3C78X

0.98 a crystal structure of nitrophorin 4 from rhodnius prolixus containing fe(iii) 2,4 dimethyl deuteroporphyrin ix complexed with ammonia at ph 7.5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin-4
publication title Heme Distortion in Nitrophorin 4: High Resolution Structures of Mutated Positions L123V and L133V and Heme Altered Proteins
rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 48
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3c78X00
5K06A 3DTQA 1CBIA 3KFFA 5HCDC 5LKFA 1DV9A 3WJEA 3ELZA 1A3YA 5F6ZA 1ACDA 2OVAA 1TOWA 2OFMX 3DSZA 3WVMA 3B2LA 1T0VA 3VG5A 5IO7A 3EBKA 5HAEA 1ICMA 1IFCA 4IAWA 4TKJA 2Q9SA 2WWPA 4ORUA 3ZQ3A 2AT3X 2RQ0A 3VG7A 5DG4A 5LJHA 4IB6A 1GT4A 1DZJA 1PBOA 4NNTA 4YDBA 1BSQA 1ZNGA 1LIEA 1QABE 3RSWA 1YWAA 1FE3A 1SA8A 1RBPA 4YKOA 5LJKA 1I4UA 1JV4A 2XKLA 2G79A 2HMBA 5D45A 3VG2A 2ALLX 5IO5A 5BVSA 1QY2A 3FR2A 1TVQA 1HQPA 3VG4A 1CBQA 3NQ9A 3AKMA 1X8PA 5H9KA 4EXZA 2K23A 1OBPA 4ORSA 1L6MA 4YBUA 1BSOA 5HTEA 5LJDA 1PEEA 3EM0A 5EZ2A 1ICNA 4ZCBA 1D3SA 3F8AA 4ZR2A 3SAOA 4ZHDA 1YP7A 4Y0RA 4ORRA 4QAEA 4ZHFA 1KT7A 4IBAA 2EU7X 4LKTA 2N93A 4BOEA 3VG6A 4GETA 1HN2A 1JBHA 2HZQA 3D95A 3PH6A 5KIDA 1ZNHA 5FAZA 5LJGA 3NQ3A 3CMPA 5KICA 2HYSA 3I0AA 4ORYA 4ZH6A 1ERXA 2FS7A 1OPBA 1LF7A 5IO6A 3IFBA 5HZ6A 5BVQA 2YG2A 3FW5A 4HFOA 2FRSA 1E00A 1SY2A 2KTDA 1GT5A 5CE4A 2JU8A 1GT3A 3O22A 1S2PA 4AYHA 3P6FA 3TGBA 5HA0A 5H9LA 4ES7A 4ZHGA 1GKAB 1S44A 3I17A 1ZNDA 1GM6A 2L68A 2Q2MA 4N7DA 2L67A 2ANSA 1DC9A 2P8GA 3STKA 4QGWA 1OEKA 4I9SA 5FENA 1DZMA 2Q39A 3CQRA 4AZNA 1KGLA 1LPJA 1E02A 3NADA 1DFVA 1GXAA 2MJIA 1ZNKA 2E4JA 1LNMA 2WQAE 1MUPA 1OPAA 2WUTA 1JYJA 4A60A 4BVMA 1I04A 5F1EA 1HBPA 1OEJA 1OBUA 1X8NA 5HBSA 4BQUA 1TW4A 2BLGA 2NP1A 3GAQA 3U9PC 5HWZA 4ALOA 5KHPA 1IW2A 2A2GA 4GRJA 4RUUA 4IMNA 2RD7C 3STNA 1QFVA 4TQ2A 1QQSA 5LJEA 1BWYA 4I3BA 4OMXA 1BRPA 2X46A 2AT8X 2NNDA 5AQ6A 1TOUA 3F9DA 1EPBA 3FEPA 3KFIA 4GNWA 4ZFXA 4WBKA 1ALBA 1LIBA 1TXLA 1B4MA 3STMX 4XMCA 5L8IA 4AW8A 4ORWA 2ACOA 1EPAA 4OS3A 3B2KA 1KXOA 1LKEA 4IMOA 5F58A 2HNXA 2NNEA 1CBSA 1G7NA 4ALBA 3WJDA 5LKEA 2QO6A 1VYFA 3WJFA 4I9RA 4YFPA 1BM5A 3TGAA 1KT3A 2AT5X 2QO5A 4NYRA 4AZOA 4NNSA 1YP6A 3EYCA 3NX2A 3AKNA 3TZSA 2R74A 3UEWA 1ZRYA 2IFBA 2A3FX 1A57A 2FR2A 2JU7A 1LIDA 2GC9A 1MVGA 1GKAA 3BX7A 5D47A 3TGCA 3B2IA 2A2UA 5D48A 5F6BA 1CJ5A 5LJCA 2QM9A 3C76X 3FA8A 4NLJA 5F7GA 4I3CA 5EDCA 4GKCA 1B8EA 5H8TA 3C78X 3HWFA 1HBQA 4QZTA 1N0SA 4ZHCA 1EIOA 5B29A 1JZUA 4RUNA 3U03A 1QFTA 1KT6A 1FENA 5HA1A 4ARHA 2F73A 1SY1A 1SY0A 2LKKA 4D6AA 2R56A 2OVEA 3PH5A 1BEBA 1G5WA 4M7MA 1HMSA 1AELA 5BVTA 3JSQA 1EALA 1EIIA 1JJXA 1I06A 2L5PA 3BY0A 2QO4A 3CR6A 1H91A 1DZPA 1B56A 3G7XA 1XKIA 4EFGA 4QGXA 4EDEA 3APUA 3MBTA 1OEEA 1G74A 1VPRA 1EQDA 2CBSA 3PP6A 4ZGUA 3P6EA 1ML7A 1MX8A 2GTFX 1P6PA 2FWVA 2FS6A 3CBSA 4ODDA 4TKBA 4MVLA 3CBCA 4YGGA 4YMYA 1SXWA 1MDCA 1AQBA 2FR3A 1T8VA 4QZUA 1QG5A 5EEDA 4AZMA 5L8OA 1PMPA 1SXXA 2HLVA 1YWDA 1BJ7A 1LICA 4A1HA 3NX1A 2OZQA 2CM9A 3P6CA 2RCQA 1U18A 4PSQA 3WBGA 1KT5A 3ZUOA 4YFRA 1YUPA 2RA6A 4HPDA 4A8ZA 3KZAA 4AZQA 4I3DA 1BLRA 1CBRA 1LIFA 1SXYA 2L9CA 3JS1A 1QWDA 2WR6A 1AVGI 4LKPA 3TF6A 2O62A 2FTBA 2LFOA 3D97A 3IA8A 1KOIA 4TLJA 4WFVA 4MVIA 3FR5A 4Y0SA 4YKMA 1JYDA 1NP1A 2WEXA 2OVDA 3RZYA 4TJZA 2WSJA 4NLIA 1U17A 5DPQA 4IB8A 3CWKA 3FELA 1FTPA 4D6BA 2MO5A 5L8NA 2W2BA 1KQWA 1XCAA 4ZH9A 1EXSA 3HWDA 2CM4A 1E06A 3FMZA 4GNYA 1ZNLA 4GH7A 3FIQA 3FEKA 2JOZA 4WFUA 4A1YA 3OJYC 2AT6X 3KQ0A 5B27A 3NR3A 3BDRA 3HK1A 1CRBA 4YGHA 4O9SA 1B0OA 3O19A 4IAXA 2NNQA 3BX8A 3HWEA 4OMWA 1SY3A 1T68X 2XSTA 1O1UA 4QYNA 2ACPX 4AZPA 1GGLA 1AB0A 1JJJA 2AMMX 3P6HA 3BSZE 1QY1A 4ORXA 4YH0A 2CZTA 2A13A 1G85A 1IFBA 5D8JA 1ADLA 5HZ5A 1VYGA 2AL0X 1DZKA 2JN3A 3O2YA 4ZJ0A 2FT9A 1ZNEA 4OS0A 5HCCC 4LZUA 1IKEA 1X8UA 2G78A 3WJBA 3PEDA 4HPAA 2PY1A 3KFHA 3K3LA 1KQXA 3BRNA 5H9NA 2AT0X 1O8VA 2JU3A 4YCEA 1GX8A 2Q2PA 2MM3A 5FFHA 1IKJA 3EMMA 1S7DA 4TKHA 1KZWA 1FELA 1D2UA 1LFOA 1PM1X 2AKQA 4NP1A 3P6GA 1MX7A 2CBRA 2W2FA 3FA7A 1A2DA 3ZUIA 4QGVA 4QYPA 3KFGA 1YWBA 3BLGA 3B2HA 4YDAA 3FW4A 4YCHA 3APWA 1BSYA 3UEXA 3T1DA 3APVA 4HPBA 1EUOA 3Q6LA 2A0AA 5HZ8A 3EBWA 2HZRA 4XMFA 1X8QA 4HPCA 1IIUA 5EEEA 3HWGA 3FENA 3APXA 1UZ2X 1YWCA 4AZRA 2QOSC 1FDQA 3B2JA 2GJ5A 2WEWA 3UEUA 5C0NA 1NGLA 4YFQA 3CQNA 2AH7X 2FLJA 1KT4A 4NYQA 2R73A 3BU1A 1ERBA 2KT4B 2RCTA 1RLBE 4XMGA 1X8OA 2K62A 3NPOA 1FEMA 2OFRX 3PECA 3WJGA 1HMRA 3ELXA 4DQ3A 4IB9A 1A18A 2WQ9A 4YGZA 1X89A 2CZUA 3QKGA 4MVKA 2G7BA 3WJCA 1EW3A 3NP1A 3FA9A 4Y0PA 1R0UA 4OS8A 4LZVA 3L4RA 3BS2A 5EDBA 1HMTA 1OBQA 4XMDA 3FR4A 3U0DA 3VG3A 3S26A 2W2AA 4DQ4A 2LB6A 3FA6A 4UU2A 5HZ9A 4EEJA 5JR8A 1I05A 5HCEC 1GX9A 4N7CA 1BRQA 1E5PA 4K19A 1UREA 3PPTA 1YIVA 3WXQA 3BU9A 1DF3A 4R0BA 4GE1A 3D96A 3FLLA 4M6SA 4UU3A 4TNNA 2Q4NA 5HZQA 1KZXA 3UEVA 3C77X 4IB7A 2LBVA 3P6DA 1O1VA 2POAA 5H9AA 5LJBA 1Z24A 1SXUA 1NP4A 2X45A 1GT1A 4Y0QA 5HTDA 4ZHHA 4XMHA 4YBPA 5D4AA 1X71A 2LBAA 1U0XA 3MVFA 5EPQA 2ASNX 4KIIA 4XMEA 4CK4A 1BBPA 2DM5A 1QY0A
chains in the Genus database with same CATH superfamily
5K06A 4BX6B 3DTQA 1CBIA 1STRB 2DJFA 3HOEA 3KFFA 5LKFA 5HCDC 1DV9A 3WJEA 3ELZA 1A3YA 2OY5O 5F6ZA 1ACDA 2OVAA 2Y32A 1TOWA 2OFMX 3DSZA 3WVMA 3B2LA 1T0VA 3VG5A 5IO7A 1KGLA 3EBKA 5HAEA 2JW1A 3OE3A 1ICMA 1IFCA 1VWEB 1SRJA 1STSB 1RXHA 4IAWA 4TKJA 2Q9SA 1SWLA 2WWPA 4ORUA 5B5GA 1E2TA 3ZQ3A 2AT3X 2RQ0A 3VG7A 5DG4A 5LJHA 4IB6A 5F2BA 1SREA 1GT4A 1DZJA 1PBOA 4L1NA 3QQ2A 1W6FA 4NNTA 4YDBA 1BSQA 1ZNGA 1SRGA 3ZW1B 1LIEA 1QABE 4BGFA 4FQBB 3RSWA 1YWAA 1AVDA 1FE3A 1RBPA 1SA8A 1SWRA 1I4UA 1JV4A 3AEHA 1VWAB 2XKLA 2G79A 2HMBA 5D45A 3VG2A 2ALLX 2X8TA 5IO5A 5BVSA 5CHKA 1QY2A 3FR2A 1TVQA 1HQPA 5CSEA 4HWMA 3VG4A 1CBQA 3NQ9A 1SMPI 3AKMA 1X8PA 4CDDA 2C4IA 2X8SA 5H9KA 4U9CA 4EXZA 2K23A 1OBPA 1SRHA 4ORSA 1L6MA 4YBUA 1BSOA 5HTEA 5LJDA 1PEEA 4U8UN 2BC3A 3EM0A 5EZ2A 1SWPA 1ICNA 4ZCBA 4BX7A 1D3SA 3F8AA 4MIRA 4ZR2A 2KTSA 3SAOA 1WUBA 4ZHDA 1YP7A 4Y0RA 1VYOA 4ORRA 1N4JA 3PDFA 4QAEA 4ZHFA 3MM0A 1KT7A 4IBAA 2EU7X 2RTPB 4LKTA 2N93A 3WYQA 4BOEA 3VG6A 4GETA 1HN2A 1JBHA 2RTAA 2HZQA 3D95A 3PH6A 3SZIA 5KIDA 1ZNHA 5FAZA 3WZNA 5LJGA 2IZCB 3NQ3A 3CMPA 5KICA 2HYSA 3I0AA 2RTKA 1SWBA 4ORYA 2UZ2A 4ZH6A 1LDOA 1ERXA 2FS7A 1OPBA 1LF7A 1SWDA 2KW1A 3D4RA 3IFBA 5BVQA 2YG2A 3FW5A 4EKVA 5HZ6A 4HFOA 3N91A 2FRSA 1E00A 1SY2A 2KTDA 1VWMB 1GT5A 2OY8A 3RE5A 5CE4A 2JU8A 1GT3A 3O22A 1LELA 1S2PA 4AYHA 1VWRB 3P6FA 3ZZVA 3TGBA 4OEMA 5H9LA 5HA0A 4QNIA 4ES7A 1VWHB 4ZHGA 1GKAB 1S44A 1Y55X 3I17A 1ZNDA 1GM6A 2L68A 4IABA 4ZGFA 3SOTA 2Q2MA 1SWGA 4N7DA 2L67A 2ANSA 1DC9A 4KC8A 2P8GA 3VPJE 3STKA 4QGWA 1OEKA 3ZW2A 4I9SA 2C1QA 5FENA 4OELA 1DZMA 2Q39A 3CQRA 5IRUA 4AZNA 2GTLO 1K3BA 1E02A 1LPJA 2MF6A 2RTHB 1DFVA 3NADA 4GGRA 4BX7B 1GXAA 2F09A 4GGZA 2MJIA 1KZWA 1ZNKA 1HXZA 2E4JA 4O3WA 3WYPA 1LNMA 4Z6JA 2WQAE 1MUPA 1OPAA 2WUTA 1JYJA 4A60A 1SRFA 4O3XB 4BVMA 1SLEB 1I04A 5F1EA 1HBPA 3CKFA 2UYWA 1OEJA 1OBUA 1VWPB 1X8NA 5HBSA 3PQSA 1TW4A 2BLGA 2NP1A 3GAQA 4U8UM 3T2WA 3U9PC 4O3YA 4ALOA 5HWZA 5KHPA 1IW2A 2A2GA 3RBYA 4GRJA 4RUUA 4IMNA 2RD7C 3STNA 1QFVA 2G5LA 2RTLA 1EI5A 1QQSA 1SWTA 4TQ2A 5L3YA 5LJEA 1BWYA 2OFBA 4I3BA 4OMXA 4O4OA 3VGWA 5AJCA 5IRAA 1BRPA 2X46A 2AT8X 2NNDA 2X55A 5AQ6A 1TOUA 3F9DA 1EPBA 2BS6A 4Z27A 1SWKA 2RTQB 3FEPA 4WHIA 3KFIA 2ZAIA 4GNWA 4ZFXA 4WBKA 1ALBA 1LIBA 1TXLA 1SWUA 1B4MA 4NV7A 3STMX 4XMCA 1SWOA 5L8IA 4AW8A 4ORWA 2ACOA 1EPAA 2M4LA 2RTNB 4OS3A 3B2KA 1KXOA 1LKEA 2IZGB 4IMOA 5F58A 2HNXA 4JNJA 2ZAGA 2NNEA 1CBSA 3KVNA 1G7NA 1VWLB 5CYBA 4ALBA 3WJDA 1HY2A 4Z2OA 5LKEA 2X34A 2RTDB 2QO6A 1VYFA 2F01A 3WJFA 2IZEB 2MHDA 1DF8A 4I9RA 4YFPA 1BM5A 3TGAA 1LCVA 2IZKA 3OD9A 2JMBA 3FYFA 1KT3A 3RY1A 1KL4A 2AT5X 4JHQA 2QO5A 4NYRA 4AZOA 4NNSA 2RN4A 1YP6A 4GDZA 3WZPA 3EYCA 4QGVA 3NX2A 3AKNA 3TZSA 2R74A 3UEWA 1Y0GA 4Z2PA 1ZRYA 1VWJB 2JGSA 3PK2A 2IFBA 2A3FX 2BT9A 1A57A 1IJ8A 4I60A 2FR2A 2JU7A 1LIDA 2GC9A 3EC5A 4GD9A 1MVGA 1VWGB 1GKAA 3BX7A 5D47A 3TGCA 3B2IA 2A2UA 5D48A 5F6BA 2Y3FA 3ZW0A 2RTRB 3T2XA 4I6SA 3RE6A 2X4MA 4BCSA 1CJ5A 1N9MA 3S5XA 5LJCA 2QM9A 3C76X 3FA8A 4NLJA 4U8UO 1VWCB 5F7GA 3OBLA 4I3CA 5EDCA 4GKCA 3WZQA 1B8EA 1WBIA 3E3CA 3C78X 3HWFA 1HBQA 3MX7A 4QZTA 5H8TA 1N0SA 4ZHCA 1EIOA 1KFFA 5B29A 3S5VA 2I5ZO 1JZUA 3FIDA 4RUNA 1MM9A 3EW1A 3U03A 1QFTA 1KT6A 1FENA 1SLGB 3PQUA 5HA1A 3GE2A 2VFCA 4EQAC 4ARHA 1NBXA 1JQPA 2ZSCA 2F73A 1SY1A 1SY0A 2OF9A 2LKKA 2OVSA 2DJGA 3SZHA 4GJSA 4D6AA 2R56A 2OVEA 2OF8A 3PH5A 4I95A 3VU1A 1BEBA 1G5WA 2WPUA 4M7MA 1HMSA 2AF5A 1AELA 1SWSA 5BVTA 3JSQA 1EALA 1EIIA 3SLTA 1I06A 2L5PA 3BY0A 2QO4A 3CR6A 4GK9A 1JJXA 1H91A 2VFBA 5B5FA 1DZPA 1B56A 1Y9TA 3NBXX 3G7XA 1XKIA 4EFGA 4QGXA 4EDEA 3APUA 3MBTA 1OEEA 1G74A 1VPRA 2OY7A 1EQDA 2CBSA 3PP6A 4O4XA 4ZGUA 3P6EA 1ML7A 1MX8A 4GUZA 2GTFX 1P6PA 2RTMA 4BX5A 1HQQA 2FS6A 2FWVA 3CBSA 4ODDA 1NC9A 3ZW0B 4TKBA 4MVLA 3CBCA 4YGGA 4YMYA 1SXWA 1MDCA 1AQBA 1MEPA 3LTWA 2FR3A 1T8VA 2RTOB 4QZUA 2RTFB 4OKAA 1QG5A 4FBVA 1N43A 2QMIA 4MISA 4CPHA 5EEDA 4KH8A 1VWOB 4AZMA 5L8OA 3CKGA 1PMPA 1SXXA 2FKGA 1YWDA 2HLVA 1BJ7A 1LICA 4PJ2A 2A5CA 4A1HA 2BHVA 1SWNA 2OZQA 1SWCA 3NX1A 2CM9A 2AVIA 3X00A 2OY1O 3P6CA 2RCQA 1U18A 4PSQA 2IZIA 1KT5A 3WBGA 3ZUOA 4YFRA 1YUPA 2RA6A 4HPDA 4A8ZA 3KZAA 2RTGB 1JJUA 1SWAA 4AZQA 4I3DA 1BLRA 1CBRA 1LIFA 1RSUB 1SXYA 2L9CA 1QWDA 2WR6A 1UYOX 3JS1A 1AVGI 4LKPA 3RDOA 3TF6A 1VWNB 4YVBA 3NQKA 2O62A 2FTBA 2OL7A 5B3MO 2LFOA 3HOLA 3D97A 3IA8A 1KOIA 3FDCA 4TLJA 4WFVA 4MVIA 4QRLA 3FR5A 1JIWI 1Y52X 4Y0SA 4YKMA 1JYDA 1PTSA 1MOYA 2GTLN 5AJBA 1SWEA 1NP1A 2WEXA 2OVDA 2IZHB 4IRWA 4TJZA 1RXKA 2WSJA 4GGTA 3RDSA 4LQZA 1W5RA 3RZYA 4NLIA 4CDFA 1U17A 5DPQA 3WOVA 4BX5B 3P02A 3RDXA 2I5VO 4IB8A 5JD2A 3CWKA 3FELA 1FTPA 4D6BA 2MO5A 4MEEA 5L8NA 2W2BA 1KQWA 2IZDB 1XCAA 1Y9LA 4U3QA 1EXSA 4YKOA 2MWHA 2IZJA 3HWDA 4ZH9A 2CM4A 1E06A 3FMZA 4GNYA 4ON1A 2Z4IA 3VE1A 1ZNLA 4GJVA 4GH7A 4Y5DA 3FIQA 2BS5A 3FEKA 2JOZA 4WFUA 4A1YA 4CPHB 3OJYC 2AT6X 3KQ0A 5B27A 3NR3A 3F6ZB 3BDRA 3HK1A 1CRBA 3ZI8A 1KL3A 4YGHA 5FQ8E 4BJ8A 4O9SA 1SWFA 1B0OA 1SWQA 1PBYA 3S60A 1AVEA 1W4TA 3O19A 2RTEB 4IAXA 2NNQA 3BX8A 3HWEA 4OMWA 5FQ6E 4CDCA 1SY3A 1T68X 2A5BA 2XSTA 1O1UA 4QYNA 2ACPX 2X32A 5B2AO 1VWFB 4AZPA 1GGLA 1AB0A 2LA7A 4JGLA 4CV7A 3VHIA 1JJJA 2AMMX 3P6HA 3BSZE 1QY1A 4ORXA 4YH0A 1SRIA 2CZTA 2A13A 1SWHA 1NDJA 2OL8O 1G85A 1IFBA 5D8JA 1ADLA 5HZ5A 1VYGA 2AL0X 5AEOA 1DZKA 2JN3A 4BQUA 2RTCB 3O2YA 4KCAA 4FBRA 2FT9A 3Q34A 4ZJ0A 1ZNEA 4OS0A 4U46A 5HCCC 4LZUA 1N7YA 1IKEA 1X8UA 1LCWA 2G78A 3WJBA 3PEDA 4HPAA 2PY1A 3KFHA 3K3LA 1KQXA 3BRNA 4Z28A 5H9NA 3VHMA 2AT0X 1O8VA 4DNEA 4INNA 2JU3A 3MG5A 3JQOA 4YCEA 1GX8A 2Q2PA 2MM3A 2Y3EA 5FFHA 3T6LA 3WZOA 1IKJA 3EMMA 2GH7A 4B55A 1S7DA 2RTBB 1N9YA 1FELA 4TKHA 1D2UA 1LFOA 1PM1X 2AKQA 2X8FA 4ML7B 4NP1A 3P6GA 4O4UA 3SLJA 1MX7A 2CBRA 2W2FA 3FA7A 1A2DA 2GTLM 2KD2A 4QYPA 3KFGA 2IZAA 3ZUIA 1YWBA 3BLGA 3B2HA 4YDAA 3FW4A 4YCHA 3APWA 1BSYA 3UEXA 3T1DA 3APVA 4HPBA 1EUOA 1SLDB 1OSPO 5FQ7E 3Q6LA 4CDEA 2A0AA 4JO6A 5HZ8A 4L3RA 3EBWA 3UAQA 1JMZA 1K24A 1NQNA 2G8CO 2HZRA 1X8QA 4XMFA 3RDUA 4HPCA 2X56A 2HKDA 2A8GA 1RXJA 1IIUA 5EEEA 3RY2A 4CSBA 4DCBA 3HWGA 2IZBA 3FENA 4GU8A 1NQMA 3APXA 3SZJA 1UZ2X 1YWCA 4AZRA 4BBOA 2QOSC 4GDAA 4COTA 2IZFB 2PI3O 2YMSA 1VWQB 1FDQA 3RDQA 2CAMA 2QCBA 3B2JA 2GJ5A 2WEWA 3UEUA 2QOMA 5C0NA 5IRWA 1NGLA 4YFQA 1I78A 1GX3A 3CQNA 4FGIB 2FKJA 1RAVA 2AH7X 2FLJA 1KT4A 4NYQA 2R73A 3BU1A 1ERBA 2KT4B 2RCTA 1RLBE 4GZVA 4XMGA 1X8OA 3ZWEA 4CPIA 4Y59A 2K62A 1FJ1E 2RTIB 3NPOA 3RWXA 1FEMA 2OFRX 1HXLA 3PECA 3WJGA 1HMRA 3ELXA 3HPEA 4DQ3A 4IB9A 1A18A 2WQ9A 4O49A 4YGZA 1X89A 2CZUA 3QKGA 1STPA 4MVKA 4NV8A 1VWDB 3VE2A 4QQ1A 2G7BA 1VWBB 3WJCA 3T6FA 1EW3A 3LV4A 5B11O 1MK5A 2VDFA 3NP1A 3FA9A 4Y0PA 1R0UA 4OS8A 5B10O 5K67A 4CPEA 3P24A 4LZVA 4BX6A 3LHNA 3L4RA 3BS2A 2BSZA 1HMTA 5EDBA 2FHNX 1KL5A 5IXGA 4MVEA 1OBQA 4O4SA 4XMDA 1VWIB 2FHLA 4NW4A 3V8UA 3FR4A 3U0DA 2OYBO 3VG3A 3S26A 1Y53X 2W2AA 4O3ZA 5K68A 4DQ4A 2LB6A 1SLFB 3FA6A 4KC7A 1LDQA 4UU2A 5HZ9A 2FGSA 2IZLB 5IO6A 4EEJA 3SLOA 5JR8A 1I05A 5HCEC 1GX9A 4N7CA 1BRQA 1E5PA 3D9WA 4K19A 1UREA 3PPTA 1YIVA 2Z4HA 1UYNX 4FBOA 3WXQA 5BYPA 3BU9A 1DF3A 4R0BA 4GE1A 3RDMA 3D96A 3FLLA 4M6SA 4UU3A 4TNNA 4KT5A 2Q4NA 5HZQA 1LUQA 3UEVA 1KZXA 3C77X 3ZW1A 1RSTB 4IB7A 4ID2A 1LCZA 2LBVA 3P6DA 2OFAA 1O1VA 3RKGA 2POAA 5H9AA 3VHHA 1Z24A 1SXUA 1NP4A 2C1SA 5LJBA 2X45A 1GT1A 4Y0QA 1JMXA 4C5PA 5HTDA 1VWKB 4ZHHA 4XMHA 3EW2A 4YBPA 5D4AA 1X71A 3HTYA 2LBAA 5LJKA 1U0XA 3MVFA 5EPQA 2ASNX 2OL6O 2RTJA 4KIIA 4XMEA 4Z2VA 4CK4A 1BBPA 2DM5A 3H3IA 1I9HA 1QY0A 4CPFA 1SWJA 3AUMO
chains in the Genus database with same CATH topology
5K06A 3DTQA 1CBIA 3KFFA 3HOEA 5HCDC 5LKFA 1DV9A 3WJEA 3ELZA 1A3YA 5F6ZA 1ACDA 2OVAA 1TOWA 2OFMX 3DSZA 3WVMA 3B2LA 1T0VA 3VG5A 5IO7A 3EBKA 5HAEA 2JW1A 3OE3A 1ICMA 1IFCA 4IAWA 4TKJA 2Q9SA 2WWPA 4ORUA 3ZQ3A 2AT3X 2RQ0A 3VG7A 5DG4A 5LJHA 4IB6A 1GT4A 1DZJA 1PBOA 4L1NA 4NNTA 4YDBA 1BSQA 1ZNGA 3ZW1B 1LIEA 1QABE 4FQBB 3RSWA 1YWAA 1FE3A 1SA8A 1RBPA 4YKOA 5LJKA 1I4UA 1JV4A 2XKLA 2G79A 2HMBA 5D45A 3VG2A 2ALLX 2X8TA 5IO5A 5BVSA 1QY2A 3FR2A 1TVQA 1HQPA 3VG4A 4HWMA 1CBQA 3NQ9A 1SMPI 3AKMA 1X8PA 2X8SA 5H9KA 4U9CA 4EXZA 2K23A 1OBPA 4ORSA 1L6MA 4YBUA 1BSOA 5HTEA 5LJDA 1PEEA 4U8UN 3EM0A 5EZ2A 1ICNA 4ZCBA 1D3SA 3F8AA 4MIRA 4ZR2A 2KTSA 3SAOA 4ZHDA 1YP7A 4Y0RA 4ORRA 4QAEA 4ZHFA 1KT7A 4IBAA 2EU7X 4LKTA 2N93A 4BOEA 3VG6A 4GETA 1HN2A 1JBHA 2HZQA 3D95A 3PH6A 5KIDA 1ZNHA 5FAZA 5LJGA 3NQ3A 3CMPA 5KICA 2HYSA 3I0AA 4ORYA 4ZH6A 1ERXA 2FS7A 1OPBA 1LF7A 5IO6A 2KW1A 3D4RA 3IFBA 5BVQA 2YG2A 3FW5A 5HZ6A 4HFOA 3N91A 2FRSA 1E00A 1SY2A 2KTDA 1GT5A 5CE4A 2JU8A 1GT3A 3O22A 1S2PA 4AYHA 3P6FA 3ZZVA 3TGBA 5HA0A 5H9LA 4QNIA 4ES7A 4ZHGA 1GKAB 1S44A 3I17A 1ZNDA 1GM6A 2L68A 4IABA 4ZGFA 3SOTA 2Q2MA 4N7DA 2L67A 2ANSA 1DC9A 4KC8A 2P8GA 3VPJE 3STKA 4QGWA 1OEKA 3ZW2A 4I9SA 5FENA 1DZMA 2Q39A 3CQRA 4AZNA 2GTLO 1LPJA 1E02A 1KGLA 3NADA 1DFVA 1GXAA 2F09A 2MJIA 1ZNKA 2E4JA 4O3WA 1LNMA 2WQAE 1MUPA 1OPAA 2WUTA 1JYJA 4A60A 4O3XB 4BVMA 1I04A 5F1EA 1HBPA 1OEJA 1OBUA 1X8NA 5HBSA 4BQUA 3PQSA 1TW4A 2BLGA 2NP1A 3GAQA 4U8UM 3U9PC 4ALOA 4O3YA 5HWZA 5KHPA 1IW2A 2A2GA 3RBYA 4GRJA 4RUUA 4IMNA 2RD7C 3STNA 1QFVA 4TQ2A 1EI5A 1QQSA 5LJEA 1BWYA 4I3BA 4OMXA 4O4OA 5AJCA 1BRPA 2X46A 2AT8X 2NNDA 5AQ6A 1TOUA 3F9DA 1EPBA 2BS6A 3FEPA 4WHIA 3KFIA 2ZAIA 4GNWA 4ZFXA 4WBKA 1ALBA 1LIBA 1TXLA 1B4MA 3STMX 4XMCA 5L8IA 4AW8A 4ORWA 2ACOA 1EPAA 2M4LA 4OS3A 3B2KA 1KXOA 1LKEA 4IMOA 5F58A 2HNXA 2ZAGA 2NNEA 1CBSA 1G7NA 5CYBA 4ALBA 3WJDA 5LKEA 2QO6A 1VYFA 3WJFA 2MHDA 4I9RA 4YFPA 1BM5A 3TGAA 3OD9A 2JMBA 3FYFA 1KT3A 2AT5X 2QO5A 4NYRA 4AZOA 4NNSA 2RN4A 1YP6A 4GDZA 3EYCA 3NX2A 3AKNA 3TZSA 2R74A 3UEWA 1ZRYA 2IFBA 2A3FX 2BT9A 1A57A 2FR2A 2JU7A 1LIDA 2GC9A 1MVGA 1GKAA 3BX7A 5D47A 3TGCA 3B2IA 2A2UA 5D48A 5F6BA 3ZW0A 4I6SA 1CJ5A 3S5XA 5LJCA 2QM9A 3C76X 3FA8A 4NLJA 4U8UO 5F7GA 3OBLA 4I3CA 5EDCA 4GKCA 1B8EA 3E3CA 5H8TA 3C78X 3HWFA 1HBQA 3MX7A 4QZTA 1N0SA 4ZHCA 1EIOA 5B29A 3S5VA 1JZUA 4RUNA 3U03A 1QFTA 1KT6A 1FENA 3PQUA 5HA1A 3GE2A 4EQAC 4ARHA 2F73A 1SY1A 1SY0A 2LKKA 2OVSA 4D6AA 2R56A 2OVEA 3PH5A 4I95A 3VU1A 1BEBA 1G5WA 4M7MA 1HMSA 1AELA 5BVTA 3JSQA 1EALA 1EIIA 1JJXA 1I06A 2L5PA 3BY0A 2QO4A 3CR6A 4GK9A 1H91A 1DZPA 1B56A 1Y9TA 3NBXX 3G7XA 1XKIA 4EFGA 4QGXA 4EDEA 3APUA 3MBTA 1OEEA 1G74A 1VPRA 1EQDA 2CBSA 3PP6A 4O4XA 4ZGUA 3P6EA 1ML7A 1MX8A 2GTFX 1P6PA 2FWVA 2FS6A 3CBSA 4ODDA 3ZW0B 4TKBA 4MVLA 3CBCA 4YGGA 4YMYA 1SXWA 1MDCA 1AQBA 2FR3A 1T8VA 4QZUA 1QG5A 4FBVA 2QMIA 4MISA 5EEDA 4KH8A 4AZMA 5L8OA 1PMPA 1SXXA 2HLVA 1YWDA 1BJ7A 1LICA 4PJ2A 4A1HA 2BHVA 3NX1A 2OZQA 2CM9A 3P6CA 2RCQA 1U18A 4PSQA 3WBGA 1KT5A 3ZUOA 4YFRA 1YUPA 2RA6A 4HPDA 4A8ZA 3KZAA 4AZQA 4I3DA 1BLRA 1CBRA 1LIFA 1SXYA 2L9CA 3JS1A 1QWDA 2WR6A 1AVGI 4LKPA 3TF6A 3NQKA 2O62A 2FTBA 2LFOA 3HOLA 3D97A 3IA8A 1KOIA 4TLJA 4WFVA 4MVIA 4QRLA 3FR5A 1JIWI 4Y0SA 4YKMA 1JYDA 2GTLN 5AJBA 1NP1A 2WEXA 2OVDA 3RZYA 4TJZA 2WSJA 4LQZA 4NLIA 1U17A 5DPQA 3WOVA 3P02A 4IB8A 3CWKA 3FELA 1FTPA 4D6BA 2MO5A 5L8NA 2W2BA 1KQWA 1XCAA 1Y9LA 4U3QA 1EXSA 4ZH9A 2MWHA 3HWDA 2CM4A 1E06A 3FMZA 4GNYA 4ON1A 2Z4IA 3VE1A 1ZNLA 4GH7A 3FIQA 2BS5A 3FEKA 2JOZA 4WFUA 4A1YA 3OJYC 2AT6X 3KQ0A 5B27A 3NR3A 3F6ZB 3BDRA 3HK1A 1CRBA 3ZI8A 4YGHA 5FQ8E 4O9SA 1B0OA 3S60A 3O19A 4IAXA 2NNQA 3BX8A 3HWEA 4OMWA 5FQ6E 1SY3A 1T68X 2XSTA 1O1UA 4QYNA 2ACPX 4AZPA 1GGLA 1AB0A 2LA7A 4JGLA 4CV7A 1JJJA 2AMMX 3P6HA 3BSZE 1QY1A 4ORXA 4YH0A 2CZTA 2A13A 1G85A 1IFBA 5D8JA 1ADLA 5HZ5A 1VYGA 2AL0X 5AEOA 1DZKA 2JN3A 4KCAA 3O2YA 4FBRA 2FT9A 4ZJ0A 1ZNEA 4OS0A 5HCCC 4LZUA 1IKEA 1X8UA 2G78A 3WJBA 3PEDA 4HPAA 2PY1A 3KFHA 3K3LA 1KQXA 3BRNA 5H9NA 2AT0X 1O8VA 4INNA 2JU3A 3JQOA 4YCEA 1GX8A 2Q2PA 2MM3A 5FFHA 1IKJA 3EMMA 1S7DA 4TKHA 1KZWA 1FELA 1D2UA 1LFOA 1PM1X 2AKQA 2X8FA 4ML7B 4NP1A 3P6GA 4O4UA 1MX7A 2CBRA 2W2FA 3FA7A 2GTLM 2KD2A 1A2DA 4QYPA 3KFGA 3ZUIA 4QGVA 1YWBA 3BLGA 3B2HA 4YDAA 3FW4A 4YCHA 3APWA 1BSYA 3UEXA 3T1DA 3APVA 4HPBA 1EUOA 5FQ7E 3Q6LA 2A0AA 5HZ8A 4L3RA 3EBWA 3UAQA 2HZRA 4XMFA 1X8QA 4HPCA 1IIUA 5EEEA 4CSBA 3HWGA 3FENA 4GU8A 3APXA 1UZ2X 1YWCA 4AZRA 4COTA 2QOSC 2YMSA 1FDQA 3B2JA 2GJ5A 2WEWA 3UEUA 5C0NA 1NGLA 4YFQA 3CQNA 4FGIB 2AH7X 2FLJA 1KT4A 4NYQA 2R73A 3BU1A 1ERBA 2KT4B 2RCTA 1RLBE 4GZVA 4XMGA 1X8OA 3ZWEA 2K62A 3NPOA 3RWXA 1FEMA 2OFRX 3PECA 3WJGA 1HMRA 3ELXA 4DQ3A 4IB9A 1A18A 2WQ9A 4O49A 4YGZA 1X89A 2CZUA 3QKGA 4MVKA 3VE2A 4QQ1A 2G7BA 3WJCA 1EW3A 3LV4A 3NP1A 3FA9A 4Y0PA 1R0UA 4OS8A 3P24A 4LZVA 3LHNA 3L4RA 3BS2A 5EDBA 1HMTA 4MVEA 1OBQA 4O4SA 4XMDA 3V8UA 4NW4A 3FR4A 3U0DA 3VG3A 3S26A 2W2AA 4O3ZA 4DQ4A 2LB6A 4KC7A 3FA6A 4UU2A 5HZ9A 4EEJA 5JR8A 1I05A 5HCEC 1GX9A 4N7CA 1BRQA 1E5PA 4K19A 1UREA 3PPTA 1YIVA 2Z4HA 4FBOA 3WXQA 5BYPA 3BU9A 1DF3A 4R0BA 4GE1A 3D96A 3FLLA 4M6SA 4UU3A 4TNNA 4KT5A 2Q4NA 5HZQA 1KZXA 3UEVA 3C77X 3ZW1A 4IB7A 4ID2A 2LBVA 3P6DA 1O1VA 3RKGA 2POAA 5H9AA 5LJBA 1Z24A 1SXUA 1NP4A 2X45A 1GT1A 4Y0QA 5HTDA 4ZHHA 4XMHA 4YBPA 5D4AA 1X71A 3HTYA 2LBAA 1U0XA 3MVFA 5EPQA 2ASNX 4KIIA 4XMEA 4CK4A 1BBPA 2DM5A 3H3IA 1QY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K06 A;  3DTQ A;  1CBI A;  3KFF A;  5HCD C;  5LKF A;  1DV9 A;  3WJE A;  3ELZ A;  1A3Y A;  5F6Z A;  1ACD A;  2OVA A;  1TOW A;  2OFM X;  3DSZ A;  3WVM A;  3B2L A;  1T0V A;  3VG5 A;  5IO7 A;  3EBK A;  5HAE A;  1ICM A;  1IFC A;  4IAW A;  4TKJ A;  2Q9S A;  2WWP A;  4ORU A;  3ZQ3 A;  2AT3 X;  2RQ0 A;  3VG7 A;  5DG4 A;  5LJH A;  4IB6 A;  1GT4 A;  1DZJ A;  1PBO A;  4NNT A;  4YDB A;  1BSQ A;  1ZNG A;  1LIE A;  1QAB E;  3RSW A;  1YWA A;  1FE3 A;  1SA8 A;  1RBP A;  4YKO A;  5LJK A;  1I4U A;  1JV4 A;  2XKL A;  2G79 A;  2HMB A;  5D45 A;  3VG2 A;  2ALL X;  5IO5 A;  5BVS A;  1QY2 A;  3FR2 A;  1TVQ A;  1HQP A;  3VG4 A;  1CBQ A;  3NQ9 A;  3AKM A;  1X8P A;  5H9K A;  4EXZ A;  2K23 A;  1OBP A;  4ORS A;  1L6M A;  4YBU A;  1BSO A;  5HTE A;  5LJD A;  1PEE A;  3EM0 A;  5EZ2 A;  1ICN A;  4ZCB A;  1D3S A;  3F8A A;  4ZR2 A;  3SAO A;  4ZHD A;  1YP7 A;  4Y0R A;  4ORR A;  4QAE A;  4ZHF A;  1KT7 A;  4IBA A;  2EU7 X;  4LKT A;  2N93 A;  4BOE A;  3VG6 A;  4GET A;  1HN2 A;  1JBH A;  2HZQ A;  3D95 A;  3PH6 A;  5KID A;  1ZNH A;  5FAZ A;  5LJG A;  3NQ3 A;  3CMP A;  5KIC A;  2HYS A;  3I0A A;  4ORY A;  4ZH6 A;  1ERX A;  2FS7 A;  1OPB A;  1LF7 A;  5IO6 A;  3IFB A;  5HZ6 A;  5BVQ A;  2YG2 A;  3FW5 A;  4HFO A;  2FRS A;  1E00 A;  1SY2 A;  2KTD A;  1GT5 A;  5CE4 A;  2JU8 A;  1GT3 A;  3O22 A;  1S2P A;  4AYH A;  3P6F A;  3TGB A;  5HA0 A;  5H9L A;  4ES7 A;  4ZHG A;  1GKA B;  1S44 A;  3I17 A;  1ZND A;  1GM6 A;  2L68 A;  2Q2M A;  4N7D A;  2L67 A;  2ANS A;  1DC9 A;  2P8G A;  3STK A;  4QGW A;  1OEK A;  4I9S A;  5FEN A;  1DZM A;  2Q39 A;  3CQR A;  4AZN A;  1KGL A;  1LPJ A;  1E02 A;  3NAD A;  1DFV A;  1GXA A;  2MJI A;  1ZNK A;  2E4J A;  1LNM A;  2WQA E;  1MUP A;  1OPA A;  2WUT A;  1JYJ A;  4A60 A;  4BVM A;  1I04 A;  5F1E A;  1HBP A;  1OEJ A;  1OBU A;  1X8N A;  5HBS A;  4BQU A;  1TW4 A;  2BLG A;  2NP1 A;  3GAQ A;  3U9P C;  5HWZ A;  4ALO A;  5KHP A;  1IW2 A;  2A2G A;  4GRJ A;  4RUU A;  4IMN A;  2RD7 C;  3STN A;  1QFV A;  4TQ2 A;  1QQS A;  5LJE A;  1BWY A;  4I3B A;  4OMX A;  1BRP A;  2X46 A;  2AT8 X;  2NND A;  5AQ6 A;  1TOU A;  3F9D A;  1EPB A;  3FEP A;  3KFI A;  4GNW A;  4ZFX A;  4WBK A;  1ALB A;  1LIB A;  1TXL A;  1B4M A;  3STM X;  4XMC A;  5L8I A;  4AW8 A;  4ORW A;  2ACO A;  1EPA A;  4OS3 A;  3B2K A;  1KXO A;  1LKE A;  4IMO A;  5F58 A;  2HNX A;  2NNE A;  1CBS A;  1G7N A;  4ALB A;  3WJD A;  5LKE A;  2QO6 A;  1VYF A;  3WJF A;  4I9R A;  4YFP A;  1BM5 A;  3TGA A;  1KT3 A;  2AT5 X;  2QO5 A;  4NYR A;  4AZO A;  4NNS A;  1YP6 A;  3EYC A;  3NX2 A;  3AKN A;  3TZS A;  2R74 A;  3UEW A;  1ZRY A;  2IFB A;  2A3F X;  1A57 A;  2FR2 A;  2JU7 A;  1LID A;  2GC9 A;  1MVG A;  1GKA A;  3BX7 A;  5D47 A;  3TGC A;  3B2I A;  2A2U A;  5D48 A;  5F6B A;  1CJ5 A;  5LJC A;  2QM9 A;  3C76 X;  3FA8 A;  4NLJ A;  5F7G A;  4I3C A;  5EDC A;  4GKC A;  1B8E A;  5H8T A;  3C78 X;  3HWF A;  1HBQ A;  4QZT A;  1N0S A;  4ZHC A;  1EIO A;  5B29 A;  1JZU A;  4RUN A;  3U03 A;  1QFT A;  1KT6 A;  1FEN A;  5HA1 A;  4ARH A;  2F73 A;  1SY1 A;  1SY0 A;  2LKK A;  4D6A A;  2R56 A;  2OVE A;  3PH5 A;  1BEB A;  1G5W A;  4M7M A;  1HMS A;  1AEL A;  5BVT A;  3JSQ A;  1EAL A;  1EII A;  1JJX A;  1I06 A;  2L5P A;  3BY0 A;  2QO4 A;  3CR6 A;  1H91 A;  1DZP A;  1B56 A;  3G7X A;  1XKI A;  4EFG A;  4QGX A;  4EDE A;  3APU A;  3MBT A;  1OEE A;  1G74 A;  1VPR A;  1EQD A;  2CBS A;  3PP6 A;  4ZGU A;  3P6E A;  1ML7 A;  1MX8 A;  2GTF X;  1P6P A;  2FWV A;  2FS6 A;  3CBS A;  4ODD A;  4TKB A;  4MVL A;  3CBC A;  4YGG A;  4YMY A;  1SXW A;  1MDC A;  1AQB A;  2FR3 A;  1T8V A;  4QZU A;  1QG5 A;  5EED A;  4AZM A;  5L8O A;  1PMP A;  1SXX A;  2HLV A;  1YWD A;  1BJ7 A;  1LIC A;  4A1H A;  3NX1 A;  2OZQ A;  2CM9 A;  3P6C A;  2RCQ A;  1U18 A;  4PSQ A;  3WBG A;  1KT5 A;  3ZUO A;  4YFR A;  1YUP A;  2RA6 A;  4HPD A;  4A8Z A;  3KZA A;  4AZQ A;  4I3D A;  1BLR A;  1CBR A;  1LIF A;  1SXY A;  2L9C A;  3JS1 A;  1QWD A;  2WR6 A;  1AVG I;  4LKP A;  3TF6 A;  2O62 A;  2FTB A;  2LFO A;  3D97 A;  3IA8 A;  1KOI A;  4TLJ A;  4WFV A;  4MVI A;  3FR5 A;  4Y0S A;  4YKM A;  1JYD A;  1NP1 A;  2WEX A;  2OVD A;  3RZY A;  4TJZ A;  2WSJ A;  4NLI A;  1U17 A;  5DPQ A;  4IB8 A;  3CWK A;  3FEL A;  1FTP A;  4D6B A;  2MO5 A;  5L8N A;  2W2B A;  1KQW A;  1XCA A;  4ZH9 A;  1EXS A;  3HWD A;  2CM4 A;  1E06 A;  3FMZ A;  4GNY A;  1ZNL A;  4GH7 A;  3FIQ A;  3FEK A;  2JOZ A;  4WFU A;  4A1Y A;  3OJY C;  2AT6 X;  3KQ0 A;  5B27 A;  3NR3 A;  3BDR A;  3HK1 A;  1CRB A;  4YGH A;  4O9S A;  1B0O A;  3O19 A;  4IAX A;  2NNQ A;  3BX8 A;  3HWE A;  4OMW A;  1SY3 A;  1T68 X;  2XST A;  1O1U A;  4QYN A;  2ACP X;  4AZP A;  1GGL A;  1AB0 A;  1JJJ A;  2AMM X;  3P6H A;  3BSZ E;  1QY1 A;  4ORX A;  4YH0 A;  2CZT A;  2A13 A;  1G85 A;  1IFB A;  5D8J A;  1ADL A;  5HZ5 A;  1VYG A;  2AL0 X;  1DZK A;  2JN3 A;  3O2Y A;  4ZJ0 A;  2FT9 A;  1ZNE A;  4OS0 A;  5HCC C;  4LZU A;  1IKE A;  1X8U A;  2G78 A;  3WJB A;  3PED A;  4HPA A;  2PY1 A;  3KFH A;  3K3L A;  1KQX A;  3BRN A;  5H9N A;  2AT0 X;  1O8V A;  2JU3 A;  4YCE A;  1GX8 A;  2Q2P A;  2MM3 A;  5FFH A;  1IKJ A;  3EMM A;  1S7D A;  4TKH A;  1KZW A;  1FEL A;  1D2U A;  1LFO A;  1PM1 X;  2AKQ A;  4NP1 A;  3P6G A;  1MX7 A;  2CBR A;  2W2F A;  3FA7 A;  1A2D A;  3ZUI A;  4QGV A;  4QYP A;  3KFG A;  1YWB A;  3BLG A;  3B2H A;  4YDA A;  3FW4 A;  4YCH A;  3APW A;  1BSY A;  3UEX A;  3T1D A;  3APV A;  4HPB A;  1EUO A;  3Q6L A;  2A0A A;  5HZ8 A;  3EBW A;  2HZR A;  4XMF A;  1X8Q A;  4HPC A;  1IIU A;  5EEE A;  3HWG A;  3FEN A;  3APX A;  1UZ2 X;  1YWC A;  4AZR A;  2QOS C;  1FDQ A;  3B2J A;  2GJ5 A;  2WEW A;  3UEU A;  5C0N A;  1NGL A;  4YFQ A;  3CQN A;  2AH7 X;  2FLJ A;  1KT4 A;  4NYQ A;  2R73 A;  3BU1 A;  1ERB A;  2KT4 B;  2RCT A;  1RLB E;  4XMG A;  1X8O A;  2K62 A;  3NPO A;  1FEM A;  2OFR X;  3PEC A;  3WJG A;  1HMR A;  3ELX A;  4DQ3 A;  4IB9 A;  1A18 A;  2WQ9 A;  4YGZ A;  1X89 A;  2CZU A;  3QKG A;  4MVK A;  2G7B A;  3WJC A;  1EW3 A;  3NP1 A;  3FA9 A;  4Y0P A;  1R0U A;  4OS8 A;  4LZV A;  3L4R A;  3BS2 A;  5EDB A;  1HMT A;  1OBQ A;  4XMD A;  3FR4 A;  3U0D A;  3VG3 A;  3S26 A;  2W2A A;  4DQ4 A;  2LB6 A;  3FA6 A;  4UU2 A;  5HZ9 A;  4EEJ A;  5JR8 A;  1I05 A;  5HCE C;  1GX9 A;  4N7C A;  1BRQ A;  1E5P A;  4K19 A;  1URE A;  3PPT A;  1YIV A;  3WXQ A;  3BU9 A;  1DF3 A;  4R0B A;  4GE1 A;  3D96 A;  3FLL A;  4M6S A;  4UU3 A;  4TNN A;  2Q4N A;  5HZQ A;  1KZX A;  3UEV A;  3C77 X;  4IB7 A;  2LBV A;  3P6D A;  1O1V A;  2POA A;  5H9A A;  5LJB A;  1Z24 A;  1SXU A;  1NP4 A;  2X45 A;  1GT1 A;  4Y0Q A;  5HTD A;  4ZHH A;  4XMH A;  4YBP A;  5D4A A;  1X71 A;  2LBA A;  1U0X A;  3MVF A;  5EPQ A;  2ASN X;  4KII A;  4XME A;  4CK4 A;  1BBP A;  2DM5 A;  1QY0 A; 
#chains in the Genus database with same CATH topology
 5K06 A;  4BX6 B;  3DTQ A;  1CBI A;  1STR B;  2DJF A;  3HOE A;  3KFF A;  5LKF A;  5HCD C;  1DV9 A;  3WJE A;  3ELZ A;  1A3Y A;  2OY5 O;  5F6Z A;  1ACD A;  2OVA A;  2Y32 A;  1TOW A;  2OFM X;  3DSZ A;  3WVM A;  3B2L A;  1T0V A;  3VG5 A;  5IO7 A;  1KGL A;  3EBK A;  5HAE A;  2JW1 A;  3OE3 A;  1ICM A;  1IFC A;  1VWE B;  1SRJ A;  1STS B;  1RXH A;  4IAW A;  4TKJ A;  2Q9S A;  1SWL A;  2WWP A;  4ORU A;  5B5G A;  1E2T A;  3ZQ3 A;  2AT3 X;  2RQ0 A;  3VG7 A;  5DG4 A;  5LJH A;  4IB6 A;  5F2B A;  1SRE A;  1GT4 A;  1DZJ A;  1PBO A;  4L1N A;  3QQ2 A;  1W6F A;  4NNT A;  4YDB A;  1BSQ A;  1ZNG A;  1SRG A;  3ZW1 B;  1LIE A;  1QAB E;  4BGF A;  4FQB B;  3RSW A;  1YWA A;  1AVD A;  1FE3 A;  1RBP A;  1SA8 A;  1SWR A;  1I4U A;  1JV4 A;  3AEH A;  1VWA B;  2XKL A;  2G79 A;  2HMB A;  5D45 A;  3VG2 A;  2ALL X;  2X8T A;  5IO5 A;  5BVS A;  5CHK A;  1QY2 A;  3FR2 A;  1TVQ A;  1HQP A;  5CSE A;  4HWM A;  3VG4 A;  1CBQ A;  3NQ9 A;  1SMP I;  3AKM A;  1X8P A;  4CDD A;  2C4I A;  2X8S A;  5H9K A;  4U9C A;  4EXZ A;  2K23 A;  1OBP A;  1SRH A;  4ORS A;  1L6M A;  4YBU A;  1BSO A;  5HTE A;  5LJD A;  1PEE A;  4U8U N;  2BC3 A;  3EM0 A;  5EZ2 A;  1SWP A;  1ICN A;  4ZCB A;  4BX7 A;  1D3S A;  3F8A A;  4MIR A;  4ZR2 A;  2KTS A;  3SAO A;  1WUB A;  4ZHD A;  1YP7 A;  4Y0R A;  1VYO A;  4ORR A;  1N4J A;  3PDF A;  4QAE A;  4ZHF A;  3MM0 A;  1KT7 A;  4IBA A;  2EU7 X;  2RTP B;  4LKT A;  2N93 A;  3WYQ A;  4BOE A;  3VG6 A;  4GET A;  1HN2 A;  1JBH A;  2RTA A;  2HZQ A;  3D95 A;  3PH6 A;  3SZI A;  5KID A;  1ZNH A;  5FAZ A;  3WZN A;  5LJG A;  2IZC B;  3NQ3 A;  3CMP A;  5KIC A;  2HYS A;  3I0A A;  2RTK A;  1SWB A;  4ORY A;  2UZ2 A;  4ZH6 A;  1LDO A;  1ERX A;  2FS7 A;  1OPB A;  1LF7 A;  1SWD A;  2KW1 A;  3D4R A;  3IFB A;  5BVQ A;  2YG2 A;  3FW5 A;  4EKV A;  5HZ6 A;  4HFO A;  3N91 A;  2FRS A;  1E00 A;  1SY2 A;  2KTD A;  1VWM B;  1GT5 A;  2OY8 A;  3RE5 A;  5CE4 A;  2JU8 A;  1GT3 A;  3O22 A;  1LEL A;  1S2P A;  4AYH A;  1VWR B;  3P6F A;  3ZZV A;  3TGB A;  4OEM A;  5H9L A;  5HA0 A;  4QNI A;  4ES7 A;  1VWH B;  4ZHG A;  1GKA B;  1S44 A;  1Y55 X;  3I17 A;  1ZND A;  1GM6 A;  2L68 A;  4IAB A;  4ZGF A;  3SOT A;  2Q2M A;  1SWG A;  4N7D A;  2L67 A;  2ANS A;  1DC9 A;  4KC8 A;  2P8G A;  3VPJ E;  3STK A;  4QGW A;  1OEK A;  3ZW2 A;  4I9S A;  2C1Q A;  5FEN A;  4OEL A;  1DZM A;  2Q39 A;  3CQR A;  5IRU A;  4AZN A;  2GTL O;  1K3B A;  1E02 A;  1LPJ A;  2MF6 A;  2RTH B;  1DFV A;  3NAD A;  4GGR A;  4BX7 B;  1GXA A;  2F09 A;  4GGZ A;  2MJI A;  1KZW A;  1ZNK A;  1HXZ A;  2E4J A;  4O3W A;  3WYP A;  1LNM A;  4Z6J A;  2WQA E;  1MUP A;  1OPA A;  2WUT A;  1JYJ A;  4A60 A;  1SRF A;  4O3X B;  4BVM A;  1SLE B;  1I04 A;  5F1E A;  1HBP A;  3CKF A;  2UYW A;  1OEJ A;  1OBU A;  1VWP B;  1X8N A;  5HBS A;  3PQS A;  1TW4 A;  2BLG A;  2NP1 A;  3GAQ A;  4U8U M;  3T2W A;  3U9P C;  4O3Y A;  4ALO A;  5HWZ A;  5KHP A;  1IW2 A;  2A2G A;  3RBY A;  4GRJ A;  4RUU A;  4IMN A;  2RD7 C;  3STN A;  1QFV A;  2G5L A;  2RTL A;  1EI5 A;  1QQS A;  1SWT A;  4TQ2 A;  5L3Y A;  5LJE A;  1BWY A;  2OFB A;  4I3B A;  4OMX A;  4O4O A;  3VGW A;  5AJC A;  5IRA A;  1BRP A;  2X46 A;  2AT8 X;  2NND A;  2X55 A;  5AQ6 A;  1TOU A;  3F9D A;  1EPB A;  2BS6 A;  4Z27 A;  1SWK A;  2RTQ B;  3FEP A;  4WHI A;  3KFI A;  2ZAI A;  4GNW A;  4ZFX A;  4WBK A;  1ALB A;  1LIB A;  1TXL A;  1SWU A;  1B4M A;  4NV7 A;  3STM X;  4XMC A;  1SWO A;  5L8I A;  4AW8 A;  4ORW A;  2ACO A;  1EPA A;  2M4L A;  2RTN B;  4OS3 A;  3B2K A;  1KXO A;  1LKE A;  2IZG B;  4IMO A;  5F58 A;  2HNX A;  4JNJ A;  2ZAG A;  2NNE A;  1CBS A;  3KVN A;  1G7N A;  1VWL B;  5CYB A;  4ALB A;  3WJD A;  1HY2 A;  4Z2O A;  5LKE A;  2X34 A;  2RTD B;  2QO6 A;  1VYF A;  2F01 A;  3WJF A;  2IZE B;  2MHD A;  1DF8 A;  4I9R A;  4YFP A;  1BM5 A;  3TGA A;  1LCV A;  2IZK A;  3OD9 A;  2JMB A;  3FYF A;  1KT3 A;  3RY1 A;  1KL4 A;  2AT5 X;  4JHQ A;  2QO5 A;  4NYR A;  4AZO A;  4NNS A;  2RN4 A;  1YP6 A;  4GDZ A;  3WZP A;  3EYC A;  4QGV A;  3NX2 A;  3AKN A;  3TZS A;  2R74 A;  3UEW A;  1Y0G A;  4Z2P A;  1ZRY A;  1VWJ B;  2JGS A;  3PK2 A;  2IFB A;  2A3F X;  2BT9 A;  1A57 A;  1IJ8 A;  4I60 A;  2FR2 A;  2JU7 A;  1LID A;  2GC9 A;  3EC5 A;  4GD9 A;  1MVG A;  1VWG B;  1GKA A;  3BX7 A;  5D47 A;  3TGC A;  3B2I A;  2A2U A;  5D48 A;  5F6B A;  2Y3F A;  3ZW0 A;  2RTR B;  3T2X A;  4I6S A;  3RE6 A;  2X4M A;  4BCS A;  1CJ5 A;  1N9M A;  3S5X A;  5LJC A;  2QM9 A;  3C76 X;  3FA8 A;  4NLJ A;  4U8U O;  1VWC B;  5F7G A;  3OBL A;  4I3C A;  5EDC A;  4GKC A;  3WZQ A;  1B8E A;  1WBI A;  3E3C A;  3C78 X;  3HWF A;  1HBQ A;  3MX7 A;  4QZT A;  5H8T A;  1N0S A;  4ZHC A;  1EIO A;  1KFF A;  5B29 A;  3S5V A;  2I5Z O;  1JZU A;  3FID A;  4RUN A;  1MM9 A;  3EW1 A;  3U03 A;  1QFT A;  1KT6 A;  1FEN A;  1SLG B;  3PQU A;  5HA1 A;  3GE2 A;  2VFC A;  4EQA C;  4ARH A;  1NBX A;  1JQP A;  2ZSC A;  2F73 A;  1SY1 A;  1SY0 A;  2OF9 A;  2LKK A;  2OVS A;  2DJG A;  3SZH A;  4GJS A;  4D6A A;  2R56 A;  2OVE A;  2OF8 A;  3PH5 A;  4I95 A;  3VU1 A;  1BEB A;  1G5W A;  2WPU A;  4M7M A;  1HMS A;  2AF5 A;  1AEL A;  1SWS A;  5BVT A;  3JSQ A;  1EAL A;  1EII A;  3SLT A;  1I06 A;  2L5P A;  3BY0 A;  2QO4 A;  3CR6 A;  4GK9 A;  1JJX A;  1H91 A;  2VFB A;  5B5F A;  1DZP A;  1B56 A;  1Y9T A;  3NBX X;  3G7X A;  1XKI A;  4EFG A;  4QGX A;  4EDE A;  3APU A;  3MBT A;  1OEE A;  1G74 A;  1VPR A;  2OY7 A;  1EQD A;  2CBS A;  3PP6 A;  4O4X A;  4ZGU A;  3P6E A;  1ML7 A;  1MX8 A;  4GUZ A;  2GTF X;  1P6P A;  2RTM A;  4BX5 A;  1HQQ A;  2FS6 A;  2FWV A;  3CBS A;  4ODD A;  1NC9 A;  3ZW0 B;  4TKB A;  4MVL A;  3CBC A;  4YGG A;  4YMY A;  1SXW A;  1MDC A;  1AQB A;  1MEP A;  3LTW A;  2FR3 A;  1T8V A;  2RTO B;  4QZU A;  2RTF B;  4OKA A;  1QG5 A;  4FBV A;  1N43 A;  2QMI A;  4MIS A;  4CPH A;  5EED A;  4KH8 A;  1VWO B;  4AZM A;  5L8O A;  3CKG A;  1PMP A;  1SXX A;  2FKG A;  1YWD A;  2HLV A;  1BJ7 A;  1LIC A;  4PJ2 A;  2A5C A;  4A1H A;  2BHV A;  1SWN A;  2OZQ A;  1SWC A;  3NX1 A;  2CM9 A;  2AVI A;  3X00 A;  2OY1 O;  3P6C A;  2RCQ A;  1U18 A;  4PSQ A;  2IZI A;  1KT5 A;  3WBG A;  3ZUO A;  4YFR A;  1YUP A;  2RA6 A;  4HPD A;  4A8Z A;  3KZA A;  2RTG B;  1JJU A;  1SWA A;  4AZQ A;  4I3D A;  1BLR A;  1CBR A;  1LIF A;  1RSU B;  1SXY A;  2L9C A;  1QWD A;  2WR6 A;  1UYO X;  3JS1 A;  1AVG I;  4LKP A;  3RDO A;  3TF6 A;  1VWN B;  4YVB A;  3NQK A;  2O62 A;  2FTB A;  2OL7 A;  5B3M O;  2LFO A;  3HOL A;  3D97 A;  3IA8 A;  1KOI A;  3FDC A;  4TLJ A;  4WFV A;  4MVI A;  4QRL A;  3FR5 A;  1JIW I;  1Y52 X;  4Y0S A;  4YKM A;  1JYD A;  1PTS A;  1MOY A;  2GTL N;  5AJB A;  1SWE A;  1NP1 A;  2WEX A;  2OVD A;  2IZH B;  4IRW A;  4TJZ A;  1RXK A;  2WSJ A;  4GGT A;  3RDS A;  4LQZ A;  1W5R A;  3RZY A;  4NLI A;  4CDF A;  1U17 A;  5DPQ A;  3WOV A;  4BX5 B;  3P02 A;  3RDX A;  2I5V O;  4IB8 A;  5JD2 A;  3CWK A;  3FEL A;  1FTP A;  4D6B A;  2MO5 A;  4MEE A;  5L8N A;  2W2B A;  1KQW A;  2IZD B;  1XCA A;  1Y9L A;  4U3Q A;  1EXS A;  4YKO A;  2MWH A;  2IZJ A;  3HWD A;  4ZH9 A;  2CM4 A;  1E06 A;  3FMZ A;  4GNY A;  4ON1 A;  2Z4I A;  3VE1 A;  1ZNL A;  4GJV A;  4GH7 A;  4Y5D A;  3FIQ A;  2BS5 A;  3FEK A;  2JOZ A;  4WFU A;  4A1Y A;  4CPH B;  3OJY C;  2AT6 X;  3KQ0 A;  5B27 A;  3NR3 A;  3F6Z B;  3BDR A;  3HK1 A;  1CRB A;  3ZI8 A;  1KL3 A;  4YGH A;  5FQ8 E;  4BJ8 A;  4O9S A;  1SWF A;  1B0O A;  1SWQ A;  1PBY A;  3S60 A;  1AVE A;  1W4T A;  3O19 A;  2RTE B;  4IAX A;  2NNQ A;  3BX8 A;  3HWE A;  4OMW A;  5FQ6 E;  4CDC A;  1SY3 A;  1T68 X;  2A5B A;  2XST A;  1O1U A;  4QYN A;  2ACP X;  2X32 A;  5B2A O;  1VWF B;  4AZP A;  1GGL A;  1AB0 A;  2LA7 A;  4JGL A;  4CV7 A;  3VHI A;  1JJJ A;  2AMM X;  3P6H A;  3BSZ E;  1QY1 A;  4ORX A;  4YH0 A;  1SRI A;  2CZT A;  2A13 A;  1SWH A;  1NDJ A;  2OL8 O;  1G85 A;  1IFB A;  5D8J A;  1ADL A;  5HZ5 A;  1VYG A;  2AL0 X;  5AEO A;  1DZK A;  2JN3 A;  4BQU A;  2RTC B;  3O2Y A;  4KCA A;  4FBR A;  2FT9 A;  3Q34 A;  4ZJ0 A;  1ZNE A;  4OS0 A;  4U46 A;  5HCC C;  4LZU A;  1N7Y A;  1IKE A;  1X8U A;  1LCW A;  2G78 A;  3WJB A;  3PED A;  4HPA A;  2PY1 A;  3KFH A;  3K3L A;  1KQX A;  3BRN A;  4Z28 A;  5H9N A;  3VHM A;  2AT0 X;  1O8V A;  4DNE A;  4INN A;  2JU3 A;  3MG5 A;  3JQO A;  4YCE A;  1GX8 A;  2Q2P A;  2MM3 A;  2Y3E A;  5FFH A;  3T6L A;  3WZO A;  1IKJ A;  3EMM A;  2GH7 A;  4B55 A;  1S7D A;  2RTB B;  1N9Y A;  1FEL A;  4TKH A;  1D2U A;  1LFO A;  1PM1 X;  2AKQ A;  2X8F A;  4ML7 B;  4NP1 A;  3P6G A;  4O4U A;  3SLJ A;  1MX7 A;  2CBR A;  2W2F A;  3FA7 A;  1A2D A;  2GTL M;  2KD2 A;  4QYP A;  3KFG A;  2IZA A;  3ZUI A;  1YWB A;  3BLG A;  3B2H A;  4YDA A;  3FW4 A;  4YCH A;  3APW A;  1BSY A;  3UEX A;  3T1D A;  3APV A;  4HPB A;  1EUO A;  1SLD B;  1OSP O;  5FQ7 E;  3Q6L A;  4CDE A;  2A0A A;  4JO6 A;  5HZ8 A;  4L3R A;  3EBW A;  3UAQ A;  1JMZ A;  1K24 A;  1NQN A;  2G8C O;  2HZR A;  1X8Q A;  4XMF A;  3RDU A;  4HPC A;  2X56 A;  2HKD A;  2A8G A;  1RXJ A;  1IIU A;  5EEE A;  3RY2 A;  4CSB A;  4DCB A;  3HWG A;  2IZB A;  3FEN A;  4GU8 A;  1NQM A;  3APX A;  3SZJ A;  1UZ2 X;  1YWC A;  4AZR A;  4BBO A;  2QOS C;  4GDA A;  4COT A;  2IZF B;  2PI3 O;  2YMS A;  1VWQ B;  1FDQ A;  3RDQ A;  2CAM A;  2QCB A;  3B2J A;  2GJ5 A;  2WEW A;  3UEU A;  2QOM A;  5C0N A;  5IRW A;  1NGL A;  4YFQ A;  1I78 A;  1GX3 A;  3CQN A;  4FGI B;  2FKJ A;  1RAV A;  2AH7 X;  2FLJ A;  1KT4 A;  4NYQ A;  2R73 A;  3BU1 A;  1ERB A;  2KT4 B;  2RCT A;  1RLB E;  4GZV A;  4XMG A;  1X8O A;  3ZWE A;  4CPI A;  4Y59 A;  2K62 A;  1FJ1 E;  2RTI B;  3NPO A;  3RWX A;  1FEM A;  2OFR X;  1HXL A;  3PEC A;  3WJG A;  1HMR A;  3ELX A;  3HPE A;  4DQ3 A;  4IB9 A;  1A18 A;  2WQ9 A;  4O49 A;  4YGZ A;  1X89 A;  2CZU A;  3QKG A;  1STP A;  4MVK A;  4NV8 A;  1VWD B;  3VE2 A;  4QQ1 A;  2G7B A;  1VWB B;  3WJC A;  3T6F A;  1EW3 A;  3LV4 A;  5B11 O;  1MK5 A;  2VDF A;  3NP1 A;  3FA9 A;  4Y0P A;  1R0U A;  4OS8 A;  5B10 O;  5K67 A;  4CPE A;  3P24 A;  4LZV A;  4BX6 A;  3LHN A;  3L4R A;  3BS2 A;  2BSZ A;  1HMT A;  5EDB A;  2FHN X;  1KL5 A;  5IXG A;  4MVE A;  1OBQ A;  4O4S A;  4XMD A;  1VWI B;  2FHL A;  4NW4 A;  3V8U A;  3FR4 A;  3U0D A;  2OYB O;  3VG3 A;  3S26 A;  1Y53 X;  2W2A A;  4O3Z A;  5K68 A;  4DQ4 A;  2LB6 A;  1SLF B;  3FA6 A;  4KC7 A;  1LDQ A;  4UU2 A;  5HZ9 A;  2FGS A;  2IZL B;  5IO6 A;  4EEJ A;  3SLO A;  5JR8 A;  1I05 A;  5HCE C;  1GX9 A;  4N7C A;  1BRQ A;  1E5P A;  3D9W A;  4K19 A;  1URE A;  3PPT A;  1YIV A;  2Z4H A;  1UYN X;  4FBO A;  3WXQ A;  5BYP A;  3BU9 A;  1DF3 A;  4R0B A;  4GE1 A;  3RDM A;  3D96 A;  3FLL A;  4M6S A;  4UU3 A;  4TNN A;  4KT5 A;  2Q4N A;  5HZQ A;  1LUQ A;  3UEV A;  1KZX A;  3C77 X;  3ZW1 A;  1RST B;  4IB7 A;  4ID2 A;  1LCZ A;  2LBV A;  3P6D A;  2OFA A;  1O1V A;  3RKG A;  2POA A;  5H9A A;  3VHH A;  1Z24 A;  1SXU A;  1NP4 A;  2C1S A;  5LJB A;  2X45 A;  1GT1 A;  4Y0Q A;  1JMX A;  4C5P A;  5HTD A;  1VWK B;  4ZHH A;  4XMH A;  3EW2 A;  4YBP A;  5D4A A;  1X71 A;  3HTY A;  2LBA A;  5LJK A;  1U0X A;  3MVF A;  5EPQ A;  2ASN X;  2OL6 O;  2RTJ A;  4KII A;  4XME A;  4Z2V A;  4CK4 A;  1BBP A;  2DM5 A;  3H3I A;  1I9H A;  1QY0 A;  4CPF A;  1SWJ A;  3AUM O; 
#chains in the Genus database with same CATH homology
 5K06 A;  3DTQ A;  1CBI A;  3KFF A;  3HOE A;  5HCD C;  5LKF A;  1DV9 A;  3WJE A;  3ELZ A;  1A3Y A;  5F6Z A;  1ACD A;  2OVA A;  1TOW A;  2OFM X;  3DSZ A;  3WVM A;  3B2L A;  1T0V A;  3VG5 A;  5IO7 A;  3EBK A;  5HAE A;  2JW1 A;  3OE3 A;  1ICM A;  1IFC A;  4IAW A;  4TKJ A;  2Q9S A;  2WWP A;  4ORU A;  3ZQ3 A;  2AT3 X;  2RQ0 A;  3VG7 A;  5DG4 A;  5LJH A;  4IB6 A;  1GT4 A;  1DZJ A;  1PBO A;  4L1N A;  4NNT A;  4YDB A;  1BSQ A;  1ZNG A;  3ZW1 B;  1LIE A;  1QAB E;  4FQB B;  3RSW A;  1YWA A;  1FE3 A;  1SA8 A;  1RBP A;  4YKO A;  5LJK A;  1I4U A;  1JV4 A;  2XKL A;  2G79 A;  2HMB A;  5D45 A;  3VG2 A;  2ALL X;  2X8T A;  5IO5 A;  5BVS A;  1QY2 A;  3FR2 A;  1TVQ A;  1HQP A;  3VG4 A;  4HWM A;  1CBQ A;  3NQ9 A;  1SMP I;  3AKM A;  1X8P A;  2X8S A;  5H9K A;  4U9C A;  4EXZ A;  2K23 A;  1OBP A;  4ORS A;  1L6M A;  4YBU A;  1BSO A;  5HTE A;  5LJD A;  1PEE A;  4U8U N;  3EM0 A;  5EZ2 A;  1ICN A;  4ZCB A;  1D3S A;  3F8A A;  4MIR A;  4ZR2 A;  2KTS A;  3SAO A;  4ZHD A;  1YP7 A;  4Y0R A;  4ORR A;  4QAE A;  4ZHF A;  1KT7 A;  4IBA A;  2EU7 X;  4LKT A;  2N93 A;  4BOE A;  3VG6 A;  4GET A;  1HN2 A;  1JBH A;  2HZQ A;  3D95 A;  3PH6 A;  5KID A;  1ZNH A;  5FAZ A;  5LJG A;  3NQ3 A;  3CMP A;  5KIC A;  2HYS A;  3I0A A;  4ORY A;  4ZH6 A;  1ERX A;  2FS7 A;  1OPB A;  1LF7 A;  5IO6 A;  2KW1 A;  3D4R A;  3IFB A;  5BVQ A;  2YG2 A;  3FW5 A;  5HZ6 A;  4HFO A;  3N91 A;  2FRS A;  1E00 A;  1SY2 A;  2KTD A;  1GT5 A;  5CE4 A;  2JU8 A;  1GT3 A;  3O22 A;  1S2P A;  4AYH A;  3P6F A;  3ZZV A;  3TGB A;  5HA0 A;  5H9L A;  4QNI A;  4ES7 A;  4ZHG A;  1GKA B;  1S44 A;  3I17 A;  1ZND A;  1GM6 A;  2L68 A;  4IAB A;  4ZGF A;  3SOT A;  2Q2M A;  4N7D A;  2L67 A;  2ANS A;  1DC9 A;  4KC8 A;  2P8G A;  3VPJ E;  3STK A;  4QGW A;  1OEK A;  3ZW2 A;  4I9S A;  5FEN A;  1DZM A;  2Q39 A;  3CQR A;  4AZN A;  2GTL O;  1LPJ A;  1E02 A;  1KGL A;  3NAD A;  1DFV A;  1GXA A;  2F09 A;  2MJI A;  1ZNK A;  2E4J A;  4O3W A;  1LNM A;  2WQA E;  1MUP A;  1OPA A;  2WUT A;  1JYJ A;  4A60 A;  4O3X B;  4BVM A;  1I04 A;  5F1E A;  1HBP A;  1OEJ A;  1OBU A;  1X8N A;  5HBS A;  4BQU A;  3PQS A;  1TW4 A;  2BLG A;  2NP1 A;  3GAQ A;  4U8U M;  3U9P C;  4ALO A;  4O3Y A;  5HWZ A;  5KHP A;  1IW2 A;  2A2G A;  3RBY A;  4GRJ A;  4RUU A;  4IMN A;  2RD7 C;  3STN A;  1QFV A;  4TQ2 A;  1EI5 A;  1QQS A;  5LJE A;  1BWY A;  4I3B A;  4OMX A;  4O4O A;  5AJC A;  1BRP A;  2X46 A;  2AT8 X;  2NND A;  5AQ6 A;  1TOU A;  3F9D A;  1EPB A;  2BS6 A;  3FEP A;  4WHI A;  3KFI A;  2ZAI A;  4GNW A;  4ZFX A;  4WBK A;  1ALB A;  1LIB A;  1TXL A;  1B4M A;  3STM X;  4XMC A;  5L8I A;  4AW8 A;  4ORW A;  2ACO A;  1EPA A;  2M4L A;  4OS3 A;  3B2K A;  1KXO A;  1LKE A;  4IMO A;  5F58 A;  2HNX A;  2ZAG A;  2NNE A;  1CBS A;  1G7N A;  5CYB A;  4ALB A;  3WJD A;  5LKE A;  2QO6 A;  1VYF A;  3WJF A;  2MHD A;  4I9R A;  4YFP A;  1BM5 A;  3TGA A;  3OD9 A;  2JMB A;  3FYF A;  1KT3 A;  2AT5 X;  2QO5 A;  4NYR A;  4AZO A;  4NNS A;  2RN4 A;  1YP6 A;  4GDZ A;  3EYC A;  3NX2 A;  3AKN A;  3TZS A;  2R74 A;  3UEW A;  1ZRY A;  2IFB A;  2A3F X;  2BT9 A;  1A57 A;  2FR2 A;  2JU7 A;  1LID A;  2GC9 A;  1MVG A;  1GKA A;  3BX7 A;  5D47 A;  3TGC A;  3B2I A;  2A2U A;  5D48 A;  5F6B A;  3ZW0 A;  4I6S A;  1CJ5 A;  3S5X A;  5LJC A;  2QM9 A;  3C76 X;  3FA8 A;  4NLJ A;  4U8U O;  5F7G A;  3OBL A;  4I3C A;  5EDC A;  4GKC A;  1B8E A;  3E3C A;  5H8T A;  3C78 X;  3HWF A;  1HBQ A;  3MX7 A;  4QZT A;  1N0S A;  4ZHC A;  1EIO A;  5B29 A;  3S5V A;  1JZU A;  4RUN A;  3U03 A;  1QFT A;  1KT6 A;  1FEN A;  3PQU A;  5HA1 A;  3GE2 A;  4EQA C;  4ARH A;  2F73 A;  1SY1 A;  1SY0 A;  2LKK A;  2OVS A;  4D6A A;  2R56 A;  2OVE A;  3PH5 A;  4I95 A;  3VU1 A;  1BEB A;  1G5W A;  4M7M A;  1HMS A;  1AEL A;  5BVT A;  3JSQ A;  1EAL A;  1EII A;  1JJX A;  1I06 A;  2L5P A;  3BY0 A;  2QO4 A;  3CR6 A;  4GK9 A;  1H91 A;  1DZP A;  1B56 A;  1Y9T A;  3NBX X;  3G7X A;  1XKI A;  4EFG A;  4QGX A;  4EDE A;  3APU A;  3MBT A;  1OEE A;  1G74 A;  1VPR A;  1EQD A;  2CBS A;  3PP6 A;  4O4X A;  4ZGU A;  3P6E A;  1ML7 A;  1MX8 A;  2GTF X;  1P6P A;  2FWV A;  2FS6 A;  3CBS A;  4ODD A;  3ZW0 B;  4TKB A;  4MVL A;  3CBC A;  4YGG A;  4YMY A;  1SXW A;  1MDC A;  1AQB A;  2FR3 A;  1T8V A;  4QZU A;  1QG5 A;  4FBV A;  2QMI A;  4MIS A;  5EED A;  4KH8 A;  4AZM A;  5L8O A;  1PMP A;  1SXX A;  2HLV A;  1YWD A;  1BJ7 A;  1LIC A;  4PJ2 A;  4A1H A;  2BHV A;  3NX1 A;  2OZQ A;  2CM9 A;  3P6C A;  2RCQ A;  1U18 A;  4PSQ A;  3WBG A;  1KT5 A;  3ZUO A;  4YFR A;  1YUP A;  2RA6 A;  4HPD A;  4A8Z A;  3KZA A;  4AZQ A;  4I3D A;  1BLR A;  1CBR A;  1LIF A;  1SXY A;  2L9C A;  3JS1 A;  1QWD A;  2WR6 A;  1AVG I;  4LKP A;  3TF6 A;  3NQK A;  2O62 A;  2FTB A;  2LFO A;  3HOL A;  3D97 A;  3IA8 A;  1KOI A;  4TLJ A;  4WFV A;  4MVI A;  4QRL A;  3FR5 A;  1JIW I;  4Y0S A;  4YKM A;  1JYD A;  2GTL N;  5AJB A;  1NP1 A;  2WEX A;  2OVD A;  3RZY A;  4TJZ A;  2WSJ A;  4LQZ A;  4NLI A;  1U17 A;  5DPQ A;  3WOV A;  3P02 A;  4IB8 A;  3CWK A;  3FEL A;  1FTP A;  4D6B A;  2MO5 A;  5L8N A;  2W2B A;  1KQW A;  1XCA A;  1Y9L A;  4U3Q A;  1EXS A;  4ZH9 A;  2MWH A;  3HWD A;  2CM4 A;  1E06 A;  3FMZ A;  4GNY A;  4ON1 A;  2Z4I A;  3VE1 A;  1ZNL A;  4GH7 A;  3FIQ A;  2BS5 A;  3FEK A;  2JOZ A;  4WFU A;  4A1Y A;  3OJY C;  2AT6 X;  3KQ0 A;  5B27 A;  3NR3 A;  3F6Z B;  3BDR A;  3HK1 A;  1CRB A;  3ZI8 A;  4YGH A;  5FQ8 E;  4O9S A;  1B0O A;  3S60 A;  3O19 A;  4IAX A;  2NNQ A;  3BX8 A;  3HWE A;  4OMW A;  5FQ6 E;  1SY3 A;  1T68 X;  2XST A;  1O1U A;  4QYN A;  2ACP X;  4AZP A;  1GGL A;  1AB0 A;  2LA7 A;  4JGL A;  4CV7 A;  1JJJ A;  2AMM X;  3P6H A;  3BSZ E;  1QY1 A;  4ORX A;  4YH0 A;  2CZT A;  2A13 A;  1G85 A;  1IFB A;  5D8J A;  1ADL A;  5HZ5 A;  1VYG A;  2AL0 X;  5AEO A;  1DZK A;  2JN3 A;  4KCA A;  3O2Y A;  4FBR A;  2FT9 A;  4ZJ0 A;  1ZNE A;  4OS0 A;  5HCC C;  4LZU A;  1IKE A;  1X8U A;  2G78 A;  3WJB A;  3PED A;  4HPA A;  2PY1 A;  3KFH A;  3K3L A;  1KQX A;  3BRN A;  5H9N A;  2AT0 X;  1O8V A;  4INN A;  2JU3 A;  3JQO A;  4YCE A;  1GX8 A;  2Q2P A;  2MM3 A;  5FFH A;  1IKJ A;  3EMM A;  1S7D A;  4TKH A;  1KZW A;  1FEL A;  1D2U A;  1LFO A;  1PM1 X;  2AKQ A;  2X8F A;  4ML7 B;  4NP1 A;  3P6G A;  4O4U A;  1MX7 A;  2CBR A;  2W2F A;  3FA7 A;  2GTL M;  2KD2 A;  1A2D A;  4QYP A;  3KFG A;  3ZUI A;  4QGV A;  1YWB A;  3BLG A;  3B2H A;  4YDA A;  3FW4 A;  4YCH A;  3APW A;  1BSY A;  3UEX A;  3T1D A;  3APV A;  4HPB A;  1EUO A;  5FQ7 E;  3Q6L A;  2A0A A;  5HZ8 A;  4L3R A;  3EBW A;  3UAQ A;  2HZR A;  4XMF A;  1X8Q A;  4HPC A;  1IIU A;  5EEE A;  4CSB A;  3HWG A;  3FEN A;  4GU8 A;  3APX A;  1UZ2 X;  1YWC A;  4AZR A;  4COT A;  2QOS C;  2YMS A;  1FDQ A;  3B2J A;  2GJ5 A;  2WEW A;  3UEU A;  5C0N A;  1NGL A;  4YFQ A;  3CQN A;  4FGI B;  2AH7 X;  2FLJ A;  1KT4 A;  4NYQ A;  2R73 A;  3BU1 A;  1ERB A;  2KT4 B;  2RCT A;  1RLB E;  4GZV A;  4XMG A;  1X8O A;  3ZWE A;  2K62 A;  3NPO A;  3RWX A;  1FEM A;  2OFR X;  3PEC A;  3WJG A;  1HMR A;  3ELX A;  4DQ3 A;  4IB9 A;  1A18 A;  2WQ9 A;  4O49 A;  4YGZ A;  1X89 A;  2CZU A;  3QKG A;  4MVK A;  3VE2 A;  4QQ1 A;  2G7B A;  3WJC A;  1EW3 A;  3LV4 A;  3NP1 A;  3FA9 A;  4Y0P A;  1R0U A;  4OS8 A;  3P24 A;  4LZV A;  3LHN A;  3L4R A;  3BS2 A;  5EDB A;  1HMT A;  4MVE A;  1OBQ A;  4O4S A;  4XMD A;  3V8U A;  4NW4 A;  3FR4 A;  3U0D A;  3VG3 A;  3S26 A;  2W2A A;  4O3Z A;  4DQ4 A;  2LB6 A;  4KC7 A;  3FA6 A;  4UU2 A;  5HZ9 A;  4EEJ A;  5JR8 A;  1I05 A;  5HCE C;  1GX9 A;  4N7C A;  1BRQ A;  1E5P A;  4K19 A;  1URE A;  3PPT A;  1YIV A;  2Z4H A;  4FBO A;  3WXQ A;  5BYP A;  3BU9 A;  1DF3 A;  4R0B A;  4GE1 A;  3D96 A;  3FLL A;  4M6S A;  4UU3 A;  4TNN A;  4KT5 A;  2Q4N A;  5HZQ A;  1KZX A;  3UEV A;  3C77 X;  3ZW1 A;  4IB7 A;  4ID2 A;  2LBV A;  3P6D A;  1O1V A;  3RKG A;  2POA A;  5H9A A;  5LJB A;  1Z24 A;  1SXU A;  1NP4 A;  2X45 A;  1GT1 A;  4Y0Q A;  5HTD A;  4ZHH A;  4XMH A;  4YBP A;  5D4A A;  1X71 A;  3HTY A;  2LBA A;  1U0X A;  3MVF A;  5EPQ A;  2ASN X;  4KII A;  4XME A;  4CK4 A;  1BBP A;  2DM5 A;  3H3I A;  1QY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...