGB 5THWA 4HHUA 4L74A 1HJRA 4QPXA 3EM1A 1JQGA 4DV5F 1HLWA 2E1ZA 3CMEN 3C6TA 3PEJA 2R9LA 1IJEB 2DRBA 4W90B 4YOUA 4RW4B 4PZVA 5KFNA 3EPGA 1BC6A 1SC6A 4QS7A 4DUZF 2IBKA 3N5FA 4RG8A 2YX6A 1S4EA 1TUYA 4ED2A 3AD9C 1U6ZA 3HSJA 3CJ2A 3CQYA 3JTNA 5B7WA 3SMSA 3D28A 3QO9A 2AJ4A 2ZZTA 4GVEA 1MWZA 4FCYA 3CCVS 4CJ7A 4EHUA 4I9QA 2NYHA 2P1JA 5HRRA 1NNDA 4USTA 1T8EA 3P31A 2UXCK 2P9LB 4O3SA 4CF2A 1MNEA 3R6GB 2LDIA 3GIIA 2HPUA 3L4QA 3UO0A 1RTHB 1KTQA 4NZ0A 4EU0A 2G4BA 4DI6A 4JKAA 4USHA 3J7ZO 2E1YA 1GAOA 4DV5K 2LP4A 3FK4A 2XS2A 3VQPA 4X4TA 2OTLS 5C24A 1OJ4A 1TKXA 3MPWA 1BDGA 1I39A 2H1YA 3I5BA 3JSMA 3AO2A 4K8ZA 3IFRA 4RNNA 4QW9A 3BDPA 1G15A 1UAXA 3DNCA 2DJWA 1U09A 5TKYA 3DLEB 3FEXB 1NH8A 4C0OC 3VTHA 4C23A 3MCMA 4TN2A 2LQBA 3KD5E 1RT5A 3VGTA 3AA4A 4KO0B 1I94K 4RW9B 2OELA 3IA0A 3HLUA 1FNXH 1ZZFA 3LWMA 3VAGA 1NKBA 1FJGK 1U2CA 4CLYA 1W2IA 3M8SA 3SQ2A 3ATUA 3MCAB 2NZ4A 2W9AA 3OVAA 3BYRA 1HQUB 4UQGA 4YHHJ 2QKKA 3CULA 5AZJB 4BC4A 4LFCK 4KRFA 1JNRB 3GDQA 2YJEA 1U0HA 3RMBA 1KD1O 4M3YA 1PJ6A 3LGHA 3NCIA 3MI7X 3F0NA 4TLQA 4M5LA 3TVZA 2KJWA 1XQIA 4OJ3A 2UXBK 4A8SA 3ENHA 3C2PA 3V4IB 1FWKA 1VQLS 3SLCA 3CTRA 3KLHA 1HNXK 2ZDOA 3AA5X 3J81U 2HVHA 4J9NA 5BJRA 3W9IA 1XMOK 2QRRA 1GK8A 2AP6A 2GVZA 1OWXA 4LH4A 2D9PA 2R7OA 2P2CB 4MLEA 4NCGB 3KLIB 3MWBA 4U8YA 4FLTA 2CGKA 1O6XA 3GR0A 3TR8A 1TAUA 3KK1B 3GTYX 3O9SA 1Y11A 4FKXA 1RYRA 9ATCB 2MQMA 2PT0A 4C3KA 3J8AA 2CNLB 3T1HJ 5CH7B 1XHXA 5AQVA 1S99A 4IOCQ 3V4IA 4QIWD 2QWNA 4Z4GA 4CW7B 2UXCJ 2R3VA 4HDHA 1WUUA 1V5VA 2V68A 4BS2A 3CCMN 2XQCA 4J9RA 5KFOA 2YNGA 1OH8A 1WSHA 2Q31A 4GMJB 3W8GA 3EKUA 5AE1A 2P8IA 1H73A 2RDJA 1DARA 1SI9A 4C2MA 2X3GA 4J37A 4BVPA 4HCCA 2E9RX 3HVWA 5KOWA 4JUZA 3AFGA 3HK2A 4ZVQB 4X65F 3AA9A 4OI0A 3OT9A 4DU4A 1ZAXA 2XLIA 4A5AA 2Y0BB 1TL3B 1P9QC 2V2QA 1TKZA 3G71S 3EZOA 3CM6A 4WIIA 4CO1A 4CGGA 4X66F 3DOMA 2B6AA 4LSLB 4GKJF 3K5PA 3VMFB 3VR1A 4DQRA 1VQOS 5F1XA 1IWGA 1IO2A 1G1XA 3M2UB 1F3FA 2MZTA 3CCQS 3MOJB 5A2QY 2F1FA 4BQLA 5M2UA 1TK8A 1Q5VA 5AQQA 2IRXA 4OI6A 4PL7A 3GYNA 3GJRB 1NKCA 3I4HX 4QIVA 3ZZPA 3RVCA 2CWKA 3QRQA 1FFGB 4OHWA 1WG1A 1ZC6A 3LPUA 4GW6A 4FJNA 2YHBA 3PY8A 4Q8FA 3H46O 2W6LA 2OPPB 3DRPA 3NEKA 1XMBA 2Q36A 1RILA 2MJUA 4Y00A 3QYYA 2BQRA 1CLQA 2MKHA 1BQMA 4PRFA 1JXLA 2E1PA 4ZP7A 3DU6A 4O3OA 1C0UB 2VC1A 5LMNK 4DQQA 2QYCA 4BACA 1W2BR 2I0XA 3UN5A 1K0VA 4CLUA 4KRWA 4G6VB 3UDEA 4K5SA 5KG3A 4WJBA 3TARA 2UUCF 3QJJA 3PIOL 4CJ4A 3K9KA 1ZM9A 4CECA 1IXKA 2FGOA 1LWFA 4YB1P 1TUVA 1NMEB 4RNHA 1NG9A 2AEJA 4PKDB 1QS4A 4EMDA 4NLCA 2LEAA 3QT5A 4IEIA 3MCNA 1RZMA 3O9RA 2KFNA 2MB0B 3WX8A 2OPQB 3DMJA 3CJ3A 5ETPA 5I4MA 2PBDA 4YS2A 1S22A 3DXKA 3ZNJ1 5CY4A 4ERDA 1NDPA 1X5SA 4KGMA 3OR2B 4F4ZA 2CH5A 2PGCA 4H0OA 4B3SK 4HYKA 2NXUA 3FC9A 2J0QD 1JCGA 2P9PA 3MPYA 4C8MA 3OLAA 1UPPA 1XIQA 2HEKA 1KC8O 1CZAN 4RTFD 3CD7A 3G4SN 1GEHA 3Q8SB 4NLTA 3NNHA 1NB2A 2CRLA 5KQDA 3EZUA 2J0SD 2J9DA 2BACA 4DEZA 4DUZK 2YJFA 1ICEB 3FFIA 4I4BA 3RB3A 3D4JA 3GIJA 3G82B 3M8RA 3MM6A 2RKIB 2E7XA 3JXUA 3SQ0A 3DM2B 3GILA 4K4ZA 4RO0A 1KLNA 4ZN3A 1U45A 2DY9A 4LRFA 3M1VB 2HHVA 3V5RA 1DQAA 1C1CA 2V8GA 1TKXB 2M8DB 1LAWA 4CD3A 3P6YC 2CJBA 2BOPA 2OI2A 3W2WA 3M9OB 3W60A 3A8KA 1U2VA 4HWIA 4F4AA 1HNXJ 2A3JA 3S7RA 4A8FA 4LF7J 1HNVA 1JLAB 3KHHA 4EHTA 1FI4A 2UU9J 5KFYA 4B3SJ 1TUGB 3CC2N 4CEEA 2GZOA 5J1EA 4B9SA 2LEBA 3GJTB 2KQ2A 3T5JA 1KRPA 3GV5B 3J80U 4PY5A 2LDYA 3A5MC 2FLPA 3P39A 4X62J 1SQKA 5MLCV 3CG7A 3NF7A 4EP4A 4ZPBA 2X7IA 4P52A 4FL9A 3GSIA 5T14A 5AZJA 2UVRA 1TGOA 4JYAJ 3AVNA 1U1QA 3VAMA 4RPFA 4HTIA 1S6QA 4IO1A 2FBXA 3EL2A 3ET6B 3VQTA 1FJGJ 3IBFB 4DR5J 1HNIB 2ZZNA 4DL4A 5KRTA 3JSBA 1XEZA 4NLDA 4OGCA 1FW6A 1D9FA 1VQ5S 4DJBA 4KB7A 5A8RB 1AXQA 2JZ5A 3MEKA 4CH1A 3A8EA 2HMPA 4LJMA 2KXNB 5A8RA 4CJSA 4CBWA 3DXMA 3WXLA 3IM9A 4KREA 3H0PA 3N0VA 4AQYK 5EDWA 4GV9A 4P10A 2C22A 5C24B 5L1JA 2MPUA 3Q7CA 1VJWA 1GX6A 3OL9A 4PG7A 1MWQA 4DV4J 5B0AA 4NLSA 1X1PA 1B99A 2V9KA 2VA3A 5DDOC 3U1NA 4RNMA 2P9LA 1HL6A 1SZ2A 2CVEA 1OH5A 2ACMA 3MPDA 4JI8F 4ZPDA 1HA1A 5FIIA 1S10A 3HKZD 2P9SB 1IJJA 2VG5A 3VV2B 4I9LA 4QYZK 1RCXB 1IKYB 1U0HB 1ZM4A 1N36F 3NH2A 4WF9L 4F4YA 5AQKA 2MHNA 2HK2A 1KXPA 4U9RA 2MZRA 4LF1A 2N3LA 4F2SA 3CGIA 4CCHA 2J9DE 3EXCX 3T41A 5L9NA 3JQMA 3C65A 1CEZA 3HD2A 3VEVA 1GLBG 5EXWA 1RAEB 2I7NA 2CH6A 4KO0A 1IQZA 3IWLA 3KXDA 1VBZA 5HQMA 4CIOA 2A41A 3P83D 3QBWA 3GV8B 1RT7B 3KG0A 1WAFA 1VRUB 1OH7A 3H4DA 1Y64A 3HULA 5HLFA 3NCPA 4FJGA 4WQ5A 3BQ1A 3V6JA 5TKWA 4AYBD 3LH2S 5A8WA 1ZAVA 2OTLN 2UXDF 2HIQA 3H5UA 1KVJA 1HYZA 2A6AA 3MUTP 3CCJN 4KTZA 4B8AB 1YXQA 4LF4J 3EKSA 4OI4A 3U9DA 4ELUA 4PWDB 3WX4A 4MK8A 4CLFA 1N33J 5C25B 5C2CA 3O44A 3NNCA 2VQFF 4H4MA 3NMRA 5I42A 2GIFA 4GMKA 2DGTA 2YKQA 1CVJA 1YJ7A 2ZBCA 4LR8A 4GKKF 1EZZB 2XNQA 3NGSA 3IN5A 4DV1F 2GGPB 4PWWA 2E5LK 1HKGA 3M05A 2ZJRQ 2VG6B 2R7SA 5H9FK 3M2UA 4DR4J 4FBTA 4FYWB 2IC3A 4OYMA 1HQ2A 2Y0SD 2AIRB 3Q24A 3MR5A 2FSNA 4CF0A 3G8TA 1XK8A 4UZCA 2DRAA 1WSGA 4KHQA 1P6TA 4QWAA 3BGRA 1EHWA 1BL3A 2IVOA 2P9KB 3KD1E 3HPGA 2ROEA 3IRXB 4HUGA 5A8KA 2DR7A 3DFEA 3QFUA 2P9UA 3KJVA 3Q83A 3ZSVA 5FPEA 1RI7A 5ETLA 3TANA 4DCJB 1Q8BA 3FZHA 5F8MA 4ENOA 3K2PA 1LOTB 3DCAA 2WRMA 5K8OA 2VG6A 4F3QA 4C8NA 3TX8A 1RU2A 4X62K 1NOYA 4M5DB 4K8RA 3A5OC 3B4DA 3M8PB 4USWA 4WZMA 5DGBA 4NXMK 3DLJA 1UVNA 1NM1A 1BCMA 1LFWA 1WORA 4J2DA 3ZTRA 1IQTA 3RYLA 2EPIA 3PIPQ 1AUSL 3GE1A 3PX0A 4YR3A 2W2MP 1VSMA 4FJ7A 2QN6B 4U96A 1U48A 3OFHA 2P9EA 3KLGA 3ILLA 4EZ9A 3THYA 1HARA 3R3TA 5DQIA 3H5XA 4LF5K 5EX0A 2M4MA 3AJ1A 1YIJN 4CLLA 3J7YU 3CC4S 3C66A 5KFSA 4CZMA 4OZ3A 3CJRA 2GA7A 2FBTA 1M0SA 2OD6A 4W5NA 2O8EA 3KLFA 3PDNA 3IAM9 2DD8S 2MDAA 5FRMA 2HBJA 2Z8QA 2KHOA 3G10A 1IG9A 4YY3F 4RL1A 3PTWA 3OVSA 4BRPA 3FZMA 3KJQB 1U25A 4LSNB 3EMTA 4Y2KA 5FDLA 4BLGA 2IM3A 5K14A 2W7OA 1N0VC 2M9KA 2ZUGA 3NCQA 2Q1NA 1HWUA 2Z4PA 4FYDA 3QZ7A 4ICLA 4OX9F 3T1AA 4RWTA 2NYIA 1SKRA 1Y5NB 4F0HA 3UKUA 1S9EA 2LA4A 1LK7A 3SBGA 4F25A 1M5PC 1X3MA 1GX5A 2OPPA 3DRPB 1RP5A 4JKFA 4CJRA 2WVFA 1X4FA 3OFGA 3DLLL 4FWKA 8AT1B 2YVSA 4IQXA 2QMWA 1KNZA 4MO4A 1B9FA 2ZWOA 1JLBB 3GLJA 1H6KX 2H3EB 3FBEA 5IM0B 4BRMA 1SIZA 2GFFA 2CKWA 3QDKA 2HYIB 3VWSA 1NK8A 2XY6A 5B0CA 1C0TA 3V1RA 2ZM6J 3VQCA 4P72A 1W97L 3UKUB 1X0PA 1IBKJ 3H42A 1BISA 3K8WA 3CC4N 4ILMA 4H5RA 2CZ9A 1AUDA 3L6QA 1E3MA 3EE3A 2ZBIA 3TU5A 2MQ8A 4PG5A 2VQFJ 2CPJA 3FSIA 3D3CJ 5BYRA 4PUOB 3FNNA 4FM1A 3H7HB 3SAHA 5J2MB 5CYMA 5IOLA 2DGSA 2BJDA 4DR3J 4LRDA 4J9MA 4FVUA 2YH1A 1SXLA 3AGKA 3EGWB 3OA9A 2NXEA 2VG7A 3GFHA 2BZ2A 4LFCF 1YAGA 5HRSA 3CJ0A 1R8BA 1CC7A 2QXLA 1VIOA 2CIMA 3CQ8A 4A8KA 1U1KA 3IWNC 4YR2A 2E29A 3THPA 3W8PA 4DL7A 1FVQA 2MTLA 2PY5A 1N32F 3OTEA 3TW0A 4CF1A 2UV8G 4Z0UA 2V4JA 5IXUA 2IYIA 1VQ9S 1N56A 2F4VJ 2O8BB 3DGPA 3CJ7A 1U02A 1B9DA 4QS8A 4CLSA 5K20B 5J2QA 1RCOB 2C3PA 2H48B 3JAMO 1N4LA 2N4CA 4OPKA 4RNOA 4IH7A 1ZTTA 1PIEA 3QLHB 1UWAA 4CZFA 2LQJA 4IJAA 1Q1KA 3UD3P 5M1PA 4NA2A 1RWUA 1H72C 2HSTA 2QEXS 1Q9XA 3ZEUB 4DV7K 2JLFA 3QIDA 2VWJA 1HNWK 3VQ6A 2YTCA 3A12A 5CYMB 2DNKA 3IRWP 4DWIA 4DR1F 2D3UA 3WXJA 5LL6d 1PYOB 2DNQA 2QC3A 5HQ8A 2VWKA 1REVB 2XG8A 3ENWA 4CJUA 4Q44A 2PMWA 4ZLNA 3CJKB 2H5JB 2GX9A 4JI0K 5F8NA 1MW7A 2ZM6K 1L3VA 4KB0A 2Z2ZA 3ISNC 3ZZTA 3OBIA 1C4CA 3AVFA 3WXIA 3TWZA 3VGMA 4OKKA 1FFWB 2J8SA 1K0TA 4FWMA 4FF4A 2H4YB 4WFNQ 1FTRA 1QDUB 1NGDA 3G9CA 3FEYB 2C3YA 1IKWA 2FHJA 4DV3F 1TKTB 4Q2MA 4B1WB 4MH8A 1VDHA 3OS2A 1EX8A 1R7IA 2VODA 3QT7A 2CPYA 4DHYA 1RT4B 2HMIA 4DR3K 3PACA 2FC8A 4E19A 2QWMA 3KJNB 4UOCA 5SWMA 3TRGA 2VASA 3SDEB 3SI6A 4CJFA 3RBZA 2A1SA 1HNVB 5LMUK 4ZLJA 1MDUB 2V0NA 4KKOB 3AOBA 2EK6A 1NSPA 2NRWA 5HVGA 4AHRA 3VCDA 2VHGA 4CJEA 4J2EA 3IGVA 1VQ7S 1BQNA 2BJ9A 5DZ7A 3HYFA 1IV0A 3AAPA 3G6XA 2V63A 2BQUA 3DJCA 4R8UA 4IOAQ 4ELVA 4P2MA 5T7BA 3LAMA 1ZBUA 4WP3A 1WOSA 1B0VA 1A9NB 4JV0A 2R4FA 2C2DA 3OYFA 2F4VF 1Q18A 3P5BP 3DLBA 4IEEA 3N9UC 1RT6B 3IR6B 2VQEK 3QRPA 3WC2A 3OTBA 2IHR1 5DZ6A 4FLVA 2DKOB 4GC7A 1EQYA 3PFOA 1JJ4A 1VHXA 2CA9A 2ZOGA 3ZZRA 3FBFA 1I3OB 3AH6A 5BRFA 3KVGA 1KC8T 1QJHA 5H1SQ 3PXGa 1YTUA 3P45B 4LBHA 2QGFB 2Q3PA 3EN9A 5IS2A 1MWKA 1Q16B 4FS1A 2M8HA 1S1UA 5H9EJ 4WE1A 3BGRB 2YQ3A 2BM1A 2FBYA 4B1VA 4WKRA 4PWDA 3CD0A 2XULA 1IR0A 2QFJA 5C25A 4CF9A 1VC0A 3GV7B 2HNYA 5C2FA 2B4UA 4DV0F 2DCUB 4JN4A 1Y10A 4H0XB 4PG6A 1ASVA 1ZBTA 2G0IA 4FBUA 3C16B 2KT2A 2HLUA 1TL7A 2O4GA 4ED6A 1RAGB 3MMCB 2HF3A 3WQUA 4MMOA 3BO2A 4FJ8A 3U7JA 2FGCA 3OHBA 3OJSA 1I1GA 1ROFA 3FKBA 5ADZA 3L3UA 2LA6A 1R0AB 2NUUG 4Y6IA 2LU2A 1WI6A 4PEOA 1EETA 4MQ3A 1VR6A 5C42B 2ZBPA 5KFAA 5K8NA 1KTVA 3PIPL 1FVSA 1LFPA 1RT7A 1NJIT 1PJ5A 4HKQA 2YKMA 1HX1A 1H2UX 5ETSA 4Y34A 5I3PA 3LA0A 3R5CA 2XHWA 1ZBHA 4EFHA 4C0HA 4DSEA 2HBRB 4JHDB 2RT3A 4PYDA 1FERA 2EKNA 5KG0A 1RWWB 3CNQP 4DMZA 1WHWA 2VWBA 3HCXA 1BQNB 3IFEA 2CAJA 3KWGA 3ZCMA 2PYJA 5HI7A 3M6WA 3G8SA 3CQXA 2PO4A 1MWYA 1Q86T 2CDRB 4FWRA 1Q81T 4DSIA 2X78A 4LT6A 3ASMA 2HQGA 2PE8A 4Z7YA 1GXTA 3T1YJ 4IOAL 5C0YA 1X5TA 4LF4F 3QAUA 2BM0A 4KR0B 1S9GA 2HHTA 2B3TB 2RHSB 4DZ6A 4XIUA 1H0HB 2VG7B 2KO1A 5CHCB 3TAQA 3VA0A 4KSEB 2MXYA 3J81j 2E88A 3K5NA 1HUXA 3I87A 2Y1RI 2YXLA 5CABA 3DLHA 3VAJA 2KRBA 1LW0B 4QU6A 3MWPA 3RGIA 3V1OA 2FVSA 1NGIA 1KDNA 1OIAA 2GNKA 3A5NC 4K42A 2F8SA 3J7Z5 3AOCA 2C2NA 1VQKN 3N6LA 3PHTA 1MN7A 3FSYA 5LJWA 3S3OA 1VQNS 4CZHA 1HBMB 4B3TK 3M6UA 2BW7A 1RDWX 2GTDA 2W25A 2RQKA 4JI0J 2ASJA 2DT9A 1H1VA 3BO3A 2HRUA 4KAZA 3VF6A 2Y1IA 3E9OA 2OFGX 4ILRA 3UCZP 5HJYA 2XHBA 4CM0A 4MIWA 1Q81O 5AJ3K 3DI6B 1Q95G 1JLAA 3OV7A 4HI1A 3UE2A 4P9SA 2XMUA 1RHKB 5KFCA 3FQKA 1LXNA 3JQKA 2Y3YA 4H4KA 3LDPA 3R1HA 2Y8WA 2YY3A 4ID5B 1XMOF 2ITMA 3RBXA 4KHWA 4L73A 4DPTA 2A5XA 3TUZC 4CGFA 5ADXA 4IO9Q 1HBUA 2QO3A 4WIQA 3CF5Q 4BRAA 2ZHAA 4KHPJ 1T7PA 2HQFA 3E01A 3BSNA 4BY9C 1YJ9S 3RSEB 5JJBA 1HWJA 2QM1A 2NZCA 1DEJA 2VOPA 3I55N 2UUBF 1IJFB 2HFZA 3TA1A 2V69A 3TP2A 3GMGA 1S1VA 1D9AA 5D0HA 3VQDA 1U26A 3QJLA 3GJSB 4IH6A 3FFIB 5HOOA 2XC9A 4ZS6A 4EYHB 4CNYA 2NLXA 1T05B 2KHCA 3TEGA 1Z05A 4IG0B 3VALA 3PRDA 3EGZA 1S5JA 5K14B 5DDPC 3TZYA 4CGHA 2MKIA 2IM2A 5EX3A 3RW7A 1VQMS 4DLGA 5CZVA 4WFZA 2A2CA 3FCWA 3D2FB 3FUYA 3SAFA 3I0RB 1BO5O 4ZP8A 4RKUC 3MM7A 2XMTA 5F3TA 4YOWA 2VFVA 2D0OA 2YHWA 2FVQA 3C15A 1TYQA 1WF0A 4O23A 1VLOA 2MJNA 4QPTA 2E5LF 1W7AA 2MKSA 2YCHA 4USJC 3NLCA 1R8CA 4KH1B 1S0NA 4K50A 3N28A 5H1SV 1KAYA 1RGVA 2AQ4A 2NUHA 2HHSA 3Q8YA 2HVIA 2BJ7A 1LOUA 3EVOA 5EOYA 1T94A 1HWIA 2VDIA 3VZHA 3H5YA 2HHUA 3IG1B 2GAHC 1FE0A 3CJKA 2Z30B 1MU2A 2PFDA 4OX9J 2DHXA 2JVOA 1WKLA 1RLCL 2B4JA 4JEPA 4ZVEA 2PA3A 3MMBA 1E6VB 2HOEA 3OVBA 5EVZA 1NGBA 3FZLA 3VHQA 4ZVSB 4MLHA 3QINA 4CI6A 4QQBA 2ZM6F 1YI2N 4AL5A 4NOHA 2JWNA 5C5JA 2YHXA 2NPFA 4Q0BA 3RG6A 3CEDA 3DOKB 2U1AA 2VKRA 5KFPA 3PZPA 3R7NB 2GAGC 2AEMA 4CZCA 1FKOA 3AVAA 3SCLE 1GOBA 1FDDA 4URSA 3A4TA 4C11B 2DPJA 4WPAA 1U1PA 3SAGA 4MT1A 2PC6A 4XDCA 1ITGA 2IAJA 1T11A 4O0IA 3VGVA 1S57A 3JSRA 3PX6A 2UUAJ 5KFMA 3RZAA 2V9WA 2DGUA 3EZ5A 2HS4A 2LCWA 2VYPA 2E2QA 2CDQA 4Y0FA 2AZ3A 4YDXA 3E2EA 2WVDA 3DN9A 4WQ5C 4U7BA 3AO1A 2VBWA 3DKDA 2P5GA 4FWNA 5EHHA 3GP9A 3E66A 1JB0C 4DV4F 4AL6A 2EFNA 2E4LA 4MK7A 2YNFB 2IJFA 4EO8A 2HFVA 3P4UB 3WQTA 2DXFA 4LSLA 3MK6A 4H54A 5A76A 5ETOA 2C28A 4NLYA 5LY3A 1KAXA 2X1BA 3SBTA 4NLWA 3Q23A 3IUCA 4OX6A 4WKYA 4AXIA 1AB8A 1BWEA 4OGEA 2QA4S 1RBUA 2P6SA 1QVFR 4DR2F 1S5ZA 2MLYA 4K4WA 3R9PA 1SJFA 2QFIA 2OO4A 5JMVA 3A8YA 2Q6BA 4J7CA 4NYPA 2DNOA 1TL5A 5D4NA 2KZZA 3IAS9 3W66A 3AARA 3TAMA 4XPEA 1RYSA 1OS5A 1BQMB 4DR4F 3NFAA 4IUFA 5AR0A 2FSKA 4TYAA 4X62F 1J5OB 4CYUB 3QNWB 4WZQA 4GKKK 1WNSA 4C3LA 4PQAA 1X5OA 2GJIA 2YBVA 3IR7B 3D0GE 3PG9A 4ZIWA 4X66K 5T41A 5DMRA 3MN7A 4E8UA 1BXNA 3UDCA 1NCLA 2D3O1 1Q7YO 2G0CA 2I2YA 2D69A 4TU9A 4QOTA 3CDBA 8RUCA 4JI3K 1FKPB 2XMVA 4J9LA 1LNQA 2AYMA 4Z2XA 3NHGA 4FP9A 1ATNA 3NS6A 1BUPA 3RW6A 3L0QA 2Q79A 3KKRA 2CNKB 3OS1A 1W9HA 2ASPA 2DNPA 4WK3A 1FRLA 2RD5C 2VFSA 5DQHA 1S7IA 2UUAK 4HR2A 2VGNA 3R27A 2HHWA 5HRPA 3GFXA 2PZSA 4BRHA 3C14A 4TNOA 1XMQF 3R8EA 2VQEF 5HSPA 3D1OA 2BANB 1XTZA 3U8XA 3S9HA 2OEJA 6AT1B 2ZH4A 4J9PA 3DHWC 5CZ1A 1S9GB 1VIXA 4FYVB 2DHSA 2RQMA 4WFAL 2H65B 1SIWB 2M2BA 1WC5A 2QT7A 3PKMA 1NMNA 1AFJA 4HEA9 4PPDA 3KLGB 4P75A 1RACB 3HD1A 3T3FA 2LLZA 5DK5A 2IM0A 3DLKB 3W5XA 1KQKA 4MYTA 5DGAA 3FLCO 1FXDA 2FJEB 3OYAA 2ZJQL 2E6MA 2WONA 1NJWA 3FQLA 3BPSP 4DU1A 2O8EB 1RT3A 4DV5J 3RBDA 1NDLA 3MEGB 3O3FA 2Q3SA 3G0ZA 5BPMA 1LWFB 2CQ3A 4B9NA 4JHDA 2YV0X 4J2AA 2MY7A 4MAKA 3BGUA 4JP8A 1HR0K 2R7WA 2F96A 2EBEA 2R2UA 1KQFB 2VJVA 1XNQF 1HR0F 2FD2A 2VU5A 3OW2M 5D0EA 3DRSA 4FLUA 4AILC 1UOCA 2UXDJ 1RGIA 3ZSWA 3U9ZA 5A6WA 1YBTA 4JD2B 4DTSA 4X66J 1YK9A 1NM2A 3QGPA 4X2BA 3OTDA 3LP1B 3D68A 4OYOA 4BE2A 1JLFA 3PO5A 4K7QA 2RKIA 3UNYA 1DURA 2QLFB 3CE8A 2WOMB 3HTVA 2K7JA 2ZJPQ 3G6EN 2XGPA 3ZSYA 4IOXA 4K0KK 5AQJA 1F5BA 4JI7K 3GYGA 4YP3A 2QXFA 3CIMA 5J2PB 3TR5A 1ZZNA 4ZOSA 2LQ9A 3HPOA 1KP6A 4DV7F 3BEXA 2ZWHA 3GZ7A 2IGIA 4F0MA 3KDOA 3GIKA 3SNNA 1TMMA 3FBCA 3H1QA 2H9ZA 5CE3A 1PAUB 2HBMA 2FXUA 5K9FA 4ZCLA 3N6MA 4LR7A 1K6YA 4DPYA 5DM7L 1WC1A 3ITHB 1IR1A 1R6VA 1FKAF 4ED0A 3GR1A 2VBYA 2C2EA 3DAWA 4IFVA 3DM2A 4J9QA 4C9DA 3V9UA 2Z2YB 2A42A 3VQSA 2K1RA 4AD6A 2IRYA 1U1LA 1GNKA 2DNZA 4RUCA 3NE6A 3O5BA 3N5BA 4DTJA 2JFKA 1CQMA 3IC1A 2CWXA 4BROA 2R8IA 4LF8K 3KLEB 4NXNJ 1JLEB 1OVYA 1TL4A 3RUBL 5MAOA 3DDIA 3Q2TC 2CQGA 3T5LA 4F50A 3DLRA 1Q5YA 2KT5A 2I5JB 2EFQA 3D2EA 5KFFA 3PYEA 3D67A 5C12A 4QIGA 3SI8A 1BUXA 3I56S 2P9NB 3FGVA 1YITS 3VF4A 2HQCA 4WU3A 4Q0BB 2UXCF 4I68A 2DGOA 2X74A 1IKVA 2WK4A 5IT9U 1QHTA 3WIUA 4CO3A 4P73A 2FZCB 4Y2IA 1R0CB 2ATCB 1JLQB 4OHXA 4B3MJ 1YZ6A 3HHDA 4W4MA 2YNFA 4CD1A 2ZH2A 4NLOA 1TKTA 4K4SA 1KVIA 1RU1A 2EC2A 4K5RA 2BABA 2E2NA 2QA4G 4LF5F 3EPIA 2QW9A 1TFWA 4CTAA 1VRQC 2Z57B 1WEYA 5A8WB 1N32J 4K4VA 5HMZA 4HHTA 3O80A 2BV3A 2CPXA 4FJKA 1FEEA 1BGXT 1WJ9A 2KL8A 3JAMU 3BUZB 1HBUB 5KI6A 1DHMA 2ZD1A 2DGVA 2IY5B 3N4WA 2D1KA 4FPIA 5I42B 3C15B 1RTJB 1VQSA 1XQSC 1Z4UA 4CH7A 1IBMK 4I67A 3V9SA 3LALA 2UUTA 4DL0C 4YOEA 3MMVA 1T3OA 1RWOB 1JKHA 3TUPA 4KY3A 4A59A 3B8HA 2ATLA 4CEQA 3IMQJ 3O3HA 5E2QA 1ZPVA 3TAPA 2LFVA 5CD4H 3P38A 4FK4A 4OMFG 2CJKA 4DV1K 3ITHA 4WBFA 2GVZB 3H25A 3ZSRA 4W98A 4DFMA 4DFPA 3HT0A 5J2MA 3MCSA 2GIRA 2KM8B 3EUNA 2GWJA 3CXCM 3CB4A 5FLXO 3MPUB 1Q53A 4L3QA 4UY8O 4QWBA 3I0RA 1RTHA 4LH5A 3P5JA 3HBTA 3O8MA 4DKWA 4YHHF 1UL3A 4XTTA 1B0PA 2BVZA 2J76E 3H98A 4OYBA 4CHPA 3GIRA 1YBAA 4NXNF 1JIHA 1SBRA 1LAVA 1R8AA 5D78A 4KJIA 1NEEA 4Z4IA 1RJJA 2B4PA 1REGX 4QWEA 3M6GA 1E4FT 2UYTA 3VAKA 5FRNA 3QAEA 3VAIA 4E1NA 3O3GA 4DG1B 3QNOA 2AP1A 2XNRA 2YKAA 1HRHA 3KNGA 3ENOA 2FHKA 2XI2A 3B54A 5DO2A 5AFUH 1SKSA 3AA3A 4ALZA 4FK0A 1NK5A 4B9UA 4IKFA 5HAOA 3PM9A 4IQMA 4LFBK 1SL2A 3UD5A 5HATA 4LFBJ 1DJ0A 1RT1A 4IO8A 3PO4A 1S1WB 1JJCB 3LM9A 3O1LA 4PG4A 3V6HA 4DV1J 4CHYA 1P27B 3M6VA 4GVLA 3ZTPA 1ZBIA 5IFMA 2WTUA 3GQCA 4KHPF 1ZA1B 3LOUA 2V2ZA 7FD1A 2ZH7A 4ZVRB 3U27A 4FXVA 2KLAA 2RN2A 5E33A 2ZEJA 4BC5A 1U1MA 2C3UA 3ZTOA 4JB8B 2QLXA 2LQ8A 1JLBA 4N41A 2EW9A 3CC7S 3SSRA 4JKCA 2VONA 2CQBA 2ZOMA 3G87A 3J7YP 3SV3A 5F9NA 2XB2D 3NKYA 3MCOA 2UU9K 3TAGA 1K8AO 4NCGA 2KVQE 1FX4A 5GVQA 1KS2A 1HYVA 2NRVA 2OPSA 1S77D 1NSKL 4BQZA 3MM5B 5H9FJ 3GB0A 4LMZA 1S76D 2CQ2A 2WUSA 1HI0P 3AVGA 1X7VA 3HHLC 1RWVB 2VB6A 2IVNA 5AQRA 3P8BB 5D77A 1I3AA 3KWMA 3RMCA 5GMDA 4FVMA 2O01C 5AQXA 3MDFA 4JV2A 4OPJA 3ZT1A 4URQU 4XH5A 1NNEA 4LUBA 2G13A 4DR6J 4DR7K 4FS2A 1Q82O 2RJZA 5EUHA 3M8PA 2D0AA 1VQ8N 3KKFA 2A0FB 2I8EA 3AD8C 2IC3B 4ZHRA 4GY2B 4M5KA 2D4WA 4QR2A 3OR2A 1HHQA 2P9PB 3QFHA 5BPLA 1BD6A 2K8GA 4LF4K 1H2TZ 2GMJA 3MUMP 2HHHJ 1NH7A 1RE1B 3CPWM 3OJUA 3L2UA 4ILGB 3NS7B 2HFOA 4L76A 1UWBB 3K89A 5HK4A 1S49A 2W01A 2DTJA 2DITA 3M7VA 3QEXA 1PG5B 1L3UA 3R97A 5EX5A 1EWRA 4PKHA 2G8IA 4FVCA 2PSZA 1TL1B 5DM6L 3BF3A 2R7VA 3G6VA 3U02A 1PO6A 1N8RO 3J7AP 1DY3A 3WNFA 2G0JA 3CCZA 3EGVA 3KUHA 4J9KA 1ILYA 3QEVA 1ATRA 4M42A 3UDVA 3OL7A 2E8AA 4R79A 3TQEA 2XZWA 2EKYA 3U1MA 2V5HG 5M1OA 4W5OA 4DN9A 2VFTA 2EFPA 2HVEA 5IQ6A 4DSKA 1IKVB 4DQSA 3VERA 2FHOB 3SXLA 1C1BA 4KFBA 5CD4A 4UW2A 3I96A 4OYWA 4A8OA 4YY3K 2CUYA 3QATA 1NGGA 4MIBA 2R7UA 2H3GX 3WXMB 3MUVP 3H2UB 1HW8A 5IQQA 3CXCR 1C1BB 4L3KA 1YI2S 4X4RA 4IH5A 3D2EB 2RPIA 3V81A 2ROPA 4ES1A 5L1LA 1Y5LB 5DRKA 4CIGA 2RUGA 1PILA 1BI4A 2ZBQA 2Q0UA 4P7TA 4NXMJ 1S12A 4BWJA 4M3WA 4DTNA 2NXNA 3C8YA 2EEYA 5IC4B 5KFTA 3ZZ0A 4K43A 4DR5K 1TU0B 2IOCA 5KFXA 1N5QA 4ZDNA 3HSCA 2EK1A 3ZZOA 2HZCA 1N34J 1EIYB 1C2PA 2YWFA 4B3RF 2DNGA 3JXOA 3KK2A 3ILJA 4NLUA 4CM2A 1B3TA 5LMUJ 3OY9A 1N36K 1YUWA 3FEZA 3ZSOA 1HQEB 3IDHA 3MPVA 4NWBA 1RBTA 2CYYA 1JLQA 1RHQB 2BE7D 4IFYB 4WYWA 3SQ1A 1RAFB 5AXMA 4QBUA 1QQNA 4EAHD 2VQFK 5FLXU 1X31C 3ZETA 3W7BA 3ZYYX 2AWZA 3H2LA 3T1YF 1RK8A 5C2DA 1V4TA 1OSDA 3MEDB 5LT5A 4CHQA 1SKWA 4ECXA 4M3ZA 1JMTA 3E9LA 3EY1A 3QETA 1S0MA 4WFNL 3ZNUA 3ZT0A 2VV5A 2LVWA 2E5LJ 4JI2J 4KGKA 4CJQA 4GVBA 2AEFA 2E6LA 3QLHA 2VG5B 1N5VA 2I9SA 3MMAA 1BQXA 1PAEX 4RBVA 3K0SA 5KPRA 4BRCA 4UOHA 1NK9A 4ZJLA 1M5HA 1VC5A 3ALYA 4HI2A 1J9AA 4DR6F 1QVGR 1M5VC 1G99A 3D0PA 4O4GB 4B9QA 2DB1A 1YKWA 4LIWA 1VQON 2CJAA 4DR3F 3K0JA 4BRFA 1S48A 2J9CA 5CZXA 2FUG9 1GTEA 6FD1A 1VC6A 3I8BA 4B17A 5HMYA 1ATSA 5KFVA 5AZIA 5KPTA 3M4XA 1LQ9A 1ULRA 3RBEA 4YN3B 1ZBLA 3H59A 2NLWA 1T6DA 2IIRA 1JLCB 4GO7X 5KQ8A 3CDAA 2ZDPA 1Z26A 4CERA 1JXEA 5AQPA 4JRPA 4ID8A 2GMLA 3DDKA 1BWVA 3O3LA 5CYQB 1NGFA 1S6QB 4H4OB 1BLUA 2Z1IA 4DS5A 4XH1A 3WDOA 3MEEB 4O44B 3NF9A 1L3KA 1F2GA 4CE9A 1PCAA 4IOBA 4GVBB 4P7VA 2L3MA 3ZTSA 3J80Y 1PYTA 1PBUA 3PHEA 1Y3KA 2VJUA 4LF9J 5EN1A 1SJ3P 1IN0A 4UOFA 5C7PA 1N36J 2A10A 3WNGA 3W2VA 3KK3A 4DU7A 4USIA 3VVTA 1EKEA 5KOXA 4GNIA 4LFBF 5IWAJ 4DV6J 2D3ZA 3AVBA 2O8BA 4JYAF 4CWBA 2QMUB 1K8AT 1GLDG 5CR4A 4FJHA 1ZYQA 4C7QA 4KH6A 4XAKA 3TSUA 1QZ6A 1A5WA 2QTDA 2DO4A 2WCXA 1QM9A 2J0WA 4RU9A 3T1YK 4KB1A 1PC5A 3MURP 4E7KA 4Y2AA 1WC3A 3TSQA 4P71A 4BR2A 2F8EX 1K47A 4DV3J 2A40A 4OV6A 2HRTA 3A5LC 4HACB 2QL5B 4JOUA 1G6BA 1J5OA 4LF6J 2GO8A 3T69A 3G25A 2N4DA 1R8HA 4GVMA 1F0XA 4JI1F 4IJNA 3AQOA 5KGWA 4JI8J 3TAMB 1MMDA 3NGIA 3F56A 1RAHB 3VQBA 4D3GA 2HGMA 5E26A 2AW0A 2WBMA 1KR4A 3OYNA 1C1AA 4HCBA 1ZBSA 4A2AA 4ZCIA 3K2YA 1JKHB 3MCPA 4ECSA 4ZKAA 4F26A 4EI2A 4CJLA 3NRBA 1R0AA 1LCUA 3O5TB 4TY9A 4F36A 2QL9B 2QA4N 1XWLA 2QWQA 4X64F 4MKBA 4AT1B 3E1YA 4ECRA 3LDSA 3KLFB 1FJEB 5D0RA 1EO1A 4LY7A 3KG4A 3CMAS 4JI5K 4FK2A 1FJCA 3CFOA 1X4HA 4TY8B 3BQ0A 3NAIA 2ZUAA 1GOAA 3VAFA 4Y2MA 4DX5A 3Q8UA 3BP8A 2COLA 5KG4A 2KTQA 3AHPA 3OUYB 3AXMA 4A8XA 1JLGA 2DK2A 2YPYA 5C42A 3M2VA 1B4SA 2WSEC 1WTBA 3MDQA 4W5TA 3EO3A 4M63A 1NZAA 4HDGA 4CH0S 3SUQA 3TO8A 4LVNP 4QZVB 2F9JA 3BR8A 1UEVA 1JX4A 3ENAA 4OHVA 1DBDA 2GW8A 1ESVA 2YNGB 1RT2A 3BBFA 4Y3CA 4FF1A 4GKKJ 3SSQA 4C48A 4IFYA 4L75A 1RISA 4F8RA 4M41A 4KPCA 2BJEA 2JEIA 4DTOA 3JS9A 2VPZB 4F3MA 4OPAA 4CFDA 4DSLA 3R6LB 3MM5A 3CJ4A 3GCXP 3RRGA 3OYLA 2B5JB 1EJ7L 3CSKA 3HHLD 2VPXB 2DVIA 5JVHQ 3JS6A 2F65A 2UUBK 4A2BA 4JI6F 2G1HA 3DOMB 5IT0A 4DL2A 2WZ1A 4ZCMA 4V19S 3TVYA 3FJ2A 5AT1B 5CHIA 3BREA 1X8DA 5GINA 3JYTB 2ZNZA 4DLEA 2Y1LB 5GAHP 1HYSB 4OZJA 4UUWA 4HH0A 4QIFA 2V67A 3OUYA 2QSWA 4WFBQ 1TK5A 3HHKA 2P5OA 1NZ8A 2DR5A 5E5NA 3O1WA 3UN3A 2ZGZA 2XRIA 3SUPA 4ID1A 3ZSXA 3BB5A 4IOCL 4IWVA 3CC7N 1O8BA 3MM7B 2IDLA 5KFHA 4NYNA 1WAJA 2UUAF 3Q8VA 2RB7A 1FXLA 2B9EA 3C7NA 3DYAB 4DMNA 3EDRB 4RW6B 4KH0B 3LGNA 4CLPA 5DETA 4CP5A 3W65A 1M1KT 2EFOA 1VQPS 2NRZA 4BRIA 4H5VA 3VEXA 4UY8T 4ZVGA 4B9VA 1D09B 2G1DA 2IBOA 2RS8A 2N3OA 3NH1A 4OZ1A 3D0IE 4IG0A 1HBNB 1UFLA 4K0KF 2VGMA 4TU8A 3M8WA 4CEAA 4OZ2A 1SB6A 4LF2A 2HW3A 1RDRA 1SV5B 3MECA 1XNRF 2HFUA 1B64A 4HHJA 1FRIA 2V6AA 2RF2A 1WHYA 3UDLA 3V9XA 3R3LA 2KXHA 3R5AA 2E2OA 2UUBJ 4J9VA 5KFBA 1QVGM 4DTUA 2EWHA 3E9PA 2I38A 3QMLA 2HB5A 3S8SA 4M5HA 4GKJK 2XMWA 1J5EK 1F1BB 1WELA 3U1LA 4K59A 2FYXA 2N7YA 1NLKL 5F8LA 2W7PA 4JI3F 4L72B 1RADB 1G7CB 1IWAA 2BGGA 4A62A 4ZMMA 1CBKA 3DC2A 2P51A 3LP1A 4GRSA 2CZVC 2B56A 3RWUA 4KHSA 3MD1A 2RMLA 4ID5A 3CFRA 2BEFA 1SJ4P 4C6AA 3CJTA 1NSAA 2XTJP 4DTPA 3WEEB 3ATVA 4CK2A 3HSGA 4BR4A 3HRGA 4CFAA 2W4PA 3Q0AA 2ZH5A 4F04B 2ZH3A 4CO2A 1MMLA 1MROA 1H98A 2CGLA 2WFBA 1B0TA 5KFDA 4ZLPA 1WKKA 3CIZA 4R5PA 1QAJA 2CJYB 3L2VA 4BRGA 3AO3A 3BY5A 1HQEA 1KCFA 2EHGA 4NLVA 3MAHA 2GHPA 2K2PA 1VQNN 3LDLA 2G8UA 2MLXA 3AQPA 4R25A 4JKGA 5J1EB 2QI2A 3OL6A 5KTQA 1KN6A 2DY1A 4RWXA 4WFBL 3D1QA 1U2VB 3WEEA 3MTJA 4PXCA 3DXSX 4FZXC 3ISND 4NB4A 1H7WA 1BIUA 1UETA 1C1CB 2YNIA 3D1HA 1D0EA 1OO0B 2Y1JA 2Z1GA 3L7OA 1WSRA 3NWRA 3QGHA 4KIAA 5GADP 4DUYK 2VBXA 2G2ZA 3J81Y 4DPOA 3M9MB 4AQYF 1X5PA 3TOQA 3NMAA 3NXZA 3W61A 1HKBA 3ENBA 3RB0A 2H54B 5CZ2A 4NASA 2QJ3A 2O8FA 1QHAA 4JI1K 4ILJA 1FRXA 2HFSA 3H6EA 5K8PA 4NEZA 4ZIVA 1PGZA 4YOTA 2FLNA 2OD4A 1NPPA 3OHRA 1WD6A 2D41A 4USVA 4ZTJA 3PVXA 3GE9A 1GLLO 2AX0A 1RTJA 3D6TB 2RVJA 3C6TB 3C6UB 1CJVA 1GMWD 4I7FA 2MSSA 3CJ1A 2LU1A 1WHVA 2GQQA 2RDDA 2ZZMA 3IG1A 2F9WA 1RT1B 4PG8A 4HH1A 5M1NA 1Q9YA 2E1RA 4DS4A 2P9UB 2ZKTA 4F3OA 1OYEA 1TUUA 4OLBA 2BR0A 5L9XA 4JK8A 3NP5A 3CF5L 1JLEA 1FNMA 4HHHA 1GLFO 2H51B 1NHUA 3HSTB 4BGBA 1N6QA 3CPWR 2IVPA 3PSFA 4NYZA 3R7SB 2K7KA 4JI4K 5F0XA 3M5RA 4ED5A 4IZ9A 5F9LA 4OYZA 5GADI 5D3GA 1HI8A 3B6PA 3M32B 1HNZK 3T9NA 1KLMA 2JSXA 1FKOB 3DWLA 4ANDA 3CCMS 4CZGA 1KFDA 4C97A 4CGJA 2ILZA 4P6QA 2Q6CA 1V4SA 2BJ8A 3DHXA 3C19A 3QT8A 5E3CA 3KOAA 5A8KB 3K8VA 2FJAB 1S1TA 2FBVA 1X9MA 4AM7A 1DZ5A 4OZLA 1NGEA 1C0GA 2DEIA 2YKNA 1DKGD 4Y28C 2MKJA 3BKTA 4BRLA 5MLCQ 3DYAA 3M2RA 4E1JA 4K8XA 5AQZA 5BN8A 1GMWA 3CIPA 1NPRA 1Z1ZA 3AVLA 3BGOP 4O0JA 2QEXN 3SCJE 4ECTA 1Q7YT 3HHNB 5IT4A 1XR7A 4ILHA 1CSJA 3K5LA 2MZ1A 1U4BA 1W0HA 4GC6A 1QD1A 4ZVFA 2DNRA 3FCHA 4PXBA 4AHTA 4LVOP 3D2WA 4ED1A 2A1RA 3W5ZA 3HX9A 3ULHA 4CFCA 1VLYA 3I9V9 3U6FA 4FF2A 2OPRA 1CS4A 4E7JA 3MXHP 4NMLA 5FPNA 1JL2A 1KQGB 1S72S 3OYMA 3THWB 2CQ0A 4MK9A 4BC7A 1A0OB 4HUFA 1GLEG 5LOQA 1T6CA 2YQ1A 4EO6A 2M5YA 2OAUA 5BRHA 4WF9Q 1SJRA 3NOGA 3KTQA 2MKYA 4LRBA 4I69A 1BOTO 2JH3A 1D4XA 4QIEA 2PFUA 1D8YA 3HM9A 4Y0WA 1B7YB 5GAHI 1T3VA 5AQLA 3L4BC 2IJRA 2VH7A 1UAWA 1I94J 2GMHA 5IZHA 2HZVA 4C0BA 1RTDA 2ZHBA 3GG0A 1NGJA 4NZ7A 2W40A 3OTOK 4EEYA 4E3SA 5FPMA 3QESA 3QBXA 3VQ9A 2KG1A 1QAIA 2D74B 2XBPA 1CJUA 4WTOB 3BKUA 2E5HA 3IRXA 5CAAA 3AB4B 3MAAA 2ADCA 1NKEA 3FDSA 3UE5A 4FLWA 3TJAA 1EQMA 1HD1A 1V3RA 3CPEA 4EZ6A 1S1TB 4HUEA 3K9JA 3FR0A 4A46A 1W2BM 1FDAA 2MQLA 4OZ5A 4DQIA 1HPZA 3L7UA 2HNDB 4OI1A 2KKZA 3CO9A 4OZ0A 3AJ2A 5F8HA 1X4CA 3AODA 3OLBA 4FF3A 4ZCKA 3ID8A 4E2FB 3KLIA 1UZHA 3E01B 3QEPA 3Q22A 1ELOA 1TZ0A 1XBWA 1YJUA 3VENA 1M5SA 4FW2A 4DR1K 1WSVA 3GWCA 3D5MA 3SQGB 4B3OB 2IDOA 4MTPA 2BOAA 2XS5A 2AJFE 4NXMF 4R5PB 2WONB 2NCKL 2OH2A 4QS9A 4CJ5A 2M3DA 3CO0P 3R8YA 2B8QA 1WC0A 2B9YA 3VF2A 2UP1A 4B3SF 3GBTA 4OHZA 1ZH5A 1SJ1A 2EFVA 1NJZA 3M6XA 1NJYA 5HROA 3MXIA 4B3MF 5KT6A 2QA1A 3R5JB 3DXMB 3HDSA 3U4LA 3PYFA 2FY1A 2WB4A 1NMDA 5ETQA 4F4WA 4NLPA 2YX7A 3OFFA 5IV3A 5JUMA 2XMJA 1M1KO 3K7RA 5B0DA 3R5DA 4HLBA 2IA6A 5ELZA 3KNAA 4PHTX 3GONA 3HZGA 3F9KA 3QQCD 4OFZA 1WKJA 2FTRA 3MEEA 1GXLA 2DFEA 4WFYA 1CJKA 5CXTA 3CJSA 4DUZJ 1TAQA 4LF8J 1F2HA 3FRYA 2CGJA 2R8HA 5CCMA 3D6MB 1EP4B 5KFEA 3UCUP 2QWOA 1SV5A 2JLEA 1VSJA 2RF2B 1SJQA 3C6AA 2YNIB 4V19X 2B9XA 3BDEA 1BA1A 4I6YA 3ENQA 1SQGA 1V9OA 2QYGA 4X4PA 4MKYA 4KGZB 4LIRA 3BN7A 3UW1A 1PBAA 1KQSM 4UY85 3IS9B 1FJ7A 2UXDK 4BHQA 1T9XA 1FXRA 4OZNA 2DH9A 3IM8A 1TELA 5M1QA 4PKIA 4Y1CA 5KT4A 1AZSB 5C15A 3AY9A 2IIHA 3M1VA 1LW2B 3MTKA 2ZNYA 5BYQA 1RDDA 2O5DA 3FSXA 4EK2A 1HQUA 1XNQJ 3SFUA 4FLXA 2XGQA 1CLFA 4OVLA 3G82A 4LQ9A 2LEPA 1N48A 3BH7B 4CBXA 4AHVA 3CYMA 5E84A 4ISFA 5HBMA 4BVOA 3M32A 4Z4CA 3T1HF 2XYPB 4LBIA 3S3MA 2W9BB 1VSEA 3G4SS 1LV5A 3R5GA 5BR9A 1S4FA 1VJQA 1CXQA 3PEHA 3AVHA 1IR2A 4W5RA 3X3UA 2HWIA 3JSMB 1VSDA 4KKOA 5DDQC 3ZX3A 5GADU 3P4IA 1FJGF 4E7HA 2OZMA 4KTWA 3QSIA 1ZXOA 3BM7A 4HT5A 4A57A 2AMCB 5D3GB 1T95A 2Z56B 4XH4A 2OP5A 2YKOA 2MZQA 3KFWX 2YWEA 4DV0K 5D15A 4U7CA 5I3QA 2HBYB 1ZAWA 4K2JA 1YWXA 4IXCA 3MMBB 1S79A 1YVUA 4C98A 1HLUA 2JNJA 2E1CA 4A8WA 2VIHA 5E3RA 3ILOA 1CZBA 2Z58B 1YJWS 4OLOA 1C6VA 4RUAA 4WYLA 3V6DB 1HBOB 2FJBB 3VZIA 4HTUA 4W92B 4DSFA 3HKWA 4HACA 3WC0A 3R6MA 1TQLA 2HKEA 3V2UC 1O0PA 3W5YA 4JI7J 2RE2A 1E6VA 5M1FA 1XR6A 4YEAA 2GQ2A 4CGIA 4CJTA 3HMJG 3PJ9A 1U2FA 3TUIC 4GV3A 2JX2A 2OZSA 4CFBA 1Y9OA 2D0CA 3E51A 4NA3A 1VQ6N 4O3NA 3CJ8A 3MMJA 2GUIA 2QTWA 1T03B 1P1TA 4Y2CA 2J6UA 1GOCA 1NK6A 4IRCA 2RSQA 2HGNA 3MM9B 3SJHA 1RLDA 3A8JA 1YQHA 2BE2B 3HJVA 4NI2A 1WC4A 2QA2A 3IWXA 2D1CA 2UVWA 1WEXA 3CCEN 2DGWA 5DG9A 1HMVA 3HJFA 4RLEA 1Q86O 2R7QA 1NHVA 1WOPA 3KIOA 2IVFB 1QUVA 3TVKA 1VSFA 1RWNB 1G3OA 4NL5A 3OPKA 5JVHL 2MSTA 3R2CJ 4DV2F 5KFZA 3CHWA 4DN0A 1X60A 2HHHF 1N6QB 3HHLA 1FWLA 4DOZA 2XI3A 3PRVA 5KRSA 4DHVA 4FJXA 3I82A 3KMSA 2QE5A 1O13A 4ITSA 1O51A 2MGZB 1JLGB 4DG1A 1FDNA 5JICA 4N56A 1U24A 1Z2LA 1NJIO 3JTOA 1KLMB 2DIVA 1DQ8A 4KBOA 2JEJA 3FZ2A 4I7FB 3TEHB 5I9EB 1VISA 1VAZA 1QQMA 3QFPA 1RT2B 3RR8A 4NA1A 4FNHA 2MZSA 4H4OA 3NF6A 3VF0B 3LO3A 2XLKA 3NGTA 4DCOB 5BPNA 4EYIB 2F7VA 3UD4P 5D4OA 4OPHA 2FIUA 1K1SA 3TJ9A 3T5KA 3BSOA 1N34K 2UVVA 1NWKA 3AAWB 2AGOA 2R8GA 4X4NA 3F44A 3L4IA 2G8KA 1AROP 1HWKA 1DT9A 4ISGA 3TTDA 4KT0C 3MAAB 1RWKB 2OUGA 4K0KJ 2L41A 5AJ3F 1DGKN 2V8VA 4UQTA 4OJRA 1FRKA 1VBXA 3HF5A 3ADAC 3NCRA 4G1QA 2PA8D 2JOQA 1U8SA 4FM2A 1OH6A 5DG8A 4OX8A 2OTJS 2J4RA 3GJQB 4O0NA 1RT5B 2LECA 3G96A 4RBTA 5KFGA 2AZ1A 2ASLA 3JB9k 3OVNA 2WOMA 4JV5K 1XUPO 5KFIA 2EFGA 4N47A 3I0SA 1X0FA 4RX6A 4B3RJ 1P1LA 1VRTB 1N34F 3S01A 4UT4A 4ZPVR 1EETB 2FC0A 3S41A 4M95A 1RHRB 2K3IA 4KGVB 4FPAA 2C1EB 3AT1B 3TZZA 1RBAA 4N76A 5JS1A 2XWYA 2Y9HA 3MN6A 3B4MA 1M90O 3EJMA 4B3OA 3MD3A 2RHQB 2FC9A 3O6WA 2O4IA 2ACYA 5LJ3Y 2B9WA 4DL6A 1S7HA 2L9DA 2CPFA 3V9WA 1WTFA 1BU6O 1RABB 2DTUA 5GMKa 2LXIA 2P9NA 4B02A 3B82A 1WWHA 1MROB 3SQOP 3HM8A 5HROB 5BR8K 3TYTA 4FLZA 5SUHA 4ED4A 4I2PA 1EX4A 4CJWA 2KT3A 3DOLB 4X65K 4BCAA 2J5AA 3CCLN 1HNWF 4NLBA 1VSHA 3C7NB 3AA2A 4CRJA 4Z37A 5HANA 4RBUA 4C8OA 1JK9B 2XSJA 1S9EB 1MMNA 3D6HB 2AHOB 3SQGA 4Q43A 2XY7A 2ZJQQ 2LSNA 4B3RK 4M5GA 2E66A 2IS3A 1C0TB 1FD2A 1K9MO 3V6DA 1AYEA 2E7VA 5KT2A 4JI3J 2FHMA 1GH8A 3V1QA 3UN2A 3SPYA 1HYSA 2GV9A 1NDKA 5GAGP 1LWCB 1CPZA 4X4UA 2DNNA 1RAAB 4TKTA 3A8IA 5KFLA 4F0KA 3PR5B 3CWJA 4G9ZA 1YRUA 3EXYA 2PI4A 1VQ5N 3T6BA 3HP6A 3EDQB 2EWSA 3I6PA 3OW2R 3ZLJA 5AXNA 2CPIA 4M63C 1TKZB 1CULA 3QZ8A 3D0HE 1YGYA 1AFIA 1RBRA 1UPMB 1XMQJ 1U1NA 1OY6A 2CFXA 3SCIE 2B5JA 4L6V3 1NUEA 4I2QB 5J1NA 2CNNB 1C0FA 4NI2B 2Q43A 3TAEA 3MN5A 4DTRA 4F7VA 1IM4A 1J2VA 1CULB 4Z7CA 4WYBA 2KH9A 2HWTA 3D45A 4DV7J 4NO7A 3RAXA 4KE5A 3LF0A 4FXDA 1HHSA 4WK1A 2C3MA 4WQ4C 4LBPA 4DR6K 3FE1A 5D6GA 3QBCA 3MR6A 2DRDA 3ZXWA 3SCKE 1XMOJ 3ZT3A 1NAQA 4W5QA 2KU7A 5F41A 1J5EJ 3HOTA 4DF4A 3SPZA 1GXUA