3C6UA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6uA05
4LH5A 4O3QA 5JS2A 1SKWA 2F8EX 3SV3A 4FM2A 4OGCA 5HRRA 4CJLA 1RDCA 2W9BB 1I3AA 4IRDA 2HWIA 2XY7A 4WYWA 5DQIA 1TQLA 1RAJA 3E01B 4GVMA 1XR5A 4CK1A 1B9DA 3TI0A 1KVAA 2BRLA 4TY8A 3LANA 4IRCA 3KK3A 3HM9A 4MKAA 2JEIA 5F9NA 1BL3A 3S3NA 5FRNA 3HXMA 2GIQA 3BR9A 5KFSA 5CYQA 4PQUA 1TK8A 4DSFA 3I5CA 4W5NA 4ZVFA 2WHOA 3FQKA 3DM2B 3DLKA 4NLOA 3UR0A 3OYCA 1QQCA 2BRKA 5C42B 4EBDA 4M41A 3SYZA 3U3GA 2FLLA 1C0UA 1W0HA 1S9FA 4O3OA 4F3OA 4HUGA 3NBPB 4CGHA 3GIJA 2JC0A 3QEWA 2WK4A 3DRSB 3VQ9A 1DTQA 3HPHA 3GIIA 3TQ1A 2YNHA 3T3FA 5K14B 4IOBA 4ID1A 3IS9B 4CJUA 3M8QB 2E6MA 4FBTA 4NLQA 4K4SA 2D0BA 1Z25A 1S1VB 2R8GA 3KLEB 1GOBA 3KLGA 3PJWA 5DGAA 1WNEA 3AO2A 4NLWA 4Z0UA 3LDSA 4E7IA 5EUHA 4I2PA 2FVSA 4I9QA 1BISA 2IM0A 3ZSZA 1BI4A 1YTAA 3OYMA 1TKTB 3AO3A 4IR1A 4RZRA 2XY5A 4YR3A 4FS2A 1HNIB 2I1RA 3CJ3A 3I8DA 4DFKA 4JV2A 3MXIA 4AHSA 1SKRA 3MECB 4M95A 2FC0A 4L8RB 1UWBA 5JXSA 4OL8A 2GIRA 1XWLA 4AHUA 5KFBA 2IM1A 3PW5A 1NHVA 4RNFA 1N5YB 1U04A 3KLFB 3ZSQA 3KMSA 4CHYA 4M3XA 4EP5A 4CGIA 1ZYQA 3CO9A 4O44B 3S9HA 2W7OA 1NOYA 3F9KA 3OL8A 4Q8FA 4CGDA 2OPQB 2O4GA 3NGZA 1XHZA 4Z4EA 1WSJA 2QK9A 3FFIA 4FLTA 2VG6A 4I7FB 5KG0A 3QEPA 4C8LA 4FK2A 2IA6A 4WFYA 4NCGA 5FDLA 3OSNA 1S1UA 2FLPA 3QZ8A 5HLFA 3TANA 3QYYA 2BR0A 4IFYA 5KFVA 4K4UA 4NLRA 4IG3A 3OYGA 3K57A 3KLHA 4KB0A 2YNFA 2RF2B 1C1BB 1HQEA 1NHUA 1FKOB 2B5JA 4DU4A 4K50A 4F4YA 3HVRA 1Q8IA 3NF7A 1IKXB 4ID5A 2D3ZA 4F2SA 3SI8A 2BQRA 3T5KA 1ASVA 1JLAA 4KI4A 4E1MA 1FXXA 2ZE2A 3V4IB 2OZSA 4B3OA 3OYNA 4DSJA 1L5UA 3NH0A 1NK6A 4ZVGA 3NGIA 3GV5B 5KFIA 2EHGA 1JLBB 4ZTJA 2ALZA 4HUEA 4J9RA 4CJ3A 1VSIA 1S1TA 5KFHA 3I0RA 3GV7B 3AA3A 3SNNA 3C6TA 2FLNA 3ICLA 4J9OA 4TY8B 1K1SA 1C1CA 1RT5B 4JV1A 2FBVA 3KK3B 3ZSXA 2J6UA 1RDAA 4O3PA 1CZ9A 3FDSA 5CYQB 4PQUB 4CIEA 1GOAA 3C6UB 4ZP6A 1IKYA 3RR8A 1KHWA 4H4OB 2ATQA 3QLHB 3OS2A 4Z4CA 3QESA 4FLUA 3DLKB 2WOMA 1TV6A 5KFKA 4TXSA 2HNYA 4ZPBA 2RDIA 5L1LA 2Q3SA 3G86A 3DYAA 3FRZA 1UOCA 4E7LA 4IH5A 1DTQB 2RPIA 2AGPA 4BDZA 2YNHB 3PW0A 1EX4A 4J9LA 2DFFA 3ZT4A 1F21A 4C8OA 4ELTA 2AX0A 1L3VA 3LAKA 2HHSA 4BE1A 4YFUA 2P5OA 1SUQA 1LW2A 4KE5A 3NAEA 4KTWA 2G8KA 3QIOA 4K4WA 5KGWA 2ILYA 4I2PB 5JS1A 2QV6A 5KFUA 3RMBA 1RBUA 3TVKA 4R8UA 2HHXA 2DPIA 5HP1A 1BI4B 3H5YA 4E89A 1JL2A 5F8NA 1BQMA 4DTJA 3Q8PB 2WCXA 4FJ5A 1I6JA 4IQXA 1IKWA 2W8KA 1L3SA 2UVRA 1O1WA 2JLEA 4K4YA 2O4IA 4F4ZA 4RUCA 4CGJA 4MFBA 1XC9A 4YP3A 3HO1A 1CZBA 1D0EA 1HYVA 4BWJA 2C28A 2ZQBA 3VQ8A 2NUBA 4MIBA 2R2RA 1T94A 3H40A 1EXQA 2BQUA 4Q8EA 5KFRA 3FQLA 3DLGA 4E19A 3C94A 4EYIB 1YT3A 3PW4A 3HVTB 3DI6A 2YNGA 4M94A 4FS1A 2AU0A 3TAMB 3V9SA 3WNGA 1RTIB 4ECWA 3S3MA 3C95A 2IC3A 4KFBA 3M9MB 3I0SA 4ZVEA 1TKXA 3BREA 4CEQA 4G1QA 1RTDA 3MEEA 3FFIB 1RDBA 2VG6B 2WB4A 3SJJA 2VWKA 1RT3A 4XPCA 3AA2A 4ECVA 4AHVA 4DSKA 3OYBA 4NCGB 4NYZA 3DMJB 4CJ4A 5FDLB 1ZTTA 4CHPA 1LWEA 1RTHA 3QIDA 4WXOA 4DQSA 3BSNA 4ECYA 3DRRA 4FJHA 3PHEA 3WNHA 4DS4A 4LD0A 3RMCA 1ZBLA 3CM5A 4F4XA 5HROA 1LV5A 3QIPB 2W42A 2G8IA 4RG8A 4FJNA 1NK5A 1C0TA 1TGOA 3KK1A 2IGIA 3GV8B 3HT3A 4CHOA 4X2BA 2GUIA 4PUOA 2AWZA 5KG6A 1HYZA 4Y1CA 4ECQA 2R2UA 3QETA 1JLAB 1L3TA 3SUOA 1I39A 4DL3A 4O4GA 3AVAA 5KG3A 4B3OB 3OLBA 3H2LA 3OYHA 4HCCA 2FJVA 4KB7A 4F3TA 4ECXA 2KZZA 4LSNB 3QEVA 2RDJA 2R7YA 2YKMA 5C24A 4ECZA 1XR6A 4OKEA 4ZMMA 3NE6A 4NYNA 1QUVA 4LSLB 4J9KA 4KPYA 5J2PA 1S1TB 4DTNA 3I0RB 4FXDA 3PX4A 1RDRA 3UDLA 4KKOB 3C6TB 3GYNA 1EP4A 1A5XA 2I5JB 2B43A 2KQ2A 4Y1DA 3QNNA 1C1CB 1QAIA 4ICLA 4N41A 4GW6A 1TVRB 1NJXA 1IKVB 5D3GA 5DG9A 5J2NA 3TAQA 3IRXB 2QKKA 1VSDA 3SQ4A 2ILZA 2D5RA 2D7SA 2CKWA 3ITHB 1TKZB 1GOCA 3V1RA 3QZ7A 1NKEA 4DG1B 2ASDA 4RU9A 4K8ZA 1TV6B 1T8EA 4FZZA 1W9HA 1KLMA 3P5JA 3PVXA 4CJPA 3V9WA 2ETJA 3VQSA 3SFGA 3BSOA 2IAJB 3AO5A 3DYAB 1QSLA 5DMRA 4NLDA 4AHRA 5KFFA 3QO9B 3AVFA 4ZHRA 4DQQA 1BQNA 1T05A 2IS3A 1SKSA 2HMIB 1JLCA 4DQPA 1C6VA 1T03B 4Z4HA 3AVJA 3RWUA 1SL0A 2XC9A 5HRPA 3H5UA 3HYFA 1LW2B 4O55A 2DY4A 2F8TA 2XHBA 2IMWP 5JUMA 5KFXA 4PA1A 3QEIA 3M9OB 1HQUA 5F8IA 4Q43A 4O0IA 3HP9A 3RMAA 2QXFA 4ED3A 2YKNA 3SFUA 4HUFA 1LWCA 4MK8A 3BGRB 3JYTA 3TARA 3AVNA 4WE1B 1NK0A 4NLYA 3V6KA 1HMVA 2C2RA 4CK2A 1BQMB 4IKFA 4OKJA 1OS5A 4E0DA 4ED7A 3BQ1A 3QINA 4ELVA 1U4BA 4URSA 5CY4A 4ZPCA 3H5SA 4KHRA 1IKWB 4WYLA 3VQBA 3OYDA 5F8GA 2BQ3A 4H54A 2EC0A 3ASMA 3OYLA 2KTQA 1HPZA 2HNZA 3SUQA 3MXJA 4MFBB 1D5AA 1S9GA 1MU2B 1RDDA 4BACA 1S0NA 4FJ9A 3FSIA 2HNDA 1RA6A 2G8UA 3O3GA 3L2RA 4KO0A 3NHGA 3DLGB 1KCFA 1ITGA 1SL2A 2VG7B 4Y2AA 2YHAA 2IC3B 4KRFA 4FCYA 5KRSA 4Z4GA 3M8PA 1TKXB 3IGNA 3L2VA 4DTRA 1HNVA 3AVBA 4QCLA 3MEEB 1S1XA 1YVUA 1RT7B 2HWHA 3ZT3A 3HL8A 4KTZA 3LALA 2WONB 3K5MA 2FVQA 3NDKA 4O3NA 2UUWA 2P51A 2ZD1B 4DLGA 1LWEB 3ULDA 2OPSB 1S6QA 3V6HA 5EWGA 3L8BA 1R0AA 1QSSA 3I5BA 2E4LA 4FW1A 1N48A 2FVRA 4E7HA 4FJ8A 4G3IA 3CDUA 3EPIA 4ECRA 4IH7A 1CLQA 4B9LA 3AVIA 4CEOA 3N6MA 4NCAA 2R8JA 1REVA 5HROB 1SH3A 3CJ4A 2YNIA 4RNHA 3OHAA 4Z4FA 1RA7A 4TSXA 3THVA 4CF9A 4RW7A 5J2QB 1BHLA 4DTOA 1C0TB 3KK1B 3LP0B 5KT6A 3KMQA 1S48A 3SQ2A 2P5GA 5J2MA 3PZPA 1JKHB 2FVPA 2O5DA 4OLAA 3AVCA 1ZTWA 4I2QB 1JLFA 1NK9A 4RNNA 3TR8A 4ED2A 4M3YA 2RKIB 1RT6A 3WNEA 2IDOA 3O3HA 3VQ6A 3OYKA 3JSMB 2HHVA 2J6TA 5J2PB 2XO7A 1U47A 3MFHA 4DSEA 1VSHA 1EP4B 1SV5A 4XO0A 4K4TA 2ASLA 2HW3A 5DQGA 1NOZA 2OA8A 2G8HA 4ICLB 4RW4B 4CHQA 4DU1A 1S0OA 2XI2A 1QS4A 3P83D 5D3GB 5J2NB 3OYEA 3KLVA 2HVHA 2Z1IA 3AO4A 4KV8B 5F8LA 1U45A 1JLGA 3H5XA 4WZQA 4F8RA 4MH8A 4QW8A 4XPEA 4R5PA 3MFIA 1KLMB 4DEZA 1KRPA 4CESA 2PYLA 3A2FA 3IG1B 4ECUA 1UAXA 3DOKA 3SCXA 4CJEA 4B9TA 2WTFA 4ZP9A 4NLGA 4LQ9A 4YR0A 3LP3A 1S10A 1GX6A 4QWBA 3RBDA 4FJKA 4DSIA 1BQNB 1RBVA 3KHLA 1QE1B 3NGYA 1HRHA 2HHUA 4EBEA 3K5NA 5FRMA 3AV9A 4CJ5A 4RW6A 1TK0A 3DLEA 3ZCMA 4CF8A 1ZBUA 4B9MA 3O4QA 4RW8B 1TAQA 3LP2B 5KG5A 3BJYA 4JS4A 4DQRA 4FJGA 1XR7A 2OPRA 3MAQA 4J2BA 1HQUB 4DFJA 4NZ0A 4RW9A 3ZSVA 2AX1A 4EO6A 3BQ0A 2VA2A 4KHYA 3VQCA 4KSEB 4FLZA 4W5OA 4DTXA 4M3WA 4QWCA 3VQ4A 4K4ZA 4FVMA 4B8CA 1HARA 4NRTA 5T7BA 3SPYA 1D9FA 3LP1A 5KI6A 2HAIA 2WRMA 3OYJA 2HNZB 2R8HA 1U09A 1KFSA 1DTTA 5KFOA 5KFGA 3HK2A 1YTUA 3EYZA 2KFNA 1TL3A 4GC6A 4CECA 2ASJA 3MR5A 4TQRA 2HNDB 1NJWA 5KT2A 1B9FA 3HPGA 3KJVA 3V9UA 5F8MA 3VQAA 5T14A 3DRPA 1C0UB 4IG0A 1NK7A 2OPPA 4CJQA 5L9XA 1HNVB 5L1KA 4CHNA 1VSJA 2XY8A 5FROA 3SQ1A 3GIMA 1KSPA 3T1AA 3CDWA 2BE2A 4CJRA 4RNMA 1U48A 4KI6A 2R2TA 3V1OA 4CFAA 5DK5A 4FJLA 3CFPA 3HHKA 5HBMA 4BDPA 3OL6A 1S6QB 4E3SA 4MK9A 4E7JA 4CJWA 4NRUA 3SPZA 2OH2A 1BIZA 3MR2A 3GILA 3RB6A 4N76A 4URQU 2E6LA 4E1NA 3LZJA 2AQ4A 4IR9A 1HYSA 1XI1A 2VG5A 2HHWA 3KLGB 4FBUA 4DU3A 4F50A 3Q8SB 2YNIB 1RNHA 1S1WA 4RW7B 4J9NA 2KZMA 1TL1A 3NH1A 4FJMA 5F9LA 5C25A 2ITGA 5EWFA 2HB5A 3AVHA 4KBIA 1JLEA 4DL4A 4FJXA 1RT2A 1VRTA 2R8KA 3NF6A 1JLQA 1RBSA 3IN5A 3BDPA 5L1JA 3MR3A 4FJIA 4IDKA 2QKBA 1UWBB 2PYJA 2W9BA 4CEDA 1EETA 4H4MA 3B6PA 2V4RA 2DFHA 4M45A 3RTVA 3E01A 5KFAA 1Y97A 4ED6A 3H98A 2HHTA 4CJSA 5KG4A 3PR5B 1C0MA 3O3FA 1GX5A 3QEXA 2UVUA 3ISND 4Y3CA 3NAHA 2GC8A 2AGOA 1UA0A 3M9NB 4ZP8A 4CEZA 5KT3A 1UA1A 1LWFA 1QHTA 3ZT1A 3K59A 4QOZB 3DM2A 1JLGB 4KHSA 5J1EA 3TAEA 2BANA 3UPFA 2F96A 1N4LA 5C42A 1TAUA 1S1UB 4OJRA 4HCBA 5HLFB 2D41A 5SZTA 4J2EA 4IFYB 3NBPA 3KLIA 1FKPA 3DRSA 4IG3B 3MF5A 4DSLA 3TAPA 4DTPA 4M42A 3DOLA 3KK2A 1CXQA 2FBYA 3KLHB 2YNFB 2B6AA 2UVWA 5F8JA 2XWYA 3M8QA 1HQEB 5CZ1A 1WNSA 1JXLA 5KG2A 4ED1A 3KOAA 4E7KA 2B5JB 4RW6B 3DLEB 4TYBA 4KHUA 3QGGA 4J9MA 1NKBA 1S1VA 3KTQA 4ID5B 3KLEA 3LWLA 4AH9A 2JEGA 3VQ7A 3G6XA 1BGXT 3ZSWA 3RAQA 4N5SA 5KFQA 2ZE2B 4LQ3A 4Q45A 2VWJA 2OPRB 3IAYA 3M8SA 4RW9B 2Z1HA 3OS0A 2Z1JA 3V6JA 2Y1IA 4DL7A 3RBEA 5I3UA 1XHXA 4ELUA 5KFJA 3MECA 1D9DA 1X9SA 4C8MA 2GBZA 2JC1A 4NLVA 2GV9A 1X9MA 2UUTA 4PWDA 4B9NA 1N5YA 1MMLA 3KLFA 4M3ZA 1DTTB 1JIHA 3MEDA 3CQ8A 3LPTA 3SUNA 1WSEA 3OL7A 2W9AA 4EP4A 4O44A 4ED0A 3L3UA 1IKYB 1SH2A 3MEGA 4CEFA 2X78A 4CIFA 4CK3A 2WOMB 3DRPB 4DLEA 5DLFA 1J5OA 3K5LA 3V6DA 1S6PA 4IG0B 2HNYB 1BCMA 2C2DA 4I7FA 4NLUA 4J9SA 1L3UA 4OGEA 1N56A 2BE2B 2RN2A 4J9QA 2DPJA 1VSFA 3KD5E 4O3RA 1Z26A 3U3YA 4QW9A 3OY9A 4Y34A 4ZPAA 5DGBA 2P1JA 1WSFA 3RRGA 2FJWA 1K1QA 4GMJB 3V81A 2JEFA 3ZT0A 3EZUA 1SUQB 3U6FA 1HYSB 2VG5B 3K2PA 1C1BA 3KHHA 3G6YA 1FKOA 1S1WB 4FZYA 3HSTB 1JL1A 1KFDA 3RB0A 4Q0BA 4NLTA 3VQEA 1TL1B 3KHGA 1CSJA 3V9XA 1IKXA 5C25B 4RNOA 1JLEB 4QPXA 4R8UB 3NFAA 5HP1B 4KTQA 2V4QA 4DTMA 1Q9YA 1JLQB 1BIUA 3PO4A 1TP7A 4PY5A 4IDKB 1RTJA 2XI3A 1J9AA 4LY7A 1EETB 1JLBA 3T5LA 4H4MB 4WFZA 4BWMA 4FZXC 4FLXA 3DLRA 3P1GA 3E51A 4ED8A 5KFYA 4AILC 3SV4A 5KTQA 3DI6B 2YNGB 1RT5A 3TABA 1C2PA 4R0EA 1G15A 2QE5A 4KFBB 1ZBIA 2XGQA 3I0SB 4QWDA 3LZIA 4CFCA 5KT4A 3C6UA 4CIGA 4QWAA 4G1QB 1RTDB 2A1RA 3RAXA 1J53A 5KFZA 4H4OA 1RT3B 3QERA 3PR4A 4CJKA 1LWFB 3RR7A 3QLHA 1DLOA 2IM2A 5J1EB 2BANB 4IFVA 3NGDA 2G8FA 2C2EA 1EKEA 1RTHB 4C8KA 2C22A 1T3NA 3N6LA 3AVKA 3DRRB 4U7CA 3KLIB 1FKPB 4DL2A 3RRHA 3SZ2A 1QSYA 3DOLB 3KK2B 1BCOA 2F8SA 4LH4A 2B6AB 4YR2A 2HVIA 1NK8A 3T5JA 4WXWA 2LSNA 1RBTA 4NLPA 3OL9A 2A1SA 5EU7A 4O4RA 4DFMA 3NKYA 2BGGA 3EY1A 1RCHA 1JX4A 4PUOB 4F4KA 4MQ3A 2YV0X 4DTUA 5E41A 3HPOA 4DF8A 3LAMA 3CDEA 3TAGA 5DQHA 4O4GB 4B9UA 5SWMA 3VA0A 3ALYA 2UVVA 4M3TA 3OYFA 2X74A 4UQGA 5DG8A 4CCHA 2YKMB 5C24B 3H4DA 3KD1E 4FYDA 2IOCA 3KNAA 3NCIA 3CJ5A 3ZSOA 4KHWA 1TKDA 2IJNA 4ECTA 5I3UB 3BSCA 2J6SA 2FJXA 4W5QA 2YHBA 3HP6A 1W25A 3NAIA 1S0MA 1FK9A 1VSEA 4KHMA 4PWDB 3AVGA 4ECSA 4EYHB 4FLVA 2E9RX 1S49A 1KHVA 3CFRA 4CE9A 3MXMA 4Y2CA 1X1PA 4DL5A 1SL1A 4OPKA 3MEDB 1RYSA 4TQSA 4KREA 1JXBA 1CXUA 4FJ7A 3OJSA 3HVTA 3MEGB 3F73A 3KHRA 3TAMA 1RTIA 4DQIA 3RB3A 3H4BA 1LAWA 3CYMA 2ATLA 1J5OB 3V6DB 1S6PB 3CJ2A 3ISNC 5KFEA 4QAGA 4IBNA 1KLNA 1RBRA 3M8RA 3K5OA 2V9WA 2EX3A 3OS1A 4CERA 4M3UA 3RMDA 1N6QA 3DMJA 4J9PA 4B9VA 1WSIA 4ZHRB 4CJFA 4FM1A 3N6NA 1T05B 2CJQA 4EEYA 1JLCB 1X9WA 4BE2A 3CWJA 3I5AA 4NCBA 4RUAA 3V81B 4DMNA 3VN5A 1NK4A 4KHNA 4F2RA 3G10A 3QIPA 3NH2A 2R2SA 1LW0A 4OLBA 2D3UA 1S97A 5CYMA 4Q5VA 4Q0BB 5I42A 2XGPA 2FVCA 2YKNB 1LWCB 1LAVA 1NJZA 3JYTB 4H8KA 1HMVB 3H08A 1VRUA 4DWIA 1RT4A 1S9EA 3DDKA 2W9CA 3NL0A 4CEAA 2IJFA 4QWEA 2PY5A 3AVLA 4CEBA 5C5JA 4TYAA 4LSNA 1RTJB 3PUFA 1HPZB 3G6VA 4ZTFA 1S9GB 2ZKUA 3L2QA 4LSLA 4EZ9A 3OHBA 2DTUA 4IRKA 4KKOA 4KO0B 1WSGA 2I5JA 3TWHA 5DG7A 4WFXA 3KKRA 2JEJA 5KFMA 1K6YA 3NF8A 3DLHA 1Q9XA 1TVRA 1IKVA 4IH6A 4OVLA 3M8PB 4B9SA 3OYIA 3IRXA 3AVMA 1Z4UA 4DF4A 3BQ2A 5KT7A 1S1XB 4DFPA 2XCAA 1ZBFA 3ITHA 1TKZA 3NMAA 1DLOB 1WAFA 4CJVA 4IFVB 4W5TA 4NLSA 4DG1A 2Y1JA 1IG9A 1QAJA 4CHZA 4KAIA 4EBCA 4CGFA 1IH7A 1D8YA 1R0AB 2IAJA 1WSHA 3S3OA 1A5WA 4HYKA 1WN7A 3PX0A 4FM0A 4Z4IA 3QO9A 3SUPA 1RT1A 4WZMA 1TK5A 4Q44A 1REVB 4O3SA 2KW4A 2HMIA 3DLBA 4CF1A 3CG7A 4FJJA 4N47A 3OSPA 1T03A 2D0AA 3BSAA 4YQWA 4J2DA 1C1AA 3KKSA 3MTKA 5KRTA 4EO8A 4B8AB 5L1IA 5J2MB 1KVBA 3PJXA 3QGIA 3EZ5A 2E9TA 1JLFB 2OYQA 2E9ZA 3OLAA 3TAFA 3T5HA 2IBKA 4C8NA 4ZVHA 5KG1A 2AGQA 3BGRA 3CFOA 2V0NA 1IO2A 1RT6B 4WE1A 3OVNA 4OPJA 2G8WA 1IM4A 3PW2A 3UIQA 2KFZA 5KFNA 4CFDA 2BDPA 2R8IA 1U49A 1SV5B 3AA5X 3ZT2A 3CVKA 4CJTA 1FK9B 3CIZA 4JRPA 1MU2A 3L2UA 4OKKA 3EPGA 3VQDA 1KVCA 2G8VA 4JS5A 4ZP7A 2DFEA 4HHTA 3D28A 1S5JA 2VG7A 3T19A 4MK7A 3PW7A 2VA3A 3VQPA 4JRQA 4R5PB 5KG7A 4DS5A 3SQ0A 4HTUA 4K4VA 1VSKA 3DOKB 1WAJA 4URGA 4FK4A 1RT7A 4KHQA 4FK0A 5HRNA 3VQQA 3L2WA 4TN2A 3WNFA 2WONA 2JGUA 1D1UA 1N6QB 3IGVA 5K14A 1VSMA 3ZSYA 3IS9A 2ZD1A 4HKQA 2OPSA 5EDWA 4JUZA 4DL6A 1QTMA 4JLHA 4TLRA 1RILA 1VSLA 1ZBHA 5CZ2A 3D5MA 4MKBA 3Q8QB 3V1QA 1YVFA 4O0JA 4JV0A 3LPUA 4FLWA 3MR6A 3GIKA 1LW0B 5J2QA 3OYAA 5KFWA 3ZSRA 2FBXA 3QGHA 4I9LA 5CYMB 3LP0A 4CF0A 5I42B 4NLXA 5F8HA 5KT5A 3O4NA 4MIAA 1TKTA 3AA4A 2B4JA 1JKHA 3HKWA 3PX6A 1HNIA 2HHQA 1VRUB 1A5VA 4B08A 1RT4B 1S9EB 4I2QA 2W9CB 4GC7A 4FLYA 4KAZA 2W8LA 1NKCA 3LP1B 4CGGA 4AHCA 2RKIA 4U6PA 1S4FA 2X6SA 5KFCA 1B92A 3H59A 1ZETA 2OZMA 1NNDA 4XIUA 3JSMA 3UQSA 5DLGA 2X6NA 3D45A 2XY6A 1TL3B 4O5BA 3PV8A 1HJRA 3HVWA 3OJUA 3SI6A 3Q8RB 4AHTA 3KJVB 4IKAA 2OPQA 4EZ6A 1VK0A 5KFTA 3VQ5A 2AJQA 2XRIA 4RW4A 3CM6A 3L3VA 4K4XA 4CF2A 1NJYA 3HJFA 2OPPB 4F4WA 3QNOA 5EWEA 2PZSA 3D0PA 1SH0A 2Z1GA 4KV8A 4K8XA 4M3RA 5HRSA 3KIOA 3PO5A 3K58A 4YMEA 4DTSA 4KB1A 5HBMB 1J54A 4N56A 1KTQA 5KFLA 2D0CA 3IG1A 1RYRA 3AO1A 2XCPA 3NF9A 3V9ZA 4HVJA 4W5RA 1JXEA 4ZPDA 2RF2A 3PY8A 2FBTA 1RT1B 1ASWA 4YNQA 2W7PA 4BDYA 4FW2A 3B6OA 4BE0A 1QE1A 3LWMA 4TY9A 3RB4A 3GQCA 5KGXA 4CFBA 4J2AA 4NYFA 3G0ZA 3CJ0A 1T7PA 3HVAA 5KFDA 4RW8A 3VA3A 4CEEA 3LP2A 1WLJA 1RT2B 1VRTB 2IM3A 5KFPA 3V4IA 1ASUA
chains in the Genus database with same CATH superfamily
3P96A 5JS2A 2VBZA 3GE9A 1B4SA 5BR9A 3ENAA 3C14A 1DRZA 4Y2IA 2P9IA 3WT0A 3T41A 1HNXK 2ZH2A 1ZBSA 3J80Y 4IJAA 1GH8A 4HACB 1HKBA 5DQIA 3VENA 1Q5VA 2LKZA 1FX2A 1WI6A 3MGJA 5HJXA 4JI0J 1VQKN 3MM8A 3RBZA 1WOQA 3EJMA 3HM9A 5ETTA 1WTBA 3OW2M 1OMSA 3S3NA 2OP5A 4H0TB 3HXMA 4X62J 5KFSA 4XAKA 4PQUA 2KKZA 1YGYA 4C6AA 3I5CA 4JD2A 3OYCA 2ZM6K 3TVYA 5C42B 3DXKA 4M41A 2YWWA 5HJYA 3U3GA 4NYOA 2ZNYA 1S9FA 4DV7F 4HUGA 1YUWA 2KXHA 3U8XA 2O8DA 4M5NA 4IO1A 3HPHA 2V2VA 4PG5A 1HA1A 3M8QB 5CXTA 4NLQA 3MHYA 4K4SA 1HBNB 3WXJA 1RABB 1Z25A 1S1VB 3KLEB 1GOBA 3M7VA 3KLGA 3G71N 5HANA 5DGAA 3HOTA 2J7WA 3ZNUA 3HMJG 2PMWA 3FGVA 1SJQA 3ZSZA 2QLBB 1YTAA 2E5IA 1X9JA 2I38A 4IR1A 2OFHX 4WQ5C 3ENWA 2ZDOA 2XY5A 1RAOA 3LGNA 1TTHB 3CJ3A 3I8DA 4DFKA 4M95A 2OO4A 2ZFHA 2GIRA 3FEYB 2QYGA 3CCQS 2P9EA 2GMLA 3ZSQA 3KMSA 4HHJA 5TKYA 3GPAA 3CO9A 2W7OA 1NOYA 3PKMA 3F9KA 3OL8A 4LFAF 2OPQB 2O4GA 2FPHX 1YJ9S 4HLBA 3FFIA 5DDRC 2HGMA 1FWKA 4YDUC 3MCPA 4WFYA 1VC0A 3MM9A 3I4PA 2RS2A 2P9PA 2FLPA 1IBLF 4USHA 2E44A 5D4NA 5IT4A 3GR1A 3TANA 4QR2A 4UUXA 5KFVA 3ZZTA 1FRHA 3GG1A 4NLRA 2XYPB 3T69A 5D4LA 4XH5A 3OYGA 4JI1J 3WEEA 4KB0A 5IQ6A 1C1BB 1HQEA 5CCMA 1X4GA 1FKOB 1H73A 2B5JA 2HFZA 3HVRA 4Z37A 1XTZA 2QMUB 3OXGA 4J8FA 4ID5A 2D3ZA 2ZH3A 4LFCJ 3CGIA 1O51A 3MUVP 3G8QA 1ASVA 3T9ZA 4OHZA 1LWXA 3ENHA 1BUXA 3QT6A 2ZE2A 5DS7A 7FDRA 4KH1B 3OYNA 4K0KF 3NH0A 1NK6A 1NUEA 4USVA 2ALZA 3MURP 1VSIA 2KKHA 2A3JA 3C6TA 3HSCA 2APOA 3THXA 2CJAA 3DGVA 4CZKA 4DUZF 1RT5B 4Z7YA 4JV1A 2J6UA 3M1VB 4YS2A 5K8MA 3VAKA 5CYQB 2B9YA 1NB2A 1GOAA 5IFMA 4H5RA 3C6UB 2GHPA 3AJ2A 1VQ6N 5HSPA 2ATQA 2ZC3A 3DLKB 4J9UE 3FBEA 2FHJA 3VGVA 1R43A 2QWQA 4ZPBA 3B82A 3IC1A 1UOCA 1RBOB 2C2ZB 3CMAS 2DCLA 4IH5A 1DTQB 2RPIA 3CE8A 2AGPA 4FKYA 3SQGB 5I3QA 2G0CA 2DFFA 3ZT4A 2RQMA 1F21A 1PYOB 2OGUA 3LAKA 2MZTA 3EGZA 2HHSA 3QJJA 4BE1A 1HD1A 1R0CB 2K7JA 1SUQA 2NXUA 3CTRA 4KE5A 2PEHA 3NXZA 3G82B 2G8KA 3CD0A 4LF8K 4I2PB 2F40A 5JS1A 2QV6A 1M5KC 5HAOA 2E5LF 3TVKA 5GINA 2HHXA 2E2PA 4ZVSB 2HRTA 2JZ5A 3VAHA 1GLEG 3Q8PB 3GCWP 2WCXA 1C0GA 2ZH8A 1U0HB 4DDFA 1CJVA 4KPCA 1WDTA 2G2OA 4RUCA 4CGJA 1IBMJ 1PCAA 1CZBA 1VYAA 2C28A 4Q7AA 2ZQBA 5FLXO 4UOFA 4MIBA 2UUBJ 2BQUA 1XNRJ 3CCLN 5GAHP 5KFRA 4DXLA 3DLGA 1K8KA 2V52B 4M94A 2HQGA 1IR1A 3OTEA 4ECWA 3I0SA 3UE5A 3BREA 3K8WA 2HQIA 4CEQA 1RTDA 4CTAA 1WHWA 2EG2A 2WB4A 3BP8A 2VWKA 4DI6A 5DDPC 1CC8A 3IR6B 2V8VA 2J8SA 3OYBA 1WEXA 3DMJB 4B3MJ 5FDLB 4X4PA 4CJ4A 1LWEA 2CQPA 2BJ8A 4ANDA 3DRRA 1ASUA 3BGUA 1Y00A 3WNHA 2WVBA 4F4AA 1YQHA 4NXNF 4F4XA 5HROA 1Z05A 5BYQA 3QBCA 1C0TA 1TGOA 4BCAA 2IGIA 3ELHA 4ZJOA 4WP3A 4CHOA 5F1XA 4WTOB 2EG1A 4CJ7A 3GFZA 4Y1CA 1EB0A 2D69A 2R2UA 1JLAB 2I9SA 3G2XA 2A6MA 2ASOA 3OLBA 2FJVA 3P5BP 1RWNB 4LSNB 2R7YA 2YKMA 1FHTA 1VI7A 3WBZA 5T7LB 4GVLA 3OVSA 3NE6A 4KPYA 3AB2B 2IMOA 2FSKA 1REGX 4JI7F 2I5JB 3B4MA 4Y1DA 5B7WA 2Z2MA 5E26A 1RISA 4N41A 4K59A 3N28A 4GW6A 1TVRB 1NJXA 1QQNA 2BYCA 4C2MA 2VCPA 3G6EN 2ILZA 2RUSA 2C42A 2CKWA 1QVGM 3ITHB 4OX9F 2ASMA 4DU7A 1NKEA 1VHIA 3PYDA 2ASDA 2DCUB 2JJ4D 3OFGA 3MMVA 1VC5A 1T8EA 1KLMA 1NH7A 3VQSA 1DQ9A 5AE1A 3BSOA 3AO5A 5AQVA 3DYAB 3OVBA 1UFKA 3ISZA 2IVMA 4DQQA 2ZJPL 1BQNA 5JLHA 3TUZC 2IS3A 3C65A 2DNRA 4GRSA 2QFIA 4Z4HA 3SSQA 3RWUA 2O8BB 2CG8A 2PI5A 4O55A 5GAHI 3TOQA 3MM7A 2UUAF 3VVUA 2XHBA 2XLIA 3CC2S 3OTOJ 1YI2N 1EO1A 3M9OB 3FZKA 3R97A 1VQ8N 2QXFA 2YKNA 2JX2A 3QB0A 1QY7A 3EVWA 3BGRB 2E1ZA 1NK0A 3AQPA 4OKJA 4E0DA 1SC1B 3EL2A 1VS3A 3BQ1A 1NJIO 5CY4A 3H5SA 4KHRA 4WYLA 2I0XA 2EC0A 4USIA 1TFWA 1Q4RA 1FDAA 3WX8A 2QN6B 1S9GA 5JMNA 3P4IA 4B02A 4HT5A 4QYZK 1VFJA 2OMLA 3NCQA 1WC4A 2DNHA 2ZH1A 2HNDA 3C16B 2G8UA 3NMUA 3MDFA 4JN4A 4KO0A 2KG1A 1GLLO 4B1ZA 4L3NA 1ITGA 3OT9A 3IBWA 4Y2AA 2YHAA 4DR3J 2IC3B 4KRFA 1CPZA 3UVJA 2ZUGA 1TKXB 5GAEP 2YWFA 1AZSB 2BA9A 1TMJA 1S1XA 1YVUA 3RG6A 3ZT3A 2HHPA 2UXCF 3LALA 3HHNB 4DR6K 4F25A 5LJVA 3VEYA 2FVQA 3NDKA 4X4UA 4DLGA 3ULDA 1S6QA 3V6HA 4DR4K 2QLJB 4X66J 1T95A 2L3MA 3I5BA 4K25A 2E4LA 3CMEN 5LMUK 2DNGA 4O5FA 4G3IA 3EPIA 4ECRA 3MMCA 1XK8A 4QZVB 4DCPB 3QFWA 1KS2A 1F5BA 1O13A 4Z4FA 3J7ZT 5J2QB 2V8PA 3PACA 4TU8A 1X3NA 3LP0B 3VGLA 2DD8S 4KHPF 2A10A 1ZAVA 5J2MA 3PZPA 1JKHB 2FVPA 1YZ7A 4HI2A 2MKKA 3ATUA 4CH7A 1HI8A 4LF5K 1NK9A 1R6YA 4CZMA 3BY5A 4DX6A 1HW8A 3QBXA 4F7VA 1RT6A 3O3HA 3A8KA 4BQLA 3JSMB 3ZEUB 4BRFA 1EIYB 5EY4A 1N33K 5DM6Q 1WOOA 3KYLA 3MFHA 2GVZB 1PJ6A 1EP4B 3GR0A 3TA1A 2JWLA 4XO0A 3LL3A 4RUHA 4B3SF 5IT0A 3D3CJ 4K4TA 1Z2LA 5F0WA 4DR2F 2OA8A 2HBRB 4CHQA 4H0YB 3P83D 2YHWA 3HT0A 5D3GB 4JI8K 3VETA 3BV8A 4MH8A 4I64A 1FT8A 2OELA 3GYGA 3CJSA 2DB1A 4XPEA 1HNWJ 4DEZA 3TSPA 3UWTA 2PYLA 5A6PA 3IG1B 4ECUA 4LRBA 1UAXA 1UVIA 4CJEA 4B9TA 2V63A 2MPUA 3QT5A 3JAMU 3R9LA 4ES2A 4C3MA 3LP3A 1GX6A 1PYTA 3RBDA 3AB4B 4DSIA 4PL7A 1WTFA 1RBVA 4YUDA 1RDUA 1HRHA 3O9RA 2CJ9A 4A8KA 2XZTB 3VEOA 4B9MA 3TX8A 3D3BJ 3WXKA 4RW8B 4F9OA 1P8GA 5IOLA 1CQMA 3BJYA 2ZKTA 4JS4A 2OPRA 1CVJA 1HQUB 4DFJA 1NB7A 5BRDA 1R0BG 2MKJA 4EO6A 3BQ0A 3ULEB 1EZZB 3TRGA 5GAEI 4IO9Q 4WCEQ 1EWQA 4KSEB 2FHOB 3N5FA 4I6MB 4DU8A 1NMEB 3WC0A 4K4ZA 2PN6A 3GJRB 2H5EA 1EHWA 3O6WA 1UEKA 1NG9A 1KBRA 1VDHA 5A8RB 3EYZA 5AQFA 1EKRA 2MKIA 1KN6A 3DCAA 1HI0P 3S01A 3V9UA 5F8MA 5T14A 3OR2B 4M5IA 2LEPA 3SEOA 1MN9A 1VLYA 2XY8A 2VQFK 2R9LA 3T1AA 1IWAA 2XMMA 4CJRA 5GVQA 4WFNQ 1T02A 3L7PA 3H7HB 4B1UB 3CFPA 4FJLA 1S3XA 3M6UA 2LA6A 3NOCA 1IV0A 4E7JA 1KQSR 4C11A 2GMJA 4URQU 4USTA 1WSVA 1HYSA 1XI1A 5HI7A 2HHWA 3U1LA 3UR3C 1IBCB 4GV9A 3DGPB 2YNIB 2HGLA 1Q8BA 4L74A 5ETQA 4A59A 3KKFA 4J9NA 1WORA 3FE1A 3NH1A 3A12A 1H2VZ 3AVHA 2UXDK 3R9PA 3FBBA 3FNNA 1JLEA 2XYGB 2GGPB 1FXLA 2PO4A 1VRTA 3T7ZA 4USMA 2R8KA 3MMAB 3BGLA 1RBSA 3MN9A 1D4XA 2YHXA 3MR3A 4FJIA 4IDKA 4JI4J 1EETA 5H9FK 3MN6A 4H4MA 3CJ9A 3B6PA 2V4RA 2DFHA 2P6SA 5AZJA 4LRCA 3RTVA 1KVJA 3H98A 2DHGA 4CJSA 5KG4A 4TU9A 3O3FA 1GX5A 3QEXA 3VESA 1XEZA 2X3GA 2YBVA 3EEQA 2BJDA 4LT6A 2HLUA 5IZHA 2AGOA 3ZFVA 2YQ1A 4ZP8A 1VQOS 1UA1A 1VJQA 3GFYA 1LWFA 3K59A 4FWPA 1NMDA 4M7XA 2CPYA 1JLGB 3UPFA 2F96A 5C42A 2R42A 1S1UB 3KDNA 3THWA 1T3VA 1ZS6A 4J2EA 3SMPA 1Q8LA 3M3ZA 2GVDB 2CQ4A 4DSLA 4M42A 3KK2A 1CXQA 3ZLJA 2FBYA 3UDEA 2YNFB 2JOQA 4MLEA 3M8QA 2P9LA 1WNSA 2K3KA 1P6TA 1FRJA 1W97L 1N32K 4QQBA 2HZCA 3HCXA 5KPRA 3N4PA 2H5JB 3I31A 1NKBA 1S1VA 3KTQA 3F44A 2VJVA 2GQQA 3KLEA 5LXRA 4PXEA 4QJVA 4KQZA 3VQ7A 3ETMA 4NXMJ 3WHIA 3RAQA 4N5SA 4LIWA 4LRAA 1F9FA 4Q45A 4GKKJ 2A41A 3A5OC 3T1HK 3AH6A 4OHYA 1BQXA 2HQCA 2Z1HA 2EK1A 2H4WB 2QI2A 3V6JA 5E5NA 3RBEA 3U27A 3GP9A 2LXIA 4ELUA 2PA3A 2HQDA 1X9SA 2GBZA 4NWBA 2JC1A 4NLVA 3O8WA 2GV9A 1X9MA 1NGJA 2M3DA 4B9NA 4M3ZA 1NBEB 1QQMA 2KYZA 1F9HA 4FXWA 3O1LA 3L3UA 1SIWB 1YJ9N 3MEGA 2NYIA 4ILGB 1P8ZA 2CQDA 3MX5A 2YPZA 2NUUG 1FDNA 3ILJA 1OH7A 4IWVA 2C2DA 2I6WA 4J9SA 4OGEA 4GY2B 4HTJA 2BE2B 2P2CB 3J80O 3KD5E 4O3RA 1Z26A 3WZ0A 1I3OB 1YSJA 1RWXB 2CJXB 1MN7A 5E2QA 3V81A 5KAKA 2JEFA 1RCOB 2EFQA 2NRTA 1GEHA 2V5HG 4JV5J 3ZT0A 3EZUA 3K2PA 1C1BA 4DX5A 4MKYA 4HDGA 3EM1A 1FKOA 4KGMA 1JL1A 1IM6A 3VQEA 1TL1B 2OEJA 3KHGA 1M90T 4B3RK 4QPXA 5HP1B 3DFEA 3CCRS 5AE2A 5LMNJ 1Q9YA 1N8RT 1D3WA 4LFBJ 2XQCA 5CZXA 3OVAA 2AJ1A 2WBRA 3SBMA 3AHPA 3EKSA 4WFZA 4BWMA 1I94J 1KKHA 4BC4A 3CCWA 5DDQC 4ED8A 4IOXA 1GLFO 3BS9A 4Q2LA 3DI6B 1RT5A 3DN9A 2CVEA 2E88A 4QWDA 3LZIA 4YOXA 1NSPA 4NZ6A 4JI3J 3C6UA 1S79A 5JJBA 5IM0A 2RQ4A 3KXDA 2X1BA 2ZITA 2Y1LB 1DJ0A 1GLCG 3BZQA 2BANB 3KVGA 1T6CA 2O8EA 1GMUA 2CQ2A 3K9JA 2C2EA 2F3JA 3CMAN 3MDQA 2M70A 3KLIB 1FKPB 3DOLB 1BCOA 1S57A 5HK4A 1LKZA 4YR2A 2ZBQA 2HVIA 1NK8A 3T5JA 3IKMA 2POKA 4WXWA 3O08A 2MQ8A 1VQ4S 1XUPO 1KC8T 1UW4A 1WUUA 4KC5A 4A8FA 4PUOB 3SDEB 1K8AT 3GE1A 1N88A 5C7PA 1X31C 2DRBA 3CDEA 4CYUB 4PL8A 3IR5B 1FDBA 4B9UA 5I3PA 3K17A 3M2VB 5KPTA 2AD9A 4UQGA 2HZVA 4CCHA 4GKJF 5C24B 1XQIA 3CJ5A 2ZZTA 4KHWA 3GYXB 2DTJA 5I3UB 3BSCA 2J6SA 2KT5A 4IOAQ 4W5QA 2CDQA 1U0HA 3QWPA 2MHNA 3BEGB 2YX1A 3J81O 2VKRA 1PC5A 3ENOA 3F56A 3HDSA 3HLUA 4CE9A 3MXMA 3CD5A 4Y2CA 2P5VA 1B64A 4X4VA 3QJLA 5HMWA 4TQSA 5D8HB 4RR5A 1CXUA 3OJSA 3HZGA 3KHRA 4DPYA 4DV5K 1RWWB 1Y64A 3RB3A 1APSA 3RSEA 1LAWA 1FJCA 3Q0AA 1J5OB 4LF2A 3CJ7A 3CJ2A 4BR0A 1DFDA 2XM3A 1RBRA 3M2RB 1UJ4A 1MDUB 1VQMS 3DMJA 1G4CA 2CNNB 4B9VA 1NPRA 4JKBA 2J7UA 2DRDA 4CJFA 3N6NA 1F1BB 1KTVA 3MM6B 2XYHB 3CWJA 4U67Q 4BRKA 3PFOA 4KHNA 4F2RA 4MLHA 3FRYA 3H20A 2WBNA 1LXJA 3E9PA 2DHAA 1S97A 2QWMA 4MAKA 2V9KA 4Q5VA 1M1KT 4LF4J 2AMCB 4Q0BB 4NYPA 5L46A 5I42A 2NPFA 5IWAF 4NASA 3JYTB 2VODA 2L9DA 1RT4A 1WEZA 1KQKA 2MKSA 1SQGA 3WQTA 4LSNA 3ZC4A 1HPZB 3DLLQ 2D4WA 2DYAA 2K7KA 3HHLB 3NCRA 4X65J 3EZWA 3L2QA 2A1BA 1RP5A 3A3PB 2I5JA 2M2BA 4CNZA 1F0XA 5IT9O 4FYVB 3TWHA 5DG7A 1KOOA 4WFXA 2LDIA 3K8VA 1K6YA 1A9NB 3NF8A 3DLHA 4RBUA 1Q9XA 1TVRA 3LDQA 4IH6A 5GAGU 4OVLA 3M8PB 5AQJA 1VBXA 2BM0A 3D1OA 3OYIA 1SJ3P 2IHR1 2X1FA 2GX8A 4CLWA 4E8UA 2XCAA 3ITHA 4DPXA 2E5HA 1QTNB 4CJVA 2Y1JA 2FY1A 4KAIA 2BKNA 2NRVA 1TUVA 1D8YA 1KQGB 4J91A 3N4WA 3GDQA 1JB0C 1A5WA 3PX0A 2ZVSA 4RCHA 1KD1T 1REVB 3VEWA 4CF1A 3F41A 5EGYA 4CLYA 4FJJA 5B08A 4DR6F 1F5AA 1S12A 2DY9A 4K8RA 2QXLA 5AQTA 1ZZFA 3MTKA 3GLJA 2VF3A 3CC2N 4C8YA 3R3LA 5LMUF 1RUSA 3CT9A 1Q95G 3CEDA 1RADB 5E33A 1RDWX 3MN5A 2YH0A 4UOGA 1KXPA 1ULRA 1VIOA 3OLAA 3TAFA 1B7YB 3T5HA 3N4QA 4JK7A 3L9ZA 3BGRA 3CFOA 1X5PA 1NM1A 4BRHA 4CZIA 5AQUA 3JQKA 4LREA 4Y28C 4BG8A 2KFZA 4LVNP 1NPKA 1Q7YO 2DGWA 1J6ZA 7FD1A 5EVZA 5AJ3K 3WQPA 2OCEA 5LSOA 4K7QA 3L2UA 4O0NA 4JS5A 4KR0B 1YRXA 2C3YA 1N33F 2KXFA 2E1RA 3PW7A 3ZO7A 2KG0A 5ETVA 1RQ0A 3SQ0A 2XULA 1XMOK 2BW7A 4FK0A 1VQSA 4TN2A 3WNFA 2JGUA 3IGVA 5DJBA 5K14A 4QU7A 4DV3J 4Z94A 1CJUA 4HKQA 4JI8F 5EDWA 1B3TA 1NSQA 1HHTP 1RKIA 4OLPA 2ZJQQ 3OBIA 2VC1A 1YVNA 1YJNS 1ZM4A 2VDIA 1YVFA 5AFUH 1LW0B 5J2QA 3OYAA 3P4UB 1GK8A 5HMYA 4I9LA 3LP0A 4LF6K 4NLXA 5F8HA 5KT5A 2FTRA 3O4NA 2YQ3A 4RPFA 1MG7A 3AA4A 1YJRA 1JKHA 1JK9B 3PX6A 1FEEA 3Q7CA 3PSFA 3O6QA 2W9CB 3Q8VA 4MDAA 4ZCKA 1NKCA 3LP1B 1ZPWX 4AHCA 2V67A 3EE8A 4IFEA 3H59A 1HLWA 3JSMA 3UQSA 3NG8A 3H2VE 1P90A 2X6NA 1S72N 4DX7A 2XY6A 2CGJA 1HJRA 3W5YA 1HBOB 3E2EA 4WFAL 1FCAA 2GVZA 1KNZA 4CLZA 1YIJN 3Q8RB 4AHTA 1Z6RA 1SC6A 1G7CB 2AJQA 1CJKB 1J5EK 2X51A 2OPPB 4BRDA 2N4DA 1U1PA 1SH0A 2Z1GA 4MO5A 4K8XA 1LCUA 3MAAA 4F67A 3P3DA 1HR0K 5D15A 2JDJA 4JAXA 2PIIA 1WG4A 3IG1A 2MGZB 2AA4A 2CQBA 2V69A 4DV2J 3V9ZA 4HVJA 4W5RA 4XTTA 2RF2A 3PY8A 1KQFB 1Y0HA 3B6OA 2VQFF 2QWRA 3CJBA 3LM9A 3RB4A 2WW4A 5KGXA 3VGKA 4NYFA 3G0ZA 4DV1K 3IP0A 2ZH6A 4RW8A 4CEEA 3H1QA 1WLJA 3FFKB 4X62K 1RLDA 3BYPA 2IM3A 3V4IA 2QZ8A 1SKWA 2RJZA 2YWKA 4OGCA 5HRRA 1RDCA 2C1EB 2PBDA 3ZX0A 2XY7A 4WYWA 2QL7B 4EHUA 4I6MA 1RAJA 2GAHC 1XIQA 2F9JA 2A2CA 2HBYB 1ATNA 2BRLA 4TY8A 4IRCA 3KK3A 2ZBCA 1RWPB 1WKJA 3QT7A 1GT8A 2CH6A 4IOCQ 4PYDA 1KQSM 4OZ2A 4W5NA 2OI2A 3VTIA 2UU9J 3ILOA 3KDOA 1QQCA 4ATNA 2D3O1 1V5IB 5ETLA 3OR2A 3SYZA 1RK8A 2OAUA 3TTCA 3DOMA 1W0HA 4O3OA 3IR7B 4CGHA 3HHLD 4A57A 1F5CA 5ADXH 4ZVUB 3GIIA 3TQ1A 4JB8B 3PRVA 2VICA 2YNHA 4X84A 3SXLA 3IS9B 4CJUA 2AYEA 1T3OA 5FIIA 1AW0A 1NGGA 4MT1A 2EFOA 4O8UA 4WU2A 2IRYA 3NWRA 1VR6A 2E20A 2Q6BA 2FGOA 3AO2A 4NLWA 4FVUA 2V2QA 2W4PA 4Z0UA 5EX0A 1UEVA 3HI0A 1S4EA 2ZWOA 4USJC 1H72C 2MZQA 4CO0A 1NEEA 2HVDA 2IM0A 3JAMY 3UCZP 2B4UA 4MKVA 4RO0A 2RIJA 4IUFA 3B6BA 3CJ8A 1SVDA 1HNIB 2I1RA 5CHCB 4JV2A 1SKRA 2FC0A 5AQKA 1XMQK 4L8RB 4YOVA 1GXTA 4AHUA 4K43A 2E1PA 2IM1A 3RYLA 4RNFA 3OR1B 1U04A 3T1HF 5LOQA 4UUWA 4CHYA 5LY3A 3TP2A 2QA4S 1UAWA 1KAZA 3THYB 1WD6A 2R7RA 2XSJB 4BRIA 4O44B 4AQYF 4JI1K 3SSSA 3FBFA 4CGDA 1VQON 4PR6A 1UPPA 1XHZA 4Z4EA 3M6VA 2VG6A 3QEPA 2FUG9 2BXJA 4C8LA 2IA6A 4X64K 2DGOA 4LFCK 3OSNA 1C0FA 1S1UA 1VLOA 3DXMB 2Q79A 4KGKA 3ADAC 2GVDA 2B9XA 4UOHA 3B78A 4TU7A 3MMBB 2YNFA 1GLDG 1R89A 2GWJA 1E6YB 4FF1A 2KLAA 2GW8A 2YTCA 3PRBA 4HH1A 4WF9Q 4DU4A 2B8QA 2E1AA 3R5GA 4F4YA 4FF2A 4NZ7A 2YKQA 4EGLA 5JVHL 4F2SA 1Q81O 2HFUA 3SI8A 5CD4A 1X7VA 1RAEB 1FXXA 2OZSA 4B3OA 3TSUA 8RUCA 4OZLA 5E3QA 4ZVQB 1MROB 1QLNA 4ZVGA 3NGIA 1WUAA 2EHGA 4OX7A 4ZTJA 2YY3A 4LMZA 2KVIA 5AQRA 2HFNA 4RWTA 4HUEA 4CJ3A 4B3RF 1S1TA 3F9MA 2BX6A 1K9MO 3AA3A 2P9KA 3SNNA 3BR8A 1TYQB 1BU6O 5DETA 4A2AA 3D0GE 1RDAA 4ETXA 3JS6A 4CIEA 4UF4A 4PQUB 3KWIA 1KHWA 3Q8UA 4IZ9A 3QLHB 4FLUA 4CZLA 2FZKB 4I68A 5E3PA 3MX2A 5A8KA 4BRNA 5B8HA 2PDAA 4P75A 4ISGA 1VQPS 2Q3SA 1VQLN 2O8DB 2IPOB 3VTHA 5D78A 1H2TZ 3KJQB 4BDZA 3FZBA 3PW0A 1ZAXA 2B7CB 4YN3B 1EX4A 2N4CA 2AX0A 2NRHA 1OKJA 2V6AA 2UUCJ 3UB5A 5BPNA 1IBMK 1LW2A 4DHYA 4JEPA 1T6DA 4CD3A 1HI1A 3W5XA 2CGLA 4F36A 2YKAA 2UUBK 3QIOA 2ZGYA 4FPBA 1XNRK 2PSZA 2OKQA 2HS4A 5KGWA 3FBCA 1FERA 2LEAA 3CCRN 3PJ9A 2DPIA 5HP1A 3MD1A 1LNQA 2CNOB 3OXLA 1BQMA 2IIHA 4DTJA 2BJEA 4JKGB 4FJ5A 3T1YJ 1IKWA 1NHKL 3HZEA 4KBOA 4PABA 1L3SA 3BH6B 2VPZB 2UVRA 1HWUA 1VBZA 4K4YA 4A8YA 2O4IA 3JTNA 2VFRA 2FY8A 2ZH7A 4B3MK 4MFBA 1XC9A 3HO1A 1HFEL 2DNNA 1D0EA 3ZNJ1 2XMKA 2ZZNA 4K2XA 2R2RA 1T94A 3BO4A 2NLXA 4CLPA 3FQLA 2HYIB 2NXEA 1IBKJ 1YT3A 3R1XA 3DI6A 4FS1A 3Q23A 3WNGA 2M4MA 4JHDA 2VQEJ 4ZVEA 4BRAA 3FFIB 4XPCA 1CEZA 1QAXA 2Y9HA 4DSKA 1KDNA 1CS4A 1ZTTA 3SQOP 2H65B 2DO4A 3TSQA 2OIHA 3AD7C 1A7GE 4DV5F 3CCSN 1U6FA 3GU0A 3PHEA 4HH0A 3KNGA 5BR8J 2XMTA 3WEEB 3K2YA 1ZBLA 1VQ4N 4UY85 2W42A 2G8IA 4RG8A 1RI7A 4FWSA 3KK1A 3BYRA 3GV8B 3HT3A 4X2BA 2GUIA 4PUOA 1GMWD 1HYZA 2MHEA 3AVAA 3S41A 2W01A 3FR0A 4LF1A 1GNKA 4F3TA 4ETZA 2ZJRL 2KZZA 1PILA 2RDJA 5C24A 2Q97A 4ZMMA 2H51B 3B4DA 3CD6S 2OANA 3CCTA 3R5DA 5J2PA 1HBMB 3FSYA 4DTNA 4LFAK 2AHOB 2LQJA 3UDLA 4KKOB 4M5DB 3C6TB 3GYNA 1A5XA 3THXB 2KQ2A 2VWBA 4CD1A 2DNLA 3QNNA 4ICLA 3LW5C 1U2RA 9ATCB 5FLXU 5C0YA 5J2NA 3TAQA 4CDIA 1VSDA 1IBLK 2D7SA 2F4VJ 1NGHA 3V1RA 3QZ7A 4DG1B 4K8ZA 1N36J 2CPHA 5BXIA 3SCKE 4FZZA 3C0BA 4FWMA 3PVXA 2ETJA 3SFGA 3C6HA 3H25A 1Q82T 3M2RA 1UL3A 2F63A 5CCLA 1QSLA 5ETRA 5IC6B 1YBTA 2DEJA 2HBMA 4P74A 2DEIA 3AVFA 3OPKA 3UO0A 3GSIA 1SKSA 3IRWP 3MM6A 4DQPA 3D6MB 3N5BA 5K9FA 1SL0A 2XC9A 3W8GA 5HRPA 2BW2A 1KOHA 4K0KK 3K0JA 4CP5A 2F8TA 4AM7A 1WHXA 5JUMA 3QEIA 2RRNA 1FTCA 1Y10A 2J9CA 5F8IA 3AQOA 3NGRA 2OTLS 4MK8A 1SQFA 1Q86O 3JYTA 3AVNA 5K20B 4WE1B 3T9NA 4DR3K 4NLYA 1TELA 1I51B 4ED7A 3W62A 2ZHAA 3OYDA 1F9EB 5F8GA 4JI5F 4H54A 3U1MA 1CJVB 1HPZA 2HNZA 4RBVA 1RZMA 4ES1A 2GJ2A 1WF0A 1RDDA 1YG0A 1P1LA 4NX9A 4X66K 2PC6A 3FSIA 2DVIA 3NHGA 3DLGB 1KCFA 3D1HA 1VQNN 1SL2A 1HNXJ 2VG7B 4F3QA 1FJEB 4PHTX 3M8PA 3L2VA 3U9DA 1HNVA 3BBFA 2DRAA 3AVBA 4ILMA 1CC7A 2HWHA 1RWVB 2PFUA 1VJWA 2V8HA 5A0YA 2WW8A 3IM9A 4O3NA 2ZD1B 1LWEB 3L8BA 1QSSA 3O9SA 1VCTA 1N34F 3JSRA 4UQTA 2AJ0A 4CWBA 4FJ8A 1YJ7A 3W63A 3CDUA 3CDAA 4IH7A 3BZKA 2ZM6J 4CEOA 2R8JA 1REVA 5HROB 1PAUB 3THVA 3CJRA 4FOEA 1BHLA 1C0TB 1Q8KA 3ID6A 2KFYA 2QG9B 4UW2A 2XB2D 3KMQA 2CYYA 7AT1B 4JI6J 1SZ2A 2O5DA 1T44A 4OLAA 2CWKA 2BE9B 3AVCA 1ZTWA 4I2QB 3EVOA 5ETOA 2JVOA 4RNNA 2CQ3A 2ZEJA 4ED2A 2YX7A 4ITSA 4PXCA 2HHHJ 3DRYA 2ZF5O 4LF6F 3VQ6A 4DPUA 3U7JA 3ZZPA 2J6TA 1HNWK 2DGXA 3IMXA 3BF1A 4W90B 4CZJA 3X1LB 4ES3A 3W1YC 2VOOA 2ERRA 4DSEA 4DCOB 2GQCA 3GWCA 5DM7L 2HW3A 3CCZA 3KWMA 1ZZNA 4X4NA 2FJAB 4OHXA 2WC9A 1U45A 3QFHA 4DV0F 1UKUA 2HIYA 3R2CJ 2J5AA 3MFIA 1KLMB 3J7YI 1KRPA 2RDDA 3A2FA 5D0RA 1OYDA 2LLZA 2RT3A 2WTFA 4ZP9A 4W98A 4ILRA 4V19J 3N79A 4YR0A 5AQPA 1S10A 1X5SA 1BQNB 3KHLA 1B0VA 1DBDA 5FRMA 4RW6A 1TK0A 3DLEA 3ZCMA 2ZUAA 1ZBUA 1HR0F 1YJNN 1TL5A 3OHRA 3DAWA 2RD5C 1TAQA 4EFAC 5CE3A 4EWTA 2HWTA 2BABA 4DQRA 1W7WA 4P2XA 3MAQA 4J2BA 4DUYJ 1Y9OA 4NZ0A 4RW9A 2AX1A 3SCIE 1RLCL 3BBBA 3VQCA 1KVIA 4W5OA 4JI0F 4M3WA 1LFWA 3UD4P 4JI7K 2GS8A 2VBYA 4I56A 4WP8A 5ETNA 4DV1F 2HMPA 2QSFA 3LP1A 4X62F 3W66A 4FSVA 2NXCA 3UCUP 3VMFB 2R8HA 4H5VA 1DTTA 4R25A 5KFGA 3CC7S 2V7ZA 4JI2J 1UFWA 3R6MA 2ASJA 3MR5A 1JNRB 2C2KB 2HNDB 1TMMA 2XHWA 4X4TA 4F0HA 5KT2A 1B9FA 4F04B 2IDEA 3TZWA 2XMAA 2QWLA 2Z30B 1QZ6A 4CO5A 4LF7J 1CJKA 4H5WA 2GHWA 4G1PA 4IG0A 2OPPA 3FSXA 3H42A 4CHNA 3GIMA 5LJWA 3D6TB 1U48A 3D68A 3AOCA 4CFAA 3ZZZA 3V1OA 4P7TA 2HOEA 1S6UA 3JB9k 3GJTB 2GCFA 3R6LB 1FRXA 1S6QB 3SPZA 2MGZA 3C6AA 1UWAA 3L7UA 3GILA 4N76A 4E1NA 2E6LA 2Z58B 2AQ4A 4IR9A 1XBWA 5F0XA 3MMCB 3THTA 2O66A 2MQNA 3Q8SB 1S1WA 3J7Z5 2XMWA 2KZMA 3QFUA 2HKEA 1WC6A 4FJMA 2ITGA 4OYZA 1BA0A 5HL7Q 3HX9A 4GVEA 3NF6A 1JLQA 3AD8C 4G9ZA 1BE4A 3NGKA 4QS7A 1AA1B 3IN5A 3BDPA 2RQCA 1HKGA 5L1JA 1HBUA 2JLFA 1UWBB 2PYJA 4ZN3A 4CEDA 2DH7A 2MY7A 4PKIA 1NM2A 1OPIA 2HAFA 2QYCA 3P38A 2V8DA 1URRA 2CADA 4ED4A 1Y97A 5AXLA 1YITS 1C0MA 3PR5B 1OO0B 4ANCA 2H9ZA 2UVUA 4P52A 4LF8J 1QQOA 2R7OA 2R3VA 2QGFB 3ZX2A 2EBGA 2E29A 2O8CA 3KJNB 1UA0A 5B0BA 3M9NB 2W40A 2DHHA 2DNYA 2NZ4A 5KT3A 2GJIA 3TJ8A 1QHTA 1ROFA 2VH7A 4KHSA 4JP8A 4ZVRB 4PEOA 3P6YC 2CAJA 1QAYA 1TAUA 1YXQA 3TZXA 4NXMK 4JOUA 4HCBA 4CLLA 4A62A 4BG9A 5SZTA 2J9EA 4IFYB 4RX6A 4JI1F 3AXMA 2QTDA 4GKKK 1HLUA 3A5LC 1NNEA 1U1KA 3S7RA 4R0JA 4IG3B 2IBOA 3MF5A 5GADI 4CLTA 5CZ1A 1TFYA 3HHLC 1X8DA 3L7OA 2NZTA 4LFCF 4ED1A 4E7KA 2Y8YA 5THWA 1N5QA 2BUPA 2VONA 4FPAA 1WHYA 3U1NA 5EX3A 4AH9A 2JEGA 1BGXT 1U02A 3W2VB 1K47A 2DR7A 4DV6J 1CQNA 2VWJA 2OPRB 3OTDA 1QD1A 3IAYA 4YOEA 2V50A 2AW0A 2V8GA 3V5RA 1PGZA 3OS0A 2Z1JA 4DJBA 2KJWA 2HSEB 1XHXA 4B3SK 4XH4A 3UDVA 1D9DA 4C8MA 2FDNA 3A4TA 3SAFA 3MOZA 2QA4N 4BR5A 2CPXA 3TA2A 3TEHB 5KQDA 3JQJA 4IO8A 2LU1A 3MEDA 1ZM9A 3VWSA 3THYA 4EP4A 2W9AA 4O44A 2EC2A 1IKYB 1SH2A 1NBWA 4CEFA 1VQ9N 4JV5K 2X78A 3SMSA 3FZ2A 4CK3A 2WOMB 4QR1A 3WXMB 5DLFA 3V6DA 1S6PA 1VQ5N 1A6LA 4NLUA 2WAQD 2MZJA 2W24A 2DPJA 4KH6A 3DJCA 4M63C 3EDQB 3ID8A 5LMNK 3D6RA 3PG9A 4H0OA 4C11B 1WSFA 2FJWA 1K1QA 3HFKA 1I94K 4YY3J 1HYSB 3N01A 2KN4A 3ZTOA 5J1PA 2VPXB 4M8LA 4S0MA 4A8MP 1Q1KA 4LJMA 2NXNA 1ICEB 1KFDA 5GMKa 2I8EA 4CZEA 5A2QO 3V9XA 3CCUN 4Y0FA 1PBUA 1U1RA 1JLEB 4R8UB 4BVOA 2Z2YB 2DJWA 3PDNA 2V4QA 4JI3K 1U2FA 2YCHA 3IBFB 1BIUA 1IBMF 3KG1A 2DY1A 1MROA 4IDKB 2AEJA 1RTJA 2XI3A 1EETB 2IVFB 5E7OB 2UUBF 4H4MB 1XNRF 5AZJB 4U8VA 3RW7A 2RS8A 4XK8C 4CLUA 3QQCD 3NLCA 3CJKA 2QFJA 1S59A 5AQQA 3SV4A 2L9WA 5CH7B 1TYQA 5KTQA 4NE9C 2YNGB 3TABA 1C2PA 3MWBA 4R0EA 5HO4A 4QWAA 4G1QB 1SC3B 4B3MF 1PAEX 1J53A 2A1RA 3WQUA 1S5ZA 5G4DA 3PR4A 1LWFB 3QLHA 1DLOA 2YXLA 2PMHA 2ZOMA 5ETMA 4H4KA 5KOXA 3NGDA 1VQPN 1EKEA 3THWB 1X4AA 4M5MA 2C22A 3D0HE 3M05A 3AVKA 3MK6A 4FO0A 1PSDA 4DL2A 4UTGA 1RAAB 4ILLA 4LSZB 3KK2B 2F8SA 3J80U 3W5ZA 3I55S 3CC4S 1FRLA 4TLQA 3RAMA 1OJ4A 2P9LB 2LSNA 2BKPA 3MCMA 3NGUA 4DFMA 2LEBA 1JX4A 4OYWA 3S1TA 4AFFA 4OI1A 5ADZA 1F3VA 3TA0A 5M1QA 3UN2A 5DQHA 1UPMB 2COLA 4DR4J 2K1RB 3W7BA 3VA0A 3ALYA 2DNZA 2UVVA 3OYFA 4M3TA 1D8ZA 4LF9J 3H4DA 3VAMA 2IOCA 1KWMA 3KZBA 4JKGA 2E7VA 5CYJA 2HFVA 5LJ3Y 2EPIA 2QEXS 3NAIA 1S0MA 1FK9A 3D6FB 2NR0A 4C97A 4ECSA 4EYHB 2DR6A 3EMTA 2E9RX 1E4GT 1KHVA 4OO1J 3R5BA 1NGFA 1BOTO 4LF5J 1ZA2B 1RYSA 2GA7A 4KREA 4PPZA 3PIPQ 3CCVS 4HEA9 3MEGB 4DQIA 2LQ5A 3CYMA 2KVQE 3ISNC 2AJ2A 4LF4K 4IBNA 3M8RA 2O8FB 2AIRB 4I69A 3OS1A 3OBYA 2EW9A 2QIFA 4WQ4C 1N6QA 4J9PA 4P2MA 1ZXOA 4K5SA 5EXWA 2BH1A 1U0SA 4FM1A 1T05B 3VGMA 1X9WA 2W6LA 3I5AA 4NCBA 2MKCA 4RUAA 4FXVA 1AB8A 3OTOF 3V81B 1PBAA 3A5NC 4X65K 1U8WA 4UY8T 2Q66A 3NH2A 4CO4A 2H54B 4EK2A 1GQEA 3TEGA 9RUBA 3QRQA 1LAVA 5D0EA 2XMUA 1HMVB 1S9EA 3PNIA 4CEAA 2CQCA 2IJFA 3DXBA 5E84A 2PY5A 2CPDA 3UD5A 1MNEA 2MJUA 3EE3A 2AJ4A 2QTWA 3CD6N 3G6VA 1VQKS 1MWKA 3VZIA 4GVBB 2ZKUA 2H5IB 1NGIA 2L9NA 1TUYA 3OHBA 1HBMA 4YHHJ 3R8YA 1X4FA 4CH0S 4KKOA 4M5DA 4DR3F 1ZAWA 1DY3A 4FWNA 2GV1A 3J81U 2PFFB 5KFMA 4MO4A 3LGHA 3GG0A 4O8KA 3IBCB 2Q0UA 3AVMA 4G65A 5IM0B 4X4OA 3BQ2A 3G8SA 1K73T 4OZJA 2V2KA 2GJFA 2DHXA 4X66F 2FD2A 2N3OA 3KJFB 4W5TA 2A5XA 1IJFB 2HSTA 3IWNC 4DG1A 2O8EB 1IG9A 2MB0B 4CGFA 3A3NB 1IH7A 1N5VA 4IEEA 1R0AB 1OWXA 1Y5NB 3BGOP 4HYKA 1OVQA 4FM0A 1W2BM 4DR1J 4QIVA 4B3TJ 2DHSA 2F9TA 4JNEA 4WZMA 1OQ3A 3CF5Q 3MD3A 2AZ1A 1KR4A 4OZNA 2HRYA 2KW4A 1C4CA 3DLBA 1BG3A 3BEXA 2D74B 2D0AA 4YQWA 2VQFJ 4J2DA 5L8RC 3JSYA 4OJGA 5ETPA 5KRTA 2MLYA 3QGIA 2F8HA 5CQGA 4MYUA 3PYGA 2OYQA 4DN0A 3HKZD 4DL0C 1TL7B 4RL1A 3U4LA 1W7AA 1WBBA 4WE1A 4OZ1A 2CDRB 3OVNA 1UVLA 3JXOA 1MA9B 3BO3A 4JYAJ 3UIQA 2F8MA 2DH9A 4CFDA 5EHHA 2BDPA 2R8IA 1SV5B 3ZT2A 2UXDJ 4CJTA 2Z56B 1IJJA 3M6GA 3JXUA 4JRPA 5MAOA 1VHXA 4NMXA 1IR2A 3Q83A 4OKKA 4X4RA 3HHEA 1BWEA 2PEBA 2H4YB 3E9OA 2DFEA 2VFTA 4DX8H 3D28A 2QX0A 5IT9U 1S5JA 2MKYA 5H9FJ 2VG7A 2ZH9A 1HNWF 3MCAB 2Y3YA 4OHWA 1RHKB 1BDGA 2B7BB 3RSEB 3NCPA 1MMNA 1FWLA 4R5PB 4U95A 3CSKA 2QLWA 2DR8A 5HRNA 3L2WA 3R1HA 1X3MA 3ZSYA 2ZD1A 4DR5J 3IO1A 5FLXY 3MMJA 4JUZA 2DGUA 3SMZA 2Q0RA 4BS2A 5M1FA 1AFIA 1UVMA 1VSLA 4RJVA 4RWWA 2M9KA 3Q7BA 1FFGB 2KI2A 1PYSB 3D5MA 2LQ9A 3H0PA 3MR6A 4KY3A 2KT3A 4GKJK 4A5AA 5I42B 4FF4A 3SIPB 1Q18A 2BBEA 1WELA 2DNQA 1TKTA 1NSKL 3HKWA 1SS6A 2HHQA 1RT4B 4I2QA 4C3KA 1TUUA 2F1FA 4FLYA 4KAZA 4YB1P 1N32J 4DR7J 2CPJA 3R3TA 4U6PA 1S4FA 5KFCA 1B92A 1DURA 2DNMA 2OZMA 4ZITA 1NNDA 2MMYA 1P1TA 3LTOA 2FJEB 4DV2K 4CT9A 3DU5A 1K44A 1HX1A 3SI6A 4EZ6A 4FVCA 2WVFA 1VK0A 1KAXA 2XRIA 4Y2KA 2GTDA 3CM6A 5FPEA 1NJYA 1K0VA 2DGTA 3JSBA 5EWEA 1IG8A 1V6HA 1BUPA 3D0PA 4NEZA 2VIHA 4WP9A 4PKGA 4W92B 3BKFA 4DPTA 4M3RA 5HRSA 3PO5A 3KIOA 1RE1B 4XDCA 2ZBPA 4H03B 4YMEA 3E1YA 3VAIA 4DBQA 5HBMB 1J54A 5M2RA 5KFLA 3MM5B 1RXOB 1WC5A 3TWZA 1G1XA 2AEMA 4XDDA 1JXEA 5CZVA 2F9WA 4AUKA 2W7PA 2F7TA 1FXRA 3TTDA 5IWAK 3LWMA 2MQPA 2FYXA 3GQCA 1CLFA 3IUCA 2IY5B 3NNAA 3HVAA 4QYRA 1ITPA 3VAJA 5A8WB 3CB4A 1RT2B 4DMZA 4JI4F 3RZAA 2ZC4A 2ADCA 1NAQA 3I96A 2VKZG 2ZWHA 5LJ5Y 4CJLA 2KO1A 4USUA 5M1OA 3B54A 5A76A 4IRDA 1TQLA 3E01B 4GVMA 4CK1A 1OYEA 4K42A 2RQKA 1V3ZA 1M5OC 5B0AA 2J76E 4N8NA 1VBKA 3TI0A 4OV1A 1KVAA 4KGVB 2PD1A 3HFZB 4I4BA 4IEIA 1WF2A 2M52A 4MKAA 2JEIA 3CCLS 4LBIA 4P72A 1TK8A 4DSFA 4FF3A 4ZVFA 3UI3A 3K5PA 3FQKA 3DM2B 3HRGA 4NLOA 3UR0A 1FJGJ 2BRKA 3ENVA 1MWMA 2HBZB 2G0JA 4L72B 3NBPB 1WEYA 5IQQA 2JC0A 2DKOB 1ZC6A 3DRSB 3VQ9A 2W6KA 2J4RA 3JS9A 2HFSA 5K14B 4PCQA 3PFEA 1CJUB 4ID1A 3EZOA 2E6MA 2AYBA 3M30A 1HNZJ 2ATCB 4FKXA 3W3DA 4NXMF 3CCJS 1L3KA 2R8GA 3QDKA 4GKKF 3HM8A 1VQ7N 1WNEA 2LA4A 2W4DA 4MYTA 4E7IA 4I1TA 5EUHA 3THPA 4I9QA 1BISA 4ALZA 3Q86A 1BI4A 1U7LA 4EAHD 2VHGA 3AO3A 5HMZA 3L4QA 2RU3A 4FS2A 4A5BA 4ZPVR 3MXIA 4OX8A 1FESA 2B4OA 1UWBA 4OL8A 4L6V3 1P27B 4X4SA 3PW5A 5CD4H 1NHVA 3NNHA 2C3UA 4JK9A 1RKJA 2GAGC 1B7FA 3RVCA 4M5HA 1RGIA 3IFEA 4CGIA 1FFWB 3P31A 1ZYQA 3FCVA 2IIRA 3S9HA 3QFPA 5L39A 3G6ES 4F26A 2V4JB 3EKUA 3NGZA 2KM8B 1WSJA 2QK9A 2E2OA 1LK5A 5KG0A 1H74A 4FK2A 2PGCA 4NCGA 3MAAB 2CJYB 4V19X 2BVZA 3QSYB 4WIIA 4IFYA 4LR7A 4JV5F 2YX6A 4FOIA 4PG6A 4IG3A 3OFFA 1NDKA 2F5GA 1ESVA 3UNYA 3BUZB 3DKDA 2RF2B 4I6YA 1URNA 1NHUA 3ZZRA 5BRFA 3SSRA 1Q8IA 4ZLPA 5LMNF 1DAXA 1S7IA 4LFBF 3IWXA 5JVGQ 2BQRA 1GLJO 4XH1A 3W2VA 2RE2A 4KI4A 3V4IB 1DARA 1SBRA 1YAGA 3MEKA 3ZXWA 1I94F 3PYEA 4HTLA 3ZX3A 4B1XB 2ZGZA 3CJCA 4IJNA 1UP1A 5KFIA 1JLBB 4AXIA 3O2IA 4J9RA 4C4WA 3I0RA 4FDFA 3V2UC 2HVZA 2FLNA 1UTAA 4TY8B 4JI3F 2ZOGA 1C1CA 2UZAA 2HFOA 3LM2A 2FBVA 3KK3B 1M1GA 2WUSA 3ZSXA 3O9UA 5AQOA 1CZ9A 2Y8WA 4CBWA 3FDSA 4ZS6A 4OFZA 3JTOA 5AQLA 1Y5LB 2MXYA 2HG4A 4ZP6A 1IKYA 3EICA 4KT0C 2UUCK 1X4EA 3OS2A 3QESA 1OY8A 2QL9B 4YOWA 3QSIA 3M6WA 2WOMA 1DT9A 2X3DA 1TV6A 3AXKA 4TXSA 1S77D 3DOMB 4YB7A 1JCEA 2RDIA 4CI0B 3OXFA 4OYOA 5L1LA 3FRZA 2MSTA 4E7LA 1R27B 2YH1A 1JCFA 3AARA 1RAGB 1ZA1B 1X4BA 2YNHB 3AJ1A 4J9LA 5DM6L 4C8OA 3T1YK 2JHEA 1T9VA 1L3VA 5HQMA 4V1Ak 4BY9C 3G9CA 3BM7A 5CAAA 3TUPA 3NAEA 2FIUA 4YDUA 4AM6A 4C3LA 3GL1A 1IBKK 3M6XA 2LDYA 3RMBA 4R8UA 1FNMA 3H5YA 1JL2A 2VQEK 3PIOQ 3O9TA 1E3MA 4WFBQ 1VOMA 4IQXA 4Q2MA 3A1YG 2W8KA 5AQZA 2G1HA 1NZ8A 1B0TA 2J0SD 4YP3A 3WXIA 3J7A1 4FL9A 1M1HA 1HYVA 3P8BB 2HQFA 4BR9A 1FEHA 2NUBA 2R7QA 1T0TV 4Q8EA 1WHVA 3ETOA 3C94A 2P6TA 4YOYA 2YNGA 3V9SA 1AT1B 5LT5A 3C95A 3M9MB 2X1AA 5E0OA 1IVZA 3MZIA 4ZK7M 2FC8A 4G1QA 3MEEA 4J5OA 4LR8A 2VG6B 3SJJA 2O3DA 3AA2A 4ECVA 4IO9L 4WCEL 4ZCIA 4RKUC 3CUNA 4NYZA 3C15B 5AJ3J 4W4MA 4DQSA 1U2CA 2CXEA 2OSQA 1Y7PA 2EKNA 2IVYA 3DLJA 3I55N 2P9NB 3W8PA 2KT2A 4ILHA 4LC9B 1XMBA 3CC4N 4DS4A 4AL6A 3I56S 1GMVA 1B0PA 3RMCA 3CM5A 4LF4F 5HQLA 2GHVC 3QIPB 3OFEA 2CUYA 3ZETA 2MYFA 5KOWA 3GB0A 3QRPA 4BC7A 2YWHA 1XMOJ 2YJFA 2B3TB 2CJKA 4L75A 1X4DA 5KG6A 2KL8A 4PG7A 5M1PA 3H8YA 3QETA 4CH1A 2HK2A 3CJTA 1I39A 2K1RA 4B3OB 1DHMA 3OYHA 4QOTA 4X65F 4KB7A 4WFNL 4ECXA 3QEVA 2NREA 4C48A 2V7YA 3PTWA 5IXUA 4ECZA 1XR6A 4OKEA 5HVFA 4AQYK 1N36K 4G6VB 4LSLB 2QEXN 1S1TB 3VEZA 1LOTB 1RDRA 3ONQA 2P9KB 3CCQN 2B43A 2OMOA 1CULA 1NLVA 1QAIA 2EXUA 1HQ2A 1R8HA 3L4BC 3PEHA 2CZ9A 5DG9A 4U96A 3Q24A 2QKKA 3SQ4A 2ZH5A 1QHAA 2D5RA 2CQGA 1SJ4P 3EGVA 3ENQA 1TKZB 2D9PA 3R7NB 2UXBJ 4OI0A 1HJOA 3QICA 2RB7A 5A8KB 1RWOB 3H90A 2KHOA 5AFUA 3V9WA 1E6VB 5F41A 2O8FA 2IAJB 1DQAA 3AAPA 1RCXB 2VASA 4PYAA 5CA5A 4USKA 3RJMB 4QR0A 4NLDA 1IXKA 2MEWA 4B1VA 5KFFA 4HR2A 5D0GA 4KJIA 1T05A 1HHQA 1YBUA 1J5EJ 2HMIB 2B8PA 1T03B 1H3DA 3AVJA 5IV3A 1GFWB 1NGBA 3DHWC 3HYFA 3J7ZO 2H3EB 1LW2B 2ASPA 2DY4A 2DGVA 1H7XA 3B8AX 1BD6A 3OA9A 3WXLA 3VHQA 4O0IA 3HP9A 4HUFA 2DR9A 1TL4A 3TARA 1HMVA 3QAEA 2C2RA 4CK2A 1BQMB 1UVNA 2EI5A 3EGWB 4DCHA 4ELVA 2DGQA 1IKWB 3VQBA 1GTHA 3TX0A 3QJPA 3OYLA 5EN1A 4ISFA 3R8EA 4DV1J 2VB6A 3Q2TC 3GFXA 4MFBB 4GVBA 4CO2A 2EFGA 2W2PP 4BACA 1S0NA 4FJ9A 1Z2ZA 2QW9A 4BRGA 3O3GA 4OPHA 4FN5A 2G1DA 1B70B 1CJTA 3LGMA 2EVZA 3KG0A 2LXFA 3ENBA 3LQVA 4JHDB 4FCYA 4Z4GA 2GEMA 2J9DE 3AAWB 3IGNA 1J2VA 4DTRA 4QCLA 4DV3F 2QM1A 2VPWB 1RT7B 2QWPA 3I9ZA 2DXFA 3HL8A 4KTZA 4JI6K 3FZHA 5ETSA 1CS4B 3K5MA 1LOUA 2UUWA 2XNQA 2KRRA 2OPSB 1U1OA 3NNCA 5I9EB 1R0AA 1N48A 2FVRA 4E7HA 1BY9A 2C2MB 1KAYA 1CLQA 4QS9A 4B9LA 2HHHK 4AL7A 4NCAA 4KH0B 1SH3A 2E7XA 3ULHA 1JMTA 3CJ4A 3OHAA 3AOAA 1RA7A 4TSXA 4CF9A 4RW7A 1RAIB 4U9RA 4YB6A 3KK1B 2RRAA 2M5YA 2XEXA 1NGCA 5KT6A 3QNWB 1S48A 1BLUA 4R79A 4QU6A 4BBYA 3SQ2A 2P5GA 1JXVA 2DO0A 4Y0WA 4DV4J 1AUSL 1FWPA 2M8HA 2E1YA 4BR4A 4DCJB 3C19A 1NJIT 2RKIB 1TL7A 2KH9A 2IDOA 1HWIA 2SXLA 2KXNB 3OYKA 2HHVA 5IS2A 4QBUA 5J2PB 4U7BA 2MQQA 2QSWA 3HSJA 5ADXA 1SV5A 1HWLA 2A3ZA 5J1NA 2ASLA 2CGKA 1FNOA 4B1WB 4ICLB 2G8HA 4FNHA 1S0OA 2XNRA 2AP6A 2XTJP 4A2BA 5J2NB 3KLVA 1XMQJ 2Z1IA 3R5CA 3AO4A 3R6GB 4KV8B 5F8LA 2V51B 4WKRA 4WZQA 1R8CA 3R7BB 5E3AA 2BTFA 3L0QA 1XNQJ 1QZ5A 2ACMA 4DV2F 4R5PA 1UMJA 3CJAA 4ZIWA 4CESA 2MTLA 4DUYK 2XBPA 2BJ7A 4I6AA 3J81Y 1F2HA 4WBFA 3MCSA 4LQ9A 2HRUA 1WI8A 1SJFA 2WSFC 2QA4G 1QE1B 3AV9A 1WKLA 3ZTPA 4M7YA 1SQEA 4PWUA 4X64J 1BMQB 4ID8A 2C3PA 4JI2K 4OZ3A 3D2WA 4FJGA 3U9ZA 1XR7A 3FC9A 3NY0A 5C2CA 2KDOA 2Q31A 2XZWA 3ZSVA 1WOSA 2VA2A 4KHYA 5GAHU 4DTXA 4QWCA 4LF7K 5H9EJ 2RAQA 3R5JB 2NSCA 4NPOA 3K9KA 2YHYA 4B8CA 1HARA 2OD6A 3TQEA 5I4MA 4NRTA 5T7BA 1VK3A 2IRXA 2HNZB 2IRUA 2Q1LA 2KB2A 5KFOA 4FWLA 2UU9F 3OV7A 3HK2A 2KFNA 4CNYA 3AODA 2EFVA 2DIUA 4EMDA 3K89A 4QIFA 3NRBA 3HPGA 2CQ1A 3UN5A 3WIVA 3HJVA 3DRPA 1C0UB 4BVPA 1HNVB 3V4MA 3WX4A 4NB4A 4NA1A 3SQ1A 3RBXA 2RE1A 3CDWA 1IQZA 3UW1A 3QAUA 3EDRB 2VJUA 4RNMA 5A0YB 3NS6A 5DK5A 5M1KA 1RGVA 5HBMA 1T9WA 4IOAL 1XN9A 5GMEA 3MM5A 4E3SA 3AJDA 4CJWA 4BLGA 4NRUA 2BE7D 5IT9Y 1GTEA 3LZJA 2JRSA 2W1BA 1RTZA 2VG5A 2Z0GA 1T9YA 3M2UA 4FBUA 1YJUA 4DU3A 2Y0BB 1RNHA 3OUYB 1H38A 3MTJA 1UFLA 1WG5A 3CO0P 3ILLA 2QT7A 4UT4A 5EWFA 5C25A 4KBIA 4DL4A 5AXNA 2NSBA 4FJXA 4CQ1A 5A8WA 3EX7B 4JI5K 1RT2A 1FFSB 4FWRA 2O67A 4BC3A 2CPEA 4C0OC 2Q43A 4XEIA 1N54B 3G4SS 2KRBA 1DGKN 2EEYA 3CIMA 1IN0A 3E01A 5KFAA 3VERA 3ZTRA 2ZJPQ 4U67L 5LL6d 5HN0A 1YJTA 3A13A 2BACA 1KONA 4Y3CA 3CIPA 1X5OA 3M8ZA 1YRUA 2GC8A 2HF3A 2CNKB 4CEZA 1RU2A 2W2OP 2OHDA 3QRRA 3D2EB 3DM2A 5C10A 5J1EA 2DR5A 1N4LA 4BC5A 1N34K 4FP9A 1NU0A 4DV6K 5EOYA 5HLFB 3N0VA 2FF3B 5LXYA 2YJEA 2OUGA 3NBPA 3QT8A 4UZBA 2ROEA 3DRSA 3QWUA 3BDEA 3DLLL 2BUNA 3TAPA 3BZCA 2QWOA 4DZDA 2FXUA 4DV7J 5GAGP 3KLHB 2B6AA 1QUPA 2UVWA 5F8JA 2XWYA 3CCJN 8AT1B 3W61A 4KYZA 2Q1NA 1S6OA 2VBWA 3BN7A 4RW6B 3DLEB 2AYGA 2RILA 4KHUA 4J9MA 4A48A 3R2DJ 2D3OR 4OLOA 4BREA 2CPIA 4QIGA 4KRWA 3ZSWA 2C3OA 5KFQA 4E98A 2J8AA 1M90O 3ATVA 2BOPA 3M8SA 4RW9B 2RH3A 3CJQA 3UDCA 1LXNA 4O23A 1N8RO 3Q22A 3C66A 4J90A 2Y1IA 4FWKA 3LPYA 2M88A 2MY8A 2UV8A 1R6VA 5KFJA 3GOIA 1R8BA 1AUDA 5GAEU 1FF2A 4PWDA 5ITHA 2AEFA 4C8ZA 1DTTB 3FCWA <