3C6UA

Crystal structure of hiv reverse transcriptase in complex with inhibitor 22
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 151
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3c6uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3c6uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3c6uA05
2WHOA 3SQ0A 3C6UA 2R8IA 4I2PA 3IRXB 3KLEB 5KFSA 3VQQA 3RAXA 2HWHA 1X9SA 3QYYA 1RDAA 4M45A 4ECWA 4KO0B 3AVIA 4I7FA 3VQ4A 3SCXA 1S6QA 1VRUA 3V4IA 3K2PA 1VSHA 4I7FB 4Z4HA 3U6FA 2D3UA 3U3GA 3KLHB 2F8SA 3O3HA 3CVKA 3MXMA 4MIAA 3V6DA 4E89A 4MQ3A 1TKTA 4W5OA 3ISNC 5EWGA 2ITGA 1IG9A 3S3NA 5HRRA 1HMVB 2XHBA 3SV4A 3E01A 3T5JA 2ETJA 2UUWA 2HMIB 4NCGA 1S0MA 1KVBA 3RMBA 1JLFB 1LV5A 4FJ7A 2UVVA 4O3NA 2XC9A 4CJRA 5HP1A 3I0SB 4F50A 3V6HA 1A5XA 3V9WA 3ZSVA 5KI6A 3OY9A 3IG1B 2AX0A 1D0EA 1ZBFA 1S1WA 1TL3A 3QLHB 3IG1A 2EHGA 3N6MA 4O4RA 4ICLB 4O4GB 4K4SA 1L3TA 3TAGA 3PW0A 5KG6A 5KFOA 3VQ8A 1S1TA 4F3OA 4DSKA 3DRRB 4ED2A 5KFNA 1RILA 5HRNA 5KT2A 2AU0A 5HLFB 1WSFA 2HMIA 4PQUA 2RF2A 4B9LA 3HSTB 1TV6B 3OL8A 1N5YB 4OKKA 3S3OA 1CSJA 5L1LA 4PQUB 3L3UA 1QSYA 4LH4A 3T5HA 4FJHA 3B6PA 2QV6A 3I8DA 1S48A 4MK7A 3CDWA 3PO4A 4HUEA 3SI8A 1EP4A 4KPYA 4Q0BA 3OL6A 4FW2A 2G8IA 2VG6B 3T5KA 3V9ZA 3DDKA 3H4DA 1L3SA 1S1WB 1TL3B 3QLHA 1U48A 3KD5E 4KB1A 5I3UA 2ZKUA 4N56A 3RTVA 4KFBA 4KTWA 5F9NA 3T3FA 4WE1A 2BQRA 1UA1A 4O55A 4CECA 1Z4UA 4DTRA 1NJZA 4B9NA 1XHXA 4B9VA 1SH0A 2FJXA 3BQ1A 4EBEA 4FJGA 3OHAA 5KFGA 2OPQB 3H08A 3H5XA 3DOLB 1RAJA 3MECA 1TV6A 3C95A 1KLMB 4J9QA 1RT4A 5F8GA 4Z4EA 1U04A 2X6SA 1BIUA 5KT4A 4Q43A 1JLBB 4ELUA 5FRNA 3P5JA 1T94A 1QSLA 3DRPB 4O0JA 4PWDA 3PW4A 3FDSA 3NMAA 3H40A 3GIJA 3M8PB 4HCBA 3LP1B 5HRPA 1FKPA 2IJFA 4DLEA 1FKPB 3RMDA 5KG3A 5HRSA 4KB0A 1NK9A 4QPXA 1Y97A 5CY4A 2DFFA 3NCIA 1ASVA 1R0AA 1IKXA 1IO2A 1S9EA 3K5MA 2YNHA 4NLDA 2XRIA 3VA3A 3Q8QB 5J2NB 4H4OA 4NLGA 3KK3A 1MMLA 5KFKA 2JEFA 4CJSA 1WNSA 1B9FA 4DSEA 3HL8A 2FJVA 2QXFA 2XCAA 2RDJA 5C42A 1BGXT 4H8KA 1FKOB 3QO9B 4EZ6A 4R5PB 3RB3A 4CIFA 4DQIA 4YMEA 3FQKA 1HJRA 3OS2A 4DL4A 3NF8A 4ECUA 1WNEA 4FLWA 1JLGA 1HYSB 4ZHRB 1IKVA 5DLGA 2R7YA 3M8SA 4Q45A 5KT7A 2WTFA 4KFBB 2HHWA 4O3OA 1RT7A 4FS2A 4IFYA 5KFXA 3GV8B 4OGEA 2WB4A 4YR0A 1KHVA 3KLGA 1Q8IA 3F9KA 4LSLB 3I5BA 3VQ7A 1UWBA 3NF9A 1ZBLA 4KSEB 3MEGA 1R0AB 4JV2A 3QZ8A 3MEGB 3DOLA 5J2NA 2R2RA 3IAYA 4JUZA 4KREA 1JLQA 3L2WA 2IC3A 3ISND 2HAIA 2ZE2B 3O3FA 3N6LA 2OPSB 4MFBB 2F8EX 3G0ZA 4IDKA 2OYQA 3MXJA 4KHMA 1XR7A 4YP3A 2FLNA 1RA7A 4TQSA 3OL9A 1NJXA 3AA4A 3AVBA 4RU9A 4J9PA 3DYAA 3LZJA 3K5NA 4TSXA 1C0UA 4AHSA 3RR8A 4TXSA 1TVRA 2IAJB 3MAQA 3AA3A 3QEVA 1JLEA 4LD0A 4Z4GA 1NJWA 2RN2A 1RDRA 4KHRA 1JXBA 5J2PB 2W42A 3S3MA 4NYFA 5J2PA 3GV7B 2FBYA 4E7LA 2G8HA 1KVAA 5KT3A 4DF8A 1RT6A 4RW8B 1YT3A 4IKFA 1HPZA 4DU3A 3KLVA 2W9CB 4J2BA 4C8KA 4CGDA 2J6SA 2XY7A 4JS4A 4QWCA 2FBTA 4FLZA 4CJKA 3L2VA 4KI6A 3EZUA 3TVKA 3MEDA 1KRPA 3CJ3A 5F8IA 4URGA 3NE6A 1XI1A 1YTUA 3M8QB 1X1PA 5EUHA 2RF2B 3PJXA 1RYSA 4EBCA 1N48A 2G8FA 5DLFA 1S5JA 1CLQA 4NZ0A 4KHQA 3MEDB 1Q9XA 4M3XA 4CE9A 5C42B 4FJ5A 3SPZA 4FVMA 4QOZB 1HQUA 2QE5A 3VQBA 2WOMB 1SV5B 4WFXA 5L1JA 3CDEA 4Z4FA 2ILZA 3HHKA 3TAEA 2DY4A 3K58A 1LW2A 3KKRA 3SYZA 1EETB 1C0UB 1XC9A 4MKBA 2VG6A 3KHRA 4B9UA 4K4ZA 1HNIA 3SFGA 4DQRA 3DLEA 3VQ6A 4FLTA 5D3GA 3SI6A 4J9MA 2ILYA 2FC0A 1NHUA 1S1XA 1S0NA 2AJQA 2HVIA 3KJVA 4RZRA 4R5PA 3DRSB 4YR2A 5KT5A 3VQAA 2HHSA 5D3GB 4ECVA 3KK1A 4K8ZA 3KD1E 3IRXA 1NKCA 3PR4A 1RTJA 1HYVA 1YTAA 4ID1A 3EPIA 4CEZA 3MFIA 2Y1JA 4YR3A 2V0NA 3KHGA 4J9SA 4OPKA 5J1EB 4B08A 3RAQA 2HHVA 2F8TA 4E7KA 4FJXA 4W5QA 3MF5A 3MTKA 2VG5A 4E7JA 3KK2A 4J9RA 5KFMA 1NJYA 3KKSA 4AILC 1SKSA 1N6QA 3I0RA 4B9MA 2W7OA 3EPGA 3DI6B 1WLJA 3FSIA 1WSGA 2A1RA 2FVSA 4Q8FA 5KG5A 2IDOA 1RT2A 5JS2A 2XY5A 4BDPA 1K1QA 5DG7A 1W9HA 4J9OA 3K57A 3QEIA 3NH1A 4IDKB 1FK9B 4KKOA 4CF2A 3ZSRA 2B6AB 1W0HA 4NCGB 1ZBUA 3V81A 4CJQA 5KG7A 4ECYA 4K50A 1WSIA 4XPEA 4LQ9A 4PWDB 4ICLA 4J2EA 3M9NB 2X74A 4B8AB 3HKWA 1TL1B 3H5YA 3KK2B 3QGHA 2KZMA 4AHRA 1DTTA 2P51A 1BHLA 1WN7A 4KHWA 4OL8A 1C0MA 2YNHB 4AHVA 4ELTA 2DFEA 4CHPA 1BQMB 2PYJA 2CKWA 1T7PA 2IMWP 3NAIA 2BRLA 1IKYA 2HVHA 4NLQA 4MK8A 4KHNA 1XR5A 4NLOA 4I9QA 2IC3B 2OZMA 1RT5B 3VQSA 2B5JB 1T05B 2W9AA 1EKEA 3KNAA 3C6TB 5CYMB 4YFUA 2D3ZA 2BE2B 4F2RA 4C8NA 1NK8A 4WFZA 3OYNA 4ECRA 3QZ7A 1QAJA 4DG1A 3EZ5A 1BI4B 3CJ4A 1S1XB 4G3IA 2OPRB 2GIRA 1TKXB 5J2MB 4FJNA 1DTTB 4H4MA 4URSA 3BQ0A 1EXQA 5K14A 2W7PA 5C25A 4TYAA 4R0EA 4N47A 5KRTA 4EEYA 4LQ3A 3AO2A 5EDWA 4Q0BB 4O3QA 1UWBB 5J2QB 4CFCA 4RNFA 4H4MB 4NLVA 3NH0A 3SPYA 2RKIB 1RT3A 3PY8A 5KFQA 3SUNA 3AO4A 4Q8EA 3M9MB 2W8KA 1N5YA 3QNOA 1S9GB 3ZT3A 3HT3A 3M8QA 4XPCA 3D5MA 3JYTB 2OPSA 4MFBA 3QIOA 4M94A 3ZSYA 4AHTA 5F8NA 1IKWB 2FVPA 3C6TA 4H4OB 3OYCA 4JS5A 3KLHA 1K1SA 4OKEA 1LAVA 3OJSA 2F96A 3NFAA 3Q8RB 4HYKA 1HNVB 1QE1B 3P83D 3HXMA 1JLBA 3QIDA 3AVLA 4EP4A 5KFYA 2C28A 3CQ8A 4RNOA 3RMCA 3BQ2A 2HNZA 4ZP8A 4IG0A 3LP2A 5KFFA 5KTQA 4DL5A 4FJ8A 3DMJB 1VSEA 3QERA 1S4FA 3PV8A 1HQEA 4DTMA 4EP5A 2Z1IA 4F4XA 2KW4A 4CJ3A 4DF4A 1U09A 4BDZA 3DM2A 4IRDA 3M8RA 3LP1A 3DLBA 1RTDA 4O3RA 4FK2A 3P1GA 1S1VB 3CM5A 4MKAA 3NGZA 2WRMA 3MR5A 3KLEA 3QETA 4O4GA 2RDIA 4ED6A 3WNFA 1VRTA 4CJTA 4KHYA 1RA6A 1SL1A 3V9UA 2ATQA 3MR6A 3I0SA 2E4LA 4EO6A 1S6PB 4G1QA 1QHTA 1WAFA 2HHTA 4FBUA 4J2AA 2C2EA 1U49A 1KHWA 3DYAB 1IKVB 2JEJA 2NUBA 4NYZA 3LPTA 4WFYA 2FBXA 1Z26A 3LP0B 4N5SA 1JLFA 5DG9A 5EWEA 4CEOA 3GIKA 1YVUA 1HPZB 2BQ3A 2IS3A 1EP4B 3SZ2A 4CCHA 4FS1A 4FW1A 1N56A 4FZYA 1TL1A 4BE2A 1VRTB 1OS5A 1ASUA 3OYBA 1HRHA 3KK1B 3CG7A 4K4YA 5F8HA 1WSJA 1WSEA 1S6QB 1JXLA 3DLGB 3GILA 5EU7A 3ZSWA 4E7IA 3MR2A 3EYZA 3I5CA 2I1RA 4HUGA 4FJLA 3SQ2A 4ZVHA 4KTZA 1TAUA 4ED8A 1C1AA 4ZP6A 4IOBA 2AQ4A 4QWDA 3AVJA 2YNIA 4ZTFA 1HNIB 2UVWA 3WNEA 1NK5A 4DS4A 4N76A 4MK9A 4OGCA 5KFTA 1JKHA 1JX4A 2ZQBA 2HNDB 5EWFA 3CFRA 4E19A 5KFIA 1VSLA 2KQ2A 4Z4IA 4RG8A 1J54A 3DLKB 1D5AA 2AWZA 2HNYB 2DPIA 1RBUA 3V81B 4DSFA 1HNVA 2KZZA 2E6MA 1RBTA 3ZT2A 1RTHB 4CGIA 4FJJA 1QUVA 3M9OB 1NKBA 4I2QA 3QGIA 3NKYA 1RNHA 4ID5B 2QKKA 3T5LA 4HUFA 4KB7A 3KLFB 1UAXA 2R8GA 4F8RA 1RBVA 3DLHA 1QAIA 2IBKA 3Q8SB 2HWIA 1TP7A 3PZPA 4RW6A 2GV9A 4I2PB 1FXXA 4FJMA 5DG8A 3BR9A 5F8MA 3O3GA 1J53A 2ASDA 2XY6A 5KFCA 4DQPA 3TAQA 4B9TA 4OLAA 1NKEA 3E01B 2YKMB 2W9BB 4DL3A 4F4WA 3PX4A 3CWJA 3LANA 4IRCA 5KFVA 4RNNA 3G6VA 4FK0A 1TVRB 2IAJA 3OSNA 5DQHA 2IM0A 4NLWA 4ZPBA 3B6OA 4DTOA 3LP0A 4CHOA 3GV5B 4CJPA 3OYKA 2HNYA 1RYRA 1NOYA 5FDLA 2VA3A 2D41A 3VA0A 3HJFA 4DL2A 4CGHA 1GX5A 3ZSXA 1DTQB 3BSCA 3A2FA 3EY1A 4DFMA 4JLHA 5T14A 4M3TA 1LWEB 4I9LA 3PJWA 3UQSA 4IG3B 1U4BA 2E6LA 4IG3A 1RTIB 3OYHA 4F3TA 3KJVB 4ELVA 3DLGA 4CEBA 1LW2B 3OS0A 1GX6A 1SKWA 1RT3B 3OLBA 3KK3B 3I5AA 1B9DA 4DG1B 4ZTJA 1XHZA 4LSNA 3HYFA 5L1IA 1JLGB 1GOCA 2HW3A 4IR1A 1A5WA 2JGUA 4ZMMA 4JV0A 3S9HA 1U47A 1C0TA 1T03B 3BGRA 1JLCB 3CFOA 3LAMA 1BCMA 2FLPA 3HM9A 4TY8A 4CFDA 3QO9A 3H59A 1SL0A 3D45A 2KTQA 3G86A 3HVWA 3L2QA 3MEEB 4WE1B 3TI0A 4DTXA 2JEIA 5KFWA 3VQPA 2XY8A 3SFUA 4DTPA 1CZBA 1RDCA 4KAIA 5DMRA 4KBIA 4RW4A 1REVA 2IA6A 1K6YA 4Z4CA 4LSLA 3V9SA 4KI4A 1IH7A 1IKWA 3IGVA 1SH2A 3NBPB 2O4GA 3AVMA 4E7HA 4K4XA 3FFIB 1RT6B 3QEPA 4KHUA 5KFDA 2UVUA 3ZT1A 1QQCA 4RW4B 1S9GA 3NHGA 4YQWA 2YNGA 5SWMA 5C24A 4DS5A 1NK0A 4L8RB 1C1CA 3ZT4A 2A1SA 5KFZA 3PW7A 4FJIA 5KFUA 1JXEA 1MU2A 3RB4A 3H5UA 4CK3A 3TQ1A 1HARA 4OJRA 3RMAA 3PR5B 4O5BA 2G8VA 4NLYA 4TLRA 1VK0A 1D9DA 2WONA 3NL0A 5FDLB 1L5UA 3CJ5A 1HMVA 3VN5A 4WXOA 2BANB 2ASJA 1BISA 5C25B 1ZYQA 1VSFA 5CYQA 3NGIA 3OHBA 1KVCA 1G15A 4DWIA 1DLOA 3VQCA 2HB5A 1O1WA 4IH5A 4DTSA 4NLSA 4RUCA 3BSAA 2ZD1A 3TWHA 3D28A 4DSIA 4FLVA 4M3UA 3MXIA 1RT5A 3KMSA 4QW9A 4K4VA 2DFHA 4E0DA 4F4KA 4CGFA 3BSNA 1MU2B 4IH7A 5HLFA 3K5OA 5T7BA 1NK6A 3H98A 4O44A 4KRFA 4TY9A 4O44B 2OPRA 4UQGA 1TAQA 4ECSA 1I39A 5KG0A 4DFKA 1RBRA 4DFPA 5FRMA 1ZTTA 4BE1A 1LW0B 2VA2A 1C6VA 3NDKA 3CJ2A 3OL7A 4XO0A 4B3OA 2HHXA 5J2MA 1I3AA 2VWJA 1CZ9A 3SJJA 3VQ5A 2Z1JA 2Z1HA 2WK4A 3DOKB 4NLXA 3KLFA 3V1QA 3KMQA 4BDYA 4M3YA 4FJ9A 4QWBA 2E9RX 4IQXA 1HQEB 1JL1A 1VSJA 3AVNA 5KFHA 4Y1DA 3AVGA 4Z0UA 4AHUA 1VSMA 3DI6A 3GIMA 3RRGA 2X6NA 3HP9A 3LWLA 4NCBA 2QK9A 1TKZB 1S1UB 3LAKA 4OPJA 3OYLA 2PZSA 4IRKA 1ZBHA 1HQUB 3V6DB 5F9LA 1JLAA 3JYTA 1S1VA 3QEWA 2YNFA 3ITHB 1BCOA 4KO0A 2P5OA 4U7CA 5KG4A 2B6AA 4DSJA 2P1JA 3DOKA 4IH6A 3PX0A 4QWEA 4CERA 5KGXA 3C6UB 5KFRA 4O0IA 5FROA 2PY5A 3G6YA 2YKNB 2VWKA 2J6TA 4ED0A 3HO1A 3WNGA 4J9KA 2D0BA 2AGOA 1LWEA 2V4RA 1ZTWA 2AGQA 4C8LA 4F4YA 3DRRA 1BQNA 2V4QA 3T19A 1ZBIA 2CJQA 1S1UA 4CIEA 3SV3A 1KSPA 2XO7A 2DPJA 3NGYA 3OYJA 5KG2A 4PUOB 4DL6A 1VSIA 4CF8A 1SL2A 5J1EA 2G8KA 4ZVEA 5CYMA 3UDLA 1F21A 2DTUA 2R8HA 1BL3A 3KLIA 1SV5A 4NRUA 3AVCA 4CJ5A 4YNQA 3QGGA 5KFAA 2JLEA 3FQLA 4GMJB 2ZD1B 4DMNA 3CIZA 3SQ4A 3C94A 3ITHA 4KHSA 2FVCA 1T8EA 3QNNA 3KLIB 4CJLA 2I5JB 3DLEB 3PO5A 4ED1A 1HYSA 2JC1A 4BWMA 4CFBA 1J5OB 3DRSA 5L9XA 2O5DA 4ZVGA 1VSDA 2IM1A 4LH5A 4CEQA 2J6UA 4WZMA 3L8BA 4K4WA 4CEAA 4RNHA 4IBNA 2XGPA 1SUQB 4BE0A 4HTUA 3VQEA 2FBVA 1REVB 1J5OA 3LZIA 5HBMA 2XCPA 2YHBA 4J9NA 4K4UA 3MFHA 3CFPA 2ALZA 4K8XA 4M3ZA 4CEDA 4CK2A 4E3SA 3LP2B 3MECB 4FZXC 4TN2A 3DM2B 2D5RA 2RPIA 3LALA 1C1BA 4U6PA 1LWFA 2I5JA 4IR9A 4RNMA 5CZ2A 3HK2A 4N41A 4ED7A 3PX6A 3IS9B 1TK5A 2EX3A 2YNIB 4J9LA 4FM1A 2R8JA 4BWJA 1T3NA 3BGRB 3LWMA 1JLQB 2OZSA 2BQUA 4LSNB 1S0OA 1D9FA 3SUOA 4EBDA 1TGOA 4M3RA 1D1UA 4DTJA 4EYHB 3SUQA 4IFYB 3TAFA 4AHCA 1SUQA 4CIGA 2JC0A 4URQU 3HP6A 1BI4A 4IFVA 4TY8B 5KFJA 3AVHA 2IOCA 3UIQA 2AGPA 4C8OA 4IFVB 1XWLA 1FK9A 3NH2A 3TAMA 3NGDA 3V6KA 3WNHA 3ASMA 4WYWA 3AA5X 4CJVA 4GVMA 2RKIA 3F73A 2OH2A 3AA2A 4CJFA 2FJWA 4I2QB 3HVTA 5E41A 2W8LA 3E51A 2V9WA 5JUMA 2X78A 1BQNB 4CHNA 3ZSQA 4QAGA 3ZSZA 4CF9A 4E1MA 1SKRA 1CXQA 1ZETA 2AX1A 4PUOA 4CESA 3OYGA 5KT6A 4DEZA 3AV9A 3UPFA 2VG7A 2B43A 5KRSA 2PYLA 2XWYA 2BANA 4QWAA 4X2BA 3VQDA 2HHUA 1JKHB 1UA0A 2IGIA 2GIQA 3K59A 3BREA 1WAJA 3D0PA 4Y2CA 4NLRA 4CF0A 4FCYA 3DRPA 1YVFA 4JRPA 5HP1B 2FLLA 2XGQA 3AO5A 3NF6A 4AH9A 1T03A 2WCXA 3OLAA 4M41A 3RB6A 4CEEA 3THVA 4NLPA 3H2LA 4GW6A 4WZQA 3NAHA 5SZTA 1L3VA 4ZP7A 3ZCMA 3HPOA 4BACA 3AVAA 4ECXA 4FK4A 4DQQA 1JL2A 3FFIA 5DGBA 1IKXB 1RDBA 4DFJA 3SNNA 1RTHA 2IM2A 2GBZA 4B8CA 3PUFA 4OLBA 3RR7A 1RT4B 2XI3A 5KFEA 2C2DA 1I6JA 1JLCA 3OYMA 5HROB 5JS1A 3G10A 3BSOA 1RT1B 2VG7B 4NCAA 2UVRA 2OPQA 4NLTA 4Y1CA 4FM2A 1RT2B 4HHTA 2QKBA 4Y2AA 1LW0A 4DL7A 1EX4A 3RBDA 1TK0A 4KE5A 2HNZB 3GQCA 2E9TA 3TANA 4K4TA 2R2SA 3QESA 4OVLA 4FBTA 2EC0A 3IN5A 2BGGA 4ZPAA 3OYEA 3GYNA 5I42A 3V1OA 3O4QA 1KFDA 5I3UB 1A5VA 2W9CA 3OYFA 3TARA 2HHQA 1L3UA 1C0TB 3V1RA 5KGWA 2FVQA 3GIIA 1TQLA 2KFZA 4CJWA 3LPUA 2O4IA 1CXUA 4LY7A 3ZT0A 2HNDA 2OPPB 4GC7A 2GUIA 1NK4A 1RTDB 4ECZA 4TQRA 1NK7A 1C1CB 3LDSA 4RUAA 4FXDA 5F8JA 2E9ZA 4H54A 1LWCA 1KLMA 3VQ9A 3OYAA 2IJNA 3L3VA 5DQIA 1LWFB 3CM6A 3AO3A 4PA1A 1NOZA 2B5JA 5C24B 1T05A 2ZE2A 4MH8A 3UR0A 1S1TB 1EETA 2D0AA 4RW6B 1S6PA 4G1QB 3OSPA 4CK1A 3KHLA 3K5LA 1NHVA 2YV0X 1IKYB 3PVXA 2OA8A 4RW9A 3AVKA 2C2RA 1DLOB 1RCHA 2KFNA 3RBEA 4JV1A 2ATLA 4IKAA 5CYQB 4FLXA 4Q5VA 4MIBA 4ZHRA 4M95A 5KG1A 4ECTA 3RB0A 1S10A 4C8MA 1D8YA 4O3SA 4O3PA 1WSHA 1SH3A 3MEEA 4CEFA 4EZ9A 4HVJA 3AVFA 3DLRA 4ID5A 4F2SA 3CJ0A 1HYZA 2FVRA 1C1BB 4CJUA 4DQSA 3SUPA 4OKJA 1X9MA 2IM3A 4Y34A 1LAWA 4Y3CA 4ECQA 1KLNA 3FRZA 5J2QA 4GC6A 3AO1A 3TR8A 2P5GA 3JSMA 2D0CA 5L1KA 3V4IB 4ZVFA 1TKZA 1UOCA 4Q44A 3TABA 3KOAA 4CF1A 1QE1A 2WOMA 4W5RA 1X9WA 3NBPA 1TKXA 5I42B 4NLUA 4RW9B 4XIUA 1XR6A 3L2UA 3IS9A 3RWUA 4R8UB 2LSNA 1JLEB 4DSLA 3DLKA 4DLGA 4CHYA 4ZPCA 4F4ZA 3H4BA 3IGNA 2WONB 4FYDA 3G6XA 3MR3A 4CJEA 4WYLA 2C22A 1KCFA 3HVAA 4DTUA 5CZ1A 3DMJA 1RT1A 4CGGA 5KFBA 1ITGA 1RBSA 3M8PA 4FLUA 4DTNA 4B3OB 1DTQA 5KFPA 1QTMA 4J2DA 4DU4A 3NF7A 4RW7B 4W5TA 1S49A 5DK5A 1QSSA 4W5NA 2R2TA 4RW8A 3HPHA 2OPPA 4FJKA 1S9FA 3KLGB 3KHHA 3V9XA 4QCLA 4QW8A 2G8UA 4DU1A 4FZZA 1U45A 4E1NA 3NAEA 1BIZA 1GOBA 2YKMA 2W9BA 5C5JA 2R8KA 4FLYA 4NRTA 2BRKA 5F8LA 1C2PA 3QIPA 4ED3A 2YNGB 4NYNA 3T1AA 3QINA 3HVRA 3Q8PB 3SQ1A 4EYIB 3OVNA 1VSKA 5DGAA 1Z25A 3CO9A 2YNFB 2BE2A 4R8UA 3V6JA 3L2RA 2YKNA 2XI2A 1IM4A 3QIPB 3RRHA 4IG0B 4B9SA 2B4JA 1TKDA 3KTQA 1N6QB 3OYDA 4JRQA 1FKOA 3KIOA 3OJUA 5K14B 1Q9YA 3O4NA 1JIHA 4KAZA 3PHEA 1KTQA 4FM0A 4KV8A 4RW7A 4KV8B 2D7SA 4CGJA 4HCCA 2YHAA 3BDPA 4KKOB 3HVTB 4HKQA 1B92A 4M3WA 3CDUA 1S9EB 3JSMB 4CJ4A 1RTIA 1GOAA 2JEGA 1LWCB 5HBMB 3PW2A 5HROA 4ZP9A 2Y1IA 3U3YA 2ASLA 3BJYA 3OS1A 2Q3SA 3ALYA 2BR0A 3PW5A 1VRUB 1BQMA 2UUTA 3ULDA 2VG5B 3CYMA 1TK8A 3ICLA 4KTQA 1JLAB 1RDDA 1S97A 2BDPA 3H5SA 3N6NA 4CFAA 3HPGA 5JXSA 1KFSA 1TKTB 2G8WA 4CHZA 3I0RB 4M42A 4PY5A 3QEXA 3OYIA 4CHQA 1QS4A 2Z1GA 1W25A 3LP3A 5KFLA 2GC8A 4EO8A 1J9AA 5DQGA 4TYBA 1RTJB 1N4LA 3TAMB 1ASWA 3ZSOA 3TAPA 1NNDA 4ZPDA 4WXWA 2R2UA 1RT7B
chains in the Genus database with same CATH superfamily
3G8TA 2R8IA 2HG4A 4CZHA 3QFUA 2EBEA 5LT5A 4DR5F 2VZ9A 3SEOA 4B3TF 4MLEA 1X9SA 4WKYA 3Q7BA 1RDAA 4M45A 3DLLQ 4KO0B 3VQ4A 4GRSA 5JVGQ 4DZ6A 3ZYYX 5A6PA 3KLHB 3U7JA 3V6DA 1IR1A 2MKCA 3CD5A 5LXRA 3SIPB 2ABYA 5D0GA 3S3NA 5HRRA 2XHBA 2LA4A 3T5JA 1P27B 2ETJA 2DK2A 1JLFB 1LV5A 2UVVA 4O3NA 2XULA 2XC9A 5K8MA 3I0SB 1R89A 3ZZRA 3X1LB 2RE2A 3FCHA 3V6HA 2NREA 3VPZA 3TJ8A 3EL2A 3FR0A 3P45B 4BR7A 2QLWA 3IG1B 2ASPA 2EHGA 1HQ2A 4ICLB 1UVLA 2IJRA 3IBWA 1L3TA 1F9EB 1UVNA 5KG6A 1S1TA 2K1RB 3I8BA 5KFNA 3E66A 2YCHA 4X65F 1WSFA 3GJTB 2ZOFA 2V8PA 2HS0A 5CAAA 4H0XB 3QAUA 1JMTA 4ZK7M 4OKKA 3S3OA 1CSJA 2QW9A 2HIYA 4FKYA 4PQUB 3VGUA 5AXKA 4FJHA 4MO5A 4MK7A 3ZTPA 3SLCA 3A3OB 4KPCA 4HUEA 3CJKA 2O8CB 3TTFA 3KUGA 3SI8A 3CJBA 4Y28C 1UZDA 3FEZA 4JBCA 1S1WB 5AE1A 1U48A 1RSCA 4KB1A 4LF4J 1NU0A 2A10A 5JMNA 3T3FA 3O4WA 4WK3A 4CECA 4BROA 2VGMA 2YWWA 1OH6A 1RHUB 1DJ0A 1X3NA 3J80U 3MMJA 4BC9A 2DVIA 1RQ0A 3BQ1A 3CCMS 2UUAJ 2OPQB 3M1VB 3CMAN 3DHXA 3H5XA 1NMEB 5AQKA 2JFDA 2XMMA 1KAZA 1U6ZA 5F8GA 2W4PA 3CTRA 3KG0A 3NWGA 3KDNA 1JLBB 3N0VA 4YORA 2QFIA 5AQPA 4OI3A 4MJKA 1T94A 2DB1A 3DRPB 1YDLA 4H5NA 5DM6L 3AOAA 4LF5K 4A61A 3VF6A 5A8WB 4B1XB 1R59O 4KBOA 5HRPA 1IWGA 1YJUA 1OH7A 2IJFA 3BZQA 1E6VB 3MN9A 2GUPA 3M2UB 2A2DA 4MAKA 1GMWD 1S9EA 3E9PA 5BRDA 4DXLA 4F0KA 3FZLA 1T02A 1MMLA 2C1EB 1NBWA 4H0TB 4DHYA 4X62J 3M7VA 2QXFA 2XCAA 1WC4A 2RDJA 3A3PB 3A0IX 3CW2C 1UFKA 3VEYA 3J7AP 1HJRA 3TA1A 3NF8A 3HT0A 1VIXA 5LMUF 2XLKA 1JLGA 1AZSB 4JI6K 3G8QA 5DLGA 2MLXA 4KFBB 1HBMA 3EWGA 4IO1A 2HHWA 4USWA 1S6UA 1S12A 4DR2F 4RPFA 3J7YP 3HRGA 3ATUA 4YOVA 2YH0A 4IFYA 3N4WA 5KFXA 4OGEA 3M30A 1YXQA 2DISA 2OI2A 3AH6A 3AOBA 3VQ7A 1XMQJ 4UOGA 1HNWF 1RWMB 1ZBLA 3VAJA 5CD4A 4NL5A 4AXIA 5BR9A 1R0AB 3QZ8A 3MEGB 3N01A 3BZKA 1RXOB 4WFBQ 3VV2B 4NXMJ 1JLQA 3L2WA 2HAIA 2E7VA 5TKWA 4DMZA 1VBZA 3N6LA 2OPSB 1P1TA 4B1UB 2OYQA 2IBOA 1XR7A 4YP3A 2XMTA 1VMBA 3OL9A 1MROB 1WG4A 4NWBA 3LZJA 2P5VA 3O5TB 4HL9A 2GO9A 1VQ8S 1TVRA 1EAYC 4IO8A 1EZZB 3AY0A 1JLEA 4BY9C 2DY1A 4OYOA 4LD0A 4Z4GA 2RN2A 1RDRA 1JXBA 1MA9B 2W42A 2EFQA 5J2PA 4E7LA 4DI6A 3CGIA 3ZZ0A 4IKFA 4AXJA 4F25A 3UE2A 2MZRA 5BR8K 1XNRJ 3VETA 1VK8A 4C8KA 5B0CA 1SS6A 4QWCA 4JYAF 1T6DA 3TVKA 3MEDA 4CH7A 3KDOA 4YDUC 3CJ3A 5F8IA 1VQ9S 3NE6A 1R8PA 1WEYA 4YHHJ 2JLGA 1X1PA 1Q7YO 2CQ2A 2G8FA 1VQSA 3MEDB 1VQ5N 1UZHA 3P49B 2CQBA 5CZXA 5B0GA 3I56S 2ZZMA 3UKRA 2KM8B 3HHKA 2ZJPQ 3TAEA 2O8DB 3K58A 4CVNE 1MN7A 4CLLA 5H1SQ 4FPIA 2DNOA 2PFUA 4BRIA 2VG6A 3G96A 3EXCX 4K4ZA 2AJFE 3SFGA 3VQ6A 3UKRB 5D3GA 4FLTA 4I1TA 2FC0A 3CCES 3QATA 1VAZA 1X9JA 3MX5A 4RZRA 4YR2A 3C7NA 4F0HA 3PYGA 4NA2A 3KD1E 4OI0A 1G1XA 1AZSA 3TVZA 3CJ7A 2V2VA 1XMOF 5AZIB 2G2YA 4HLBA 2MZ1A 4L75A 3L09A 4ID1A 2PDAA 1RBOB 1SJRA 2V0NA 2OTJS 4OPKA 2BABA 4B3MJ 5RUBA 3CCRS 1VQOS 4B08A 2HHVA 2RS2A 2E5GA 4AYBD 3KK2A 3A8YA 1NDLA 4J9RA 1NJYA 1SKSA 3EPGA 1SIWB 2D9PA 2FVSA 1WC6A 5KG5A 5JS2A 1K1QA 4JI1J 3K57A 3LL3A 3AQOA 1VQPN 2R7RA 4KR0B 3AXMA 2G1DA 4Y2MA 2W24A 2PFDA 4KKOA 2QEXS 1MG7A 1R8HA 1GLFO 4OJ3A 4NCGB 4ZCLA 1WSIA 5I3QA 4ICLA 1TL1B 3QGHA 2P51A 3O9UA 2QL9B 1IBKJ 4OL8A 1X5OA 2DFEA 4NASA 2CKWA 2IMWP 2O8BB 4NLQA 4RBTA 4NLOA 1VS3A 5LOQA 3VQSA 2B5JB 2W9AA 1X4DA 1TUWA 2XSFA 5JJBA 3NEKA 1UP1A 3FCVA 4F2RA 2UXCK 4DG1A 1GMWA 3VMFB 4C6AA 1B0VA 3HLUA 4QYRA 5E3AA 2DXEA 1XMQK 2ZHBA 2PI4A 5AE2A 2B4OA 2MJNA 4H4MA 4URSA 5K14A 2C3MA 4WFBL 1GH8A 1HW9A 4A57A 5EDWA 2AZ1A 1T9VA 5J2QB 1ATRA 2W6LA 3W3SA 3I4PA 3HFKA 4RNFA 4KH5A 1HNXK 3PY8A 2MKSA 5KFQA 1J27A 3AO4A 2VQFF 1NG9A 4Q8EA 4D3HA 4P73A 1VQNS 2RHSB 3NG8A 3QNOA 2M8HA 1Q78A 3M8QA 4XPCA 3FGVA 3D5MA 2WVEA 3ZSYA 1NPRA 4PKHA 1YBUA 4JEPA 4O8KA 4H4OB 3EVWA 3SAHA 2I38A 4B1YB 1K1SA 1LAVA 3OJSA 2E44A 4CH1A 2NQPA 1FWKA 3D6MB 4HYKA 1HNVB 2BKNA 1ZBTA 1JLBA 3U9DA 3OW2R 2F4VF 4IDHA 1YLXA 2YWKA 4NXMK 3IP0A 3ZZYA 1RAOA 1XMOJ 3L4BC 2OFHX 4RNOA 2CNOB 4DV3F 2HNZA 5D15A 2A3JA 5KTQA 3I31A 4FJ8A 4ZJQA 1S4FA 3PV8A 4K0KJ 1E3MA 1P9QC 1H38A 4OZ3A 5D0RA 1TL7A 4FYVB 4U67L 4DV0J 3DM2A 3PSFA 4B17A 4O3RA 4HTLA 2MGZA 3OBWA 1RWVB 1SBRA 1V4TA 4DV5F 2GX8A 2RDIA 3WNFA 2KKZA 2YKPA 3I87A 1ULRA 4CJTA 1RA6A 2LP4A 2DNMA 3TTCA 3AT1B 3AB2B 1S6PB 4ILGB 4C97A 5H9EK 4QIGA 3BGFA 4ES2A 1KS2A 4LRDA 3T1YJ 3DRYA 4XH1A 2YI1A 4NYZA 1E6YB 3RAMA 2RRAA 2QLFB 4DPUA 5AQYA 1A7GE 2FBXA 2GMHA 2Q43A 3G87A 2ZH3A 2V52B 3LP0B 5D4NA 4JI6F 5EOYA 1M1KO 3ET6A 3NVMA 4C11A 3BY5A 1TL1A 4UF4A 3SXLA 4BRQA 3HSZA 2DH8A 3O08A 3HHLD 4LFCK 4XH4A 3O8WA 3EYZA 4FJLA 4OYMA 3SQ2A 2O8EA 2E1MC 4ED8A 1MDUB 4L3QA 2DHXA 2AEJA 2ACYA 1WDDA 4QWDA 3AVJA 4ZTFA 1H6KX 5LJWA 1QUPA 4F04B 4C1NI 1VQ7N 4OGCA 5D0HA 5KFTA 4LMZA 1CQNA 1HX1A 1J6ZA 3SAFA 3M2VA 1IM6A 2VFSA 3ZZZA 5H9FK 2HNDB 3MM6B 3JXUA 1HNWJ 2ZJQQ 2KQ2A 4UOFA 1J54A 3DLKB 5IV4A 4OZ0A 5JICA 1IJEB 3ZT2A 1RTHB 5BN8A 2CJXB 2OJ3A 4FJJA 4U7BA 2NXJA 5B0AA 2FZKB 3GJQB 3MMVA 4ID5B 2DGXA 4HUFA 3KLFB 3DGVA 3UI3A 4QR1A 1OYDA 2GV9A 3FEXB 2QLBB 5DG8A 4M5JA 2M5YA 3AGRA 1J53A 3TA0A 5EGYA 3JAMO 3TAQA 1QVGM 4B9TA 2UXBK 4AFFA 3KK7A 4NPOA 1NKEA 2F5GA 3E01B 4DL3A 3OPKA 3NY0A 4F4WA 1HFEL 1T0TV 4ILHA 3LANA 2VYPA 4DJBA 1P90A 4FK0A 3OBYA 4X64K 3Q89A 2HGLA 2IM0A 3LP0A 5HL7L 2G13A 2D41A 4CZGA 4LF4K 4X4VA 1RKIA 3TJ9A 4CGHA 3DKDA 3RG6A 1ZZFA 1O13A 2J0QD 4M3TA 3PJWA 3R2DJ 4IG3B 4OX6A 1EB0A 3QWPA 1JCFA 3HBTA 2HFVA 1P8ZA 4M5HA 4PL7A 3OYHA 1VQKN 3UFCX 2C2ZB 3KJVB 4CEBA 2Q2RA 2P9UB 4QZVB 4BRLA 1WF1A 5A0YA 1RT3B 5GADU 1URRA 2WVBA 2YQ0A 4DZDA 2VQEF 4QR2A 2RH3A 3I5AA 2KKHA 2NRXA 1XHZA 4LSNA 5CE3A 1N0UA 4FNIA 2UUBF 2P9PB 3B4MA 2D4WA 3E1YA 4CM0A 4JV0A 3EEQA 1HBNB 2DBBA 4J91A 4BRCA 3BGRA 5LY3A 3CFOA 1NDPA 2FLPA 3HM9A 2FPHX 4WJBA 4CFDA 3H59A 1YGYA 1SL0A 3C16B 4M5DA 3G86A 2HFZA 5HVFA 2NZTA 3I55S 1TR0A 3IUCA 5KFWA 1PC5A 1Y11A 4DTPA 4L74A 4J90A 4KBIA 3MM6A 4RW4A 2CQ4A 4LF6J 2IA6A 1TUVA 4LSLA 1IH7A 1LWXA 1IKWA 3NBPB 2WSFC 4E7HA 2CPXA 5C2DA 4DV7K 5AQHA 4G9ZA 4KHUA 5KFDA 4QIWD 2OO4A 1WC5A 3NHGA 1WDTA 4AL5A 2XMJA 5C24A 4DS5A 3GB0A 4ILMA 5HQ8A 3ZT4A 2QG9B 2VV5A 3SMPA 1DKGD 4FJIA 5KFUA 3M32B 4HT7A 5LXYA 3PR5B 3NNAA 2DITA 2Z2LA 1VK0A 3MCAB 3I4HX 3ISZA 5TKYA 3MOZA 4CTAA 1L5UA 4CI6A 2PEBA 2AIRB 3CJ5A 4JI4K 3MM9A 1X0PA 2BANB 1RP5A 2BX6A 1Q95G 4X64F 2DHGA 1UL3A 4BHQA 2CYYA 4ES1A 4U7UK 2V8DA 5F0XA 2YH1A 1KVCA 3H46O 1WUAA 3FUYA 2ASOA 4DV6J 3SQGB 3CETA 5GADP 3TJAA 6AT1B 2DR8A 3TWHA 3D28A 4CJ7A 1N32F 4RBUA 4M3UA 2LQ8A 1T3OA 1RT5A 4YB6A 2ERRA 4C9DA 4BR0A 3QFPA 4E0DA 4HHJA 4F4KA 3TX0A 3EUNA 4F9OA 4DV4K 4CGFA 2ROPA 3BSNA 3I33A 1MU2B 1ZM3A 4IH7A 1PC4A 3EVOA 4DR7J 2JX2A 1VC0A 3M6WA 3GSDA 4O44A 5KPRA 4QS9A 2OPRA 4UQGA 1OSDA 1I39A 5FRMA 1ZTTA 4DV0F 2ZH1A 2CJAA 2FC9A 1C6VA 1UEKA 4JI3F 2HHHK 2EWHA 2MPUA 2AW0A 2PE8A 1CZ9A 3SJJA 3VQ5A 2Z1JA 3QB0A 2WK4A 4NXNJ 4R25A 2QMUB 3V1QA 4BDYA 4M3YA 3PEHA 4C2MA 2E9RX 3PRDA 1GLBG 2NRTA 3AVNA 2DGUA 1TMMA 1WHXA 1VSJA 2WVCA 4Z0UA 2Z56B 2X6NA 4FOEA 1BDGA 2QK9A 4MO4A 2Y3YA 3HHEA 1NJIO 5F3TA 1ZBHA 4C23A 3C15A 2WTUA 2NZCA 3QEWA 2YNFA 2OP5A 3QRPA 1YRUA 1K9MO 1H7WA 4DSJA 2A41A 1HBNA 2K7KA 4PG5A 4CERA 4OFZA 5KGXA 2PY5A 3ENVA 1FXLA 4B3MF 3HTVA 5G4DA 1WOOA 3WNGA 4J9KA 2DHSA 2V4RA 1DGKN 2KU7A 5M2PA 2QX0A 2UUCF 4C8LA 3DRRA 2V4QA 5JVHQ 1VQ9N 4CIEA 3H8YA 2XMVA 4PUOB 3JB9k 1SL2A 1UMJA 5MLCQ 3UDLA 1BL3A 3KLIA 3I56N 1NJIT 2N7CA 1HI1A 3F2KA 4CJ5A 1HBOB 2YKOA 1TZ0A 4X62K 1Y5IB 3LDNA 4HVZA 2AJ2A 1Q81O 3QNNA 3KLIB 4PXDA 1EWRA 3PO5A 4ED1A 1FNOA 2DYAA 1PCAA 2P9KB 4K0KK 2O5DA 3CMEN 4X4RA 2IM1A 2HF4A 1G6BA 4IEEA 4IBNA 4AQYK 2BUPA 1WORA 3I55N 1YJRA 2DNNA 2EVZA 1J5OA 1GK8A 3D1OA 2YHBA 1OO0B 4J9NA 3CFPA 4M3ZA 1HA1A 2QL7B 4CEDA 4ITSA 2GJIA 4E3SA 3LP2B 2D5RA 2ATCB 3TX8A 4RNMA 5CZ2A 3W65A 3S1TA 3WXKA 4ED7A 2YNIB 5EN1A 2R8JA 4BWJA 1QLNA 5MLCV 3H3OB 2B4UA 4LSNB 5BJRA 1S0OA 4DUZJ 1JXVA 2B56A 7AT1B 1YAGA 4C0OC 1H2VZ 4V19J 1URNA 4DTJA 2G0JA 3SUQA 1U8WA 2LMIA 4HDGA 4IFVA 3L95X 1FK9A 3NGDA 3CJSA 1X4AA 1X8DA 3DDNA 1ZXOA 2Q66A 4YB7A 4CM2A 2RKIA 1NH8A 2OH2A 3S6EA 1OQ6A 3GFYA 3AA2A 4DCJB 2AP6A 3HVTA 2BJ8A 5E41A 1RBLA 4O5FA 2HK3A 5JUMA 4A5BA 3SBGA 4YUDA 2X78A 1FJCA 3QQCD 1XQIA 1SKRA 4DR1J 2CQ3A 4E8UA 2HQFA 1CXQA 4PUOA 4CESA 3OYGA 3MM7A 5KT6A 2GEMA 3CPEA 3GG0A 2B43A 2EPIA 2GVZB 1DURA 3UNYA 4Y2IA 4CLPA 3BREA 2IRUA 1AT1B 1OY8A 4FCYA 5F0UA 2HFUA 2KT3A 3SCJE 1U0SA 4DV3J 2CPIA 1YVFA 4ZDNA 4AQYF 2LFVA 5HP1B 3ZZOA 3M8ZA 2H65B 3BN4A 3NF6A 4K0KF 4TVAB 3OLAA 2R7UA 5DRKA 2MTLA 4ZP7A 3NGTA 2XLIA 3HPOA 4P7TA 3AVAA 1PYTA 3QT8A 3IMXA 1TL5A 1IKXB 1XBWA 3DXMB 1RTHA 3W5XA 8AT1B 5E3PA 2VC1A 5BYRA 2M52A 2C2OB 4AE5A 3J81U 4OLBA 2CG8A 3MMBA 5KFEA 2M9KA 1JLCA 1J5EF 1NMNA 3BSOA 3LM9A 4NLTA 4Y1CA 4FM2A 2NUUG 1OQ3A 4CLKA 1U1PA 4Y2AA 2RQMA 2E20A 2PC6A 3IR6B 1FW6A 2HNZB 3GQCA 2J9DA 3TVYA 4BC3A 3R7NB 4ZPAA 3OYEA 3M8YA 2Z0GA 1KFDA 5E0OA 5GAHU 4U7UD 4LR8A 2I6WA 3TARA 5FPEA 2LEAA 3C14B 5KGWA 4X66K 1YZ6A 2FVQA 2YKAA 1TQLA 4C3KA 4B1VA 3LPUA 1CXUA 3ZT0A 3MMCA 1RHRB 5AQMA 1GLAG 1NK4A 3PHTA 1RTDB 2MLZA 3DNCA 2CZ4A 2HAFA 3DU6A 4C11B 2F1FA 1C1CB 3OFGA 4NO7A 4H5WA 3HHLA 4I64A 1VRQC 3TUJC 1LWCA 1UJ5A 3VQ9A 1K47A 2IJNA 1WUUA 3IFRA 4OJHA 2LXIA 1HBOA 4ATNA 1T05A 2ZE2A 3UD4P 3HHNB 1EETA 2O3DA 1S6PA 4K7QA 3C14A 2WAQD 2LXFA 2JL9A 3KVGA 3R8EA 2RIJA 3NOCA 1OPIA 2ZGYA 1Y10A 2C2RA 5AZJA 4L72B 3R3TA 3CC2S 4CO0A 4LFAJ 4IKAA 3HD2A 1Y9OA 3VAKA 4Q5VA 2HBZB 3MDFA 4M95A 4ECTA 3ZNUA 3RB0A 4JI4J 4AD6A 3QBCA 1WF2A 4O3PA 3F56A 1SH3A 3OUYB 2HFNA 3AVFA 4JI5J 4Q2MA 5EHHA 2CQ1A 1HYZA 4DR6F 4U8VA 2COLA 2EXUA 4DUYF 1C1BB 1WOQA 5HL7Q 4Y34A 4Y00A 4Y3CA 5AQTA 4CH0S 1NZ8A 2ZH2A 4CZEA 3DLJA 3ID6A 3EGZA 5B8HA 4ZVFA 2PAVA 2MY7A 3TABA 1LK7A 2WOMA 2QA1A 1X9WA 3NBPA 1TKXA 3NNHA 1FWPA 4YY3K 4RW9B 2KJWA 2IYGA 2HLUA 1PGZA 2ZWPA 2LSNA 4YOYA 4H0YB 1UJ6A 1YF5L 3H4BA 3VEVA 2I7PA 3MR3A 3GG4A 4WYLA 3ZNJ1 5FD1A 2HBLA 5HMYA 2VCPA 1ITGA 1RBSA 4FLUA 3BEGB 4YEAA 5KFPA 1QTMA 3MEKA 3JQJA 4OJGA 2C2MB 2HFOA 2DKOB 3UCZP 1R0BG 5GVQA 2R2TA 4RW8A 2GZOA 4FJKA 1VQ4S 1S9FA 2QSFA 3CCUS 3KHHA 1ELOA 4QW8A 4QCLA 4DU1A 4FZZA 1N32K 3NAEA 1GOBA 2V51B 5A2QU 4UY85 2PA8D 4ISFA 3V2UC 4P74A 3QIPA 3PYDA 4ED3A 2YNGB 1D09B 2PN6A 2Y0SD 4CTAB 2FHMA 2O67A 1RWWB 4I0WA 1QY7A 2IVFB 1R8AA 5CZVA 2KXNB 2R7TA 2DNPA 2JVOA 1T6CA 2FSNA 4IG0B 2OGUA 3ZX0A 4OYXA 4ZIVA 2CJKA 1YSJA 1FKOA 4FWOA 3VEZA 3OJUA 1WOSA 5M1OA 3D67A 4KAZA 1KTQA 2Q6BA 1X60A 1R6VA 1GTEA 2D7SA 1VQKS 4X64J 4KKOB 1FDBA 1TYQA 4M3WA 3HZEA 3EMTA 1Q8KA 2A6AA 2Q6CA 3C2PA 4B3RF 1SQEA 2Z57B 4JD2A 1M5SA 1YJWS 2QA2A 2DH9A 1LWCB 5AXMA 2KRRA 1N5VA 2BOPA 3EVMA 3H90A 3OS1A 1FVQA 1R31A 1U6BA 1LXJA 1BQMA 3TQEA 1PG5B 2ZGZA 3C15B 1RDDA 3NMUA 3GMGA 3HPGA 4BRPA 2G8WA 3J80O 5AFUH 4M5NA 2JLFA 3I0RB 4M42A 4ZCMA 2V8GA 3LF0A 3K8WA 2Z1GA 4NX9A 5KFLA 1U1LA 2GC8A 5A6WA 3JS6A 5ETQA 2E5LJ 2ZJPL 2JZ5A 1ASWA 1AFIA 5H9FJ 1NNDA 2DGVA 4ZPDA 4GV6A 3MURP 2VQEK 4G6VB 3C6UA 3IC1A 4DR7F 4I2PA 1B99A 2H4WB 1GLCG 2VDHA 3BN7A 3E9OA 3THXB 5ETTA 4I7FA 1WOPA 1HJOA 1VSHA 4JI7K 1X0FA 3MM8B 4M5GA 3U6FA 3U3GA 5AXNA 3CVKA 4UUWA 4MQ3A 1XMQF 1IG9A 2I8EA 5E33A 3CJRA 3I9V9 5ADZA 4NCGA 1S0MA 1KVBA 2RQCA 1K0TA 4PPDA 2M7SA 4CJRA 3VVTA 2FXUA 4H0OA 5IT9U 4B02A 1EQYA 1HNZJ 1LCUA 3EICA 3A12A 3O44A 5MAOA 1V3SA 1S1WA 3GLJA 1VC6A 3N6MA 4O4RA 1KQKA 4O4GB 4K4SA 2UUBJ 1SJQA 3Q23A 3VQ8A 4RJVA 3BYPA 1NAQA 3DRRB 1IQZA 4ER8A 5HRNA 2AU0A 5HLFB 2RILA 1F60B 1K73O 4DR2K 3ETOA 4B9LA 1IBMJ 3R5JB 4DR4J 2IFXA 3FCWA 4HDHA 1HKAA 2V50A 5L1LA 2FJBB 2HBQB 3L3UA 4LH4A 3T5HA 3B6PA 2QV6A 3CDWA 3PO4A 1N52B 3OL6A 1W26A 3GG1A 3ZTSA 2G8IA 2VG6B 4AUKA 5DDPC 3V9ZA 4CLYA 3DDKA 1S76D 2HS3A 1GT8A 3H4DA 2VBXA 4P2XA 4IXCA 1VGYA 3KD5E 2QO3A 3TW0A 4LF8F 3EDQB 2OMLA 4KFBA 4KTWA 5F9NA 5C2FA 2P9GA 2E5HA 1Q7YT 1GNKA 2V8VA 3ZX3A 4BREA 4LJMA 1XHXA 2CPEA 3CULA 4FJGA 4ZPWR 5IWAK 2HGMA 1PAUB 2OLWA 1NBEB 2ZBRA 5ETSA 1F5CA 4ZOSA 2ZKTA 1KLMB 1EHWA 3MMBB 2RVJA 4ZS6A 2YWEA 4JI7F 1BIUA 2U2FA 2J4RA 2N82B 4BLGA 2GV1A 4QYZK 2ZF5O 3WEEA 1FF2A 3TZWA 3LTOA 1UWAA 2UZAA 3FBBA 4ILRA 4PWDA 3NMAA 2CQIA 3CIPA 2XB2D 1I94J 1PO6A 1IBMF 4G65A 2AYGA 3RMDA 3GE9A 2UXCJ 4QS8A 4QPXA 3HMJG 3QWUA 1RWOB 1NB7A 9ATCB 1EJ7L 3K2YA 1A6LA 2BM1A 5CY4A 2DFFA 1R0AA 1IO2A 4ZLNA 3K5MA 4NLDA 3RU0A 2BH1A 3EZWA 4DUYK 5ETNA 3PFOA 4NLGA 2JEFA 1E4GT 3CE8A 1B9FA 4U67Q 4DSEA 4KC5A 2N3LA 3HL8A 2UP1A 2FJVA 2QMWA 5CABA 1BGXT 3QO9B 4R5PB 4B3TJ 2AV5A 3OUYA 4YMEA 1WWHA 4YN3B 2JJ4D 4DL4A 5JVGL 3MXHP 1M5PC 2MKYA 1HYSB 4TLQA 1IKVA 3M8SA 4CZMA 3P38A 4OX9J 2YKQA 2K3KA 1NLVA 1SVDA 4EFHA 3UDCA 3CCJN 5T41A 1WD6A 2WB4A 1KHVA 2LA6A 1Q8IA 3OFFA 2XYGB 1QTNB 3MM5A 3QMLA 4GKJJ 2F4VJ 2JNJA 4BVPA 1S77D 5I3PA 1YUWA 4JV2A 1N34J 2HZAA 2EWSA 2R2RA 1FRIA 3IAYA 3FSYA 4KREA 5HAOA 2ZE2B 1W2IA 3O3FA 2F8EX 4IDKA 1FWLA 2GQQA 1M1GA 2FLNA 3AVBA 3DYAA 1Q82O 4TSXA 2ITMA 3AY9A 1SQGA 2IAJB 3MAQA 3AA3A 5M2UA 1FEEA 3CD6S 4IWVA 3DHWC 2AEFA 3OXFA 3GV7B 2FBYA 4I6MB 2IVMA 5AQVA 5DS7A 1PSDA 2J6SA 1HHQA 2XY7A 1SJ1A 2DR7A 3EZUA 2MSTA 4YOXA 4NA1A 1KRPA 2PGCA 3W8PA 3V5RA 1YTYA 3TA2A 1XI1A 3M8QB 5EUHA 4BRNA 4DU8A 2ZBPA 4KGZB 4NZ0A 1Q9XA 4R0JA 2P9NB 1Z05A 1PJ5A 4QOZB 1ZA1B 4RUBA 4ISEA 2QE5A 3W66A 3HX9A 2ILZA 2DY4A 5IT9O 3P39A 4DCOB 1EETB 2OCEA 3KHRA 4FWKA 4B9UA 3WEEB 1HNIA 3DLEA 3SI6A 3NP5A 2Z4PA 4EI2A 4J9MA 2JRSA 1SQKA 2EFGA 4DN9A 2CVIA 2AJQA 3KJVA 4R5PA 3DRSB 1H7XA 2MEWA 5D3GB 2P9EA 3UN5A 4ECVA 5EVZA 3PR4A 4WQ5C 2X1FA 1BUXA 5DDOC 2VOOA 2Y1JA 3R5AA 4YR3A 3RW6A 2DIUA 3VVUA 5HK4A 5IM0A 4GKKF 2HVZA 4W5QA 3GR1A 3MF5A 4CZLA 3O6QA 4E7JA 1V6HA 4M1KA 1N6QA 4Y65A 3OFEA 4GV9A 2FJEB 5HMXA 2PIIA 1SQFA 3M05A 1W9HA 4GVBA 2QRRA 3NOGA 3GR0A 3NH1A 2GJFA 4EMDA 3A1YG 5CCLA 4IDKB 1FK9B 5FLXO 3Q86A 3AJ2A 5AQLA 3ZSRA 2B6AB 3OTOK 4N77A 4CJQA 1QVGR 4LQ9A 2HLTA 4LF1A 4WTOB 3H3NO 3HKWA 3H5YA 2B3TB 3KK2B 3CJQA 1ICEB 3A8KA 1DTTA 4DV4J 1LQ9A 2KG1A 4MTPA 1T7PA 3ULEA 4AL6A 1YI2N 2WVFA 1XR5A 2IC3B 5AQOA 2OZMA 3SSSA 2BJDA 3EX7B 1R8CA 3KNAA 5CYMB 4OHXA 4K25A 2VL1A 1SIZA 1NK8A 3MK6A 5L46A 3QZ7A 3ENOA 1X4BA 3BGUA 2HHHF 4QU7A 4G3IA 4NEYA 1HWUA 1RDWX 1Q81T 5BPNA 5J2MB 4LF5J 2DO4A 3QMQA 1W7WA 3BQ0A 2W7PA 2F8MA 4TYAA 2VFTA 3LA0A 4N47A 5KRTA 3AO2A 1NM1A 3B82A 1NSQA 1HLUA 1CLFA 4H4MB 4NLVA 4ED5A 2RKIB 1RT3A 3SUNA 4WQ4A 2ZM6J 3M9MB 2JSXA 3FK4A 1S9GB 4EAHD 1WHVA 2J5AA 1LK5A 3ZT3A 2ZVIA 1KONA 2BJ7A 3UCGA 1VQMS 3RW7A 1YJVA 3H6EA 3JYTB 2OPSA 3U27A 5DETA 2RHKA 1SAZA 4CWBA 4CP5A 2HSTA 1OIAA 4C1NK 4LFCF 4B9QA 2LQ5A 4DHVA 2FVPA 2P9SB 4LIRA 3C6TA 2VJUA 3KLHA 3A8IA 1V3RA 2RT3A 1IQTA 4M5KA 2VGNA 4PKIA 1QE1B 4PXEA 3P83D 4CNYA 2YJEA 3R1HA 3W7BA 4EP4A 1T44A 1FVSA 5LMUK 3QAEA 3W5ZA 1RHKB 3HD1A 4ZP8A 5M1FA 3QICA 3TSPA 3LP2A 1LFWA 5KFFA 1DZ5A 2RUSA 4DL5A 3CJCA 3C66A 2Z30B 3L0QA 4OPAA 4Y6IA 2ZBCA 4F4XA 1HI0P 5IWAJ 2R9LA 1ATSA 4H5TA 2AD9A 4DF4A 1W97L 2SXLA 2P9LA 1BLUA 4IRDA 2WW8A 3LP1A 5BYSA 1YIJS 4A8WA 1Y7PA 4DV2K 3VTHA 1WHYA 5ITHA 3A8JA 2NYIA 3CM5A 2PMZD 2QIFA 3NGZA 3NGSA 1DQ8A 3BPDA 3MR5A 2D3OR 5AJ3F 4O4GA 2E5LF 2QI2A 3M6UA 1SL1A 5LL6Z 1NSAA 4C3MA 3MR6A 3MCMA 4LF5F 4WCEQ 4EO6A 4WQ4C 1WAFA 5E26A 2QTWA 2HMPA 1S72N 1C0FA 1LFPA 3THWA 2C2EA 1U49A 2J7WA 3DYAB 3A5LC 2VD3A 5GAGP 3LPTA 1XUPO 1ZC6A 3AJDA 3BGOP 4FWMA 2APOA 2YX1A 2PI5A 3CCQN 4N5SA 5BR8F 3K0JA 1JLFA 5EX0A 4DR1F 1YVUA 3OVAA 4OZ1A 2BQ3A 1EP4B 1RABB 4CCHA 1Y3JA 2UXDJ 4FW1A 3F9MA 1QQOA 2UXBJ 4OHVA 1BD6A 5M1KA 2F40A 2VICA 4CLZA 4OI4A 3CG7A 1FT8A 2UYTA 5F8HA 3R1XA 2G2ZA 3N28A 1JXLA 3DLGB 5IWAF 5EU7A 3MR2A 3I5CA 2I1RA 4HUGA 1QVFR 4ZVHA 1B70B 3W64A 1U6FA 3D6FB 2CGLA 1C1AA 1WEXA 4ZP6A 1TU0B 1YBTA 3HF5A 4MT1A 1I94K 4GVBB 1NK5A 4DS4A 4N76A 4MK9A 4KHPJ 1JKHA 1FTCA 1LKZA 1B7FA 2H3GX 4DV7F 3TR5A 4HWIA 5EWFA 4F02A 3CFRA 4E19A 2VKRA 2DJWA 3EGVA 3FMBA 1N33F 4Z4IA 1HNWK 2AWZA 2HNYB 1RWKB 1RBUA 4DSFA 1HNVA 2KZZA 4L6V3 2E6MA 2LEPA 4AM7A 1YHQN 2PBDA 4JI0K 1UVKA 4OPHA 2P9IA 3BYRA 4I2QA 4C48A 2ZC4A 4FNHA 2VHGA 2UU9F 1HHTP 1UAXA 1Y4ZB 3VGVA 1RBVA 3Q8SB 1RWPB 2HWIA 5IFMA 1VIOA 2J7KA 2KG0A 4B1WB 5IXUA 5F8MA 1WBDA 3VALA 2O01C 3O3GA 2VPYB 2XY6A 3LGMA 4L3KA 4OHWA 3G9CA 4OLAA 1UKUA 2YKMB 2W9BB 3OXGA 4ID8A 2B7CB 3CWJA 1OY9A 4JV5F 5GAHI 5KFVA 4NXNF 4RNNA 1OPZA 3B6BA 4OYZA 3TYTA 3L4QA 4JHDA 3O9SA 2MKIA 2VB6A 3S8SA 2JVRA 4A8SA 5DQHA 1HWLA 4ZPBA 4DV3K 3OYKA 2HNYA 4RCHA 4KGXB 1NOYA 1WC0A 3FE1A 4M5DB 4Q2LA 3A4TA 3HJFA 4GKKJ 1S3XA 3W9HA 3QT6A 3A2FA 4DFMA 1VBXA 4JLHA 4ZVPB 3J7YU 3UQSA 1U1MA 2P6SA 3DLGA 1FJGK 3EKSA 5GAGU 1UFLA 1V4SA 2W4CA 1KBRA 2Q0UA 1X4FA 3U4LA 2IY5B 4ETZA 3QSIA 4UT4A 3T6BA 1MWMA 3TEGA 3KK3B 2MQMA 1Q79A 2GQCA 1DBDA 5JVHL 4DG1B 5LJVA 1HNXF 4ZTJA 1KXPA 3VGMA 3UNGC 2WUSA 4X4NA 5L1IA 4IR1A 3M1VA 3SMZA 3S9HA 1U47A 1C0TA 2AT1B 3MN6A 3R5GA 1JLCB 4FF1A 2QWQA 2IDEA 3LAMA 4WIQA 1OWXA 4TY8A 3HCXA 2ZDOA 3QO9A 1T11A 4HT5A 3G6EN 5LMNK 4NI2A 3MEEB 3TI0A 4FF2A 4KH0B 2GO8A 4YDXA 3SFUA 3VF4A 2RDDA 4CBUA 1REVA 4Z4CA 5LSLA 3V9SA 2F3JA 1H2TZ 4K4XA 1CJKA 4BC5A 3FFIB 3T69A 1FD2A 3ZO7A 4IYQA 1QQCA 4RW4B 1MN9A 3M6GA 1EKRA 3RSEB 2LYVA 2BACA 4UOCA 1C1CA 2A1SA 3S7RA 3PW7A 3VAHA 1MU2A 5F1XA 2K8GA 1BY9A 1AYEA 2R42A 3G2XA 5AJ3J 3FSXA 1KOOA 6FD1A 4JKFA 4B3SJ 2BBEA 4WXOA 3P4IA 1BISA 2CUYA 5CYQA 4PCQA 1U0HB 3VQCA 3M2UA 2HB5A 1RWUA 1M5HA 2DGWA 2EFNA 2EBGA 1HIYA 4NLSA 4RUCA 2ZD1A 5KAKA 1VLYA 3PKYA 3HI9A 2O8BA 1N34F 1CJUA 3KYLA 3MXIA 5E2QA 4K4VA 1AUSL 3OT9A 4DV1K 1G2EA 5HLFA 3K5OA 3CCVN 1TMJA 2FB0A 3H98A 2HQIA 5I9EB 1LOTB 4KRFA 2Y1LB 1QDUB 2VPWB 5KG0A 4ECSA 4DFKA 4A8FA 4NEZA 4DFPA 2MQNA 5C10A 2CA9A 1NGFA 4XO0A 3CCRN 1VQON 2HHXA 5J2MA 2O1PA 4LRAA 2POKA 2Z1HA 3DOKB 2CNNB 4NLXA 3O1LA 3T1HK 4QWBA 4IQXA 3O5BA 2FF3B 5KFHA 4F26A 2CPDA 4BRMA 3AVGA 3O9RA 3RRGA 4NCBA 5CHCB 1H0HB 3RRKA 1S1UB 1I1GA 1VQMN 2WFBA 4IRKA 3KJQB 3V6DB 3IDHA 1JLAA 3JYTA 1S1VA 1OY6A 4KHPK 2ZH4A 3EE8A 2B6AA 2KT2A 2PA3A 2P1JA 4IH6A 3PX0A 4JKBA 4QWEA 5G0RB 3C6UB 3AODA 4O0IA 1KAYA 2XTJP 4CNZA 3G6YA 3GYXB 3NCRA 2J6TA 3O9TA 3OA9A 2D0BA 1LWEA 5J1PA 1S5ZA 5BRFA 2E7WA 4IO9L 1ZTWA 4F4YA 5A8KB 1WG1A 3T19A 4Z2XA 1ZBIA 3T9NA 1S1UA 1RZMA 4DPYA 1Q16B 2OANA 3BF1A 1K73T 4WBFA 5KG2A 4DL6A 1WKKA 2HBKA 4O23A 5CYMA 4BRFA 1MWQA 1U8SA 3D3BJ 3AVCA 3THYB 3QGGA 1LXNA 3PRBA 4GMJB 2W25A 3A5OC 4DMNA 2EI5A 3C94A 3ITHA 1B64A 3RVCA 1XNRK 2I5JB 3DLEB 3JSBA 2CPJA 3PYFA 1ZS6A 2C3OA 3PIOQ 4K2XA 4CFBA 3DRSA 2P6TA 1GXLA 2XHCA 4EIAA 1RJJA 3O8MA 2J6UA 4WZMA 3PEJA 3W9JA 3KHYA 5HMZA 2AEMA 4ANEA 2VF3A 2BOAA 3VQEA 1REVB 3LZIA 2AJ4A 1SB6A 3QJJA 2XCPA 1SXLA 4K4UA 1KQFB 4BRHA 2NYHA 2VASA 4V1Ak 3MECB 3DM2B 1KKHA 3OVBA 3LALA 5F41A 2J9DE 2LQBA 4LR7A 5C12A 2YBVA 2H54B 1EQMA 4KJIA 1RBAA 2FY8A 3PX6A 1TK5A 5E7OB 1FTRA 2WBMA 3N9UC 4J9LA 4FM1A 4ILJA 2OZSA 3H0PA 5LJ5Y 1HNZF 2XMUA 1JJHA 2QWPA 1TGOA 3AFGA 2RSQA 1FEHA 4W98A 5AFUA 4AHCA 1SUQA 4EU0A 2MQOA 2PT0A 2JC0A 2JWNA 4URQU 3CCLN 1BI4A 5KFJA 1XC3A 3AVHA 3UIQA 3UVJB 5DDRC 1FESA 3NH2A 3TAMA 4WYWA 1XNQK 3AHPA 1N5TA 5GINA 4AL7A 2CJYB 2FJWA 2R7WA 5EX3A 2HK2A 4BG9A 5BPLA 2V63A 1T9UA 4BC4A 2K06A 2G1HA 2YY3A 3VZIA 1KDNA 5KRSA 4CZJA 2BANA 1U1RA 3ZTOA 4QWAA 1V5VA 1UA0A 4NYOA 3K59A 1WAJA 3D0PA 4NLRA 1MWZA 1AXQA 2WSEC 1WELA 3NRBA 3Q2SC 2ZWOA 4M7XA 2FLLA 3M3ZA 2W4DA 3AJ1A 3AO5A 3DDIA 2CRLA 2DNLA 3W1YC 2F4FA 4A8MP 4M41A 4CEEA 4NLPA 4PWWA 1K44A 4WZQA 3X3UA 2W6KA 3ZCMA 1UEVA 3LPYA 1VQLS 4ZKAA 4ZN3A 4LVNP 4DQQA 1JL2A 5DGBA 1VJWA 3IWXA 5ELZA 3HI0A 2IM2A 3OD2A 3RR7A 1RT4B 2XI3A 1RLDA 1DARA 2ZH5A 5CR4A 5JS1A 5HROB 3G10A 2GHWA 2LDIA 4NCAA 2UVRA 2OPQA 1LW0A 4EGLA 4KE5A 5T7LA 2E9TA 4OVLA 2EC0A 4XDCA 3IN5A 3GYNA 5HN0A 2MLYA 1R43A 3UN2A 3SBMA 5AZJB 3V1RA 1G4CA 5CXTA 3QT7A 3GIIA 2KFZA 3R9PA 5BXIA 2HNDA 3M5RA 2NSCA 2NXNA 1IR0A 1U1QA 2G9OA 2XMWA 3LDSA 4C7QA 2MZSA 4OLOA 3H1VX 2UUBK 2EFPA 4QOTA 5F8JA 3CT9A 3DRXA 1KLMA 5AZIA 3U1NA 1JB0C 4FN5A 3FLCO 4DPXA 3AO3A 2XZDB 2B5JA 4O8UA 4B3SF 1S1TB 4W92B 1VQ4N 3CCUN 2DR6A 3K17A 2D0AA 3B78A 4CK1A 3CPWM 3THWB 3B4DA 2OTLN 3OTBA 1G99A 2HS4A 3WIUA 4RW9A 3AVKA 1AROP 3RUBL 2CVEA 2J8SA 3UD3P 2KFNA 4JV1A 3NS5A 2YVSA 4PXBA 3KG1A 4FLXA 5KPTA 5D6GA 3F0NA 4DB3A 4CO1A 3EDRB 1D8YA 2CQDA 1CC7A 4DX5A 2V67A 4HVJA 4MDBA 3D2FB 4F2SA 3ENAA 1D4XA 2B51A 4NZ7A 5HI7A 2J0XA 4OKJA 1LAWA 1T3VA 1WBBA 1IBKF 1KLNA 4C3LA 2ROGA 2LU2A 2Y0BB 4W90B 2ZUGA 3CERA 3JSMA 1UJ4A 2D0CA 1B7YB 1DQAA 4P2MA 5CD4H 3SCIE 1TUUA 4UY8O 3KOAA 3MM5B 3WX8A 2RB7A 3M2VB 1QE1A 4W5RA 2O8FA 4XIUA 3IS9A 3RWUA 4R8UB 4YOTA 3DLKA 3L7UA 4DLGA 3MI7X 2ZWHA 3HHDA 3D0HE 4ZJLA 4JI8J 2WZ1A 5CZ1A 4CGGA 2ROEA 5KFBA 3M8PA 1RACB 4B3OB 1JJ2M 1DTQA 4LRFA 3O1WA 2QLJB 4J2DA 4DU4A 2V69A 3NF7A 2LXUA 4BCAA 3VAFA 1IBLF 2OPPA 4MMOA 3TWZA 3KLGB 2MSSA 2NRVA 1U45A 4JKAA 3MM8A 1CJTA 5ETMA 3ZEUA 4FLYA 4NRTA 2YHYA 2XEXA 1K8KB 1U26A 2H9ZA 5DM7Q 3T1AA 3CMAS 3CDBA 4EYIB 1VSKA 3CO9A 2XI2A 2DRDA 2EFVA 3QIPB 3KNGA 1T9XA 4DKWA 4B9SA 2B4JA 4I6YA 3ONQA 2BUNA 4LF7J 2B7BB 1IJFB 3R7BB 3J7ZO 3KIOA 5B0BA 5K14B 5GAGI 3GTYX 3O4NA 1B0PA 3FBFA 1IVZA 3Q24A 2KH9A 1M1HA 4RW7A 4KV8B 3E3XA 1FRXA 2F9TA 1YWXA 3BDPA 3HVTB 2RNEA 4M63C 1S9EB 1VQLN 3JSMB 3BO3A 4CJ4A 4GKJK 4X62F 1WSVA 1R0CB 3UN3A 4C98A 4OYPA 1GOAA 2JEGA 1OJ4A 1H98A 3PW2A 5HROA 2Y1IA 1Q7LB 2DRBA 1N36K 2CPYA 4WP3A 1CQMA 2BR0A 1IBKK 4I6AA 4DV6K 2NPFA 2UUTA 1WG5A 3ICLA 4KTQA 2KXFA 5BR8J 3SK3A 1JLAB 1X4HA 4FOIA 4CFAA 4IOAQ 2D1KA 4CHZA 1QQMA 2N4CA 3GL1A 3MAAA 2PFFB 3T7ZA 2X1AA 1RHMB 2YWFA 4YY3J 3J7ZT 1QS4A 3KWMA 1V5IB 3LP3A 3MX2A 1IWAA 4TYBA 3VAIA 3D2EA 1N4LA 1E6YA 5E3RA 4DDFA 3TAPA 3LGNA 2F4VK 3LM2A 4WXWA 1RT7B 3SQ0A 2YXLA 2VJVA 2V7ZA 3WT0A 2UV8A 3IRXB 3KLEB 4Y0FA 3FZFA 2YX4A 3RAXA 5D77A 1A9NB 3L4IA 2R7QA 4LRCA 2W40A 2HWHA 4DBQA 3CPWR 3SQGA 3QYYA 4ECWA 4MKYA 3AVIA 3V4IA 1Y5LB 4LF6K 4DU7A 4Z4HA 2D3UA 4A46A 5JLHA 3O3HA 4E89A 4MYTA 1A0OB 5E3QA 1TKTA 2ITGA 2RS8A 4DCPB 4ZCIA 1HMVB 3SV4A 5B7WA 2HMIB 5ETLA 3RMBA 4DV5J 1Q5VA 1S59A 4FJ7A 4ZVSB 2AJ0A 1VQ8N 5HP1A 3D7SB 3D2EB 2FJAB 4DUZF 3ZSVA 1LOUA 2XNRA 3LDQA 3OY9A 4QIFA 3G8SA 1D0EA 1ZBFA 3IG1A 5BREA 4LFCJ 3NVKA 3MPVA 2MQ8A 1ZBSA 4FWSA 4JNEA 3TAGA 3PW0A 2AHOB 4J8FA 2K1RA 4J5OA 5KFOA 3VEOA 2GVDB 1O6XA 4RKUC 2E2PA 4ED2A 2P9LB 2HMIA 2E66A 1GLEG 3M1FA 2RF2A 4U95A 3FZ2A 1TV6B 2HEKA 3JTNA 2R7OA 1HL6A 1N5YB 3LUYA 1MW7A 2MHNA 3RGIA 4ZPVR 1I51B 4DR5K 1S48A 2W2PP 4Z7CA 2NCKL 3D7EO 1EP4A 4KPYA 3O2IA 3IA0A 1W7AA 4FW2A 3BBFA 3T5KA 3HM8A 1NGEA 2OMOA 3PM9A 3R8YA 1L3SA 2DHHA 3GPAA 3H20A 1TL3B 3QLHA 4N8OA 5I3UA 3RTVA 3ILLA 1P6TA 2FZCB 2IVPA 2QA4N 2QJ3A 3H2VE 3ILIA 3I9ZA 4NI2B 4WE1A 2PEHA 3MR7A 1UA1A 1TL4A 4DTRA 1NJZA 4B9NA 4B9VA 3UVJA 1Q1KA 1SH0A 4C8ZA 2E5LK 3QBXA 2FJXA 4EBEA 3EM1A 4KGKA 3TZZA 2HRTA 4X4OA 3H08A 4QU6A 3R6GB 3N4QA 3DOLB 2RU3A 1RAJA 3VCDA 4JI8F 5KOWA 5AQIA 1TV6A 4DX7A 2UUCJ 3C95A 4J9QA 1RT4A 2AJ1A 1EWQA 1FRLA 1U04A 3JAMY 2X6SA 4CLFA 3D4JA 2BEFA 2MYFA 4Q43A 3THXA 5K5MA 4ELUA 5GMKa 2WBRA 2DRAA 2VIHA 1F9FA 4WU3A 2GQ2A 1RAAB 3D6HB 1HLWA 4DUZK 3CNQP 1GQEA 4KGVB 2QSWA 2VKZG 3H40A 3EE3A 2CDRB 5CA5A 4TNOA 3GP9A 3M8PB 4HCBA 3LP1B 3G6ES 2JWLA 3NNCA 2HBMA 2VFUA 4DLEA 1FKPB 5KG3A 3PIPQ 3VQTA 5HRSA 2PO4A 4KB0A 4ENOA 1Y97A 5L9NA 3GU0A 3NCIA 3NMRA 1IKXA 1CULA 3R27A 2YNHA 4FWLA 3G71S 3CSKA 3N5BA 3Q8QB 5M1NA 3ULEB 4ZIWA 4CJSA 2H1YA 2MHEA 1WNSA 4M5LA 3L9ZA 3CF5L 4UW2A 3J7AN 4H8KA 2HIQA 3RB3A 4CIFA 4DQIA 1RLCL 4BR4A 1GXTA 3FQKA 3OS2A 4A8KA 1RTZA 3W9IA 4FXWA 5ETKA 2ADBA 1WNEA 4FLWA 1RI7A 2HF3A 4ZHRB 4PEOA 1NGBA 2XS7A 3M2RB 4IOXA 1RT7A 3SQOP 4FS2A 5IC4B 4K5SA 1XEZA 3E9LA 4YR0A 3KLGA 1N5QA 2AA4A 1FDDA 3M30B 2EW9A 4LSLB 3I5BA 3R7SB 1UWBA 1FERA 2EC2A 4YHHF 4KSEB 2VFRA 2X1GA 2WVDA 3MEGA 3UWTA 3R1LA 4L76A 3DOLA 2BKPA 5J2NA 4LFBK 1HR0K 2X3DA 2IC3A 2VPZB 4NLBA 2P9CA 2OEKA 4MFBB 3G0ZA 3FEYB 3MAHA 1GXUA 4OX9F 3UO0A 3MXJA 1PIEA 3M2RA 3CCVS 1RA7A 4TQSA 5BRHA 1NJXA 4J9PA 5A8RA 3K5NA 2FHOB 1HUXA 2O8FB 1KWMA 2CH6A 2XSJA 4AHSA 3K89A 3QEVA 2OEJA 1FFWB 2QGFB 3WUHA 4KHRA 2R7VA 5J2PB 3S3MA 4NYFA 5A8RB 2G8HA 1KVAA 3QPIA 4DF8A 4RW8B 1YT3A 4OYBA 2YTCA 2KT5A 3KLVA 4WFAQ 2CWXA 4ANCA 2HYIB 3OVSA 4CJKA 3L2VA 4KI6A 3EGWB 6FDRA 2C3PA 2OD4A 1I3OB 3BH6B 4URGA 5C15A 1JNRB 1XIQA 1PAEX 2RF2B 1RYSA 4EBCA 4ZVUB 2D3O1 4K5RA 5AQUA 3CMQA 5DLFA 4KHQA 4CE9A 5C42B 2KRBA 3SPZA 4FKXA 4B3TK 2L41A 4USJC 2LU1A 3CCTA 3ZEUB 1HQUA 3Q22A 2ZH9A 4FPAA 2WOMB 3VQBA 3CDEA 3KKRA 1SCJB 5HOOA 3IAM9 3BDEA 1PKUA 3PRVA 1C0UB 1X5TA 1XC9A 3I6PA 4KY3A 4FWRA 4DQRA 5CYJA 4HR2A 1VHXA 1J2VA 2B8PA 4FO0A 2QTDA 1FCAA 2ILYA 2V8HA 4K43A 1NHUA 5A2QO 5DO2A 4NZ6A 1XJWB 1CS4B 2A1BA 5KT5A 2BVZA 4CZCA 1NWKA 4K8ZA 4EWTA 2CIMA 4GKKK 3BPSP 4D3GA 3FGUA 3EPIA 3GDQA 2A6OA 4CEZA 4LFBF 3PJ9A 1S57A 1ZAWA 1QD1A 5J1EB 4BGAA 2D0OA 4JOUA 2VG5A 2C3YA 2YX6A 5T7LB 5GMDA 4AILC 3I0RA 4K41A 1BWEA 4AT1B 4QBUA 3FSIA 4KT0C 2A1RA 2GHVC 1VQ6S 3G4SN 1RT2A 2GGPA 5DG7A 1JCGA 4CQ1A 5K8OA 2NR0A 3GFHA 5F0WA 3ENWA 4JK7A 3QEIA 4QQBA 4USIA 3CIMA 1KVKA 3KWIA 2M4MA 4CF2A 2QC3A 1HKGA 1W0HA 4PPZA 3V81A 5KG7A 1RGIA 1CG2A 1KD1O 2X74A 3MUTP 1IN0A 4AHRA 4WCEL 3VR1A 4UQTA 3PLAA 4JI5K 4KHWA 4H5RA 3H7HB 2YNHB 2H51B 4CHPA 2PYJA 3NAIA 2HVHA 1JNZB 2CXEA 4RWWA 4MK8A 1P8GA 2X7IA 3MCPA 1YRTA 4I9QA 2GELA 1RT5B 4ANDA 4Z7YA 2NLXA 5M2RA 1EKEA 3C6TB 4YFUA 3BKUA 1NGDA 1WSRA 2D3ZA 2OUGA 3MD1A 4LFBJ 3U8XA 4JKDA 3OYNA 4JI6J 1S7HA 4ECRA 3IXQA 3OTCA 2FDNA 2VBYA 3Q7CA 1YITN 1DFDA 1S1XB 2OPRB 2NUHA 2GIRA 2BTFA 2M8DB 1KOHA 2HKEA 3O1BA 3SJHA 1QQNA 1DTTB 3DOMA 5C25A 2F9JA 1FO1A 1OKJA 2IRXA 2BZ2A 4X84A 2VBWA 3AAPA 4CFCA 5IT4A 2FGCA 4CRJA 5GIPA 3NH0A 4DV2F 2YWGA 4NMXA 2DGSA 2YJFA 3MWTA 2W8KA 1N5YA 1WACA 3CCQS 4RL1A 3HT3A 3O6WA 1N33J 4M94A 3QIOA 2GVDA 4AHTA 2I2YA 5F8NA 5DZ6A 4N8NA 4HTJA 4K59A 4UY8T 4JS5A 3QGPA 4BBYA 4OKEA 5AXLA 2X1BA 3NFAA 4WFAL 3F44A 1KP6A 3QIDA 4XEIA 2L9NA 2N3OA 2A5XA 4DL0C 5KFYA 2C28A 2OIHA 1NGJA 3CC7N 2U1AA 3CQ8A 2MY8A 3RMCA 4TU7A 3HSDA 3KZBA 3L6QA 2E5JA 3U1LA 2Z2MA 4IG0A 4WK1A 2ZZTA 2M3DA 4DR3F 1YJ7A 3DMJB 3DGPB 1S7IA 3QERA 1T95A 1HQEA 4OHZA 1KNZA 4EP5A 4XK8C 1YJ9N 1T9TA 2KW4A 4CJ3A 1F3FA 4OZLA 3MCOA 3WXMB 1U09A 4P72A 4CLTA 1S99A 5I4MA 5B0DA 2E1AA 3DXSX 4OI6A 2VU5A 3P1GA 1LNQA 1S1VB 3VWSA 1AFJA 3KUEA 4DR5J 1VQ5S 1RHJB 1MMNA 3KWGA 3ID8A 2QWNA 3KLEA 5M1PA 5LSOA 1AUDA 1ATNA 3M8WA 2RRBA 1EO1A 4H5VA 1F5BA 1M0SA 3V9UA 3R3LA 2E4LA 3KUHA 4KH4A 1AW0A 2CADA 4DR4K 9RUBA 4C0HA 4J2AA 1KHWA 4HH1A 2VWBA 2DNQA 4DR2J 1WTFA 1IKVB 2JEJA 5HQMA 1F3VA 2B8QA 3DCAA 4WTYA 4FPRA 2QWOA 2GCFA 4BG8A 3GFXA 5EWEA 5IS2A 4OV6A 3GIKA 3CI5A 1P9YA 5AQXA 1G3OA 5AR0A 4RWXA 4OYIA 3KG4A 1OS5A 1ASUA 5A0YB 1HRHA 2CQHA 3PYEA 4HACA 3KK1B 1S6QB 4RWTA 3GILA 2DGQA 3ZSWA 4E7IA 4AF1A 4FVUA 2QN6B 1F2HA 5AQSA 1TAUA 4IOBA 1HW8A 3CJ8A 2FD2A 2AQ4A 5FJ4A 1HNIB 2UVWA 3WNEA 2UUCK 4LUBA 2ZH7A 2V2ZA 1JX4A 3CB4A 2R3VA 1RADB 5D0EA 4QJVA 2ZQBA 4CO2A 2MZJA 1PYOB 3VTIA 3GJSB 2BJ3A 1VSLA 1OVQA 3IAS9 4RG8A 2MKJA 3W2VA 3NS7B 3EZOA 2DPIA 1SZ2A 3V81B 1JJ2R 1B0TA 4CGIA 4OX8A 3W0LA 1NKBA 8RUCA 3GIRA 1Y0HA 3NKYA 5F2RA 1M5VC 2QKKA 3T5LA 2MXYA 4KQZA 1IBLJ 2R8GA 3DLHA 2VH7A 4RW6A 2KHCA 1REGX 1FXXA 2GNKA 3BR9A 2V68A 4PZVA 2O8EB 4M7YA 3AXKA 4DQPA 1S72S 3HKZD 2GMJA 2ZH8A 5D4LA 2F8HA 2AYEA 3MOJB 1O8BA 5IT0A 2Q1LA 2GA7A 1WKJA 3TPQA 4IRCA 4Y0WA 2HRUA 3VZHA 1TVRB 3N5FA 3DJCA 4JKHA 4NLWA 3B6OA 2DPNA 3JXOA 3ZZTA 4CJPA 1FJEB 5FDLA 2VA3A 4DV1F 1KAXA 3VAGA 1HI8A 4LRBA 1U24A 3ZSXA 1DTQB 3BSCA 3EY1A 3PDNA 1LWEB 4I9LA 3FZKA 2E6LA 4IG3A 1U0HA 2J9CA 1CJUB 3IM9A 4ELVA 2XO6A 3TNVA 4IOAL 4F3QA 3TSUA 5GAEU 3ELHA 3ZXWA 4NXNK 1DY3A 4IQMA 2W2QP 4CD1A 2CZ9A 3H42A 1RKJA 1Z2ZA 3HYFA 1N33K 1CULB 1GOCA 4DV6F 2QYGA 4ZMMA 1KR4A 1TUYA 3OXLA 1XERA 3D2FA 2EK6A 4IZ9A 5CHIA 3HSGA 2KTQA 4LF8J 4WE1B 4BGBA 4DTXA 1QJHA 5CH7B 2JEIA 1UW4A 3T1HJ 3VQPA 2HQCA 4PG8A 3MMCB 2XY8A 1CZBA 1RDCA 1CC8A 4KAIA 3GSIA 5AQFA 1YRXA 2HPUA 4K8RA 4A62A 1HBUA 3FNNA 1ZA2B 3A3NB 2ZH6A 1TYQB 4KI4A 4PYAA 2QL5B 5AE3A 3IGVA 2H5JB 3KJNB 1UTAA 3W2WB 2V7YA 2UVUA 3ZT1A 1S9GA 2YNGA 5SWMA 4L8RB 1ZOTA 3CD6N 5KFZA 1JXEA 3H5UA 4CK3A 3TQ1A 1HARA 4OJRA 2Y9HA 3RMAA 3J7A1 2G8VA 2QA4G 4NLYA 2WONA 1F1BB 1OSCA 2NS1B 3NL0A 1W2BM 5FDLB 2GTDA 1FKAF 3TUIC 3J7Z5 4ZN1A 1HMVA 3VN5A 4FXVA 5C25B 1VSFA 3L3CA 2V94A 4PL8A 4TU8A 3OHBA 5FLXU 2OTJN 3MTJA 1G15A 4DWIA 5BN9A 1R7IA 4NA3A 4JI8K 4LF7F 1TUGB 4NXMF 4FYXB 3BSAA 3G71N 1VJQA 4GY2B 2C3UA 1FXRA 2LECA 4FLVA