3C7CB

A structural basis for substrate and stereo selectivity in octopine dehydrogenase (odh-nadh-l-arginine)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
403
structure length
403
Chain Sequence
b'TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDVKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDGGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Octopine dehydrogenase
publication title A structural basis for substrate selectivity and stereoselectivity in octopine dehydrogenase from Pecten maximus.
pubmed doi rcsb
source organism Pecten maximus
molecule tags Oxidoreductase
total genus 118
structure length 403
sequence length 403
ec nomenclature ec 1.5.1.11: D-octopine dehydrogenase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3c7cB02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c7cB01
3OJ0A 2JD0A 3PDUA 3RKRA 3KETA 1DIRA 1E92A 3MZ0A 2NTJA 3I9MA 4YRAA 3RC7A 1XU9A 3VPHA 4EGFA 4HXYA 4GQAA 5I8WA 4RPKA 1WDMA 1R6DA 5CG2A 3FBGA 1QYCA 1DRUA 3M1LA 1ULUA 2CNBA 5BSHA 5IFLA 4Q9NA 2GERA 1E7WA 4CV3A 1O0SA 1DOHA 1UJMA 2JFGA 2YDYA 3COSA 1EUCA 3ICCA 4K6FA 1K6XA 3TN7A 1HDZA 3DFUA 2Y1OA 3TOXA 3P5SA 4U7WA 2Y93A 4AVYA 3PYLA 3Q9NA 4E3ZA 1Q7BA 4PRLA 1IL0A 1LDBA 4ZQGA 1V35A 3PWSA 3Q0EA 2VCYA 1R16A 3S2FA 2DVMA 3B1KA 3W4KA 1KS9A 2JAHA 1ISHA 2CD9A 5CEEA 3DEYX 2WMDA 1ADCA 5CDTA 1Z6ZA 2J3KA 4INAA 1C1DA 3L0DA 3ZWNA 1TVEA 4XR4A 3DBHA 5I7VA 5JCXA 2AHRA 1ISGA 2FY8A 1KC1A 4PRKA 5AQ1A 3JQAD 4EEXA 3EZLA 1HLDA 3NTQA 3OICA 4E21A 2QZ9A 2NVUA 4BKUA 3OM9A 3INGA 1ZVMA 3HJAA 1F12A 4XB2A 3ZU5A 1YL7A 3R3JA 1RJWA 3ZWYA 2O7SA 1F8GA 4BO2A 1TA4A 2CVOA 4YJHB 1MB4A 4E6PA 4J16A 4YTEA 2D3TA 1BDBA 4LRSB 4R5MA 1BG6A 1VJ1A 2D5AA 1FXSA 2C2XA 3MJEA 5L4LA 1DJQA 1R0SA 4FBGA 1FDVA 4FC7A 1PJBA 4W4TA 3ZU2A 5L7WA 3AM4A 4Z0HO 5JO9A 1YJQA 1H94A 1SNYA 1DFGA 5TS3A 2VHZA 5G0VA 3OJEA 2HUNA 5JY1A 1PGOA 1SCUA 4B3IA 5ENVA 3V1YA 1XQ6A 2UDPA 2HK9A 3RWBA 3VPGA 4XB1A 1F14A 2Y66A 1HYEA 4RPGA 4TZTA 5EQDA 1M2WA 3AU8A 2PZKA 2XOXA 3AU9A 4IQ8A 4BNHA 1Y5MA 3HADA 4II3A 2VTDA 3PHLA 2X5OA 4HFMA 4CQLB 2IE0A 2AEMA 3GGGA 5AXDA 3U4HA 4OO3A 4WNCA 3I9OA 4XYGA 3UFXA 4GVXA 1F06A 4DLAA 1HETA 4IS3A 1HF3A 5KJ1A 5KKCA 4AL4A 2GNAA 4O0LA 4CODB 3IOYA 2W2KB 1VSUA 4D79A 3CEAA 1LSUA 1HYGA 1ADBA 1E7YA 1O89A 4E5PA 5MDHA 1NFFA 3PFWO 1A5ZA 1FDTA 3QVTA 1OMOA 3QJ5A 4UUOA 4N54A 2W4QA 1IHYA 3JTMA 4ITUA 3ZV3A 2YW9A 3AUUA 3IUPA 3BMQA 4XJTA 1RM3A 2OGUA 2Y05A 3GF4A 2POQX 1LDEA 1VSVA 1WWKA 2V7PA 4OKNA 4HUJA 1BXKA 1VL0A 4IMRA 3H3FA 3EC7A 1DDOA 1N92A 1XA0A 4J49A 5L9AA 4IDCA 3D3WA 3F3SA 4OGWA 1DHRA 5CPBA 1UZMA 1LU9A 1NHWA 5COBA 5KJFA 1NX6A 3GUYA 4FW8A 5I7SA 1LA2A 1D8AA 3RUFA 3VAZA 4PZCA 2DLDA 4OM8A 2VYNA 3AFMA 4CUJA 2YV2A 1PGJA 3WGIA 3BTVA 5A3JA 3Q2KA 5IZCC 1H6AA 3DMTC 5EIOA 1JVBA 4S3MA 1KVSA 2AMFA 3DOJA 3K8ZA 3B70A 4D0RA 4IDEA 2X6TA 5G0SA 4J7XA 3ZWWA 2C20A 3GVXA 5C7OO 1OAAA 4E4YA 4XIYA 2HLPA 1EE2A 4I5GA 3FSRA 2GO1A 5A4DA 2X9NA 3WFJA 3ANLA 5H83A 4FC6A 1P9LA 1KY5A 4RGBA 2DPHA 3EHEA 1Z75A 3SLKA 4MVJI 4BQPA 3GPDG 3NYWA 2X5KO 4AJJA 2DQ4A 3VZQA 1MC5A 4QECA 4FD3A 1HSZA 2O7QA 3RCBA 3CMCO 3S2IA 4BQRA 5T8KA 4AICA 4WCFC 4ID9A 4Y6SA 3B1FA 5CDUA 1LTHR 1XWFA 4YJGA 2VZ8A 4CM9A 5BR7A 3TZHA 5T57A 4OH1A 1LEHA 1LRJA 2D8AA 4W7IA 5ES3A 3WOHA 4CMIA 3KYDA 2OL4A 1XHLA 3RAJA 3KOUA 3WICA 3HN7A 3KZVA 4NBUA 5L4SA 4X54A 4OHUA 3AI3A 4MVJP 1RWBA 4DQUA 3ONDA 4IDGA 5C3MA 2RHRA 5EINA 2FSVA 2BI7A 5A02A 3BMOA 1EEHA 3LT0A 1PQUA 4Q3BA 4RVUA 2X22A 2JFFA 4PLTA 5ADHA 4B3JA 1B16A 1V0JA 2P4HX 4RQUA 4CMBA 3E6AA 4OSPA 3QVOA 5IZCA 3JD2A 1JKFA 1JW9B 1G1AA 1SO8A 1U3VA 1E3WA 4URFA 4E5KA 2PD3A 2B37A 1U7HA 4GL4A 2EW8A 1Y5RA 1P1JA 3I3OA 1FJHA 1WDLA 4BNXA 2DM6A 3JQBA 4QFCA 1Z82A 4J91A 1HE2A 5JDCC 1EVIA 3N7UA 3ROPA 1LXCA 3SC4A 3L77A 3E82A 4CM4B 4WLFA 1I3KA 4XQCA 4CMGA 1LDYA 4XRRA 4PCVA 6LDHA 4MPDA 3F4LA 5KOIA 1T24A 2R00C 4ND2A 4AJPA 4PVCA 4A73A 1I10A 3GK3A 4PLPA 5AYVA 4GGOA 1EK6A 3VVBA 3GQVA 4JX8A 4JNKA 4WCFA 3D64A 2CFCA 3AI1A 3ONFA 4FOOA 1X7GA 3PWZA 4J0FA 1MXFA 4QQRA 4IQGA 1NFQA 4XQEA 2HQ1A 2EGHA 1DC3A 2EJVA 4XQGA 3PLNA 5CP8A 3CINA 1Q7GA 5EMHA 1ZBQA 5EERA 3IS3A 1XCBA 5GZ1A 1CETA 1KEWA 1QV7A 4FIZA 1HXHA 2OP1A 1ZIDA 5I8ZA 3RASA 3ZHXA 3CE6A 3WGZA 1EQ2A 2FPIA 2VUTA 4CMJA 3FI9A 4QX6A 3ON5A 1WZIA 2JCYA 3GHHA 2EKPA 2Y0EA 3TL3A 3D0OA 4DPMA 2JCVA 5JAIA 3I52A 3VOSA 2J3HA 1ADGA 5GZ3A 1PS9A 3U4DA 3AOEA 1NP3A 3OEWA 1PJ4A 3NGLA 4NFHA 3RI3A 1GUYA 1H2BA 4L4RA 1U3TA 3WYBA 4YRDA 3LZ6A 1GDHA 4GVLA 1N9GB 1G6KA 3D4NA 3CMMA 3QRWA 1VJ0A 4EUFA 1RPNA 1DRVA 3EVTA 3I6QA 4BV8A 4TSKA 4GWKA 2PA3A 3WYCA 3JYOA 1HDGO 4CQMB 1HZJA 2NVWA 1JTVA 2DT5A 2UV8A 3I4FA 1BGVA 1E7SA 3K2BA 3KSDO 2Y0DA 3Q1LA 1MV8A 1ZH8A 3GN1A 4Z9YA 1KVRA 2P4QA 1DXYA 3GMSA 1WZEA 3NX4A 4NPCA 5HS6A 3OEYA 1QKIA 5KNLA 1NPYA 4I1IA 3K96A 1PZGA 1IY8A 1A27A 1P1HA 2DTDA 5L4NA 3RC9A 4N18A 1GAEO 3O26A 1VPDA 5A04A 5FEUA 1E6UA 1HDYA 1YJ8A 3U4CA 2CUKA 3L4SO 2UYYA 4O1MA 5L53A 2O23A 1E3LA 1P1KA 1ZJZA 2HKIA 5EN4A 3PFFA 2EHDA 5KWEA 3WGYA 3JQ9C 4IDAA 2E48A 4M8SA 4XEHA 3U49A 3JQGA 1X15A 4K6CA 3ZWOA 4GPD1 3I9KA 4R4JA 1GYQA 5JYDA 1ISJA 4GWGA 1NPTO 2P9CA 3L9XA 4PLZA 3NT4A 3NUGA 3ZWXA 3V2HA 1P1RA 1B8UA 3ENNA 3F4BA 5JE8A 4EZBA 4G2NA 2G0TA 1JQBA 3DBHB 3JQ7B 1H6DA 3W8DA 2NU7A 4IIVA 3DONA 3TFOA 4RDHA 1YQXA 4DYVA 1P3DA 3WDSA 3U5TA 1MG0A 3PP8A 4ALNA 4WLEA 2NVUB 5F5LA 3A9WA 2NU6A 3I5MA 1IZ0A 4ALMA 2JCXA 4J2HA 3HG7A 4UUNA 1DIAA 1GFSA 2I76A 2QZZA 1B0AA 1EVZA 4TMFA 1DAPA 1X7HA 4QT0A 2EG9A 5BSGA 5IN4A 4CLRA 2AE1A 3DBLB 4Z0TA 5MGBA 1M6WA 2JFHA 4MVJF 5IDWA 1VL6A 3SJUA 3UCXA 3PIIA 1P77A 2DBVO 4B7UA 1GEGA 1SZJG 4E13A 4IBOA 3H5RA 4R51A 1YBAA 3BTUA 1UXHA 1MUUA 1NR7A 1SBYA 3NV9A 2CDAA 4WLUA 3QWIA 4BOYA 1DSSG 1RKXA 3HQ4O 1B8VA 3KBOA 2G17A 3RJ9A 1DC6A 3JQFC 2Y1GA 4E2ZA 3UGKA 4E2YA 1PJCA 5JC1A 4LMRA 3ZNOA 5DP1A 4MVJA 1MC4A 2QRJA 3AW9A 2Q4EA 1CF2O 3PZRA 3FRJA 3ZWCA 2PD6A 1NVTA 2QG4A 3TL2A 2IZZA 2X0RA 2V6BA 3LT1A 1EBFA 4TRRA 1U8XX 1R4NB 2WE7A 3L6OO 4Z3DA 4CLHA 2NQ8A 4CM8A 3BTOA 1AXGA 2FMUA 1E77A 1BWSA 1ZK2A 4CMCA 1IUKA 3TJRA 1TT5A 3UXYA 2NU8A 3D5QA 1VM6A 4NJOA 1A7KA 4BNGA 2OFPA 1TT7A 2FR1A 2Z1MA 5JS6A 4CMEA 3FNFA 4R1NA 4NFSA 3W4IA 2OBNA 1GADO 3AK4A 4ZICA 3K30A 5A05A 5JAMA 4ZQBA 1H5QA 1Z45A 4J4HA 4PLHA 4D3FA 2ZTMA 5B1YA 3KHUA 5KTKA 1M76A 3AI2A 3WGHA 1QSGA 1VLLA 5F1PA 3WMXA 4XYMA 3JQAA 4ALLA 1EVJA 4M54A 2VWPA 3GNSA 2RCYA 1B26A 4OXYA 5DBGA 1YB1A 3ZWVA 2X0IA 3CTMA 4UVIA 1DHTA 4BNFA 4TRJA 2C0CA 3L4BC 2VHYA 2WM3A 3X2FA 4AJOA 3F46A 3K5PA 2HK7A 3QVWA 1T2CA 2PKQP 2BFAA 2YFQA 4BKOA 5G4KB 3R0IA 1ZEJA 4EYEA 1I3LA 1N1EA 2FR8A 3DZFA 4MIOA 2ZKLA 4GMGA 3GC6A 3JQFA 4NQZA 3HN2A 4GI2A 4YAJA 5IZ4A 4FDAA 1NAIA 2OHXA 2YV1A 1P1IA 4FS3A 2PZJA 2QQ5A 1C3VA 2HO5A 4I08A 1X0VA 4D42A 4XYLA 1MG5A 3ADOA 1ZJYA 3UCFA 1Y8RB 1ZSNA 1HE4A 2O3RA 3MTGA 3PRJA 3QE3A 3QWAA 1JWBB 4FFLA 1YOVA 1E5QA 1R37A 3NRCA 4XDZA 2EP7A 4NK4A 4NJMB 5IN5A 2YDXA 3ANNA 1T2AA 3RROA 3U09A 1YB4A 1U5CA 1U3UA 2PD4A 4FPXA 4NR0A 4Z6KA 3ZW8A 5EQFA 2ZYGA 1O9BA 3BZUA 4BKQA 1PJLA 1NWHA 1OBFO 3JV7A 2AW5A 4L4XA 1FDUA 7ADHA 3ZV5A 4FFRA 3FD8A 1TI7A 1NM5A 4RLHA 1OC4A 5CPFA 2B83A 1U4OA 2P9GA 4MJLA 4BMNA 5CDYA 4XCVA 4D44A 1BSVA 1HL3A 2O4UX 3AY6A 1A4UA 2DUWA 1KEUA 5JPIA 4KWHA 3GFGA 2HCTA 3K31A 3LC1O 3TSCA 4DUPA 1I32A 3EAGA 2Q1SA 2WD8A 3LYLA 2C07A 1B2LA 4RL6A 3LDHA 1LLUA 5COAA 3TPCA 2BKAA 2H63A 4YAIA 3VHRA 1CWUA 3C1OA 1PGQA 3LVFO 1U2DA 4R1TA 1X14A 1GZ3A 3JYPA 2GRAA 3BIOA 3DZJA 3ZWPA 4HBGA 3BA1A 3OMLA 5L95A 2YHIB 3CKYA 3GEGA 4P22A 3H65A 2NNLD 2AQIA 5ITWA 1V9LA 3OSUA 2PNFA 3PVZA 1YKFA 4FFNA 4B4UA 3WQRA 4NBWA 2RHCA 4BNUA 4YT8A 5A5FA 5JC8A 1V3TA 2NTNA 3E48A 4P4NA 4WLNA 2A92A 1J6UA 1TXGA 4MVJD 4CMAA 4E0BA 4IZIA 3FNEA 4EJ6A 2WTBA 1J0XO 2E4AA 3ADPA 3C24A 2X4GA 4GX1A 2FHSA 3GNQA 4DIBA 5ICSA 4R16A 1G0OA 4J1TA 4D45A 3BMCB 1GQ2A 4IDFA 3INRA 3JQCA 4TQGA 4D3SA 2B35A 4J1NA 3ICPA 2PLAA 4JN6B 2QIOA 4FJ2A 3EDMA 3PHGA 3FWNA 4YJFA 2NUAA 2AG5A 3GDFA 3BAZA 1BW9B 1R0KA 1SB8A 1KVTA 3MWEB 3FPCA 4Z9FA 2EW2A 1N7GA 1QR6A 2GR9A 2XXJA 2RH8A 3ANMA 3MOIA 2AG8A 2O3TA 2YQ5A 3RUAA 3MOGA 3QWBA 2P91A 4WASA 3AY7A 3LT2A 4PLYA 5JYEA 4B8ZA 5BSFA 2ZJ0A 5JDIC 3DAFA 1LSJA 1BXGB 5B12A 1ENZA 1ZZEA 1W73A 2V65A 3UCEA 3DMYA 1N7HA 5AXBA 3VDQA 4FQ8A 4TROA 4HNGA 3LF2A 1A9ZA 2GDZA 1UP6A 4P8RA 4Q3DA 1XQ1A 4GSKA 1EBUA 4U0JA 1ENPA 5GZ6A 2PY6A 2HMVA 5TNXA 1CYDA 4J0EA 1EZ4A 1I2ZA 1IE3A 4BGEA 2ZYDA 1Y1PA 4Y67A 5BNIA 5DOVA 4CM3A 2Y67A 3KXDA 4L74A 3TOZA 3HE3A 2HAEA 1SPXA 2I66A 2C59A 3ZCXA 1YBVA 1MA0A 4TRNA 4BNIA 4AJEA 5TX7A 4BKPA 4QSMA 3E9MA 1RM5A 3NTOA 1DAOA 4CM6A 1XU7A 3OECA 1HYHA 3H3JA 1SC6A 1U7TA 3CZMA 3HHPA 5TRTA 3ASUA 5JBIA 3RBVA 2Q2QA 4B8WA 2OZPA 1DIHA 1BHSA 3OA2A 5F1OA 3NDJA 1P44A 2SCUA 3PK0A 2WD7A 3Q6IA 2VWQA 3VVCA 1X13A 1Q7CA 5BNFA 4GLLA 4WOJA 3PIDA 4LGVA 4PG5A 4R54A 2CZCA 4W99A 1LUAA 1PL7A 4W9NC 3NTRA 4R41A 1DO8A 4D7AA 3GMDA 3G1UA 3GUCA 9LDTA 5JY6A 3BXXA 1KERA 4N5MA 3JQ6A 3SC6A 2X1HA 1LDNA 2NACA 1JDJA 4FSHA 5A9TA 1C0KA 3SEFA 4ZRMA 4WCDA 1UZLA 1PTJA 1Y6JA 4DGSA 4J9UE 3H4VA 2X7HA 4CM1A 1TEHA 5G4LA 2PTGA 1EFKA 4GSLA 4XIJA 3TRIA 4FOSA 3PEFA 3HDQA 3KO8A 4BVAA 4KP7A 4F6LA 4CR6A 1DEHA 2O4CA 2WYWA 4PN3A 1KEPA 4YB8A 4DPKA 2RIRA 4A0SA 1K6JA 3DBRB 4OAQA 1D4FA 1NBOA 2Q99A 4DIFA 2FPGA 3DL2A 4DMMA 5IDXA 4E32A 2EF1A 1PX0A 5DCYA 5H81A 1QG6A 4NBRA 5DP2A 1GR0A 2EGGA 4MKZA 1DBVO 3O8QA 4ND5A 1YS4A 4M1QA 3WJ7A 1C0LA 2EV9A 2GCGA 1LJ8A 4OYRA 3ZWMA 5IDYA 4IS2A 3RUCA 1EK5A 1AXEA 1ISFA 2B4TO 1H6CA 3GR6A 3WBFA 5L45A 2DBQA 4ZU3A 2VZ9A 4UVHA 4C4OA 5I9LA 5J23A 5IJZA 1GZ6A 4WLOA 4QTZA 2VOEA 3PJGA 3ZHBA 4H16A 1NAHA 3OBBA 3LC2O 3CTVA 1ZO8A 2A94A 3QW2A 5BQFA 1E1NA 3WNVA 1YB5A 1J4AA 2Q4BA 2QHXA 3WBBA 4YRBA 1OOEA 3GN2A 1WP4A 3DBVO 3TNLA 2PKQO 3WSVA 1UUFA 3I1JA 4K1LA 2QYTA 1LDGA 3E9NA 5G2OA 2J8ZA 4RV9A 5JCJA 2PR2A 3H2SA 1WLYA 3MJCA 3FTNA 1IZ9A 1YL6A 4ZQEA 3QHAA 3P19A 4XJSA 3PI7A 4WGGA 2ZCVA 4EJ0A 5C7LO 2IZ0A 1GV1A 1U8FO 5DCUA 4E5YA 4ALJA 1E3IA 1H93A 4RCVA 1UDAA 1WMBA 4LVUA 2GGSA 4M49A 1TT5B 2WE8A 3P2YA 1A9YA 3NJ4A 4YJDA 3VZRA 3WX0A 4BNJA 4YAGA 3DZBA 4CV2A 5JMWA 4YEDA 5B37A 3UUWA 5TT1A 5TC4A 2IRWA 5LC1A 1U2GA 3KYCB 3CUKA 1HLPA 1FDWA 3GAZA 3QLJA 1O5IA 1W8DA 2YV3A 2YFHA 5K6AC 4RVHA 3K73O 5JW6A 3IAHA 1JWAB 3GH3A 2X9VA 3R1IA 1DLIA 3QQPA 1PL6A 2C54A 1WPQA 2CVZA 1DFIA 4Z9XA 2DFVA 3FNHA 2RH4A 3ROMA 4UVDA 1PJ3A 4LSWA 4XX0A 3V1UA 3GPIA 1U5AA 3IMFA 2O48X 1GCOA 2WEKA 3KLPX 1I36A 4BNKA 4RQTA 3DB2A 3WLFA 3W8EA 3WB9A 3OP4A 4J7CA 9LDBA 1EUDA 1Y8QB 2Q49A 4MVJH 4GX2A 2NU9A 1G0NA 5G0TA 1R12A 2Y1FA 1SAYA 4DL9A 1OC2A 3MJSA 5KVVA 3DMTA 3KUXA 4EJMA 1GD1O 3L07A 2B0JA 3QIVA 1Y9EA 1H2HA 1ZW1A 5ER9A 1R4MB 2NVBA 2B4RO 4ONEA 1SEVA 3DHYA 4WEOA 4M89A 2Q2WA 2O3QA 1UP4A 4BMVA 3WIEA 1QXSA 5HTOA 2A9FA 1EUZA 3OQ6A 2H6EA 3DDNA 1YO6A 4BGUA 4QUKA 1A4IA 1I01A 2O50A 3S55A 4N7RA 2JD2A 3LSYA 4B4WA 4YA6A 1I3NA 3HFGA 1WAMA 4IMPA 1X7DA 4RVDA 2OP0A 1DC4A 4PLFA 2XPCA 4BO0A 1B3RA 5CEFA 4D46A 4J1QA 4XR9A 3CPSA 4IJKA 1TB4A 3N58A 2UUOA 4CLOA 4L76A 2I3AA 1T25A 2Q46A 3GT0A 3JYNA 3BMNB 2FN7A 3ETGA 2X86A 4YPOA 4FB5A 4AJ4A 1T2EA 4MIEA 1UDBA 1VJTA 3W6ZA 4N5NA 1M6HA 4PVDA 3WIDA 3TZCA 1XLTA 2Q1WA 4CPDA 4PG4A 4UEOA 3HDJA 3PGJA 2HMSA 4UUMA 2O2YA 4QXMA 1ZFNA 3JQ8B 4PG6A 3BHIA 4BV9A 5A06A 5EL0A 3JD0A 1XYGA 4MVJG 4WKGA 2O3SA 4IQ0A 3ABIA 3IL2A 4WNIA 3VKUA 2P68A 2CF5A 5KJCA 3G79A 4FFPA 1ZEMA 2VT3A 3C7DB 5B4VA 1NR1A 1B14A 4UULA 2NLOA 5FYDA 2ZTLA 3GVPA 4ZQHA 3K2EA 2PK3A 1PQPA 4XKJA 3RKUA 2FR0A 4R9SA 5BSEA 3HDHA 4A5OA 2B69A 1PQWA 5HM8A 3STHA 4PLCA 4GKVA 3PTZA 3EMKA 3GDGA 4Y9DA 4BNWA 4PLVA 3TZKA 4ESOA 3RU7A 1I3MA 1UH5A 3GY0A 1NQTA 1CEQA 1Q1NA 4ZA2A 1EMDA 3GVIA 3MWDB 2EXXA 2DAPA 1HDCA 2D1YA 5DULA 2DKNA 2JHGA 5A3VA 5JDCA 5KJ6A 4GX0A 4BO1A 2GPTA 1HTBA 3JQEA 4YR9A 1LSSA 3WFIA 5DBFA 4KUEA 2X9GA 1VKOA 3HFSA 4ZRNA 3E5RA 5JCJD 2E49A 3P7MA 1T2FA 2R00A 3FN4A 1NQ5A 1PS0A 1ZK1A 3NJ8A 4OXNA 1DPGA 4Q3AA 2VHWA 4YJHA 4PG7A 2ZB3A 3PZBA 2VRCD 2VTEA 3LLVA 3DC2A 1S6YA 1UDCA 2QYSA 1HKUA 3GVCA 1GU7A 3RUEA 2VUUA 2X58A 4C7JA 1QMGA 2I9PA 2LDXA 4Y6RA 3OH8A 3QWFA 4W7HA 5U4QA 3RFTA 5I7FA 3F6YA 1UXJA 4YJFB 1D3AA 4YT4A 1N5DA 4UREA 3C1AA 2VHXA 3NKLA 3M1AA 4PLWA 4JQCA 1DB3A 4P38A 1ZMOA 2VNSA 3WGGA 3ZV4A 1T4BA 2HRBA 1YDEA 4S1VA 1O8CA 1LC0A 4I9NA 4ZN6A 4BO3A 2AA3A 1ZMTA 1C1DB 3U4IA 1MGOA 2AEFA 3JYQA 3V1TC 4HFNA 2Y0CA 2IXAA 2A35A 1YWGO 5FI5A 5KJEA 5CEJA 2JD1A 5IXYA 3JCZA 4TKLA 1XIVA 4CQLA 3WYEA 1VRWA 4WEQA 2GASA 4CV0A 3BYZA 1IPEA 2FWMX 2VZ0A 3JD3A 2D4AA 2C82A 2GD1O 2PFGA 4I9UA 4M86A 3UICA 2EEZA 1SOWA 1XEAA 1MFPA 1LLDA 2AQ8A 2I5PO 5C37A 3O38A 2W2KA 2XXBA 3BTSA 3PQEA 2JHFA 2QX7A 2G1UA 3I9LA 1DIBA 3IKVA 2CMDA 4DQXA 3SJ7A 3FPLA 1L1FA 4A2CA 1QV6A 1KETA 1ZXBA 5T6BA 2VYVA 4IXWA 1D1SA 4DBZA 2BFPA 3IC5A 4PIVA 3KV3O 3RVDA 1ZNQO 1A72A 5JSFA 1HEUA 1MLDA 3UKOA 3ZWBA 5THKA 4YT2A 2OXIA 5FWNA 3CZRA 1IULA 1I2CA 1LDMA 1MFZA 3BHMA 3F9IA 2VUSA 3T4XA 4B3HA 4CUKA 4I5EA 4II2A 5A1TA 2FZEA 2HDHA 4OMUA 4WPGA 3ZU3A 1FMCA 5JAQA 5IAAA 3FNGA 1AN9A 4DIOA 4J43A 1F0YA 1NVGA 4E31A 2HMUA 3DAGA 4DQVA 2JJYA 1LRKA 5ILGA 3X2EA 1C1XA 1W4ZA 4RORA 1O95A 3JQ9A 1X1EA 1YBMA 4R3WA 5DCWA 2VNAA 3GFBA 2EWMA 3DR3A 1Y81A 3W1VA 1B15A 4HKTA 4KQXA 4BO5A 4LW8A 3T4EA 3EGOA 3D7LA 3LU1A 4RDIA 2A4KA 3GEDA 4GLOA 4RPHA 4DC1A 2YYYA 1PGPA 2DPGA 1PEDA 2C7VA 2CY0A 2PV7A 3HB5X 1E1KA 3GNTA 3PYMA 3D1LA 2DTXA 2BGMA 4MP3A 4HV4A 3V2GA 3DWFA 4Z0PA 4UEKA 4ILKA 1D7OA 1VL8A 3JQDA 4BB5A 4U0KA 3HNPA 3HSKA 1T26A 3GGOA 4RLSA 4D3DA 4GMFA 4UEJA 4O5OA 2ET6A 3BMQB 5H82A 4LISA 4CR7A 4UAGA 3AOGA 4BHTA 1KC3A 1Q2XA 2PWZA 3EYWA 1DJNA 2OO5A 4U6QA 1JVSA 2PH3A 3PLRA 1DLJA 1R0LA 2G76A 3H9GA 5FFFA 3KRTA 3D3WB 3WGTA 5EESA 1MX3A 3R6DA 2CVQA 3T7EA 3B6ZA 3GZ4A 3GZNA 3ZHYA 1ULSA 3F47A 1T1SA 4HP8A 4JBHA 5TLSA 3E18A 4J6FA 4Y98A 3ZGYA 5DF1A 4AJ1A 3UF0A 1MXHA 5KVSA 1S7CA 3WJAA 4XD2A 2Q50A 4CMKA 4DMLA 4I5FA 4A7PA 1GEEA 3AUTA 4R3NA 4RJTA 1UP7A 4Y8VA 1V8BA 3BHJA 3LK7A 3VH2A 2AQKA 1DIGA 4C7KA 3FR7A 1QYVA 5AVOA 5ILOA 1U1IA 2P9EA 1NPDA 1GPDG 4EDFA 3OF2A 4W82A 2NQTA 3KM0A 4QO7A 4M55A 2RAFA 1L7DA 2X0JA 4PGFA 1PJQA 3F5SA 4JGBA 3C8MA 3GRKA 4BGVA 1LC3A 4E12A 1N8KA 3WGQA 3RD5A 1QRRA 4B4VA 3TZ6A 3WQSB 3EZYA 2EIHA 3H5AA 4FFMA 3E03A 3F1KA 2YZ7A 5HBRA 4NFYA 3WNQA 3K9QO 1H6BA 8ADHA 4DTIA 1Z73A 3G3EA 3VC7A 3Q2IA 2J5QA 5AXCA 2JAPA 4E30A 3EW7A 4KTTE 4MO2A 4CM4A 3SLGA 4YJGB 4RF3A 3DXFA 4TVOA 4CMIB 1RM4A 3SX2A 3KYDB 1YH3A 5A5EA 2VT2A 4J4TA 3WXBA 2VHVA 3F1LA 1NQAO 3RUDA 4F45A 3W4JA 1E3SA 3PHIA 5T64A 4JJIA 3OJFA 1YVEI 1Y7TA 4JK3A 4ND3A 1HE3A 3BMOB 2IODA 3CIFA 4B7CA 4RZIA 4CUZA 3L4BA 1B3BA 3UW3A 2OORA 4O63O 2XAAA 1BRMA 1K3TA 1Q0HA 5COQA 3VTFA 2EERA 1KOLA 4IZHA 2O2SA 4MDHA 2IDZA 1ISMA 2VYVD 4P4LA 4XZ3A 3ITKA 3S2EA 4KOAA 1Z7EA 3RFXA 1U3WA 4RO0A 3H7AA 3EUWA 4NBVA 1E3WB 1QLJA 3K6JA 4Q3NA 5IDQA 4B79A 3AM5A 1PL8A 1NNUA 1ISIA 1K6IA 1Z7BA 1R66A 3L6DA 2VWHA 3G1TA 1LRLA 2VRBA 4K9DA 2HMTA 4DA9A 4AJIA 4LMPA 3C85A 4ALKA 4BMSA 5FF9A 2BH9A 3A1NA 4OQZA 1GQYA 1ML3A 2G5CA 3ENKA 4BB6A 4TWRA 3GAFA 4YAEA 1VE9A 2UAGA 2E6UX 1HDXA 3U62A 4G5HA 4YDRA 3ST7A 3DTTA 1NVMB 4GKBA 4MVJE 3EK2A 3ROQA 5F3RA 4YQYA 3H9UA 2OBYA 3FCOA 5C5IA 2TMDA 4W6ZA 3RQSA 4LK3A 3ZHZA 2BFMA 1BVRA 4WCFB 4CQMA 4PZEA 1JAXA 3N74A 3IIEA 3NDIA 3DAPA 4MOWA 1YQDA 1ONNA 1R15A 2QRLA 5G0UA 3FTPA 3W6UA 5TGDA 3TZQA 1I33A 4NI5A 5L7YA 3D4PA 3DZGA 1NFRA 5JFOA 3TWOA 4L75A 5HRUA 4FN4A 3LT4A 4OQYA 2X0NA 5IF3A 4EUEA 2NM0A 2C7GA 1ARZA 1HDOA 4NBTA 3B20A 4IINA 2Y68A 3GRPA 1OI7A 1TLTA 5HA5A 2CDCA 4H15A 2GYYA 4WECA 3SVTA 4OSOA 1LI4A 4MIYA 4QO8A 3ULKA 2BF7A 3I6IA 4P4GA 1KBZA 3I9NA 4TKMA 2Y99A 2D2IA 5TT0A 3I9JA 4RVGA 4E5NA 6ADHA 1RM0A 2B4QA 2IEBA 4OJNA 3C1TA 3JSAA 4CM5A 5U9CA 2WYUA 1QYDA 1YQGA 4GH5A 4ZQFA 2Z5LA 3AY3A 3KVOA 3WTCA 2X8LA 3JQ7A 1P45A 3HWRA 2R2GA 4CMHA 2F00A 3AJRA 5AXAA 3V8BA 1L7EA 3ZNNA 4EI2A 2GF2A 3OJLA 5IG2A 4XDYA 2D59A 2YQ4A 4GGPA 5L51A 1V3VA 1B8PA 1VKNA 5IXSA 1HT0A 2YJZA 4KQWA 4N5LA 3MTJA 3KYBA 3UVEA 2XF8A 2ZATA 4IDBA 1WVGA 2J6IA 2Y1DA 4LCEA 1JKIA 3RBZA 4BO4A 3OHSX 5T67A 4RF5A 1BMDA 3DBLA 1P33A 2FOIA 5CDSA 4KUHA 3WS7A 3NAQA 4HWKA 1CIVA 1E1LA 3TQHA 4WJZA 2ZYAA 1XGKA 3CH6A 3CSDA 4LCJA 5B4UA 5K0ZA 3QP9A 3VH4A 1Z74A 3DTYA 1PR9A 3AUAA 2Q1UA 1GUZA 3HB4X 2O3JA 2BD0A 4EITA 1UXIA 3JQGB 4BO8A 2J5KA 1UR5A 3D4OA 1N2SA 4XGKA 1UAGA 2PH5A 5TIIA 4DYDA 2FP4A 1ID1A 4J2OA 3FF4A 3DZKA 5ICMA 5JDIA 4JLWA 5A9RA 4IPTA 1XG5A 3VZPA 4E5MA 3CXRA 3PQFA 4BNMA 1SEPA 1ZSYA 5F1KA 1H9AA 4WE3A 3HZZA 3WLEA 4PG8A 1IOLA 4IGFA 3ZU4A 4ZD6A 5CG1A 4GX5A 5A03A 2IEDA 3T7CA 4ZVVA 4Y6PA 2BRUA 2I3GA 1R4NA 5C7IO 1K0UA 2J3IA 2C5AA 1SB9A 3OIDA 1HRDA 4XA8A 3RBXA 1ZCJA 1NWCA 1QYWA 4TZKA 1NASA 3NEPX 4JBIA 2HK8A 5K9ZA 2HJRA 3V5NA 1PZHA 4JJFA 4CLRB 1YDWA 4IGEA 4JIGA 5KCZA 4A26A 1E7QA 5T8KC 4KDFA 2BELA 4MKXA 4H7PA 1JKJA 2ZQYA 3IKTA 3I23A 3GOHA 2FRDA 3PJEA 3PJFA 3ORFA 4AJKA 5A9SA 2AEJA 5KVCA 3WGOA 2X23A 5EPOA 3WG9A 2CDBA 3GEMA 2X5JO 4PFJA 1WNTA 1BXZA 2PKRA 1AHHA 3VPSA 1X0XA 3QY9A 2B5WA 4RPLA 4PZDA 3E9QA 4HY3A 4NK5A 4AFNA 4EEZA 4BS9A 4BO6A 1C1XB 2ZB7A 3M6IA 3OETA 4HNHA 3VZSA 3KEQA 3JD1A 4FCCA 5G4KA 4W9NA 2LDBA 3VPFA 2Z95A 4CQMD 2VRCA 2FSSA 4NZ9A 4NNJA 3PWKA 3RC2A 3DZIA 3MJ4A 3GA0A 3ZI0A 1FK8A 4BO9A 4CM8B 1DFHA 3C3XA 3UOGA 2H1SA 3VTZA 3RU9A 3M2TA 1GL3A 4HFJA 3ZDFA 4XGIA 1Y8RA 1WDKA 1LSOA 1AHIA 2HRZA 1FF9A 4FJ0A 2P2SA 4DWVA 3DFZA 2C5EA 3JQBC 5JLAA 4CR8A 3A4VA 4U8GA 4WUVA 4NJMA 2AXQA 2OMEA 5L40A 4CV1A 4UUPA 3H2ZA 4AG3A 3ROKA 1T4DA 1I2BA 1A71A 3D3EA 1I30A 1ORRA 3C7AA 2IXBA 4OKIA 1WW8A 2DC1A 3ZH2A 8LDHA 3JYLA 1JU9A 2C2YA 1J5PA 1PJSA 3JQAB 1BVUA 4XWYA 1W0CA 1JAYA 1CERA 3GZNB 1LLQA 1ZXLA 5GMOA 3TF5A 4M87A 2ZTUA 1M66A 1EDOA 1PS8A 4JBGA 5KVQA 4EW6A 2EKLA 2I6TA 4J4BA 2VQ3A 2C29D 2CSUA 4IDDA 1QLHA 4EBFA 5ENDA 1ADFA 4TRMA 3S2GA 3KSZO 3RSHA 1XELA 5CAEA 4DC0A 4J3FA 1NQOA 3DHEA 3H9EO 3OIFA 2PZMA 4MINA 5L3ZA 2B36A 4F3YA 4CL8A 2AE2A 1E6WA 1EE9A 1YOVB 3KLMX 2DBZA 4BNYA 2BMAA 3F5QA 2YHIA 3QWHA 3QVSA 3VPXA 4J90A 4KZPA 4MVJM 1DRWA 1GPJA 1RYEA 1UXKA 3ZW9A 1ONOA 4YAKA 4HFRA 3GLQA 3AOEC 5JMPA 3FHLA 4AJHA 2GZ2A 4RVFA 2WYVA 1KVQA 2WWRA 1YE3A 1O94A 1FDSA 2NTVA 2VN8A 5LDGA 3KEOA 3INTA 3PQDA 4NHEA 2GSDA 4G65A 1U4SA 5K6AA 1I0ZA 1WMAA 4J1SA 2BLLA 2VWGA 3QSGA 4YYZA 1XR3A 4MP8A 4Q3CA 3PPIA 4LRTB 3IUSA 5TJHA 1ZK4A 4B4OA 1H9BA 1UXGA 2EJWA 1KVUA 2AQHA 3GHYA 2OOSA 2GN6A 3OQ1A 4R69A 3BMCA 2FPPA 3MJTA 1SMKA 3RIHA 4JCOA 3GG2A 1CRWG 2UVDA 2BHLA 4BL5A 1X1TA 3O03A 2W2LA 2I99A 4L0QA 4KWIA 5F21A 1I8TA 1ENOA 1BW9A 4QEDA 4R9RA 1LBEA 3A06A 2WDZA 1OFGA 3AFNA 1JA9A 1J49A 1LLCA 3DOOA 3QVXA 1KIFA 5CHEA 3DZHA 1C0PA 4UVGA 4BNVA 2JL1A 1T1RA 1JN0A 4GBJA 4NH4A 4DRYA 2HJSA 1U9JA 3HDYA 1OZAA 3TFQA 2BI8A 4JXKA 1F17A 2D5CA 2YHUA 1YGYA 3LLSA 4QFDA 1BXGA 4UVEA 3UHAA 3ZZNA 5AOVA 5DN9A 4WOKA 2NSDA 5ITVA 2Y1EA 1ENYA 4KUGA 4FJ1A 4R68A 4BNLA 4YCAA 3ETDA 4YT5A 4K26A 1E5LA 3O9ZA 5JO0A 3Q9UA 4I8XA 4RVSA 4LSMA 1YONA 1QYXA 3IDSA 4OL9A 3L9WA 1EFLA 2VYND 4CM7A 3RUHA 1I24A 3H5NA 4IUYA 5EJ2A 2YUTA 1UZNA 3IP3A 4WK6A 4FGWA 2DUUA 3DO5A 1E7RA 4JP3A 2CF6A 1P1FA 4AJNA 4HADA 1GQQA 1V3UA 1PR3A 2ZK7A 5DDIP 2I65A 3AWDA 2E82A 2Q3EA 5I7EA 3G49A 2ZJ1A 2G82A 3KSUA 1HWYA 1ZK0A 2QRKA 4E2XA 2BFOA 2ZB4A 2W98A 4BO7A 4OXKA 5JNLA 1H0KA 3E1KA 4U6SA 2Q1TA 1HSOA 2IZ1A 3PJDA 1C14A 1AE1A 3D5TA 4CLDA 2GN8A 7MDHA 5THQA 5CDGA 3H9JA 2BGLA 3R3SA 4IJWA 4YQZA 4D0SA 3ZWAA 3PYXA 4PLGA 1JLLA 4J7UA 4XYBA 4DVJA 4ZGWA 4BIIA 4Z3KA 1K89A 4IY1A 5GY7A 3U0BA 4L73A 1E7MA 4GAEA 4CM9D 1I5RA 2W90A 2P5YA 4B7XA 5B4TA 4ND1A 4NG5A 2W8ZA 2J3JA 4J9VA 3S8MA 4NU5A 4AJLA 3B1JA 3ZN2A 5L7TA 4DPLA 1HDRA 2UUPA 3PHJA 3IP1A 5TJ9A 1T2DA 4NDNE 4FGSA 3U9LA 4D41A 4CMEC 2D0IA 1E1MA 4LN1A 2V6FA 2DTEA 1P0CA 4Q39A 3DBRA 4CJXA 4Q3EA 1NHGA 1YRLA 1C0IA 1QORA 1WXDA 4YWJA 1DC5A 3PHHA 1SOVA 3IJRA 5FI3A 4A27A 1ZSVA 1GYRA 2GZ3A 3V2UA 4MP6A 4BNZA 1NYTA 1YL5A 3DOCA 4K28A 2EKQA 2DU8A 4I5DA 1PWZA 3PGXA 3GG9A 1BDMA 3FBTA 4H3VA 1XDWA 4O59O 3WTBA 3KTDA 2ZQZA 1CJCA 4NU6A 3L6EA 2WD7B 3ASVA 3OA0A 3ZV6A 4CL3A 4KDEA 4ZJUA 1PWXA 2PGJA 5DBIA 4HX5A 5LDHA 1A7AA 4ROSA 5DZSA 1K2WA 3NT5A 2IYOA 3H9QA 5KKAA 2IYPA 3IQDB 2HU2A 4OOFA 2O3UA 4ZHSA 5KIAA 1Y9AA 1YXMA 4JJGA 2QW8A 4AJ2A 3C7CB 1HZZA 4IXTA 3VDRA 3PDJA 4OOEA 3W8FA 1XSEA 4KTVE 2ZTVA 3ZNQA 3SBOA 2H5LA 1EVYA 4R1SA 3A14A 1AGNA 2Z1NA 1MP0A 1KYQA 3Q11A 3VH3A 3HUDA 2W2LD 1PJTA 3SXPA 1AUPA 3UAGA 3WWYA 1V6AA 2ZCUA 1GUFA 4XGNA 3OQBA 1IHXA 5G0WA 5LCXA 4DREA 1RYDA 1M75A 1B7GO 3WSWA 4D43A 3O8QB 3RJ5A 3H8VA 1PGNA 2JKVA 1Q0LA 3DQPA 4IJVA 1PZEA 3KYCA 3FR8A 4XQ9A 4DLLA 1Q0QA 2P5UA 2Y1CA 4DBVO 3RFVA 3QV1A 3AUSA 4FR5A 1F8FA 3GDOA 4FFOA 4OIMA 4E2WA 3I4CA 2ZIZA 1GYPA 3MCVA 2GLXA 4NIMA 4R5HA 1PSDA 3EVNA 3U3XA 4RPJA 1BTOA 1QP8A 5A9SB 1P0FA 3OJOA 3OIGA 3G0OA 2FZWA 2PZLA 2V6MA 4YBZA 4YVFA 4G81A 1NTOA 3O4RA 3WMWA 4RZHA 1N1GA 2OUIA 3FWZA 3ZNPA 4E33A 1CDOA 1O6ZA 4RF4A 3DHNA 1PJ2A 5CFZA 3Q3CA 1Y8QA 4JP2A 5DOZA 4DLBA 1PIWA 4A10A 2Q45A 2YY7A 3EY4A 1LQTA 1GTMA 3OFSA 5I9MA 3QA9A 4L9RA 4LVCA 2VOJA 2NADA 1R4MA 5U1PA 4CLEA 4CLXA 1PZFA 3WWZA 1EDZA 1NXQA 1HE5A 3KB6A 1D1TA 4IJUA 1M67A 2R6JA 2WJPA 4R1UA 4BGIA 1ONPA 5DT9A 4YACA 1P31A 3RC1A 1IPFA 5DNAA 4BKRA 2PGDA 1KEVA 3LQFA 3G17A 1VI2A 1ZKMA 3H6KA 1LNQA 1GY8A 3VH1A 1E3JA 1U28A 3A28A 3M2PA 2GZ1A 1PU2A 4O6VA 5TQVA 4XRGA 2GUGA 2NV6A 3UN1A 5JAZA 2V6GA 3LF1A 5F5NA 1GV0A 3BMNA 4YXFA 2Q2VA 2HMWA 4WLVA 2TMGA 3E8XA 4L4SA 1E3EA 5I9NA 2EP5A 3E5MA 5BT9A 4ND4A 3S1LA 2ZB8A 5BNTA 4JROA 4I9HA 2H9IA 2E37A 1VC2A 2NWQA 3GVHA 3JQ8A 3VKVA 4F6CA 1K5HA 5JXWA 2RBEA 2B5VA 2GN4A 2J5RA 1IB6A 4MKRA 5HWSA 4IM7A 1E0DA 3LC7O 4NMHA 1XKQA 3MEQA 3AM3A 3K92A 4DXHA 3NT2A 2HSDA 4L8VA 4A03A 2DBRA 1EQUA 1LX6A 1UAYA 3ONEA 1ZUD1 1ZK3A 3TDKA 1IYZA 3P2OA 4BUCA 4R01A 4BNTA 3WR5A 3ITDA 3GGPA 3PXXA 2PGLA 4XYEA 5ER6A 5HS4A 1CQIA 3RUIA 4ALIA 1CQJA 1P74A 3ETEA 3IJPA 5TF4A 3NDRA 2ILTA 2WSBA 4U5QA 4TVBA 1KY4A 2DFDA 4EUHA 3UH1A 3I83A 4CLOB 1LQUA 1N9GA 2I67A 2F1KA 3MJVA 2GN9A 4KMSA 2BGKA 1W6UA 4BNNA 4IIUA 5TSDA 3NGXA 1E6EA 4F46A 1GCUA 5T5QA 1GZ4A 3WQQA 4RF2A 3JD4A
chains in the Genus database with same CATH superfamily
3CX6A 2YWHA 4RKFA 4S1NA 1DIRA 2Y1KA 3QFHA 1WW2A 1R50A 3QE2A 3I9MA 2G8NA 521PA 1KQFA 3NDBB 3IX7A 1XU9A 2BN4A 2RH5A 3VYVA 1T9DA 4HXYA 2I7CA 4RPKA 1WDMA 2ZPTX 2PYDA 5CG2A 1DAGA 1UIMA 4ED9A 3M1LA 5BUSA 1ULUA 5IFLA 5GJCA 3CPEA 1FPMA 2BR3A 4FQ7A 3UPUA 3LJKA 2QOEA 2H0AA 2ZI9A 5GQSA 3ICCA 3K16A 3Q8KA 1K6XA 1HDZA 1UPTA 5JZVA 1M9NA 2IF2A 5KAMA 4EY7A 2IPMA 2JGDA 2Y93A 1GQFA 1ZINA 3PYLA 4AVYA 4E3ZA 2J6HA 1NBMD 4PRLA 3DM5A 3RTGA 1NJ1A 2AR7A 3GD5A 1LDBA 4AXXA 3ZHSA 2B5OA 3GRRA 4KRFA 4L5YA 3PWSA 2GM3A 2COEA 1R16A 2AFIE 3VGPA 4KIUA 3K6SB 3R8CA 2P9TA 4ICIA 2VPXA 5BORA 4RTSA 2CD9A 5CEEA 5CVJA 4UM9D 4QOGA 3STTA 4ZIRB 4P81A 1W4BA 2WMDA 1ADCA 1YR6A 2J3KA 4KVZA 2O1SA 4X71A 1C1DA 3ZWNA 1TVEA 3H8WA 5ALIA 1VB5A 3EVAA 4JT4A 5B3LA 2AHRA 1ISGA 2VDQB 2GA9A 5LQDA 2GB4A 2MYUA 4NSNA 5LZ9A 1KC1A 3M4JA 1LPOA 3GP5A 3HXPA 3JQAD 3O0DA 3EXHC 4RY2A 4BTVA 1FNSA 1HLDA 2ZB2A 3KKEA 4GG1A 3T1OA 3UKJA 4IHJA 1J9EA 3OICA 4OMFG 2QZ9A 2J32A 1CY7A 1P2FA 2Q5JA 3HU1A 3INGA 3G5UA 5TV2A 5HX7A 3WWDA 1AMNA 3WDMA 3EXIA 4XB2A 3TE6A 2XTNA 2Y1XA 2FDXA 5CW2A 4DJAA 3A3OA 2VRNA 1DCMA 1Z5ZA 1F8GA 3EDCA 1IXZA 2HJHA 3ZC3A 3AVUA 1X2EA 3KZCA 1B4DA 4PXSA 1G42A 2G36A 3ZUPA 2D3TA 1P2SA 2YW2A 3LMKA 4WESB 1BG6A 1NBWB 4ZCPA 2QUBA 1UXOA 1N36B 1OYOA 2CC2A 2BL4A 1TQ6A 4G5RA 4ZOEA 4RW0A 1R0SA 5A5GA 2GOYA 3EXAA 3A36A 4RACA 1X80A 3E1GA 4MV6A 5TS2A 4D8VA 7REQB 5L7WA 4Z0HO 2IOHA 1IK6A 1H94A 3PSAA 4UC0A 1X70A 4JUDX 3QNWA 3DMPA 5TS3A 1P7VA 1OHHD 4AKTA 3OJEA 4UTVA 4CTMA 1PGOA 1IMJA 3CUVA 4POOA 1UMBA 4RWZA 1DINA 3BF8A 3AHGA 4KVGA 3PC8A 5EMJA 2Q6TA 1MNAA 3LCVB 1DP4A 1SD5A 3HKBB 3VPGA 3S3TA 1ZWLA 4WBNB 1F14A 1CV2A 1V71A 2HD4A 2O2XA 4TZTA 3AU8A 3AJ8A 3U7RA 1PFGA 4EHJA 4AI6A 5JTUA 2QX6A 3AU9A 2LE0A 4ADSG 3JAMA 2YRFA 3EQ9A 2W6JD 4NDZA 4BNHA 3F71A 2B82A 3F9CA 2IE0A 3FUUA 3MS7A 2OXFA 1JU3A 2Z3WA 5DSTA 1CXZA 4HH0A 4Z4IA 1KRXA 1I6KA 5CMLA 2D06A 2FTKE 5ECWA 1RXEA 4G3XA 1F06A 4LPSA 1Q0UA 4ROTA 4FZ5A 2GVZC 4IS3A 4NV1A 3E9YA 4EJSA 5KJ1A 4O0LA 1Y8AA 4CODB 3IOYA 3CLKA 2C8LA 3UYKA 3ZDQA 1T3GA 3B51X 3CEAA 2JCSA 1U2ZA 1Z0JA 2ODEA 2C7PA 1Z06A 3D6FA 2YQZA 5HRAA 1HYGA 3BWBA 2BMFA 3I6YA 1LBTA 3D8TA 3EBPA 5BY2A 5MDHA 1MH1A 4R1MA 3GT3A 1FDTA 4QKQA 2PWYA 4OQMA 3OE7A 1RMYA 5EXPA 4OIFA 3PXGA 5HP4A 3U4AA 3GT7A 2N42A 1IHYA 5HUQA 1J0AA 2YW9A 3P96A 5DHTA 3BMQA 3DE7X 2XLBA 4JB0A 5ALLA 3FDFA 2OGUA 2IYUA 3ENVA 4RELA 2IZ5A 2ZS9A 1FFWA 1M33A 1Q0PA 2A0YA 2ORYA 4JOCA 5K3FB 1NI4A 3H3FA 1C4WA 1DDOA 2DWUA 2GTHA 3WYAA 5L9AA 1IB0A 2ECOA 2JGJA 3F3SA 1XCLA 2ZIWB 4IICA 4F8EA 1XDSA 5KU7A 1UZMA 2BKUA 3GARA 3VX3A 1M2KA 4LWZA 1XPUA 1QE5A 5JRDS 1CQXA 5I7SA 3K1ZA 4MA5A 4ENWA 5C4GB 3OOWA 3OKFA 3ZGNA 1DJLA 3ETJA 5C34B 4PZCA 2BVNA 4LHVA 2DLDA 3AFMA 2YV2A 3N87A 1PGJA 4YONB 4ZVQA 3WGIA 2WP8J 5IZCC 3DMTC 1M3SA 2I2DA 3ED5A 1M1XB 4S3MA 2AMFA 4PS1A 3ZQUA 3FGPA 2CLFB 2FW7A 3K8ZA 3B70A 3MB5A 1DBIA 1ZD5A 2Q5EA 1VE5A 3QVKA 4D0RA 5JJ5A 2VP9A 3FMPB 1HKHA 1SIOA 4J7XA 3A2LA 3T7DA 4ND8A 5ITZA 3BKWA 4ODIA 3TQTA 2O14A 3B6MA 5C7OO 4O4JA 4EMBA 4F84A 1OWLA 3ICQB 3H1GA 1EE2A 4I5GA 5CB8A 1O4VA 4D5EA 2CL7X 2FPWA 2ZSUA 3FSRA 2GO1A 2ZUVA 3IKMB 3KPVA 3N5KA 1KPIA 4FR0A 4TLBA 4DUGD 3WFJA 4M53A 1PQ4A 4O4LA 2HIHA 1P9LA 1GL9B 1Q0SA 2DPHA 1UBMS 1SCNE 1SIWA 1ZGCA 3SHTA 1TA0A 1FSPA 1YQTA 3EUAA 1BA3A 2JRCA 4FONA 2NZ8A 3IKLA 1UKVY 1ACLA 2AT1A 3EZFA 1DQYA 2BEUB 3NYWA 3R5TA 4KXUA 1H1LA 1L2TA 3F49S 2QN7A 4X1YB 4KO1S 4X44A 4BATA 5LD2B 1T9CA 3LPAA 3VZQA 5KHOC 2A59A 3SF8B 5LLDA 1AHNA 1S8FA 2F9MA 2JCBA 1W0KA 5JZSA 1RP1A 2Z3VA 5GJVC 2O7QA 3PQ8A 1GNTA 4LJ9A 5B3AA 1YGPA 3RCBA 5IRCD 3DLBA 1QH1A 4WCFC 2N3ZA 3B2NA 1LTHR 3KSBC 3M6MD 1H4TA 1P7YA 1XLTC 5BR7A 4DA4A 1KQNA 5FWXA 5K4HA 3ROXA 1DJPA 5ES3A 2CN1A 5C7YA 4Q3OA 2OL4A 1XHLA 1E4EB 1U11A 3RAJA 1EDBA 3TEMA 3WICA 2EX0A 1L4KA 2I7XA 3KIPA 3P5BA 3M9WA 1FBTA 1A50B 4JJ8A 5EHXA 3AEKA 4NBUA 1HQCA 3DE2X 4MQFB 4X54A 3P9RA 3V8QA 5HQTA 4XFKA 3ZGZA 4MVJP 4IDGA 4C3ZA 2RHRA 2QLNA 1EXDA 3ODGA 2FSVA 2QR3A 3BE6A 3HXLA 2QSUA 3BMOA 4UHDA 1M6EX 2ZR7A 3WIBA 4B48A 1MKYA 2EIXA 4C6RA 2JZCA 1PN3A 5BV0A 3AB8A 3CUYA 1RYZA 1B16A 2NTEA 3FZNA 3D8BA 3HP1A 2P4HX 1N78A 4RQUA 1ZGZA 1JDTA 1N34B 3ZEIA 3KSAC 2FF7A 5JTTA 4OSPA 4F9TA 1JYEA 1USVA 1JKXA 2A9VA 4HATA 2C9CA 4KGVA 4L5BA 5EA2A 3JD2A 5AVJA 2ZI6A 1K8YB 1JKFA 3B38A 5IZCA 3IOEA 1U3VA 2ASEA 2I1QA 4TTQA 3W5HA 4P7KA 2COUA 1E1CA 4URFA 4AU1A 4E5KA 2ODTX 2JHPA 2PD3A 2B37A 3THXB 2VQEB 3GLGA 5CM9C 2GFIA 4TKZA 1UPCA 4DZRA 3Q5DA 4BNXA 3N2LA 4GR4A 2DM6A 1OLUB 4ZCRA 2I91A 2UZ4A 3Q85A 4UDNA 4TV8B 1YFJA 1EVIA 4DMCA 3SC4A 1TO1E 2CMFA 2UZIR 4WLFA 1I3KA 5EZSA 3CUUA 4JXZA 4CMGA 1BE1A 1LDYA 1C7QA 4PQYA 1PYDA 4FU0A 4B6QA 2HF2A 4EFMA 3NALA 1EKXA 1NRJB 1O7JA 2J1LA 5KOIA 1GZVA 1XKLA 5DYWA 2AYZA 4BLQA 1Z4IA 1IHPA 4JYCA 4XWOA 1T24A 5IK2D 5JIBA 1IAQA 2X41A 1G16A 1VJDA 3MF4A 1KYWA 4JI8B 4DUYB 4PLPA 2V74B 5JPCA 3FCXA 3R7AA 4GGOA 1CZOA 1Q91A 3U40A 4JX8A 2CUZA 1JT2A 4WCFA 2PQMA 3W3ZB 2ZJ8A 4CIVA 2G9ZA 4ZOQI 3GUHA 3WGUA 3PWZA 4FMCB 4YRGA 1KH3A 1CUXA 3KZMA 3AIKA 5HKOA 3TLXA 1D9XA 3WYFA 1XQXA 2GFQA 4XQEA 2RAVA 1KDOA 1I7PA 1QG0A 4GHWA 2EGHA 1DC3A 4Q02A 4Z3OA 4NC9A 3PLNA 1Q7GA 2Z9CA 2BZ1A 1U2RA 3C70A 5EERA 3IS3A 1KK2A 5EMLA 4EQZA 2QN6A 1QTQA 2Q5OA 2BCEA 1CETA 3A0UA 4NCJA 4FIZA 5I4BA 3F3MA 3KL2A 4Y7DA 1ZIDA 1H5UA 4EUNA 5FFNA 3ZHXA 4EA8A 2KBFA 1MHTA 3CE6A 2ZP1A 3FVVA 2O9JA 2YNMD 4K9KA 4G0UA 5LQMA 4CMJA 5PGMA 3SS7X 1H4SA 5JARA 4FHDA 4FXOA 4IG9A 3QPUA 1L5HB 1G5FA 3GHHA 3N7AA 1E5TA 4BBZA 3VOAA 2PAFA 3JATA 2JCVA 2HPVA 4ETWA 4EOGA 5J4LA 2J3HA 1BRTA 1NUQA 1G20E 3UTCA 1FU8A 4G41A 3K6KA 1L3BA 4TKVA 1UFQA 3H2BA 4R2LA 1JHQA 3E8MA 5J3JA 4NFHA 2JIZA 3PPYA 4ZGBA 1A9SA 1GUYA 1JA0A 3N0WA 4L15A 1Z6XA 4ZTUB 1XFDA 3LZ6A 4TL7A 1ISSA 4GVLA 4CKCA 4DVGA 3D4NA 4GXRA 2QRGA 4B8YA 1RPNA 4FEAA 3EVTA 2CFRA 4MV5A 4GWKA 3C41J 2GBLC 3WYCA 3JYOA 1HDGO 4QPCA 2HZBA 2NVWA 4IG4A 4U7JA 2LR0A 3NWEA 4DXAA 2QRQA 3FNRA 3I1IA 3I92A 4ZYYA 1EFRA 4P3OA 4C06A 3T5MA 3KJGA 1U2SA 3GN1A 2JAXA 1DXYA 1X2BA 3NX4A 4NPCA 1ZI9A 5AM5A 3IMCA 1KI9A 1PLLA 1S1CA 3E9ZA 1OX4B 4I1IA 1PZGA 1P1HA 4U3JA 3RS9A 3LHIA 2LXNA 3A26A 2QNIA 2I34A 4DWJA 3CVXA 2ODNA 5FEUA 1F4VA 2HSZA 4PX5A 3V48A 3ELYA 2YTZA 1DUIA 2CUKA 4O4HA 2F8SA 4N3GA 1E3LA 2XMBA 1DV1A 5JBNA 1N7JA 2ZUBA 3PIRA 2WQZA 4ABYA 3E3OA 1THZA 2AKAB 1O95C 2QM7A 1VKJA 3JQ9C 1IPHA 1SC1A 2E7ZA 1OX5A 4QL3A 4UHFA 1COZA 3K0HA 1JR3E 1X15A 3H2KA 3JQGA 4H3HB 3N2GA 3ZWOA 1G21B 5LXTA 2OV8A 3CUSA 1U81A 2IF0A 1B41A 1AA6A 4REMA 5DLDA 1L7AA 1KI3A 4YXWA 3W9UA 2EEPA 3NT4A 3NUGA 1JL3A 1URPA 3WZ2A 3VAYA 1SOUA 4KHZA 3GRFA 3ZWXA 4BDTA 1B8UA 2Q1YA 5B7QA 5H4GA 3RNOA 1QK3A 3D4IA 3VR3A 3DW1X 3LM8A 4H7FA 4BFXA 3SHVA 2HBZA 3L46A 1IQUA 4IIVA 1T29A 1PG0A 2WVGA 3DONA 4RDHA 2IUYA 4FYIA 2EQAA 5HDBB 4JELA 2UVQA 1H3NA 1JJ7A 4WLEA 2XNDD 2NVUB 5HUHA 3N5CA 2NU6A 1B6TA 1SVWA 3QFCA 4S1OA 2QAGC 3PX3A 2OSBA 4Z1MD 3A1TA 3IVCA 3B53X 4RNDB 2QZZA 1U0TA 3TW4A 1EVZA 5JHHB 3VQTA 1IEWA 2YJ3A 4TMFA 3FUXA 4KRGA 2WJVA 1AK2A 2EG9A 2ZAIA 5BSGA 5IN4A 2H3EA 4CLRA 1ODSA 4Z0TA 2JGEA 1N2CB 2ZE7A 3ZE2B 1VKHA 4RSRA 1RWQA 3E2PA 3T3MB 3UCXA 3PIIA 4AKSA 3EMBA 5AVQA 3BH0A 2VJOA 5LP6B 4B7UA 1U9IC 1POWA 3KOXA 4N76A 3D6NB 1MUUA 1SBYA 1LD3A 1UMDA 1KMHB 3QWIA 3ZK7A 4P4SB 4AB1A 4BOYA 1NVUQ 2R1VB 4RMHA 5JQGB 1IN7A 1PVVA 2IOQA 4CKBB 3MSCA 3HQ4O 3ZUGA 4F3CA 5KWJA 1MJNA 4L8GA 5IULC 1DC6A 2RHWA 3ILYA 1OA1A 4U2BA 4DZTA 2FW1A 3OFKA 2X6QA 2Y1GA 5CFPA 4UQLA 2V4MA 2FPKA 1GSOA 4E51A 2K7ZA 4E2YA 1FZQA 1PJCA 4LMRA 4QUEA 3ZNOA 1QAQA 4UCFA 2OZEA 3BWEA 2WFZA 4C2BA 4DC9A 5IJ9A 3C3BA 4EYSA 3CEJA 5IVKA 3PZRA 3FRJA 2OA0A 1ZOOA 1EZ1A 4YRJA 1JJBA 5JAPA 2X0RA 4X91A 3RLFA 3UMYA 3N1UA 2H1CA 1V3QE 1WXHA 2QJTA 3OTWA 4P36A 4YR7A 1PBTA 5TGZA 1R4NB 4EW1A 3DE1X 1F38A 3SQNA 2E9SA 3BTOA 2BCGY 2FMUA 1RQRA 3IYLW 2V1UA 4KC0A 3MYYA 1ABBA 4DRXB 1FIUA 1Y89A 1PI3A 3PX2A 3UXYA 4ASUD 1E1QA 1L5OA 1SUIA 2IE8A 4BNGA 1KY3A 1ZJ5A 1JH8A 5JS6A 2IEAA 2ZBGA 4NFSA 4UBMA 3EEYA 4GSYA 2OBNA 3BXPA 3AK4A 5J1SB 2WKSA 4B3FX 2WIBA 2FXVA 2V6IA 4I36A 4EG3A 3EHDA 2FFBA 1H5QA 1S2IA 4IIEA 5LBUA 4XQ0A 2ZTMA 3DVAB 3NBQA 3MAJA 2GKSA 4US0R 4BZWA 4EPXA 3B3JA 4YV7A 2ZT7A 1VLLA 5AQ1A 3WMXA 3N2EA 1JEDA 1ZIOA 2R7LA 4ALLA 5M2QA 4ZALA 2NSLA 1QHNA 5LYJF 3OO0A 4UMVA 4FCWA 1B26A 1ZW6A 3E9CA 2WB4A 1F60A 1Z7GA 5SY6A 1ETHA 3I45A 4UVIA 1DHTA 2PA0A 3KWMA 2EDAA 4BNFA 3T1QA 5JD5A 1Y9DA 2VHYA 3P9PA 4LHYA 2BEVA 4RXTA 5TMEA 1MO6A 3X2FA 4Q9LA 4DJFC 2PKQP 4ZMRA 2VQSA 2BFAA 5IVIA 4X1KA 1ZL0A 2II6A 2IYWA 2YFQA 1RADA 3N75A 3ZE7A 3F9RA 2EL7A 3DDCA 1KQOA 1N1EA 1BE8A 4U6NA 3O83A 3G0BA 2ZKLA 3ORYA 4GMGA 4NQZA 4UEQA 1BJRE 1L5YA 4WGFA 3WA6A 4P0TA 4HGRA 3N39C 2E2WA 1WCXA 4GE0A 1W5SA 5EJAA 2DWQA 2QQ5A 2HO5A 2N47A 3QVUA 2PNJA 1X0VA 1ZAKA 2IYZA 5DTIA 5GVSA 5C51B 3ADOA 2XXAB 4HRYA 3NYQA 4HRXA 3UCFA 3P32A 4BLRA 4UOZA 3MTGA 5FTLA 4CEJB 1LV8A 4RM3A 4N6NA 4EQ6A 4HS9A 1OTXA 1SJ9A 1GGKA 2Q41A 3JASA 3NRCA 4R8VA 3T15A 2J30A 3ANNA 1KMNA 5AJXA 5ENZA 1NMZA 4HEHA 4KN5A 1W1WA 5F2KA 3PJRA 1U3UA 1N9ZA 1QG2A 3E7FA 4W5QA 1YV9A 3A6GA 4EMTA 1K68A 2PMBA 2E4XA 4QOEA 3JZDA 3D6TB 3MBIA 3LV8A 4KCGA 3JAWA 3STXA 4M6WB 5IJAA 5LL6P 3M3PA 4ECEA 4H08A 3AEUB 3IE0A 7ADHA 2WV9A 5A71A 3CNLA 3FD8A 4GFDA 2GCPA 4FMDF 1Q1BA 3VSEA 4YDHB 3GLFA 5CPFA 5C80A 1H0HA 3UWSA 2MDTA 4DV2B 2VJMA 1FP4A 2XE8A 4R0NA 4XCVA 2B4YA 3MWLA 4D44A 3N76A 1HL3A 1EZZA 3AY6A 2RMKA 3GFGA 1YR3A 1ISPA 1U0FA 3DXYA 2HCTA 2AOTA 4KXNA 1I32A 3EAGA 2Q1SA 5BVGA 5HGJA 3VJRA 3ZGXA 2WSLA 1ZGJA 4RVNA 4Q9IA 2WZQA 2BEWB 3KVRA 2Z8XA 2ZI3A 4OP1A 4QJBA 4MEJA 5BSVA 4JR0A 2CHEA 2BKAA 1MENA 2R6GA 4OJTA 4LY9A 4EK9A 4A9AA 2J7PA 1E18A 2KJQA 4NV3A 3GLVA 3LVFO 5ARDA 1Y4ZA 1V45E 1GZ3A 1NF3A 1X14A 2A4MA 3QI2A 4P58A 1CY0A 3A31A 2WUEA 4E08A 4H0CA 2HPZA 2K2WA 1U0LA 5ALSA 5HRCA 3LYUA 3QPVA 1MB9A 4QRHA 2A8YA 4WFKA 1WD7A 4J8PA 3Q72A 4P22A 4HTFB 4TXJA 4PIMA 4ZEWA 3AR5A 2C5LA 1UBRS 2GM4A 2OCYC 4P0PB 5AK0A 5FUBA 2NNLD 2FPSA 3CU5A 5B2EA 4DCMA 2CHUA 4V1CB 3DDOA 1OVGA 4N39A 3M6WA 3RHSA 2ZYRA 4XWKA 1EXVA 4U2DA 1C8KA 4ER3A 3WQRA 2RHCA 4BNUA 3P9KA 1FQOA 5ECYA 4YT8A 2LIVA 3I2KA 3T5PA 1E2NA 3JVUA 2HWXA 3L0BA 3OCYA 4WLNA 4D4MA 1V43A 4DB4A 3S5JA 1C3JA 4QOFA 2V5VA 4HWRA 4A1OA 4GW3A 4ILEA 3IUNA 4IZIA 4WXHA 3AXTA 3TMKA 1QANA 2WTBA 3LY7A 1Y1LA 2LPMA 1EJ6A 4N0MA 4Q4HA 2ZJ3A 3A32A 4PXYA 2FN4A 4ZOBA 2V03A 4IIJF 4Z7NB 3DOUA 5CFLA 2P4EA 5ICSA 1S7GA 1PT7A 1I9CA 1R5BA 3E2IA 4D45A 1C1YA 4NKRA 5SYMA 2BFWA 1DTEA 3J80A 4DV3B 2ECPA 1U80A 3DEKA 4J1NA 3FBWA 2QIOA 2A5JA 3PGKA 3OWHA 2JJ1A 3C3MA 1TE2A 3PHGA 2OHFA 1NIPA 2A1IA 2R6DA 2ZR8A 1ZU5A 4FE4A 4ME6A 1BW9B 3OPVA 5EEGA 3MXOA 5HKKD 1KVTA 1TFUA 3QPDA 1F8UA 2H52A 1L6RA 3WP1B 5JCPA 4L2IB 1B8OA 2D2VA 2RH8A 2AR9A 4CIDA 4EF4A 5ALXA 4Y2YA 5EXSA 1T8WA 4DMHA 1QVRA 3GJ7A 4MW2A 4PAWA 3RAPR 3FB1A 3AY7A 4WASA 2PX4A 1R8XA 3H16A 2I62A 3CNNA 5B1IA 3U1TA 3NRBA 1I5OA 2G9RA 3R7BA 2ZJ0A 1JJIA 4R0MA 3SICE 5BSFA 3FYTA 3LTNC 1PTJC 2ICAA 3T7RA 5B12A 1WQ4A 1WRBA 1W73A 5LDDC 4NBNA 3JY6A 3EFOA 2ZDGA 3PU6A 3UCEA 1NQVA 3DMYA 3GDHA 3P1JA 4MS1A 4ZWNA 3L7BA 3D1JA 3LF2A 1A9ZA 2I4LA 3E0XA 5ALMA 1TC2A 2GDZA 1UP6A 2A5FA 2JBAA 2ZAGA 4CZ2A 2IS6A 1T35A 3A6ZA 3K4PA 4LOLA 3TW6A 1PT6A 2BMEA 2Z98A 2X42A 5GZ6A 4PHCA 2HMVA 4LF4B 3MW8A 4TMTA 5BQ5A 1TJ3A 3ZWQA 1CYDA 3KEFA 1QE3A 13PKA 1TCBA 4J29A 3HKDB 4F56A 1I2ZA 1EZ4A 5JSZA 1WXIA 3FMGA 1P39A 2AJTA 3OD5A 4OAPA 4PHHA 1CK4A 4CM3A 2XNHA 5K0GA 1O6BA 1GXSB 2HAEA 2I66A 4LDZA 4WK0B 3Q88A 2HRDA 2GTPA 1LK0A 1UK6A 3PXBA 5SYNA 3OM0A 1E0KA 3OLXA 4B6GA 3B3FA 2WQ7A 1B0PA 2OD7A 4BKPA 2JVJA 4XOUA 3QXCA 4YQEA 4GRIA 1G59A 1RM5A 1R0RE 1SWVA 3NTOA 4FDTA 1ZZGA 3DEHA 4UTZA 3ZWDA 5IYZB 2HR1A 3NEAA 3QIAA 4Q34A 2PBRA 2XVZA 1JF8A 2BFDB 2PRSA 4NHOA 4NF2A 4MCJA 1WB9A 2YN2A 4LZNA 2Q2QA 1FTSA 3Q7SA 4LXIA 1H8ED 1YHNA 3U0VA 5AVSA 5CIQA 2BHNA 3NDJA 2P4UA 3CKKA 5CXSA 4QPNA 2GK4A 5DYIA 3Q6IA 3SVLA 4YWHA 3FLAA 2EYQA 5BNFA 2YVQA 4WOJA 3B1VA 3TM5A 3HL0A 4N4AA 3U3MA 4OHZA 1F2UA 1LUAA 5BW5A 9LDTA 4D25A 1JFFA 3GGCA 2FH5B 5EIFA 1AUOA 3F78A 4KBFA 4GLJA 5JZOA 1A69A 3CW2A 1SBTA 221PA 4HWSA 2RI0A 2WILA 3EGVA 4RM2A 1C4XA 1JDJA 2NACA 5CDUA 1EM8B 2IXTA 1UZLA 1PTJA 4A0GA 3TLYA 1SPBS 5L6LB 2FCAA 1TEHA 1QHHA 3C6BA 3HUUA 5G4LA 3GIWA 4XIJA 4LJ4A 3TRIA 2PS0A 2H0QA 4A23A 1SC9A 3WKCA 4F6LA 4B87A 3K35A 4PN3A 1L3CA 1CNEA 4YB8A 5BN3A 5EYPA 4EO7A 2Y71A 4NS1A 2JLUA 1ZM3A 3GLTA 3DBRB 5AK5A 3E58A 4DMMA 2Q99A 1JT9A 5IDXA 4TUYF 4X20B 5DTRA 2IYNA 3KJQA 5F51A 3U9SA 2F3SA 4R2MA 5DCYA 3BK7A 1QG6A 5J2TF 1DQSA 1N8SA 4EUSA 2EGGA 1XZHA 3EMVA 2H17A 3HYNA 3NIBA 3QKSA 4PQRA 1V2HE 3MIZA 3SEAA 5HPYB 2EV9A 1WV1A 2GCGA 3HY4A 3DEFA 4JUBA 5CDFE 3KYIB 3WRVA 3GR6A 1DAIA 5EZYA 3WBFA 3UWKA 1CRQA 3OU7A 3WLRA 1FS6A 3OJWA 4E5UA 2Z1DA 2B8WA 4UXIA 5AVZA 4OX9B 3V6LA 5I9LA 1F9AA 2MT9A 3K9LA 2ZIAA 1I14A 4UTXA 4WLOA 1VMAA 3CH7A 4BVFA 5IJZA 5LA6F 5FX2A 3PPXA 5JXGA 3DL4A 1BN6A 1D2GA 1ZO8A 3QW2A 1T9KA 2I03A 2HEIA 1TW3A 3OKPA 3T1VA 3WNVA 1YB5A 4NECA 4AYXA 3O82A 3B9QA 1YZVA 2QHXA 3KOMA 4R05A 1FVXA 1OOEA 1YMQA 2QN3A 5CCXA 3BSYA 2FFJA 1E1RA 1UUFA 3I1JA 4JA2A 5D85A 3ND5A 4FZ3A 4HLNA 2CV0A 3ACDA 4LFCB 1ZIYA 5FHQA 1P4SA 2INGX 3H2SA 1J39A 1WLYA 3AB7A 3NBXX 2WHEA 5CLLA 2ZBUA 3C3PA 3EZGA 4IDHA 5DRYA 4C0BA 5KQLA 1XP5A 2ONYA 3A04A 2APJA 4N3BA 1T9BA 4XJSA 2XKAA 3DR5A 3PI7A 4ZODA 3VTKA 4EKGA 2AVNA 2Z8ZA 3LO5A 4F1JA 3B2EA 5K0SA 2LUOA 1NDUA 1U8FO 1GV1A 5C7LO 5CJJA 1E3IA 2XUHA 4RCVA 2NXWA 1RJ9B 1UDAA 1WMBA 1YU6A 3NP7A 4M49A 2F9FA 4RAQA 1Z0UA 4MICA 1W48A 3NJ4A 4GDMA 1K88A 4MDYA 1WDWB 1T3HA 3BSFA 5JMWA 4BNDB 3NHRA 4YEDA 1OLOA 5B37A 1YACA 4B3MB 1LWOA 2LVBA 2IS1A 2OPBA 5TC4A 3CTPA 1Y6ZA 1IM2A 3A6FA 2YX1A 3IO3A 4LUCA 4DILA 2ZWPA 5JANA 1W8DA 5JAUA 2YV3A 1MIOA 2QTTA 3IO5A 4F5YA 1JWAB 4MR9A 2OO3A 1U0OC 2FN3A 1DLIA 2BDTA 3QQPA 5E4FA 2I6XA 4KG7A 4PYQA 3L6UA 1W0JD 5D5PA 3WV5A 1CBUA 2FF5A 2VG8A 4YFYA 2QRVB 2G4CA 2GBGA 3GJYA 5BMVF 3FNHA 3ROMA 4NVRA 4Q48A 1WCYA 1GGMA 3QNMA 4Y1RB 2OKCA 5I01A 3V1UA 1FS4A 1RRKA 1U5AA 1C7IA 3GUUA 4BNKA 1I36A 1X7XA 4IKEA 5A5DA 4IYRA 3ZDAA 4HNRA 1PW5A 1OFHA 3KKKA 4WKOA 5KPDA 4YAUA 3N3BC 4GYJA 4ZVSA 1YD7A 1XLUA 2YS7A 4GX2A 1OLXA 3KEMA 3AKEA 2NU9A 5G0TA 4MRAA 1KZ4A 2MJLA 1SAYA 2JDIA 2C9OA 4AF7A 1EBBA 2A0KA 5A2QA 1XXHA 2ZT5A 4F71A 4AM8A 1W85A 3PCRB 1GD1O 2A5LA 3QIVA 3P97A 2GEUA 1R4MB 1N6OA 5KNBA 4ONEA 4C0WA 3DHYA 4WEOA 2FMTA 1X1SA 4LS3A 2PRIA 4QBIA 1MT3A 3HJBA 1QKJA 4GM4A 3OWXA 5M3BA 1MVLA 3WIEA 2QZ4A 4ENVA 3BGSA 3G23A 4BZXA 1BEZA 3FI0A 1EGAA 2FDRA 4DNOA 1YR2A 5CNJA 4DCVA 1I01A 1SXPA 2IUUA 2NXNA 4B4WA 3EA0A 3ANSA 1RCFA 1UL1X 1YBFA 3VR2D 1P19A 3FDJA 4MR8A 2PEYA 1X7DA 5LFAA 1MAUA 4Y1FA 4U39A 1Z6QA 3NWOA 1K5PA 5CEFA 5IAOA 4RFLA 4XR9A 1RPTA 3Q1KA 2Y3IA 1TB4A 1JHMA 1Y4UA 1TO2E 3LUFA 1S4MA 3TPFA 3WLPA 4EL5A 4Q03A 5BW6B 1T9HA 1N0IA 3BMNB 5GONA 4P7GA 1M2VA 1N1MA 1UOOA 3TH5A 3ENQA 1E64A 1FFDA 2ZDQA 4MCIA 3JQRA 4HXEB 4N5NA 1TCUA 3SSOA 1M6HA 3PCTA 3FTQA 2Q1WA 5CA1F 4PG4A 4CDRA 4IRMA 1DDIA 4REQA 1P5JA 2MSCB 3PKZA 3TQCA 3EVDA 3PGJA 5LNK1 3VSCA 2R3SA 4Q9JA 2ZI5A 3NUZA 3VNQA 2DE0X 3OIYA 4RTOA 3DMFA 4XM1A 5FL7D 4LDQA 5H16A 1XYGA 4IRXA 3BK2A 4MVJG 4OQQA 3I8XA 3OQIA 4H4CA 5HK9A 1Y9JA 2ZUTA 3HWWA 4P2GA 3PC3A 3FKJA 4DQDA 3RYTC 3CX8A 2VJBA 2ZRCA 2WINI 5KJCA 2XCIA 3DKVA 4H7KA 5F3WB 1LW7A 2PJZA 4WXEA 5IM5A 2D1FA 3ND8A 4PINA 4AX4A 3SAJA 2ZAMA 1NR1A 1V5IA 2CLCX 5DGHA 2AI1A 1FX0B 3HRKA 3HP4A 3JX9A 1QQTA 2ZTLA 4G86A 4NZMA 3C43A 3H4IA 3LH5A 5EP1A 4BEBA 3RKUA 1ID8A 5BSEA 2HGZA 2C4HA 4QYWA 3TKYA 3UB4A 3HDHA 4C0KA 2B69A 4QYXA 1XC7A 2HSWA 1OJLA 4A6XA 2VHEA 1IVYA 4B35A 4MB2A 2JKZA 4BNWA 5GOTA 2NUTB 4MI6A 2QJWA 4EFKA 1XVAA 1QUEA 5FPKA 4I1SA 4GF5A 3DLTA 2EXXA 1U9ZA 2GAIA 4EHKA 2CNWD 2DAPA 1HDCA 4MGIR 1FSFA 2P62A 5JVDB 3C4JA 1RYHA 2DKNA 4URVR 1UPBA 2QN8A 1RIIA 3IDFA 3JALB 4GX0A 1BN7A 2QTHA 4V0SA 3A3NA 2BTEA 2JJ2D 3IH5A 1IHOA 2J48A 5DLEA 3HB9A 4L4YA 4AZ3A 4YDSA 1DX9A 1X86B 2JGRA 3C3WA 3EH2A 5E9QA 3RODA 3V4PB 4EB3A 1AB6A 2IPOA 5CJPA 4O29A 5ALFA 2GZAA 4EIWA 5JNTA 1ZN9A 4EG6A 2FJPA 1M6VA 1H2AS 2C03A 3CN9A 3DBOB 3EZ2A 3KR2A 4Q3AA 3T35A 4AO6A 5KTNA 4XLTA 2DUMA 2IYQA 4YJHA 3FNBA 2XDAA 4PG7A 4WSOA 4C29A 1DC7A 2B7CA 2OZVA 2CLEB 4QDKA 1XCJA 3NRJA 2WVJA 1HKUA 2KPOA 4ON9A 4XM2A 5KNDH 3RUEA 1TYEB 2HHHB 2YWFA 3S70A 1JECA 1MDBA 5D5QA 2LDXA 2PQ0A 3KVYA 3OH8A 4Y6RA 4HPJB 2Q3MA 4HMOA 4W7HA 4G63A 5DKFA 1QU3A 3HFRA 4DHEA 3F6YA 3OZCA 5B1HA 1KJJA 2JGDB 4MWOA 3T7IA 4C21A 2VJCA 5C5CA 2QRPA 5DV9A 1NBIA 1L1RA 3WZLA 2FN8A 2ZRAA 4YT4A 1Z8HA 3A7DA 2I78A 4QEKA 1TYBE 1K0FA 3A4TA 1DB3A 4P38A 3WGGA 4IVRA 4QYIB 1WHTB 2EZTA 2QRNA 3MJFA 3V7NA 1EHIA 1JLMA 1T4BA 2PBLA 1VHJA 4OQPA 3ZV4A 4I9NA 5AP9A 1RNLA 3VUEA 2QUHA 4BO3A 1YQWA 1C1DB 3HXTA 1D2MA 2XB8A 4F5ZA 2IU0A 3U4IA 5E0KB 1GNVA 3BK1A 1VLQA 2A35A 1C8BA 2H2IA 3N53A 4XLZA 5FI5A 1Z5GA 4OI1A 2IOYA 5CEJA 1OH8A 4XVRA 5EUBA 1C3EA 3BZWA 1IY1A 3WYEA 4WEQA 2Q3LA 2GASA 1VI5A 2QSYA 4CV0A 1I7QB 1RFGE 1IPEA 1Y1KE 3KQHA 1W4CA 2PFGA 2YBEA 3LX6A 4M86A 3A6PC 3G8DA 1NBEA 4C3OB 2EEZA 2B1QA 2CJFA 2RGUA 3O3CA 1O6CA 1LLDA 4RTLA 2I5PO 2HQRA 2QTFA 3O38A 4L8WB 5C37A 1B23P 2W2KA 2XYQA 3BTSA 2HREA 4RK6A 2QX7A 2G1UA 3GB9A 2XDQA 3IKVA 5EKXA 5A62A 3JZFA 5KU1A 1KPGA 2CL6X 3IHWA 4DQXA 1K8RA 1CUAA 2LKCA 3MS4A 2OCDA 3A9VA 1AIPA 1QV6A 3L05A 2VUIB 3LQ1A 4IXWA 2AC4A 2BFPA 1YDFA 2Q0SA 4ITVA 3RVDA 2G77B 1X80B 1X92A 2FEAA 1UFKA 2OCAA 4FHCA 3GRYA 1WUIS 4EZEA 3ZWBA 5HCIA 4UMDA 4IIXA 5THKA 2OXIA 5E6SA 2D54A 4ZREA 3A1WA 3KSMA 3I61A 2VO1A 2HA4A 3A2KA 1JX6A 3BHMA 3GLUA 3O6VA 3ORSA 4JVNA 3B13B 1UMBB 4B1FA 3T4XA 1RHQA 4F2DA 3GJ8A 1XNGA 2O8NA 5HF6A 5A6SB 3RVSA 5DI3A 5M04A 4OMUA 2WYOA 3H42B 4D3ZA 5IAAA 2XA2A 4ZAXA 1C81A 3DQZA 1FFSA 4ZAGA 3RS0A 2FW6A 4E31A 2G71A 2Q5IA 1D0SA 2JJYA 4DQVA 3I58A 1W4ZA 3PXDA 1SELA 1LFAA 4KFSA 4RORA 3X2EA 1DIOB 1O94D 1TYCA 1OBOA 1YBMA 3DFIA 2WSYB 3BJMA 4X85A 4EGQA 2PZGA 3GFBA 5JWRA 1GAWA 3TINA 2UUAB 2GM9A 3L04A 1NXWA 3EZ9A 2FB9A 2M1ZA 3BGDA 3OPXA 4MARA 3D7LA 3LU1A 3QE4A 4RDIA 3FDZB 3FHJA 3V8VA 4FGKA 2CJPA 2FMIA 4RPHA 1L4MA 1PGPA 1EG2A 2PV7A 1QONA 5AW3A 1E1KA 2IUSA 3TLEA 5IAKA 1NBAA 2DYKA 3AF1A 2CVHA 3AC0A 3DWFA 3IAAA 3EXHB 4HZUA 1EK0A 2Q4OA 5FUYA 2FCRA 4BB5A 4U0KA 3AESA 3HSKA 2BMJA 3A1FA 3C5CA 3X1XA 5BN5B 2ZUUA 1HG1A 4D3DA 1WY7A 2QE6A 4UEJA 1BMFA 3BMQB 3AHCA 4ZYZA 5JS2A 3RVOA 3IBFA 2YKGA 1VL2A 3AP3A 1GFZA 4HB4A 4F1WA 5FPYA 2JZOA 3CLSD 4LWOA 3IFSA 2RGDA 5I8PA 2QW0X 3WDLA 3KDPA 3WAJA 2DCUA 3KTAA 1AGYA 1DAKA 1O9HA 2WJWA 3H9GA 3PUYA 4X8MA 2WUDA 3KRTA 2AFIA 2J9FA 3GUVA 1MX3A 3R6DA 2CVQA 3T7EA 4D9IA 2VLIA 4QDZA 3B6ZA 1XJ0A 2EBFX 1R3UA 3GZNA 4D1YA 2CXSA 2RGCA 1ULSA 5LQKA 2PUAA 5JJKA 4HP8A 1UDRA 1USIA 1S0UA 2IP1A 2P78A 1J00A 2O19A 3E18A 1USUA 4AJ1A 3UF0A 4HQRA 2BFFB 4KE7A 3LZCA 3CCFA 2Q50A 3WKEA 2PX0A 2QV7A 4X64B 2O07A 4PHTA 2VPIA 4HLQB 2D74A 1UP7A 3KDSE 4LYGA 1V8BA 3BHJA 4XIFA 1XXLA 1EB8A 1TVMA 3EPRA 3E4DA 3VH2A 4PF1A 1X39A 1LGYA 2QU8A 2ZWMA 4K9LA 4RFSA 5ERYA 1U1IA 1I5EA 3R5SA 4ZT4A 4QRDA 4LRYA 5GJWC 3GFPA 4KU4A 4ND8B 4R0VA 4A6DA 2V9ZA 4EDFA 2G5TA 3VBEA 5AESA 2XMDA 1XBTA 3I04A 4M55A 4O4JB 1Y6RA 4W9MC 3CUEF 1R6TA 2IV2X 2X0JA 3TOVA 2C2OA 1KGDA 1SBIA 3F5SA 3IQEA 4A6PA 2WNSA 3RREA 2A67A 2X1VA 3TQOA 3I2JA 4QLOA 4BGVA 4OA8A 3IKJA 3O8NA 4O4LB 4A8JA 2ZYUX 3FIJA 1KYTA 2GEVA 2JS7A 2G3YA 4E12A 2GXQA 1N8KA 2X14A 2WICA 4Y7CA 3EVFA 1MX9A 1JQ5A 3KOOA 3P9IA 3WGQA 1I7DA 1RYBA 3MD9A 3V4RA 1L5KA 3UMGA 3EC2A 3S4YA 3WQSB 3VZCA 5DM0A 1PUJA 1H1LB 3GPCA 2REBA 3SF0A 1P0IA 2FMHA 2IHUA 4G1UC 1SFRA 4D9BA 5K3OA 2QQ0A 3A1VA 1I3CA 4MEAA 3RRJA 1Z73A 1P6XA 4C4AA