3C75H

Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
375
structure length
375
Chain Sequence
QTEGQRGAAEAAAALAAGEADEPVILEAPAPDARRVYIQDPAHFAAITQQFVIDGSTGRILGMTDGGFLPHPVAAEDGSFFAQASTVFERIARGKRTDYVEVFDPVTFLPIADIELPDAPRFLVGTYQWMNALTPDNKNLLFYQFSPAPAVGVVDLEGKTFDRMLDVPDCYHIFPASPTVFYMNCRDGSLARVDFADGETKVTNTEVFHTEDELLINHPAFSLRSGRLVWPTYTGKIFQADLTAEGATFRAPIEALTEAERADDWRPGGWQQTAYHRQSDRIYLLVDQRDEWKHKAASRFVVVLNAETGERINKIELGHEIDSINVSQDAEPLLYALSAGTQTLHIYDAATGEELRSVDQLGRGPQIITTHDMDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of crystal and solution states of the 138 kDa complex of methylamine dehydrogenase and amicyanin from Paracoccus versutus.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase heavy chain
total genus 77
structure length 375
sequence length 375
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c75H00
4ERYA 1YFQA 3L4MD 2PM6B 4ZOYA 1QNIA 2XL2A 4GQBB 3KRXB 1OLZA 3DWLC 3W15A 4XYHA 5CXBA 3I7HA 4FHLA 3BG1A 3UVMA 3AL8B 4LG9A 4L9OA 1GG2B 4FA9D 4A11B 2YNPA 3SBQA 5GMKn 4J87A 5IJ8E 2I3SA 4J0WA 3V5WB 5K1CC 3RLMD 3EMHA 3OKYB 1TYQC 5GXIA 4D6VA 4GGAA 1JMXB 1SQ9A 5EM2A 3I7OA 2BCJB 2J56H 4LGNA 4PSWB 3F3PA 3RRMC 3F3GA 4J77A 3CIKB 3UR4A 1NEXB 3N0EA 3I7KA 2IUQA 3KRWB 3N0DA 4FWWA 4CZYA 4FA4D 5CYKA 1GOTB 3IIWA 3IJ1A 3DXKC 4ZOZA 3F3FA 3OL2A 4Y7RA 4K3ID 4G56B 4A08B 5FKSA 3U4YA 1JOFA 4FAVD 2AGZA 5HE3B 2GC7A 4CY1A 2QXVA 2OVRB 2AH0A 3JPXA 4ERZA 1R5MA 3V9FA 2PBIB 3VA6A 4O3TB 3C99A 3V7DB 4PXWA 2XU7A 1GP2B 5EMMB 3MZKA 4ERQA 1TBGA 2AQ5A 1RI6A 2H6NA 2I0RA 4GGCA 2XL3A 4OZUA 4A09B 5EAMA 2H9LA 2HYEA 5EAPA 3ULEC 3JZGA 4CY3A 1K32A 5GXHA 4IMMA 5TEEA 5AFU3 4CZXA 4E5ZA 4BL0A 3EI1A 3EI1B 5K19A 4ES0A 2PM9B 4CI8A 3DM0A 2AGLA 5HE2B 2IWFA 4J79A 1P22A 5H1MA 5C2VB 2AGWA 2HESX 3RN0D 2H6KA 3PXTD 2HJBA 5TF2A 2OJYA 4QT8A 2P9SC 3C75H 2G99A 4JXMA 3IJ0A 3HFQA 2W18A 1Q47A 4L1QD 2P9KC 3GFCA 3GREA 3DSMA 4A08A 3SN6B 4MK0B 3B7FA 1N6DA 4L3HD 5EM2B 4CI1A 5HYNB 2HKRA 3SLED 4GZ8A 4FA1D 4E5ZB 5FQDA 5A2Qg 2Z2NA 4GQ2P 4CY5A 4JT5C 5HQGA 4A7JA 4GM3A 2I3TA 2B5MA 3I2NA 4D0KA 4FAND 2B5LA 4JSPC 4O45A 5CYKB 1PEVA 5HE1B 2GNQA 4J0XA 5I5IA 4E54B 2P9PC 2PM7B 2CE8A 4PNKB 1PGUA 4J81A 2YMUA 4R7AB 3MZLA 3PSCB 5EALA 5H14A 2UZYB 3JZHA 3AL8A 3J80g 3OKYA 3JZNA 3NVNA 3RMZD 3CFSB 3NVXA 2YBAA 3RFGA 2H9NA 3AH8B 4XYIA 1A0RB 4AEZA 4E54A 2Z2PA 2YNOA 1GXRA 5CXCA 4I79A 3SBRA 3P4FA 2H13A 5AJAA 2GC4A 4FB1D 4KFMB 2H9PA 2UZXB 2H68A 3EG6A 4FA5D 3RFHA 3C5MA 4A09A 4O1QD 4X60B 3I89A 3I7NA 4J8BA 5C2WB 3K26A 5I5JA 2CN3A 5GSAA 2AH1A 1N6EA 2YNNA 5H17A 2OIZA 1VYHC 2YB8B 2IAAA 4JT6C 4LG8A 2IWKA 3EI3B 4A0BB 4GGDA 4HDJA 1N6FA 2OVQB 2CNXA 4YVDA 5EMJB 4CY2A 5HE0B 1L0QA 4QQEA 1XIPA 4GMBA 2CN2A 3BG0A 2AGXA 3SJLD 1MDAH 3SCYA 4JSNC 4OWRA 4H5IA 4GM8A 5EMLB 3I7LA 2AGYA 1MG2A 4Z8LA 2IUPA 2I0SA 5C9ZB 1XHMA 5FKRA 3PE7A 2MTAH 3A0FA 1SQJA 4N14A 3UVKA 4J82A 4BUJC 4J73A 3ODTA 3NVQA 3EWEA 4GM9A 5EMKB 3RSEC 1NR0A 1SHYB 2P9IC 4O3UB 4ZOXA 3VH0A 3EI2B 3SHFA 2H6QA 3AFCA 3UKUC 4ESGA 1JJUB 5CXCB 2EBSA 4X61B 3OKWA 5IC7A 2J57G 4ZN4A 2Z2OA 5EARA 3I7PA 3I8CA 4CC9A 4A0AA 4K3JB 4H5JA 4A0AB 3UVOA 3BWSA 3IJCA 1PBYB 3UVNA 4IA9A 3MMYA 2HJ4A 3I8EA 5TEFA 4PBYA 3K27A 3EI3A 3SFZA 4A0BA 2HKMA 4QRJA 5JWZA 3CFVA 3SXTD 2J55H 4TZ4A 4AOWA 1XKSA 5FKQA 3L4OD 4NSXA 5AMSA 3J81g 2P9UC 3EU7A 2CO0A 3UKRC 3JB9L 3FRXA 3OW8A 2IURA 3SWSD 2P9NC 3PVWB 4Y5RD 5IGOA 4CI3A 1ERJA 4BH6A 4U7AA 4O9DA 1B9YA 2Q7QA 3PVUB 5FA5B 4J78A 4J8GA 2H3XA 4X63B 3OTTA 3JROA 4ZOVA 5IT9g 5IJ7E 3E0CA 4UI9R 3SVWD 3AL9A 2CE9A 2PM9A 4EWRA 1JMZB 4PBZA 2OVPB 2B5NA 4A2LA 3VGZA 4A11A 4J84A 5FKTA 3MKSB 3OKTA 1FWXA 2I0TA 1S4UX 1OMWB 3RN1D 1K8KC 2XYIA 4JSVC 5FLXg 2QC5A 4JSXC 2IUVA 4A2MA 5KDOB 2O9KA 3PXWD 2H47A 2H14A 5FXYA 2P9LC 5IGQA 2H9MA 5B4WA 2G9AA 4L3GD 3UVLA 3DXMC 4CZVA 3MKQA 3EI4B 1B9XA 3PXSD 3MXXA 3ORVD 2CO0C 5I5MA 3OL2B 2HXCA 4PSXB 3FM0A 3IIYA 3SMRA 3JAMg 5THAA 4QL1A 4X3EA 3PSLA 4CI2A 2BBKH 2B4EA 3IKOA 5CXBB 3SBPA 3ZWLB 5SXMA 4GQ1A 3EI4A 3FGBA 1PI6A 4PC0A 1U2VC 3JRPA 2OK6A 2TRCB 1U4CA 1MG3A 4JD2C 2OK4A 3C9CA 4U1EI 5TDHB 4XEIC 3EI2A 4J86A
chains in the Genus database with same CATH superfamily
4ERYA 1YFQA 3L4MD 4MMZA 2PM6B 4ZOYA 1QNIA 2XL2A 4GQBB 3KRXB 1TYEA 2XDWA 3EQ9A 1OLZA 3DWLC 3W15A 4XYHA 5CXBA 2VDRA 3I7HA 4FHLA 2EIDA 3BG1A 3AL8B 3UVMA 3IVMA 4LG9A 4L9OA 1GG2B 4FA9D 2XZGA 4A11B 2YNPA 3SBQA 5GMKn 4J87A 5IJ8E 2I3SA 4J0WA 3KCIA 5K1CC 3RLMD 3V5WB 5E6UA 3EMHA 3OKYB 3QHYB 1E8MA 4BP9A 1TYQC 5GXIA 4D6VA 1T2XA 3QI0A 4GGAA 1JMXB 1SQ9A 3IUMA 3I7OA 5EM2A 5M5VA 2VZ3A 2BCJB 2J56H 4LGNA 4PSWB 4G55A 3F3PA 3RRMC 3F3GA 4J77A 3CIKB 3UR4A 1NEXB 3N0EA 3I7KA 2IUQA 3KRWB 3N0DA 4FWWA 3OF7A 3IUQA 4CZYA 4FA4D 5CYKA 1GOTB 3IIWA 2VDMA 3IJ1A 3DXKC 2WQ8A 4ZOZA 3F3FA 3OL2A 4Y7RA 4K3ID 4Z7NA 4G56B 4A08B 1JTDB 1A12A 5FKSA 3U4YA 1JOFA 1QFMA 3K72A 4O2WA 4FAVD 2AGZA 5HE3B 2QZPA 4RE5A 2VDKA 2GC7A 4CY1A 2QXVA 2OVRB 2AH0A 3JPXA 4UM8A 1O6FA 4ERZA 4NC4A 3IULA 1R5MA 3V9FA 2PBIB 3VA6A 4O3TB 3C99A 3V7DB 2VDOA 4MMYA 1GOGA 2XU7A 4PXWA 1GP2B 5EMMB 3MZKA 4ERQA 2HU5A 1H2XA 1TBGA 4WJKA 3VI4A 1YR2A 2AQ5A 1RI6A 1U8CA 2H6NA 2I0RA 2HU8A 3FCUA 4GGCA 2XL3A 4OZUA 4A09B 5EAMA 2H9LA 2HYEA 5EAPA 4G1MA 3ULEC 3JZGA 4CY3A 1K32A 5GXHA 4IMMA 5TEEA 5AFU3 4CZXA 4E5ZA 4BL0A 3EI1A 4WK4A 5K19A 3EI1B 4ES0A 3DDUA 1VZ2A 2PM9B 4CI8A 3DM0A 2AGLA 5HE2B 2IWFA 4J79A 1P22A 3FCSA 5H1MA 2AGWA 2HESX 5C2VB 3GD1I 3RN0D 2H6KA 4IRZA 3PXTD 2HJBA 5TF2A 2OJYA 4QT8A 2P9SC 3C75H 2G99A 4BCCA 4JXMA 3IJ0A 3HFQA 2W18A 1Q47A 4L1QD 3ZDXA 2P9KC 3GFCA 3GREA 3DSMA 3O4HA 4A08A 3SN6B 4AN0A 4MK0B 2EICA 4BP8A 4D9SA 3B7FA 1N6DA 4L3HD 5EM2B 4CI1A 2VDNA 5HYNB 2HKRA 3SLED 4JHNA 4GZ8A 3ZE0A 4FA1D 4E5ZB 5FQDA 3ZDYA 5A2Qg 2Z2NA 4GQ2P 4CY5A 4JT5C 5HQGA 4A7JA 2I3TA 4GM3A 2B5MA 3I2NA 4D0KA 4FAND 2B5LA 4JSPC 3ZE2A 4O45A 5CYKB 4AMYA 1PEVA 5HE1B 4O02A 2GNQA 4J0XA 5I5IA 4E54B 2P9PC 2PM7B 3NIGA 5M5RA 3NIDA 2CE8A 4PNKB 4WK2A 1PGUA 4J81A 2HU7A 2YMUA 4R7AB 3MZLA 3PSCB 5EALA 2EIBA 1VZ3A 5H14A 2UZYB 3JZHA 3AL8A 1VE6A 4DNVA 3J80g 3OKYA 1K3IA 3JZNA 3NVNA 4QAMA 3RMZD 3CFSB 3NVXA 2YBAA 5C92A 3RFGA 2H9NA 3AH8B 4XYIA 1A0RB 4AEZA 4E54A 2Z2PA 1H2ZA 1GXRA 2YNOA 5CXCA 4I79A 3SBRA 3P4FA 2H13A 5AJAA 1C9LA 2GC4A 5FFGA 4FB1D 4KFMB 1O6GA 1M1XA 2H9PA 2UZXB 3MVDK 2H68A 3EG6A 4FA5D 3RFHA 3C5MA 4A09A 3V4PA 4O1QD 3ZE1A 4X60B 4JHPC 5C86A 3I89A 3I7NA 4J8BA 5C2WB 3K26A 3O4GA 5I5JA 2CN3A 5GSAA 2AH1A 1N6EA 2YNNA 5H17A 4NBMA 4AX4A 2OIZA 1VYHC 4DNUA 2YB8B 2IAAA 4JT6C 4LG8A 2IWKA 3EI3B 2VDPA 4A0BB 4GGDA 1GOHA 4HDJA 1N6FA 2OVQB 1GOFA 2CNXA 4YVDA 5EMJB 4CY2A 5HE0B 1L0QA 4QQEA 1XIPA 4GMBA 1UOQA 2CN2A 4MMXA 3BG0A 2AGXA 3SJLD 4BCBA 1MDAH 3SCYA 4JSNC 4OWRA 2XE4A 4UM9A 4H5IA 4GM8A 5EMLB 4AMZA 3I7LA 3MUNA 2AGYA 1MG2A 4Z8LA 1UOOA 2IUPA 3MUOA 3IJEA 2I0SA 3NIFA 5C9ZB 1XHMA 5FKRA 3PE7A 2MTAH 1BPOA 3A0FA 1SQJA 4N14A 3UVKA 4J82A 4BUJC 4J73A 3ODTA 4Z7QA 1QFSA 3NVQA 3EWEA 4GM9A 2VC2A 5EMKB 3RSEC 2VDQA 1NR0A 1SHYB 2P9IC 4O3UB 4ZOXA 3VH0A 3EI2B 3SHFA 2H6QA 3AFCA 3UKUC 4RE6A 4ESGA 1E5TA 1JJUB 5CXCB 3IURA 2EBSA 1H2WA 4X61B 3OKWA 4Z7OA 5IC7A 2J57G 4ZN4A 3EQ8A 2Z2OA 5EARA 3I7PA 3V4VA 3I8CA 4CC9A 4A0AA 4K3JB 4H5JA 4A0AB 3UVOA 3BWSA 4NAAA 3IJCA 1PBYB 3UVNA 4IA9A 3MMYA 2HJ4A 3I8EA 5TEFA 4PBYA 3K27A 3EI3A 3SFZA 4DNWA 4A0BA 5HDBA 2HKMA 1UOPA 4QRJA 5JWZA 4WK0A 3CFVA 3SXTD 2J55H 4TZ4A 4AOWA 1H2YA 1L5GA 1XKSA 5FKQA 3L4OD 4NSXA 1UTCA 5AMSA 3J81g 3T3PA 2P9UC 3EU7A 5FFOA 2CO0A 3UKRC 3JB9L 3FRXA 3OW8A 2IURA 3SWSD 2P9NC 3PVWB 4Y5RD 5IGOA 4CI3A 4BCDA 1ERJA 4BH6A 4U7AA 4O9DA 2EIEA 1B9YA 2Q7QA 3PVUB 3EQ7A 5FA5B 1C9IA 4J78A 4J8GA 3K71A 2H3XA 4X63B 1I2MB 3OTTA 3JROA 3VI3A 4ZOVA 5IT9g 5IJ7E 3E0CA 4UI9R 3SVWD 2BKLA 3AL9A 2CE9A 2PM9A 4EWRA 1JMZB 2QR5A 4PBZA 3T3MA 2OVPB 5M61A 2B5NA 4G1EA 4A2LA 3VGZA 4A11A 4J84A 5FKTA 5M5UA 3IUNA 3MKSB 3K6SA 3OKTA 1FWXA 2I0TA 5E6SA 1S4UX 1OMWB 3RN1D 1K8KC 2XYIA 5E6RA 4JSVC 5FLXg 2QC5A 4JSXC 2IUVA 4A2MA 5KDOB 5M5SA 2O9KA 3PXWD 1E8NA 2H47A 2H14A 5FXYA 2P9LC 5IGQA 2H9MA 4L1MA 5B4WA 2G9AA 4NENA 4L3GD 3UVLA 3DXMC 4CZVA 3MKQA 3ZDZA 2JKXA 3EI4B 4AN1A 3PXSD 1B9XA 3ORVD 3MXXA 2CO0C 3O4JA 5I5MA 3O4IA 3OL2B 2HXCA 4PSXB 3FM0A 3IIYA 3SMRA 3JAMg 5THAA 5M5TA 4QL1A 4X3EA 3PSLA 4CI2A 2BBKH 2B4EA 3GC3B 3IKOA 5CXBB 3SBPA 3ZWLB 5SXMA 4GQ1A 3EI4A 2VZ1A 3FGBA 1PI6A 4PC0A 1U2VC 3JRPA 2OK6A 2TRCB 1U4CA 1JV2A 1MG3A 4JD2C 2OK4A 2VDLA 3C9CA 4U1EI 5TDHB 4XEIC 3EI2A 1VE7A 4J86A 3IUJA
chains in the Genus database with same CATH topology
4ERYA 1YFQA 3L4MD 2PM6B 4ZOYA 1QNIA 2XL2A 4GQBB 3KRXB 1OLZA 3DWLC 3W15A 4XYHA 5CXBA 3I7HA 4FHLA 3BG1A 3UVMA 3AL8B 4LG9A 4L9OA 1GG2B 4FA9D 4A11B 2YNPA 3SBQA 5GMKn 4J87A 5IJ8E 2I3SA 4J0WA 3V5WB 5K1CC 3RLMD 3EMHA 3OKYB 1TYQC 5GXIA 4D6VA 4GGAA 1JMXB 1SQ9A 5EM2A 3I7OA 2BCJB 2J56H 4LGNA 4PSWB 3F3PA 3RRMC 3F3GA 4J77A 3CIKB 3UR4A 1NEXB 3N0EA 3I7KA 2IUQA 3KRWB 3N0DA 4FWWA 4CZYA 4FA4D 5CYKA 1GOTB 3IIWA 3IJ1A 3DXKC 4ZOZA 3F3FA 3OL2A 4Y7RA 4K3ID 4G56B 4A08B 5FKSA 3U4YA 1JOFA 4FAVD 2AGZA 5HE3B 2GC7A 4CY1A 2QXVA 2OVRB 2AH0A 3JPXA 4ERZA 1R5MA 3V9FA 2PBIB 3VA6A 4O3TB 3C99A 3V7DB 4PXWA 2XU7A 1GP2B 5EMMB 3MZKA 4ERQA 1TBGA 2AQ5A 1RI6A 2H6NA 2I0RA 4GGCA 2XL3A 4OZUA 4A09B 5EAMA 2H9LA 2HYEA 5EAPA 3ULEC 3JZGA 4CY3A 1K32A 5GXHA 4IMMA 5TEEA 5AFU3 4CZXA 4E5ZA 4BL0A 3EI1A 3EI1B 5K19A 4ES0A 2PM9B 4CI8A 3DM0A 2AGLA 5HE2B 2IWFA 4J79A 1P22A 5H1MA 5C2VB 2AGWA 2HESX 3RN0D 2H6KA 3PXTD 2HJBA 5TF2A 2OJYA 4QT8A 2P9SC 3C75H 2G99A 4JXMA 3IJ0A 3HFQA 2W18A 1Q47A 4L1QD 2P9KC 3GFCA 3GREA 3DSMA 4A08A 3SN6B 4MK0B 3B7FA 1N6DA 4L3HD 5EM2B 4CI1A 5HYNB 2HKRA 3SLED 4GZ8A 4FA1D 4E5ZB 5FQDA 5A2Qg 2Z2NA 4GQ2P 4CY5A 4JT5C 5HQGA 4A7JA 4GM3A 2I3TA 2B5MA 3I2NA 4D0KA 4FAND 2B5LA 4JSPC 4O45A 5CYKB 1PEVA 5HE1B 2GNQA 4J0XA 5I5IA 4E54B 2P9PC 2PM7B 2CE8A 4PNKB 1PGUA 4J81A 2YMUA 4R7AB 3MZLA 3PSCB 5EALA 5H14A 2UZYB 3JZHA 3AL8A 3J80g 3OKYA 3JZNA 3NVNA 3RMZD 3CFSB 3NVXA 2YBAA 3RFGA 2H9NA 3AH8B 4XYIA 1A0RB 4AEZA 4E54A 2Z2PA 2YNOA 1GXRA 5CXCA 4I79A 3SBRA 3P4FA 2H13A 5AJAA 2GC4A 4FB1D 4KFMB 2H9PA 2UZXB 2H68A 3EG6A 4FA5D 3RFHA 3C5MA 4A09A 4O1QD 4X60B 3I89A 3I7NA 4J8BA 5C2WB 3K26A 5I5JA 2CN3A 5GSAA 2AH1A 1N6EA 2YNNA 5H17A 2OIZA 1VYHC 2YB8B 2IAAA 4JT6C 4LG8A 2IWKA 3EI3B 4A0BB 4GGDA 4HDJA 1N6FA 2OVQB 2CNXA 4YVDA 5EMJB 4CY2A 5HE0B 1L0QA 4QQEA 1XIPA 4GMBA 2CN2A 3BG0A 2AGXA 3SJLD 1MDAH 3SCYA 4JSNC 4OWRA 4H5IA 4GM8A 5EMLB 3I7LA 2AGYA 1MG2A 4Z8LA 2IUPA 2I0SA 5C9ZB 1XHMA 5FKRA 3PE7A 2MTAH 3A0FA 1SQJA 4N14A 3UVKA 4J82A 4BUJC 4J73A 3ODTA 3NVQA 3EWEA 4GM9A 5EMKB 3RSEC 1NR0A 1SHYB 2P9IC 4O3UB 4ZOXA 3VH0A 3EI2B 3SHFA 2H6QA 3AFCA 3UKUC 4ESGA 1JJUB 5CXCB 2EBSA 4X61B 3OKWA 5IC7A 2J57G 4ZN4A 2Z2OA 5EARA 3I7PA 3I8CA 4CC9A 4A0AA 4K3JB 4H5JA 4A0AB 3UVOA 3BWSA 3IJCA 1PBYB 3UVNA 4IA9A 3MMYA 2HJ4A 3I8EA 5TEFA 4PBYA 3K27A 3EI3A 3SFZA 4A0BA 2HKMA 4QRJA 5JWZA 3CFVA 3SXTD 2J55H 4TZ4A 4AOWA 1XKSA 5FKQA 3L4OD 4NSXA 5AMSA 3J81g 2P9UC 3EU7A 2CO0A 3UKRC 3JB9L 3FRXA 3OW8A 2IURA 3SWSD 2P9NC 3PVWB 4Y5RD 5IGOA 4CI3A 1ERJA 4BH6A 4U7AA 4O9DA 1B9YA 2Q7QA 3PVUB 5FA5B 4J78A 4J8GA 2H3XA 4X63B 3OTTA 3JROA 4ZOVA 5IT9g 5IJ7E 3E0CA 4UI9R 3SVWD 3AL9A 2CE9A 2PM9A 4EWRA 1JMZB 4PBZA 2OVPB 2B5NA 4A2LA 3VGZA 4A11A 4J84A 5FKTA 3MKSB 3OKTA 1FWXA 2I0TA 1S4UX 1OMWB 3RN1D 1K8KC 2XYIA 4JSVC 5FLXg 2QC5A 4JSXC 2IUVA 4A2MA 5KDOB 2O9KA 3PXWD 2H47A 2H14A 5FXYA 2P9LC 5IGQA 2H9MA 5B4WA 2G9AA 4L3GD 3UVLA 3DXMC 4CZVA 3MKQA 3EI4B 1B9XA 3PXSD 3MXXA 3ORVD 2CO0C 5I5MA 3OL2B 2HXCA 4PSXB 3FM0A 3IIYA 3SMRA 3JAMg 5THAA 4QL1A 4X3EA 3PSLA 4CI2A 2BBKH 2B4EA 3IKOA 5CXBB 3SBPA 3ZWLB 5SXMA 4GQ1A 3EI4A 3FGBA 1PI6A 4PC0A 1U2VC 3JRPA 2OK6A 2TRCB 1U4CA 1MG3A 4JD2C 2OK4A 3C9CA 4U1EI 5TDHB 4XEIC 3EI2A 4J86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERY A;  1YFQ A;  3L4M D;  2PM6 B;  4ZOY A;  1QNI A;  2XL2 A;  4GQB B;  3KRX B;  1OLZ A;  3DWL C;  3W15 A;  4XYH A;  5CXB A;  3I7H A;  4FHL A;  3BG1 A;  3UVM A;  3AL8 B;  4LG9 A;  4L9O A;  1GG2 B;  4FA9 D;  4A11 B;  2YNP A;  3SBQ A;  5GMK n;  4J87 A;  5IJ8 E;  2I3S A;  4J0W A;  3V5W B;  5K1C C;  3RLM D;  3EMH A;  3OKY B;  1TYQ C;  5GXI A;  4D6V A;  4GGA A;  1JMX B;  1SQ9 A;  5EM2 A;  3I7O A;  2BCJ B;  2J56 H;  4LGN A;  4PSW B;  3F3P A;  3RRM C;  3F3G A;  4J77 A;  3CIK B;  3UR4 A;  1NEX B;  3N0E A;  3I7K A;  2IUQ A;  3KRW B;  3N0D A;  4FWW A;  4CZY A;  4FA4 D;  5CYK A;  1GOT B;  3IIW A;  3IJ1 A;  3DXK C;  4ZOZ A;  3F3F A;  3OL2 A;  4Y7R A;  4K3I D;  4G56 B;  4A08 B;  5FKS A;  3U4Y A;  1JOF A;  4FAV D;  2AGZ A;  5HE3 B;  2GC7 A;  4CY1 A;  2QXV A;  2OVR B;  2AH0 A;  3JPX A;  4ERZ A;  1R5M A;  3V9F A;  2PBI B;  3VA6 A;  4O3T B;  3C99 A;  3V7D B;  4PXW A;  2XU7 A;  1GP2 B;  5EMM B;  3MZK A;  4ERQ A;  1TBG A;  2AQ5 A;  1RI6 A;  2H6N A;  2I0R A;  4GGC A;  2XL3 A;  4OZU A;  4A09 B;  5EAM A;  2H9L A;  2HYE A;  5EAP A;  3ULE C;  3JZG A;  4CY3 A;  1K32 A;  5GXH A;  4IMM A;  5TEE A;  5AFU 3;  4CZX A;  4E5Z A;  4BL0 A;  3EI1 A;  3EI1 B;  5K19 A;  4ES0 A;  2PM9 B;  4CI8 A;  3DM0 A;  2AGL A;  5HE2 B;  2IWF A;  4J79 A;  1P22 A;  5H1M A;  5C2V B;  2AGW A;  2HES X;  3RN0 D;  2H6K A;  3PXT D;  2HJB A;  5TF2 A;  2OJY A;  4QT8 A;  2P9S C;  3C75 H;  2G99 A;  4JXM A;  3IJ0 A;  3HFQ A;  2W18 A;  1Q47 A;  4L1Q D;  2P9K C;  3GFC A;  3GRE A;  3DSM A;  4A08 A;  3SN6 B;  4MK0 B;  3B7F A;  1N6D A;  4L3H D;  5EM2 B;  4CI1 A;  5HYN B;  2HKR A;  3SLE D;  4GZ8 A;  4FA1 D;  4E5Z B;  5FQD A;  5A2Q g;  2Z2N A;  4GQ2 P;  4CY5 A;  4JT5 C;  5HQG A;  4A7J A;  4GM3 A;  2I3T A;  2B5M A;  3I2N A;  4D0K A;  4FAN D;  2B5L A;  4JSP C;  4O45 A;  5CYK B;  1PEV A;  5HE1 B;  2GNQ A;  4J0X A;  5I5I A;  4E54 B;  2P9P C;  2PM7 B;  2CE8 A;  4PNK B;  1PGU A;  4J81 A;  2YMU A;  4R7A B;  3MZL A;  3PSC B;  5EAL A;  5H14 A;  2UZY B;  3JZH A;  3AL8 A;  3J80 g;  3OKY A;  3JZN A;  3NVN A;  3RMZ D;  3CFS B;  3NVX A;  2YBA A;  3RFG A;  2H9N A;  3AH8 B;  4XYI A;  1A0R B;  4AEZ A;  4E54 A;  2Z2P A;  2YNO A;  1GXR A;  5CXC A;  4I79 A;  3SBR A;  3P4F A;  2H13 A;  5AJA A;  2GC4 A;  4FB1 D;  4KFM B;  2H9P A;  2UZX B;  2H68 A;  3EG6 A;  4FA5 D;  3RFH A;  3C5M A;  4A09 A;  4O1Q D;  4X60 B;  3I89 A;  3I7N A;  4J8B A;  5C2W B;  3K26 A;  5I5J A;  2CN3 A;  5GSA A;  2AH1 A;  1N6E A;  2YNN A;  5H17 A;  2OIZ A;  1VYH C;  2YB8 B;  2IAA A;  4JT6 C;  4LG8 A;  2IWK A;  3EI3 B;  4A0B B;  4GGD A;  4HDJ A;  1N6F A;  2OVQ B;  2CNX A;  4YVD A;  5EMJ B;  4CY2 A;  5HE0 B;  1L0Q A;  4QQE A;  1XIP A;  4GMB A;  2CN2 A;  3BG0 A;  2AGX A;  3SJL D;  1MDA H;  3SCY A;  4JSN C;  4OWR A;  4H5I A;  4GM8 A;  5EML B;  3I7L A;  2AGY A;  1MG2 A;  4Z8L A;  2IUP A;  2I0S A;  5C9Z B;  1XHM A;  5FKR A;  3PE7 A;  2MTA H;  3A0F A;  1SQJ A;  4N14 A;  3UVK A;  4J82 A;  4BUJ C;  4J73 A;  3ODT A;  3NVQ A;  3EWE A;  4GM9 A;  5EMK B;  3RSE C;  1NR0 A;  1SHY B;  2P9I C;  4O3U B;  4ZOX A;  3VH0 A;  3EI2 B;  3SHF A;  2H6Q A;  3AFC A;  3UKU C;  4ESG A;  1JJU B;  5CXC B;  2EBS A;  4X61 B;  3OKW A;  5IC7 A;  2J57 G;  4ZN4 A;  2Z2O A;  5EAR A;  3I7P A;  3I8C A;  4CC9 A;  4A0A A;  4K3J B;  4H5J A;  4A0A B;  3UVO A;  3BWS A;  3IJC A;  1PBY B;  3UVN A;  4IA9 A;  3MMY A;  2HJ4 A;  3I8E A;  5TEF A;  4PBY A;  3K27 A;  3EI3 A;  3SFZ A;  4A0B A;  2HKM A;  4QRJ A;  5JWZ A;  3CFV A;  3SXT D;  2J55 H;  4TZ4 A;  4AOW A;  1XKS A;  5FKQ A;  3L4O D;  4NSX A;  5AMS A;  3J81 g;  2P9U C;  3EU7 A;  2CO0 A;  3UKR C;  3JB9 L;  3FRX A;  3OW8 A;  2IUR A;  3SWS D;  2P9N C;  3PVW B;  4Y5R D;  5IGO A;  4CI3 A;  1ERJ A;  4BH6 A;  4U7A A;  4O9D A;  1B9Y A;  2Q7Q A;  3PVU B;  5FA5 B;  4J78 A;  4J8G A;  2H3X A;  4X63 B;  3OTT A;  3JRO A;  4ZOV A;  5IT9 g;  5IJ7 E;  3E0C A;  4UI9 R;  3SVW D;  3AL9 A;  2CE9 A;  2PM9 A;  4EWR A;  1JMZ B;  4PBZ A;  2OVP B;  2B5N A;  4A2L A;  3VGZ A;  4A11 A;  4J84 A;  5FKT A;  3MKS B;  3OKT A;  1FWX A;  2I0T A;  1S4U X;  1OMW B;  3RN1 D;  1K8K C;  2XYI A;  4JSV C;  5FLX g;  2QC5 A;  4JSX C;  2IUV A;  4A2M A;  5KDO B;  2O9K A;  3PXW D;  2H47 A;  2H14 A;  5FXY A;  2P9L C;  5IGQ A;  2H9M A;  5B4W A;  2G9A A;  4L3G D;  3UVL A;  3DXM C;  4CZV A;  3MKQ A;  3EI4 B;  1B9X A;  3PXS D;  3MXX A;  3ORV D;  2CO0 C;  5I5M A;  3OL2 B;  2HXC A;  4PSX B;  3FM0 A;  3IIY A;  3SMR A;  3JAM g;  5THA A;  4QL1 A;  4X3E A;  3PSL A;  4CI2 A;  2BBK H;  2B4E A;  3IKO A;  5CXB B;  3SBP A;  3ZWL B;  5SXM A;  4GQ1 A;  3EI4 A;  3FGB A;  1PI6 A;  4PC0 A;  1U2V C;  3JRP A;  2OK6 A;  2TRC B;  1U4C A;  1MG3 A;  4JD2 C;  2OK4 A;  3C9C A;  4U1E I;  5TDH B;  4XEI C;  3EI2 A;  4J86 A; 
#chains in the Genus database with same CATH topology
 4ERY A;  1YFQ A;  3L4M D;  4MMZ A;  2PM6 B;  4ZOY A;  1QNI A;  2XL2 A;  4GQB B;  3KRX B;  1TYE A;  2XDW A;  3EQ9 A;  1OLZ A;  3DWL C;  3W15 A;  4XYH A;  5CXB A;  2VDR A;  3I7H A;  4FHL A;  2EID A;  3BG1 A;  3AL8 B;  3UVM A;  3IVM A;  4LG9 A;  4L9O A;  1GG2 B;  4FA9 D;  2XZG A;  4A11 B;  2YNP A;  3SBQ A;  5GMK n;  4J87 A;  5IJ8 E;  2I3S A;  4J0W A;  3KCI A;  5K1C C;  3RLM D;  3V5W B;  5E6U A;  3EMH A;  3OKY B;  3QHY B;  1E8M A;  4BP9 A;  1TYQ C;  5GXI A;  4D6V A;  1T2X A;  3QI0 A;  4GGA A;  1JMX B;  1SQ9 A;  3IUM A;  3I7O A;  5EM2 A;  5M5V A;  2VZ3 A;  2BCJ B;  2J56 H;  4LGN A;  4PSW B;  4G55 A;  3F3P A;  3RRM C;  3F3G A;  4J77 A;  3CIK B;  3UR4 A;  1NEX B;  3N0E A;  3I7K A;  2IUQ A;  3KRW B;  3N0D A;  4FWW A;  3OF7 A;  3IUQ A;  4CZY A;  4FA4 D;  5CYK A;  1GOT B;  3IIW A;  2VDM A;  3IJ1 A;  3DXK C;  2WQ8 A;  4ZOZ A;  3F3F A;  3OL2 A;  4Y7R A;  4K3I D;  4Z7N A;  4G56 B;  4A08 B;  1JTD B;  1A12 A;  5FKS A;  3U4Y A;  1JOF A;  1QFM A;  3K72 A;  4O2W A;  4FAV D;  2AGZ A;  5HE3 B;  2QZP A;  4RE5 A;  2VDK A;  2GC7 A;  4CY1 A;  2QXV A;  2OVR B;  2AH0 A;  3JPX A;  4UM8 A;  1O6F A;  4ERZ A;  4NC4 A;  3IUL A;  1R5M A;  3V9F A;  2PBI B;  3VA6 A;  4O3T B;  3C99 A;  3V7D B;  2VDO A;  4MMY A;  1GOG A;  2XU7 A;  4PXW A;  1GP2 B;  5EMM B;  3MZK A;  4ERQ A;  2HU5 A;  1H2X A;  1TBG A;  4WJK A;  3VI4 A;  1YR2 A;  2AQ5 A;  1RI6 A;  1U8C A;  2H6N A;  2I0R A;  2HU8 A;  3FCU A;  4GGC A;  2XL3 A;  4OZU A;  4A09 B;  5EAM A;  2H9L A;  2HYE A;  5EAP A;  4G1M A;  3ULE C;  3JZG A;  4CY3 A;  1K32 A;  5GXH A;  4IMM A;  5TEE A;  5AFU 3;  4CZX A;  4E5Z A;  4BL0 A;  3EI1 A;  4WK4 A;  5K19 A;  3EI1 B;  4ES0 A;  3DDU A;  1VZ2 A;  2PM9 B;  4CI8 A;  3DM0 A;  2AGL A;  5HE2 B;  2IWF A;  4J79 A;  1P22 A;  3FCS A;  5H1M A;  2AGW A;  2HES X;  5C2V B;  3GD1 I;  3RN0 D;  2H6K A;  4IRZ A;  3PXT D;  2HJB A;  5TF2 A;  2OJY A;  4QT8 A;  2P9S C;  3C75 H;  2G99 A;  4BCC A;  4JXM A;  3IJ0 A;  3HFQ A;  2W18 A;  1Q47 A;  4L1Q D;  3ZDX A;  2P9K C;  3GFC A;  3GRE A;  3DSM A;  3O4H A;  4A08 A;  3SN6 B;  4AN0 A;  4MK0 B;  2EIC A;  4BP8 A;  4D9S A;  3B7F A;  1N6D A;  4L3H D;  5EM2 B;  4CI1 A;  2VDN A;  5HYN B;  2HKR A;  3SLE D;  4JHN A;  4GZ8 A;  3ZE0 A;  4FA1 D;  4E5Z B;  5FQD A;  3ZDY A;  5A2Q g;  2Z2N A;  4GQ2 P;  4CY5 A;  4JT5 C;  5HQG A;  4A7J A;  2I3T A;  4GM3 A;  2B5M A;  3I2N A;  4D0K A;  4FAN D;  2B5L A;  4JSP C;  3ZE2 A;  4O45 A;  5CYK B;  4AMY A;  1PEV A;  5HE1 B;  4O02 A;  2GNQ A;  4J0X A;  5I5I A;  4E54 B;  2P9P C;  2PM7 B;  3NIG A;  5M5R A;  3NID A;  2CE8 A;  4PNK B;  4WK2 A;  1PGU A;  4J81 A;  2HU7 A;  2YMU A;  4R7A B;  3MZL A;  3PSC B;  5EAL A;  2EIB A;  1VZ3 A;  5H14 A;  2UZY B;  3JZH A;  3AL8 A;  1VE6 A;  4DNV A;  3J80 g;  3OKY A;  1K3I A;  3JZN A;  3NVN A;  4QAM A;  3RMZ D;  3CFS B;  3NVX A;  2YBA A;  5C92 A;  3RFG A;  2H9N A;  3AH8 B;  4XYI A;  1A0R B;  4AEZ A;  4E54 A;  2Z2P A;  1H2Z A;  1GXR A;  2YNO A;  5CXC A;  4I79 A;  3SBR A;  3P4F A;  2H13 A;  5AJA A;  1C9L A;  2GC4 A;  5FFG A;  4FB1 D;  4KFM B;  1O6G A;  1M1X A;  2H9P A;  2UZX B;  3MVD K;  2H68 A;  3EG6 A;  4FA5 D;  3RFH A;  3C5M A;  4A09 A;  3V4P A;  4O1Q D;  3ZE1 A;  4X60 B;  4JHP C;  5C86 A;  3I89 A;  3I7N A;  4J8B A;  5C2W B;  3K26 A;  3O4G A;  5I5J A;  2CN3 A;  5GSA A;  2AH1 A;  1N6E A;  2YNN A;  5H17 A;  4NBM A;  4AX4 A;  2OIZ A;  1VYH C;  4DNU A;  2YB8 B;  2IAA A;  4JT6 C;  4LG8 A;  2IWK A;  3EI3 B;  2VDP A;  4A0B B;  4GGD A;  1GOH A;  4HDJ A;  1N6F A;  2OVQ B;  1GOF A;  2CNX A;  4YVD A;  5EMJ B;  4CY2 A;  5HE0 B;  1L0Q A;  4QQE A;  1XIP A;  4GMB A;  1UOQ A;  2CN2 A;  4MMX A;  3BG0 A;  2AGX A;  3SJL D;  4BCB A;  1MDA H;  3SCY A;  4JSN C;  4OWR A;  2XE4 A;  4UM9 A;  4H5I A;  4GM8 A;  5EML B;  4AMZ A;  3I7L A;  3MUN A;  2AGY A;  1MG2 A;  4Z8L A;  1UOO A;  2IUP A;  3MUO A;  3IJE A;  2I0S A;  3NIF A;  5C9Z B;  1XHM A;  5FKR A;  3PE7 A;  2MTA H;  1BPO A;  3A0F A;  1SQJ A;  4N14 A;  3UVK A;  4J82 A;  4BUJ C;  4J73 A;  3ODT A;  4Z7Q A;  1QFS A;  3NVQ A;  3EWE A;  4GM9 A;  2VC2 A;  5EMK B;  3RSE C;  2VDQ A;  1NR0 A;  1SHY B;  2P9I C;  4O3U B;  4ZOX A;  3VH0 A;  3EI2 B;  3SHF A;  2H6Q A;  3AFC A;  3UKU C;  4RE6 A;  4ESG A;  1E5T A;  1JJU B;  5CXC B;  3IUR A;  2EBS A;  1H2W A;  4X61 B;  3OKW A;  4Z7O A;  5IC7 A;  2J57 G;  4ZN4 A;  3EQ8 A;  2Z2O A;  5EAR A;  3I7P A;  3V4V A;  3I8C A;  4CC9 A;  4A0A A;  4K3J B;  4H5J A;  4A0A B;  3UVO A;  3BWS A;  4NAA A;  3IJC A;  1PBY B;  3UVN A;  4IA9 A;  3MMY A;  2HJ4 A;  3I8E A;  5TEF A;  4PBY A;  3K27 A;  3EI3 A;  3SFZ A;  4DNW A;  4A0B A;  5HDB A;  2HKM A;  1UOP A;  4QRJ A;  5JWZ A;  4WK0 A;  3CFV A;  3SXT D;  2J55 H;  4TZ4 A;  4AOW A;  1H2Y A;  1L5G A;  1XKS A;  5FKQ A;  3L4O D;  4NSX A;  1UTC A;  5AMS A;  3J81 g;  3T3P A;  2P9U C;  3EU7 A;  5FFO A;  2CO0 A;  3UKR C;  3JB9 L;  3FRX A;  3OW8 A;  2IUR A;  3SWS D;  2P9N C;  3PVW B;  4Y5R D;  5IGO A;  4CI3 A;  4BCD A;  1ERJ A;  4BH6 A;  4U7A A;  4O9D A;  2EIE A;  1B9Y A;  2Q7Q A;  3PVU B;  3EQ7 A;  5FA5 B;  1C9I A;  4J78 A;  4J8G A;  3K71 A;  2H3X A;  4X63 B;  1I2M B;  3OTT A;  3JRO A;  3VI3 A;  4ZOV A;  5IT9 g;  5IJ7 E;  3E0C A;  4UI9 R;  3SVW D;  2BKL A;  3AL9 A;  2CE9 A;  2PM9 A;  4EWR A;  1JMZ B;  2QR5 A;  4PBZ A;  3T3M A;  2OVP B;  5M61 A;  2B5N A;  4G1E A;  4A2L A;  3VGZ A;  4A11 A;  4J84 A;  5FKT A;  5M5U A;  3IUN A;  3MKS B;  3K6S A;  3OKT A;  1FWX A;  2I0T A;  5E6S A;  1S4U X;  1OMW B;  3RN1 D;  1K8K C;  2XYI A;  5E6R A;  4JSV C;  5FLX g;  2QC5 A;  4JSX C;  2IUV A;  4A2M A;  5KDO B;  5M5S A;  2O9K A;  3PXW D;  1E8N A;  2H47 A;  2H14 A;  5FXY A;  2P9L C;  5IGQ A;  2H9M A;  4L1M A;  5B4W A;  2G9A A;  4NEN A;  4L3G D;  3UVL A;  3DXM C;  4CZV A;  3MKQ A;  3ZDZ A;  2JKX A;  3EI4 B;  4AN1 A;  3PXS D;  1B9X A;  3ORV D;  3MXX A;  2CO0 C;  3O4J A;  5I5M A;  3O4I A;  3OL2 B;  2HXC A;  4PSX B;  3FM0 A;  3IIY A;  3SMR A;  3JAM g;  5THA A;  5M5T A;  4QL1 A;  4X3E A;  3PSL A;  4CI2 A;  2BBK H;  2B4E A;  3GC3 B;  3IKO A;  5CXB B;  3SBP A;  3ZWL B;  5SXM A;  4GQ1 A;  3EI4 A;  2VZ1 A;  3FGB A;  1PI6 A;  4PC0 A;  1U2V C;  3JRP A;  2OK6 A;  2TRC B;  1U4C A;  1JV2 A;  1MG3 A;  4JD2 C;  2OK4 A;  2VDL A;  3C9C A;  4U1E I;  5TDH B;  4XEI C;  3EI2 A;  1VE7 A;  4J86 A;  3IUJ A; 
#chains in the Genus database with same CATH homology
 4ERY A;  1YFQ A;  3L4M D;  2PM6 B;  4ZOY A;  1QNI A;  2XL2 A;  4GQB B;  3KRX B;  1OLZ A;  3DWL C;  3W15 A;  4XYH A;  5CXB A;  3I7H A;  4FHL A;  3BG1 A;  3UVM A;  3AL8 B;  4LG9 A;  4L9O A;  1GG2 B;  4FA9 D;  4A11 B;  2YNP A;  3SBQ A;  5GMK n;  4J87 A;  5IJ8 E;  2I3S A;  4J0W A;  3V5W B;  5K1C C;  3RLM D;  3EMH A;  3OKY B;  1TYQ C;  5GXI A;  4D6V A;  4GGA A;  1JMX B;  1SQ9 A;  5EM2 A;  3I7O A;  2BCJ B;  2J56 H;  4LGN A;  4PSW B;  3F3P A;  3RRM C;  3F3G A;  4J77 A;  3CIK B;  3UR4 A;  1NEX B;  3N0E A;  3I7K A;  2IUQ A;  3KRW B;  3N0D A;  4FWW A;  4CZY A;  4FA4 D;  5CYK A;  1GOT B;  3IIW A;  3IJ1 A;  3DXK C;  4ZOZ A;  3F3F A;  3OL2 A;  4Y7R A;  4K3I D;  4G56 B;  4A08 B;  5FKS A;  3U4Y A;  1JOF A;  4FAV D;  2AGZ A;  5HE3 B;  2GC7 A;  4CY1 A;  2QXV A;  2OVR B;  2AH0 A;  3JPX A;  4ERZ A;  1R5M A;  3V9F A;  2PBI B;  3VA6 A;  4O3T B;  3C99 A;  3V7D B;  4PXW A;  2XU7 A;  1GP2 B;  5EMM B;  3MZK A;  4ERQ A;  1TBG A;  2AQ5 A;  1RI6 A;  2H6N A;  2I0R A;  4GGC A;  2XL3 A;  4OZU A;  4A09 B;  5EAM A;  2H9L A;  2HYE A;  5EAP A;  3ULE C;  3JZG A;  4CY3 A;  1K32 A;  5GXH A;  4IMM A;  5TEE A;  5AFU 3;  4CZX A;  4E5Z A;  4BL0 A;  3EI1 A;  3EI1 B;  5K19 A;  4ES0 A;  2PM9 B;  4CI8 A;  3DM0 A;  2AGL A;  5HE2 B;  2IWF A;  4J79 A;  1P22 A;  5H1M A;  5C2V B;  2AGW A;  2HES X;  3RN0 D;  2H6K A;  3PXT D;  2HJB A;  5TF2 A;  2OJY A;  4QT8 A;  2P9S C;  3C75 H;  2G99 A;  4JXM A;  3IJ0 A;  3HFQ A;  2W18 A;  1Q47 A;  4L1Q D;  2P9K C;  3GFC A;  3GRE A;  3DSM A;  4A08 A;  3SN6 B;  4MK0 B;  3B7F A;  1N6D A;  4L3H D;  5EM2 B;  4CI1 A;  5HYN B;  2HKR A;  3SLE D;  4GZ8 A;  4FA1 D;  4E5Z B;  5FQD A;  5A2Q g;  2Z2N A;  4GQ2 P;  4CY5 A;  4JT5 C;  5HQG A;  4A7J A;  4GM3 A;  2I3T A;  2B5M A;  3I2N A;  4D0K A;  4FAN D;  2B5L A;  4JSP C;  4O45 A;  5CYK B;  1PEV A;  5HE1 B;  2GNQ A;  4J0X A;  5I5I A;  4E54 B;  2P9P C;  2PM7 B;  2CE8 A;  4PNK B;  1PGU A;  4J81 A;  2YMU A;  4R7A B;  3MZL A;  3PSC B;  5EAL A;  5H14 A;  2UZY B;  3JZH A;  3AL8 A;  3J80 g;  3OKY A;  3JZN A;  3NVN A;  3RMZ D;  3CFS B;  3NVX A;  2YBA A;  3RFG A;  2H9N A;  3AH8 B;  4XYI A;  1A0R B;  4AEZ A;  4E54 A;  2Z2P A;  2YNO A;  1GXR A;  5CXC A;  4I79 A;  3SBR A;  3P4F A;  2H13 A;  5AJA A;  2GC4 A;  4FB1 D;  4KFM B;  2H9P A;  2UZX B;  2H68 A;  3EG6 A;  4FA5 D;  3RFH A;  3C5M A;  4A09 A;  4O1Q D;  4X60 B;  3I89 A;  3I7N A;  4J8B A;  5C2W B;  3K26 A;  5I5J A;  2CN3 A;  5GSA A;  2AH1 A;  1N6E A;  2YNN A;  5H17 A;  2OIZ A;  1VYH C;  2YB8 B;  2IAA A;  4JT6 C;  4LG8 A;  2IWK A;  3EI3 B;  4A0B B;  4GGD A;  4HDJ A;  1N6F A;  2OVQ B;  2CNX A;  4YVD A;  5EMJ B;  4CY2 A;  5HE0 B;  1L0Q A;  4QQE A;  1XIP A;  4GMB A;  2CN2 A;  3BG0 A;  2AGX A;  3SJL D;  1MDA H;  3SCY A;  4JSN C;  4OWR A;  4H5I A;  4GM8 A;  5EML B;  3I7L A;  2AGY A;  1MG2 A;  4Z8L A;  2IUP A;  2I0S A;  5C9Z B;  1XHM A;  5FKR A;  3PE7 A;  2MTA H;  3A0F A;  1SQJ A;  4N14 A;  3UVK A;  4J82 A;  4BUJ C;  4J73 A;  3ODT A;  3NVQ A;  3EWE A;  4GM9 A;  5EMK B;  3RSE C;  1NR0 A;  1SHY B;  2P9I C;  4O3U B;  4ZOX A;  3VH0 A;  3EI2 B;  3SHF A;  2H6Q A;  3AFC A;  3UKU C;  4ESG A;  1JJU B;  5CXC B;  2EBS A;  4X61 B;  3OKW A;  5IC7 A;  2J57 G;  4ZN4 A;  2Z2O A;  5EAR A;  3I7P A;  3I8C A;  4CC9 A;  4A0A A;  4K3J B;  4H5J A;  4A0A B;  3UVO A;  3BWS A;  3IJC A;  1PBY B;  3UVN A;  4IA9 A;  3MMY A;  2HJ4 A;  3I8E A;  5TEF A;  4PBY A;  3K27 A;  3EI3 A;  3SFZ A;  4A0B A;  2HKM A;  4QRJ A;  5JWZ A;  3CFV A;  3SXT D;  2J55 H;  4TZ4 A;  4AOW A;  1XKS A;  5FKQ A;  3L4O D;  4NSX A;  5AMS A;  3J81 g;  2P9U C;  3EU7 A;  2CO0 A;  3UKR C;  3JB9 L;  3FRX A;  3OW8 A;  2IUR A;  3SWS D;  2P9N C;  3PVW B;  4Y5R D;  5IGO A;  4CI3 A;  1ERJ A;  4BH6 A;  4U7A A;  4O9D A;  1B9Y A;  2Q7Q A;  3PVU B;  5FA5 B;  4J78 A;  4J8G A;  2H3X A;  4X63 B;  3OTT A;  3JRO A;  4ZOV A;  5IT9 g;  5IJ7 E;  3E0C A;  4UI9 R;  3SVW D;  3AL9 A;  2CE9 A;  2PM9 A;  4EWR A;  1JMZ B;  4PBZ A;  2OVP B;  2B5N A;  4A2L A;  3VGZ A;  4A11 A;  4J84 A;  5FKT A;  3MKS B;  3OKT A;  1FWX A;  2I0T A;  1S4U X;  1OMW B;  3RN1 D;  1K8K C;  2XYI A;  4JSV C;  5FLX g;  2QC5 A;  4JSX C;  2IUV A;  4A2M A;  5KDO B;  2O9K A;  3PXW D;  2H47 A;  2H14 A;  5FXY A;  2P9L C;  5IGQ A;  2H9M A;  5B4W A;  2G9A A;  4L3G D;  3UVL A;  3DXM C;  4CZV A;  3MKQ A;  3EI4 B;  1B9X A;  3PXS D;  3MXX A;  3ORV D;  2CO0 C;  5I5M A;  3OL2 B;  2HXC A;  4PSX B;  3FM0 A;  3IIY A;  3SMR A;  3JAM g;  5THA A;  4QL1 A;  4X3E A;  3PSL A;  4CI2 A;  2BBK H;  2B4E A;  3IKO A;  5CXB B;  3SBP A;  3ZWL B;  5SXM A;  4GQ1 A;  3EI4 A;  3FGB A;  1PI6 A;  4PC0 A;  1U2V C;  3JRP A;  2OK6 A;  2TRC B;  1U4C A;  1MG3 A;  4JD2 C;  2OK4 A;  3C9C A;  4U1E I;  5TDH B;  4XEI C;  3EI2 A;  4J86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...