3C7CB

A structural basis for substrate and stereo selectivity in octopine dehydrogenase (odh-nadh-l-arginine)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
403
structure length
403
Chain Sequence
TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDVKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDGGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for substrate selectivity and stereoselectivity in octopine dehydrogenase from Pecten maximus.
pubmed doi rcsb
molecule keywords Octopine dehydrogenase
source organism Pecten maximus
molecule tags Oxidoreductase
total genus 118
structure length 403
sequence length 403
ec nomenclature ec 1.5.1.11: D-octopine dehydrogenase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3c7cB02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c7cB01
4BO2A 4M89A 2H6EA 3G17A 3FPLA 1Y8RB 1M2WA 4WLOA 2NVBA 1N7HA 3BMNB 3L0DA 4UUPA 5IAAA 2O3SA 2WSBA 3KB6A 2DU8A 4N5MA 1N8KA 4QO7A 1TLTA 1VL6A 4DYVA 4RF5A 5KTKA 2XF8A 1ENOA 2PKRA 2PD3A 4BMVA 1A4IA 1DRWA 3L4BA 4CQLB 5IF3A 1E6WA 1NQOA 1DB3A 4EEZA 1OOEA 2HJSA 3JQFA 3QW2A 1F14A 4FSHA 4LCEA 1UXIA 1U9JA 3HFGA 5JO9A 4NK5A 1HT0A 1SBYA 4ZRMA 2RHRA 4CM9D 1CRWG 2BFOA 5CPFA 5TIIA 5KVVA 4J0EA 4WLEA 3HDYA 1FDSA 4K26A 4DLLA 1K0UA 4JBGA 3WIDA 1XEAA 4XA8A 1Y8QB 5C5IA 3DTYA 3DBRB 5COBA 3I4FA 4QXMA 4XB2A 4YAGA 3JQFC 2X58A 3KZVA 1IE3A 2PZMA 1J6UA 1C0KA 2NTVA 3D3WB 2O3TA 2V7PA 1ADBA 4IJKA 3OIDA 3PGJA 2DUUA 4I9UA 3GEDA 1ENYA 2NVWA 3D4NA 2AQKA 2NUAA 4YJGA 2NQ8A 3DHEA 4CV2A 3JYOA 4IDEA 3ZWXA 3P2YA 1EUZA 1I3KA 1W8DA 1HTBA 3ZHZA 1BTOA 3FCOA 3TSCA 4KDEA 3H9QA 2O50A 4L74A 3ZHYA 2PKQP 4NHEA 1VJTA 3M6IA 4LRTB 1QP8A 3HDJA 4O1MA 4AFNA 1SOVA 3H6KA 3DZHA 3QIVA 2NNLD 1P1IA 5I8ZA 4II3A 5CPBA 3O4RA 1J5PA 1QSGA 3JQ8B 3INTA 4PLYA 1S6YA 1YO6A 2LDXA 2TMGA 3R3JA 2H1SA 4B4UA 3EMKA 3NDRA 3PHJA 1WVGA 4GL4A 5H83A 3DFZA 1M75A 3Q3CA 4EYEA 2ZTUA 3QWIA 1RPNA 4PRKA 1JAYA 4I1IA 4ALJA 4MVJH 3V2HA 3ZWBA 4CM6A 2PY6A 1HSOA 1PR3A 3DBHA 3NKLA 4YEDA 4J2OA 3IIEA 3ONDA 4EZBA 2IEBA 5JCXA 4NBWA 5I9MA 2PLAA 1ML3A 3WBFA 4G65A 5AXDA 1I30A 1TT5A 3GZ4A 4HADA 4H3VA 3UUWA 4E5KA 5KJFA 4B3HA 2O23A 2B0JA 3H4VA 2QYTA 1QLJA 5ER6A 2QYSA 3NDIA 3GN1A 2ZCVA 1ISJA 2O2SA 3TWOA 4OSOA 4CV0A 3RUIA 5JC1A 4ZQFA 2DVMA 3AUTA 3K96A 4O63O 4B4WA 1ZKMA 4JXKA 4LVUA 3NT4A 1YQDA 5KWEA 4CMCA 3B20A 4XQGA 1YDEA 4NDNE 1LEHA 1CIVA 1P31A 2X5OA 4LSMA 1EVIA 4FFOA 1B3BA 3BHIA 3OMLA 4ZGWA 4RL6A 3PYXA 1PJ2A 2ILTA 3KBOA 4M87A 3WSWA 4B7UA 3E9MA 4XGIA 2OP0A 5BSEA 2GDZA 2HMWA 4CPDA 4NJMB 3S55A 5DOZA 3MJVA 4U5QA 5F1PA 3VZSA 2DQ4A 1NPYA 4HWKA 3OJ0A 4BV8A 1LXCA 2FPGA 5IDWA 5JYEA 3O8QB 4EUHA 5G4LA 3GLQA 5H82A 1EDZA 2Q1TA 4RLSA 2VHWA 4CMBA 1U4SA 3K9QO 4E32A 3VH2A 1XSEA 5C7IO 3ETGA 5B37A 4PLHA 4ND1A 2RCYA 3DB2A 2PGDA 4B7XA 4CMJA 2EHDA 2YUTA 3PJFA 4L9RA 1ONPA 3QA9A 4CV1A 3KO8A 4XYGA 1KERA 5F3RA 1ISHA 2VWGA 4FOOA 2WE7A 5TF4A 1PEDA 4A2CA 3GF4A 4MIYA 3VPHA 2JJYA 3HNPA 4HFMA 4YAIA 5I7FA 1X0XA 4RVSA 1Z75A 5BQFA 1X0VA 1QR6A 4RGBA 3ZU3A 2VOEA 4DRYA 3WGOA 1O6ZA 1H2BA 3D5QA 1B2LA 2X7HA 4M8SA 2C7GA 3E03A 3UW3A 3ZU5A 4CJXA 1UZMA 3F6YA 2O48X 2ZB3A 4YAEA 3M1AA 4YJDA 3RC7A 3GC6A 3SBOA 2BMAA 3WFJA 4QSMA 5AXAA 1LLDA 2CDCA 2FR0A 3ZHBA 2VNSA 4PG7A 3AFNA 2Q45A 4L8VA 1ULUA 3WYBA 1T1RA 3ZW8A 2PH5A 1M66A 1VRWA 4MVJP 4ALMA 1VKNA 2GZ3A 3QVSA 4BNFA 4YAJA 4RPKA 1E7MA 1IHXA 4RQTA 3U62A 3Q1LA 3FNEA 4FJ1A 1LDYA 2EGHA 1UP6A 1RWBA 2FMUA 1L7EA 3C7CB 3EW7A 4YJHA 1GZ4A 3AY6A 5KIAA 3IL2A 1DPGA 2VHVA 5KJ1A 8ADHA 3KTDA 4LRSB 3ZWAA 3AM5A 2VN8A 1HLDA 3MEQA 4CMHA 4WE3A 4R69A 3WWYA 3ZU2A 4NPCA 4UVGA 5JY1A 3LT4A 1UAGA 2BGKA 4DYDA 1ISIA 2E37A 3BAZA 4JQCA 2AE1A 1IPFA 4WEQA 3UAGA 4J90A 5CDTA 1Q1NA 2NM0A 3IKVA 1V6AA 2B36A 2Q2QA 1QV6A 1VJ0A 2Z1MA 1E3WA 2W4QA 1TI7A 1C0PA 2VRCA 1H9AA 3NJ8A 1EBFA 4NU6A 2Q46A 1EUDA 3OJFA 3F9IA 3T7EA 5CG2A 1R12A 4CMAA 1PS8A 5L7TA 3FR7A 2F00A 2Z5LA 2EXXA 1Z45A 4H16A 3RWBA 1JWBB 3A1NA 3OBBA 4E5YA 3PZBA 2ZTMA 2G76A 2CSUA 3H2ZA 4E4YA 3UICA 5DCWA 1UAYA 1W0CA 1V3UA 3DZKA 4HKTA 4G2NA 1F17A 5EQDA 1CERA 1DRVA 1C1DA 2IZ0A 2AW5A 1R0KA 4E2XA 3AOGA 4U6SA 3HN2A 1K3TA 1T2DA 2BKAA 1DC4A 2FPPA 1HDCA 5G0SA 4Q39A 3EK2A 1U3WA 5AOVA 4YB8A 1LSUA 3MTJA 3NGXA 1I2BA 4X54A 1P1JA 2UV8A 3DMYA 1QYDA 3KV3O 1WLYA 2EW2A 3CUKA 3NEPX 4OH1A 1IULA 2VZ8A 2X8LA 2HMUA 3DMTC 1PJSA 3KSZO 1KEUA 3K30A 2XOXA 5JNLA 1M76A 1TT7A 4RVHA 4E31A 2C29D 4YBZA 4YRAA 3FPCA 3FTPA 3U09A 2HRBA 3CH6A 4DMLA 1YQXA 1PTJA 1U28A 3ZHXA 3CTMA 1LDNA 3M2PA 4CLOB 4ZQEA 1VE9A 2GUGA 4J3FA 4NIMA 2D2IA 2Y0DA 4TQGA 4YJFB 3G1TA 1Z6ZA 1IB6A 1U3VA 3JQDA 1PGPA 2NU7A 1R4MA 1IZ9A 3FRJA 5F1KA 5G0VA 3E6AA 4BO3A 1SPXA 4PCVA 3I3OA 5HS4A 5I8WA 1AE1A 1N2SA 1I5RA 4MP8A 1P9LA 2NLOA 2UVDA 4ZVVA 3JD4A 4TSKA 4JNKA 4XYEA 3SC6A 4M49A 4PG4A 4CLEA 2EWMA 2Y93A 2ZQZA 1KS9A 2DTXA 3PWKA 3PIDA 3GUCA 4GPD1 5JPIA 2HMSA 1GUYA 3WGYA 2UDPA 4KWHA 1K89A 3EZYA 4OIMA 1EQ2A 1PJ3A 5IN4A 3L07A 4GAEA 2VHYA 5J23A 2J5QA 3K92A 4DIFA 5F21A 2OUIA 3RC1A 3MJEA 3WG9A 2BGLA 4AJNA 4A7PA 1RYDA 1MX3A 3IP3A 3GG2A 5ICSA 4XYMA 2EKLA 4GKBA 2J8ZA 3ANLA 5EERA 3WYEA 2ZQYA 4IY1A 1HDZA 4PZDA 1FK8A 2OL4A 4OAQA 7ADHA 4OL9A 2YJZA 4W82A 5KNLA 4QTZA 3UF0A 2CF5A 1GEGA 1LC0A 4OM8A 1MC5A 4J9VA 4MVJG 1H93A 4BNUA 4CLRA 3DZFA 4FOSA 3VZQA 3GDFA 1NFFA 2D0IA 2FHSA 4ND5A 5U1PA 3JD2A 4KUEA 3UH1A 1F0YA 4QUKA 4Z3DA 1PQPA 1H6AA 4Q3NA 4BKUA 1JLLA 3WTCA 4L75A 3AUAA 4BO5A 1DO8A 2C2YA 2GD1O 4LVCA 5AXCA 1ENPA 2IE0A 3RU9A 1VSVA 1DHTA 2W2LA 4FW8A 4C4OA 1MA0A 3GQVA 2YY7A 4HNGA 4I5EA 5H81A 5IDYA 4BUCA 3N58A 4AJ2A 3DAFA 1CJCA 4JP2A 4Z9FA 3I9NA 3SXPA 1B0AA 1HSZA 3A06A 4BNNA 4BKRA 3S8MA 4YT8A 1MUUA 1N9GA 4HFRA 3T7CA 3BTSA 3ITKA 1U8XX 1XIVA 5JBIA 2PR2A 1E0DA 1NNUA 3GPIA 1Q7GA 3IQDB 4MVJD 1BXZA 3RBVA 1M67A 5JCJD 3ZV6A 4KDFA 2AQHA 3QWBA 5L4SA 1UXHA 4IS3A 3RI3A 1KC1A 1DEHA 3PTZA 4PG6A 5L95A 2F1KA 2WYWA 4NK4A 5CEEA 5TLSA 5JAZA 1LLCA 1S7CA 1C1XA 4AG3A 1NHGA 1YGYA 3R6DA 4RVUA 4ALNA 3I9LA 1U2DA 3EDMA 2PK3A 1E3EA 2FR1A 3GVIA 3I1JA 5TRTA 3JQAD 3M2TA 2DLDA 3D4OA 4BL5A 1DIRA 3W4JA 1Z74A 2WMDA 5I9LA 3DHNA 3H3JA 4OXYA 4XIYA 3HJAA 3ZWPA 4DQUA 3ZNOA 2WD7A 2CF6A 4MDHA 3Q0EA 4FBGA 3PLRA 2D3TA 2GGSA 5JDCC 3TNLA 4CQMD 3C1OA 1R0SA 1O94A 3W8DA 4Z9XA 3PJGA 1HF3A 5DP1A 1P44A 4IGEA 1IHYA 1U7HA 3AOEC 4WUVA 1UP4A 1A9ZA 3RUHA 4R5HA 4CLRB 4YT4A 1VPDA 2D5CA 1P77A 2NU9A 3GNSA 3DBLA 2C2XA 3JV7A 5IFLA 1IOLA 3PHHA 4JLWA 4NFSA 4ZQBA 4XYLA 5AYVA 1PGOA 3QV1A 4RVDA 1WDKA 4DIOA 2ZB7A 5GMOA 5I7VA 4CMEA 2EERA 3OICA 3IJRA 4DBVO 5G4KB 2Y99A 4J4HA 2P9CA 5L53A 1I36A 1KOLA 5LDGA 1CWUA 3UCEA 1A5ZA 4F46A 3ICPA 2C54A 3FWNA 2I65A 2WE8A 4K6FA 4N5LA 4DQVA 4IDDA 4AJHA 5B12A 1KC3A 4CLXA 3UHAA 4D43A 3S2EA 1TEHA 4NFHA 2B35A 4CMEC 4EEXA 4DL9A 4TMFA 4GWGA 2YW9A 2O3JA 3QVWA 1MC4A 2YV3A 3WGZA 3BZUA 4U7WA 1UXGA 2GO1A 2BI7A 5B4VA 3FNGA 3BMNA 4R3NA 4RVFA 3X2FA 4XZ3A 4J7CA 3OECA 4PZEA 3JQ9A 1I2CA 3BYZA 4YRBA 1NAIA 5DBGA 3TZHA 2UUPA 3L9WA 2CVQA 2PA3A 4FFLA 2HCTA 4ILKA 3KSUA 5T6BA 2JFFA 3OETA 3ETDA 2JFHA 3JQBA 4LISA 4WCDA 3NYWA 4PVCA 3OJLA 1DFHA 1JA9A 3I9OA 3GEGA 4CQLA 5AQ1A 1HE3A 2NACA 4YAKA 5F5NA 1B16A 3DZJA 2BLLA 4CLDA 3JQ9C 3ORFA 3ZWCA 5CAEA 3VC7A 2Z1NA 3VOSA 5KJ6A 2NU6A 1DBVO 4N5NA 2NVUB 4E2WA 5K0ZA 3ENNA 5C3MA 1LRLA 4M86A 2D1YA 1NVMB 4XEHA 3JQBC 4P8RA 3E5MA 5TT0A 2ZK7A 2DKNA 4JX8A 3GPDG 1BMDA 3DBRA 4XD2A 2PGLA 4D45A 2GCGA 1PQUA 1JQBA 4W99A 1Y6JA 2GYYA 2Y1CA 3QQPA 5DDIP 1H0KA 3PQFA 4GKVA 3VKUA 3JQAA 4INAA 5G0TA 1G1AA 3D3WA 1E6EA 2CY0A 5C37A 2V6FA 2BRUA 3JYLA 5DP2A 3GRPA 1W6UA 3TRIA 1GQ2A 3K5PA 3VVBA 2X23A 1E7QA 1BRMA 1B14A 4Y6PA 1GV1A 4GX5A 4LK3A 3W4KA 3KYCB 5TSDA 4XGKA 4RCVA 4KUGA 4UVDA 3LLVA 4YRDA 4BKOA 2I9PA 4UULA 5ILOA 1KEPA 5JAIA 1G0NA 2QIOA 3WQSB 1H9BA 3QVOA 3QWFA 4CR6A 2VCYA 4RV9A 2NTJA 3I5MA 3NJ4A 3CZMA 4AJJA 4LGVA 2HU2A 4BOYA 1V0JA 2FPIA 1ZK3A 3JQ8A 1SB9A 4Z0PA 1DAPA 4UUNA 3KOUA 2VYNA 2FOIA 2JD0A 1D4FA 3ROMA 3CXRA 2X9VA 4LW8A 5A05A 1ADCA 1MG0A 3C1AA 1U5CA 1QYWA 1T2EA 1YH3A 5L51A 1NR7A 4M54A 1IZ0A 4UVEA 2VWQA 5DULA 1VM6A 2E49A 3JTMA 3JSAA 4G5HA 3H2SA 4UEJA 4GSLA 1PL8A 3FF4A 3HN7A 4CR7A 4LN1A 2AEFA 4GI2A 1YOVB 1LRJA 3GA0A 3BTOA 1O8CA 4IDGA 4K9DA 4Y8VA 1NQAO 4P4NA 5AVOA 1ZSNA 3CZRA 1PWZA 1BHSA 3QJ5A 4ALLA 2DBRA 4YQYA 5DN9A 3DO5A 3KSDO 2ZCUA 3QY9A 4U8GA 2GZ2A 4WKGA 1I3MA 3JQAB 1PJBA 4QFCA 4B8WA 5ITWA 3I83A 2WYVA 4NNJA 1BGVA 2HK8A 3B70A 4WOKA 4RDIA 3RKUA 2VZ9A 5IXYA 3TZKA 2A4KA 4HP8A 4IJVA 5HBRA 2WYUA 3FD8A 1KY4A 2A9FA 5F1OA 3AI1A 1HDXA 3G79A 4E2ZA 5L4LA 1TXGA 3TOXA 1FDTA 3Q2KA 4A03A 5CDSA 4BO8A 4PLGA 2UYYA 4HXYA 3C24A 3GGPA 2EEZA 1D8AA 4J7UA 4PGFA 1MB4A 2GSDA 3R0IA 4D41A 1A4UA 2O7QA 1YRLA 4NJMA 3F5QA 3WWZA 2OBNA 3PHIA 4XJSA 1E5QA 1GY8A 3PQEA 3AI3A 5JYDA 4R1NA 4FD3A 4MVJM 5IZCC 3ZV4A 2WEKA 3I6QA 3O8QA 5ITVA 1U8FO 3EUWA 4L76A 3TQHA 4EITA 2C0CA 2RIRA 1C3VA 4OKIA 3ZWYA 2Y66A 4NU5A 3VZPA 6ADHA 2I3AA 1WW8A 4EJ6A 3B6ZA 1EQUA 1PR9A 1I3LA 1YBAA 2CDBA 1P0FA 1T2AA 1ZJYA 2YHIB 3KLPX 3CKYA 4W9NC 5DZSA 4CUKA 2R6JA 2GN4A 2SCUA 4OXKA 4BQRA 1GZ3A 4IDCA 1I3NA 4HX5A 4A5OA 4XDYA 4ZQHA 5L4NA 1GCOA 5FI5A 1SMKA 5K6AC 4E30A 3H9GA 1DHRA 2X0JA 2P91A 2A92A 4CM4B 3RUEA 4XB1A 4RLHA 5JS6A 3A4VA 5CEFA 5LDHA 1K5HA 4XJTA 4OQZA 2NU8A 1LC3A 2ZB8A 3R3SA 2QHXA 4IXTA 4BVAA 4TZTA 3GFGA 1E7WA 2OXIA 1CEQA 4XR9A 1WAMA 1X1TA 3TL2A 5EESA 1CQJA 3C85A 4DMMA 1Y9EA 3A9WA 1A9YA 4CM9A 4I5DA 2AHRA 1G6KA 3I23A 2NTNA 2EG9A 3IUSA 3QSGA 2I6TA 4GMFA 3UN1A 2GN9A 1D1SA 4J2HA 3ZCXA 2P9EA 4ID9A 2V6MA 4W6ZA 4Z0TA 5KVCA 4CMIB 5EJ2A 1CETA 2P5UA 4YT2A 3GMDA 3EAGA 2XPCA 1Z7BA 3AW9A 3E1KA 2JD1A 4RZHA 1QXSA 2PZKA 2QG4A 3PWSA 1B8VA 3P19A 4TRRA 1MXHA 3RFXA 5EIOA 2JCXA 2VUUA 3V5NA 3EYWA 4DGSA 3Q6IA 4IPTA 1T2CA 1NM5A 4BO9A 4OXNA 1NAHA 2AG8A 4E5MA 1P1FA 1NR1A 4R68A 2IXBA 1XCBA 1ZUD1 1Y7TA 4W4TA 3WIEA 3ZN2A 4MVJI 2GZ1A 4ZJUA 2VWHA 4MP3A 5ENDA 2VT3A 4BB6A 4ND4A 2HKIA 2P5YA 1IY8A 4DWVA 4B79A 1WP4A 3ZGYA 2NQTA 4MIOA 5A5EA 1H6BA 2P9GA 4QFDA 4RPGA 5A06A 3VPFA 3PDUA 1X7GA 3W8EA 3L6OO 1HDGO 1PJQA 2O4UX 1PJCA 4D46A 3OP4A 4BNHA 3QVTA 2PFGA 3V8BA 3EGOA 1UUFA 1PQWA 2QZZA 3PYMA 3INRA 2G17A 3BMOB 4YA6A 4PLVA 4KZPA 3KM0A 1Z82A 4QT0A 4R01A 4WEOA 4NJOA 5DBFA 1C14A 2B4QA 5CDGA 3DHYA 4PRLA 2YV1A 4J9UE 3QHAA 4BB5A 3ZWWA 4GLLA 4YPOA 4WJZA 4D3DA 1ISFA 2GRAA 3WOHA 5KOIA 3VPGA 2FRDA 4MJLA 1D3AA 3TJRA 3JQEA 2V6GA 3L6EA 3VHRA 2HRZA 4FC7A 4XRGA 3PYLA 3COSA 5GZ3A 3Q9UA 3ONFA 7MDHA 4F6LA 2JAHA 2GN6A 1ZJZA 4I9HA 4S1VA 1L1FA 1F06A 1ZZEA 3WQRA 2ZIZA 4ROSA 3WLFA 1E3JA 4KMSA 5TQVA 1LA2A 3P5SA 1DSSG 4OKNA 3MCVA 4U6QA 3RKRA 4FCCA 4CLOA 3GT0A 1RYEA 2Q2VA 1EVJA 3GVCA 4IINA 4YJFA 3IAHA 1XYGA 4D3SA 1HDOA 1OC4A 3LDHA 2HUNA 1LDBA 1NFRA 1HE5A 1P1RA 3LYLA 4MO2A 3VPSA 3WBBA 1WMAA 2YYYA 5L40A 5T8KC 5TJ9A 3PHGA 3UVEA 3K73O 1GQQA 1HZJA 2P4HX 2R00C 4RF3A 3HADA 1I8TA 2FZEA 4Z0HO 3E5RA 3RD5A 5JY6A 2WM3A 4KUHA 4L0QA 3W8FA 3IOYA 5I9NA 2XXBA 1Q7CA 4PZCA 4R16A 5GY7A 2B37A 2VYVD 3H9EO 1NASA 4CUJA 1U7TA 2PV7A 5DOVA 3HSKA 1RM5A 4XWYA 4PVDA 4ALKA 4GX0A 3ZW9A 4KWIA 3O9ZA 1LJ8A 2HMVA 3N7UA 3F1KA 4JCOA 3L9XA 3L77A 3DMTA 3I4CA 3GG9A 1BW9B 2IODA 4KOAA 4J6FA 2H5LA 1B3RA 3AUUA 2RHCA 3C8MA 3S2GA 3PJEA 3GVXA 3ASVA 2G0TA 4MKXA 1KVRA 4JJFA 3LF1A 3RC2A 1KVTA 1YE3A 3QWHA 3IKTA 1U3UA 3WGHA 2V65A 4BNMA 4EGFA 3JD1A 1ISGA 3CE6A 3E18A 1H6CA 1R4NB 3F1LA 4R5MA 5ENVA 1OI7A 3TZ6A 2QW8A 1ZO8A 5CG1A 1GPJA 2Z95A 2OHXA 2RBEA 2GR9A 3GNTA 3D4PA 2AQ8A 1E6UA 3T4XA 1Y9AA 2DM6A 1MV8A 3E48A 3ITDA 1LUAA 2Y0CA 3KYBA 4J1SA 2GLXA 4NMHA 1SC6A 1GFSA 2HO5A 4KTVE 5TS3A 1QLHA 3CPSA 1F12A 2I67A 3PHLA 2D4AA 1PJTA 4JBHA 4UUOA 5FEUA 5JMWA 4LMRA 3PFFA 3B1JA 4WPGA 1NTOA 4FQ8A 3OJOA 4XQCA 1NVGA 1E1KA 3HDQA 1XDWA 5C7LO 4XGNA 2QQ5A 1R37A 1V3VA 4Q3AA 1WZIA 1I0ZA 1JTVA 5GZ6A 4OOFA 5THQA 2B83A 2O7SA 1OMOA 2ZYGA 3KRTA 2E48A 1OBFO 1DDOA 4P4GA 4IXWA 4E3ZA 1E3LA 1RM4A 4YT5A 1ORRA 1T2FA 4OSPA 2VTEA 4DUPA 4URFA 1N1GA 2CVZA 3H5AA 4QX6A 4BQPA 1CF2O 2Q4EA 4NI5A 2B5WA 2EIHA 5FI3A 2W98A 3GR6A 3BHMA 4WECA 2DC1A 4BGEA 2EJVA 3CMMA 3ULKA 1HWYA 1EUCA 5KKAA 5EQFA 5KVQA 4C7JA 2X0RA 3OIFA 4FIZA 1UJMA 1AGNA 1LX6A 3RJ5A 3WYCA 3MOGA 3ZDFA 2JHFA 1XU7A 3RQSA 4WNIA 3GZNB 1DFIA 4AJLA 5B4TA 1FDVA 3MJCA 4J4TA 3ZWNA 1GR0A 4FC6A 2A35A 4OQYA 2W8ZA 3CIFA 3G1UA 1KBZA 5ADHA 1LU9A 4O5OA 4QECA 2AQIA 3DL2A 1ZK4A 3P7MA 2EW8A 5JFOA 5JMPA 3TDKA 3CEAA 3GK3A 3EVTA 1KY5A 4CMGA 2GERA 3H7AA 3IJPA 5BT9A 4GGOA 1OAAA 1B15A 4J43A 1GL3A 3GRKA 3RC9A 4BO4A 3D5TA 4NBRA 5JW6A 3HZZA 2O3UA 4Y67A 5G4KA 4J0FA 5JLAA 3GOHA 3ZWVA 4J1QA 5DCUA 2C59A 1JKFA 3JQ6A 4BNVA 1JW9B 1FMCA 2DFVA 5A9SB 3HDHA 1GV0A 1O89A 3WDSA 3GUYA 1LBEA 3D64A 2DTDA 1Y5RA 5TX7A 2X4GA 1I24A 2DT5A 2ZTLA 1BDBA 1K6XA 4R1SA 5CDYA 4WOJA 4E21A 1BXGB 1AXEA 5A04A 3ST7A 4UVIA 1YBVA 1GYQA 1UXJA 3D1LA 1GYRA 3KEOA 1ZIDA 3Q9NA 3HE3A 3I9JA 3KVOA 3DC2A 4DC0A 4NR0A 5JDCA 3O38A 3ICCA 4MKZA 2IZ1A 1T4BA 1DC5A 2IXAA 3KETA 3AOEA 4P38A 3U0BA 2TMDA 2Y1OA 4D42A 1XR3A 2B69A 4IJWA 1DC6A 2UUOA 3NT2A 4A27A 3CTVA 5JC8A 3EC7A 1Q0HA 5LC1A 1NFQA 5LCXA 2IRWA 2NVUA 1PX0A 6LDHA 3VDRA 4EJMA 3AWDA 5COQA 2J3JA 4Y9DA 5ES3A 4D0SA 2BF7A 1DAOA 3DWFA 9LDBA 1EZ4A 1BVRA 2HSDA 3BMQA 3NTRA 4PG5A 5T67A 5K9ZA 3ABIA 1WPQA 1RM3A 2Y1GA 1KVSA 5TNXA 4ZHSA 5BNIA 3V2GA 4BNXA 3OFSA 4IDFA 1I2ZA 1MGOA 3RBZA 3H3FA 4HNHA 2JHGA 1DLIA 3NUGA 4WK6A 2D5AA 1Z73A 5F5LA 4FGSA 4D0RA 1P1KA 1J4AA 8LDHA 3SEFA 2YDXA 3KYCA 4E5NA 4OOEA 3W4IA 4R1TA 3TZQA 1H6DA 4XDZA 3BTVA 2EKQA 2P4QA 2E82A 5L7WA 3F4BA 3U4CA 1E1MA 1GD1O 1JVBA 1BWSA 1NQTA 2EV9A 2XAAA 4PLWA 4GH5A 1NP3A 1PZEA 5EL0A 4I5FA 2AEJA 1VL8A 4GX1A 3D0OA 5BNFA 1P0CA 5A9RA 3Q2IA 3PGXA 3HWRA 4XR4A 5HRUA 1ZSYA 4GMGA 1LI4A 5HA5A 3NV9A 3FWZA 5L9AA 5FWNA 2PKQO 4BNWA 4I9NA 1DJQA 4CV3A 5KVSA 1OZAA 2G82A 3GDOA 5CFZA 4C7KA 3DAGA 2YDYA 3F46A 4YTEA 4E5PA 2FWMX 3UXYA 4TKMA 4K1LA 4BHTA 9LDTA 4HV4A 1E77A 3DR3A 4BGIA 1ZSVA 2H9IA 2DPGA 4Q3EA 2IYPA 4IIVA 3N74A 4EW6A 1PIWA 1UZNA 2FSSA 4MVJA 4EUFA 5JCJA 1LSSA 1ZXLA 3PVZA 1TVEA 1ZH8A 3FNFA 1P3DA 1JWAB 4D44A 2ZYAA 3GGGA 3V1YA 1JKJA 4AJKA 3VDQA 3LVFO 1MP0A 3DBVO 4LCJA 2DAPA 1I01A 1YOVA 3HHPA 5BR7A 4J1NA 1DRUA 2X9GA 3NTOA 5A02A 3F5SA 5IZ4A 2DUWA 4O0LA 3RCBA 2FP4A 3WJ7A 1QYCA 4QQRA 3TL3A 5DNAA 3BMQB 2A94A 3WTBA 2NSDA 4E13A 1BDMA 1NPDA 2CDAA 3HUDA 3JD3A 2EGGA 1WDMA 2HJRA 4R51A 4E0BA 2FR8A 3WMWA 1NWHA 2CNBA 2PZJA 1AN9A 1LLUA 1UDCA 3ADPA 1DIGA 3KYDB 2RAFA 2OGUA 2VOJA 1EFKA 4FN4A 4CQMA 2C5AA 3U4DA 2BH9A 4BO7A 2IEDA 3AU9A 3W1VA 4AJ1A 4IBOA 4BKPA 3NGLA 4EI2A 1WZEA 3KUXA 4CM8A 3R1IA 5B1YA 4IQGA 2X1HA 3GAZA 1E1NA 3ASUA 1KETA 5IDXA 3C1TA 4MPDA 4RORA 2BFAA 5COAA 4R4JA 2PD6A 1SB8A 3E9QA 3TPCA 3U5TA 4J49A 3NDJA 1FDWA 3SLGA 3RJ9A 4FFPA 4RDHA 1JAXA 5JXWA 4JP3A 4FJ2A 4FGWA 1P45A 3BXXA 3FHLA 3E9NA 2BFMA 2E6UX 5A5FA 3STHA 5I7SA 3MJ4A 4BNTA 4PFJA 4R54A 3SVTA 3WR5A 3DOCA 4BO1A 2IDZA 5JDIC 1IUKA 4XKJA 3TF5A 1D7OA 1ZK1A 4FB5A 2ET6A 1PZHA 2YHIA 4ITUA 4TRMA 4YQZA 1HDRA 4BNZA 3OJEA 1SOWA 3OEWA 2ZYDA 1V9LA 3TZCA 1QMGA 2QRLA 2R2GA 4M1QA 5EINA 3W6UA 4YXFA 3ETEA 4M55A 2VT2A 4JGBA 1K6IA 1SNYA 3OH8A 1HZZA 3NRCA 3JYQA 3RIHA 1R0LA 2W2KA 3FBTA 3RUCA 1Z7EA 3WICA 4UUMA 2Q2WA 3WSVA 1TB4A 4L4RA 2JCVA 5EPOA 4HY3A 4IMPA 4CM4A 4XIJA 5JAQA 3MJSA 4DREA 2OMEA 3BTUA 4CMKA 1ZNQO 3LT1A 4Y6SA 3D7LA 1P33A 1BVUA 1LDMA 4WLFA 3H65A 3H5NA 4CLHA 3MJTA 5C7OO 5EN4A 3PLNA 1HETA 3LC1O 4S3MA 4KTTE 5G0WA 3RASA 4AJOA 1AXGA 1QRRA 4BNGA 4CQMB 1I33A 3U3XA 1GAEO 4AICA 5U4QA 1MG5A 5KJEA 3CMCO 4FFNA 3L4BC 4YACA 3PJDA 3E8XA 4CM8B 4DIBA 1EVZA 3WFIA 3LC7O 1WXDA 3RROA 5IZCA 1FDUA 3UFXA 4N18A 3IP1A 2C82A 4DTIA 2J3HA 1DOHA 1GUZA 4CMIA 1ULSA 2OBYA 3QLJA 3H8VA 1PWXA 4IZIA 4IZHA 3UCXA 4ZA2A 3JQ7B 4EBFA 4J1TA 5HS6A 4KQWA 4R9SA 3GVHA 3RUAA 1LQTA 4XYBA 4NZ9A 4W9NA 3VPXA 3C7AA 1E92A 1GZ6A 2EP7A 4BO0A 1GADO 1EK6A 4ZN6A 3U9LA 1YQGA 3ZNNA 1QKIA 2CMDA 4HBGA 4ND3A 2DPHA 3EY4A 1BSVA 3CSDA 5HM8A 3GGOA 5K6AA 2RH4A 1CQIA 3V1UA 3BMCB 3K8ZA 4J4BA 1SO8A 1WDLA 4HFJA 1LLQA 2HMTA 1H2HA 2IZZA 1B7GO 1G0OA 1GDHA 2WDZA 4R1UA 1E7RA 4ZD6A 4ESOA 2W2KB 1EE2A 1HYHA 2P68A 2I76A 4BS9A 3MWEB 4N54A 1M6WA 1JVSA 1V8BA 2Y05A 4DBZA 1X13A 1AHHA 2HLPA 3VH1A 4ZICA 4EJ0A 1H94A 1U3TA 3F47A 3KHUA 2IYOA 4IIUA 4BNKA 1ZK0A 1LDGA 4R9RA 4Q9NA 3BMOA 3PP8A 4D79A 4TZKA 3I52A 1UH5A 3OA0A 1CDOA 2NADA 3AUSA 2Y67A 3ONEA 4R41A 3S2IA 5CEJA 1ZEMA 4XCVA 3GMSA 1M6HA 2OOSA 1O9BA 1AHIA 2E4AA 2YQ4A 4XQEA 3LF2A 4IDAA 3PI7A 3GHHA 4PLFA 1GCUA 1A27A 4TRJA 4JJIA 3WS7A 1XQ1A 4YCAA 3GEMA 5THKA 3ZZNA 5JAMA 5BSGA 1JU9A 2VHZA 3IS3A 3V1TC 1LSOA 3FR8A 3VTZA 4RPLA 1Q0LA 3RFTA 4LMPA 1PGJA 3TFOA 3NX4A 3TN7A 1PSDA 4B4VA 2O2YA 1PJ4A 4YJGB 2EKPA 3ANMA 2CFCA 4ZRNA 1GYPA 2GNAA 2BD0A 2PNFA 1J0XO 2CZCA 1WWKA 3PXXA 1J49A 4E12A 1TA4A 4TVOA 3UKOA 2JL1A 2AG5A 1YWGO 4CM7A 3IMFA 4BMNA 1UXKA 2YV2A 3HFSA 1W4ZA 1ONOA 2ZJ0A 1ISMA 3WQQA 3Q11A 1BXKA 5IN5A 2Q50A 3UGKA 4B4OA 1ONNA 4F3YA 4Z6KA 1E7SA 5KJCA 1R66A 4HFNA 5HTOA 2Q4BA 3K31A 4L4SA 2VRCD 3BIOA 3G0OA 2X5KO 1HDYA 4JJGA 5GZ1A 2C07A 4MIEA 4HUJA 5TC4A 2ZATA 1T25A 1QYVA 2WJPA 3AY7A 3BHJA 1NPTO 4ONEA 4A73A 4Z3KA 5BSHA 4PN3A 4YDRA 3WGTA 2PZLA 5JSFA 4ND2A 1T1SA 3IDSA 4RO0A 1GTMA 3I6IA 3OEYA 3WNVA 4I5GA 4MVJF 4BNJA 4DPLA 4II2A 2BGMA 1HKUA 4PG8A 1KVUA 3VZRA 1HEUA 5IJZA 3QWAA 3DBHB 3GFBA 2BI8A 3QE3A 4DC1A 2PH3A 1K6JA 2GASA 1DIBA 2QZ9A 5T64A 1E3SA 5MGBA 4NH4A 2W90A 1LDEA 1BW9A 2C7VA 2VWPA 1E3IA 3ADOA 1TT5B 4JROA 4PIVA 1PU2A 5JE8A 2EJWA 1P74A 2D59A 3NAQA 3C3XA 3E82A 4GQAA 5IG2A 2VUTA 3G3EA 4FPXA 2OORA 4JIGA 1YDWA 4IDBA 2YHUA 4PLTA 1NYTA 1R4NA 3OQBA 4OGWA 1ZMTA 5A1TA 1SEVA 3UOGA 5U9CA 4F45A 3LT0A 3H5RA 1ZEJA 1U2GA 2Y1FA 1Q0QA 3ZWMA 2PWZA 1EE9A 2J6IA 2ZKLA 4P4LA 5T8KA 2Q3EA 1O0SA 1NVTA 1WMBA 4MVJE 1ENZA 1N5DA 3LSYA 4U0KA 4WLVA 4RPJA 2R00A 1YS4A 3P2OA 5DT9A 3VTFA 1ARZA 3WGIA 4W7IA 4GGPA 5L45A 2DBVO 4OHUA 4NBUA 3D3EA 5CHEA 3CINA 4LSWA 4E33A 4ZQGA 1T24A 3KEQA 1E1LA 3ON5A 4W7HA 2NWQA 4DPKA 1YONA 1N92A 1QORA 4H7PA 4UEOA 3ZI0A 4TROA 3SC4A 5A3VA 1ID1A 1L7DA 2AXQA 3OQ6A 2X5JO 1PL6A 1DJNA 1YL6A 4MOWA 3WXBA 1LTHR 2AA3A 2QRJA 4N7RA 3PFWO 1YJ8A 3OQ1A 3AK4A 1YBMA 3MTGA 1SEPA 4WLNA 1EFLA 1VL0A 4I8XA 2O3QA 4GVXA 3DOOA 1ZMOA 2JD2A 3FI9A 3PK0A 5ER9A 1LQUA 2DTEA 5FYDA 3RSHA 5JO0A 3AI2A 2VHXA 4MKRA 5DF1A 2HAEA 2Y0EA 2Y1EA 3GZNA 2Y68A 3AM4A 4IMRA 3SJ7A 2OFPA 1NXQA 3ZWOA 1ZBQA 2NV6A 4DXHA 1I32A 4NBTA 3RUDA 1EEHA 5DCYA 4UVHA 2I99A 4J7XA 2BHLA 3H9UA 3HQ4O 1X15A 1X7DA 1MLDA 3RUFA 5IDQA 3OM9A 1YVEI 1Q7BA 3ZNPA 1O5IA 2JKVA 1MXFA 3GH3A 1N1EA 4WCFA 1GQYA 3DZBA 3JQCA 4O6VA 3GY0A 1Y81A 2FY8A 5T5QA 4D7AA 2CD9A 2X22A 1ADFA 3LK7A 3WMXA 1F8GA 3JD0A 3PZRA 5TJHA 2J3KA 4DVJA 3LT2A 3F4LA 3K2BA 3L4SO 3WGGA 4KQXA 4B3JA 1HL3A 1VLLA 1T26A 3WNQA 5FFFA 1Q2XA 1NHWA 1ZW1A 2W2LD 4UAGA 4WCFC 3HG7A 2YZ7A 3PWZA 3DZIA 4RQUA 4AJPA 2Y1DA 1UP7A 4YJHB 5G2OA 4BNYA 4XRRA 2Q1WA 1GUFA 4QEDA 3AU8A 1HXHA 4BIIA 4IGFA 5A9SA 2AE2A 2Q49A 1FXSA 4UREA 2C20A 1I10A 4YYZA 1C0LA 4Y6RA 3TOZA 5CDUA 1DC3A 3I9MA 1SAYA 2WTBA 4A26A 2ZB4A 4E2YA 3B1FA 2B5VA 2OO5A 4YVFA 1BXGA 4IS2A 3JYNA 1EK5A 4CM5A 5I7EA 4RJTA 3GDGA 3DTTA 2B4RO 3WJAA 1XELA 2YQ5A 1KYQA 4AVYA 3PQDA 2B4TO 1PGNA 2Q1SA 1E3WB 3AM3A 1O95A 2H63A 2POQX 4WASA 4BGVA 3WX0A 4EUEA 2LDBA 3A14A 4GLOA 1VJ1A 1WNTA 4FDAA 3RVDA 2X0NA 4FFRA 2VUSA 4OMUA 2FSVA 3VH4A 1FJHA 1HE2A 2PGJA 2C5EA 2GN8A 3FN4A 4MP6A 1UR5A 2VTDA 1XKQA 3DDNA 4JK3A 2VYVA 4B3IA 5ICMA 1X1EA 4GX2A 3PRJA 4CR8A 1HLPA 1XU9A 4ALIA 1FF9A 5KCZA 4WCFB 3FBGA 3GHYA 1C1DB 4AL4A 1PS0A 3WGQA 4Q3BA 2GF2A 2I3GA 3LLSA 1IYZA 4BV9A 1X14A 3NT5A 4IM7A 2JFGA 5A9TA 3DAPA 1B26A 3JCZA 4OO3A 3RBXA 1DLJA 4FJ0A 2D8AA 2BFPA 4RZIA 5B4UA 1HYEA 4L4XA 5EMHA 4AJIA 5ILGA 3HB4X 2EP5A 4UEKA 1XA0A 5TT1A 3MZ0A 1KVQA 1ADGA 5IXSA 2G1UA 3GAFA 3LZ6A 3VVCA 1NX6A 3AFMA 3S1LA 1U4OA 1U1IA 4ZU3A 1F8FA 1QV7A 3OA2A 1K2WA 1LSJA 3PEFA 2UAGA 1KEVA 4CM1A 1OC2A 4U0JA 4RF4A 4CUZA 3ROKA 3SLKA 3H9JA 2J5RA 3DZGA 3OIGA 4CL8A 1A71A 5T57A 2AMFA 4B7CA 4NG5A 1ZCJA 3QP9A 2HDHA 1R4MB 3RFVA 1PJLA 1RJWA 1VKOA 4J91A 3BA1A 5HWSA 1UZLA 4R3WA 4TKLA 4TRNA 5TGDA 1XHLA 1EBUA 3W6ZA 4PLCA 4DQXA 1ZXBA 1JDJA 1LNQA 3A28A 3KLMX 3L6DA 2OP1A 1NQ5A 1IPEA 2X6TA 5G0UA 1YB1A 1YB4A 3SX2A 1BG6A 1OFGA 3U4IA 4RVGA 2WWRA 4QO8A 3ANNA 1HYGA 3INGA 2G5CA 2PTGA 2P2SA 5L7YA 2FN7A 3EHEA 4NFYA 4FFMA 1X7HA 2HQ1A 1VC2A 1PZFA 4B8ZA 3X2EA 1N7GA 2DBZA 1VSUA 1XQ6A 4K28A 4AJ4A 1H5QA 2FZWA 1R6DA 1JKIA 4WNCA 1YL7A 4KP7A 3DQPA 3EZLA 3O03A 3AJRA 1ZVMA 1D1TA 4CODB 4RF2A 2X86A 1SCUA 3GNQA 4K6CA 1T4DA 4IQ0A 3JQGA 3UCFA 1YB5A 4I08A 1V35A 4AJEA 3WB9A 2CVOA 2VRBA 3K2EA 3KYDA 4BNIA 5KKCA 1E7YA 3RU7A 3ZU4A 1VI2A 4OYRA 3ROQA 2VNAA 3O26A 4IJUA 4FS3A 4YWJA 1R16A 4TVBA 4GBJA 1P1HA 1GEEA 3ZH2A 3PDJA 3JYPA 2Q1UA 3AY3A 4FR5A 2JAPA 1IL0A 4YR9A 4BNLA 3C7DB 2DFDA 2JCYA 4WGGA 3S2FA 3ZV3A 2I5PO 2X0IA 3K6JA 4O59O 1EMDA 3ENKA 3DONA 3VKVA 1ZK2A 3V2UA 3LC2O 4DLBA 1MFPA 3DXFA 4NQZA 1A7AA 1YXMA 2X9NA 2VYND 5L3ZA 5BSFA 3SJUA 4E6PA 1NBOA 2YFQA 4Q3DA 1PS9A 4DPMA 1XLTA 4PLZA 3DOJA 2O4CA 3LQFA 3DEYX 1LRKA 1N9GB 2VZ0A 2PD4A 1YL5A 1DXYA 1SZJG 3MOIA 4CL3A 4EDFA 3IUPA 2HK9A 3GVPA 2CUKA 3PPIA 1Y8RA 4G81A 3IC5A 3MWDB 2HK7A 3OSUA 4XQ9A 2J5KA 1XG5A 4DLAA 3FNHA 3F3SA 1KIFA 5FF9A 3ROPA 1ZFNA 3LU1A 4L73A 4BGUA 1C1XB 2ZTVA 1E5LA 4IUYA 4GVLA 4PLPA 4BKQA 1GU7A 3OHSX 1PZGA 1U5AA 4J16A 3QVXA 1PL7A 4GWKA 2OZPA 3QRWA 4TWRA 4Z9YA 3TFQA 4OJNA 3U49A 4BMSA 4CM3A 1W73A 2AEMA 3JQGB 1Y5MA 4BO6A 2QRKA 3ZNQA 2GPTA 3I9KA 2WD7B 3WLEA 3FSRA 2Q99A 4NBVA 1B8PA 1GPDG 3RAJA 4WLUA 2EF1A 3VH3A 3M1LA 3T4EA 1B8UA 1RM0A 3G49A 4XX0A 1EVYA 2XXJA 4D3FA 2BELA 5MDHA 1Y8QA 3KXDA 4GSKA 2YFHA 1YKFA 3VAZA 1HRDA 1DIAA 3EVNA 4MINA 3DBLB 4Q3CA 1YJQA 3GN2A 4P22A 3DFUA 3ZV5A 3B1KA 1CYDA 2O3RA 1XGKA 1EDOA 3OF2A 5A4DA 4JBIA 3JQ7A 2VQ3A 5AXBA 5JDIA 5A03A 1V3TA 1R15A 2J3IA 3PIIA 4F6CA 1JN0A 1RKXA 5A3JA 5BNTA 2V6BA 4RPHA 4H15A 3FTNA 1DFGA 1UDAA 1MFZA 2ZJ1A 4A10A 3NTQA 4A0SA 1AUPA 2WD8A 3HB5X 2RH8A 1PGQA 1QG6A 1XWFA 4IQ8A 1Y1PA 4Y98A 1DIHA 5CP8A 2I66A 4JN6B 4DA9A 1HE4A 1KEWA 1A72A 2QX7A 5DBIA 2DBQA 1UDBA 3BMCA 3U4HA 1NWCA 1C0IA 1QYXA 1A7KA
chains in the Genus database with same CATH superfamily
3PE6A 3CGWA 2ZUTA 3F67A 2H6EA 3SDSA 3G17A 4B44A 3FPLA 9MHTA 2GD0A 4MYTA 3C3CA 1FTSA 2GSWA 3Q9LA 3MWYW 4N03A 4UDYX 4UFNA 4DDKA 4N8EA 4LNHA 2YKGA 3REQB 5C18A 3KSMA 1QC5A 1SJ9A 1WCYA 5IAAA 2ZJ4A 3FDZA 2WSBA 3KHKA 4AP9A 1CDDA 1SHUX 3VSEA 2XNHA 4BLTA 5JADA 2ZM5A 1N8KA 3INNA 1TLTA 3MQ2A 3KQMA 2A1TR 2YVLA 3EG9A 4O4LF 4DYVA 4M0EA 4ESEA 3N6VA 4CBVA 5JRJA 2ZAYA 4HXFB 2XF8A 5I9IA 4DB4A 2PKRA 4AF8A 2WF6A 2G9QA 2FFQA 2PD3A 1A4IA 1T9HA 2QRQA 2VT7A 3ESRA 4Q48A 5D7NA 5A6SA 4H6PA 2WVHA 4GXNA 2AFHE 4YP9A 2VAXA 1MZVA 4UUBA 5JQWA 3B13B 1DB3A 2XUZA 1QK5A 2FX5A 5CAEB 3QW2A 1F14A 3F9RA 4LJ8A 1QGUA 3HFGA 1U9JA 2RC6A 3GLHB 2GEDA 2HGZA 2XA9A 1HT0A 2XD4A 4NK5A 3KX2A 1SBYA 1IZ7A 2Q6IA 5C5EA 4AQYB 2I34A 1WA5A 3D2AA 3MRVA 1YVDA 4R1MA 4DCJA 5AM3A 5I6DA 3T06B 3T7KA 3SJZA 1FFXA 1FW8A 4B4KA 3L0IB 1K0UA 4KYTA 1Z16A 1XEAA 3B2EA 1QHHB 3L0CA 2LV8A 2PWAA 4IICA 2QX8A 5COBA 1EAMA 3DBRB 3EZ2A 3P0HA 4F84A 3L7NA 4R2JA 1CS0A 2NXWA 3A4NA 1BJRE 2GZDA 4HYTA 2PS1A 4INOA 2SICE 3KZVA 4FHEA 1B00A 1PK7A 1J6UA 1C0KA 3A26A 4V0ME 1XZFA 2DUUA 3ML1A 3PGJA 4QBGB 3GEDA 2HHLA 2FKAA 3BIJA 3X1DA 2NUAA 4TV8A 2QUHA 3B60A 3T5DA 2NQ8A 2WF8A 4S12A 4TUYF 4YI3A 1ZH4A 5BPFA 3JYOA 4H1UA 5EHNA 3I4LA 3NPMA 4IDEA 3WLLA 4BUJA 1YF3A 5JBNA 4YCCA 3DL7A 3W5HA 1TM4E 4AY5A 4B48A 4OQLA 1JHZA 3FCOA 4QOIA 4TTQA 3RC8A 2G06A 1V5GA 2GUWA 1L4HA 3F8TA 2ON6A 3TSCA 3ZHCA 3H9BA 1N25A 3GLKA 3OE7D 2O50A 5D01A 1T9AA 1ACJA 1M2VA 1T3ZA 4NCHA 3JZFA 4NHEA 4RS3A 3PNKA 4XJVA 5BVHB 2BGRA 2W22A 4BFVA 5A4AA 3EPRA 1A2BA 1QP8A 2GJ4A 4HJXA 1SOVA 4AFNA 2JZNA 2VDJA 1IJEA 4JUBA 1CKEA 1G55A 1P1IA 1PFYA 2MSCB 4II3A 2B6NA 2PKYX 3O4RA 1A76A 2FPIB 2HK6A 2ASVA 4BMZA 1UBEA 4AP6A 3F9CA 3GXOA 1YO6A 1XCOA 4H0CA 4DCTA 1XNRB 1U11A 3ZY2A 1XQYA 1ZHHA 4W5HA 3AXSA 2ZBVA 5NLLA 5IUNC 5JNUA 3EMKA 2QMYA 4WD3A 5I4CA 3IDFA 3R09A 5KYXA 2VQSA 3A25A 3F97A 3GLGA 4Y30A 2ZSJA 1YS9A 2GCNA 3GUHA 3NDRA 5SY6A 4X85A 5H83A 2HA6A 5EUBA 2B2NA 3RK4A 4R2HA 3MVEA 1JP7A 2MSKA 2RAPA 2QORA 4EYEA 1RPNA 5FOXA 4PRKA 3C5VA 4ID3A 4MVJH 1VL2A 1QO9A 4EW3A 2H2GA 1CLEA 2Q9UA 3PEVA 4J2OA 3WYDA 1H1TA 3DJYA 3VGJA 3EGDB 5JCXA 4JSTA 3COJA 1QB8A 2PLAA 5I9MA 2J9FA 1CRQA 3HVKA 5AXDA 4MV4A 1GIAA 3K94A 3KKQA 1I30A 2I2XB 1ZH6A 3WI7A 4QDKA 4WIAA 3UUWA 5LQDA 1PD0A 4B3HA 2HXGA 2B0JA 2PUFA 5J59A 3H4VA 1QLJA 3K05A 3W5JA 1W0JD 4HDKA 3UV6A 3UAYA 5HEKA 5LYYA 4BU0A 1N6KA 2PRIA 4KN8A 4E2FA 5IANA 4GI3A 3ZDCA 4UQOA 5BYBA 1S2DA 4TYPA 4ZQFA 4BVJA 1TYZA 1RU3A 1QDUA 2CFOA 2W6JD 2KX7A 4JENA 4WRRA 2P1ZA 4JXKA 2J3EA 4ANFA 2HRQA 3NT4A 4Y2TA 5CIYA 4AQ7A 1YQDA 3PFKA 2VYCA 4CMCA 4W63A 3WL6A 1F2TB 1Z37A 4XQGA 1YDEA 1L2TA 4EM6A 4BV2A 4B17A 2Q0XA 4FFOA 3RLIA 3QFHA 3BHIA 4FN5A 2PKCA 5LZ7A 1Q19A 2ZAGA 3GELA 1SHTX 1R1DA 4EUSA 2MHCA 3MIZA 2QRZA 3KBOA 4MS1B 2J33A 3HCFA 3E7DA 4Y1FA 3HY6A 2OP0A 1RI4A 4BFXA 2WAYA 1RWXA 5C8YB 3WIOA 1C2TA 2VG8A 1SVIA 4NJMB 5CFPA 3LIIA 5DOZA 3RVJA 5F1PA 3RVBA 4A8JA 3VZSA 1PZNA 1SIBE 4DDMA 2J30A 3PNBA 5EP3A 1W4RA 4JU8A 3BERA 3I58A 4BXOA 1LXCA 3TR0A 3MXTA 3ETJA 1G8KA 4QE3A 1IWPB 5KHAA 4EL0A 2Q9AA 2V1UA 3D5EA 1D6SA 1MO2A 1KJ9A 4RW0A 4MKIA 1EDZA 2Q1TA 2IEAA 3KT3A 1Y1QA 2VHWA 4RK7A 1EIZA 4W8HA 3RPEA 2G72A 3VH2A 3WGVA 4G5SA 3SFVA 4CNQA 3EOBI 4XX1A 4IUDS 1U0LA 5FNVA 2RGUA 4G84A 4C01A 5JH7B 2R11A 5ADVA 1JG3A 3RO7A 1N5OX 1KEEA 4V03A 2WTXA 1BU5A 3G8BA 1S2NA 2RH5A 3D4LA 3I8XA 3QA9A 3RODA 3UANA 4CV1A 1TMYA 1WBDA 3MRXA 3ER6A 5IT9A 2GXSA 5F3RA 3C5HA 3R6TA 4DR1B 1SHZA 2VWGA 3AG6A 1L5QA 3AJAA 3PRYA 2C2HA 2J6BA 4B2IA 3I0ZA 4WBXC 1EH5A 4W5JA 1XFDA 3GLVA 1Q50A 4HFMA 1R0XA 3HBMA 4OU4A 1XALA 2EJBA 4E09A 1X0VA 4JZKA 3OT5A 1QR6A 3IESA 3PC8A 4RGBA 5FAXA 3ZU3A 1C9KA 2VOEA 3V7UA 5FLEX 3WGOA 4IDNA 4EI9A 1O6ZA 4P2BA 3LQ4A 3OTOB 2LGJA 3G2NA 4G8BA 3L0ZA 1A8IA 2QL6A 4XAQA 2X7HA 1NXWA 5HUJA 2QMOA 2FNAA 2P9TA 3E03A 4FXPA 1ELOA 4FZ5A 2JH8A 4LZLA 4B80A 4DV5B 4NZOA 3F6YA 3UMVA 4WESB 3M1AA 5ALSA 3RFCA 4WA8A 1JG7A 5E4FA 2CDCA 2VNSA 2NV0A 1RR6A 1CRZA 3AFNA 2PZAA 2JJQA 4MV3A 4IW3B 1OA1A 4QT4A 4OBBA 4QGSA 5MF6A 2PUDA 4Y2QA 4X6XA 1WF3A 2EYUA 1A77A 5DHUA 3WYBA 3YASA 1QVRA 3ZW8A 1BMFD 2XUFA 2XI4A 3E9EA 4EHIA 2GZ3A 3K09A 3QVSA 4DLNA 1AMUA 2C2MA 2XMGA 1R5JA 3ICEA 1OILA 2QDXA 4YAJA 1UM9B 1IHXA 4RQTA 2VF8A 3I32A 3H5VA 1Y4ZA 2VP2A 3BDAA 1VHQA 4MI9A 4CF4A 4EJ2A 1UP6A 5LQNA 1RADA 4MROA 2F8LA 1LB1B 3C7CB 3U26A 1YUNA 4WXYB 3HZOA 5AT1A 5KIAA 1DPGA 2FRDC 2HZ7A 5JOQA 1FFGA 1ZPDA 2XMDA 4FDUA 8ADHA 4E11A 2AVDA 3CUEF 3WK9A 3DLAA 1FQOA 3EZFA 5LBUA 3ZWAA 4P32A 3DV9A 3EXAA 4J0QA 2PUCA 3GBSA 2RBKA 5AHXA 4OSEA 4CMHA 1TQHA 3VJRA 4CKEA 5CB6A 3BWCA 5F9FA 4N5IX 1EFDN 1Q84A 3WWYA 4EMTA 2R6R1 2G6BA 4QNRA 3QXHA 1QGAA 4RLFA 5DNUA 3OT4A 2GF9A 3LT4A 4Z5XA 2BGKA 3U1VA 2E37A 4D4HA 1TLLA 2C04A 4PYJA 1RPTA 3GJ4A 4YMIA 3O3NB 2A88A 3N8HA 4LK2A 2Z1MA 1QV6A 3RG2A 1Y34E 5IAJA 1X19A 3A4YA 4M22A 5K3BA 5CFNA 3DPUA 4KREA 4GNKA 3CLTC 5BWLA 1H9AA 1WTCA 1EBFA 4EPTA 1J20A 4FKBA 3V8EA 1N2CB 2C99A 3F9IA 4X45A 1L4BA 3MGGA 4YRIA 5LFAA 3ZLJA 3H97A 1FU4A 1GZ7A 3R3XA 3HYCA 4X00A 3T3HA 1OQAA 5L7TA 1M1ZA 5KYYA 3HKCA 4BY9E 3IEVA 1TKBA 2PBFA 3AC0A 4E5YA 1G63A 2OBXA 2DJIA 1O57A 3V1KA 4P33A 2G76A 4M0LA 5LQAA 2VLIA 1OH6A 3IRUA 2B25A 3IQGX 5DHSA 3GLRA 2BR4A 1UAYA 1LFDB 2WHEA 3DZKA 4HKTA 3VPCA 3CO0S 1AK1A 5IBPA 1QIJA 4OHVA 2G08A 4E2XA 3KUDA 1RT9A 3AOGA 1E2EA 5GM2A 5DW0A 2DQSA 4B7AA 4F2GA 3HGTA 1DC4A 2FPPA 4Q39A 2X3YA 4JYZA 1ECLA 1K08A 4WFIA 1YDGA 2PSEA 3HXTA 4WNAA 5AOVA 3UOAB 1O6CA 4MEAA 5EEGA 1MNAA 1URPA 5FBQB 3QBVA 1I2BA 3SHQA 2QTHA 3SS8A 4BKMA 4GBGA 4GZ6A 1QYDA 4Y9TA 3HP1A 3KV3O 4CDGA 4M1TA 1EM8B 2ONCA 3NEPX 4QTUB 3KR0A 4OH1A 4OHYA 1EE1A 1NVUQ 2H54A 2EDCA 2X8LA 1IATA 3R24A 3PEUA 1D2GA 3TXXA 1KEUA 3HM9A 3DT8A 4DA8A 3VJLA 2W42A 4RMIA 1M76A 4MLCA 1DARA 2B1RA 4I50B 4RVHA 4Y2XA 4YBZA 5FA5A 4E31A 4YRAA 1M1YE 3FTPA 4K8OA 4MYDA 4BAZA 3U09A 2PQ0A 1U28A 3R7SA 3LDFA 1BJKA 2QG9A 2XCIA 2X41A 3M2PA 3NONA 3OZBA 4MMZB 4OGFA 5LZ8A 1VE9A 3TLCA 1L5FA 4KQ1A 4QQ8A 4YJFB 4IZ6A 4DM4A 4NSNA 4ASUA 3FHTA 1KORA 1EZZA 1U3VA 2AVNA 2PRYA 3CNBA 2FJUA 1CF4A 4TL7A 4S1OA 3WLHA 1R4MA 3STXA 1KMIY 3ZHVA 1IZ9A 2H2IA 3CW9A 2WPNA 4NPAA 4MUBA 4EJFA 1X1BA 1G18A 3I3OA 4G25A 2XODA 1N2SA 1NUSA 4JB8A 2UVDA 4B73A 4JNKA 3IFSA 4L72A 4PG4A 5ICCA 2ZQZA 1Z0UA 1KS9A 2HBQA 4ZANA 4I2NA 3PIDA 4OMCA 5AFSA 2GXQA 1Y33E 2Z8YM 3QQ5A 4EY4A 1WVIA 2RGDA 2HMSA 2L19A 3WGYA 4OEHA 1Q6YA 2CLOB 2GM5A 1XEXB 1CE8A 3GLUA 3VU9A 1K89A 4HTFB 3H2IA 1Q44A 2R1TB 2QP9X 3L07A 4Q4AB 3V8PA 1T6NA 4PAOA 6AT1A 2VC2B 4ZO9A 2HADA 5IT4A 4XPIB 3E8MA 5JPDA 3S6JA 4A2WA 1NRWA 2R60A 4A7PA 1TEXA 4MUFA 1Z15A 4R31A 5IAGA 5CDFE 1TVMA 4F4IA 5ICSA 2EKLA 1VDMA 3UKDA 5D85A 1YOBA 4G24A 3ANLA 2V7TA 1P5JA 5EERA 3RYHB 3DXYA 3WYEA 2HIAA 2WB2A 4EKDA 3B82A 2O1XA 1QQAA 1QCDA 3PG5A 4PZDA 1WDTA 1EX6A 3MMZA 4TV9A 1V48A 5A5GA 1M6EX 4JY7A 3I12A 1KAMA 1KO4A 1Q1BA 4K9SA 3U40A 1Z35A 3M6XA 1JH9A 2WSSD 3M5PA 4CFZA 5M29A 5CK5A 1U2EA 2YJZA 2QTWB 4W82A 5CLIA 4QAQA 3VU1A 5KNLA 3O4IA 1LC0A 1MC5A 4FYIA 4NICA 4WXRA 1MN6A 1H93A 2EFCB 4HC4A 4BNUA 5CFQA 4L85A 1YTUA 2REQA 3EG5A 5HDQA 4TPKA 4COOA 5HCNA 5U1PA 1SBNE 5TQ2B 1NMYA 2GEFA 2OZLA 3BE5A 2CL5A 4RACA 1W0KA 4U9HS 4UBNA 3CUYA 2F1JA 4IAOA 3CBGA 2Q3HA 3OAAD 3H04A 1V47A 3TIIA 4BKUA 3WTCA 1WXGA 2C3YA 4MV0A 5BORA 2L42A 3PGLA 3DG9A 2B94A 4LFCB 3PIRA 4W1RA 1DO8A 1MQ8B 5C81A 1IOWA 1J8QA 1SH7A 1RQPA 5AR1A 1I0LA 1Z5WA 1HV8A 3ZWWA 3LPMA 3P4UA 1VSVA 3U1TA 2C4NA 2YRXA 1VE7A 2JFXA 3BM5A 3B9BA 3WHLA 4AJ2A 2IBSA 3TYXA 4MRMB 4O8CA 4O4JA 5BMVF 4UNSA 5EJEA 1UOPA 4I4IA 4YT8A 4DWJA 1H8HD 1N9GA 1B4DA 1MO3A 1YB7A 4HFRA 2REOA 4TMYA 2PPLA 1SWVA 2N9UA 3HMQA 1ZUIA 2DWUA 4JEUA 4JYBA 5BXYA 5JJKA 3UMYA 2I55A 2PR2A 1J07A 3F6RA 4MPJA 4Q34A 5JAOA 5JI2E 3GPIA 3H75A 4QFBA 3ZE6A 3IQDB 5FL7A 2VF7A 3EIUA 5KNCH 3MFQA 3N6RA 4GMXA 4O8ZA 5FA6A 1EVKA 3U6BA 1KC1A 3B1WA 3OZVA 4W5NA 3LP5A 4PG6A 3CR3C 5KTPA 2WYWA 1WL8A 521PA 3REFA 1EG2A 5JAZA 5L95A 5KNBA 3EQ8A 1G17A 3URMA 4MB2A 5C5DA 1T10A 4O1HA 1XZIA 1XMQB 1G16A 1M34B 1NHGA 1ORWA 2H1IA 3R6DA 4UDNA 2C5BA 3DB1A 1OSNA 4ZVMA 4NBSA 3CSUA 1K4YA 2AWNA 3EDMA 3H9CA 1NYRA 5LYJB 1E3EA 1M8KA 3N8GA 4P3YA 4RC9A 2X2FA 1OASA 3L6RA 3M2TA 2VNIA 3D4OA 1DIRA 1P9WA 1Z74A 1R27A 3DV2A 3DHNA 4C0BA 4QOFA 4ENVA 5I9LA 3QXJA 1QH1A 4GS5A 4EG1A 1WU8A 3EGVA 3ZI0A 2V03A 3PLRA 3OKCA 1J2YA 5JDCC 4BB0A 3HV0A 5BW6B 3C1OA 1TIBA 3EVEA 2RIPA 3KPVA 4HPWA 1R0SA 3FLAA 4KL8S 3A6DA 1O94A 1ZH2A 4NOJA 5FX2A 5DP1A 1SUAA 2HC9A 1P44A 2H5IA 3MFYA 2HPHA 2YXNA 4DW8A 2ZTSA 4CLRB 1HUQA 3FCEA 3AEKA 1VPDA 1E2NA 4KSYA 1JPJA 4MZXA 1P77A 3CVUA 3GNSA 2W70A 2AF4C 4GO1A 4OLJA 5JJBA 4X0EA 2C2XA 1IOLA 2A7XA 2GTPA 1GPBA 3UXHA 3F49S 4LY0A 5EMNA 4XWOA 2JAUA 1G38A 3NIGB 3PHHA 2A9JA 1CQZA 3NVMB 4E03A 1M1NB 3A31A 2D0DA 3KKLA 4ZTZB 1WDKA 3FMGA 5AJWA 3PUWA 1QH8B 2GPSA 4RKEA 2EERA 4JC4A 3FGPA 4ARZA 1F4VA 4J4HA 1JU3A 4OHFA 2VQEB 3A70A 1HQYE 3GIDA 5JSKA 1XP8A 1XP5A 4Q37A 5C31A 2C54A 3AL0C 4FE4A 1A98A 3HKDB 5AKZA 2OMKA 3EUFA 1AVTA 4N5LA 5HUHA 2OCIA 2V9PA 1KC3A 3TRJA 3PI6A 3Q12A 3JTEA 4DPMA 1YMUA 1Z0DA 3ZJTA 3UHAA 4CEIB 1QPBA 3V1LA 3HK2A 1TEHA 4CMEC 2CE7A 2YW9A 3OIYA 2O3JA 2VRWA 3FROA 1AXRA 3JRXA 2YV3A 3BBLA 3ZDXB 1AMOA 2KBFA 3Q85A 4V2IA 5B4VA 4IFTA 2J41A 2ZPTX 2CLFB 2I2AA 5M04A 4R3NA 3OECA 3REQA 2XE7A 2HWKA 3G7UA 5DBGA 3TZHA 2UUPA 1TQ4A 3P94A 4QAJA 1V45E 2IUFA 2PA3A 4REQB 3R3HA 4KQHA 4YJ2F 1HR0B 4ILKA 3KSUA 2JFFA 4LJYA 4M1EA 4G63A 4P36A 3PKIA 5FA8A 1N2IA 2XTZA 2EATA 4MR8B 1PNRA 1LV7A 1DFHA 3NVDA 1TJNA 3DZJA 5HFAA 2DLCX 4CLDA 3JQ9C 1PT7A 3IP7A 5CAEA 3ZWCA 1DO2A 2F43B 2J9YB 5ALJA 2B6HA 4N5NA 2NVUB 2AOTB 3GLHA 2J59A 2OB2A 2QN8A 4Q7JB 3EXFB 3T9DA 4V0OA 2W93A 3IURA 3TXAA 1KKMA 1P5RA 4P8RA 1RJ9A 3C6ZA 1NVFA 2WHPB 3QOWA 5AI0A 3JRNA 4E5SA 1IY0A 3K1ZA 2ZK7A 2DKNA 3JAWA 4WVFA 1QHHA 4BJ5A 4DCSA 2W2PA 4DR4B 1I4EB 3HL4A 3DBRA 2WAXA 2WG1A 4IIYA 1FYEA 3EF0A 4I4TF 3QQPA 4LXGA 1CY0A 3FZEA 5DDIP 5A7HA 4Y2PA 3VKUA 3RTBA 4C0QC 4CTJA 1G1AA 5JU6A 4ZOQI 4L9AA 1C7IA 1ZI8A 2CY0A 3KZOA 4JL8A 4PHCA 1WETA 1XZCA 3GRPA 5DP2A 5ED4A 3A05A 2C2ZA 1JKMA 1GQ2A 3K5PA 3QV2A 4I55F 4EPXA 2AFIE 3AETB 5IVHA 1L9XA 5DBOA 1SVSA 5DPMA 1HMYA 3UATA 1E7QA 5HFJA 3RTGA 4LK3A 1O4VA 2M1ZA 4IKOA 4KUGA 4RCVA 3TX6A 3JASB 2D7CA 2FR8C 1VQ1A 1YDFA 3TZEA 1Z6TA 1P2SA 5FOWA 3FKJA 4UULA 2H0RA 4CGYA 5F7ZA 2QJRA 4NC9A 4UU1A 5JAIA 2DR3A 2HV8A 1IONA 2XGSA 3G6WA 1Y1LA 1BIFA 1U8ZA 2V96A 3OOSA 3V6LA 1P39A 3NHJA 4OJMX 4PPQA 3VBEA 3Q8MA 3IMKA 2VCYA 2ZOSA 3HYRA 3N53A 3U61B 2QGFA 4L8WB 2NTJA 3R7DA 2C8VA 4DT1B 2FPIA 2PZBA 1HK7A 1SB9A 2YWXA 2ZAOA 3C4VA 1DAPA 3WWCA 4HNTA 2KM1A 1Z2OX 3L6UA 3HBJA 3R9IA 5JD6A 2VYNA 1RYNA 2YWRA 3GGDA 5HIMA 3RS5A 5FUQA 3F0TA 3QIAA 3CXRA 2X9VA 4LW8A 4B75A 2IT1A 3B2QA 4XWGA 2PUVA 5E2AA 2GRJA 1CZOA 2CNOA 3FMFA 4LKRA 2AC4A 2OG1A 3IB6A 3QBEA 4Q00A 5L51A 3IUMA 1JA1A 3QUTA 1RPAA 2C7BA 3WLQA 5FUMA 1FSGA 3OHPA 1VM6A 5DULA 1JYSA 1OXUA 1XXLA 1WHTB 4YECA 2IPAB 3PR2B 3NEJA 1ZOSA 2R4UA 3JWHA 4HMOA 1KQPA 3N1UA 2AOWA 3EGDA 4OJQA 4MI1A 1KAEA 4PTLA 3IVRA 4RZ3A 4TLCA 4GI2A 3J81A 2W2QA 1C3JA 5IK2A 1N2BA 1A8SA 2JFZA 1ZICA 1JMYA 1JDPA 3LVQE 2HCFA 1A69A 4MQFB 1NQAO 5J2TF 3RHTA 4HQNA 2UYHA 3GGCA 3IPXA 2DBRA 1XMXA 1K5DA 3DDWA 2NMVA 1ZVJA 1OUMA 1XZBA 2M6LA 4U8GA 3ZUPA 2EP8A 2GZ2A 4QA9A 5BW5A 4BGDA 3E23A 4ZODA 3JQAB 1B2RA 1C1HA 1U7OA 3SMQA 4IVRA 1K97A 2H92A 4MYSA 5C4IA 4NNJA 3PFGA 4KQ2A 3B70A 1T4MA 4WOKA 4RDIA 5EUCA 2W48A 1PFVA 5EZ5A 3QMPA 5T3UA 1T6XA 4OX9Y 3QU2A 3P9IA 4IJVA 3R9WA 2I8CA 2ZSUA 1DTWB 2HEGA 1QTNA 2QTRA 5BSVA 3LUHA 3HCNA 3FA2A 5GV8A 4KX3A 3LM8A 3TE7A 4UHCA 2HMAA 4B81A 2ZSKA 4A03A 3Q2KA 1GGFA 2B34A 4QXOA 1C2YA 2O0HA 4PLGA 1K7CA 1IK6A 3VYSB 4BO8A 4EZIA 5F2OA 1NV8A 1X8KA 1E62A 1U0NA 2OOKA 4E5UA 4MS1A 1JJBA 2BDTA 1MB4A 4WFQA 2G5PA 2JGLA 2X4IA 1A4UA 1TK2A 1VL1A 1W9HA 2IHJA 2O7QA 2PZGA 5C8YA 4NJMA 3F5QA 5DNEA 3TB6A 1T0JB 2BT4A 1RJEA 1N2EA 3GJ8A 4TSFD 2VK1A 4YQEA 3S7TA 2GNOA 3PQEA 4OB7A 3AI3A 1FIUA 5IZCC 4OB8A 2W5UA 2HF7A 4RM3A 1G7SA 3I6QA 1SCIA 4ZOBA 1U8FO 2I6FA 4PZYA 4LJRA 4L76A 1OF1A 2AD1A 4DHEA 4O2AA 1C3VA 3I61A 4P0PB 1W85B 3KKPA 4N3AA 3NYRA 4GP7A 4NU5A 2G04A 2I3AA 4MI3A 1WW8A 4GR9A 3VZPA 4P0TA 3SK0A 1PNVA 4KMRA 2GPJA 2ZRBA 5JH7A 1XVLA 1I3LA 3DQQA 1T2AA 2H65A 4CUKA 1GNLA 5JATA 3WWOA 1AKRA 1U7PA 4B2LA 4BYGA 2R6JA 1JF8A 1ZGJA 2SCUA 1IRIA 2YNMD 3JSXA 2UZ1A 3Q7QA 4IDCA 5DSTA 1YAJA 1N2OA 4X1OA 2I1WA 4C7MA 2V45A 9ABPA 1MO6A 3BGSA 4H6WA 4QUDA 1I4DD 2FZKA 5FL3A 1SQ5A 1L4NA 4ZQHA 2VBGA 3AF6A 5FI5A 5K6AC 1NQXA 2MU1A 1UJ5A 3W04A 2VDKB 5JWRA 5DHPA 5AO9A 2YBDA 3WLTA 3OX4A 4XB1A 5JS6A 1FP6A 1FYVA 1ZJ6A 2CYBA 1YZLA 4URUR 4Z1MD 5FCDA 2FMXA 5LDHA 4JI8B 3NTVA 2J0VA 3ND8A 5HF8A 4RGQA 1FP1D 2VSOA 3CLRC 2A86A 3MS2A 4WESA 3FFWA 4H0NA 1QQBA 2WM8A 4EFLA 4BEWA 1VPVA 1GUAA 1WAMA 2W2NA 3FWHA 3G5AA 1X1TA 3K9GA 4H6VA 4RKYA 3C0KA 2OXFA 4X91A 2FA9A 1O7JA 4Y1RB 5ALVA 5KHOC 1W4LA 4B3TB 1Y9EA 1X42A 1M1UA 1G8FA 1A9YA 1EGAA 2DG2A 1FRVA 1BEZA 2O2GA 2SKEA 2WUEA 4CM9A 4EOGA 3UC9A 1KPGA 1C30B 1C3LA 1U81A 2EFJA 4MQMA 5LQJA 2EG9A 3IUSA 4ZOCA 4DSNA 2O8DB 3OEED 3UNXA 1W34A 3ZKWB 2GN9A 3BCUA 1Z0SA 2CFRA 2V6MA 5I7AA 1M7BA 1UM9A 2CLIB 3DBOB 4KSBA 4W6ZA 4Y2JA 4EF5A 2E6KA 5AESA 1RZRD 2R4TA 5EJ2A 1CETA 4NAHA 4YT2A 4U7FA 1HA3A 5FTLA 5JSZB 3VSBA 2WSMA 2XPCA 3NLLA 3NHZA 5FLKA 4BZPA 1APBA 2V7GA 1N6NA 1NVVR 3PPXA 621PA 3QELB 4UTVA 4GI7A 1WV1A 4RWEA 1QXSA 3MGKA 3ZVNA 1M72A 1SCNE 2L69A 1JXAA 3BB1A 3R5JA 3PBKA 3RFXA 3WKDA 1M6VB 3RVRA 4A5SA 5L6LB 2Z2KA 4GM1A 1KNQA 5DFAA 2Z6UA 4F9FA 1T2CA 3FOEC 4DUGD 1RYBA 1KAQA 4EG0A 3AB3A 3W5CA 4I4LA 2BIFA 1H4TA 4Q4HB 4R68A 2V0CA 1UPBA 3HI6A 4W4TA 3I2GA 3ZN2A 4AKIA 4OMDA 2MSDB 4EAAA 1GGJA 2GZ1A 1M8FA 4GHWA 4UMVA 1TQ2A 4FIDA 4P53A 3FY4A 4ZCTA 4DARA 2ZPUA 2P5YA 1IY8A 1K27A 1WP4A 3GLIA 1N2CA 5A5EA 4BBPA 2ZZNA 4UTXA 3VRHA 2UUBB 4B31A 4KGXA 1GT6A 1RHJA 3H13A 3L6OO 1WPGA 3RTAA 2PVPA 4BFUA 3PHCA 1HDGO 3HLKA 4KXQA 5DT2A 3TK1A 4DKXA 5EIEA 2GJ9A 3PC7A 3M4XA 1G3IA 4NBKA 3KYJB 3P71T 4BNHA 2PFGA 4RTPA 3B51X 2X2OA 1TA9A 3V8BA 1Y7IA 4YUZA 1UUFA 3WGNA 2GHRA 1BS2A 1PQWA 2HA5A 1XD9A 3INRA 2DX7A 4E1BA 2Y1KA 4EVQA 2PS9A 2FXIA 3NWBA 3RU3A 3N70A 1NJ5A 4NJOA 5CDGA 2ZULA 4DCUA 2VQFB 2OCLA 4A0FA 1WF6A 2CN1A 4EO9A 4MYCA 4ZI7B 3QHAA 2RD2A 4BB5A 3C14C 4G09A 5KDDA 2H7YA 2OPBA 4QELA 1ZAYA 1XMJA 2FPMA 1T3TA 5D5QA 4F3TA 3SOPA 4XW2A 2Q4TA 1WZNA 2FRDA 3I39X 3W5SA 3PFCA 2H31A 1D3AA 2CK3D 4MGIR 2ABWA 1IXRC 4BWGA 1RXUA 3NC0C 1GDDA 1H4VB 1MRZA 4K9QA 2WTEA 3A1VA 4FYVA 3ONFA 1EM8A 3F2IA 1JFVA 1ZOOA 4MHOA 1DT3A 3IMEA 2X8WA 3KAQA 1ZJZA 1IN7A 3MD0A 2QI9C 4BATA 1KPIA 3C39A 1IRXA 1F2VA 3WQRA 2F8TA 2YXDA 3LDAA 4ROSA 3G9UA 3VYVA 1IUNA 3W2TA 4I50A 3RDPA 1F9AA 3BWBA 3TVTA 3WLFA 2D5IA 1RWNA 2GD2A 2QN1A 3I01A 3IAS1 1WE2A 4C0KA 5LSAA 3HBAA 2W4MA 1HGXA 3CF4G 3MCVA 4NE7A 3JWGA 1Z7WA 2FEOA 3OZDA 4UNQA 2OHVA 3GT0A 3M49A 1JHQA 1EVJA 2CB0A 4YJFA 1XYGA 3FZQA 4ZEWA 3LPCA 3NC4A 1C81A 3Q40A 5I9SA 4RHEA 4XUDA 1DJLA 1V7CA 4OKSA 5JWHA 4BLSA 3R3WA 3JZDA 4UE6A 3S70A 3X1MA 4FSDA 4IL5A 5IWCA 1V5WA 3GJXC 2YHBA 4HDOB 1XL0A 2Z6AA 5IHXA 3IPRA 4X6UA 2IEIA 5TJ9A 4BAGA 1D0SA 1QCZA 1GQQA 1HZJA 1M10A 3DEHA 3K73O 1SHJA 3H2HA 3QOFA 4HB3A 3VU0A 4JHXA 3V4VB 4TLMB 2DPMA 1W44A 2QRHA 1VE5A 2LRHA 3AP3A 1I8TA 1FFCA 3H87A 4EBBA 4ER7A 1TMKA 1T8YA 1XEXA 1H9CA 2PYZA 4MRRA 1P2GA 3E5RA 4HTFA 5AMXA 5B1DA 1V71A 2OM2A 2R1TA 3LX4A 4L0QA 3S3TA 4Q4AA 3W8FA 3VVLA 2V7QD 3W1EA 2HA0A 2Q9CA 2A8YA 1Q7CA 2NUPA 2V8OA 1VBMA 5GY7A 4JOQA 3TSOA 3RRZA 1NASA 5BUZA 5CBKA 3A9RA 4RTKA 4D8UA 4P5DA 4XWYA 3A1SA 3THSA 3N2LA 5LQKA 4DJJA 4ALKA 3W7VA 1HYBA 2XYPA 3NH6A 3HLTA 2DCUA 3AW8A 1M8JA 1CR1A 3AERB 3LBAA 1E2MA 1Q0UA 5AI9A 3RYHA 4LZJA 1EINA 3I4CA 1JBQA 4HDMB 3TI9A 2R87A 4C7BA 4UTPA 1OLSB 4KOAA 3TQCA 2BMWA 4M1MA 5HKKD 3T7RA 1GUBA 3M3DA 4RV5A 3PR3A 2H5LA 1P60A 1IB0A 2CCGA 4J6FA 1AGRA 2GYUA 2RHCA 4OQQA 3CVWA 1CLUA 3ASVA 4UOZA 1J8DA 2OSBA 2QVBA 3BWDD 4HH0A 4JJFA 4MKXA 1E6CA 1YE3A 3QWHA 3IKTA 2X3FA 5AKLA 4FNGA 2FW7A 2JCBA 1P80A 3EHDA 3EPHA 2A9RA 3G5UA 4BNMA 1M8GA 2IZOA 3MGBA 3VNUA 1H6CA 1NY6A 1R64A 3FTCA 3O2SB 1OXMA 5DO9A 5TQ2A 2QW8A 4PZAA 1QYRA 3E1GA 4V2UA 1L3CA 1II8B 5F9MA 5I9TA 3WZ2A 1RKVA 2C0QA 3I37X 3GFTA 4PHTA 4DNXA 3ZBPA 1Y9AA 4OHKA 1MV8A 5ER6A 2VUIB 1LUAA 3KYBA 2PX2A 4KTVE 4LHZA 2IBTA 2DECA 1TMGE 2NN3C 2I67A 2X2PA 4EQ6B 1PBNA 3AP2A 5EXTA 3BREA 1NULA 1NVGA 4EVSA 1TPZA 1XDWA 2BM9A 2QQ5A 4MRMA 1V3VA 1Z08A 4RDCA 4U39A 3TH5A 4QVIA 1WZIA 1UKVY 5GGYA 1T8PA 1UEJA 3NM5A 1BRTA 5IRCD 2O7SA 1T34A 1JMKC 3KRTA 4QIHA 3FCUB 4QHTA 5TQ0B 1X8LA 4P4GA 1BAPA 4AKGA 1K75A 3FG9A 4E3ZA 1RM4A 1UJ4A 1JLHA 4YT5A 1ORRA 3M3PA 1D0IA 1SC9A 1Z8HA 3CUTA 4MMXB 4GYYA 3IQEA 3QHQA 3OM0A 2PRJA 4GDMA 5ALXA 1J8FA 2XYRA 5IEJA 2YVUA 1ZONA 3GR6A 2F2TA 1SUEA 3GQBB 3PR1A 1KP9A 1M34A 2EJVA 2YJ3A 3N0RA 4OHMA 2YZGA 4D8WA 5KVQA 2JJ1A 4DOMA 4FHZA 1E0KA 3OIFA 3DUWA 5LYJA 2ZWIA 3LNCA 3KD2A 4J0IA 2DY1A 3FKSD 4UNPA 2DY0A 1KI1A 4FYXA 4WNIA 1SKYE 1DFIA 2RGWA 4J4TA 1B6SA 1GR0A 2QDKA 2A33A 4ZV7A 4QOEA 2ATCA 3AH8A 1Q5PA 4MCHA 4OQYA 1OIWA 4E5DA 2IYWA 2BAGA 3TB4A 2HNBA 5D2CA 1PZMA 4O5OA 4ZYVA 5CD9A 5KQRA 2AQIA 2WWTA 3DL2A 1ZK4A 3R4CA 3COVA 5E2IA 2FG6C 1TO6A 1N4AA 3TLXA 4EG5A 5JFOA 5JMPA 5JXJA 1ZOLA 4IJQA 3EF1A 2H2FA 5DBHX 5EIHA 4YAIA 3L05A 2ZVJA 3WO0A 2N1BA 1XOIA 5HW0A 2WV7A 1BOOA 1KI2A 3PL1A 1B15A 3VAYA 3S8YA 1PR2A 2BEKA 4J43A 4DEXA 4KITB 1M1NA 3GPBA 2F1HA 2V5VA 1QH8A 4U6NA 1F5NA 3V4FA 3RSCA 4ZV4A 3VSCA 2IKQA 4D25A 5EXXA 2PEZA 5J40A 2WWHA 1O6FA 5JLAA 2HPZA 3ZWVA 3W3AD 1ITZA 3I2KA 1SKAA 2CXXA 2WZDA 2XHEA 5DCUA 3T0IA 5C1OA 1NN0A 5CXXA 2IYVA 1JKFA 4KE7A 2D00A 3UGQA 2NYVA 2Y9MB 1KHTA 3B1XA 2A0YA 2V4MA 3PRHA 4E3WA 3ZGZA 5AWFC 3CCBA 3BQNB 3OG9A 4GPAA 1UZUA 1Y5RA 3K1YA 2X4GA 1XMPA 4HG2A 5FWYA 1KI9A 2WKPA 2ZTLA 3IT1A 1BXRB 3OUUA 4NV1A 2WFLB 2VATA 1EP1B 4YV2A 5AHKA 5B57C 5KUTA 1BXGB 1ZRNA 3L8GA 4IGIA 1YBVA 3WMRA 1GYRA 2Z2XA 3KEOA 2CWDA 4RELA 1MRNA 4W5QA 4RTOA 1XJQA 1TYCA 3RIXA 4FR0A 3B89A 1R5OA 3FDIA 3WNDA 4CCYB 1EG7A 4C3UA 5JDCA 2DHRA 2CT8A 2XKBA 2XCSB 1JGTA 1KMCA 2IZ1A 5I51A 2HPAA 1VXRA 4MR8A 4MI6A 3D8RA 3KETA 4RHYA 1U8AA 1UMCB 3DP9A 4IGKA 1JECA 2OWEA 2B69A 2G07A 3JWIA 4PQEA 4U2FA 3TQIA 2VBCA 2FUG1 3CTVA 2FH5B 3EOAI 3IUNA 1NOKA 1Q83A 5IJXA 3WMEA 4ZJYA 5LC1A 1TIPA 1YASA 3LBHA 5LCXA 2NVUA 2AOTA 3C3DA 6LDHA 2DFLA 2PL5A 3EXFA 4MAAA 1BHO1 1CNEA 2DMRA 1NMQA 2X42A 5IXJA 1YDMA 4G1CA 5G40A 4L27A 1KQFA 1NSYA 2WHPA 4D0SA 1GPWB 2DQZA 2PVSA 3H6HA 4LV8B 4YRCA 1HYQA 3O3MB 3R23A 3ENVA 2Z2IA 3FXAA 4RFSB 4YHHB 3V8NA 1EZ4A 1XZPA 3BMQA 2IQ5A 1H5UA 4LGYA 1LI5A 5K9ZA 3CKKA 5J43A 3QSYA 4GFDA 1QFZA 1Z29A 1Y7PA 2RHOA 3GJYA 4DJ5X 1XRMA 3ITNA 4ZHSA 1EJBA 5K0BA 4FYPA 3TQTA 1V9CA 1WS6A 5YASA 3IVAA 3GO4A 3NWPA 4XB6B 4Q3LA 4BPBA 1I2ZA 1MGOA 1SXJD 3T5TA 3TD9A 3AETA 3SQNA 2JFUA 3J81k 3ZDDA 2D5AA 2H48A 2WUDA 3AV0B 1D2HA 3MUFA 3C3MA 2IYXA 2Y4NA 4DA4A 1PSZA 1H6DA 3K0FB 3JASA 1YI1A 3BTVA 4H7HA 5E7IA 2E82A 5L7WA 1OV6A 2QK4A 2GYWA 3F4BA 3GPLA 3BIFA 3HKBB 3LO5A 1DC7A 1UDXA 4A6PA 5C34B 2KMLA 1JVBA 1BWSA 2M1XA 3D6JA 4Z4FA 2J31A 2Z3VA 4G5GA 1JHDA 2R6CA 3LX8A 2AKAB 3OBIA 4I5FA 2AEJA 3FUTA 3KQTA 1KO1A 3UW1A 4L4ZA 1XBTA 5BNFA 5D3KA 1MQSA 1THMA 2FRVA 4DT1A 5H16A 3LK6A 4PRYA 1FS6A 3PGXA 3DXXA 3RM3A 1EFCA 2IHKA 2VDPB 1EB8A 1JI0A 5AKEA 2EGUA 2C42A 1ULBA 4F1WA 4BNWA 1HORA 4CV3A 1UAAA 1I7SB 4HAOA 2G82A 2GM3A 2A5DA 2GQ0A 3H7IA 2IXTA 2FZCA 3KZMA 3D8TA 3M6VA 3MLBA 3AVQA 4YTEA 4C7KA 3CLKA 1Q0TA 4C06A 2F3QA 1SXHA 4M3NA 3TLGB 2R0QC 1REQB 2WQ7A 1VYTA 3KJXA 1RI3A 3DR3A 2GCEA 1T6BY 3CLUD 4JITA 2QAGA