3C75H

Paracoccus versutus methylamine dehydrogenase in complex with amicyanin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
375
structure length
375
Chain Sequence
b'QTEGQRGAAEAAAALAAGEADEPVILEAPAPDARRVYIQDPAHFAAITQQFVIDGSTGRILGMTDGGFLPHPVAAEDGSFFAQASTVFERIARGKRTDYVEVFDPVTFLPIADIELPDAPRFLVGTYQWMNALTPDNKNLLFYQFSPAPAVGVVDLEGKTFDRMLDVPDCYHIFPASPTVFYMNCRDGSLARVDFADGETKVTNTEVFHTEDELLINHPAFSLRSGRLVWPTYTGKIFQADLTAEGATFRAPIEALTEAERADDWRPGGWQQTAYHRQSDRIYLLVDQRDEWKHKAASRFVVVLNAETGERINKIELGHEIDSINVSQDAEPLLYALSAGTQTLHIYDAATGEELRSVDQLGRGPQIITTHDMDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
molecule tags Oxidoreductase
publication title Structural comparison of crystal and solution states of the 138 kDa complex of methylamine dehydrogenase and amicyanin from Paracoccus versutus.
pubmed doi rcsb
total genus 77
structure length 375
sequence length 375
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c75H00
3OL2B 3AL9A 3C75H 5EMLB 2QC5A 4CI2A 5EALA 2H6KA 3CFVA 3C99A 2O9KA 3A0FA 5SXMA 3JPXA 5THAA 2P9IC 2XU7A 2P9SC 1MDAH 3DXMC 4Y7RA 2OVRB 1B9XA 4GM8A 5GXIA 3PSLA 5FKQA 1YFQA 4IMMA 2HYEA 3MZLA 1Q47A 5EAPA 3B7FA 4ES0A 5EM2B 2AGXA 3I7NA 3I7OA 1N6FA 4ZOZA 5CXCB 1K8KC 2I0SA 3I7KA 2TRCB 4Z8LA 3PXSD 3RRMC 2XL3A 3IKOA 2CN3A 4IA9A 4GQBB 3RMZD 5FLXg 4YVDA 5H17A 2P9UC 3BWSA 2PM9A 2PM9B 1VYHC 5H14A 4AOWA 2P9NC 4GQ1A 4L1QD 5IJ8E 4ESGA 4L9OA 2GC7A 1PGUA 3KRWB 1OMWB 3SVWD 3N0DA 3ORVD 2CO0A 3JZHA 4GMBA 4J78A 4FA1D 3EI1A 2H47A 3SBRA 4CY5A 1ERJA 2IUPA 2B4EA 4H5JA 2AH0A 2G9AA 3SMRA 1JOFA 5AFU3 3F3GA 4JSNC 3I8EA 5EMMB 3AL8B 4Y5RD 1FWXA 4K3JB 3MXXA 2H68A 3MZKA 5I5IA 4A7JA 2AH1A 5FA5B 2IWFA 5CYKB 3VGZA 2H3XA 2EBSA 2J57G 3K26A 3SFZA 2CO0C 2IAAA 3J81g 1OLZA 3F3PA 4J73A 3EI1B 3ZWLB 5GMKn 4J79A 3I89A 2AGWA 3VH0A 4GZ8A 1GOTB 2AGZA 4KFMB 2P9KC 1XIPA 3W15A 4BL0A 2GC4A 5A2Qg 3RFHA 2B5NA 2I0RA 3OKWA 4GGAA 4ZOVA 3AL8A 4AEZA 3I8CA 3FGBA 3OKTA 3EWEA 1N6DA 3L4MD 4PSXB 5TDHB 3SCYA 3I7LA 3BG1A 4QRJA 3I7HA 2BCJB 2H9NA 4A0BB 4CZYA 3RN0D 4PC0A 5IGOA 5AMSA 5HE1B 2OK6A 3RSEC 3AH8B 4QL1A 3F3FA 5FQDA 3JZNA 3NVNA 4E54A 3CIKB 3V9FA 4CZXA 2YNPA 4J77A 3EI4A 3EI3B 4EWRA 4JT5C 4TZ4A 4K3ID 3PE7A 5IJ7E 3PXWD 3EG6A 4L3GD 3OKYB 2XL2A 3IIYA 3FRXA 3PXTD 5IT9g 4J87A 3UVLA 4A08A 3AFCA 3UR4A 5CXBB 5TEEA 5FKSA 4JSXC 1L0QA 4G56B 3OKYA 2Q7QA 3SBPA 2OIZA 3EU7A 1P22A 2I3SA 4JXMA 4CZVA 3OL2A 4FA5D 2H14A 4A0AB 1SQ9A 5K19A 5HE3B 2J56H 2H6QA 3NVQA 1U2VC 4FWWA 2HKMA 2W18A 4JT6C 4ERQA 5C2VB 3IIWA 4XYIA 2HJ4A 3UVOA 3K27A 5CXBA 1K32A 4XYHA 4ZOYA 5CYKA 4CC9A 3PSCB 4NSXA 2OVQB 4CY2A 3N0EA 5IC7A 2PM6B 2J55H 3EI3A 4O3TB 5C9ZB 2H6NA 2HESX 5EAMA 4U1EI 4X63B 3V5WB 5K1CC 4LG8A 1TBGA 2P9PC 5HQGA 2CE9A 2G99A 1A0RB 3CFSB 1XKSA 2CN2A 3GFCA 3RN1D 4A2MA 1QNIA 2OJYA 2CE8A 3IJCA 4I79A 4XEIC 4JSPC 2IUVA 4ZOXA 5KDOB 1PI6A 2I3TA 3UKUC 3U4YA 3SHFA 3OTTA 3EI2A 4A08B 4BUJC 2IURA 2Z2PA 4J0XA 3SLED 4A09A 3DM0A 3C5MA 4GQ2P 1RI6A 4PSWB 3BG0A 3GREA 2YMUA 4A11B 4E5ZA 4X60B 3VA6A 4A2LA 3JZGA 3C9CA 2YNNA 1S4UX 4FA9D 4A0BA 1XHMA 3DXKC 2P9LC 4QQEA 4E5ZB 1SHYB 4J8GA 5JWZA 2YBAA 2Z2OA 4J84A 4BH6A 1PBYB 4CI8A 2B5LA 3RFGA 2HXCA 3L4OD 4HDJA 4J81A 4GM3A 3JB9L 1TYQC 5IGQA 4OWRA 4X3EA 2H9MA 4PBZA 4O1QD 1R5MA 3J80g 2IWKA 3FM0A 3IJ1A 1JMXB 4FHLA 4CI3A 4J86A 2I0TA 4R7AB 4J8BA 1JJUB 3OW8A 4CY1A 2PM7B 5AJAA 2OK4A 4N14A 3JAMg 3MKSB 3PVWB 4A11A 4H5IA 5I5MA 2BBKH 1GXRA 4QT8A 5HYNB 4O9DA 4A09B 4CY3A 3HFQA 1B9YA 1GG2B 1U4CA 2UZXB 2YNOA 1NR0A 5B4WA 2YB8B 4X61B 3UVMA 5I5JA 5GXHA 3ULEC 5CXCA 2CNXA 2H9LA 3UKRC 5GSAA 3SJLD 2AQ5A 4O3UB 3JROA 2Z2NA 4PXWA 4GGCA 4FA4D 2AGLA 2HKRA 3KRXB 2IUQA 3I2NA 4U7AA 4UI9R 3V7DB 3I7PA 4ZN4A 3EI2B 1SQJA 4CI1A 4FAND 3SBQA 3UVNA 3DWLC 4GM9A 2QXVA 1N6EA 3RLMD 5EMJB 1MG2A 5EMKB 4GGDA 1PEVA 4ERZA 3MKQA 4MK0B 5HE2B 4FB1D 1MG3A 4PBYA 3P4FA 4PNKB 5FKRA 3SWSD 4A0AA 4E54B 1JMZB 2UZYB 3JRPA 3NVXA 4ERYA 5HE0B 3EMHA 5EARA 5H1MA 2OVPB 1NEXB 4L3HD 4JD2C 4LG9A 5FKTA 1GP2B 2XYIA 4J0WA 3PVUB 2H9PA 5EM2A 2AGYA 4OZUA 4LGNA 4D6VA 2H13A 3EI4B 3IJ0A 3MMYA 2GNQA 3SN6B 5C2WB 4J82A 2MTAH 5TF2A 5FXYA 3E0CA 3DSMA 2HJBA 5TEFA 4O45A 2B5MA 3UVKA 3ODTA 3SXTD 4D0KA 2PBIB 4JSVC 4FAVD
chains in the Genus database with same CATH superfamily
4O02A 3FCUA 3OL2B 3AL9A 3C75H 3V4PA 1UOPA 5EMLB 4L1MA 2QC5A 4CI2A 5EALA 2H6KA 3CFVA 3EQ9A 3C99A 4UM9A 2O9KA 3A0FA 5SXMA 3JPXA 5THAA 2P9IC 2XU7A 2P9SC 1MDAH 3DXMC 4Y7RA 2OVRB 1B9XA 4GM8A 5GXIA 5HDBA 3PSLA 5FKQA 1YFQA 4IMMA 2HYEA 2VZ3A 3MZLA 2HU8A 1Q47A 4BCCA 3IJEA 3NIDA 5EAPA 3B7FA 4ES0A 5EM2B 2AGXA 3I7NA 3I7OA 1N6FA 4ZOZA 5CXCB 1K8KC 2I0SA 4NC4A 3I7KA 3T3MA 2TRCB 4BCBA 4Z8LA 3PXSD 3RRMC 2XL3A 3IKOA 2CN3A 4IA9A 4GQBB 3RMZD 5FLXg 4YVDA 1BPOA 2P9UC 5H17A 3BWSA 2PM9A 2PM9B 1E5TA 3IULA 1VYHC 1A12A 3FCSA 5H14A 2P9NC 4AOWA 4GQ1A 1U8CA 4L1QD 4ESGA 4L9OA 5IJ8E 2GC7A 1QFSA 1PGUA 3KRWB 1OMWB 3SVWD 3N0DA 3ORVD 2CO0A 3JZHA 4GMBA 4J78A 4FA1D 3EI1A 2H47A 3SBRA 4CY5A 1ERJA 2IUPA 2B4EA 1K3IA 4H5JA 4RE5A 2AH0A 2G9AA 3SMRA 1JOFA 5AFU3 3F3GA 4JSNC 3I8EA 5EMMB 3AL8B 1YR2A 4Y5RD 1FWXA 4K3JB 3MXXA 2H68A 3MZKA 5I5IA 1E8MA 4A7JA 2AH1A 5E6SA 5FA5B 2IWFA 2VDLA 5CYKB 3VGZA 2H3XA 2EBSA 3ZE2A 2WQ8A 2J57G 3K26A 3SFZA 2CO0C 2IAAA 3J81g 4AMZA 1OLZA 3F3PA 4J73A 3EI1B 3ZWLB 3NIFA 5GMKn 4J79A 4DNUA 3I89A 2AGWA 2EICA 3VH0A 2XDWA 4GZ8A 1GOTB 2AGZA 4KFMB 2P9KC 1XIPA 3W15A 4BL0A 2GC4A 5A2Qg 3RFHA 2B5NA 2I0RA 3OKWA 4GGAA 4ZOVA 4DNWA 1VE6A 1M1XA 3AL8A 4AEZA 3I8CA 3FGBA 3GC3B 3OKTA 3EWEA 1N6DA 3L4MD 4PSXB 5TDHB 3SCYA 3I7LA 3BG1A 4QRJA 3I7HA 2BCJB 2H9NA 4A0BB 4CZYA 3ZDXA 3RN0D 4PC0A 5IGOA 5AMSA 4BP8A 5HE1B 2OK6A 3RSEC 3AH8B 4QAMA 2EIDA 4QL1A 5FFOA 3F3FA 4O2WA 5M5RA 5FQDA 3JZNA 3NVNA 4E54A 3EQ8A 5E6RA 3CIKB 3V9FA 4CZXA 4D9SA 4NAAA 2YNPA 4J77A 3EI4A 3EI3B 4EWRA 4JT5C 4TZ4A 4K3ID 2VDNA 3PE7A 5IJ7E 3PXWD 3EG6A 4L3GD 3OKYB 2XL2A 3IIYA 3FRXA 3PXTD 5IT9g 4J87A 3UVLA 4A08A 1GOFA 2BKLA 3AFCA 3UR4A 5CXBB 5TEEA 2QR5A 5FKSA 5FFGA 4JSXC 1UTCA 1L0QA 4G56B 3OKYA 2Q7QA 3SBPA 2OIZA 3EU7A 1UOQA 1P22A 2I3SA 4JXMA 4CZVA 5M5VA 3OL2A 4FA5D 2H14A 4A0AB 3T3PA 1SQ9A 5K19A 5HE3B 2XE4A 2J56H 2H6QA 4Z7OA 5C86A 3K71A 1H2WA 3NVQA 1U2VC 3MVDK 4FWWA 4AN0A 2HKMA 2W18A 4AMYA 4JT6C 4ERQA 5C2VB 3IIWA 4XYIA 2HJ4A 3QHYB 3UVOA 3K27A 4BCDA 5CXBA 1I2MB 1K32A 4XYHA 3NIGA 4ZOYA 1H2XA 5CYKA 4CC9A 3IUJA 3PSCB 4NSXA 2OVQB 4CY2A 3DDUA 3N0EA 5IC7A 2PM6B 2EIBA 2J55H 3EI3A 4O3TB 3K6SA 5C9ZB 1T2XA 2H6NA 2HESX 5EAMA 4U1EI 4JHNA 4X63B 3V5WB 5K1CC 4LG8A 1TBGA 1GOGA 2P9PC 5HQGA 2CE9A 4Z7NA 2G99A 1A0RB 3CFSB 1XKSA 2CN2A 3GFCA 1O6GA 3RN1D 4A2MA 1QNIA 3MUNA 2OJYA 2CE8A 3IJCA 1C9LA 3EQ7A 4UM8A 4I79A 1JTDB 4XEIC 3O4IA 4WK4A 4JSPC 2IUVA 4ZOXA 3QI0A 5KDOB 1PI6A 2I3TA 1GOHA 3UKUC 3U4YA 3SHFA 4DNVA 3OTTA 3EI2A 4A08B 4BUJC 2IURA 2Z2PA 1VE7A 4J0XA 3SLED 4A09A 3DM0A 3C5MA 4GQ2P 4WK0A 1RI6A 4PSWB 3BG0A 3GREA 4MMZA 2YMUA 5M5SA 4A11B 4E5ZA 4AN1A 1H2ZA 4X60B 3VA6A 4A2LA 3JZGA 3C9CA 2YNNA 3ZDYA 1S4UX 4FA9D 3O4GA 1C9IA 4AX4A 4A0BA 1XHMA 3DXKC 2P9LC 4QQEA 3ZDZA 3O4HA 4E5ZB 1SHYB 4J8GA 5JWZA 2YBAA 2Z2OA 4J84A 3IURA 4BH6A 1PBYB 4CI8A 2B5LA 3RFGA 4WJKA 2HXCA 3L4OD 4HDJA 4J81A 4GM3A 3JB9L 1TYQC 5IGQA 4OWRA 4X3EA 2H9MA 4PBZA 2VC2A 4O1QD 1R5MA 3J80g 3OF7A 2IWKA 3FM0A 3IJ1A 1JMXB 4FHLA 4CI3A 4J86A 2I0TA 2HU5A 2VDPA 3VI4A 2XZGA 4JHPC 4R7AB 2VDKA 1VZ2A 3IUNA 3IUMA 4J8BA 4MMXA 3ZE1A 1JJUB 3OW8A 4CY1A 5C92A 2PM7B 2VDOA 5AJAA 2OK4A 4N14A 3JAMg 3MKSB 3PVWB 4A11A 4H5IA 5I5MA 2BBKH 1GXRA 4QT8A 4RE6A 5HYNB 4O9DA 4A09B 4CY3A 3HFQA 2EIEA 1B9YA 1GG2B 1U4CA 2UZXB 2YNOA 1NR0A 5B4WA 3IUQA 2YB8B 4X61B 3UVMA 5I5JA 5GXHA 1L5GA 3ULEC 5CXCA 3V4VA 2CNXA 2VDRA 4G55A 3MUOA 1TYEA 1VZ3A 2H9LA 4NENA 3UKRC 5GSAA 4G1MA 3SJLD 3K72A 2AQ5A 4O3UB 3JROA 2Z2NA 4PXWA 4GGCA 4FA4D 2AGLA 2HKRA 3KCIA 3KRXB 2IUQA 3I2NA 4U7AA 4UI9R 4NBMA 1E8NA 3V7DB 3I7PA 4ZN4A 3EI2B 2VZ1A 3IVMA 1SQJA 4CI1A 1H2YA 5E6UA 4FAND 1JV2A 3SBQA 3UVNA 3DWLC 4MMYA 4GM9A 2VDQA 2HU7A 2QXVA 1N6EA 3RLMD 5EMJB 3O4JA 1MG2A 5EMKB 4GGDA 1PEVA 3VI3A 4ERZA 5M5TA 4WK2A 3MKQA 4MK0B 5HE2B 4FB1D 1MG3A 4PBYA 3P4FA 4PNKB 5FKRA 3SWSD 4A0AA 4E54B 1JMZB 4Z7QA 3ZE0A 2UZYB 3JRPA 3NVXA 4ERYA 5HE0B 3EMHA 5EARA 5H1MA 2OVPB 1UOOA 1NEXB 4L3HD 4JD2C 4LG9A 4BP9A 5FKTA 1GP2B 2XYIA 4J0WA 3PVUB 5M5UA 2H9PA 2JKXA 4IRZA 3GD1I 5EM2A 1QFMA 2AGYA 4OZUA 4LGNA 4D6VA 2H13A 3EI4B 2QZPA 3IJ0A 2GNQA 3MMYA 3SN6B 5C2WB 4J82A 2MTAH 5TF2A 5FXYA 3E0CA 3DSMA 2HJBA 5TEFA 4O45A 1O6FA 2B5MA 3UVKA 3ODTA 4G1EA 5M61A 3SXTD 2VDMA 4D0KA 2PBIB 4JSVC 4FAVD
chains in the Genus database with same CATH topology
3OL2B 3AL9A 3C75H 5EMLB 2QC5A 4CI2A 5EALA 2H6KA 3CFVA 3C99A 2O9KA 3A0FA 5SXMA 3JPXA 5THAA 2P9IC 2XU7A 2P9SC 1MDAH 3DXMC 4Y7RA 2OVRB 1B9XA 4GM8A 5GXIA 3PSLA 5FKQA 1YFQA 4IMMA 2HYEA 3MZLA 1Q47A 5EAPA 3B7FA 4ES0A 5EM2B 2AGXA 3I7NA 3I7OA 1N6FA 4ZOZA 5CXCB 1K8KC 2I0SA 3I7KA 2TRCB 4Z8LA 3PXSD 3RRMC 2XL3A 3IKOA 2CN3A 4IA9A 4GQBB 3RMZD 5FLXg 4YVDA 5H17A 2P9UC 3BWSA 2PM9A 2PM9B 1VYHC 5H14A 4AOWA 2P9NC 4GQ1A 4L1QD 5IJ8E 4ESGA 4L9OA 2GC7A 1PGUA 3KRWB 1OMWB 3SVWD 3N0DA 3ORVD 2CO0A 3JZHA 4GMBA 4J78A 4FA1D 3EI1A 2H47A 3SBRA 4CY5A 1ERJA 2IUPA 2B4EA 4H5JA 2AH0A 2G9AA 3SMRA 1JOFA 5AFU3 3F3GA 4JSNC 3I8EA 5EMMB 3AL8B 4Y5RD 1FWXA 4K3JB 3MXXA 2H68A 3MZKA 5I5IA 4A7JA 2AH1A 5FA5B 2IWFA 5CYKB 3VGZA 2H3XA 2EBSA 2J57G 3K26A 3SFZA 2CO0C 2IAAA 3J81g 1OLZA 3F3PA 4J73A 3EI1B 3ZWLB 5GMKn 4J79A 3I89A 2AGWA 3VH0A 4GZ8A 1GOTB 2AGZA 4KFMB 2P9KC 1XIPA 3W15A 4BL0A 2GC4A 5A2Qg 3RFHA 2B5NA 2I0RA 3OKWA 4GGAA 4ZOVA 3AL8A 4AEZA 3I8CA 3FGBA 3OKTA 3EWEA 1N6DA 3L4MD 4PSXB 5TDHB 3SCYA 3I7LA 3BG1A 4QRJA 3I7HA 2BCJB 2H9NA 4A0BB 4CZYA 3RN0D 4PC0A 5IGOA 5AMSA 5HE1B 2OK6A 3RSEC 3AH8B 4QL1A 3F3FA 5FQDA 3JZNA 3NVNA 4E54A 3CIKB 3V9FA 4CZXA 2YNPA 4J77A 3EI4A 3EI3B 4EWRA 4JT5C 4TZ4A 4K3ID 3PE7A 5IJ7E 3PXWD 3EG6A 4L3GD 3OKYB 2XL2A 3IIYA 3FRXA 3PXTD 5IT9g 4J87A 3UVLA 4A08A 3AFCA 3UR4A 5CXBB 5TEEA 5FKSA 4JSXC 1L0QA 4G56B 3OKYA 2Q7QA 3SBPA 2OIZA 3EU7A 1P22A 2I3SA 4JXMA 4CZVA 3OL2A 4FA5D 2H14A 4A0AB 1SQ9A 5K19A 5HE3B 2J56H 2H6QA 3NVQA 1U2VC 4FWWA 2HKMA 2W18A 4JT6C 4ERQA 5C2VB 3IIWA 4XYIA 2HJ4A 3UVOA 3K27A 5CXBA 1K32A 4XYHA 4ZOYA 5CYKA 4CC9A 3PSCB 4NSXA 2OVQB 4CY2A 3N0EA 5IC7A 2PM6B 2J55H 3EI3A 4O3TB 5C9ZB 2H6NA 2HESX 5EAMA 4U1EI 4X63B 3V5WB 5K1CC 4LG8A 1TBGA 2P9PC 5HQGA 2CE9A 2G99A 1A0RB 3CFSB 1XKSA 2CN2A 3GFCA 3RN1D 4A2MA 1QNIA 2OJYA 2CE8A 3IJCA 4I79A 4XEIC 4JSPC 2IUVA 4ZOXA 5KDOB 1PI6A 2I3TA 3UKUC 3U4YA 3SHFA 3OTTA 3EI2A 4A08B 4BUJC 2IURA 2Z2PA 4J0XA 3SLED 4A09A 3DM0A 3C5MA 4GQ2P 1RI6A 4PSWB 3BG0A 3GREA 2YMUA 4A11B 4E5ZA 4X60B 3VA6A 4A2LA 3JZGA 3C9CA 2YNNA 1S4UX 4FA9D 4A0BA 1XHMA 3DXKC 2P9LC 4QQEA 4E5ZB 1SHYB 4J8GA 5JWZA 2YBAA 2Z2OA 4J84A 4BH6A 1PBYB 4CI8A 2B5LA 3RFGA 2HXCA 3L4OD 4HDJA 4J81A 4GM3A 3JB9L 1TYQC 5IGQA 4OWRA 4X3EA 2H9MA 4PBZA 4O1QD 1R5MA 3J80g 2IWKA 3FM0A 3IJ1A 1JMXB 4FHLA 4CI3A 4J86A 2I0TA 4R7AB 4J8BA 1JJUB 3OW8A 4CY1A 2PM7B 5AJAA 2OK4A 4N14A 3JAMg 3MKSB 3PVWB 4A11A 4H5IA 5I5MA 2BBKH 1GXRA 4QT8A 5HYNB 4O9DA 4A09B 4CY3A 3HFQA 1B9YA 1GG2B 1U4CA 2UZXB 2YNOA 1NR0A 5B4WA 2YB8B 4X61B 3UVMA 5I5JA 5GXHA 3ULEC 5CXCA 2CNXA 2H9LA 3UKRC 5GSAA 3SJLD 2AQ5A 4O3UB 3JROA 2Z2NA 4PXWA 4GGCA 4FA4D 2AGLA 2HKRA 3KRXB 2IUQA 3I2NA 4U7AA 4UI9R 3V7DB 3I7PA 4ZN4A 3EI2B 1SQJA 4CI1A 4FAND 3SBQA 3UVNA 3DWLC 4GM9A 2QXVA 1N6EA 3RLMD 5EMJB 1MG2A 5EMKB 4GGDA 1PEVA 4ERZA 3MKQA 4MK0B 5HE2B 4FB1D 1MG3A 4PBYA 3P4FA 4PNKB 5FKRA 3SWSD 4A0AA 4E54B 1JMZB 2UZYB 3JRPA 3NVXA 4ERYA 5HE0B 3EMHA 5EARA 5H1MA 2OVPB 1NEXB 4L3HD 4JD2C 4LG9A 5FKTA 1GP2B 2XYIA 4J0WA 3PVUB 2H9PA 5EM2A 2AGYA 4OZUA 4LGNA 4D6VA 2H13A 3EI4B 3IJ0A 3MMYA 2GNQA 3SN6B 5C2WB 4J82A 2MTAH 5TF2A 5FXYA 3E0CA 3DSMA 2HJBA 5TEFA 4O45A 2B5MA 3UVKA 3ODTA 3SXTD 4D0KA 2PBIB 4JSVC 4FAVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL2 B;  3AL9 A;  3C75 H;  5EML B;  2QC5 A;  4CI2 A;  5EAL A;  2H6K A;  3CFV A;  3C99 A;  2O9K A;  3A0F A;  5SXM A;  3JPX A;  5THA A;  2P9I C;  2XU7 A;  2P9S C;  1MDA H;  3DXM C;  4Y7R A;  2OVR B;  1B9X A;  4GM8 A;  5GXI A;  3PSL A;  5FKQ A;  1YFQ A;  4IMM A;  2HYE A;  3MZL A;  1Q47 A;  5EAP A;  3B7F A;  4ES0 A;  5EM2 B;  2AGX A;  3I7N A;  3I7O A;  1N6F A;  4ZOZ A;  5CXC B;  1K8K C;  2I0S A;  3I7K A;  2TRC B;  4Z8L A;  3PXS D;  3RRM C;  2XL3 A;  3IKO A;  2CN3 A;  4IA9 A;  4GQB B;  3RMZ D;  5FLX g;  4YVD A;  5H17 A;  2P9U C;  3BWS A;  2PM9 A;  2PM9 B;  1VYH C;  5H14 A;  4AOW A;  2P9N C;  4GQ1 A;  4L1Q D;  5IJ8 E;  4ESG A;  4L9O A;  2GC7 A;  1PGU A;  3KRW B;  1OMW B;  3SVW D;  3N0D A;  3ORV D;  2CO0 A;  3JZH A;  4GMB A;  4J78 A;  4FA1 D;  3EI1 A;  2H47 A;  3SBR A;  4CY5 A;  1ERJ A;  2IUP A;  2B4E A;  4H5J A;  2AH0 A;  2G9A A;  3SMR A;  1JOF A;  5AFU 3;  3F3G A;  4JSN C;  3I8E A;  5EMM B;  3AL8 B;  4Y5R D;  1FWX A;  4K3J B;  3MXX A;  2H68 A;  3MZK A;  5I5I A;  4A7J A;  2AH1 A;  5FA5 B;  2IWF A;  5CYK B;  3VGZ A;  2H3X A;  2EBS A;  2J57 G;  3K26 A;  3SFZ A;  2CO0 C;  2IAA A;  3J81 g;  1OLZ A;  3F3P A;  4J73 A;  3EI1 B;  3ZWL B;  5GMK n;  4J79 A;  3I89 A;  2AGW A;  3VH0 A;  4GZ8 A;  1GOT B;  2AGZ A;  4KFM B;  2P9K C;  1XIP A;  3W15 A;  4BL0 A;  2GC4 A;  5A2Q g;  3RFH A;  2B5N A;  2I0R A;  3OKW A;  4GGA A;  4ZOV A;  3AL8 A;  4AEZ A;  3I8C A;  3FGB A;  3OKT A;  3EWE A;  1N6D A;  3L4M D;  4PSX B;  5TDH B;  3SCY A;  3I7L A;  3BG1 A;  4QRJ A;  3I7H A;  2BCJ B;  2H9N A;  4A0B B;  4CZY A;  3RN0 D;  4PC0 A;  5IGO A;  5AMS A;  5HE1 B;  2OK6 A;  3RSE C;  3AH8 B;  4QL1 A;  3F3F A;  5FQD A;  3JZN A;  3NVN A;  4E54 A;  3CIK B;  3V9F A;  4CZX A;  2YNP A;  4J77 A;  3EI4 A;  3EI3 B;  4EWR A;  4JT5 C;  4TZ4 A;  4K3I D;  3PE7 A;  5IJ7 E;  3PXW D;  3EG6 A;  4L3G D;  3OKY B;  2XL2 A;  3IIY A;  3FRX A;  3PXT D;  5IT9 g;  4J87 A;  3UVL A;  4A08 A;  3AFC A;  3UR4 A;  5CXB B;  5TEE A;  5FKS A;  4JSX C;  1L0Q A;  4G56 B;  3OKY A;  2Q7Q A;  3SBP A;  2OIZ A;  3EU7 A;  1P22 A;  2I3S A;  4JXM A;  4CZV A;  3OL2 A;  4FA5 D;  2H14 A;  4A0A B;  1SQ9 A;  5K19 A;  5HE3 B;  2J56 H;  2H6Q A;  3NVQ A;  1U2V C;  4FWW A;  2HKM A;  2W18 A;  4JT6 C;  4ERQ A;  5C2V B;  3IIW A;  4XYI A;  2HJ4 A;  3UVO A;  3K27 A;  5CXB A;  1K32 A;  4XYH A;  4ZOY A;  5CYK A;  4CC9 A;  3PSC B;  4NSX A;  2OVQ B;  4CY2 A;  3N0E A;  5IC7 A;  2PM6 B;  2J55 H;  3EI3 A;  4O3T B;  5C9Z B;  2H6N A;  2HES X;  5EAM A;  4U1E I;  4X63 B;  3V5W B;  5K1C C;  4LG8 A;  1TBG A;  2P9P C;  5HQG A;  2CE9 A;  2G99 A;  1A0R B;  3CFS B;  1XKS A;  2CN2 A;  3GFC A;  3RN1 D;  4A2M A;  1QNI A;  2OJY A;  2CE8 A;  3IJC A;  4I79 A;  4XEI C;  4JSP C;  2IUV A;  4ZOX A;  5KDO B;  1PI6 A;  2I3T A;  3UKU C;  3U4Y A;  3SHF A;  3OTT A;  3EI2 A;  4A08 B;  4BUJ C;  2IUR A;  2Z2P A;  4J0X A;  3SLE D;  4A09 A;  3DM0 A;  3C5M A;  4GQ2 P;  1RI6 A;  4PSW B;  3BG0 A;  3GRE A;  2YMU A;  4A11 B;  4E5Z A;  4X60 B;  3VA6 A;  4A2L A;  3JZG A;  3C9C A;  2YNN A;  1S4U X;  4FA9 D;  4A0B A;  1XHM A;  3DXK C;  2P9L C;  4QQE A;  4E5Z B;  1SHY B;  4J8G A;  5JWZ A;  2YBA A;  2Z2O A;  4J84 A;  4BH6 A;  1PBY B;  4CI8 A;  2B5L A;  3RFG A;  2HXC A;  3L4O D;  4HDJ A;  4J81 A;  4GM3 A;  3JB9 L;  1TYQ C;  5IGQ A;  4OWR A;  4X3E A;  2H9M A;  4PBZ A;  4O1Q D;  1R5M A;  3J80 g;  2IWK A;  3FM0 A;  3IJ1 A;  1JMX B;  4FHL A;  4CI3 A;  4J86 A;  2I0T A;  4R7A B;  4J8B A;  1JJU B;  3OW8 A;  4CY1 A;  2PM7 B;  5AJA A;  2OK4 A;  4N14 A;  3JAM g;  3MKS B;  3PVW B;  4A11 A;  4H5I A;  5I5M A;  2BBK H;  1GXR A;  4QT8 A;  5HYN B;  4O9D A;  4A09 B;  4CY3 A;  3HFQ A;  1B9Y A;  1GG2 B;  1U4C A;  2UZX B;  2YNO A;  1NR0 A;  5B4W A;  2YB8 B;  4X61 B;  3UVM A;  5I5J A;  5GXH A;  3ULE C;  5CXC A;  2CNX A;  2H9L A;  3UKR C;  5GSA A;  3SJL D;  2AQ5 A;  4O3U B;  3JRO A;  2Z2N A;  4PXW A;  4GGC A;  4FA4 D;  2AGL A;  2HKR A;  3KRX B;  2IUQ A;  3I2N A;  4U7A A;  4UI9 R;  3V7D B;  3I7P A;  4ZN4 A;  3EI2 B;  1SQJ A;  4CI1 A;  4FAN D;  3SBQ A;  3UVN A;  3DWL C;  4GM9 A;  2QXV A;  1N6E A;  3RLM D;  5EMJ B;  1MG2 A;  5EMK B;  4GGD A;  1PEV A;  4ERZ A;  3MKQ A;  4MK0 B;  5HE2 B;  4FB1 D;  1MG3 A;  4PBY A;  3P4F A;  4PNK B;  5FKR A;  3SWS D;  4A0A A;  4E54 B;  1JMZ B;  2UZY B;  3JRP A;  3NVX A;  4ERY A;  5HE0 B;  3EMH A;  5EAR A;  5H1M A;  2OVP B;  1NEX B;  4L3H D;  4JD2 C;  4LG9 A;  5FKT A;  1GP2 B;  2XYI A;  4J0W A;  3PVU B;  2H9P A;  5EM2 A;  2AGY A;  4OZU A;  4LGN A;  4D6V A;  2H13 A;  3EI4 B;  3IJ0 A;  3MMY A;  2GNQ A;  3SN6 B;  5C2W B;  4J82 A;  2MTA H;  5TF2 A;  5FXY A;  3E0C A;  3DSM A;  2HJB A;  5TEF A;  4O45 A;  2B5M A;  3UVK A;  3ODT A;  3SXT D;  4D0K A;  2PBI B;  4JSV C;  4FAV D; 
#chains in the Genus database with same CATH topology
 4O02 A;  3FCU A;  3OL2 B;  3AL9 A;  3C75 H;  3V4P A;  1UOP A;  5EML B;  4L1M A;  2QC5 A;  4CI2 A;  5EAL A;  2H6K A;  3CFV A;  3EQ9 A;  3C99 A;  4UM9 A;  2O9K A;  3A0F A;  5SXM A;  3JPX A;  5THA A;  2P9I C;  2XU7 A;  2P9S C;  1MDA H;  3DXM C;  4Y7R A;  2OVR B;  1B9X A;  4GM8 A;  5GXI A;  5HDB A;  3PSL A;  5FKQ A;  1YFQ A;  4IMM A;  2HYE A;  2VZ3 A;  3MZL A;  2HU8 A;  1Q47 A;  4BCC A;  3IJE A;  3NID A;  5EAP A;  3B7F A;  4ES0 A;  5EM2 B;  2AGX A;  3I7N A;  3I7O A;  1N6F A;  4ZOZ A;  5CXC B;  1K8K C;  2I0S A;  4NC4 A;  3I7K A;  3T3M A;  2TRC B;  4BCB A;  4Z8L A;  3PXS D;  3RRM C;  2XL3 A;  3IKO A;  2CN3 A;  4IA9 A;  4GQB B;  3RMZ D;  5FLX g;  4YVD A;  1BPO A;  2P9U C;  5H17 A;  3BWS A;  2PM9 A;  2PM9 B;  1E5T A;  3IUL A;  1VYH C;  1A12 A;  3FCS A;  5H14 A;  2P9N C;  4AOW A;  4GQ1 A;  1U8C A;  4L1Q D;  4ESG A;  4L9O A;  5IJ8 E;  2GC7 A;  1QFS A;  1PGU A;  3KRW B;  1OMW B;  3SVW D;  3N0D A;  3ORV D;  2CO0 A;  3JZH A;  4GMB A;  4J78 A;  4FA1 D;  3EI1 A;  2H47 A;  3SBR A;  4CY5 A;  1ERJ A;  2IUP A;  2B4E A;  1K3I A;  4H5J A;  4RE5 A;  2AH0 A;  2G9A A;  3SMR A;  1JOF A;  5AFU 3;  3F3G A;  4JSN C;  3I8E A;  5EMM B;  3AL8 B;  1YR2 A;  4Y5R D;  1FWX A;  4K3J B;  3MXX A;  2H68 A;  3MZK A;  5I5I A;  1E8M A;  4A7J A;  2AH1 A;  5E6S A;  5FA5 B;  2IWF A;  2VDL A;  5CYK B;  3VGZ A;  2H3X A;  2EBS A;  3ZE2 A;  2WQ8 A;  2J57 G;  3K26 A;  3SFZ A;  2CO0 C;  2IAA A;  3J81 g;  4AMZ A;  1OLZ A;  3F3P A;  4J73 A;  3EI1 B;  3ZWL B;  3NIF A;  5GMK n;  4J79 A;  4DNU A;  3I89 A;  2AGW A;  2EIC A;  3VH0 A;  2XDW A;  4GZ8 A;  1GOT B;  2AGZ A;  4KFM B;  2P9K C;  1XIP A;  3W15 A;  4BL0 A;  2GC4 A;  5A2Q g;  3RFH A;  2B5N A;  2I0R A;  3OKW A;  4GGA A;  4ZOV A;  4DNW A;  1VE6 A;  1M1X A;  3AL8 A;  4AEZ A;  3I8C A;  3FGB A;  3GC3 B;  3OKT A;  3EWE A;  1N6D A;  3L4M D;  4PSX B;  5TDH B;  3SCY A;  3I7L A;  3BG1 A;  4QRJ A;  3I7H A;  2BCJ B;  2H9N A;  4A0B B;  4CZY A;  3ZDX A;  3RN0 D;  4PC0 A;  5IGO A;  5AMS A;  4BP8 A;  5HE1 B;  2OK6 A;  3RSE C;  3AH8 B;  4QAM A;  2EID A;  4QL1 A;  5FFO A;  3F3F A;  4O2W A;  5M5R A;  5FQD A;  3JZN A;  3NVN A;  4E54 A;  3EQ8 A;  5E6R A;  3CIK B;  3V9F A;  4CZX A;  4D9S A;  4NAA A;  2YNP A;  4J77 A;  3EI4 A;  3EI3 B;  4EWR A;  4JT5 C;  4TZ4 A;  4K3I D;  2VDN A;  3PE7 A;  5IJ7 E;  3PXW D;  3EG6 A;  4L3G D;  3OKY B;  2XL2 A;  3IIY A;  3FRX A;  3PXT D;  5IT9 g;  4J87 A;  3UVL A;  4A08 A;  1GOF A;  2BKL A;  3AFC A;  3UR4 A;  5CXB B;  5TEE A;  2QR5 A;  5FKS A;  5FFG A;  4JSX C;  1UTC A;  1L0Q A;  4G56 B;  3OKY A;  2Q7Q A;  3SBP A;  2OIZ A;  3EU7 A;  1UOQ A;  1P22 A;  2I3S A;  4JXM A;  4CZV A;  5M5V A;  3OL2 A;  4FA5 D;  2H14 A;  4A0A B;  3T3P A;  1SQ9 A;  5K19 A;  5HE3 B;  2XE4 A;  2J56 H;  2H6Q A;  4Z7O A;  5C86 A;  3K71 A;  1H2W A;  3NVQ A;  1U2V C;  3MVD K;  4FWW A;  4AN0 A;  2HKM A;  2W18 A;  4AMY A;  4JT6 C;  4ERQ A;  5C2V B;  3IIW A;  4XYI A;  2HJ4 A;  3QHY B;  3UVO A;  3K27 A;  4BCD A;  5CXB A;  1I2M B;  1K32 A;  4XYH A;  3NIG A;  4ZOY A;  1H2X A;  5CYK A;  4CC9 A;  3IUJ A;  3PSC B;  4NSX A;  2OVQ B;  4CY2 A;  3DDU A;  3N0E A;  5IC7 A;  2PM6 B;  2EIB A;  2J55 H;  3EI3 A;  4O3T B;  3K6S A;  5C9Z B;  1T2X A;  2H6N A;  2HES X;  5EAM A;  4U1E I;  4JHN A;  4X63 B;  3V5W B;  5K1C C;  4LG8 A;  1TBG A;  1GOG A;  2P9P C;  5HQG A;  2CE9 A;  4Z7N A;  2G99 A;  1A0R B;  3CFS B;  1XKS A;  2CN2 A;  3GFC A;  1O6G A;  3RN1 D;  4A2M A;  1QNI A;  3MUN A;  2OJY A;  2CE8 A;  3IJC A;  1C9L A;  3EQ7 A;  4UM8 A;  4I79 A;  1JTD B;  4XEI C;  3O4I A;  4WK4 A;  4JSP C;  2IUV A;  4ZOX A;  3QI0 A;  5KDO B;  1PI6 A;  2I3T A;  1GOH A;  3UKU C;  3U4Y A;  3SHF A;  4DNV A;  3OTT A;  3EI2 A;  4A08 B;  4BUJ C;  2IUR A;  2Z2P A;  1VE7 A;  4J0X A;  3SLE D;  4A09 A;  3DM0 A;  3C5M A;  4GQ2 P;  4WK0 A;  1RI6 A;  4PSW B;  3BG0 A;  3GRE A;  4MMZ A;  2YMU A;  5M5S A;  4A11 B;  4E5Z A;  4AN1 A;  1H2Z A;  4X60 B;  3VA6 A;  4A2L A;  3JZG A;  3C9C A;  2YNN A;  3ZDY A;  1S4U X;  4FA9 D;  3O4G A;  1C9I A;  4AX4 A;  4A0B A;  1XHM A;  3DXK C;  2P9L C;  4QQE A;  3ZDZ A;  3O4H A;  4E5Z B;  1SHY B;  4J8G A;  5JWZ A;  2YBA A;  2Z2O A;  4J84 A;  3IUR A;  4BH6 A;  1PBY B;  4CI8 A;  2B5L A;  3RFG A;  4WJK A;  2HXC A;  3L4O D;  4HDJ A;  4J81 A;  4GM3 A;  3JB9 L;  1TYQ C;  5IGQ A;  4OWR A;  4X3E A;  2H9M A;  4PBZ A;  2VC2 A;  4O1Q D;  1R5M A;  3J80 g;  3OF7 A;  2IWK A;  3FM0 A;  3IJ1 A;  1JMX B;  4FHL A;  4CI3 A;  4J86 A;  2I0T A;  2HU5 A;  2VDP A;  3VI4 A;  2XZG A;  4JHP C;  4R7A B;  2VDK A;  1VZ2 A;  3IUN A;  3IUM A;  4J8B A;  4MMX A;  3ZE1 A;  1JJU B;  3OW8 A;  4CY1 A;  5C92 A;  2PM7 B;  2VDO A;  5AJA A;  2OK4 A;  4N14 A;  3JAM g;  3MKS B;  3PVW B;  4A11 A;  4H5I A;  5I5M A;  2BBK H;  1GXR A;  4QT8 A;  4RE6 A;  5HYN B;  4O9D A;  4A09 B;  4CY3 A;  3HFQ A;  2EIE A;  1B9Y A;  1GG2 B;  1U4C A;  2UZX B;  2YNO A;  1NR0 A;  5B4W A;  3IUQ A;  2YB8 B;  4X61 B;  3UVM A;  5I5J A;  5GXH A;  1L5G A;  3ULE C;  5CXC A;  3V4V A;  2CNX A;  2VDR A;  4G55 A;  3MUO A;  1TYE A;  1VZ3 A;  2H9L A;  4NEN A;  3UKR C;  5GSA A;  4G1M A;  3SJL D;  3K72 A;  2AQ5 A;  4O3U B;  3JRO A;  2Z2N A;  4PXW A;  4GGC A;  4FA4 D;  2AGL A;  2HKR A;  3KCI A;  3KRX B;  2IUQ A;  3I2N A;  4U7A A;  4UI9 R;  4NBM A;  1E8N A;  3V7D B;  3I7P A;  4ZN4 A;  3EI2 B;  2VZ1 A;  3IVM A;  1SQJ A;  4CI1 A;  1H2Y A;  5E6U A;  4FAN D;  1JV2 A;  3SBQ A;  3UVN A;  3DWL C;  4MMY A;  4GM9 A;  2VDQ A;  2HU7 A;  2QXV A;  1N6E A;  3RLM D;  5EMJ B;  3O4J A;  1MG2 A;  5EMK B;  4GGD A;  1PEV A;  3VI3 A;  4ERZ A;  5M5T A;  4WK2 A;  3MKQ A;  4MK0 B;  5HE2 B;  4FB1 D;  1MG3 A;  4PBY A;  3P4F A;  4PNK B;  5FKR A;  3SWS D;  4A0A A;  4E54 B;  1JMZ B;  4Z7Q A;  3ZE0 A;  2UZY B;  3JRP A;  3NVX A;  4ERY A;  5HE0 B;  3EMH A;  5EAR A;  5H1M A;  2OVP B;  1UOO A;  1NEX B;  4L3H D;  4JD2 C;  4LG9 A;  4BP9 A;  5FKT A;  1GP2 B;  2XYI A;  4J0W A;  3PVU B;  5M5U A;  2H9P A;  2JKX A;  4IRZ A;  3GD1 I;  5EM2 A;  1QFM A;  2AGY A;  4OZU A;  4LGN A;  4D6V A;  2H13 A;  3EI4 B;  2QZP A;  3IJ0 A;  2GNQ A;  3MMY A;  3SN6 B;  5C2W B;  4J82 A;  2MTA H;  5TF2 A;  5FXY A;  3E0C A;  3DSM A;  2HJB A;  5TEF A;  4O45 A;  1O6F A;  2B5M A;  3UVK A;  3ODT A;  4G1E A;  5M61 A;  3SXT D;  2VDM A;  4D0K A;  2PBI B;  4JSV C;  4FAV D; 
#chains in the Genus database with same CATH homology
 3OL2 B;  3AL9 A;  3C75 H;  5EML B;  2QC5 A;  4CI2 A;  5EAL A;  2H6K A;  3CFV A;  3C99 A;  2O9K A;  3A0F A;  5SXM A;  3JPX A;  5THA A;  2P9I C;  2XU7 A;  2P9S C;  1MDA H;  3DXM C;  4Y7R A;  2OVR B;  1B9X A;  4GM8 A;  5GXI A;  3PSL A;  5FKQ A;  1YFQ A;  4IMM A;  2HYE A;  3MZL A;  1Q47 A;  5EAP A;  3B7F A;  4ES0 A;  5EM2 B;  2AGX A;  3I7N A;  3I7O A;  1N6F A;  4ZOZ A;  5CXC B;  1K8K C;  2I0S A;  3I7K A;  2TRC B;  4Z8L A;  3PXS D;  3RRM C;  2XL3 A;  3IKO A;  2CN3 A;  4IA9 A;  4GQB B;  3RMZ D;  5FLX g;  4YVD A;  5H17 A;  2P9U C;  3BWS A;  2PM9 A;  2PM9 B;  1VYH C;  5H14 A;  4AOW A;  2P9N C;  4GQ1 A;  4L1Q D;  5IJ8 E;  4ESG A;  4L9O A;  2GC7 A;  1PGU A;  3KRW B;  1OMW B;  3SVW D;  3N0D A;  3ORV D;  2CO0 A;  3JZH A;  4GMB A;  4J78 A;  4FA1 D;  3EI1 A;  2H47 A;  3SBR A;  4CY5 A;  1ERJ A;  2IUP A;  2B4E A;  4H5J A;  2AH0 A;  2G9A A;  3SMR A;  1JOF A;  5AFU 3;  3F3G A;  4JSN C;  3I8E A;  5EMM B;  3AL8 B;  4Y5R D;  1FWX A;  4K3J B;  3MXX A;  2H68 A;  3MZK A;  5I5I A;  4A7J A;  2AH1 A;  5FA5 B;  2IWF A;  5CYK B;  3VGZ A;  2H3X A;  2EBS A;  2J57 G;  3K26 A;  3SFZ A;  2CO0 C;  2IAA A;  3J81 g;  1OLZ A;  3F3P A;  4J73 A;  3EI1 B;  3ZWL B;  5GMK n;  4J79 A;  3I89 A;  2AGW A;  3VH0 A;  4GZ8 A;  1GOT B;  2AGZ A;  4KFM B;  2P9K C;  1XIP A;  3W15 A;  4BL0 A;  2GC4 A;  5A2Q g;  3RFH A;  2B5N A;  2I0R A;  3OKW A;  4GGA A;  4ZOV A;  3AL8 A;  4AEZ A;  3I8C A;  3FGB A;  3OKT A;  3EWE A;  1N6D A;  3L4M D;  4PSX B;  5TDH B;  3SCY A;  3I7L A;  3BG1 A;  4QRJ A;  3I7H A;  2BCJ B;  2H9N A;  4A0B B;  4CZY A;  3RN0 D;  4PC0 A;  5IGO A;  5AMS A;  5HE1 B;  2OK6 A;  3RSE C;  3AH8 B;  4QL1 A;  3F3F A;  5FQD A;  3JZN A;  3NVN A;  4E54 A;  3CIK B;  3V9F A;  4CZX A;  2YNP A;  4J77 A;  3EI4 A;  3EI3 B;  4EWR A;  4JT5 C;  4TZ4 A;  4K3I D;  3PE7 A;  5IJ7 E;  3PXW D;  3EG6 A;  4L3G D;  3OKY B;  2XL2 A;  3IIY A;  3FRX A;  3PXT D;  5IT9 g;  4J87 A;  3UVL A;  4A08 A;  3AFC A;  3UR4 A;  5CXB B;  5TEE A;  5FKS A;  4JSX C;  1L0Q A;  4G56 B;  3OKY A;  2Q7Q A;  3SBP A;  2OIZ A;  3EU7 A;  1P22 A;  2I3S A;  4JXM A;  4CZV A;  3OL2 A;  4FA5 D;  2H14 A;  4A0A B;  1SQ9 A;  5K19 A;  5HE3 B;  2J56 H;  2H6Q A;  3NVQ A;  1U2V C;  4FWW A;  2HKM A;  2W18 A;  4JT6 C;  4ERQ A;  5C2V B;  3IIW A;  4XYI A;  2HJ4 A;  3UVO A;  3K27 A;  5CXB A;  1K32 A;  4XYH A;  4ZOY A;  5CYK A;  4CC9 A;  3PSC B;  4NSX A;  2OVQ B;  4CY2 A;  3N0E A;  5IC7 A;  2PM6 B;  2J55 H;  3EI3 A;  4O3T B;  5C9Z B;  2H6N A;  2HES X;  5EAM A;  4U1E I;  4X63 B;  3V5W B;  5K1C C;  4LG8 A;  1TBG A;  2P9P C;  5HQG A;  2CE9 A;  2G99 A;  1A0R B;  3CFS B;  1XKS A;  2CN2 A;  3GFC A;  3RN1 D;  4A2M A;  1QNI A;  2OJY A;  2CE8 A;  3IJC A;  4I79 A;  4XEI C;  4JSP C;  2IUV A;  4ZOX A;  5KDO B;  1PI6 A;  2I3T A;  3UKU C;  3U4Y A;  3SHF A;  3OTT A;  3EI2 A;  4A08 B;  4BUJ C;  2IUR A;  2Z2P A;  4J0X A;  3SLE D;  4A09 A;  3DM0 A;  3C5M A;  4GQ2 P;  1RI6 A;  4PSW B;  3BG0 A;  3GRE A;  2YMU A;  4A11 B;  4E5Z A;  4X60 B;  3VA6 A;  4A2L A;  3JZG A;  3C9C A;  2YNN A;  1S4U X;  4FA9 D;  4A0B A;  1XHM A;  3DXK C;  2P9L C;  4QQE A;  4E5Z B;  1SHY B;  4J8G A;  5JWZ A;  2YBA A;  2Z2O A;  4J84 A;  4BH6 A;  1PBY B;  4CI8 A;  2B5L A;  3RFG A;  2HXC A;  3L4O D;  4HDJ A;  4J81 A;  4GM3 A;  3JB9 L;  1TYQ C;  5IGQ A;  4OWR A;  4X3E A;  2H9M A;  4PBZ A;  4O1Q D;  1R5M A;  3J80 g;  2IWK A;  3FM0 A;  3IJ1 A;  1JMX B;  4FHL A;  4CI3 A;  4J86 A;  2I0T A;  4R7A B;  4J8B A;  1JJU B;  3OW8 A;  4CY1 A;  2PM7 B;  5AJA A;  2OK4 A;  4N14 A;  3JAM g;  3MKS B;  3PVW B;  4A11 A;  4H5I A;  5I5M A;  2BBK H;  1GXR A;  4QT8 A;  5HYN B;  4O9D A;  4A09 B;  4CY3 A;  3HFQ A;  1B9Y A;  1GG2 B;  1U4C A;  2UZX B;  2YNO A;  1NR0 A;  5B4W A;  2YB8 B;  4X61 B;  3UVM A;  5I5J A;  5GXH A;  3ULE C;  5CXC A;  2CNX A;  2H9L A;  3UKR C;  5GSA A;  3SJL D;  2AQ5 A;  4O3U B;  3JRO A;  2Z2N A;  4PXW A;  4GGC A;  4FA4 D;  2AGL A;  2HKR A;  3KRX B;  2IUQ A;  3I2N A;  4U7A A;  4UI9 R;  3V7D B;  3I7P A;  4ZN4 A;  3EI2 B;  1SQJ A;  4CI1 A;  4FAN D;  3SBQ A;  3UVN A;  3DWL C;  4GM9 A;  2QXV A;  1N6E A;  3RLM D;  5EMJ B;  1MG2 A;  5EMK B;  4GGD A;  1PEV A;  4ERZ A;  3MKQ A;  4MK0 B;  5HE2 B;  4FB1 D;  1MG3 A;  4PBY A;  3P4F A;  4PNK B;  5FKR A;  3SWS D;  4A0A A;  4E54 B;  1JMZ B;  2UZY B;  3JRP A;  3NVX A;  4ERY A;  5HE0 B;  3EMH A;  5EAR A;  5H1M A;  2OVP B;  1NEX B;  4L3H D;  4JD2 C;  4LG9 A;  5FKT A;  1GP2 B;  2XYI A;  4J0W A;  3PVU B;  2H9P A;  5EM2 A;  2AGY A;  4OZU A;  4LGN A;  4D6V A;  2H13 A;  3EI4 B;  3IJ0 A;  3MMY A;  2GNQ A;  3SN6 B;  5C2W B;  4J82 A;  2MTA H;  5TF2 A;  5FXY A;  3E0C A;  3DSM A;  2HJB A;  5TEF A;  4O45 A;  2B5M A;  3UVK A;  3ODT A;  3SXT D;  4D0K A;  2PBI B;  4JSV C;  4FAV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...