3C75A

Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKAGETVYWVNGEVMPHNVAFKKGIVGEDAFRGEMMTKDQAYAITFNEAGSYDYFCTPHPFMRGKVIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of crystal and solution states of the 138 kDa complex of methylamine dehydrogenase and amicyanin from Paracoccus versutus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 24
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3c75A00
1ETJA 1A3ZA 1AS6A 2XVBA 3PCYA 2BHFA 2XX0A 3FU8A 2UX6A 4YL4A 1SF3A 1MZZA 1ZIBA 2R7EA 2OV0A 2J55A 3EH5B 1BYPA 4DP5X 2IDQA 5B1AB 5B3SB 1CC3A 1MDAA 3FYEB 2AFNA 5D4JA 5FC9A 4UANA 2Q9OA 4NAJA 4A2EA 2PPCA 3OM3B 2XLLA 2DWTA 1IBZA 3ABKB 1L9TA 1ADWA 2EIJB 3SBRA 3FSAA 4E9XA 4M4RB 3NJNA 4W1TA 2I85A 2Y1AA 5B1KA 4E9WA 1NIFA 5B1BB 2UXFA 5I5JA 4YSCA 3D12B 2MRYA 3EH3B 2I7SA 1BEXA 3NP3A 2N0MA 1AACA 4DP8X 2AANA 1JOIA 5B1JC 4ENZA 3CVCA 3QQXA 2XXGA 4QKTA 2IH9A 2GB2A 3AG1B 1DZ0A 1PCSA 2EIKB 1TKWA 3X1GA 3UGEA 1SFDA 1N70A 2GHZA 3NJJA 4M3HA 4CSZA 1KBWA 2XXFA 4BXSV 4YSTA 1BXVA 3WIAA 1SDDB 2BP0B 2QDVA 2XU9A 1PLCA 3G5WA 1E5YA 2BO0A 2XX1A 5I6NA 2PLTA 3FSWA 5E9NA 3PXLA 4FAAB 1J5CA 1ZV2A 3FYIB 1GS7A 1AZNA 4WKXA 4YSPA 1OCCB 4DP2X 2QDWA 1PY0A 4A67A 1J9TA 2CALA 4KOBA 2PCFA 2UX7A 3WKQA 1SDDA 1KDJA 3T6VA 3GDCA 1R1CA 2BP0A 2YXVA 4AKQA 2E86A 2BP8B 3QJQB 1A8ZA 5EHFA 2IDFA 3OQRA 5I5MA 3HEIB 3QJUB 3QPKA 2GSMB 2H47C 2DYRB 3NJMA 5B7EA 4WTQA 3T6XA 3H4FA 3IEAA 2FTAA 2A3TA 4GP8B 1KGYE 2XV0A 3GXUB 5LDUA 3QJVB 2QPDB 1QNIA 3X2QB 1IUZA 2HRHA 2EINB 3OMIB 2IWEA 3AZUA 2BP8A 2ZWNA 3OMAB 4P5RA 3SBPA 4DP0X 2VSKB 2HZHA 2R7EB 3AY2A 1NPJA 2LLNA 5AZUA 4MFHA 3L45A 5IY5B 3BVDB 1J5DA 5I5IA 4FA7B 1GY2A 1KV7A 3QJRB 1IKOP 4UAHA 3AG3B 4AZUA 2VN3A 5A7EA 1NPNA 1FA4A 1ZIAA 3FSVA 1AOZA 3SBQA 4Q8BA 3UADA 4X4KA 1JZGA 1SFHA 1AS8A 1L9QA 1V10A 4GXFA 4KO5A 4YVUA 3X1BA 3UABA 3S8GB 3CDZA 1YLBB 2HX8A 4RH4A 2MTAA 1AG6A 3CVDA 2QT6A 3PAVA 1V55B 2FT7A 3S3DB 1AS7A 3NJLA 2WO2B 3UACA 3FPYA 2VW4A 2HXAA 1ASOA 1HFUA 3X1FA 1OOWA 4GP5B 4YSQA 1AZRA 1JZJA 1NDTA 4DP9X 1XB6A 4Q89A 3DTUB 3IN2A 3S3CB 3CVBA 1ID2A 1ET8A 1X9RA 3NSDA 1BXUA 1X9UA 4YSUA 1T5KA 1L9SA 3FU7B 1EZLA 1KYAA 2DV6A 1KCBA 1NTDA 2VW6A 4A66A 4KNTA 1JERA 1OE1A 4G72B 2VM4A 1PLAA 1WA0X 4YVNA 1FWXA 1XMEB 2YAMA 1E30A 2I7OA 1GY1A 1NICA 3T71A 1PLBA 2FJSA 4JHUA 2FNWA 1ET5A 4G7QB 3WNIA 4F2EA 1GYCA 4F7KA 3ZIYA 5AKRA 1GS6X 3NYKA 4HHGA 5I28A 2RACA 3MX0B 4GY4A 4DPBX 3FT0A 2UXGA 3PPSA 4G70B 1NZRA 1CUOA 3IBOA 1ASPA 4JKNA 6PCYA 1JVOA 1J9QA 4YSRA 1L9RA 1MG2C 3FU7A 4AKPA 2CAKA 3T6WA 1RKRA 1A4BA 5B1JA 1PZCA 3TBBA 4E9VA 4GP4B 1RZPA 3AG2B 3TASA 1AZUA 3WNJA 4KO7A 5D4IA 1NIAA 1KDIA 2YAFA 1BQRA 2AZUA 3V9EA 4A2GA 1AQ8A 4BDVA 2PPAA 1JXDA 2W88A 1JXFA 3N2JA 3TU6A 2PPEA 3ABMB 3GYRA 1B3IA 1IC0A 4KO9A 2IDTA 3V9CA 4JHVA 4G7RB 3X1EA 2IAAC 1F56A 1PNCA 7PAZA 1DYZA 1I53A 1PZBA 2XV2A 4KNSA 2XWZA 1NIEA 2FT6A 2X87A 2HX9A 3IE9A 1MZYA 1V54B 4HCFA 1EHKB 4PCYA 4W9ZA 2YAEA 2OCCB 1JZEA 1NWOA 2IDSA 3NSYA 3AG4B 2OJ1A 1AAJA 2YARA 4YSEA 4NERA 3ZX1A 2UXVA 2GC4C 2GBAA 1TU2A 2CUAA 4HCGA 1XB8A 4QLWA 1VLXA 5TK4A 1XB3A 3MBWB 2AZAA 3U25A 1PAZA 5F7AA 4BWTA 1GSKA 3CDZB 2PP9A 3FU9A 1AIZA 1A65A 1E5ZA 2CJ3A 3RYMA 4NB7A 1SJMA 2J56A 2IWKA 2FWLB 1ZDQA 1OCOB 4HIPA 3H56A 4KNUA 3S3BB 1M56B 2WSDA 1WA2X 1RCYA 1OV8A 1ZPUA 2BZ7A 5B7FA 4YSSA 2BZCA 3CG8A 2CCWA 4DP6X 1AANA 5I26A 4F2FA 4HALA 2HLEB 4BWUA 3N55A 5I6OA 4L0PB 3JT2A 1AZCA 4DP4X 2B08A 3T6ZA 1SF5A 4A2HA 5I6KA 3FQ1A 1AZBA 4G71B 3UAEA 1L9PA 1PMYA 1GW0A 1BQ5A 3NJIA 3NJHA 3NJFA 4KOCA 1HAWA 3OMNB 1SHXA 3NT0A 4GYBA 1OF0A 4PAZA 1OE3A 2WO3B 2BWDA 1BQKA 1OE2A 1CYWA 3DKHA 2ZONA 4TXVB 2QPEB 3HB3B 1CYXA 1N68A 2BW5A 3QJTB 1ASQA 1BXAA 3PAZA 2YAOA 5I6MA 4N8UA 3EF4A 4DPCX 2FT8A 5ANHA 1E65A 2XV3A 3TBCA 5PCYA 1M57B 2PP8A 2PP7A 4E9QA 2XYBA 2FQGA 1J9RA 4CSPA 2BWIA 1W8EA 1L9OA 4BDVB 5AFAA 5TK2A 3T9WA 3WG7B 2XUWA 2P80A 2VM3A 3BQVA 1A4AA 2IWFA 3X1NA 4DP7X 1JZIA 2PPDA 2NRDA 5F7BA 2DYSB 2FQFA 1WAEA 1TEFA 3NP4A 1ILSA 3FS9A 3KW8A 3ERXA 2GC7C 4EF3A 4BK5C 4AKOA 8PAZA 2IDUA 2HX7A 2YAHA 4N4YB 2JFCA 3NJKA 2JXMA 1ET7A 4E9TA 3KW7A 1OCZB 1URIA 1PNDA 5I6PA 1A4CA 4HZ1A 1JVLA 3IN0A 4BXVA 1OCRB 1WS8A 2GIMA 4A2DA 1AG0A 1JZFA 2Y69B 1PF3A 2DWSA 1WA1X 5D4HA 1SNRA 1JZHA 4HHWA 1PZAA 1RZQA 2VMJA 4E9RA 1QLEB 2AVFA 2JKWA 3UAAA 3NSFA 2HRGA 9PCYA 3ZBMA 1E67A 3NSCA 3ZDWA 4BWWA 4HCIA 1GS8A 2J57A 2H3XC 2BW4A 3CZUB 1FFTB 3TA4D 1IBYA 5I6LA 2EILB 2W8CA 3H4HA 1QHQA 2VW7A 2UXTA 4YSDA 4E9YA 2PCYA 2P80D 1W6WA 2DY2A 1BYOA 1NIBA 2TSBA 3S8FB 1MG3C 4A2FA 2B3IA 4UF7C 3ASNB 3ABGA 1NIDA 2ZOOA 1JXGA 1ZDSA 4KO6A 4AX3A 2YQBA 7PCYA 3WKPA 1BAWA 2YXWA 3PAUA 3NJGA 5PAZA 1J9SA 6PAZA 2H5UA 4HAKA 4A68A 3EHBB 2CBPA 3DIVA 3QJSB 4YSAA 3PLYA 1HAUA 2YAPA 4YSOA 4AI7A 1KCWA 2FQEA 2TSAA 3JTBA 1KBVA 2GI0A 4DP1X 4E9SA 1TEGA 3FSZA 2Q5BA 4G7SB 3EH4B 1NWPA 2FQDA 1GR7A 2X88A 1NINA 4ZK8A 4K9JA 1ILUA 3FQ2A 3FQYA 3FPXA 1W6LA 1SHWA 2J5WA 1UATA 1CURA 2PPFA 3C75A 2EIMB 2YAQA 2IH8A 2VSMB 4DPAX 2ZXWB 3ASOB 5B7MA 1WS7A 3OD3A 4P5SA 3AW5A 3WI9A 3SQRA 1M9WA 3ABLB 1AR1B
chains in the Genus database with same CATH superfamily
1P4UA 3CFBA 4WTZG 4YGVA 3ROOB 2XVBA 5CILL 4HPOH 1AGCA 5JOEA 2PCPB 3EYVB 3HRPA 2NY3C 2PWEA 5E6ZA 3VXSD 3JV4A 4JFFA 4OFQA 2UZYA 4GSQA 4KXBA 4DP5X 2IDQA 4F24A 2F6AA 3E6HA 4YHLH 5I1DA 4JM0A 4XC3L 3HC3H 3QT2A 3DX1A 3ZGIA 5DMGC 3IU3B 4QWWD 5DHMC 5T1KB 1RUML 3SPIA 1MFCL 3UC0H 2P44B 2R0WH 2VITA 5EU4A 3SPCA 1YYLL 1S7RB 1PYWA 5EU6A 4E9WA 1O0VA 2X4OB 3L48A 2W38A 1M7DA 4XVSL 3T2LA 2O5XH 4KJYB 2FIKA 3BZ4A 1TZHB 2X4TA 4XCCL 3VXRE 3LZQA 1JOIA 3B2UD 1EFQA 4XMLH 2WMPA 4G6AD 5EO1A 1NAML 3O41B 4TQPA 3N41B 1XGPA 4DZ8A 1KPRA 1LP9E 2EZ0D 2VDKL 3H6JA 3MV7A 5JW4R 2AJSH 3QIWB 2NCEA 3AGVA 1PG7X 1CMOA 1YY8B 3CZFB 3EHBD 2MPAH 4MBRA 4P48A 1A6UH 3DVGB 3BHBB 1NCDH 1AVAA 4IOSD 4CSZA 4ONOA 3Q3GB 2YGPA 4Q9QH 3N1GC 5KBPA 2A6DB 3MOAH 1A64A 1LO4H 2K8MA 1YYMH 2NSQA 4XP6L 4YHYC 2UWEF 4P4RA 3WJJA 4JRFA 2K0RA 2JKXA 1ITCA 2XQYA 3HHSA 1KELH 2NY4C 1GS7A 1AMXA 4V1DB 2OW7A 3JVGC 4BK5A 2EDHA 1DQIA 2WUBL 4PU2A 1EDQA 4IS6A 3B3IA 3BKCL 3EYUH 4U3CA 1M4KA 4TN9A 1E28A 1PCXA 1V3JA 3OXSA 1PY0A 2Y3NA 5SX5K 4LHQB 4LESA 4FABL 1D9KD 1NAMA 4BGDA 4AYDC 3EOAB 3GDCA 1Q9KB 1KWGA 1HCFX 3TC9A 2NYZA 2XA8H 1F2XK 1EUTA 4ZW8A 2ALAA 3QJQB 1E5BA 3F7RA 3KAAA 1OK8A 4L9LC 3MBEB 5SWZA 2A9NL 3H7LA 1P0SE 3U4BL 1R3JB 3SJVA 1CG9B 4WTQA 1XF2A 2VLMD 4ECNA 4J7RA 2R2BB 4HS6B 3ZE2F 1KGYE 4HD5A 1UT1A 1BECA 4XXWC 4APQB 2NYYD 4GFXA 3O3UN 3FK3A 5FAAA 4G6FB 5I71C 3VDAA 3VG0L 5IHWA 4IBWA 2CPCA 3DRQA 2OR7A 2Y5TA 5B39G 2E7LA 3CFBB 1QI4A 4YGVB 4WJ5A 1DBMH 1MCQA 4DGIH 4NRYA 1MRCH 7CGTA 3JV4B 2ZXDA 4LSQH 2UZYB 1IGYA 1ANUA 2C9XA 1ZT1A 1GY2A 3MAWA 2APSA 4M7KH 4ZAKA 1MAMH 4O2EB 1RSYA 3US1A 3K6FA 5INCB 2W59A 4FQCH 4OCNC 4M61B 1AOZA 4G9FE 3HS0C 2XPZA 4GMTH 5EU4B 3VXNB 3QDMD 1JD9A 1FLRH 4AE1A 3G6JF 3QIUC 5LO7A 3HPJA 3EXJA 1ZHBA 4H20L 1M7DB 2WWMC 4LPYA 1QBMH 2WCGA 3BJLA 3BZ4B 5TF1H 1QFWL 2X4TB 1A25A 4FLHA 3JTSB 3JT0A 1DBAH 1HCVA 1ZANH 3SKUD 1KIPA 1AFVL 3L4CA 2AXJA 2WMPB 4ZZKA 5EZLB 5C3IA 4L23A 1PVHA 1BVLB 1Z0MA 2G60L 1OANA 5IVZA 1XGPB 4LMQE 4DO6A 5GS0H 1BEYH 1CLYL 3DGDA 3E8UH 4I77L 4S1SH 4XPTH 5HXMA 1MFEH 4Z76B 2OL3B 2BFVH 5DR5L 1JDCA 3KNBB 3ZN6A 3L3DA 4M7ZC 4KKPA 3REVA 1LEGB 3H6AA 1FIGL 4DCQB 3PL6B 4JFEE 3MNMA 4P2OA 1F00I 2CJTA 2N3JA 5GGTL 3FUIA 4YSUA 4F1ZA 4HLJA 3CQQA 2ARWA 1E4KA 4MCNA 4XN7A 1TQWA 4ENED 2EADA 3P77B 3FZUD 3GWJA 3A22A 1ET5A 4HUCA 4IS6B 3ZIYA 5IJVB 1GS6X 3P0YL 5FGRA 4LVHC 4CN4A 2LTQB 3HE7A 3PQYE 4P3DB 3U7AA 4JQXC 1QEWA 4OF8A 2ARJA 1T1XA 3KYKH 1PG7W 1NAMB 2R83A 1L9RA 3FU7A 2Z93A 4DVRL 3L4ZA 2EDMA 5IEKA 5D2LF 3QUXC 2C9SA 3RUGA 4BFKA 4D7BA 2BIOA 2ESVB 3FCSA 4XP5L 1WE5A 4XBMA 2BC4B 5D4IA 3SJVB 2YAFA 5HY9A 1SVBA 4WW2C 2AZUA 4JLRB 4JFDB 3BAEH 1I7RB 4WI2A 1INQA 4OFDA 3GC3A 5GGTA 3U4KA 1N10A 2OFQA 1OP5K 5LDSA 2ENJA 4YFLF 2W88A 2DQEH 2X70B 5I1CH 4WHYH 1QASA 5DQ9A 4M62L 3MCLH 4IRJC 2FD6H 4WJ5B 4NKDA 4G8GB 3CMOH 1XH0A 2VDOL 4JKMA 3T0VA 4XXCA 4K07A 1KJVB 2ZXEB 2OYPA 1P5UC 1UOVA 1V54B 1TDQA 4PS4L 5DJ2B 5E2VH 1IGYB 3ROLB 3K2MC 1WBZA 3DI3B 2YAEA 3X17A 4KITB 2E9WA 3AG4B 3S34L 1HVXA 4PJ5D 4ALAL 3KBFA 3D3VD 4X98A 2O30A 3VXTA 2G3MA 3GMNB 4L8BB 1LE9A 4NAQA 3AXHA 1N18A 1JZ4A 2EYRB 3BKYL 3HAEH 1Z0NA 2L3BA 1QWHA 2AJUL 4MXWL 1NC2A 1MJUH 3IDMA 1NLDH 3S2AA 1CLZL 1QZNA 3HPJB 1HNGA 2XXMB 2XQ0A 1ZHBB 3U0TB 4K9EC 5KYUB 1ZDQA 3P02A 2E59A 3APFA 4KFZC 4KNUA 2NW2A 2VAJA 1OGSA 3OAYK 4O9HL 1FIEA 3NDZE 1I1AA 3U36A 1RCYA 1K5NA 1E9OA 2ODHA 5DZOA 1BM7A 2OW6A 2OKMA 1KXVA 1MY7A 1BZQK 3PHQA 1U92A 2NT0A 4DP6X 5IV2A 2JSFA 4UM8A 2B4CC 1IT9H 4IHOB 3REVB 3L3OC 4I3RH 2GTWA 3FHAA 3Q8BA 4P2OB 4ZG1A 2X3BA 1UOKA 1JPGA 5CFAA 2YQGA 3B2VL 4PJEA 4JG5A 4B41A 2GEEA 4D9LH 2BRRH 3LMJH 3WD5H 1KLGB 3FTUA 2X2UA 3DSNA 3D0LA 4G1EB 3ATAA 2MNJB 3DTDA 1QMUA 2RQEA 2BP3A 4G8IB 3VACA 4X9YA 3HE7B 2R27A 3RFZA 5CCHE 3GM0A 4KJQD 4OD3L 2DYPA 1T1XB 4YZWA 3V0DA 1N64H 4X2UA 5F3HA 2ZPKH 4BRJA 4TS6A 2HLFD 4MHHG 1J1OH 1KB9K 4HIEA 4YH6A 3OKEA 3RUGB 1E65A 1P4LA 3KS0J 5JHLH 4FHKA 5HYSB 2JJUA 4BH7A 1RURH 1VFUA 3MREA 1CFQA 5HY9B 4MAUL 3ZYOA 3VSTA 4HC1L 4J12A 4HPHA 5ENWA 2XHNA 4WJG3 4K3GA 2AJVH 4NO2A 3HG3A 3SKNB 1YMHA 1NEPA 4HISA 4F15C 1A4AA 2M2DA 4ERSH 1EFXD 4GMSH 1H8SA 2NRDA 4OQTH 5DK3A 4QRQA 3N6YA 1CVSC 4NO5A 3PWLA 4NKDB 2APVA 5F9AC 1Z5HA 3PHSA 1O6TA 1U8KA 3C09C 1DVQA 4N0CD 4ORGA 1EXHA 1WBZB 1ODUA 4PRHE 3VYPA 2EE0A 1BREA 1DO5A 3CFQA 5DA0B 4KQ3H 3KYOB 5I75B 3QCTL 3VFPA 3QXDA 3BCDA 3VXTB 5KSBE 4A2DA 4AYSA 4R84A 1LE9B 2EC8A 1J05A 4JFPA 3DJZA 2VDPB 1N59A 3D4CA 2ZYHA 1ZHLA 2MIZA 3GXFA 4X8CA 5GS2H 1NC2B 1OT4A 5EUOE 4HC1A 2OS7A 2D31A 4JGUA 1P7BA 1XDTT 4KHTL 4Y2OA 3UAAA 4PJDA 4HXBL 3RG1C 3ZU8A 1XEUA 3EDEA 1EUUA 1C7SA 1RUKH 2BM3A 4UV4H 1FP5A 4LHUA 2O6DA 4HZLA 1X4YA 2NW2B 4G8EA 4PGEA 3PJNA 3PNWB 3U36B 3BJ91 1FFNB 3FFDB 2VERN 1ZY9A 4PJFA 4EIBA 3GTVA 4PV1C 1CI5A 2VW7A 1DE4B 1F4YH 1U92B 4NWTH 1YAZA 5IV2B 4M6NL 2J5LB 4A2FA 4YE4L 3OKOB 2F74A 3U2SA 2J8UE 4N87A 5ACMA 1ACCA 3TURA 4FQ1L 1BG9A 3ZKXB 4G83A 2ADFL 3LVEA 4KO6A 4PJ8C 5GRJL 4JDTL 1JPGB 4JPKH 1HK6A 2CO2A 2G75B 4PJEB 4BCZA 5ISZB 3LKPA 1ML0A 1IRAY 4R7NB 4N3UA 6PAZA 4ZFGL 4WUUE 4XVTL 5FYLL 3QJSB 4A7UA 5BXFB 3D2UA 2XSKA 2IFFL 3DSNB 2C4FU 1KCWA 2ZNWA 2VDRL 1FYTE 2TSAA 1FG2A 5C0GA 5IMLB 4PB0H 5HVWA 5D1ZB 2IPTL 1GR7A 2X88A 3A6OA 2ADIB 1DQLL 2PO6B 3BXNA 3CWGA 4U7MA 1LD9B 2PPFA 2BCKA 3NDYE 4HOZA 4GLRH 2Y72A 1AP2B 1CGSL 4XP1L 3BAWA 3BUIA 4P5SA 4F5CA 3HBPA 4O5LL 3WI9A 1MQKH 1FFPA 3ZK0A 2QSCL 3NJXA 3BP5A 4BH7B 2UVFA 1BWMA 3FO2B 1CFQB 4NFDA 1AS6A 3M7OA 5C1MB 3WMSA 2VM9A 5D7JC 2XZQH 1ZIBA 5B8CC 2I5YL 4NO2B 2DLHA 4W9JC 5CEYA 1YMHB 3HZKB 5EZOH 1WD8A 3DVFA 4L1SA 3QR2A 1YHPA 2IPUG 5AD0A 1JZ7A 2YA0A 1R0AH 2H32A 2DMBA 4FNLL 4HT1H 4QRQB 5MEPB 1OCWL 1AQHA 3SGDI 4GI6A 4WCYL 5BJTA 1U8KB 3QWRD 1GJWA 5HDOA 3QHZL 4ORGB 5HHMD 3CXHK 2EIJB 1ZGLM 2O6EA 3NJNA 5LGHL 3LQMA 4QOKA 2YUXA 3GIZL 3P30H 3VFPB 3QXDB 1A9EA 3MYJA 4A7VA 4Q56A 1FZMB 2WLYA 1JGVH 3ZYJA 1J05B 3QI9A 4NQCE 1AACA 1XGQA 1ZHLB 5IB5B 1LQBC 5EU3A 5C07E 5L2KA 4AV5A 1XVSA 5FCSH 1BG1A 3TT1L 2XWRA 4AYFB 2AJZB 1L6ZA 2RFXA 1MIML 4Z8FH 2APBA 2AXWA 2WKOF 2EDQA 4PD4K 2ERJB 3BPLC 4HZLB 1NCBH 1UZ6E 4G8EB 4NQDA 4PGEB 4K3DL 5D7IE 3BGMA 5IUCA 2LLLA 5E6IC 3QORC 4X6EB 4KV5F 4D9QE 4PJFB 4KI5D 2XIIA 1A8JH 1TQBB 1NSNH 4K5PA 4P46B 3DDGA 4X7DC 4A6YH 1FAIL 1PZ3A 1INDH 3N9GL 1CS6A 1E5YA 5IW6A 3FSWA 4Z95H 4U3SA 5HHOE 1KLFA 2F74B 4OLEA 2ZSVA 2H7WA 4WKXA 4YSPA 3LKNB 5CJBA 3TN0C 4TM9A 3TO4B 1RUPH 4XMKL 3ZDXB 4A7QA 4GO9A 4IGBB 4KAQL 4XN1A 3VXRD 3HBQA 3LKPB 5D2NB 4Y4FC 1WO2A 5IROD 2COVD 3NGBC 2QQKL 5K1NA 1R1CA 4GW1B 3D2UB 2E86A 2FSEB 2GK0B 1JV2B 3RVWD 1WZMA 2EXYD 1FG2B 1A2YA 3MRFA 3X14A 1EO7A 5ITBH 4P4KC 1KJ2H 4LLAA 4GQPH 3VFMA 4YDIH 3BDXA 1X5GA 3E8VA 4BKTC 1BVOA 2BCKB 1NGQL 3V9FA 3KJ6H 1T4KA 1G1OA 4FQXB 4NO0A 4AG4L 5IG7A 1KTRL 4G43A 5GJSL 4V1DE 4AGQA 4RMQA 3P2BA 3KCWA 4MXQD 3FCBA 3X3GL 3BP5B 4A1RA 4Y9FA 3ZYIA 3TJPA 4OZGF 5FOJA 2WKLA 3QDHA 1VERA 3BLBA 1XTLA 2IPUK 2F54A 3PS6A 5CEYB 1VFAA 5IY5B 1NGWB 2Y5QA 5AW5B 5B39B 3BAYA 4LCCC 1AO7A 5EIQA 1RK0A 5DI8B 4NAMA 2LU4A 2H32B 4HV8A 5EO9A 3ZKMD 3AG3B 5KBLA 5C9JA 4L18A 1QSVA 1LO0H 1OM3H 2VDRB 3KPNA 4Y4HA 3G7TA 5E6UB 4X4KA 5I1IL 4OGXH 4Q9RH 3HFFA 1MWAB 5SWSE 4DVBB 4JRYD 1JV5A 4RQQA 2XWTB 5D1XB 1OGAD 2DM4A 4QOKB 1RZ7H 2MCPL 4EOWL 2O5ZH 2XQBH 1F42A 1DVFB 1QYGL 1OPOA 3PAVA 1A9EB 3MYJB 4PCTA 5F7DB 4OT1H 3UJJH 3VNYA 1IM3D 3QI9B 2NY1C 1AXTH 3BN9C 2HMIC 3GLDA 3D85B 2VR3A 3MOBL 4M7LT 3WENA 3B9KA 4A37A 3G08A 3BP4A 4ONGL 3U1PA 1JHLH 1KGWA 1N67A 1SLUA 4JHAL 4MNQA 4U1MA 4EZMA 3VWKC 3QULA 4FDWA 3BGMB 1X7TA 5TPWH 2ZCLH 5DA4A 2EXWD 5C0CE 1UM6H 2DM7A 4FL4C 5A43C 4KK6D 3P9MB 4CU6A 4JPVH 2VDQH 3MRLA 4UV7L 4DERA 5DJCA 5IW6B 4G9FD 1R3LB 3WOVA 1UEYA 4LSRH 1ZE3H 1TZIA 2ZSVB 4YBQD 4MJJA 4HH9A 3MRBA 2BHZA 4KUCF 4L8SC 4RGOH 3VG9C 2ZCHL 4ODTH 4UT7H 1HT6A 2XKNB 4JPWL 4KY1H 5C92A 3JWDC 4U0RB 4GY4A 1A5FH 1HHGA 1DJIA 2WXJA 3SBWA 3CZKA 3WIIL 4YSRA 4AKPA 4EN3C 1HEHC 1WT5A 4HGMA 2GEQA 1CGTA 2BXZA 3VFGL 3DMMA 1GCYA 2CAKA 4G8FA 3JV6A 4BSVA 3AS2A 4A2LA 1T0PB 3ULUF 4UTBH 2G4EA 2RIKA 1UOWA 3WFDH 3V7AE 4L4TE 3VI3A 5JIIA 1SRDA 2EE6A 2IIJA 3LB6C 4JFED 3FRUB 4X7SL 4QJ5B 1AQ8A 5KAQG 2C4XA 4XAWH 4JJ5B 4ODWB 3RL2B 4PJ9A 2CDEB 4WUKL 3WAJA 4G43B 5IR1B 1SXAA 4J2XA 4JUTA 3GZKA 3N5AA 43CAA 2FE0A 5TE7L 1T2QH 4NHCL 3Q8CA 4PTUB 3N85H 2XG5A 4K3EH 1QRNE 1FBIH 3WEAA 1DDTA 3SQBA 4ONFL 2FT6A 3GXIA 3FF8A 3OR6A 4HCFA 4Z0XA 5K9QI 3NVQA 1EHKB 5I1EL 3T1FA 4E0RB 1AO7B 4S1RL 1COBA 4X8JB 1G0YR 4HV8B 2AI0L 2ZIDA 1WPCA 5EO9B 4MGXA 1Y18A 3TA3A 2ESVE 2QGBA 3MGAA 3V6OE 1QD0A 3KPNB 5CNHA 3TNMA 2ZUUA 1L3WA 1SJHB 4BD4A 1PL3A 5FHAH 3U25A 3KS0H 5JPMA 1N3NA 5LBVA 2Q76A 2PP9A 3B5GA 2ATKA 5MP6H 4DW2L 1PTZA 3KH3A 1JJUA 2FWLB 5CLZA 2R29H 5D7KE 3X12A 1HEZA 3EFOA 4U1KA 4G8GE 2VR6A 2WSDA 2R0LL 1WA2X 3AJ7A 4OZHF 3TYGH 1BBJA 3VJ6B 2FEDC 5CSBA 3B9KB 3SN6N 2BVTA 5I16A 3VGAB 1KIUA 3OAWA 5FM4A 4FXKC 1F86A 3PRZA 4CJ0A 1NKRA 2YGVA 5I26A 5C0ND 3LYRA 4MNQB 4R4ND 1H9VA 1Q1PA 4YDLC 1P6AB 3QULB 5JHDA 2NX5D 2F0CA 5H94A 3VRJA 2CMRL 3D0VB 3DX8B 2BIIA 3MRLB 5J13C 5IQ7L 3HHMA 1CDBA 5J1TC 1D6VH 2E75C 3MRBB 3FNKA 5FDWB 5DJDA 1N6QH 2I32A 2HYMA 3K4AA 3D7PA 3RVXD 2R1YB 4TXVB 3ZKND 1CYXA 4KK5C 4C58B 3QJTB 4NKIL 3FH5A 3BIBX 2YAOA 3C60D 2UYLB 3IJ9A 4BSVB 4MZ2A 3GIVA 3UG4A 1G7HB 5DJ8A 3G6JE 4LCWD 1G7PB 2BK8A 1EMTL 1QWUA 2W9EL 5PCYA 1Q1JH 3FBKA 2PP8A 4JRWA 4ZPVA 4LCVA 1LO2L 1JTPA 3AABA 4IBZA 4HQQL 1L9OA 4HJSA 3ULVF 1TNNA 1JK9A 4AVKA 4JQVC 4PJ9B 3WG7B 3BQVA 1KYUA 3DX4A 3K4DA 3ARFC 5TDOA 1I1RA 3UYOD 2DQGH 3TNNA 2IAMD 1YEEL 2WAQA 5IEHA 5HPMB 1R3KA 3IGKA 4QLRA 5D7HA 3JYCA 4ANUA 2ED8A 3AXIA 2ZKMX 3F05A 1B4LA 5M95B 3C12A 4X6FB 5AZEH 3EO0B 1LYQA 1IKNC 4N4YB 5HVGB 3T1FB 3WGUB 5CZVL 3NFPB 5FF6A 5I9QB 1WFMA 1IEAB 2Q3XA 2GK2A 4HW6A 2ZAIA 1Q9OB 1KTKE 1Y18B 1DQJB 2XNAA 1CGWA 2F7QA 1AGFA 3K81A 4N2MA 3ZE1B 4HMCA 4TV3A 2W9LA 2EVHA 3NACH 3FFCD 4I8DA 3TNMB 1S46A 3CCHB 4FP8L 4ZUWA 3U1SH 3T0EC 3ZE0F 3L95A 1N3NB 1WQVT 4JPQA 4TULH 2Q76B 2YJLA 1KYFA 4PIRF 4Z7WB 5FO7B 1JZ5A 4E41E 1MREL 3O3AB 3DUSB 1T1ZA 5E08L 4FFZL 3X12B 4HJJH 1HEZB 3LN4A 4U1KB 1X5FA 3PWVB 4K8RD 1X6LA 4F7MA 3VX1A 4JGNA 5IMMA 1YNTB 4L3EB 1RPUA 5FUCC 3T3PF 1BPVA 4NM8H 2V17H 3CC1A 5DHVA 2CLVA 5CD3B 5I16B 3FSOA 3Q2NA 2AV1B 3VE0A 4Z7QF 4YXLH 3I6LE 4K7FA 3PV6A 1N8ZA 4L9LA 1EHLH 2GCYB 1ES0B 5BZWA 3WLWC 5JHDB 4WEBH 3LEVH 1CQKA 2NY6C 2QTVA 3O6FC 5B21A 1AC6A 3SIKA 5AAWA 5AZ2L 4QDGA 1DVXA 1Z5YD 2KQNA 3GEFA 4L05A 7PCYA 3RQ3A 5I0YA 3RWHB 4PMFA 4OBSA 3FQNB 2ZOLB 3RVTD 4M8RA 3UJIH 1LNUA 3X3FL 4DNLA 3B8YA 4XXWA 1HQ4A 1A7OH 4PHXA 2WQRA 4FFVD 2CBPA 4U1JA 4MJHA 1JMZA 4Y16C 3RTLA 3LH8A 1P2CA 5DRWB 1KBVA 4P5TC 1RSFA 1H15A 5EULV 3HKZA 4G7SB 4FFZA 2ZAGA 2XIBA 2Y06L 1W80A 3GSUB 2WZPD 3QJHB 1NINA 1R24B 1G6RL 1P1VA 1X7SA 5CBEA 5BOZG 2BSED 5FB8B 3K6SA 4M56A 1IKFL 5B3JF 4HBCL 2NY5H 1MHCA 3KPSE 1J48A 1JNHB 1RHHA 3M46A 4ZQKB 1M2OA 3GIVB 2X0VA 1GC1C 5DJ8B 5F2FA 3WAKA 4H8WH 2R4RL 3I02A 4Z78B 1QUNA 3HS0A 2BHFA 5JPNC 4LSPH 5EDXA 1NCIA 3Q2LA 5ISZE 5DTFA 5E8OA 5HI5D 1KWKA 2KPNA 3ZTCC 2VLJE 2Q8AL 3QIUA 1TOXA 4H26B 5CMAA 5ADPL 5TDOB 5HYFA 2O5YH 1A0QL 1AHWC 4U6HB 3PDOA 5FC9A 4ZMTA 4ZMOA 1XBRA 1FO0L 2V2TA 3EF7A 1XAUA 3WFBH 1JI1A 1K6QL 2GUOA 35C8H 3EJJX 2VZUA 3C2SA 3K2UH 1WITA 5FF6B 1PW3A 1G6RA 2CU9A 3MXVH 4GINA 4F37F 3T2OA 5AG9A 4I1NB 3DIDA 2XNAB 4JREB 2WOBA 1MCPH 1AGFB 3SPGA 4ELMA 1DP0A 2DQUH 4YUEH 2PWDA 4HAGA 3S35H 4DP8X 3FB7A 4AGPA 3WTYA 3QZPA 1AXSA 12E8L 4YHYB 4YFDB 4AC4A 2OTUB 3VFTA 3SE9L 2QQLL 3L81A 3WUWG 3L9YA 3QVAA 2BNQA 5KSBA 2NY4B 3BZFB 4GS7C 3K4ZA 4OKDA 3L2MA 3TS8A 2X12A 3UTTA 2JCWA 4EO5A 4Z7VF 4ZTEA 3VFRB 3FN0H 4F7MB 5IMMB 1SDYA 1D5BA 3FTXA 4JBSA 5EUOA 4KTGA 3VGGA 1NDGA 1FO0A 3VRIA 3MBXL 3RI5F 3D9AL 3GSNB 1X9LA 3J7HA 4PBDA 4H8UA 4U0QB 5DD5H 4AEHL 3QQ9C 5CGYC 5AL8A 1D3CA 1J9CT 2PLTA 4MS8C 4XP9H 5LWYH 3QUXA 4FZ8L 4K7FB 3V4PB 1A6AA 1AZNA 2N59A 4GRMB 5BZWB 3QFDA 1OCCB 5ABDE 5LNGA 1I8AA 4WW2A 2KZWA 5C0JA 3GSQB 5FM5O 2EDTA 5E1AB 1LNUB 4K9EL 2B9AA 5CZKA 3S8WA 1HQ4B 2BVOA 2XA3A 2Y6SC 4QXUL 2J8UA 3L5XH 5IB1B 1F18A 4KXZH 1JTOA 4PLJC 2YWYA 1P2CB 2CG9X 4G5ZH 1H15B 1MHEA 3ZTEA 4TUJA 1VFOA 2FR4A 1RJCA 3L3GB 1P5UA 4POZD 5E94A 3K6SB 2J25A 3L3KB 3LXUX 4O02H 1I9IL 3T0EE 3A67L 5T1KD 4QEGA 2HRPL 2VXSL 4D9QD 6CGTA 3I3DA 1RHHB 3WFEL 1T5WA 2HRHA 4WJKB 4WHDA 3ZL2A 3QUYA 1CDHA 5LBSH 4K2UH 3SYAA 2WQVA 4HJ0D 1YDPA 3BKJL 4JR9H 5HHOD 2EDKA 4W9FC 2YEQA 4DP0X 4N9GA 5E8OB 2IH3B 5D2NE 5FUCE 2DDQL 5D93C 5AZUA 1NBVH 4YDMA 4R4BA 2Q8BH 1NC4B 2V3EA 2ENPA 4OTXL 4ZO8A 3GSOB 4EUPH 2X0UA 2VXQH 4UAOB 4UQIM 3PDOB 1KGCE 1NBQA 3EYQD 4E68A 3ARDA 1AGDA 5I1GH 2YMXL 4Q9BA 3RY4A 1ZIAA 3F62A 1JPSL 3KXFE 3UADA 2GUOB 1EGJH 3LX9A 1IARB 4KH2A 4XH2A 2P5EE 3AB0C 3MUGA 5I1HL 1M2VA 2Z92A 3UTQA 1LK2B 2Q7AA 1JYXA 1UXLA 1KIRB 4IRSC 4Y0GA 4KUZH 1D7CA 3MJ6A 3S3DB 4ELMB 1KGXA 1RD6A 1U8CA 4PSPA 5EFIA 1FORL 4FQPA 4JRXA 2P5PA 4MMYB 4V1DD 5I30L 1AXSB 4OVVA 4PY8J 3T1WA 2XIDA 3SGKC 5DLMH 2OMTB 1ZWIA 2WQXA 3VFTB 1MPAH 2AAAA 1MFUA 4GP5B 5MI0B 1HH6B 2BNQB 4ZUVA 1F02I 4Z0BL 3ZPDA 4HJGB 5KSAC 1S9YB 2JJWA 1CGXA 2B9BA 4RFEB 3F6IA 2WQ8A 5C07A 1D5BB 5EBMA 2HP4A 3MBED 5DS8A 5IOKA 1KCBA 5BO1H 1DUZB 5D1XE 1NBYA 1OE1A 3AGWA 2NQCA 1DVUA 4P59L 1TVBA 1WA0X 4XNYL 1G9MC 1U21A 1LXMA 5SWSD 4DEWA 1A6AB 4LMQI 4S1QH 5GS1C 1H3WM 3WL9A 2EECA 1BLIA 4KKQA 4HHGA 4PRAA 4P57B 4QCIA 3VO0A 2N7BA 1BZ7A 1P4BH 1MN4A 1VGEH 5TE6H 3IBOA 4HWBL 4BGLA 3ZHFA 5CR1A 2HT2D 1GTFA 4O4YH 4ZTOL 3BPNC 1EJOL 5DK2B 5CBAA 5D72L 5ID0B 2CO7A 1UVQB 3FULA 3WS6C 2PUQT 4P23C 1DHKA 2VIRA 5B1JA 3RJQB 4ETYA 2D3LA 1RHFA 1F4XL 1MHEB 1GGIH 4QAWA 5C0AE 3HVNA 3Q01A 2DD8L 3MV9A 2VWEC 3WNJA 3ULUC 4KO7A 1HX0A 3FQRB 4XOAA 5TJWK 3Q1SH 5E94B 1P5UB 1X44A 4FE9A 3KLAB 2MKLC 1L0QA 3P2DA 4KH9A 4LSSL 3UZQB 4Z7OF 1GIGL 1EVUA 5ESAB 3DX7A 1R0AL 3ALXA 3LSOA 1U4EA 3NIDF 5INDA 4X9IA 3S88L 1ZS8A 3BDYH 3QUYB 2WYTA 4YHIA 5DD6A 2L7UA 1BQSA 2R39A 3ZO0A 4ZFQA 4OZFG 4QRSB 4FA6A 3UTSD 4PM1A 1NIEA 1IGIH 2KLRA 2VDLH 2GSGB 4PHZA 3B4NA 4R4BB 3IDNB 4RGMC 5IQNA 4BM7A 4HWBA 2WZAA 1H3XA 4IJ3B 3QZBA 3ARDB 1J0HA 1R17A 2OJZL 3MXWL 3U6XS 2AHIA 4B60A 3VD4A 1WP6A 4OUOA 4NKMA 1JGUH 2VDNH 1YC7A 1RJYA 3PL6D 2ZOUA 2W9DH 5CCKL 5J12B 1JGEA 4XH2B 4A7SA 2AEQL 1M2VB 3K8MA 1A65A 2WXQA 4NQSB 1DL7H 3Q1EA 4O2FA 1IE5A 1SJMA 2IWKA 5AB2A 3MKKA 2YD2A 4WO4B 5EFIB 1U8CB 1OAZL 4PJ8A 2W0FA 4FXGB 3ECUA 5IJBC 1XGYH 5T1LA 3IGLA 2C1OB 4N0RA 1CD1A 2D3NA 4ZUVB 4OW6A 5AUMB 3QUKA 1GGBH 5DQJA 4HALA 4JY6B 5CUSL 5EUKA 1DVSA 1M6OB 4PRPB 3ILQC 3BSGA 4P06A 2DWYA 2QL1A 3IDIA 5I5RA 5DS8B 1MRFL 3RIAF 1FDLL 3LKQA 5DO2D 1OT2A 2ESVD 4EIZC 4R96A 2P46B 4HFUH 5T3ZE 3SJVD 4XMZA 5D7SL 2MOGA 1KTDA 3UTPE 4QJ4B 3R8QA 4JFDD 1TVBB 3BRDA 2FX8H 1GW0A 3SEPA 4FI6A 1H8LA 2EDXA 5C0CA 4ZX4A 4I48B 3C87A 1AJ7L 1QNZL 1Z5LA 1KG0A 2YS4A 3G6AA 5D7JA 4KK9D 3K72A 5D7KD 5B8CA 4JZJC 1SUHA 4G8GD 1ZCRA 4NWUH 4LL1A 1U8LB 2H1LM 4F7PB 3JQOB 1BQUA 5CD5C 2VIRB 5J3HC 1TJHH 4DH2A 5HGBA 4ABVA 5I1AA 2P43B 4AK1A 1ORSB 4ODSH 2DJSA 3MV9B 3QRGH 5IQLA 3BE1L 3QFJB 3WJMA 2HG5A 1BFVL 3RILA 3CVHB 3AROA 3RWFB 3MLRH 3UO1L 5TK2A 3ULVC 2KHAA 2XUWA 3LSOB 4ZX6A 1R3IL 4JE4B 2NR6C 5HI4C 1DBBL 5DGQA 5EOTB 3BCFA 4D0BA 4LVNB 1HHJA 1R34A 3BVTA 1ILSA 4L4TA 4W9GC 5I74C 4MQXC 1MCFA 5E00B 1S7VA 3AMLA 3FRPA 1FJ1B 4ZX5A 5IHUH 1VB9A 5TQ2H 2JJTC 2H1PH 2P48B 3M7FB 4E9TA 4X4ZA 1ZGLA 5C0BB 1K4DA 1QRNA 4X7EC 2VNCA 3UBFA 4F3FA 3CVIL 1YEGL 4WRLA 3ZDYB 3QORA 1WICA 2Y69B 3BGAA 4HWZB 4JVUA 4NKMB 3TEZA 2P9RA 5A2JH 1RJYB 4GAGL 3OC5A 4Y5XC 3UL4A 1LILA 1JFHA 2GKIA 4WIQA 3A5VA 3H2QA 1K8DA 1EJFA 3TFKD 2UWEA 3FUNA 4LLYB 5JXED 2AVFA 1NL0L 2WP3O 3DV4B 3LD8C 2D0FA 2EH8H 1F4WH 4ZDHA 4P2RE 4DUXA 2ZWSA 1ROCA 1U8HA 5FO8A 2W0FB 3BT2L 3TN0A 4DN3H 2FDBP 3WUWA 3HPLB 2EIZA 1N0XL 1IBYA 3WIHH 4N5UA 5T1LB 1S7QA 4UB0H 3W11C 3HE7D 4Y4FA 1MW0A 2X89D 1ITBB 1I7UA 3GI8H 3P1VA 4QAMB 4PJAF 3IFLH 4FG6C 4GXVH 4M5SA 4UF7C 2ZNXA 3ASNB 2OMYA 1BVNP 5EUKB 3ZE1E 1DBJL 1A1OB 3NUKA 1E42A 2FL5B 4P4KA 5E8DH 5F88A 3SPJA 5EBWB 4NYLA 2JH2A 4WFGE 1NGPL 4KDTA 4RISL 4RMUA 2LGNA 3SY6A 1KTDB 2H2PD 2YD0A 4Z7WE 1JHTB 4PRIA 1S5IH 3L6FB 3FC8A 3VA2C 4HPYL 5D6DC 3LEYH 2WTRA 1HAUA 2R15A 1N5AB 1Z5LB 4TOYH 1IVTA 2K1MA 1WTGT 4L3EE 5BVJA 3G6AB 2UZXB 1A14H 2ITDB 4Y1SA 5D7JB 4RETB 2A4CA 2WQSA 5E5MB 5I23A 1KN2L 1F58L 4RESB 1ILUA 2VQ1B 5ILTL 4JKKA 2K6WA 2E0PA 2I60L 4Q6KA 1PPIA 3V0FA 3HG1E 4LCCA 3SE4C 4BE6A 2LQRA 1UT9A 1UWFA 2YRLA 3WHE1 2AW2A 5I1AB 2RJMA 4LO9A 1NFIA 4ACTA 1EH9A 4N2CA 4GG6F 1HZLA 2JKJA 3D2TA 3I6LD 2X38A 5D71H 3S5YA 1SM3L 3HC0A 1F13A 3C5JB 4G9DA 2OAAA 2YIHA 5FUZL 4OZHE 4X9HA 2FATH 3UYPB 5KANG 1W2KT 1CQYA 2A83B 2D4FA 5H37G 4AL8L 4FQ2L 3CFKB 1KENL 4IQHA 1UQSB 4W9LC 5AL0A 3BFOA 3T2PA 1B4JL 3FRPB 2IALB 1PZ5A 3CFTA 4XT1C 1MJ7H 3BVNA 3HS8A 1ZOXA 4B6ZA 4JNXA 3N44B 3VXME 1F4AA 2Y1AA 2AABH 1E4XL 2JVUA 1NIFA 4X5XB 1K4DB 3BAIA 4YS4A 5I5JA 4WHCA 4K3JH 5BRZA 4JY5H 4F3FB 3VWKA 4YSCA 5ERWB 1BF2A 1KFAL 1RP8A 1FSKC 5HDQH 1EQWA 4YL9A 4EQ2A 5IJDC 1HI6A 4JM2B 2XXGA 1K8DB 2HFEA 2ZG3A 4G3YL 3ZRSA 4LPTA 3W38A 5ISZD 5HHQA 1T20A 2O61A 3X1GA 4GRWE 2D7PA 4KKNA 5FO8B 4HG4J 3FQTA 1UOLA 3WEOA 3WUWB 4AQ1C 4ELKA 2EIZB 2GJJA 4F8OA 1S7UB 2DTML 2NY2C 3D51A 1S7QB 3N43B 4I2XA 3GZQA 5D1ZD 4AENB 5AVZB 5JW3H 1HHIB 1I7UB 4P99A 2X40A 3ZGHA 4HUKB 2PO6D 2XX1A 2IBBA 4QPEA 2G3NA 3HMWH 3AWGA 4WENB 4IJTA 3FYIB 1OSYA 5D2LA 3QG7H 4HHAB 2WLLB 5I8CA 1CFTB 5F6IC 5F7EL 1P7HL 4X5PA 1JGDB 4UDTB 1NKOA 5F7WC 4IBLT 2QDWA 3LXAA 3C8KB 1F6AA 1EERB 3CXDH 3WSQH 4PRIB 2PCFA 2E8ZA 1SDDA 2W0LA 1FUNA 2C7UA 2BP0A 2DBLL 3FB8A 3M88A 1RZ8A 3F12B 1CU4L 4HUXA 2AQPA 2YKLL 4YDKH 3D33A 5BVJB 2OMNA 2I9LA 1EX0A 1JNNL 2FEJA 5CILH 4FNUA 2D73A 5ANMA 5DYOA 3T08A 2AEPL 3GMLB 2E7DA 4WU5A 1AHMA 4KU1A 4NC1C 4KJPC 3E1F1 2BSCA 4LCCB 1KF9B 2ENSA 3ZE0E 3HJEA 3WYRA 3QNZA 3WBDA 4XC3H 2AXGB 3ARGC 3RX5A 4KKLC 1NFIB 3KZ8A 1K85A 4LCIL 3A0OA 3D18A 1J1PL 1RUMH 3J07A 1MFCH 1IGFL 2LLNA 4G9DB 1NKGA 4OF0A 3HUJB 5CLYA 1WH0A 4P05A 3T3PE 1YYLH 4PJXF 2IPKB 3BUQA 1DANT 4K0OA 2VE6B 3HI1B 3L7FA 4HAFA 1DN2A 4TQEL 4OZFA 4XVSH 4M8UA 4DQOL 4WWNA 5CHNB 3BN3B 4JQIL 4XCCH 4YDJB 4Z7QE 5LXGL 3PYCA 1NAMH 3DRTA 4WHYG 2AXFA 3RKDD 2VL5A 1V10A 4GXFA 4TNFA 1EZSA 5D9SA 5CM1A 1OW0C 3VFNA 1BZ8A 3LPWA 3FO9B 4LLMA 4J3UA 2VDKH 1ZXKA 1TJIL 4P46D 5FGSA 1MW3A 2VLRB 3KR3L 3L5WA 2FBJL 3JTTB 5BRZB 5HDLA 5DUPL 3VWKB 1TITA 1R6VA 4K94C 3QK0A 2WO2B 1Y6KR 4K7PY 1KMGA 3JZ7A 3PIQA 3TO4D 4H4NA 3B2XA 3NCMA 1N2RA 4IGBD 4K73A 2OM5A 5HHQB 3KWTA 3EBIA 1DQDL 1Z32X 4B53A 1GJIA 3FQTB 5C2BL 2WUBH 2PN5A 3D2UD 3S3CB 3BKCH 1ID2A 2HTKD 3FQUA 3OR7A 1SXNA 3WKNA 3V6BR 1KGCD 4AGMA 2AQRA 3QUHA 4JQIA 4N22A 1NTDA 4K7PL 2A74C 4FABH 2ICWB 4XB3A 1TSRA 1FNAA 1Q9WA 1N0LA 2G5BA 2Z6FA 1MCNA 5D2LB 5I82A 4FQXD 4BH8A 2FJSA 5DFVC 2N01B 4G7QB 4UCFA 3WNIA 2A9NH 4TLSA 3VSUA 3BRGC 3U4BH 4OGYH 4O58L 3QH3A 1F6AB 3OL2A 2UXGA 1RZGB 1NMCC 1RK1A 4NUGL 4R4FL 5KVGE 1ZLWH 1IB5A 2PCFB 4M3KB 4YHZL 3NIGB 5E1IA 2J12B 2C7UB 3ARFA 3QR0A 1RZ8B 4LLVA 4MJIB 3PWNB 4YX2L 3VG0H 4BFNA 1PZCA 4IU2A 3S5ZA 4QRPB 2WBWB 2I9LB 1SQMA 1UWXH 1AZUA 1HE8A 4UYQA 4DFHA 3TEYA 1KDIA 3OKLB 5D7EA 1IKNA 1JWSA 2P24B 2AK4A 4B27A 2FUQA 1URZA 5KBKA 3F7YA 2BMKA 4KWUA 3FL7A 4KI1A 5D1XD 4HS8L 3AT9A 3GYRA 1B3IA 4I13B 5HYQA 2BH0A 4QOKD 4WKZA 2XZAL 2OMWA 4F9LC 1JS4A 4NKOA 1EO8L 1W0YT 1F56A 1DVFD 4XBEL 4TNEA 4Y5VC 3VYOA 3TLRA 3D18B 3T0EA 4OFKA 4DGYL 2XV2A 1L0PA 2MMXA 3QI9D 4LCUB 2J21A 4M9OA 2JCCE 3BD4A 3EUDA 3KPOA 2CXKA 3D85D 4PCYA 3UAJC 3VB8A 4H20H 2QVMA 2YXFA 1PY4A 4OZFB 4PFEA 3VQMA 5K9KB 4H8PA 3CFDA 1QFWH 2IFGA 4NERA 4KXCA 4NJAL 1TU2A 1AFVH 4X6CF 1IC4L 2ZSWB 1FH2A 1A1NB 4H40A 2OXHB 4BA8A 2G60H 4KPHL 4EBQL 2VL5B 1XZ0A 5D9SB 2CK0L 3VFNB 4I77H 4KKCD 2GITB 4LLMB 1GC1L 1NDMB 2R1WA 3FU9A 1Z6JT 1AIZA 4F8LA 3O6KL 4NZRL 5DR5H 3L5WB 1A6UL 1FNEB 1G5GA 1T6BX 3L9RB 2BY1A 2ALWA 1OCOB 4HIPA 3H56A 1FIGH 1RZJC 3CUPA 4WK2B 4X4YA 3O3EA 3NN8A 4IIZA 4KTDH 4LIQE 2B16A 2G2PA 2LE9A 5E5RB 5GGTH 2FEEL 4DUWA 2Q7YA 3PIQB 3IXTB 2VMEA 3UMNA 1EJ6A 1N2RB 4ANVA 4NC1E 1C5BL 4AGOA 1AANA 5JIPA 1DR9A 2CA3A 4Y16A 3EYUL 3JT2A 4P5TA 2DH3A 2YPLA 5AOIA 3VX0A 2QTEA 1DQVA 1Z9SB 3OR7B 2Y2YA 1GOHA 3STLB 4L29B 1KACB 1CFBA 2A4EA 4NN6C 4YMPA 4A7TA 3IJSA 3ETBJ 3MLSL 2XA8L 4DVRH 3OKMA 3SDAB 5HPOA 1Q9WB 1N0LB 2KDGA 3ILPA 3NEXA 3QZLA 5I73B 4R7DA 2K78A 1E7UA 3V0EA 4H13C 4XP5H 3E6FA 3KG5A 4QRRB 2HT4C 1Q72L 1ZVYA 5JPNA 2HFTA 4U6TA 3VD9A 3H53A 1QLFA 3V6ZA 4UQ3A 5CJXC 1M3IA 3HB3B 1RK1B 3BUPA 4GSDL 2WYIA 5ESVA 1WWCA 3HNSL 3IAQA 4LLVB 2Y2WA 4FFTA 1AHWA 4R7VA 1R9FA 3KPRB 1AO7D 4IU2B 4PRPE 4M62H 5EH1A 4MB5A 4E9QA 2XYBA 1MRCL 3O81A 1J9RA 1U2HA 2VDOH 4FD0A 2PW1B 4CSPA 1I1YB 2DWDB 4JG1L 3S5LA 4PS4H 1S9WA 2AK4B 3IU4L 2BMKB 3OAUL 1G0XA 3PWPA 4XOBA 5DT1L 3S34H 4IBUA 4Y8DC 2G3XA 2IWFA 4ALAH 3GNMH 3D4ZA 3S48A 1VGKA 4PGBA 4DP7X 5EZJA 2PPDA 1JZIA 2P8PA 4WKZB 5E4EC 2OZ4L 4XMWA 4W9KC 3W39A 3FS9A 3VCLB 3ERXA 2XWJB 2BNUB 2EAEA 1PD1A 3BKYH 3T0AA 1CD9B 2FBOJ 2P5WE 1SVCP 1UH2A 2H0PA 1M7IA 1NBZB 2J3SA 4MXWH 1EZVX 4TVPL 5H37A 1BFTA 1CLZH 2WBJB 1J0IA 4BFOA 2WLIB 3B9KD 5I0XA 1RMFL 4JMNA 4M7LL 4N6RA 5DRNA 3EBAA 3L16A 1URIA 3ME0A 4G11A 4XO5A 1JNLL 2VTFA 2WKOA 2O4EA 3CFDB 4YZFF 2GIMA 1WAAE 2BVEA 4MNQD 4O9HH 4WU7A 4D8OA 5D8JL 1TENA 3OKYA 4BFIB 2B2XL 3MRNA 3GBML 1QPKA 2FLRT 5C09A 5GS0L 1XZ0B 1YVLA 1B2YA 1NJ9B 3H2PA 3OHXC 2R1WB 3B9AA 5DC4B 1FV1A 5CXPA 1J5IA 2CO6A 3T0XA 5F7NC 4GKSB 1W0VA 2DB8A 1HWHB 5T3ZL 3DECA 2J8OA 1GS8A 2NY6B 3P4NB 3RGVC 4U1NB 1U8PA 4DJMA 5JXAL 3P73A 1TJMA 2P7TA 4OLZL 1U3HB 2OZ4A 2Q7YB 3RP1A 1F45A 3O0LA 5IFAL 4BQ9A 5F9DC 1KEML 3B2VH 3T0DA 2UXTA 5FW6A 2QVFB 3BVVA 4P9HC 3KGRA 2DMCA 3DUHA 5C0BE 1CL7I 3MACL 4A55A 4Z7OE 1H3PL 3ZDYE 3FTGA 4PD4J 3UIYA 3IF1A 5KYXA 5AENA 3EYSL 2FECL 4OD3H 4QY8A 1G94A 1BJ1J 3DHMA 4IKNA 5FO9A 4F80A 3WO4C 2D7TL 2YD9A 4LARL 3OKMB 2MOVA 3HZYA 4HAKA 1FZOA 2B8OT 3ILPB 4PJ9D 5KVDL 4AI7A 3FO1A 3S35X 1HCZA 2FQEA 2J6EL 2ZUQC 3Q6FA 3E6FB 3QUGA 3D25B 5J1AA 3FONA 3BP6A 3S98A 5GZNC 1O6SB 3BAEL 4MAUH 5JPNB 3LNEA 4HC1H 4OZGA 2AS5M 2NNFA 4UQ3B 1VFBA 1JZ3A 3S4SG 4Q97A 2JLLA 1UJ3A 4Y88A 3C8DA 5ESVB 4K5LA 1CURA 2DQEL 2KZ1B 4JDZA 1XGTB 5IBLC 1G43A 4WSKA 3SDDB 1AQKL 3KLSA 2GJRA 5JDJA 4ZO9A 3SQRA 1CXKA 4RMWA 1VKXA 2HVJA 1J7VR 1F0LA 5GJTL 2VUYA 4LPXA 3MNWA 1BOYA 2Q2LA 3QIBB 3E38A 3CV5A 4XZ4A 2BCMA 3PWPB 2LVEA 2R23B 4XI5C 4B9IA 4PGBB 3QCTH 4IRSA 5MEQA 2P8PB 2DKSA 3ZQ9A 2AFNA 3EFFA 3K2IA 4N2HA 3W39B 3IKKA 3K6OA 2YLHA 5EMYA 1F1GA 1YNKL 2J6EA 3SGKA 2HRLA 1BMGA 2Q3AA 4L3ED 1A7NL 1ADWA 1M7IB 1P1ZB 3QS3A 4KHTH 3U46B 4HXBH 4N6RB 4AVJA 3ULUL 2AEOA 3ME0B 2NNAA 4UQAA 4ZO6A 5KSAA 3LKRA 1I9JL 4ZNEA 2X4RA 5AVYB 5GRVL 3Q2VA 4AMXA 3Q8FA 3MRNB 1PQZA 3LH2L 2F9BT 1KGIA 4TMPA 5JHDD 3NK3A 1HN1A 5D1ZI 5A3IC 3S96B 1FV1B 5C08A 3AG1B 2CO6B 2QZQA 1W0VB 4M6NH 1PCSA 2IBZX 4YE4H 4XX5A 2EIKB 5CEZL 1P7QA 5GS1A 1EO5A 4FQ1H 1HDMA 1U8PB 2ADFH 3HW7A 4P2CG 1OXYA 4YDZA 3P73B 5GRJH 5EU5A 2NXZC 4JDTH 1EAPA 2C9PA 3P4MB 2YPVL 2CH8A 2AERT 5KBNC 2DICA 2A73B 3NTCL 2FX7L 2H32H 4N2BA 5LGYA 3WS6A 5FYLH 4XVTH 4FLRA 4P23A 4ZFGH 2IFFH 1DSYA 3DDFA 4MLIA 5KVEE 3FTGB 3QZMA 1NM9A 3DO7B 1ZTMA 4NBYB 1VSCA 1HXYA 3LZPA 3IF1B 2IPTH 5KYXB 2OYMA 1DQLH 4QY8B 4A67A 1G7MA 4KOBA 2WXHA 3UGUA 1CDYA 1USZA 2JIXB 3BLPX 1GYAA 4L4JA 3HZYB 2WNKA 1CGSH 2ZXAA 4XP1H 2YXVA 4DOHB 1FZOB 5TGBA 2OSWA 2WTPA 4O5LH 1SBSL 2BP8B 3Q6FB 2QSCH 2P8LB 3FFOA 4Z77B 5LUMA 5J1AB 5DJYA 2UV3A 2CE6A 4TNWK 5GGSA 1MJJB 2I5YH 4AIXA 4TVUA 3EJZC 1UJ3B 4FQHA 5C70A 2VB5A 5D5MB 3TEWA 1O9WA 4K3HA 2YPVA 3OAYH 1J8HA 2XZZA 3ARTA 1MLCB 2Z0UA 4RAVA 5HBBA 4KZ0A 1BZOA 1WWAX 5KSVA 1OCWH 1RZIA 4WCYH 4Q6IC 2ZX9A 4PJBB 3QHZH 4P5RA 3HG1A 3B2MA 4ZMQA 1QOKA 2XVLA 3W5NA 1KNOB 5LGHH 3BC9A 3QBTB 3WXVL 4UIKL 4N2DA 1HQRA 3GIZH 5MEQB 5EBLB 5T3XE 1R5VA 4WF7A 2AQNA 5DVLA 2EJ1A 3QCVL 2UY6A 1XR8A 3GJFK 2KS0A 4OZHA 5CO1A 3CN0A 3THML 1WRFA 2WOYA 3TT1H 1A7RL 1JUFA 2X3AA 1KLUA 1T0NA 3KJ4C 1MIMH 2NNAB 3C6LB 4XP4L 4PI0A 2XPYA 1F3DJ 2FT7A 4DETA 2QQNL 1GGUA 1ZHKA 4K3DH 4MDJA 5JW4N 1PQZB 2X3CA 3ULVL 2CJSA 3CZEA 3LDBC 4TUUA 3FPYA 2YPKA 4ODUB 2IGFL 4Q9CA 3N9GH 2E9JA 5C08B 4BSJA 1OSPL 3HZMB 3UBHA 1AZRA 1QLRB 2WXGA 5AAMC 1XF4A 1P7QB 1UG9A 3NQIA 3B7YA 3DHJA 3GGWA 1UM4L 3OKNA 4U3HA 5DRZA 1HDMB 3DTUB 3IN2A 4CAGA 3OG6B 1CCZA 4CMHB 4RSVA 1EAPB 4XMKH 4JZJA 4PRBA 3EJYD 4LOVA 1NFDE 4KAQH 2VW6A 2NQ3A 2WSKA 1DJXA 1G7LA 3BPNB 3BWAB 4UOJA 3S6CA 2QQKH 3SO5A 2AQSA 5HI3D 2BNRA 2VLRE 4M5YL 2WQAA 2I7OA 5KW9L 2RB8A 4U1IB 1OEZW 1HXYB 4AIZA 2BJML 4F2EA 1MCSA 3BGFB 3B3BA 4B7IA 3RDTC 4HIXL 1NZRA 4MMXC 2CBQA 4FX5A 4GQZA 3EUUA 1NGQH 5TDNA 4DAGL 1G4MA 5D1QA 3EGXA 4AG4H 2NR6A 5GJSH 1CTNA 5TGBB 5CIPA 1NC4D 4OFYA 1NEZA 2F61A 3X3GH 2YBRA 4XMPL 3ATEA 3QJFA 4OY9A 1FQ9C 2QGCA 4Y2DB 1OSEA 1T7VA 3IGFA 4H0GA 4MJ5A 5DJYB 4CU8A 5C7XL 5GGSB 2WLHA 3ZDZF 1BQRA 3A4EA 2JJTA 1P6FA 5CKGA 1J8HB 1UCTA 4R2GC 1YSOA 1JXDA 3ZT6A 2X4NB 2FO4A 5E2UL 1IC0A 2DS4A 1SLVA 5AW6B 4R0LC 2IAAC 3NAAL 2Z31C 5T1MA 1QSEE 2QV4A 1L0XA 2JKLA 1AIFB 2ZOKA 4XXDA 1B0RA 1S9XB 5I1IH 2UVEA 3CNKA 3VGEA 1MZYA 4Z6AT 3G6DL 5CR8A 1BX2A 1R75A 2PTVA 1JN6B 5ID1B 2MCPH 3MRJB 4MJIE 3D39A 3TV8A 4EOWH 3NSYA 5I1LB 1QYGH 4QRPE 2BNQD 4WWKB 4DPRA 4W81A 4EE2A 4GBXC 3QAZC 5BV7C 2G2RA 3P9LA 4HCGA 4TSBL 2N7AA 1TZOA 1PSKL 1YEIL 2R0ZL 3GF8A 3MOBH 4BA0A 3DV6B 4FFWC 1BOGA 3DUUA 1KGUA 1GSKA 3QEQE 4ONGH 3RYMA 2W07A 1AI1L 1KLUB 1UXMA 3VFSA 3QPQC 3Q2WA 4JHAH 5GGRY 4PP1D 3TV3L 5MERB 4R7LA 1E6OL 2EEBA 4WNQA 3GMQA 3FOMA 1INDL 1R5WA 5B7FA 4UV7H 4GXUN 5E5LA 2X28A 4ZSOB 1QBLL 4GUOA 5D6DA 2KMWA 4XHJC 1D6EA 1NMAL 4X99A 3GGWB 3N42B 3T77A 3GJEA 4UM9A 3BW9A 1EEYA 2ZCHH 2E7BA 2V3FA 4OJEH 1IM9A 4JPWH 3IS1X 3I6GA 2QR0B 3L1EA 1SF5A 4PRBB 4CGTA 1IAMA 1OO2A 1A4JA 2OMUB 3O2DL 2DMKA 1G7LB 5KYWB 3SE4A 3WIIH 1MFAL 3NRFA 3GB7A 4Z3TA 1OQOA 2CO4A 2BNRB 5IB2B 1C08B 2X4PA 5FFGA 2NPLX 3VFGH 4ZFZA 3ETSA 3NPZB 3RPIA 4YK4B 3BH9A 1KJ2L 5BVPL 1RZKH 4AIZB 5C3LD 3KPMA 3QUYD 3BQUC 4X4ME 2DWEB 3KGSA 3FUHA 4LGPB 3MU3A 2FLMA 2Z4QA 3HZ3A 4X7SH 3KWVA 4JM4H 2CRYA 1FCCA 2H26B 3LEXB 3R0MA 5FWQA 3VTTA 1ASQA 5D1QB 1A6TA 3IVKB 4WUKH 3CH8A 3TZVC 2XOTA 5JIQA 2BSRA 5TE7H 1TXKA 3IMRA 1LMKA 2NYKA 4NHCH 4UYPA 3G04A 3S4SA 3SCMC 4R6UA 3ARDD 3IJHA 5GGRA 4TKWA 1W8EA 2Y22A 5I1EH 1R33A 2GUYA 2Y23A 3H55A 3MRCA 3O2DA 4HIJA 4Z7UB 2VDML 4LKXA 4S1RH 4DTGL 3KLHC 2CBMA 2Q86B 2WLKA 2AI0H 1BJ1H 2NQDA 1N19A 1ZVNA 3GTNA 3RA7L 3TO2B 5KS9F 4H0HB 2DYSB 5I24A 5I19L 4QRRE 3VXPA 4WO4D 4OGXL 2GC7C 3LIUA 4Y4KC 3UXFA 5B1CA 4P9ML 4LIQL 2CJUL 1QSFE 1BX2B 2JFCA 3OG4B 4Z9KB 3NJKA 2JXMA 4DW2H 1ET7A 5L2JA 3UMTA 3OAZH 4JFOB 1E8YA 2WVVA 3IN0A 4Z7VA 3GJFA 1TCRB 4BELD 4Z3EA 4AQ1A 5DMKB 2R0LH 1PF3A 3I50L 5HDBF 5KN5A 4PRPD 3MRPA 1PJ9A 4BHUA 4HHWA 2IH1A 4WEMB 3WV0A 1RZQA 3RIAK 1C1EL 5AWNL 4XBPA 5CN3A 2CIKA 4LSUL 5CJOL 5EORL 1E67A 3JUZA 4OJDH 4UQ9A 3MNZB 4G7VL 1FVCA 1D5IL 5HVHC 1RPQA 4N0UB 3QDGE 2HVKA 4YC2B 3PABB 1OP9A 4Y5YC 3AAZB 4YE0A 2VABA 5AKSA 4RGNE 3AS1A 4HOXA 1J8SA 3L4YA 1R5WB 2DLIA 3H4HA 3LN5A 3PJSB 2CMRH 5CZXD 3OGOE 3C5SA 4M6AA 4E9YA 4MHHI 3O6LH 3IRPX 2XKUA 4LP5A 2VZSA 2P5WD 3FO0L 5IQ7H 1D6EB 4DK3A 1N5YL 1WF5A 3T77B 2OMXA 4FQJL 4QYAA 4UTAL 1IM9B 1A5FL 4MA1C 1PFOA 3TBYB 2FHFA 1A4JB 2OI9B 1IX2A 3FT3A 3MV9D 2L7EA 5D7LE 4NKIH 5DDHA 5CP7B 3GB7B 1XH1A 3QFJD 5KG9B 2X4PB 3MGTA 4RNRA 1XCWA 4ZFZB 4NQEE 4K94L 4YBHA 3PJLA 4AT6B 5EC1B 4KGJA 5EZIH 3ARGA 4M1CD 3DOSA 4QF1A 1EMTH 1XH3A 1CIUA 2W9EH 1OARH 3CHQA 3KPMB 1B0WA 1LO2H 2WNWA 3JWNC 4HU8A 1EDYA 4HQQH 2Z4QB 1EDHA 4YHKL 3WD5L 1U3YA 3QPXL 4PRNA 3Q48A 3MUUA 5EV7A 1A6TB 4A6YB 4PCKA 1Q94A 3U30C 4MCYB 4ANKA 2PWHA 3N85L 1YEEH 3G04B 1NMBL 3S4SB 1M9WA 1FBIL 1AR1B 5C0BD 5GRZA 3MHZA 5DHVH 2XJLA 2VXVL 1Z3RA 2Y9RT 3IJHB 4HLZH 4CVZB 4OM0L 1V27A 1TZGL 4TNVF 4UTAA 2GHWB 2DLGA 5HGGS 4KKBC 1OW0A 5CZVH 4NO3A 3MRCB 1KTLB 3EH5B 2VZOA 3IE4A 5CINL 2WB7A 2J88L 2C9QA 4ODVL 1KZQA 3FYEB 4UANA 3VXPB 2IANE 4APXA 3ISRA 3WNKA 4FP8H 2C3GA 4KTYA 1KJ2B 2H0FA 1QBBA 4JFVA 3CFJB 4PJGF 3W5MA 4RMTA 2BINA 1FVEA 3VXQA 2YJQA 5T1LD 2XFGB 3QQ4A 5JO5A 2JXMB 1EA9C 1MREH 3RPKA 3KDPB 3U6XA 5A2LH 3RL1A 5L7XH 5E08H 4FFZH 4TUKL 1MI5A 3D1MC 2WVVB 3U82B 4Z7VB 3DNKA 1SZNA 3GZPA 1TPXC 1CPUA 3EH3B 4AQ1B 4JN1H 4FLSA 5KN5B 2AANA 2X5PA 5BS0E 3NSXA 3TVMC 4XCEA 4EUPG 3KWWA 5DJAB 3H9SA 3V0IA 3HC2A 1CLCA 1IBBA 4XBPB 3PWJA 2W5PA 2A6KB 2NXYC 3RIKA 1DZ0A 5DEFA 2G5RA 1TKWA 1SMOA 4DSYA 4KRLB 3P0GB 1JRHL 3TBVB 2HVKB 4LLUA 4QRAA 5AW8B 5F3BA 5F70A 5AZ2H 3JYBA 2W91A 3KCPA 3DBXA 3I9PA 1KBPA 5D7JD 3X3FH 2R1XA 4X8XA 3C5SB 3SGJC 5F7KC 4OFVA 3FUKA 2PW2A 3KBHE 4OM1L 5F7UA 2XN9A 3H3BC 3MGOB 1N6QL 2WGNB 1ZT4A 4XVUC 3V0JA 4M1GL 3L2LA 3QDJE 4H88L 4ZXBA 4L1DA 5KJ7E 2Y06H 3SQOH 1VCAA 1KCLA 3L08A 1PKQB 1G6RH 4R97B 1F3DH 3BDBA 2H8PA 4OD2B 5E5UB 3LPOA 3BAXA 4HBCH 3MGTB 5IK3A 4C56E 4RNRB 4KZCA 2VXUL 1RZJL 3T6VA 3M07A 1OZUA 4FMFA 3RY6A 5FYKL 43C9A 2PWGA 5ICZA 1XH3B 1A21A 4N0YL 4N2KA 2R4RH 4JO2L 4U1GB 4F9LA 2V9TA 1IAII 2IDFA 2VQ4A 1QPPA 4Y5VA 3T6QC 4N2IA 4PBXA 4YZFE 1AGEA 3AREB 2D2OA 4Y9GA 3ZMRA 3N40P 3VSVA 3IEAA 1ZEAL 5F7MC 1SYVA 4QWWC 2Q8AH 2A3TA 3NIFF 2VDQB 3GXNA 3FUEA 4WK4B 4I4WA 1Q94B 2G9KA 4BJLA 3V0WL 3I9IA 4ZUUB 5AB9A 1BV8A 1A0QH 1CDIA 1EZUA 1NGZA 1PX4A 1RERA 4TTGA 1G9NC 5C0DB 3OMIB 4X7CC 3T4YA 2DMHA 4J3XA 1FO0H 4CC4C 4XCNB 4AYID 4XGZA 3MRKA 1J8RA 3T0WA 4X6DB 4XODA 1DVZA 1ZAGA 1K6QH 3AMKA 3ESPA 3W9DA 1I4FA 3B2UC 3AS0A 4FJZA 4G6AC 1NPJA 4MFHA 3GSRA 3VXUA 4JM2D 2A2QT 2DTSA 4JZNA 4GH7B 1U58A 2BVPA 4AGLA 5J9PA 1A1MB 2EZ0C 4JFSA 3ALWA 5LQBL 2CGYA 1S3RA 4FERA 3LS4L 3EHBC 12E8H 1AS8A 4WFFE 5D5ME 3VXQB 4KI5F 4Q58C 3SE9H 1A9BB 3VD5A 5DVKA 2O72A 1YEKL 4HIHB 3QQ4B 5JO5B 3C2AL 4HXAL 4HZAA 2DIJA 2Z1KA 4AXWB 4M5ZH 3TH2T 3W9EA 1MI5B 3WE1A 2QT6A 3HN8A 4PS8A 4X5RA 4P3CL 2BOLA 3NSJA 1JYVA 4F57L 1BZDA 2EXTA 5CEXA 4KVCL 4HBQA 3APMA 1LDPL 3KWWB 1TO5A 3QUML 3MBXH 3QR1A 3D9AH 2HXAA 5HYJA 5F1SA 1FL5B 3MRDA 4AEHH 3PWJB 4FADA 3TTSA 2KLSA 4MNHB 4NQXA 2CCLA 4ZRGA 1D9KC 4YSQA 4FZ8H 4PRID 2EUVA 2VC2L 4H25A 3ZVVA 2P8MA 4B3EA 1HH9A 4OCWL 3TP4A 4CRPA 5E99L 3QZWA 1LP9F 3KCPB 5CJXA 1L9SA 2VR9A 1CZ8H 2DV6A 1NMCB 2H2SD 4A66A 4K9EH 5MEOA 4MWFB 2CR6A 1F5WA 3LCYA 2LU3A 5HTSA 4YHNB 3DYPA 3W0WE 4QXUH 4IOFD 4QHLA 3VXOA 4XNXL 1IFRA 2ZUWA 1S6NA 4KRPB 1F6LL 1NICA 2NYYC 4X9FA 4ZXBB 5EC2B 2FNWA 1BLNA 2CHNA 3HCVA 2B0SL 3EYFA 4XNBA 3CFUA 5I28A 3SPHA 4OH2A 3TEXA 4X42A 4WI8A 3UP6A 4FS0A 1ZK9A 1O9VA 3VTAA 4EQ3A 4LU5L 1I9IH 1KCVH 2Y2TA 3A67H 2B4CH 1G0DA 1UZ8A 1J11A 5D6CA 2HRPH 5CGTA 3QUMA 3FKUS 3WE6A 1OPGL 3O9WA 3DROA 3V5DB 5HVFB 3WFEH 1RKRA 1L5GA 1MELA 2Z8SA 3IKCB 3L7EB 3BKJH 4LSPL 1AGEB 2GBTA 2OSLA 4P9HL 2E5EA 5DK0B 5T3XL 2B5IC 3HG0A 4RWYH 5IMOA 3V9EA 5KJ4A 4I4WB 4X6BA 3FUJA 4OTXH 1JXFA 1JL8A 1NGZB 4N24A 4N3TA 3K7UA 2OMVA 1NOLA 4F7TB 5FA3A 2VLRD 2YMXH 1S78D 3C5ZB 2D9CA 3MRKB 4XGZB 5BRZD 1JF1A 4FTVA 3VWKD 1JPSH 3R7QA 5KOVC 5IB3A 2Q10A 3OHXA 2BX5A 3GSRB 4EI5D 3VXUB 5I1HH 2IDCA 5CFHA 2WXKA 2AQQA 3WHXA 1U58B 5DZVA 1B2WL 5HDWA 3H9YA 5J9PB 5LNEA 2YOAA 1XGUA 4J6RL 1ZLUH 1FORH 3OGCA 1Z1WA 3GS7A 5FKAA 2QADB 5I30H 1Q4NX 3KWXA 2DL2A 2F5BL 1BD2B 2M8XA 4U7SA 1H3VA 4G6KL 4JDEA 5DYFA 3EGSA 2QELA 4PWGA 4PVLA 3SDCB 3AU1B 1NCAL 2D2CC 4DZBA 3HKFA 4MQ7B 1AC0A 4PJAA 1JD7A 4ZPTB 4Z0BH 3HRZC 5KUKA 4ENEC 5T33L 5A1AA 4FJYA 2E3VA 4N85A 1Z2KA 3HFML 4HJTA 3DPDA 3FZUC 4P5MA 3GHBL 1UASA 3S3BB 4CNIA 1AY1L 3US0A 2RQ8A 3FUMA 1MLBB 5A6MA 4NN6B 5HYJB 4XAKE 4JGJA 5EO0A 4P59H 2PABA 4QHPA 4EKJA 4HOWA 4XNYH 1URLA 2N1TE 4PWFA 4H25B 1Z3GL 2P8MB 3DVNA 1UXSB 1IC5L 4N1CA 5D70L 3IMBA 1HH9B 3GBEA 4LOUD 1CXLA 4I3GA 4MJID 3QUZD 5GZNA 3BEWB 3EJPA 4QRPD 1YY9D 3UCQA 5F9OH 2CR0A 4HWBH 4J3OG 5ETUB 5MEOB 3A6BL 2BSSB 2Q87A 1EJOH 4MKTA 5D72H 3SO3B 3VXOB 1M1SA 1L9PA 4XN9A 5L0QC 3ARXA 2DPKA 4G42A 4Q14A 1SHXA 3QEQD 1F4XH 4XN5A 2DD8H 3EYFB 4GG6A 1XMWA 4MZIA 5D96C 5DURB 2EO7A 2DJMA 4JAMA 4OB5L 4QR7A 1UZ8B 5SX4I 4LSSH 5CWSA 1A3LL 3DJSA 2ITFA 3O9WB 3BPOC 4Z3HA 3PV7A 3S88H 1O7SA 1YECH 6TAAA 5FGCE 3FN3A 3O4LA 1V7ML 3V52L 5GGVL 2V7HA 2VC2B 2YA2A 1KC5L 4TTDD 3FUDA 5ALCL 4XTRD 2L0DA 5DZAA 2Q8BL 1DQTA 1ODAA 2VXQL 4MXVF 4NCC2 4PJ7A 3PG2A 1IBGL 4OIAA 4YHOL 2X09A 1ETB1 2B20A 5CJ8A 3MXWH 2OJZH 1TEFA 3U2JA 1JF1B 4FTVB 4EF3A 1Z9OA 1Q0YH 4N5ED 5CCKH 2Z34A 1K4CB 2PTTA 2WXIA 1BMZA 3NCCB 2OJEA 3K6IA 2VLME 2Z35B 4OLXL 2ZX6A 4XNZC 2CKBL 3BSHA 3QRLA 3VGDA 4XHQA 1JVLA 2LFGA 4WY7H 1OAZH 2V5YA 2E56A 1HWGB 1BAGA 2P1YA 3VD1A 4I5BA 4LLDA 3N0PB 3RAJL 4RX4D 4Z7UE 4YR6A 1VPOL 4OIIL 1OM9A 5ABAA 4PJAB 3JWOC 2CD0A 4MJ6B 5CUSH 3GRWL 1A6ZA 4EUPA 3SDAD 2VXQA 5T8IA 2EDRA 1BIIA 4Y19E 3WDJA 3WN6A 4GKZA 1FDLH 3O8XB 2A0LD 5KVMC 4N20A 3WO4B 2KBGA 4QRRD 2EYSA 3MMEA 5D7SH 3DX9B 4YSDA 5AW1B 4L4VA 4KJQC 5ABZA 2PCYA 2P80D 3HB3D 3Q2CA 4B5ZA 5LB1A 1AKJA 2ZT9C 3S8FB 3N1MC 3GLAA 3DVNB 3ZQWA 2HLFC 3S2CA 5IWLC 1AJ7H 1QNZH 1QSFD 1Q9LB 3QDME 4CKQA 1XD1A 2MQCA 5TE6L 2CKBA 3KPRD 4MCMA 2YQBA 5DGRA 5I2IB 3A47A 4O4YL 6FABL 1BAWA 4HK0A 3C9NA 4PUBL 1OK0A 4JCMA 1K9TA 2AEIT 1WIUA 2AK4D 4UUJA 3VVWA 4ADGA 5MENA 5JHBA 4ZO7A 2YAPA 3OF6A 2JKRM 4DP1X 2GI0A 1TEGA 5F1IA 3GRWA 3PE9A 1KB3A 1BFVH 4OGAC 4CW1B 4W70A 4HOMA 1SHWA 4NZJA 4N0CC 3L4TA 5E9DA 3C75A 3UO1H 1ZLEA 4RGND 2ENQA 4PJXA 1GZQA 2JE8A 1XGRA 1DBBH 2WBJD 3MI6A 3AQXA 2V7HB 3INUL 3EBGA 4L3AA 1D5ZA 4FYQA 2DH2A 1D7BA 5GIRB 3QXTA 3PCYA 2VDLL 5L4MA 3BVXA 1MZZA 1RJLB 3WNPA 5IT2L 1MHHB 1QLEH 2OR9L 1Y1UA 3CK0L 4A39A 4PJ7B 1FF5A 4I87A 5D7LD 1SJEA 2QPUA 3WY4A 3MV8A 3CVIH 1YEGH 4GUPA 4A2EA 4OVUA 2XBTA 3CN3A 1E8WA 4IDJL 4CMMA 3V5KB 2WYZA 4GAGH 2BSTA 5FYKU 3BVWA 1NGXA 4AEEA 2PTTB 1U3HD 1NL0H 5F89B 4O02B 4NRZA 5TDPB 3QO1B 4W1TA 5LAXB 3WDIA 4UQ2B 5AAMA 2EEXA 4EI6B 5C0FA 1PKOA 2XQYG 4XE0A 2HJFA 1SDAB 3IXAA 3TOPA 3BT2H 4BRVA 3PXHA 1YEDA 5K59E 1N0XH 1OB1B 5C97A 2BOCA 2OLDA 4FQIL 1FN4A 4LLDB 4HD9A 3VFWA 4GW4B 3Q9QA 4KX7A 4OZIB 4YR6B 1DDHA 2F53A 2V9RA 4MMZB 1U42A 2RD0A 4MD4A 4OD1L 4XRCB 5BNXD 4M4RA 4EUPB 1DBJH 1YPZA 3BWSA 3FDWA 2Y7QA 1BIIB 3RDTA 3QHTC 1XF5A 1NGPH 2J6WA 4I0PA 4RISH 4MMXA 1MVUA 2G9HA 2HFGL 2EYSB 3IMWA 4UZGA 5FO2A 2MTPA 2XU9A 2FX8L 1CXHA 1OAUL 2FGWL 3ECBA 3CU7A 3QXVA 5FYJL 3KE0A 1JE6A 4HPYH 5BV7L 4YBLC 1BJMA 4TUOA 2B1AL 3SDDD 2A77L 2W1NA 2CKBB 4YPGB 4EI0A 5KS9E 2XDHA 1KN2H 1I8MA 1UH4A 3RNKB 1F58H 2R2CA 3S9DB 5ILTH 1EAJA 1CE1L 4OF5A 1IBDA 1NCNA 3BWUF 2I60H 1K72A 2PYEA 3QIBD 4QXGL 5BRQA 4U6YA 4UUJB 4MD0B 5HJBA 1H8OA 1BM3L 4UT6L 1VADA 2WZ0A 3PWPD 4KRNA 4Y1AB 4ODSL 3S3PA 3SYQA 3UG3A 4XO9A 4HWNA 2Z31A 1SHMA 2IQAA 2AQ2A 5F1IB 4U1SB 1YJDC 2GSMB 2H47C 2EH7L 4FHBD 2HT3D 3RB7A 3WLBA 1A7PL 2HKHL 1SM3H 2VLKB 4NQEA 3IDJA 4F8QA 5FUZH 5F1NA 2BHUA 4PJXB 2D4DA 2V33A 3IDGA 1GZQB 4M7JL 4P2QA 4LVOB 3DXAA 1MDTA 3JWDH 3ULAB 2C9RA 1UWYA 4AL8H 4FQ2H 2PXYB 4GBXA 2F15A 1D5ZB 1JGIA 1CVRA 1GZHC 1LM8V 4X6CA 1B4JH 1PKQE 2RH0A 2ZWNA 4QKXB 3ARPA 5K9OB 4TNGA 1DSFL 3ZZQA 3DC0A 4DIXA 3D05A 3KJ4B 4PGDA 5CGYD 1YRKA 4GSXA 4F1SA 1WFTA 3U2IA 1KTCA 4C56D 1OAJA 4WHTA 5FUOL 1J10A 3SDXE 4UT6A 4QNPE 1U8MB 1KFAH 5A7EA 1H8NA 1IL1A 1RPKA 3OJDB 1HSBB 5HGDA 4G3YH 1KYOJ 4JS7A 4KI5C 3HI6L 1RUAL 4LCYB 5CSGA 3UABA 3IRZA 2XQYK 1VRSA 5C0FB 5C0EB 1AG6A 5DUBB 3GO1L 2HJFB 3IXAB 2EDYA 3HE6B 3KPTA 4B3VA 3CHSA 1WYJA 2EDEA 2X6AA 1OSZA 1YEDB 1RIUL 3D34A 4GRLB 4NBZB 4X6DE 4PP2A 3WNOA 1FN4B 4ETQA 3P0VL 3O3DB 3RHWF 1ZVHA 2F53B 1OOWA 2VDLB 1QA9A 3FU3A 1H5BC 5LGKA 3GMPA 2JIXD 5IROC 5GS0D 4MZ3A 4JG9A 1XB6A 5F7EH 3SZ6A 3OTTA 1U8NB 2ED9A 2XT1B 1YPZB 3GHEH 2FH6A 3RVWC 2EXYC 4NPJA 1XF5B 4I0PB 2IG2L 4XN4A 3AT0A 4PJIE 1B6DA 2VDNB 1EZLA 2YRZA 3I6SA 4LNRA 3ECBB 1UZ6F 2WINA 2ZTBA 5DEZA 4OZFH 4YNYA 1MAJA 1IO4C 4E42A 1J8KA 5IUSA 3TZVA 2DBLH 2WAHA 1OAKH 4TOYL 4LAQL 4QRUA 1CU4H 2D7MA 5TQ0H 3QWQB 4TUOB 2J8HA 2YKLH 3T71A 4LQ1A 4ZZFA 4MXQC 4QGYA 1UKSA 2OMBA 2ZUYA 4HULB 3GK8L 2CDFB 4J3VA 3WFHB 4UQBA 2V7NA 4JB9L 4PR5B 1J9QA 2Z7WA 3TPKA 4R2GB 1GGYA 4PJGE 4CMMB 5DS1A 4GKNB 4U6YB 3MZGB 4C57C 1XIWA 3X11A 3N41F 3QC6X 3D52A 4HFWA 1E9QA 2K6ZA 2VXTH 1LEIB 1C12A 2XTJE 1MAKA 3B7UX 2NTSP 3BEVA 4LCIH 3ZKMC 1ZSDB 3TCXA 5IHZB 4Y4KA 4X7TB 3WLBB 1J1PH 3WNMA 1IGFH 4NNPL 2EEAA 4RMBA 2EDOA 3IDJB 3TBTA 3HS9A 1DVTA 5JQ6L 4RDQG