3C7EA

Crystal structure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
487
structure length
487
Chain Sequence
ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endo-1,4-beta-xylanase
publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 133
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7eA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7eA02
1JYXA 3C2UA 4DXRA 3DECA 4DUXA 2V5DA 2VDTA 5B6TA 1DLCA 2ZEXA 2QQNA 2X8FA 3MV11 5GLMA 3BYNA 5C0PA 1CX1A 2WO2A 2ZXQA 2X8SA 1J84A 1SDDB 2RV9A 3HNBM 3A23A 3VT0A 5B6SA 4KWUA 1YI7A 2VMDA 2ORXA 5JOYA 4OYUA 3T09A 5LA2A 4PT6A 1JHJA 3VD4A 4TTGA 2XOMA 4ARYA 3AKFA 2RVAA 3I3BA 5F7UA 2PQSA 3WF2A 4RYDA 3LFIA 3R4YA 1DP0A 1XPWA 3C8XA 3I2JA 2WDBA 2J1RA 3IDAA 1OH4A 4DEVA 2YC4A 1IQDC 1CZTA 3LPFA 2EIBA 2QQIA 2Y6JA 4KMQA 2WAAA 2WABA 3EYPA 3WNKA 2W47A 1W99A 3ACIA 4JKKA 4DXSA 2YC2A 2W1SA 5HPOA 2XONA 4UDIA 2Z4FA 3OGVA 2W91A 2QQVA 2VMCA 3A21A 4N4BA 3SC7X 3QEDA 1ST8A 4W50A 1JU4A 4BXSV 4XURA 1K42A 2W95A 1UYYA 1UXXX 3R4ZA 1NAEA 3T08A 4P02B 3UESA 2WN3A 2WUHA 1TVGA 2J7MA 2JDAA 4IUGA 1GOHA 2EIDA 2J22A 5FK7A 4EQVA 5A8DA 2Y8KA 3T2OA 3F2ZA 1UY4A 2LW8A 4A41A 3WSOA 4M4PA 4QAWA 2EICA 4UOJA 5A8CA 1XNAA 2VC9A 4GWJA 4XUOA 4A45A 3JXSA 2WN2A 4AAXA 1GNYA 3CZUA 5GLQA 4OUEA 4A44A 3R67A 3BGAA 3ETPA 4AK5A 4D0QA 3A22A 4ZY9A 3KSTA 5JXIA 4P08A 3QEFA 3WNPA 1R64A 5FMBA 5AYCA 2VMFA 5JXJA 3EB7A 3CU9A 5GLRA 3WF4A 5AYEA 4CU8A 4N1IA 4D8MA 1UY1A 4GWIA 1WCQA 1WL7A 5EJ1B 3VD7A 2AC1A 4KCAA 2HYXA 1UZ0A 2Y64A 3SEPA 3U37A 2J1VA 3HNYM 3FL7A 4MGQA 1XC6A 3T2QA 3LPGA 3UGHA 2BBAA 3ZXKA 3OM7A 1JZ4A 1W9WA 2VZRA 3OM4A 3SKJE 3AKGA 1L7QA 2C9KA 3HJRA 1UY2A 4M4RA 3IAQA 3LEKA 3OG2A 5LA1A 4QX1A 1F4AA 5CYYA 2VO5A 5FLWA 3LDKA 3HPNA 2DCKA 2ZEYA 2VZVA 2X09A 4OMCA 3C7GA 3I2HA 3U75A 1JZ3A 5JOWA 3OB8A 2KD7A 2ZEZA 5FIXA 1OF4A 2BGPA 3BYKA 4UI9L 2QQOA 3OBAA 3DYMA 3DYPA 2YFTA 3FN9A 2Y6GA 3ACFA 3UGFA 4BJ0A 3LEGA 5G05L 2WQ8A 4CUCA 1JI6A 4QDRA 2QQUA 3WF1A 5IJRA 3LDRA 3LQCA 4ARXA 3K4DA 3TAWA 1PT2A 3D60A 3HN3A 1ULPA 3E1F1 2CDOA 2B9VA 5IYYA 1T2XA 1UWWA 1GOGA 1UY0A 3LEMA 3OM6A 5JUVA 3BYJA 4AK6A 3AKHA 5HXMA 2BZDA 4PVAA 4FI9A 3NNGA 3VD3A 1WKYA 2WZEA 1W9TA 1YIFA 1LNSA 2VZPA 3OGRA 2ADDA 5CZKA 2X8TA 5G04L 3WN2A 4QQSA 3HEIA 3GGLA 3LIHA 3NJVA 3LIGA 3LE0A 4BDVB 4XUNA 3WPUA 4P00B 3PIGA 4U6DA 1UMIA 4W8JA 2VTFA 3C7EA 3P2NA 3ZM8A 4FFGA 5B4NA 5FK8A 1XNTA 2VZ1A 3T2PA 2B4WA 4KC8A 1W2TA 3NRUA 1NUKA 4FFFA 3GDBA 4UAPA 1Y4WA 1VKDA 4COTA 3LEIA 3WATA 4CUAA 4UDKE 2E26A 3T0DA 1SG3A 1YRZA 1O59A 3VT2A 3ECQA 2E33A 5A7VB 3K4AA 2W5FA 2X10A 5JOXA 4MGSA 2J1TA 4ET7A 3VDBA 3WMYA 3P6BA 3VDAA 2Y6HA 3WEZA 4D47A 3CKHA 5EIYB 2JE8A 2RJ2A 4KMIA 3QEEA 2VOTA 2QQLA 3OGSA 4AG4A 1MPXA 5ANNA 2VZOA 1W9SA 3MBWA 1NX9A 4O8OA 5JR2A 2LS6A 5I0DA 3PUHA 4W4ZA 3AKIA 1UYZA 2JD9A 1PX4A 3WF3A 1OYGA 2OXBA 5DN2A 3FHQA 3SKVA 3VSSA 4LKSA 3W5MA 2W1QA 3K46A 2EXKA 1US2A 3U14A 5JMOA 1UMHA 2VQUA 1PMHX 4ONZA 2ID4A 4P5YA 4Z2AA 3D5YA 2VJXA 2OKXA 3CQOA 4RN5A 3WNMA 4QX0A 1W0NA 2J1SA 2C26A 3CZJA 4QPWA 3C7OA 1JU3A 2QBXA 1UY3A 1Y9MA 5FMCA 4OZOA 2W94A 4JX0A 4QDQA 1KGYA 3GXUA 2V72A 1GYDB 1UXZA 2JKXA 2VCBA 3HNMA 3CIHA 4A42A 2J1AA 5LA0A 3K75B 1UYPA 2VZTA 2W1WA 3I3EA 5GLPA 2ORZA 2WBKA 4BK5A 3WNNA 2E31A 5GLNA 2DDUA 4FFIA 1P8JA 4KC7A 3C7HA 4A6OA 4O8NA 2WO1A 1JZ6A 2AEYA 3IB3A 4XVHA 3IAPA 3THCA 1GYEB 1ULOA 1EUTA 1PX3A 1GOFA 3WN0A 5FMDA 2BERA 4O8PA 2WYSA 4QX2A 5B4XA 1OD3A 3WF0A 1F4HA 5C70A 3OEBA 1W8OA 3CMGA 2WO3A 3PUIA 3PIJA 5GLLA 3WAUA 2XHNA 4E8CA 5FUIA 3QZ4A 1GYHA 1GQPA 1JZ8A 3K4ZA 2W9XA 3WPVA 1O8PA 3FHAA 1D7PM 1PMJX 3J7HA 1DYOA 3OEAA 4MO3M 3THDA 4A3ZA 5DPNA 4UDKA 2VL4A 1JZ5A 2WAOA 2VM9A 4XUTA 3MV01 3BYLA 4DEQA 1W8NA 2ZEWA 1JZ2A 1H6XA 1JZ7A 4NOVA 3I3DA 4JKLA 2EXJA 2Y6LA 2AEZA 2BGOA 1SHWB 3VSRA 3QC2A 5DQ0A 3VSFA 2VZ3A 3D61A 1GUIA 3ABZA 2CDPA 3OM2A 4DUWA 4CU6A 3ACHA 1K3IA 3VD9A 5EJZB 1W18A 3ACGA 3K1UA 5J1XA 4KCBA 2VCAA 3BN6A 2W1UA 3MUY1 3UETA 3KF5A 2DCJA 2V4VA 4TXWA 4XUQA 3WPZA 2HLEA 3W5NA 4AK7A 4UDGA 3T0BA 5C7GA 4QB1A 3C7FA 3OM5A 2VZSA 2EXIA 1UX7A 1NKGA 1CZSA 3K77A 4YPJA 2VR4A 4N2RA 4A4AA 2QQJA 3P1IA 4E8DA 1RYYA 4FFHA 3I2KA 2VZUA 2YFUA 1CIYA 3WNOA 1UV4A 1US3A 4U6BA 3I2IA 3D3AA 4QB6A 5IFTA 5AYDA 3LF7A 3VD5A 2EXHA 2C4XA 2W92A 3RWKX 1OF3A 5A1AA 2W87A 3I2GA 4JKMA 4GZ9A 5FKCA 4QDSA 3I97A 2XQXA 1L7RA 4QX3A 4XUPA 3WNLA 2X05A 2E32A 3WN1A 3VT1A 3MO4A 1JYNA 2W3JA 3DYOA 2VMEA 1OT5A 3AC0A 3CDZB 2L9LA 2VQTA 1JYVA 2YG0A 2ADEA 1Y7BA 1UYXA 3SEEA 2B4KA 4PF1A 5DMYA 2QQMA 3I2FA 2J1UA 2YB7A 5FKBA 2EIEA 3NQHA 4BK4A 3ZXJA 4UDJA 2XQRA 2QQKA 2YFSA 5JXGA 3WASA 4LPLA 1O8SA 1Y9GA 4DUVA 4JHZA 1EUUA 3GM8A 4LHSA 4MOAA 2YFRA 4L0PA 4XZUG 5C71A 5LCWL 4CU7A 1I5PA 5JXHA 4DXTA 4KI5M 4HG6B 3VDCA 3UNPA 3IIIA 3T0AA 5GLOA 3ZXLA 4CU9A 4PQQA 3HOBA 5IHRA 1TG7A 4QB2A 1JYWA 1GU3A 4ZXEA 5A7VA 3WMZA 1CZVA 1K12A 1J83A 3A7QA 4LQRA 2YFZA 1H6YA 2VZQA 2WZ8A 2Y6KA 1K45A 4ZZ8A 4MLGA 5AY9A 3MUZ1 1YQ2A 5IFPA 4N2ZA 3KF3A 4PVIA 3D5ZA 5GLKA 1KEXA 2VCCA 2R7EB 5JOZA 3LV4A 2J1EA 4OMDA 1HN1A 4MADA 2QQWA 3UGGA 3NJXA 4CVUA 3VSZA 1BHGA 1GMMA 4CUBA 4ZZ5A 3WPYA 2W46A 3WQBA
chains in the Genus database with same CATH superfamily
5A7SA 4P9JA 1RUJ3 4MUVA 5DAWA 4DUXA 1LOFA 1YFUA 2B9UA 1E57A 4CDXA 2X8FA 4YGDA 5C0PA 5CA6A 1CPNA 5HCAA 1V9U3 4GKYA 1CX1A 1WMDA 4BIFA 3LAGA 3IDCB 5I0TA 2ZXQA 5L73A 2P3KA 5T3NA 4FAGA 5F5CA 3JB8A 3HNBM 4YVSA 3OSDA 1ULCA 1MZFA 4Q29A 1RVF1 4QX7A 1JYTA 5GM0A 4EN9B 3SQOA 1DGRA 1FT9A 3F95A 4IL7A 4Q5OA 4UF0B 3C3VA 1XE8A 4UFLA 1UZYA 1HRI2 2NMOA 4YZ1A 5C9AA 1OUXA 1WBFA 2UY8A 5FREA 1JYIA 2VOKA 1V6NA 2RS33 4V1PA 1VRH2 2ZX3A 4HVRA 5DZGA 2VXJA 4TTGA 1HRV2 1FX5A 4XJAA 3USSA 2XOMA 2PA7A 4LBJA 5AVAA 3POBA 3IZOA 4RYDA 2JDMA 3R4YA 1AR91 2GMEA 1QJY3 2BQPA 2WNVB 4PIXA 3ZPOA 4Y5SA 2WKKA 1OH4A 3PURA 1LEMA 1L3JA 1U0AA 3MPBA 3ZYGA 4QHOA 3FBYA 2JG9A 3ILRA 4V2WA 4KMQA 5EJ3A 4JGZC 5FY5A 4DXSA 3ACIA 4YM1A 1AR61 4UDIA 2Z4FA 3A21A 3SC7X 2YY1A 1F5FA 1JU4A 1BEV1 4G3YC 4CDQB 3OD0A 2PHDA 1UYYA 4ZU7A 2VMGA 3T08A 4P02B 3UESA 3WDTA 4UFIA 4D7SA 2WN3A 5DUUA 1TVGA 1OA4A 2Y33A 5FY9A 4FPJA 1OQ1A 1MEC2 1O4ZA 2J22A 4ITCA 1TNFA 5K9YA 1GANA 3VBSB 2Z2SB 4EQVA 2Y8KA 4QGLA 5FP7A 1QNWA 2RMU1 2LW8A 4A41A 1DIWA 4YLZA 5H9QA 3GZUC 3WHUA 1AR93 2ZOEB 1YQ6A 1GNYA 1PK6B 3AYEA 2PHFA 3PNAA 2BGCA 3RG0A 5M0TA 2D44A 2RS51 5FYSA 4OUEA 2ZGPA 3AVRA 3BGAA 3VBOC 1W8FA 4PLMA 1FV2A 4D0QA 5FP9A 1SMVA 3A22A 1UIKA 4Y5Z0 3VHNA 2R062 4ASMB 2IXHA 5FZ0A 1AR63 1UNBA 5DXDA 5JXIA 3V0AB 3QEFA 1J59A 2BW8A 2R0FA 4EROA 2UYAA 5FPBA 1XE0A 2RDQA 2ZGKA 4YW1A 2WC2A 4XHXA 3VKMA 1S2EA 2GNDA 5GLRA 1WW4A 2ERFA 4O9GA 4CU8A 4D8MA 4N1IA 1W8TA 4IEPA 4JGZA 1NCQA 3RJRA 3UYJA 1UY1A 3J8F1 4X6QB 4KCAA 1OPOA 4V2VA 1TMF2 5EJ1B 3IIAA 4HT1T 3U0ZA 4GAZA 4WZFA 4E4DX 3U37A 1VBD2 4EN7B 1MVEA 2DCTA 2HWB1 4H14A 5FP4A 4QU2A 5C33A 5C8WA 4PDWB 3FL7A 2HWD1 1W8UA 4XQDA 1D2QA 2RMU3 1NOVA 5EFUA 1W9WA 1AZDA 3B93A 3MICA 1ZREA 3OM4A 2R1DA 2VY0A 4RFT0 4E9KA 4UW3A 4M4RA 2ZMKA 1CESA 3LEKA 1RUE2 3OG2A 3CJIA 4JTOA 1F4AA 1W6QB 2RS53 4OZXA 5CYYA 3ZYBA 5LA1A 1DQ6A 3HPNA 3ZOIA 2O0OA 2A1XA 1D4M1 5IK7A 1QY4A 2IXLA 2K0GA 4OMCA 3JB4C 4BM8A 2CSGA 3AYCA 5T54A 3D5OA 3U75A 4DO0A 2VVFA 4JC1A 4QPGA 1W6PB 2H6CA 2D93A 2HBUA 3NAPC 1HW5A 3OB8A 2XGXA 2ZEZA 3ON7A 1OF4A 3UV9A 1C8NA 1ND2C 5EHDA 3BYKA 3GNEA 1RUD1 2QQOA 4EZ4A 1NZIA 4B8EA 4BQYA 4N9HA 4DY5A 4BIOA 3DYPA 5D1IA 1SLAA 1VIWB 1W90A 3J8F3 3VZMA 2Y6GA 4JAAA 3UGFA 1NQDA 2YDEA 3LEGA 3GZEA 4M00A 5F37A 1JI6A 2PAEA 4YM3A 3LQCA 4Y1YA 1VBE1 1WLWA 2HWB3 2JDKA 3N7JA 3D60A 1PO22 1F5JA 1IGOA 2VD7A 3A0NA 1PIV2 3HN3A 3MGUA 2CDOA 2B9VA 2HWD3 1DGWA 2XUMA 3J7NA 3WP6A 5IYYA 3ATGA 2D5FA 1UWWA 1UY0A 3HD8B 3NKTA 3OM6A 4M0NA 4AK6A 4JZRA 4FOWA 4Q1RA 5FZ3A 4C1XA 4TSVA 4DY3A 4D6QA 1YIFA 2F4PA 2XVGA 1D4M3 4CDWC 1LNSA 1N1VA 5BNPA 2WLQA 1VBB3 2JICA 3E6DA 3GGLA 3POGA 4LKDA 3UK9A 1SFYA 1Y43B 3K48A 3N9MA 5GLUA 3WPUA 3M3IA 5IVYA 1RUD3 4E27A 3P2NA 4J25A 3N7MA 3ZM8A 4FFGA 4XETA 2BWAA 2R042 4MXVA 1OQEA 2JB4A 3B3QE 5AVPA 1LR5A 1O5UA 2RM22 2XDVA 4KC8A 5FZOA 5KHGA 1ENXA 4ZHNA 4FFFA 1VBE3 1O91A 3SNMA 3T4VA 4LE3A 5GLWA 3WR0A 3LCPA 2DVGA 1NZCA 4CUAA 2Q1MA 4UDKE 3E5QA 2ZPXA 4QT6A 3T0DA 2NQYA 4OI0A 1GSLA 2R071 3ECQA 3NSTA 3AZWA 4EV0A 1PO11 1W0OA 4FXKB 5I93A 2UYBA 4HVQA 2DUQA 2WZR1 4IV1A 3WOGA 3WMYA 5CADA 5CAZA 1EYBA 2EAAA 1H2MA 2D7FA 4D47A 1KJLA 5BV6A 4RR3A 2IVIB 3ZXEA 5I0SA 1IS3A 4RHV1 4IERA 4CCLA 4X8PA 4AFBA 2ARCA 5JPNB 2QQLA 4AG4A 1F15A 3O1OA 3B01A 3RYPA 3TEWA 2K9ZA 1QJU2 4LO6B 2DBIA 3U4XA 1V6LA 3GHNA 4CDWA 4COVA 5C6CA 1SBDA 4G4FA 1WCKA 2VNGA 1CPMA 3BCWA 3RZJA 4Y1VA 3KQRA 2Z69A 3PUHA 5DG1A 5A3MA 3K3NA 2TNFA 3MYXA 1LHVA 2P37A 1S55A 3AMHA 3ACLA 3VZOA 1JXNA 2YXSA 4YG6A 1STMA 3HT1A 3BOWA 3N9OA 5D8AC 5DN2A 1AYM1 5F3GA 4NPRA 4CP9A 4CSWA 4URAA 1SLTA 3VSSA 1ZX5A 3OGJA 3W5MA 2WS91 4LOSA 4LOTA 4CP2A 3IPVB 4JDMA 2VXRA 1UPIA 4CCDA 4QKDA 3U14A 1F31A 1SPPB 5JMOA 5A1LA 4FSJA 3L2YA 5J7MA 1PO13 2VOWA 3AZVA 2WZR3 2OQ6A 2ID4A 2ZA9A 3NAPB 4QHZA 2A71A 5EWSA 3ZX7A 1X33A 2OKXA 1UPSA 2SBAA 5L7OA 1ND2B 1D2SA 1EY2A 5ABJC 3AM2A 4DFSA 3RZMA 4RHV3 5KC5A 2XJVA 2OPWA 1VAMA 2DU0A 2BDRA 4I30A 2VW1A 3RYRA 1W6NB 1Y9MA 1GZCA 3WVJA 4CTEA 4AOCA 4AW7A 2GSYA 2W94A 1LJ7A 3MHZA 4JX0A 4QDQA 4GWNA 4QPIC 4XBLA 1GYDB 1CX4A 5A7NA 1UXZA 3PMEA 2JKXA 2GU9A 4HSLA 1BYHA 2OX0A 3J7LA 4K6BA 1C5HA 2E51A 2D6OX 2GDFA 3K75B 4M3CB 4NO4A 1SQ4A 4R8HA 4LBQA 5FYCA 2I74A 5CU1A 5AFBA 3VUOA 1OOPA 1XBFA 3VDDC 1CJDA 1E5IA 1KS4A 1AYM3 4HPKB 4IETA 2WNUC 5GLNA 2DDUA 3FJSA 2WWSA 4FFIA 4N53C 1H8VA 2MEV3 4A6OA 4IE4A 4O8NA 4PIZA 1AXZA 3BI3A 3D8CA 1EUTA 3JBG1 1GYEB 4MGKE 1NY72 5FMDA 5I0RA 4XEZA 4O8PA 2WYSA 3JU9A 3SH5A 2F6BA 4CA9A 2Q0AA 1QOSA 4CCCA 5BNOA 5C70A 4QXHA 2WO3A 4KL1A 1VR3A 2KR2A 2WA4A 4Z82A 3M7AA 2XBO1 5GLLA 4QQLA 2XHNA 4E8CA 5JPMB 3VV1A 1OVPA 2ZGTA 4RQPA 2ARAA 5ABJA 2HWC1 3VGIA 1BVP1 1NLQA 4GH4C 1PMJX 4YFWA 5EQUA 4UXAA 3M3CA 2HEVF 3POWA 3OEAA 1FPN2 3THDA 4A3ZA 3FFZA 4LA3A 3KHBA 4YW5A 4UDKA 2J42A 1HJFA 3M8LA 5LASA 4WVVA 4AI1A 2WAOA 2PN5A 2VM9A 3AXDA 1AUYA 2ZX0A 2CAUA 1W8NA 1JZ7A 4FPLA 5FY7A 3LSEA 3M3QA 1NE4A 4I3PA 1W8WA 1G9BA 3SITA 5CISA 4CE8A 1RUOA 3JBG3 1SHWB 4D7TA 3VDDA 5DQ0A 3AK0A 2RDSA 2RR12 2VZ3A 4OI2A 3OPZA 5SV5A 2CDPA 4AR2A 1RUF2 4B29A 3V0BA 2JXAA 2DV9A 4LLOA 1MS0A 1W18A 2AZ5A 3K1UA 1OC1A 1ZZBA 2XBO3 3BN6A 1S0DA 1A6CA 2W1UA 4CPBA 2XL9A 3ZXFA 2JDUA 2DCJA 2V4VA 4TXWA 2HWC3 4LMFA 2IUWA 3VBFC 5D8AB 5FZ4A 4UDGA 4D6RA 1HB1A 4QB1A 3WLUA 3C7FA 2JDNA 3QOPA 2WNOA 4PIYA 5DUXA 1AL0G 3MIFA 1W2AX 1LEDA 4LBNA 2FBEA 1VRBA 2WWUA 1CAVB 3FX3A 3P1IA 3ES1A 3SCFA 1V6KA 2VZUA 4U6BA 1C4RA 3I59B 3MI8A 5A80A 2ZCWA 4Y26A 1ZZ6A 4LK7A 4LIUA 3ZFFC 4CCNA 3LSDA 5E6HA 1BMV1 1AR81 1QGLA 1ZVFA 3BPSA 3RZLA 1U5XA 2C4XA 4PBOA 1UOFA 2ZX2A 2JB8A 3B5LB 3MF9A 1YQ5A 4QPIB 4M3CF 4S2GA 3EQEA 1CAXB 4GWMA 3D4KA 1U12A 4R9BA 5JDBA 1YQCA 4NRQA 2E32A 3RZKA 4OUSA 1GFF2 4CCJA 1OLQA 1U5ZA 5CG9A 5FUNA 1IPJA 3AC0A 1WGPA 1JYVA 1SEFA 5C4WB 4Y20B 2WNUB 1AL22 2FZ2A 3SEEA 1FV3A 4N53B 4L2NA 5DMYA 3BU0A 1S0BA 3NV3A 5KHJA 3DPRA 5JI7A 3H8XA 1AX2A 5FYYA 5FYMA 2D3PA 4R9DA 1XOYA 3VBRA 1UCXA 1F2NA 4Q0SA 1ZBA1 2FHRA 1FNZA 4LHSA 5IVEA 4XQ4A 3DF0A 3PVOA 1AR83 1S0GA 1XB9A 3K2OA 4OQ9A 4B3NA 2HEYF 3RRDA 1QJFA 4EYUA 1MZ6A 5LCWL 3T3YA 1RHI1 1MQTC 4YGCA 4A2UA 2DVFA 1U5IA 2ILMA 3VDCA 2VBPA 4EN0A 1H9WA 5FQ0A 1BJQA 1OI6A 3J26N 4GH4B 2WJSA 4UT5A 5FYHA 4CU9A 5I91A 2E53A 3RI8A 1AYN1 5FZ8A 2ZMLA 3IMNA 5BPXA 3WP5A 1DF0A 4XIKA 2CWMA 3ZXAC 3TB0A 1HB2A 1SCSA 4OI1A 1RXFA 1RUC3 4Y22B 4Q0QA 2YROA 3MFAA 1H1AA 1HKDA 1K12A 4WVWA 5FZDA 2DWRA 4U36A 2V4AA 2YFZA 1H1MA 1NXMA 4QM9A 1PGW1 1D0HA 1AHSA 4N2ZA 1ZBA3 3I3QA 1ULGA 4IDZA 5GLKA 1W8HA 3N9PA 3SHRA 3OPTA 2HWE2 2BNNA 1LTEA 3M3OA 3TNPB 3PDQA 4YZ3A 1HN1A 2Z79A 3ZSLA 4I0AA 2VUAA 2QQWA 2DVBA 5FYUA 1RHI3 3NJXA 3ZN6B 2VQ0A 3VSZA 5A3OA 1ZZ7A 3LWCA 5IATA 4AVAA 3I3MA 3U1XA 2WYFA 1CAWA 1IS4A 1OBNA 4COZA 3VBFB 2K2SA 4E4SA 5A6YA 4AGVA 4DXRA 2V5DA 5DAQA 2DU1A 1DLCA 1E5SA 2ZEXA 3R4DB 5B6TA 5JZGC 1AYN3 1QDOA 4OFGA 3BYNA 5LEKA 1VMFA 1Y3TA 4QKNA 1COV1 4BPZA 2TBVA 4KWKA 4H2AA 2PHRA 4AEDA 2HKXA 3ZFEA 4W65A 1SDDB 3H3ZA 2DFBA 5LK5A 2JDHA 4AHYA 3VKOA 3KS7A 3VT0A 2BYVE 2JIJA 3DUIA 1HDKA 4KGGA 3VL9A 4FOQA 1LGNA 3CLPA 1RUH1 3ZFFB 5JSRA 3DKQA 3VZNA 4XFCA 4Z1VA 1T6BX 4CDUA 5IT6A 4XXPA 4QGNA 3KCYA 1BBT1 3H0OA 4G9SB 4ATEA 4DB5A 3N36A 1Q5OA 4XDQA 2RJLA 1OSGA 4KGQA 3VD4A 4JGYA 4ARYA 1S0EA 2RVAA 2ZX4A 3ILNA 3RSJA 3TN92 4LLFA 2PQSA 3UKNA 3LFIA 3MW3A 1G7YA 1EV12 1W6MA 1ALYA 1RITA 3GJBA 1DGWX 3VZLA 5FO9B 1IQDC 4GB31 4GJZA 3M4FA 3NJYA 3OBZA 4R4ZA 3ZPYA 3HQRA 5DDJ1 2WAAA 2WABA 1YUDA 1V9U2 2QDRA 2RG4A 2D3SA 1ZRDA 2YC2A 4AF9A 5GZGA 1COV3 1JODA 5A3NA 2W91A 2QQVA 1XYOA 2VMCA 4IEWA 4LEJA 4NIDA 4EN8B 2PHWA 4XW3A 1IZ3A 1ENQA 3QEDA 2K46A 4K9SA 5T55A 1K42A 1ZZ9A 1ASJ2 4IESA 2FMYA 4KWLA 4L99A 3R4ZA 1NAEA 2D3RA 1NCRC 1TE1B 5BXXA 1RUH3 2OUJA 4QXCA 2RS32 2X5IC 2HH9A 4IUGA 1GOHA 3B00A 1C8M1 4LK6A 2D97A 1RMU2 4J1WA 1EAH1 2BNMA 3J9SA 1BBT3 1X8EA 3KD4A 3T2OA 2WFF2 5A8DA 1MQTB 1RIRA 2BP6A 4NAMA 4MYEA 5EXOA 5FOBB 1W05A 4M4PA 5FO8B 2EICA 4CCKA 5A8CA 1XNAA 2VC9A 4Q4W1 5FLHA 1UOBA 4AEMA 1N3OA 4AI0A 4NPMA 2VTXA 1H0BA 4IGQA 4HKWA 1W9YA 4IE7A 1HXS1 1WCDJ 3M3EA 5GLQA 1FMD2 4A44A 4AFAA 3R67A 1LHOA 1NG0A 4GB33 3ETPA 4QHBA 4AK5A 3RPQA 5EYYA 5DDJ3 4P9XA 5CFCC 4FT8A 4IE0A 2AENA 3M1HA 4P08A 5FYVA 1LODA 1QJEA 4FTSA 5FMBA 3TOJA 3IDEA 1WBLA 3EB7A 2XL7A 3CU9A 5BUVA 5A3WA 2QUOA 2JG8C 2A5ZA 1GICA 2ZAHA 4GWIA 3SCGA 4BQ4A 2AC1A 3AMNA 2HYXA 1WA6X 3S7EA 1Z0HA 3N35A 4PLOA 4R52A 1ZA7A 5FY0A 1C8M3 4YW4A 3H42B 4FQ4A 1EAH3 3O7OA 5FOJB 2JWPA 2VE1A 1W2UA 2LUWA 3LPGA 4KG0A 3ZR5A 3ZXKA 1VPHA 3Q8BA 3WW4A 4Q4W3 2VW2A 3KCCA 5CG8A 2YU1A 5BNNC 2RDNA 5C3OA 3AKGA 1O3TA 3EXUA 1HXS3 2A3XA 2WNVA 2IXIA 1UOGA 2RJKA 3ASIA 3LDKA 4NIHA 2DCKA 1NA1A 1GYKA 1Z7S2 2BV4A 1H2LA 2X09A 1OPMA 2OYZA 5JSPA 3SH3A 2E9QA 3OTFA 3I2HA 2AH2A 2CWSA 2H6BA 5IVVA 1BVVA 5T5JA 4A7YA 1AX1A 1XQNA 3IWZA 2NPIA 2BGPA 2C1FA 1AR71 4B4QA 3B9IA 3DKWA 2CGPA 3OBAA 3WV6A 5L19A 1QXPA 2PYTA 1VB4A 4XDOA 2ET7A 2RS11 4IEOA 4CDQA 2YFTA 3ACFA 2ZS6B 4BJ0A 1RUG2 4L92A 1CVNA 4KBZA 1Q8PA 4QX8A 5G05L 1PGL1 3WP4A 1W3XA 4XFHA 4QQ2A 3TAWA 1PT2A 5HV4A 3BTYA 1ULPA 1H8TC 4XF9A 3VKNA 3WINE 3VBSA 3ZFGB 1NLSA 5GLVA 1GOGA 3H7YA 4CCOA 4ES9A 2BZDA 4C1WA 5FZFA 3VD3A 3NWKA 4QQPA 1R1A2 2XJSA 3KVBA 1PK6A 1WKYA 4P9YA 4GKXA 3W9AA 2VG9A 4FP3A 4HXCA 1JUIA 5ACA1 3D0JA 4JRLA 3DL3A 3GCXA 3OGRA 2X8TA 2GC3A 3WDXA 4CP0A 3E5UA 1RXGA 4LTAA 2WIIB 1HLCA 1NCRB 3A0KA 1GP6A 3H50A 3LE0A 1SBEA 3LIGA 3ORJA 4XUNA 4BDVB 5A3LA 3PIGA 4U6DA 2VBBA 5FCCA 1AR73 2X5IB 3ME2A 4W8JA 3OY8B 2VTFA 3C7EA 2G1MA 3IM0A 1AJOA 2RS13 1FNYA 5FK8A 4YW7A 5F32A 2NMNA 3T1MA 1N3PA 3AKQA 2VVDA 2B4WA 3N7LA 1UD1A 1W2TA 4IE5A 4B7KA 4NIGA 4B7EA 1NUKA 5F3EA 4EWAA 3GDBA 1PM4A 4UAPA 5LRRA 1X82A 3BTAA 3UL2A 1CONA 1VKDA 4RD7A 3LEIA 4MGZE 4Q4X1 3WATA 4PDWA 1W3VA 3BTZA 2E26A 4AQSA 2PHLA 2WSUA 2E7QA 4QWNA 5CFCB 4LO4B 3K4AA 4YZ2A 1RVF3 4LNVA 4OCTA 4DRVA 4HLTA 4MGSA 4FPEA 1W06A 5T50A 1LRHA 1W6QA 4RS5B 3VDAA 3HBKA 3WDWA 1VBB2 3CKHA 2JE8A 3KB5A 1N1TA 2WNEA 4KMIA 4CEWC 1XNCA 2JG8B 2CTVA 2LRPA 2OZJA 2PHUA 1MPXA 3AMQA 1W6PA 5DZFA 2VZOA 1JS9A 1RUD2 2BTVC 5FP8A 1W9SA 5BYNA 5LEJA 3MBWA 2WT2A 4FPHA 1ZYBA 3GF6A 4NPLA 4Y24A 2YV8A 2FDKA 1OMIA 2R0HA 1XSRA 5JR2A 3R4UA 2TUNA 2LS6A 1ND3C 5HBAA 3PJYA 2VULA 2YPJA 3AKIA 5LW9A 2OIIA 1PX4A 1W39A 3RFRA 5FV3A 4FTBA 4XYXA 1F8VA 2OXBA 1QQP1 3FHQA 3SKVA 1SLLA 3UT0A 4Q4X3 4LKSA 2Z42A 4M3CE 4QD2A 5LRSA 3LDBA 5B2GB 3K46A 5TSWA 2NM1A 2Q4SA 3IBMA 1QIQA 1YO8A 3EO6A 1US2A 3CHXA 1BEV3 3BIWE 3H8OA 1PMHX 1YQ8A 4CXXA 5I0UA 4WVMB 4L8QA 5FWEA 5FPVA 4TYSA 2P3IA 2D98A 3D5YA 4KU7A 1KRIA 2YPDA 1W2NA 4RN5A 1I5ZA 4OULA 1SDWA 2HJIA 3FC0A 4XOGA 3KV6A 4YW2A 1LU2A 4KQ7A 1IOAA 4FBFA 3BB6A 5GLTA 2MHFA 2QBXA 3ZYIB 1TEIA 1R082 1AVBA 1HRI1 1LOAA 1ZZ8A 2PHXA 4QKBA 1H9PA 5AC92 1I1EA 3GXUA 2V72A 3E6BA 3EBRA 1VRH1 3G7DA 5LWBA 4GXLA 1A78A 1HRV1 1H8TB 1R092 2ZZQA 3CIHA 5DAXA 4CEYC 5LBEA 4OHWA 1W2OA 2SLIA 5LA0A 4YWAA 4TZDA 2VZTA 2W1WA 2Y60A 1S4CA 1DQ4A 5FZEA 2ZGMA 2FZ1A 5GLPA 3S5AA 1QQP3 4ISQA 5CIRA 2A3WA 1Q8SA 3OF1A 1OVSA 2E31A 4BK5A 5GLZA 5KWRA 5FPLA 4COUA 4FVVA 2B7YA 3C7HA 3KSCA 5C3QA 2ATFA 1UU4A 4W6WA 3WDYA 3IB3A 3MW2A 4XHBA 5IAVA 4S2FA 5IVBA 1Q8OA 4I09A 1HN0A 1K5MB 1WZXA 2C9AA 4SBVA 3VBOB 2P1BA 1CD3G 1GWLA 1KDKA 4WM8C 1JOJA 4XFBA 5B4XA 3WF0A 1F4HA 3BODA 5KXDA 1RUNA 3PIJA 4XJWA 4CP1A 4YSFA 4JV4A 5FR3A 2P3YA 3AL5A 1ZM1A 2UURA 5DABA 3RZHA 5FUIA 1HRI3 3QZ4A 4YARA 4CZSA 2P4EA 1MEC1 4XAAA 3WT3A 5FZ6A 3S30A 3K4ZA 2W9XA 1VRH3 4YFZA 3WPVA 3AL6A 1HRV3 3J7HA 3WUCA 2ZX1A 4HETA 2CV6A 2DBNA 2D6KA 4IEZA 3O1VA 1REEA 5LK7B 1JZ5A 3OYWA 1RJ8A 3PU8A 2XVKA 3GBFA 2MEV2 2VNOA 4O61A 4INDA 1G9CA 5CFDC 3MV01 4DEQA 4UW5A 2XJTA 2ZEWA 2UWBA 4HK9A 1FI2A 2VUCA 4NOVA 2EXJA 1FXZA 2R061 1VB2A 1OQDA 3IPVA 1SPPA 3ZN5A 5JIAA 3D82A 4CEWB 2ZGRA 1VMJA 1WW7A 5E88A 4Q0UA 3D61A 4EWEA 1GUIA 1DCSA 3NAPA 1BLZA 2BU9A 2NN8A 1UAIA 2PELA 4O7XA 3ACHA 1K3IA 1ND2A 3VD9A 5EYXA 2ETEA 2Q5TA 1TMF1 3GYDA 1ND3B 5A1FA 1APNA 2VCAA 1W6NA 2H0BA 5I8TA 1Y9QA 1MEC3 1VBD1 4N43B 3OGGA 3WPZA 3W5NA 3NKGA 1GV9A 3U78A 4NE9A 4BLIA 3T0BA 4R9AA 5C7GA 4URTA 3ZXDA 4AGGA 2VBDA 4YGEA 4TLFA 4BCUA 2RHPA 5J36A 1FATA 1KJRA 2O1QA 4M3CA 3USUB 4BQ1A 5FYIA 1XSQA 3JUUA 2VGDA 4A4AA 2QQJA 4NHYA 2WT1A 4HPKA 3BU7A 3S6PA 4E8DA 3I2KA 5FP3A 4IGOA 2YFUA 5K0UB 1A8MA 1V6MA 1N1YA 1US3A 2R063 1WW6A 3D3AA 3I2IA 4XBNA 1B35C 2OS2A 2CY6A 4LKEA 4HVOA 3LF7A 2ES3A 2XLGA 3GCWA 1XU1A 1KQRA 5LB6A 3AB0A 5KBFA 3ZYRA 1XNDA 2VECA 5A1AA 2PLV2 4HKOA 4OHVA 4YM2A 3V56A 2DURA 2A6YA 2QJVA 3I2GA 1TMF3 4QDSA 3I97A 4QX3A 4XUPA 3VBHC 4ZKTB 3H8RA 4CEYB 1XXNA 1QMJA 3VT1A 3MO4A 5FY8A 2FCTA 2JDPA 3DYOA 1VBD3 2VMEA 2R073 1PO21 1SACA 2PFWA 4XFAA 5FPAA 1PIV1 3RMXA 2VQTA 2WWJA 2QZ3A 3MLJA 4RGGA 4AQ6A 2JE9A 1OD5A 4FP2A 4F3JA 5LY1A 3Q8EA 4PF1A 2BEOA 3D0SA 5ISLA 5E16A 1CAUB 2VU9A 5FKBA 3VLBB 2EIEA 4N7IA 1S0CA 3NQHA 3NVCA 3UJQA 3ZXJA 4JDNA 2D6NA 3AYAA 2QQKA 2N7GA 2YFSA 3BKZA 1YIPA 3SH4A 3QH7A 4KG8A 3WASA 1MS3A 4XJZA 3R4SA 5FJKA 2CU5A 3GM8A 4WM8B 4BLJA 4AVBA 4QQHA 4Q4V1 3NNFA 5FYZA 5A7OA 4Y1ZA 5F3IA 3H7JA 4CUGA 4NOTA 4XZUG 1O7FA 1WMEA 4EZHA 1NXD1 3THPA 2R041 2DCZA 3R6SA 2WO7A 1HB4A 4Q4Y2 5A32B 3DEMA 5C4WC 3T0AA 2RM21 3VBUC 2C6SA 3ZXLA 2WS93 2VUDA 2I2SA 3P3PA 1TG7A 1PO23 1JYWA 3I4IA 1PIV3 2BJSA 1GU3A 2JDYA 3IT8A 1LHNA 5A7VA 3PTYA 1WWYA 4LITA 5CFDB 5D8AA 5KXEA 4ZU4A 3WMZA 1QNYA 4IV1B 1CZVA 1D4VB 2AUYA 2MPFA 1GWMA 4M01A 4RR3B 1QH6A 3KT1A 2Y6KA 3KGZA 1CAVA 3IMMA 5AY9A 3MLLA 4I3GA 4MGYE 2PMWB 1Q8VA 3ZMNA 1KEXA 4A7ZA 4QX5A 3I59A 5KXCA 4Q4V3 5KR7A 1JOPA 3PUQA 5CKQA 3ZLIA 4BQ3A 5L9VA 3LV4A 1SZBA 2P3JA 3BIEA 1KD7A 4EN6B 4MADA 3PVEA 1QJU1 3ZN4A 1OHFA 3POSA 3RI9A 2VOXA 4E2QA 4BISA 4K8FA 3WHTA 3WPYA 3H3LA 5F5IA 1PNFA 4QPIA 4BH9A 5BNQA 1JYXA 2CGOA 4Q26A 3C2UA 1CAXA 2RM23 3DECA 3AZXA 1WA4A 4LIVA 5GLMA 2Q8OA 1QJX2 5FZCA 1RUC2 2P6HA 2R1BA 4P9LA 3U4SA 2GC2A 2HBTA 4AI8A 3PJQA 1A34A 2X8SA 2FDHA 2RV9A 5C4WA 2XB6C 1ZBE2 2ARBA 2WNUA 3A23A 3AKPA 4N53A 1JH5A 5A7WB 3VHOA 5B6SA 1YI7A 2FCVA 5FZAA 4YM0A 3NO8A 4LHKA 5A70A 1B35B 2ORXA 5FMOL 3TBDA 4LXLA 3T09A 5LA2A 4ES8A 2DVDA 1DLLA 1JHJA 3G6JB 5T5LA 1H4HA 2XMLA 1QH7A 3P3NA 4OLLA 5FY4A 5F7UA 2Z5WA 1NE6A 1YXWA 5FJHA 2DTYA 3VBHB 1QJU3 1W6OB 3I2JA 1T6GC 3AYDA 1GKBA 3VHRA 1QOOA 2YC4A 2B8MA 3CU7A 1CZTA 4LO8A 2A6VA 3UKTA 2EIBA 5T52A 2QQIA 2VNVA 1TME2 4RSUA 4IE6A 4JQTA 3EYPA 5JMCA 2XR4A 4GH4A 2W47A 1W99A 4JKKA 3SCHA 3WNKA 3KT4A 2XONA 4L9BA 3OGVA 3AZZA 2YGLA 1ST8A 1UU6A 4J1XA 5FZIA 3WQBA 4BXSV 4IQPA 4IXLA 4XURA 5D21A 1FOD2 4KWJA 3TWIA 1PVC2 4WM7C 1MS4A 4XTPA 3KWVA 1XNBA 1NY71 2J7MA 2WR9A 3Q9OA 3B02A 1K5JA 2GH8A 2EIDA 1QHDA 3PLQA 4XFGA 4YRDA 5F1RA 1MS5A 5FK7A 5A3PA 3F2ZA 1RTVA 2D6LX 1J3PA 3ENRA 4I0BA 3WSOA 1X50A 1RUI1 3O0VA 5FUPA 3ZSKA 4GWJA 4OI4A 4XUOA 4A45A 1TNRA 2WN2A 4MV2A 4AAXA 2IWGB 3VBUB 1KFXL 3WDVA 2ZJCA 1BZWA 1LECA 4GJYA 5JAXA 3N9NA 1LULA 2XLAA 3VBFA 1FPN1 4YG3A 1SLBA 3WNPA 2QKDA 2HYKA 5C8CB 3LOBA 5AYCA 2VMFA 4META 5CNAA 4GULA 2GP3A 4XF1A 5JXJA 1PMIA 1VP6A 4GMP0 1UKGA 2EAKA 1ENRA 2JENA 2MNGA 4Y3OA 3I49A 1SLIA 4XMAA 5DZEA 1WL7A 4DINB 1GZWB 3AX4A 3NNJA 2RR11 3SEPA 3MIHA 3ZFFA 3ELNA 5FZ7A 1MZEA 1RUF1 4FXGB 4RFRB 3HNYM 1IPKA 1NYWA 4BQXA 1XC6A 4Q1PA 3T2QA 2WZPP 5C3SA 1PGSA 3VZKA 3OM7A 1RUI3 1JZ4A 3O1MA 4FQZA 3SKJE 5KC6A 1L7QA 2KXLA 3HJRA 3IAQA 4QX1A 2VQAA 4Z07A 2VO5A 5FLWA 3PVBB 4BU2A 2YU2A 1VAKA 1XJAA 2VZVA 3GZTB 3TNQA 1LU1A 4XAEA 5GJ6A 3PVNA 1IHMA 3RMYA 1DGRN 3C7GA 4XJUA 1JZ3A 2H0VA 5FO7B 3ZSJA 5JOWA 3KGLA 3JD72 1YWKA 1UZZA 4P9IA 2KD7A 1VJ2A 2YBPA 3AP9A 3M2MA 2FD8A 4MXWA 4Z2WA 4UI9L 2VVEA 4HONA 4F7ZA 4MZUA 4OHYA 3RYKA 3O14A 2CYFA 4WZCA 5EV7A 4BQ2A 3B7MA 1HB3A 2BWCA 4W6YA 2WQ8A 2XJRA 2OVUA 3AKSA 3VHPA 2RR13 3ZYHA 3WNXA 3LFMA 5IJRA 4JCKA 1RUF3 3ZKYA 3K4DA 1GBGA 4FPFA 4ARXA 4D94A 4QM8A 4BMBA 3E1F1 5FPUA 2JX9A 1QXRA 4E2GA 3TEYA 4WV8A 4AVSA 1T2XA 1Q56A 1MQTA 5C3PA 1GP5A 3R05A 3BYJA 4HL0A 3POYA 1YCIA 4TWTA 4ZS3A 4PVAA 4FI9A 5IWFA 3H8UA 1Z78A 2CAVA 4MHUA 4EWDA 1UZWA 1WLTA 1YHFA 2VOVA 2WZEA 5FXXA 4A7KA 2BUKA 3AP6A 3WG4A 1BCXA 1AF9A 1VBA2 5L9BA 3WW1A 4AEKA 2VZPA 2ADDA 3ZVXA 1VBC2 4IEYA 5HCBA 4RGAA 3FUOA 3J4UH 1PZ9A 4D69A 2GN3A 4QQSA 4WM7B 3HEIA 4OVEA 3HQXA 4XZPA 5ANQA 4BQ5A 3VN4A 1W28A 2X29A 1IG0A 1FAYA 1LAJA 4AL9A 1QF3A 4NHMA 2IFRA 4HMZA 4PLNA 5B4NA 1XNTA 2VZ1A 3ZFGC 3PTRB 3T2PA 1RUJ2 4K8RB 4QU1A 4PHZA 4UBGA 4WBBA 1C5IA 2AGSA 4XF4A 4BMEA 4HZFA 1Y4WA 2Q1FA 1IPSA 1RC6A 1C3HA 5H9SA 2XLFA 1YRZA 1O59A 3VT2A 2GNTA 4ISRA 1WCSA 4L97A 4CYDA 2E33A 3HAGA 4BE3A 2X10A 3U07A 4QQOA 3VDBA 5JZGA 4LBOA 4DRRA 3KV4A 2B5HA 2ET1A 3P6BA 3W58A 5J37A 3DXTA 3WEZA 4FPGA 5EIYB 2R30A 4U2AA 1URXA 3ALQA 3RS6A 4XPVA 5SV8A 2VOTA 3OGSA 5I8SA 3OUJA 1V0AA 1SBFA 1QJY2 2QDNA 4Y33A 1NX9A 2RS12 2Q30A 2QZ2A 5FLIA 5I0DA 4LO7A 2HWE1 2JDZA 3Q8CA 4I02A 1MZ5A 2IC1A 5J98B 1DQ5A 4DPNA 2JD9A 3MZHA 1CIWA 4PI0A 4XE9A 1OYGA 4RL7A 1L7LA 1VMHA 5IK5A 3QBQA 2GMPA 4HBNA 5LBBA 2WA3A 4RS5C 1LOGA 1JYCA 1OH3A 2W1QA 2Y34A 3HMYA 4XC9A 3ZFGA 4E2SA 1DFQA 2WT0A 1RVF2 2GZWA 4K3UA 2VQUA 4XTMA 4ONZA 2G19A 1C1LA 3KV9A 2BVVA 2E6VA 1HQWA 1YFXA 2IXKA 3UKVA 1PVXA 2VTXJ 1REDA 3WQ1A 4UF0A 1VLNA 1W0NA 1NT0A 1DQ2A 2J1SA 2PAMA 3CZJA 4QPWA 1FYUA 4NVPA 2ZHLA 4AFCA 2B45X 1JU3A 1UY3A 1CWPA 5A6XA 3FE5A 1NCRA 1AR92 1DYPA 4P5HA 4OZOA 4FOYA 4PBPA 4XCAA 4H55A 4XACA 5FAXA 3GALA 1GNZA 4K40A 2X5IA 2YBSA 4F83A 2JEMA 3OY8A 1LOFC 1HQNA 2VCBA 3HNMA 4A42A 4CDXC 1AXKA 1E5RA 2UWAA 2O8QA 2J1AA 2HWE3 3RNSA 5A33B 3TN91 5HI0A 4OQ8A 1YYNA 3LGRA 1AR62 1EV11 1O3RA 2GH2A 2ZBJA 3I3EA 2C0ZA 1UKRA 2HWF1 4YVSC 2WBKA 3O0WA 3T4HB 2R32A 4XF3A 2X53S 1BEV2 4HKLA 2B46X 1BQPA 4LBMA 3O1TA 2WO1A 3FBMA 3W20A 5LZ6A 1HQLA 1V9U1 3IAPA 3THCA 4DNYA 5CFCA 1PX3A 2FDFA 2BOJA 1OA2A 3VB9A 2TEPA 4X8NA 1GOFA 5LY2A 3T30A 4Q0PA 4BOWA 3Q8FA 4RS5A 1H2NA 2OZ6A 2XUEA 3LZZA 5JSOA 1ASJ1 5CBLA 1OLRA 3RZZA 1W8OA 1WD4A 3CMGA 4I0WB 3CNAA 2RMU2 1JUHA 3ETQA 3HIFA 5FZ9A 2JG8A 1DU3D 1ONAA 3WAUA 2R16A 2W52A 2OUHA 1GQPA 2JG9C 2VW0A 1RMU1 2RS52 5FXZA 2P34A 2WFF1 1MVQA 1O8PA 3FHAA 1D7PM 2OW4A 2WQZC 1LCLA 4AHXA 2GNMA 1DYOA 3TN93 4IGPA 2C24A 4MO3M 3W21A 1VALA 1J1TA 5DPNA 1EV13 5HCHA 2XJQA 1GZTA 3NL1A 1BXHA 2HWF3 3RQ0A 3ZYJB 1FMD1 2AREA 5BNNA 1GR3A 4KBBA 1K5MC 3BYLA 5KHHA 1G9AA 4YW3A 5JI9A 1H6XA 1JZ2A 2ARXA 3E5XA 2XH6A 2Q8DA 3RVHA 4YNIA 4AAPA 2Y6LA 4MVTA 2DF7A 4NROA 3J8F2 1OA3A 4I2OA 1YJKA 4AVCA 3QC2A 4WVMA 3VSFA 2ZGSA 1POV0 2ZGNA 4YVWB 3ABZA 1W9FA 4IEUA 2HWB2 4CU6A 2ZMNA 1ASJ3 4LA2A 1IKQA 3BOPA 1YEWA 2G9ZA 2DVAA 1Q3EA 2HWD2 3KV5A 4NJ4A 4C91A 5J3UA 5F9TA 4PI2A 1DQ1A 3NV4A 1J3RA 1I3HA 3MUY1 2RDRA 3B94A 3OOXA 3AFKA 1KDMA 3KF5A 2BBVA 1C1FA 1RMU3 1H2KA 2E7TA 3V64A 3B9CA 2WFF3 2HLEA 4CCEA 4D3WA 1D4M2 3L2HA 1H8TA 4KH9A 4XFIA 1W03A 5ACA3 4UYBA 2VZSA 2EXIA 1NA1B 4X6RB 1UX7A 3BYWA 3S5QA 4N2RA 1FMD3 4LORA 3GHMA 1Q8QA 2XJUA 1Z7S1 1NCQC 3ZSMA 4FFHA 3JQXA 3WNOA 1UV4A 1QJZA 3O1PA 4NIIA 3FWEA 3WQ0A 1WW5A 5IFTA 5AYDA 1WLCA 2X8KA 4IV3B 4K1ZA 4HFSA 2EXHA 3VD5A 1KFUL 4TLGA 3GBWA 3LB9A 4QMAA 2W2IA 1K5MA 2W92A 4TN7A 1VBE2 4WVZA 3RWKX 3VBOA 5JCTA 4N43C 2W87A 3I7DA 2BVBA 2LM3A 4ZXKA 2I45A 4R4XA 5JWPA 4GZ9A 2DYCA 1RUG1 2XQXA 1L7RA 2D43A 4CDXB 3WNLA 3NNLA 3WN1A 3CJIC 3MIGA 3WW2A 1H30A 4QGMA 3RWNA 2GN7A 1DYKA 1RL3A 1G8WA 1DZQA 4GQ7A 5FXWA 2FDJA 4BA6A 2ADEA 2YG0A 4K1YA 4YVSB 5FTTC 4QPGC 2A6WA 5F6KA 2B4KA 5K0UC 2QQMA 2AR6A 1SCRA 1S0JA 2J1UA 2EF6A 4MGTA 2YB7A 1HJGA 5H9PA 2ZHMA 5C9AB 4Q8LA 1R1A1 4AFMA 1LOEA 2VAUA 3AVSA 4KNCA 4UDJA 3FMGA 1Z7S3 2WFPA 2VH9A 5JXGA 2XHKA 1YNAA 1F9KA 3DN7A 4LPLA 4S2DA 5FYBA 4AVTA 4DUVA 2ZHNA 1EUUA 4JHZA 4KU8A 2A6ZA 4AQ2A 4LHNA 4XQWA 3LOIA 4C8DA 5E89A 4NR1A 4CXWA 1NQJA 2YFRA 4CEWA 1SLCA 3PU3A 1XYNA 4AVVA 4Z8BA 5C71A 4AE2A 2ZGOA 1I5PA 4N8MA 2P6CA 2YBKA 3NV1A 2F4LA 2B39A 5T5PA 2JG9B 3MFCA 4LR4A 3UNPA 1ENSA 3INAA 3ZKUA 3WG2A 3IIIA 1RUG3 3FHIB 5GALA 5KHIA 5GLOA 1GP4A 2YYOA 3E97A 1ND3A 2R072 3HOBA 4H3WA 2VPVA 3TAYA 1PO12 4XCBA 4ATFA 5IHRA 3N4MA 4AI3A 2WZR2 4N43A 1LKNA 3WY6A 4FOVA 2XPJA 4AK3A 2UY9A 5BNPC 1QU0A 4UW6A 3MIDA 2E7AA 4UFHA 4XBQA 3KT7A 2FDGA 1PNGA 5CEHA 3KLSA 4D6SA 4RHV2 5APAA 3A7QA 3WCRA 4B4RA 3VKFC 1R1A3 3SXWA 2XWBB 3USUA 2BFUL 1MR5A 4UFMA 1H6YA 4H7LA 5FZMA 4ZZ8A 4CCMA 1K45A 3ZR6A 4MLGA 3MUZ1 1VBB1 3H9AA 1YQ2A 4I01A 5IFPA 3PMSA 2NP0A 3Q8AA 4PVIA 1OKQA 5K0UA 2R7EB 3FLPA 3PUAA 1W04A 4QXBA 2V5YA 4OMDA 1J3QA 2VCMA 4ZU5A 4Q2FA 4IEVA 5FMOS 3UGGA 1UMZA 1AYM2 1E5HA 3QH6A 2EVXA 2W46A 2ZGLA 3LA7A 5FRAA 1RB8G 2A70A 1LENA 2F17A 2DUPA 2B42B 2A6XA 2WS92 3MEPA 4LJHA 3KHCA 1DG6A 2VDTA 4IV1C 3HVDA 4CEYA 2V73A 2QQNA 3CEWA 3MV11 4M0HA 4P9WA 4AYUA 3AP4A 5J48A 5L36A 2WO2A 1V70A 3LA3A 4RR3C 1REFA 1J84A 1LHWA 4JGZB 1NCQB 4Q0VA 1G6NA 1ULDA 2YUEA 3OBRA 1GQHA 1Q43A 3HBZA 1TL2A 4JQRA 4KWUA 3ITQA 2CGNA 1CAUA 4JTNA 2Q8EA 2VMDA 3BVCA 4A3XA 4YGBA 5AFEA 3TYJA 5JOYA 4OYUA 5F2WA 4PT6A 2QVSB 1OLME 1KITA 4Q4V2 3ZO0B 3EJKA 1KS5A 2NYYA 1IS6A 3I2DA 4P14A 4WM8A 3I3BA 3NV2A 3AKFA 2WQ4A 4FPKA 4Z92B 3WF2A 1R081 1R1ZA 4MH0E 2HEWF 1DP0A 1XPWA 3C8XA 3CJIB 3SISA 2WDBA 5AC91 5BNNB 2J1RA 3IDAA 4MHRA 1EPZA 4LBKA 5CB7A 1ULFA 1XRUA 3WG1A 4DEVA 3LPFA 1LOCA 4C0BA 3U10A 5GZFA 1RUE1 1WD3A 1R091 1DHKB 3K3OA 4K20A 5DAVA 2Y6JA 4AEJA 3KQ4B 4OUMA 1ZRFA 4FPOB 5A32A 4GALA 4QPGB 1BKZA 1PHMA 3AKTA 3S0MA 5HPOA 2W1SA 3JBG2 1OUSA 2FCUA 4MX3A 5L7OC 2D6MA 5IVFA 4LHLA 4XJ8A 4N4BA 4ONUA 2O14A 4W50A 1SFNA 4DIQA 1UF2C 1GWKA 2W95A 3AMMA 2C5DA 5CFDA 1UXXX 3POEA 5FY1A 5IUQA 3WXPA 2Y6FA 2A73B 2XBO2 2WUHA 3KCXA 2JDAA 1RJ7A 4L11A 1UX6A 3EMRA 1MACA 5F5AA 1G9DA 4EJRA 2HWC2 2V09A 4AGRA 1UY4A 1YLLA 4QAWA 4UOJA 1OOPC 1R083 1W8ZA 3JXSA 1MS1A 2VNRA 5HXVA 5AC93 2WL1A 2AYHA 1G86A 2UU8A 3CZUA 2G9FA 2EALA 4DXZA 1C28A 3AJZA 1UOJA 1RUE3 1R093 3OYWB 4LUMA 4RA0A 2QE3A 3ZDVA 5BNPB 3N9LA 4HOOA 4ZY9A 3KSTA 1RINA 1R64A 3KMHA 5D2AA 4IEQA 5C5UA 4DZGA 1HV1A 2MEV1 2DTWA 4D7YA 3QLQA 5BNOC 1XYPA 3WZ1A 3WF4A 1S1AA 5DAPA 3JQWA 3MIBA 5AYEA 5K8SA 4DS0A 3BALA 3KZ4C 4GA9A 4UFKA 2I07B 1WCQA 3GJAA 3VD7A 5IAXA 4AZZA 1U5YA 5A7WA 4H7MA 3POJA 4XMIA 4XXAA 1UZ0A 5FZOB 4RQPC 4ASKA 5C3RA 2Y64A 1UQXA 1B35A 2E63A 4EE2A 5C5TA 2J1VA 4Y1XA 1UU5A 3FLRA 4HANA 1V6JA 3MPPG 5FZ1A 4MGQA 3WDUA 3UGHA 2BBAA 1JBCA 1ODMA 1ZRIA 1LGCA 1YFYA 2ZTNA 2YC0A 2VZRA 1OFNA 4NN0A 2QTWB 3T2TA 1F35A 1CJPA 2C9KA 4O9EA 1UY2A 3VBHA 3O0XA 1W6OA 3S7IA 2IFWA 5C8CC 1HIXA 2ZEYA 4K21A 5HV0A 1WCUA 3WD5A 4PJYA 5A3UA 1AX0A 4HSJA 2EA7A 4K7JA 5FLJA 3O1SA 1BMV2 1AR82 1J58A 2XG3A 3H1MA 5EZWA 5FIXA 2XKPA 2ZAAA 5F3CA 4CDWB 1YJLA 3OPWA 1ZRRA 1S2KA 3RJ2X 4F8AA 3DYMA 4UBHA 4BHPA 1XNKA 2DFCA 3FN9A 2CNAA 5CKNA 3N9QA 2R043 3QACA 5KHKA 4Y1UA 4CUCA 1OLMA 4QDRA 2QQUA 1H1IA 4LUKA 3WF1A 4GMP1 3JZVA 1B09A 2WINB 2PAKA 3LDRA 2GNBA 4CP9B 3SMHA 2PLV1 2BRTA 1RUI2 4AWDA 1ACCA 2LTNA 3MLKA 3THTA 3LEMA 5JUVA 3K51A 4LO5B 3ZYPA 1H4GA 3AZYA 5HXMA 3AKHA 1OFSA 2GALA 5FXVA 1O6UA 4Y20A 3NNGA 1HV0A 2PXJA 4JHTA 3VBUA 5FFOC 2XVLA 3V65A 5H9RA 4UFJA 5L7OB 1W9TA 3FFQA 5T5OA 3IKWA 1VAVA 1ZBA2 4S2HA 3TRSB 5CZKA 2JE7A 5G04L 3WN2A 3JCIA 3WG3A 3LIHA 3NNMA 3NJVA 3ZXGA 2GMMA 5J96B 5C8CA 3R0RA 1MS8A 1XE7A 1DQ0A 2ZKNA 4P00B 5FZKA 5HCFA 4OHXA 1UMIA 2Y26A 4AFDA 1RHI2 4B1MA 2QNKA 3NW4A 1I9RA 4IEXA 3WP3A 2ZGQA 1GLHA 5A7QA 1KXGA 1UIJA 4FAHA 2YGMA 5CKMA 5IK8A 4LBQB 3NRUA 1OOPB 4GMP3 1GZWA 1AYN2 1UZVA 5EP9A 1JMUB 2NLRA 4COTA 4NUBA 3AXEA 2PLV3 2R6QA 3GZAA 5F8PA 1AXYA 2VUJA 4FPCA 1SG3A 5GKAC 4Q4Y1 3DPRC 3CL1A 3HT2A 5A7VB 3MF6A 4Y22A 5A3TA 3VBRC 2W5FA 5IW0A 4XABA 1DZRA 5JOXA 1OKOA 2J1TA 4ET7A 1PGW2 2Y6HA 4NAOA 3POFA 5BNOB 1QOTA 1EP0A 4Q27A 2CHHA 4IW3A 2RJ2A 5I8YA 5LBFA 1QDCA 2WLPA 3QEEA 1M4WA 1S2BA 2QQPA 4A6SA 2R49A 4YW6A 5ANNA 1UL9A 4HN0A 4FTEA 3WCSA 4ORFA 2Y38A 4RQPB 4YZ5A 1M06G 5ABJB 4O8OA 2QCSB 4CRQA 5FPXA 2ZZJA 4C0HA 3AJYA 4LKFA 1VE0A 4W4ZA 2FQPA 3TEXA 3ZN6A 4COWA 1UYZA 4ASLA 4XFFA 3WF3A 1JW6A 5BY5A 2W68A 5F5QA 1UO9A 2JD4A 4FO9A 3ZMOA 2VMHA 1COV2 4Q8KA 3HQUA 1O5LA 5LA9A 2ZHKA 4LULA 1IQAA 4Q4Y3 2EXKA 2P5BA 2WRAA 1UMHA 3SLIA 3OUHA 4JDOA 4AXOA 4J6GA 3ES4A 2JKBA 1LB2A 4NIAA 3VDDB 1QJX1 3P5BA 3URFA 3X29B 1RUH2 1RUC1 2W39A 3AFGA 4P5YA 5FZHA 1JOBA 3WUDA 4AHZA 4Z2AA 2VJXA 3V0BB 3CQOA 4Y4YA 1WMFA 4AHWA 2XWJB 3J7MA 3WNMA 2BNOA 3DV8A 1LHUA 2ZABA 4QX0A 4COYA 1ZBE1 1QEXA 1BBT2 2C26A 4NRMA 3H1YA 3H3UA 1C57A 5FPZA 5FYTA 3C7OA 1W0PA 4OHZA 2QFEA 1HX6A 5DG2A 4WM7A 3V0AA 3N3HA 5FMCA 1ZZCA 3BUCA 3DCQA 1KGYA 4C90A 1XU2A 4QKFA 3M70A 3T1LA 3O1UA 5ERLA 3ZSEA 4E4ZA 1UW8A 4GB32 1DBNA 3VZJA 5A6QA 3OUIA 1JN2P 1PZ8A 1YC61 4NMIA 5DDJ2 1BK0A 4CXYA 1UYPA 2ENRA 4XIOA 5FZBA 3D6EA 3S57A 3PL0A 3BPZA 3NMBA 4BB3A 4AEDC 3AKRA 5A6ZA 1FPN3 3ZFEC 1DZTA 1POQA 2ORZA 5JVVA 3WNNA 4BQWA 1V00A 1P8JA 4KC7A 1AJKA 2D6PA 1TME1 2A75A 4B1LA 1N3QA 4DQAA 2AEYA 2KA3A 1ZA4A 3WW3A 1JZ6A 2XXZA 3NJZA 3IN9A 4QXKA 4XVHA 3QCWA 1ULOA 1QJX3 3RGBA 4HK8A 2GC1A 4CDUC 3WN0A 4SLIA 3LA2A 1X9TA 1O4TA 2BERA 1C8M2 4UWDA 4QX2A 4JGYC 4FPYA 1EAH2 1OD3A 1FOD1 1ZBE3 3O12A 3ZYFA 1PVC1 3OEBA 1TQ5A 2OQ7A 3PUIA 3HN1A 4BYYA 4QPYA 1S0FA 2IXCA 4FCAA 4LBLA 4Q4W2 2Y0OA 4NRPA 1RGSA 4AQTA 1GYHA 2O8OA 3OD4A 2LALA 1HXS2 2PTMA 1JZ8A 1V6OA 5L9RA 5GZDA 3H1WA 2FDIA 4JRAA 1PZ7A 3EHKA 4ZS2A 1O3SA 2OT7A 3ZIWA 3VKLA 2G4IA 4GD4A 5CVRA 3DPRB 3IDBB 4P9GA 5IK4A 1AL21 3MIEA 1QXJA 1JHNA 4LBQD 2VL4A 1SFPA 4GIQA 2P17A 2P2KA 1BK1A 1WMXA 1MS9A 5A7PA 5F39A 4XUTA 2IVJA 3VBRB 3O1RA 4N7UA 2FMDA 3OBTA 3ROUA 1N1SA 4NHLA 5FZGA 1TME3 4ZPIA 3ILFA 3I3DA 3CO2A 4JKLA 4RGKA 4Y5TA 2AEZA 3ZIXA 2BGOA 1X8MA 2DCYA 4NHKA 4R9CA 2IXJA 4YG0A 4LT5A 3VSRA 3I8TA 4XF0A 4YZ4A 5DUWA 3OM2A 2BOIA 3ZDSA 4DUWA 2EIGA 3N7KA 1FOD3 2Q1ZB 1PVC3 2W0XA 2Y0IA 5FQ0B 2AACA 5EJZB 3ACGA 2JJ6A 3O5SA 5F6LB 4N90A 4BWOA 5J1XA 4KCBA 4N9IA 3CF6E 5FDBA 3FUQA 2CL2A 3UETA 3LKJA 1ZRCA 3L9JT 2G9GA 3KVAA 4Y4RA 1I6XA 4PCRA 4XUQA 5K7PA 4AK7A 2WSVA 3POIA 4XJ9A 3LD8A 5A33A 1LESA 3OM5A 2D40A 3I2OA 1AL23 2HWF2 2YMZA 1A3KA 1NKGA 1CZSA 5FZLA 4W6XA 3K77A 3AP7A 2VR4A 4YPJA 3CBNA 1N47A 4YVWC 1AR72 1RYYA 2YZ4A 5FBJA 1PM7A 4LE4A 1CIYA 2ZKLA 5J09A 3WQ7A 3JD71 2RE9A 2W08A 4MXWB 4NWWA 4QB6A 1PGL2 3PHMA 1JTZX 4MLOA 2D5HA 2A3YA 1ZNPA 5IVCA 3DXUA 2GAUA 1OF3A 1D0GA 3AMPA 1CAWB 1X36A 2KM2A 2A7AA 1WLDA 3OCPA 1TZOA 5IVJA 5E1RA 4JKMA 5FKCA 4JVAA 1O3QA 5FWJA 4BZ4A 3ST7A 2X05A 1IS5A 2WNVC 1POV1 1A8DA 1JYNA 4CPBD 2W3JA 3TEZA 1NA1C 1GNHA 3FLTA 1YFWA 4AI2A 1OT5A 3VL8A 3PUSA 1CQ9A 3CDZB 4AEDB 2PHTA 3QD6A 2L9LA 3HR9A 5JLVA 3ZFEB 1DDLA 1Y7BA 1UYXA 5ACA2 3I2FA 1OXCA 1LOBA 1X9PA 1GZ9A 2ZACA 5JR7B 3AP5A 4BK4A 3UJOA 2XQRA 4IV3C 4B4PA 2LROA 4CDUB 4CDQC 1Y9GA 1O8SA 3B69A 1VBA1 1VBC1 1V6IA 4JGYB 2GP5A 4MOAA 1CR7A 2PQQA 3JD73 1EPWA 1YI9A 1CGPA 5C2MA 1GQGA 4DMIA 2OA2A 1W6MB 2BPA2 4L0PA 2BFUS 1WUVA 3VBSC 4DOUA 4CU7A 4YVWA 5JXHA 4DXTA 4KI5M 5E8AA 3APBA 4HG6B 4Q4X2 5EPAA 5F2SA 2Q8CA 4BXFA 1RUJ1 3OJBA 2OPKA 4XILA 1NLRA 1OURA 3RDIA 3E6CC 1POV3 1PK6C 4PQQA 2YHJA 1UN1A 2XJPA 2VMIA 5LBCA 5C9AC 4QB2A 3RZGA 5JIUA 3FZ3A 3GBGA 2DUOA 1X7NA 1LGBA 4NWVA 4UW4A 1DGLA 4ZXEA 4MSVA 3HWJA 3A4UA 5FBZA 4NHXA 5JZGB 1J83A 5LATA 3CJXA 1IKPA 1S0IA 3I54A 4LQRA 4YYOA 4AI9A 4E4HA 3WX5A 5GZEA 3W59A 1O4YA 1IG3A 2VZQA 2WZ8A 4MG2A 3DGTA 5GZCA 1ODNA 1VBA3 2RS31 1QKQA 2UWCA 1J1LA 2ZGUA 3KF3A 1VBC3 3KM5A 2JECA 3MW4A 3D5ZA 2GC0A 2VCCA 5JOZA 5KXBA 1G9FA 4XDPA 4MGIE 2XKOA 1QWRA 1ULEA 2J1EA 4HN1A 4PQ9A 2IZWA 5K4LA 3MDPA 4IV3A 4O65A 1QJY1 4PDWC 2JIGA 4CVUA 4PF5A 1QQP2 1BHGA 1GMMA 4ZONA 5DUVA 2NZ9A 4CUBA 4ZZ5A 1CN1A 3U11A 3BTXA
chains in the Genus database with same CATH topology
1JYXA 3C2UA 4DXRA 3DECA 4DUXA 2V5DA 2VDTA 5B6TA 1DLCA 2ZEXA 2QQNA 2X8FA 3MV11 5GLMA 3BYNA 5C0PA 1CX1A 2WO2A 2ZXQA 2X8SA 1J84A 1SDDB 2RV9A 3HNBM 3A23A 3VT0A 5B6SA 4KWUA 1YI7A 2VMDA 2ORXA 5JOYA 4OYUA 3T09A 5LA2A 4PT6A 1JHJA 3VD4A 4TTGA 2XOMA 4ARYA 3AKFA 2RVAA 3I3BA 5F7UA 2PQSA 3WF2A 4RYDA 3LFIA 3R4YA 1DP0A 1XPWA 3C8XA 3I2JA 2WDBA 2J1RA 3IDAA 1OH4A 4DEVA 2YC4A 1IQDC 1CZTA 3LPFA 2EIBA 2QQIA 2Y6JA 4KMQA 2WAAA 2WABA 3EYPA 3WNKA 2W47A 1W99A 3ACIA 4JKKA 4DXSA 2YC2A 2W1SA 5HPOA 2XONA 4UDIA 2Z4FA 3OGVA 2W91A 2QQVA 2VMCA 3A21A 4N4BA 3SC7X 3QEDA 1ST8A 4W50A 1JU4A 4BXSV 4XURA 1K42A 2W95A 1UYYA 1UXXX 3R4ZA 1NAEA 3T08A 4P02B 3UESA 2WN3A 2WUHA 1TVGA 2J7MA 2JDAA 4IUGA 1GOHA 2EIDA 2J22A 5FK7A 4EQVA 5A8DA 2Y8KA 3T2OA 3F2ZA 1UY4A 2LW8A 4A41A 3WSOA 4M4PA 4QAWA 2EICA 4UOJA 5A8CA 1XNAA 2VC9A 4GWJA 4XUOA 4A45A 3JXSA 2WN2A 4AAXA 1GNYA 3CZUA 5GLQA 4OUEA 4A44A 3R67A 3BGAA 3ETPA 4AK5A 4D0QA 3A22A 4ZY9A 3KSTA 5JXIA 4P08A 3QEFA 3WNPA 1R64A 5FMBA 5AYCA 2VMFA 5JXJA 3EB7A 3CU9A 5GLRA 3WF4A 5AYEA 4CU8A 4N1IA 4D8MA 1UY1A 4GWIA 1WCQA 1WL7A 5EJ1B 3VD7A 2AC1A 4KCAA 2HYXA 1UZ0A 2Y64A 3SEPA 3U37A 2J1VA 3HNYM 3FL7A 4MGQA 1XC6A 3T2QA 3LPGA 3UGHA 2BBAA 3ZXKA 3OM7A 1JZ4A 1W9WA 2VZRA 3OM4A 3SKJE 3AKGA 1L7QA 2C9KA 3HJRA 1UY2A 4M4RA 3IAQA 3LEKA 3OG2A 5LA1A 4QX1A 1F4AA 5CYYA 2VO5A 5FLWA 3LDKA 3HPNA 2DCKA 2ZEYA 2VZVA 2X09A 4OMCA 3C7GA 3I2HA 3U75A 1JZ3A 5JOWA 3OB8A 2KD7A 2ZEZA 5FIXA 1OF4A 2BGPA 3BYKA 4UI9L 2QQOA 3OBAA 3DYMA 3DYPA 2YFTA 3FN9A 2Y6GA 3ACFA 3UGFA 4BJ0A 3LEGA 5G05L 2WQ8A 4CUCA 1JI6A 4QDRA 2QQUA 3WF1A 5IJRA 3LDRA 3LQCA 4ARXA 3K4DA 3TAWA 1PT2A 3D60A 3HN3A 1ULPA 3E1F1 2CDOA 2B9VA 5IYYA 1T2XA 1UWWA 1GOGA 1UY0A 3LEMA 3OM6A 5JUVA 3BYJA 4AK6A 3AKHA 5HXMA 2BZDA 4PVAA 4FI9A 3NNGA 3VD3A 1WKYA 2WZEA 1W9TA 1YIFA 1LNSA 2VZPA 3OGRA 2ADDA 5CZKA 2X8TA 5G04L 3WN2A 4QQSA 3HEIA 3GGLA 3LIHA 3NJVA 3LIGA 3LE0A 4BDVB 4XUNA 3WPUA 4P00B 3PIGA 4U6DA 1UMIA 4W8JA 2VTFA 3C7EA 3P2NA 3ZM8A 4FFGA 5B4NA 5FK8A 1XNTA 2VZ1A 3T2PA 2B4WA 4KC8A 1W2TA 3NRUA 1NUKA 4FFFA 3GDBA 4UAPA 1Y4WA 1VKDA 4COTA 3LEIA 3WATA 4CUAA 4UDKE 2E26A 3T0DA 1SG3A 1YRZA 1O59A 3VT2A 3ECQA 2E33A 5A7VB 3K4AA 2W5FA 2X10A 5JOXA 4MGSA 2J1TA 4ET7A 3VDBA 3WMYA 3P6BA 3VDAA 2Y6HA 3WEZA 4D47A 3CKHA 5EIYB 2JE8A 2RJ2A 4KMIA 3QEEA 2VOTA 2QQLA 3OGSA 4AG4A 1MPXA 5ANNA 2VZOA 1W9SA 3MBWA 1NX9A 4O8OA 5JR2A 2LS6A 5I0DA 3PUHA 4W4ZA 3AKIA 1UYZA 2JD9A 1PX4A 3WF3A 1OYGA 2OXBA 5DN2A 3FHQA 3SKVA 3VSSA 4LKSA 3W5MA 2W1QA 3K46A 2EXKA 1US2A 3U14A 5JMOA 1UMHA 2VQUA 1PMHX 4ONZA 2ID4A 4P5YA 4Z2AA 3D5YA 2VJXA 2OKXA 3CQOA 4RN5A 3WNMA 4QX0A 1W0NA 2J1SA 2C26A 3CZJA 4QPWA 3C7OA 1JU3A 2QBXA 1UY3A 1Y9MA 5FMCA 4OZOA 2W94A 4JX0A 4QDQA 1KGYA 3GXUA 2V72A 1GYDB 1UXZA 2JKXA 2VCBA 3HNMA 3CIHA 4A42A 2J1AA 5LA0A 3K75B 1UYPA 2VZTA 2W1WA 3I3EA 5GLPA 2ORZA 2WBKA 4BK5A 3WNNA 2E31A 5GLNA 2DDUA 4FFIA 1P8JA 4KC7A 3C7HA 4A6OA 4O8NA 2WO1A 1JZ6A 2AEYA 3IB3A 4XVHA 3IAPA 3THCA 1GYEB 1ULOA 1EUTA 1PX3A 1GOFA 3WN0A 5FMDA 2BERA 4O8PA 2WYSA 4QX2A 5B4XA 1OD3A 3WF0A 1F4HA 5C70A 3OEBA 1W8OA 3CMGA 2WO3A 3PUIA 3PIJA 5GLLA 3WAUA 2XHNA 4E8CA 5FUIA 3QZ4A 1GYHA 1GQPA 1JZ8A 3K4ZA 2W9XA 3WPVA 1O8PA 3FHAA 1D7PM 1PMJX 3J7HA 1DYOA 3OEAA 4MO3M 3THDA 4A3ZA 5DPNA 4UDKA 2VL4A 1JZ5A 2WAOA 2VM9A 4XUTA 3MV01 3BYLA 4DEQA 1W8NA 2ZEWA 1JZ2A 1H6XA 1JZ7A 4NOVA 3I3DA 4JKLA 2EXJA 2Y6LA 2AEZA 2BGOA 1SHWB 3VSRA 3QC2A 5DQ0A 3VSFA 2VZ3A 3D61A 1GUIA 3ABZA 2CDPA 3OM2A 4DUWA 4CU6A 3ACHA 1K3IA 3VD9A 5EJZB 1W18A 3ACGA 3K1UA 5J1XA 4KCBA 2VCAA 3BN6A 2W1UA 3MUY1 3UETA 3KF5A 2DCJA 2V4VA 4TXWA 4XUQA 3WPZA 2HLEA 3W5NA 4AK7A 4UDGA 3T0BA 5C7GA 4QB1A 3C7FA 3OM5A 2VZSA 2EXIA 1UX7A 1NKGA 1CZSA 3K77A 4YPJA 2VR4A 4N2RA 4A4AA 2QQJA 3P1IA 4E8DA 1RYYA 4FFHA 3I2KA 2VZUA 2YFUA 1CIYA 3WNOA 1UV4A 1US3A 4U6BA 3I2IA 3D3AA 4QB6A 5IFTA 5AYDA 3LF7A 3VD5A 2EXHA 2C4XA 2W92A 3RWKX 1OF3A 5A1AA 2W87A 3I2GA 4JKMA 4GZ9A 5FKCA 4QDSA 3I97A 2XQXA 1L7RA 4QX3A 4XUPA 3WNLA 2X05A 2E32A 3WN1A 3VT1A 3MO4A 1JYNA 2W3JA 3DYOA 2VMEA 1OT5A 3AC0A 3CDZB 2L9LA 2VQTA 1JYVA 2YG0A 2ADEA 1Y7BA 1UYXA 3SEEA 2B4KA 4PF1A 5DMYA 2QQMA 3I2FA 2J1UA 2YB7A 5FKBA 2EIEA 3NQHA 4BK4A 3ZXJA 4UDJA 2XQRA 2QQKA 2YFSA 5JXGA 3WASA 4LPLA 1O8SA 1Y9GA 4DUVA 4JHZA 1EUUA 3GM8A 4LHSA 4MOAA 2YFRA 4L0PA 4XZUG 5C71A 5LCWL 4CU7A 1I5PA 5JXHA 4DXTA 4KI5M 4HG6B 3VDCA 3UNPA 3IIIA 3T0AA 5GLOA 3ZXLA 4CU9A 4PQQA 3HOBA 5IHRA 1TG7A 4QB2A 1JYWA 1GU3A 4ZXEA 5A7VA 3WMZA 1CZVA 1K12A 1J83A 3A7QA 4LQRA 2YFZA 1H6YA 2VZQA 2WZ8A 2Y6KA 1K45A 4ZZ8A 4MLGA 5AY9A 3MUZ1 1YQ2A 5IFPA 4N2ZA 3KF3A 4PVIA 3D5ZA 5GLKA 1KEXA 2VCCA 2R7EB 5JOZA 3LV4A 2J1EA 4OMDA 1HN1A 4MADA 2QQWA 3UGGA 3NJXA 4CVUA 3VSZA 1BHGA 1GMMA 4CUBA 4ZZ5A 3WPYA 2W46A 3WQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYX A;  3C2U A;  4DXR A;  3DEC A;  4DUX A;  2V5D A;  2VDT A;  5B6T A;  1DLC A;  2ZEX A;  2QQN A;  2X8F A;  3MV1 1;  5GLM A;  3BYN A;  5C0P A;  1CX1 A;  2WO2 A;  2ZXQ A;  2X8S A;  1J84 A;  1SDD B;  2RV9 A;  3HNB M;  3A23 A;  3VT0 A;  5B6S A;  4KWU A;  1YI7 A;  2VMD A;  2ORX A;  5JOY A;  4OYU A;  3T09 A;  5LA2 A;  4PT6 A;  1JHJ A;  3VD4 A;  4TTG A;  2XOM A;  4ARY A;  3AKF A;  2RVA A;  3I3B A;  5F7U A;  2PQS A;  3WF2 A;  4RYD A;  3LFI A;  3R4Y A;  1DP0 A;  1XPW A;  3C8X A;  3I2J A;  2WDB A;  2J1R A;  3IDA A;  1OH4 A;  4DEV A;  2YC4 A;  1IQD C;  1CZT A;  3LPF A;  2EIB A;  2QQI A;  2Y6J A;  4KMQ A;  2WAA A;  2WAB A;  3EYP A;  3WNK A;  2W47 A;  1W99 A;  3ACI A;  4JKK A;  4DXS A;  2YC2 A;  2W1S A;  5HPO A;  2XON A;  4UDI A;  2Z4F A;  3OGV A;  2W91 A;  2QQV A;  2VMC A;  3A21 A;  4N4B A;  3SC7 X;  3QED A;  1ST8 A;  4W50 A;  1JU4 A;  4BXS V;  4XUR A;  1K42 A;  2W95 A;  1UYY A;  1UXX X;  3R4Z A;  1NAE A;  3T08 A;  4P02 B;  3UES A;  2WN3 A;  2WUH A;  1TVG A;  2J7M A;  2JDA A;  4IUG A;  1GOH A;  2EID A;  2J22 A;  5FK7 A;  4EQV A;  5A8D A;  2Y8K A;  3T2O A;  3F2Z A;  1UY4 A;  2LW8 A;  4A41 A;  3WSO A;  4M4P A;  4QAW A;  2EIC A;  4UOJ A;  5A8C A;  1XNA A;  2VC9 A;  4GWJ A;  4XUO A;  4A45 A;  3JXS A;  2WN2 A;  4AAX A;  1GNY A;  3CZU A;  5GLQ A;  4OUE A;  4A44 A;  3R67 A;  3BGA A;  3ETP A;  4AK5 A;  4D0Q A;  3A22 A;  4ZY9 A;  3KST A;  5JXI A;  4P08 A;  3QEF A;  3WNP A;  1R64 A;  5FMB A;  5AYC A;  2VMF A;  5JXJ A;  3EB7 A;  3CU9 A;  5GLR A;  3WF4 A;  5AYE A;  4CU8 A;  4N1I A;  4D8M A;  1UY1 A;  4GWI A;  1WCQ A;  1WL7 A;  5EJ1 B;  3VD7 A;  2AC1 A;  4KCA A;  2HYX A;  1UZ0 A;  2Y64 A;  3SEP A;  3U37 A;  2J1V A;  3HNY M;  3FL7 A;  4MGQ A;  1XC6 A;  3T2Q A;  3LPG A;  3UGH A;  2BBA A;  3ZXK A;  3OM7 A;  1JZ4 A;  1W9W A;  2VZR A;  3OM4 A;  3SKJ E;  3AKG A;  1L7Q A;  2C9K A;  3HJR A;  1UY2 A;  4M4R A;  3IAQ A;  3LEK A;  3OG2 A;  5LA1 A;  4QX1 A;  1F4A A;  5CYY A;  2VO5 A;  5FLW A;  3LDK A;  3HPN A;  2DCK A;  2ZEY A;  2VZV A;  2X09 A;  4OMC A;  3C7G A;  3I2H A;  3U75 A;  1JZ3 A;  5JOW A;  3OB8 A;  2KD7 A;  2ZEZ A;  5FIX A;  1OF4 A;  2BGP A;  3BYK A;  4UI9 L;  2QQO A;  3OBA A;  3DYM A;  3DYP A;  2YFT A;  3FN9 A;  2Y6G A;  3ACF A;  3UGF A;  4BJ0 A;  3LEG A;  5G05 L;  2WQ8 A;  4CUC A;  1JI6 A;  4QDR A;  2QQU A;  3WF1 A;  5IJR A;  3LDR A;  3LQC A;  4ARX A;  3K4D A;  3TAW A;  1PT2 A;  3D60 A;  3HN3 A;  1ULP A;  3E1F 1;  2CDO A;  2B9V A;  5IYY A;  1T2X A;  1UWW A;  1GOG A;  1UY0 A;  3LEM A;  3OM6 A;  5JUV A;  3BYJ A;  4AK6 A;  3AKH A;  5HXM A;  2BZD A;  4PVA A;  4FI9 A;  3NNG A;  3VD3 A;  1WKY A;  2WZE A;  1W9T A;  1YIF A;  1LNS A;  2VZP A;  3OGR A;  2ADD A;  5CZK A;  2X8T A;  5G04 L;  3WN2 A;  4QQS A;  3HEI A;  3GGL A;  3LIH A;  3NJV A;  3LIG A;  3LE0 A;  4BDV B;  4XUN A;  3WPU A;  4P00 B;  3PIG A;  4U6D A;  1UMI A;  4W8J A;  2VTF A;  3C7E A;  3P2N A;  3ZM8 A;  4FFG A;  5B4N A;  5FK8 A;  1XNT A;  2VZ1 A;  3T2P A;  2B4W A;  4KC8 A;  1W2T A;  3NRU A;  1NUK A;  4FFF A;  3GDB A;  4UAP A;  1Y4W A;  1VKD A;  4COT A;  3LEI A;  3WAT A;  4CUA A;  4UDK E;  2E26 A;  3T0D A;  1SG3 A;  1YRZ A;  1O59 A;  3VT2 A;  3ECQ A;  2E33 A;  5A7V B;  3K4A A;  2W5F A;  2X10 A;  5JOX A;  4MGS A;  2J1T A;  4ET7 A;  3VDB A;  3WMY A;  3P6B A;  3VDA A;  2Y6H A;  3WEZ A;  4D47 A;  3CKH A;  5EIY B;  2JE8 A;  2RJ2 A;  4KMI A;  3QEE A;  2VOT A;  2QQL A;  3OGS A;  4AG4 A;  1MPX A;  5ANN A;  2VZO A;  1W9S A;  3MBW A;  1NX9 A;  4O8O A;  5JR2 A;  2LS6 A;  5I0D A;  3PUH A;  4W4Z A;  3AKI A;  1UYZ A;  2JD9 A;  1PX4 A;  3WF3 A;  1OYG A;  2OXB A;  5DN2 A;  3FHQ A;  3SKV A;  3VSS A;  4LKS A;  3W5M A;  2W1Q A;  3K46 A;  2EXK A;  1US2 A;  3U14 A;  5JMO A;  1UMH A;  2VQU A;  1PMH X;  4ONZ A;  2ID4 A;  4P5Y A;  4Z2A A;  3D5Y A;  2VJX A;  2OKX A;  3CQO A;  4RN5 A;  3WNM A;  4QX0 A;  1W0N A;  2J1S A;  2C26 A;  3CZJ A;  4QPW A;  3C7O A;  1JU3 A;  2QBX A;  1UY3 A;  1Y9M A;  5FMC A;  4OZO A;  2W94 A;  4JX0 A;  4QDQ A;  1KGY A;  3GXU A;  2V72 A;  1GYD B;  1UXZ A;  2JKX A;  2VCB A;  3HNM A;  3CIH A;  4A42 A;  2J1A A;  5LA0 A;  3K75 B;  1UYP A;  2VZT A;  2W1W A;  3I3E A;  5GLP A;  2ORZ A;  2WBK A;  4BK5 A;  3WNN A;  2E31 A;  5GLN A;  2DDU A;  4FFI A;  1P8J A;  4KC7 A;  3C7H A;  4A6O A;  4O8N A;  2WO1 A;  1JZ6 A;  2AEY A;  3IB3 A;  4XVH A;  3IAP A;  3THC A;  1GYE B;  1ULO A;  1EUT A;  1PX3 A;  1GOF A;  3WN0 A;  5FMD A;  2BER A;  4O8P A;  2WYS A;  4QX2 A;  5B4X A;  1OD3 A;  3WF0 A;  1F4H A;  5C70 A;  3OEB A;  1W8O A;  3CMG A;  2WO3 A;  3PUI A;  3PIJ A;  5GLL A;  3WAU A;  2XHN A;  4E8C A;  5FUI A;  3QZ4 A;  1GYH A;  1GQP A;  1JZ8 A;  3K4Z A;  2W9X A;  3WPV A;  1O8P A;  3FHA A;  1D7P M;  1PMJ X;  3J7H A;  1DYO A;  3OEA A;  4MO3 M;  3THD A;  4A3Z A;  5DPN A;  4UDK A;  2VL4 A;  1JZ5 A;  2WAO A;  2VM9 A;  4XUT A;  3MV0 1;  3BYL A;  4DEQ A;  1W8N A;  2ZEW A;  1JZ2 A;  1H6X A;  1JZ7 A;  4NOV A;  3I3D A;  4JKL A;  2EXJ A;  2Y6L A;  2AEZ A;  2BGO A;  1SHW B;  3VSR A;  3QC2 A;  5DQ0 A;  3VSF A;  2VZ3 A;  3D61 A;  1GUI A;  3ABZ A;  2CDP A;  3OM2 A;  4DUW A;  4CU6 A;  3ACH A;  1K3I A;  3VD9 A;  5EJZ B;  1W18 A;  3ACG A;  3K1U A;  5J1X A;  4KCB A;  2VCA A;  3BN6 A;  2W1U A;  3MUY 1;  3UET A;  3KF5 A;  2DCJ A;  2V4V A;  4TXW A;  4XUQ A;  3WPZ A;  2HLE A;  3W5N A;  4AK7 A;  4UDG A;  3T0B A;  5C7G A;  4QB1 A;  3C7F A;  3OM5 A;  2VZS A;  2EXI A;  1UX7 A;  1NKG A;  1CZS A;  3K77 A;  4YPJ A;  2VR4 A;  4N2R A;  4A4A A;  2QQJ A;  3P1I A;  4E8D A;  1RYY A;  4FFH A;  3I2K A;  2VZU A;  2YFU A;  1CIY A;  3WNO A;  1UV4 A;  1US3 A;  4U6B A;  3I2I A;  3D3A A;  4QB6 A;  5IFT A;  5AYD A;  3LF7 A;  3VD5 A;  2EXH A;  2C4X A;  2W92 A;  3RWK X;  1OF3 A;  5A1A A;  2W87 A;  3I2G A;  4JKM A;  4GZ9 A;  5FKC A;  4QDS A;  3I97 A;  2XQX A;  1L7R A;  4QX3 A;  4XUP A;  3WNL A;  2X05 A;  2E32 A;  3WN1 A;  3VT1 A;  3MO4 A;  1JYN A;  2W3J A;  3DYO A;  2VME A;  1OT5 A;  3AC0 A;  3CDZ B;  2L9L A;  2VQT A;  1JYV A;  2YG0 A;  2ADE A;  1Y7B A;  1UYX A;  3SEE A;  2B4K A;  4PF1 A;  5DMY A;  2QQM A;  3I2F A;  2J1U A;  2YB7 A;  5FKB A;  2EIE A;  3NQH A;  4BK4 A;  3ZXJ A;  4UDJ A;  2XQR A;  2QQK A;  2YFS A;  5JXG A;  3WAS A;  4LPL A;  1O8S A;  1Y9G A;  4DUV A;  4JHZ A;  1EUU A;  3GM8 A;  4LHS A;  4MOA A;  2YFR A;  4L0P A;  4XZU G;  5C71 A;  5LCW L;  4CU7 A;  1I5P A;  5JXH A;  4DXT A;  4KI5 M;  4HG6 B;  3VDC A;  3UNP A;  3III A;  3T0A A;  5GLO A;  3ZXL A;  4CU9 A;  4PQQ A;  3HOB A;  5IHR A;  1TG7 A;  4QB2 A;  1JYW A;  1GU3 A;  4ZXE A;  5A7V A;  3WMZ A;  1CZV A;  1K12 A;  1J83 A;  3A7Q A;  4LQR A;  2YFZ A;  1H6Y A;  2VZQ A;  2WZ8 A;  2Y6K A;  1K45 A;  4ZZ8 A;  4MLG A;  5AY9 A;  3MUZ 1;  1YQ2 A;  5IFP A;  4N2Z A;  3KF3 A;  4PVI A;  3D5Z A;  5GLK A;  1KEX A;  2VCC A;  2R7E B;  5JOZ A;  3LV4 A;  2J1E A;  4OMD A;  1HN1 A;  4MAD A;  2QQW A;  3UGG A;  3NJX A;  4CVU A;  3VSZ A;  1BHG A;  1GMM A;  4CUB A;  4ZZ5 A;  3WPY A;  2W46 A;  3WQB A; 
#chains in the Genus database with same CATH topology
 5A7S A;  4P9J A;  1RUJ 3;  4MUV A;  5DAW A;  4DUX A;  1LOF A;  1YFU A;  2B9U A;  1E57 A;  4CDX A;  2X8F A;  4YGD A;  5C0P A;  5CA6 A;  1CPN A;  5HCA A;  1V9U 3;  4GKY A;  1CX1 A;  1WMD A;  4BIF A;  3LAG A;  3IDC B;  5I0T A;  2ZXQ A;  5L73 A;  2P3K A;  5T3N A;  4FAG A;  5F5C A;  3JB8 A;  3HNB M;  4YVS A;  3OSD A;  1ULC A;  1MZF A;  4Q29 A;  1RVF 1;  4QX7 A;  1JYT A;  5GM0 A;  4EN9 B;  3SQO A;  1DGR A;  1FT9 A;  3F95 A;  4IL7 A;  4Q5O A;  4UF0 B;  3C3V A;  1XE8 A;  4UFL A;  1UZY A;  1HRI 2;  2NMO A;  4YZ1 A;  5C9A A;  1OUX A;  1WBF A;  2UY8 A;  5FRE A;  1JYI A;  2VOK A;  1V6N A;  2RS3 3;  4V1P A;  1VRH 2;  2ZX3 A;  4HVR A;  5DZG A;  2VXJ A;  4TTG A;  1HRV 2;  1FX5 A;  4XJA A;  3USS A;  2XOM A;  2PA7 A;  4LBJ A;  5AVA A;  3POB A;  3IZO A;  4RYD A;  2JDM A;  3R4Y A;  1AR9 1;  2GME A;  1QJY 3;  2BQP A;  2WNV B;  4PIX A;  3ZPO A;  4Y5S A;  2WKK A;  1OH4 A;  3PUR A;  1LEM A;  1L3J A;  1U0A A;  3MPB A;  3ZYG A;  4QHO A;  3FBY A;  2JG9 A;  3ILR A;  4V2W A;  4KMQ A;  5EJ3 A;  4JGZ C;  5FY5 A;  4DXS A;  3ACI A;  4YM1 A;  1AR6 1;  4UDI A;  2Z4F A;  3A21 A;  3SC7 X;  2YY1 A;  1F5F A;  1JU4 A;  1BEV 1;  4G3Y C;  4CDQ B;  3OD0 A;  2PHD A;  1UYY A;  4ZU7 A;  2VMG A;  3T08 A;  4P02 B;  3UES A;  3WDT A;  4UFI A;  4D7S A;  2WN3 A;  5DUU A;  1TVG A;  1OA4 A;  2Y33 A;  5FY9 A;  4FPJ A;  1OQ1 A;  1MEC 2;  1O4Z A;  2J22 A;  4ITC A;  1TNF A;  5K9Y A;  1GAN A;  3VBS B;  2Z2S B;  4EQV A;  2Y8K A;  4QGL A;  5FP7 A;  1QNW A;  2RMU 1;  2LW8 A;  4A41 A;  1DIW A;  4YLZ A;  5H9Q A;  3GZU C;  3WHU A;  1AR9 3;  2ZOE B;  1YQ6 A;  1GNY A;  1PK6 B;  3AYE A;  2PHF A;  3PNA A;  2BGC A;  3RG0 A;  5M0T A;  2D44 A;  2RS5 1;  5FYS A;  4OUE A;  2ZGP A;  3AVR A;  3BGA A;  3VBO C;  1W8F A;  4PLM A;  1FV2 A;  4D0Q A;  5FP9 A;  1SMV A;  3A22 A;  1UIK A;  4Y5Z 0;  3VHN A;  2R06 2;  4ASM B;  2IXH A;  5FZ0 A;  1AR6 3;  1UNB A;  5DXD A;  5JXI A;  3V0A B;  3QEF A;  1J59 A;  2BW8 A;  2R0F A;  4ERO A;  2UYA A;  5FPB A;  1XE0 A;  2RDQ A;  2ZGK A;  4YW1 A;  2WC2 A;  4XHX A;  3VKM A;  1S2E A;  2GND A;  5GLR A;  1WW4 A;  2ERF A;  4O9G A;  4CU8 A;  4D8M A;  4N1I A;  1W8T A;  4IEP A;  4JGZ A;  1NCQ A;  3RJR A;  3UYJ A;  1UY1 A;  3J8F 1;  4X6Q B;  4KCA A;  1OPO A;  4V2V A;  1TMF 2;  5EJ1 B;  3IIA A;  4HT1 T;  3U0Z A;  4GAZ A;  4WZF A;  4E4D X;  3U37 A;  1VBD 2;  4EN7 B;  1MVE A;  2DCT A;  2HWB 1;  4H14 A;  5FP4 A;  4QU2 A;  5C33 A;  5C8W A;  4PDW B;  3FL7 A;  2HWD 1;  1W8U A;  4XQD A;  1D2Q A;  2RMU 3;  1NOV A;  5EFU A;  1W9W A;  1AZD A;  3B93 A;  3MIC A;  1ZRE A;  3OM4 A;  2R1D A;  2VY0 A;  4RFT 0;  4E9K A;  4UW3 A;  4M4R A;  2ZMK A;  1CES A;  3LEK A;  1RUE 2;  3OG2 A;  3CJI A;  4JTO A;  1F4A A;  1W6Q B;  2RS5 3;  4OZX A;  5CYY A;  3ZYB A;  5LA1 A;  1DQ6 A;  3HPN A;  3ZOI A;  2O0O A;  2A1X A;  1D4M 1;  5IK7 A;  1QY4 A;  2IXL A;  2K0G A;  4OMC A;  3JB4 C;  4BM8 A;  2CSG A;  3AYC A;  5T54 A;  3D5O A;  3U75 A;  4DO0 A;  2VVF A;  4JC1 A;  4QPG A;  1W6P B;  2H6C A;  2D93 A;  2HBU A;  3NAP C;  1HW5 A;  3OB8 A;  2XGX A;  2ZEZ A;  3ON7 A;  1OF4 A;  3UV9 A;  1C8N A;  1ND2 C;  5EHD A;  3BYK A;  3GNE A;  1RUD 1;  2QQO A;  4EZ4 A;  1NZI A;  4B8E A;  4BQY A;  4N9H A;  4DY5 A;  4BIO A;  3DYP A;  5D1I A;  1SLA A;  1VIW B;  1W90 A;  3J8F 3;  3VZM A;  2Y6G A;  4JAA A;  3UGF A;  1NQD A;  2YDE A;  3LEG A;  3GZE A;  4M00 A;  5F37 A;  1JI6 A;  2PAE A;  4YM3 A;  3LQC A;  4Y1Y A;  1VBE 1;  1WLW A;  2HWB 3;  2JDK A;  3N7J A;  3D60 A;  1PO2 2;  1F5J A;  1IGO A;  2VD7 A;  3A0N A;  1PIV 2;  3HN3 A;  3MGU A;  2CDO A;  2B9V A;  2HWD 3;  1DGW A;  2XUM A;  3J7N A;  3WP6 A;  5IYY A;  3ATG A;  2D5F A;  1UWW A;  1UY0 A;  3HD8 B;  3NKT A;  3OM6 A;  4M0N A;  4AK6 A;  4JZR A;  4FOW A;  4Q1R A;  5FZ3 A;  4C1X A;  4TSV A;  4DY3 A;  4D6Q A;  1YIF A;  2F4P A;  2XVG A;  1D4M 3;  4CDW C;  1LNS A;  1N1V A;  5BNP A;  2WLQ A;  1VBB 3;  2JIC A;  3E6D A;  3GGL A;  3POG A;  4LKD A;  3UK9 A;  1SFY A;  1Y43 B;  3K48 A;  3N9M A;  5GLU A;  3WPU A;  3M3I A;  5IVY A;  1RUD 3;  4E27 A;  3P2N A;  4J25 A;  3N7M A;  3ZM8 A;  4FFG A;  4XET A;  2BWA A;  2R04 2;  4MXV A;  1OQE A;  2JB4 A;  3B3Q E;  5AVP A;  1LR5 A;  1O5U A;  2RM2 2;  2XDV A;  4KC8 A;  5FZO A;  5KHG A;  1ENX A;  4ZHN A;  4FFF A;  1VBE 3;  1O91 A;  3SNM A;  3T4V A;  4LE3 A;  5GLW A;  3WR0 A;  3LCP A;  2DVG A;  1NZC A;  4CUA A;  2Q1M A;  4UDK E;  3E5Q A;  2ZPX A;  4QT6 A;  3T0D A;  2NQY A;  4OI0 A;  1GSL A;  2R07 1;  3ECQ A;  3NST A;  3AZW A;  4EV0 A;  1PO1 1;  1W0O A;  4FXK B;  5I93 A;  2UYB A;  4HVQ A;  2DUQ A;  2WZR 1;  4IV1 A;  3WOG A;  3WMY A;  5CAD A;  5CAZ A;  1EYB A;  2EAA A;  1H2M A;  2D7F A;  4D47 A;  1KJL A;  5BV6 A;  4RR3 A;  2IVI B;  3ZXE A;  5I0S A;  1IS3 A;  4RHV 1;  4IER A;  4CCL A;  4X8P A;  4AFB A;  2ARC A;  5JPN B;  2QQL A;  4AG4 A;  1F15 A;  3O1O A;  3B01 A;  3RYP A;  3TEW A;  2K9Z A;  1QJU 2;  4LO6 B;  2DBI A;  3U4X A;  1V6L A;  3GHN A;  4CDW A;  4COV A;  5C6C A;  1SBD A;  4G4F A;  1WCK A;  2VNG A;  1CPM A;  3BCW A;  3RZJ A;  4Y1V A;  3KQR A;  2Z69 A;  3PUH A;  5DG1 A;  5A3M A;  3K3N A;  2TNF A;  3MYX A;  1LHV A;  2P37 A;  1S55 A;  3AMH A;  3ACL A;  3VZO A;  1JXN A;  2YXS A;  4YG6 A;  1STM A;  3HT1 A;  3BOW A;  3N9O A;  5D8A C;  5DN2 A;  1AYM 1;  5F3G A;  4NPR A;  4CP9 A;  4CSW A;  4URA A;  1SLT A;  3VSS A;  1ZX5 A;  3OGJ A;  3W5M A;  2WS9 1;  4LOS A;  4LOT A;  4CP2 A;  3IPV B;  4JDM A;  2VXR A;  1UPI A;  4CCD A;  4QKD A;  3U14 A;  1F31 A;  1SPP B;  5JMO A;  5A1L A;  4FSJ A;  3L2Y A;  5J7M A;  1PO1 3;  2VOW A;  3AZV A;  2WZR 3;  2OQ6 A;  2ID4 A;  2ZA9 A;  3NAP B;  4QHZ A;  2A71 A;  5EWS A;  3ZX7 A;  1X33 A;  2OKX A;  1UPS A;  2SBA A;  5L7O A;  1ND2 B;  1D2S A;  1EY2 A;  5ABJ C;  3AM2 A;  4DFS A;  3RZM A;  4RHV 3;  5KC5 A;  2XJV A;  2OPW A;  1VAM A;  2DU0 A;  2BDR A;  4I30 A;  2VW1 A;  3RYR A;  1W6N B;  1Y9M A;  1GZC A;  3WVJ A;  4CTE A;  4AOC A;  4AW7 A;  2GSY A;  2W94 A;  1LJ7 A;  3MHZ A;  4JX0 A;  4QDQ A;  4GWN A;  4QPI C;  4XBL A;  1GYD B;  1CX4 A;  5A7N A;  1UXZ A;  3PME A;  2JKX A;  2GU9 A;  4HSL A;  1BYH A;  2OX0 A;  3J7L A;  4K6B A;  1C5H A;  2E51 A;  2D6O X;  2GDF A;  3K75 B;  4M3C B;  4NO4 A;  1SQ4 A;  4R8H A;  4LBQ A;  5FYC A;  2I74 A;  5CU1 A;  5AFB A;  3VUO A;  1OOP A;  1XBF A;  3VDD C;  1CJD A;  1E5I A;  1KS4 A;  1AYM 3;  4HPK B;  4IET A;  2WNU C;  5GLN A;  2DDU A;  3FJS A;  2WWS A;  4FFI A;  4N53 C;  1H8V A;  2MEV 3;  4A6O A;  4IE4 A;  4O8N A;  4PIZ A;  1AXZ A;  3BI3 A;  3D8C A;  1EUT A;  3JBG 1;  1GYE B;  4MGK E;  1NY7 2;  5FMD A;  5I0R A;  4XEZ A;  4O8P A;  2WYS A;  3JU9 A;  3SH5 A;  2F6B A;  4CA9 A;  2Q0A A;  1QOS A;  4CCC A;  5BNO A;  5C70 A;  4QXH A;  2WO3 A;  4KL1 A;  1VR3 A;  2KR2 A;  2WA4 A;  4Z82 A;  3M7A A;  2XBO 1;  5GLL A;  4QQL A;  2XHN A;  4E8C A;  5JPM B;  3VV1 A;  1OVP A;  2ZGT A;  4RQP A;  2ARA A;  5ABJ A;  2HWC 1;  3VGI A;  1BVP 1;  1NLQ A;  4GH4 C;  1PMJ X;  4YFW A;  5EQU A;  4UXA A;  3M3C A;  2HEV F;  3POW A;  3OEA A;  1FPN 2;  3THD A;  4A3Z A;  3FFZ A;  4LA3 A;  3KHB A;  4YW5 A;  4UDK A;  2J42 A;  1HJF A;  3M8L A;  5LAS A;  4WVV A;  4AI1 A;  2WAO A;  2PN5 A;  2VM9 A;  3AXD A;  1AUY A;  2ZX0 A;  2CAU A;  1W8N A;  1JZ7 A;  4FPL A;  5FY7 A;  3LSE A;  3M3Q A;  1NE4 A;  4I3P A;  1W8W A;  1G9B A;  3SIT A;  5CIS A;  4CE8 A;  1RUO A;  3JBG 3;  1SHW B;  4D7T A;  3VDD A;  5DQ0 A;  3AK0 A;  2RDS A;  2RR1 2;  2VZ3 A;  4OI2 A;  3OPZ A;  5SV5 A;  2CDP A;  4AR2 A;  1RUF 2;  4B29 A;  3V0B A;  2JXA A;  2DV9 A;  4LLO A;  1MS0 A;  1W18 A;  2AZ5 A;  3K1U A;  1OC1 A;  1ZZB A;  2XBO 3;  3BN6 A;  1S0D A;  1A6C A;  2W1U A;  4CPB A;  2XL9 A;  3ZXF A;  2JDU A;  2DCJ A;  2V4V A;  4TXW A;  2HWC 3;  4LMF A;  2IUW A;  3VBF C;  5D8A B;  5FZ4 A;  4UDG A;  4D6R A;  1HB1 A;  4QB1 A;  3WLU A;  3C7F A;  2JDN A;  3QOP A;  2WNO A;  4PIY A;  5DUX A;  1AL0 G;  3MIF A;  1W2A X;  1LED A;  4LBN A;  2FBE A;  1VRB A;  2WWU A;  1CAV B;  3FX3 A;  3P1I A;  3ES1 A;  3SCF A;  1V6K A;  2VZU A;  4U6B A;  1C4R A;  3I59 B;  3MI8 A;  5A80 A;  2ZCW A;  4Y26 A;  1ZZ6 A;  4LK7 A;  4LIU A;  3ZFF C;  4CCN A;  3LSD A;  5E6H A;  1BMV 1;  1AR8 1;  1QGL A;  1ZVF A;  3BPS A;  3RZL A;  1U5X A;  2C4X A;  4PBO A;  1UOF A;  2ZX2 A;  2JB8 A;  3B5L B;  3MF9 A;  1YQ5 A;  4QPI B;  4M3C F;  4S2G A;  3EQE A;  1CAX B;  4GWM A;  3D4K A;  1U12 A;  4R9B A;  5JDB A;  1YQC A;  4NRQ A;  2E32 A;  3RZK A;  4OUS A;  1GFF 2;  4CCJ A;  1OLQ A;  1U5Z A;  5CG9 A;  5FUN A;  1IPJ A;  3AC0 A;  1WGP A;  1JYV A;  1SEF A;  5C4W B;  4Y20 B;  2WNU B;  1AL2 2;  2FZ2 A;  3SEE A;  1FV3 A;  4N53 B;  4L2N A;  5DMY A;  3BU0 A;  1S0B A;  3NV3 A;  5KHJ A;  3DPR A;  5JI7 A;  3H8X A;  1AX2 A;  5FYY A;  5FYM A;  2D3P A;  4R9D A;  1XOY A;  3VBR A;  1UCX A;  1F2N A;  4Q0S A;  1ZBA 1;  2FHR A;  1FNZ A;  4LHS A;  5IVE A;  4XQ4 A;  3DF0 A;  3PVO A;  1AR8 3;  1S0G A;  1XB9 A;  3K2O A;  4OQ9 A;  4B3N A;  2HEY F;  3RRD A;  1QJF A;  4EYU A;  1MZ6 A;  5LCW L;  3T3Y A;  1RHI 1;  1MQT C;  4YGC A;  4A2U A;  2DVF A;  1U5I A;  2ILM A;  3VDC A;  2VBP A;  4EN0 A;  1H9W A;  5FQ0 A;  1BJQ A;  1OI6 A;  3J26 N;  4GH4 B;  2WJS A;  4UT5 A;  5FYH A;  4CU9 A;  5I91 A;  2E53 A;  3RI8 A;  1AYN 1;  5FZ8 A;  2ZML A;  3IMN A;  5BPX A;  3WP5 A;  1DF0 A;  4XIK A;  2CWM A;  3ZXA C;  3TB0 A;  1HB2 A;  1SCS A;  4OI1 A;  1RXF A;  1RUC 3;  4Y22 B;  4Q0Q A;  2YRO A;  3MFA A;  1H1A A;  1HKD A;  1K12 A;  4WVW A;  5FZD A;  2DWR A;  4U36 A;  2V4A A;  2YFZ A;  1H1M A;  1NXM A;  4QM9 A;  1PGW 1;  1D0H A;  1AHS A;  4N2Z A;  1ZBA 3;  3I3Q A;  1ULG A;  4IDZ A;  5GLK A;  1W8H A;  3N9P A;  3SHR A;  3OPT A;  2HWE 2;  2BNN A;  1LTE A;  3M3O A;  3TNP B;  3PDQ A;  4YZ3 A;  1HN1 A;  2Z79 A;  3ZSL A;  4I0A A;  2VUA A;  2QQW A;  2DVB A;  5FYU A;  1RHI 3;  3NJX A;  3ZN6 B;  2VQ0 A;  3VSZ A;  5A3O A;  1ZZ7 A;  3LWC A;  5IAT A;  4AVA A;  3I3M A;  3U1X A;  2WYF A;  1CAW A;  1IS4 A;  1OBN A;  4COZ A;  3VBF B;  2K2S A;  4E4S A;  5A6Y A;  4AGV A;  4DXR A;  2V5D A;  5DAQ A;  2DU1 A;  1DLC A;  1E5S A;  2ZEX A;  3R4D B;  5B6T A;  5JZG C;  1AYN 3;  1QDO A;  4OFG A;  3BYN A;  5LEK A;  1VMF A;  1Y3T A;  4QKN A;  1COV 1;  4BPZ A;  2TBV A;  4KWK A;  4H2A A;  2PHR A;  4AED A;  2HKX A;  3ZFE A;  4W65 A;  1SDD B;  3H3Z A;  2DFB A;  5LK5 A;  2JDH A;  4AHY A;  3VKO A;  3KS7 A;  3VT0 A;  2BYV E;  2JIJ A;  3DUI A;  1HDK A;  4KGG A;  3VL9 A;  4FOQ A;  1LGN A;  3CLP A;  1RUH 1;  3ZFF B;  5JSR A;  3DKQ A;  3VZN A;  4XFC A;  4Z1V A;  1T6B X;  4CDU A;  5IT6 A;  4XXP A;  4QGN A;  3KCY A;  1BBT 1;  3H0O A;  4G9S B;  4ATE A;  4DB5 A;  3N36 A;  1Q5O A;  4XDQ A;  2RJL A;  1OSG A;  4KGQ A;  3VD4 A;  4JGY A;  4ARY A;  1S0E A;  2RVA A;  2ZX4 A;  3ILN A;  3RSJ A;  3TN9 2;  4LLF A;  2PQS A;  3UKN A;  3LFI A;  3MW3 A;  1G7Y A;  1EV1 2;  1W6M A;  1ALY A;  1RIT A;  3GJB A;  1DGW X;  3VZL A;  5FO9 B;  1IQD C;  4GB3 1;  4GJZ A;  3M4F A;  3NJY A;  3OBZ A;  4R4Z A;  3ZPY A;  3HQR A;  5DDJ 1;  2WAA A;  2WAB A;  1YUD A;  1V9U 2;  2QDR A;  2RG4 A;  2D3S A;  1ZRD A;  2YC2 A;  4AF9 A;  5GZG A;  1COV 3;  1JOD A;  5A3N A;  2W91 A;  2QQV A;  1XYO A;  2VMC A;  4IEW A;  4LEJ A;  4NID A;  4EN8 B;  2PHW A;  4XW3 A;  1IZ3 A;  1ENQ A;  3QED A;  2K46 A;  4K9S A;  5T55 A;  1K42 A;  1ZZ9 A;  1ASJ 2;  4IES A;  2FMY A;  4KWL A;  4L99 A;  3R4Z A;  1NAE A;  2D3R A;  1NCR C;  1TE1 B;  5BXX A;  1RUH 3;  2OUJ A;  4QXC A;  2RS3 2;  2X5I C;  2HH9 A;  4IUG A;  1GOH A;  3B00 A;  1C8M 1;  4LK6 A;  2D97 A;  1RMU 2;  4J1W A;  1EAH 1;  2BNM A;  3J9S A;  1BBT 3;  1X8E A;  3KD4 A;  3T2O A;  2WFF 2;  5A8D A;  1MQT B;  1RIR A;  2BP6 A;  4NAM A;  4MYE A;  5EXO A;  5FOB B;  1W05 A;  4M4P A;  5FO8 B;  2EIC A;  4CCK A;  5A8C A;  1XNA A;  2VC9 A;  4Q4W 1;  5FLH A;  1UOB A;  4AEM A;  1N3O A;  4AI0 A;  4NPM A;  2VTX A;  1H0B A;  4IGQ A;  4HKW A;  1W9Y A;  4IE7 A;  1HXS 1;  1WCD J;  3M3E A;  5GLQ A;  1FMD 2;  4A44 A;  4AFA A;  3R67 A;  1LHO A;  1NG0 A;  4GB3 3;  3ETP A;  4QHB A;  4AK5 A;  3RPQ A;  5EYY A;  5DDJ 3;  4P9X A;  5CFC C;  4FT8 A;  4IE0 A;  2AEN A;  3M1H A;  4P08 A;  5FYV A;  1LOD A;  1QJE A;  4FTS A;  5FMB A;  3TOJ A;  3IDE A;  1WBL A;  3EB7 A;  2XL7 A;  3CU9 A;  5BUV A;  5A3W A;  2QUO A;  2JG8 C;  2A5Z A;  1GIC A;  2ZAH A;  4GWI A;  3SCG A;  4BQ4 A;  2AC1 A;  3AMN A;  2HYX A;  1WA6 X;  3S7E A;  1Z0H A;  3N35 A;  4PLO A;  4R52 A;  1ZA7 A;  5FY0 A;  1C8M 3;  4YW4 A;  3H42 B;  4FQ4 A;  1EAH 3;  3O7O A;  5FOJ B;  2JWP A;  2VE1 A;  1W2U A;  2LUW A;  3LPG A;  4KG0 A;  3ZR5 A;  3ZXK A;  1VPH A;  3Q8B A;  3WW4 A;  4Q4W 3;  2VW2 A;  3KCC A;  5CG8 A;  2YU1 A;  5BNN C;  2RDN A;  5C3O A;  3AKG A;  1O3T A;  3EXU A;  1HXS 3;  2A3X A;  2WNV A;  2IXI A;  1UOG A;  2RJK A;  3ASI A;  3LDK A;  4NIH A;  2DCK A;  1NA1 A;  1GYK A;  1Z7S 2;  2BV4 A;  1H2L A;  2X09 A;  1OPM A;  2OYZ A;  5JSP A;  3SH3 A;  2E9Q A;  3OTF A;  3I2H A;  2AH2 A;  2CWS A;  2H6B A;  5IVV A;  1BVV A;  5T5J A;  4A7Y A;  1AX1 A;  1XQN A;  3IWZ A;  2NPI A;  2BGP A;  2C1F A;  1AR7 1;  4B4Q A;  3B9I A;  3DKW A;  2CGP A;  3OBA A;  3WV6 A;  5L19 A;  1QXP A;  2PYT A;  1VB4 A;  4XDO A;  2ET7 A;  2RS1 1;  4IEO A;  4CDQ A;  2YFT A;  3ACF A;  2ZS6 B;  4BJ0 A;  1RUG 2;  4L92 A;  1CVN A;  4KBZ A;  1Q8P A;  4QX8 A;  5G05 L;  1PGL 1;  3WP4 A;  1W3X A;  4XFH A;  4QQ2 A;  3TAW A;  1PT2 A;  5HV4 A;  3BTY A;  1ULP A;  1H8T C;  4XF9 A;  3VKN A;  3WIN E;  3VBS A;  3ZFG B;  1NLS A;  5GLV A;  1GOG A;  3H7Y A;  4CCO A;  4ES9 A;  2BZD A;  4C1W A;  5FZF A;  3VD3 A;  3NWK A;  4QQP A;  1R1A 2;  2XJS A;  3KVB A;  1PK6 A;  1WKY A;  4P9Y A;  4GKX A;  3W9A A;  2VG9 A;  4FP3 A;  4HXC A;  1JUI A;  5ACA 1;  3D0J A;  4JRL A;  3DL3 A;  3GCX A;  3OGR A;  2X8T A;  2GC3 A;  3WDX A;  4CP0 A;  3E5U A;  1RXG A;  4LTA A;  2WII B;  1HLC A;  1NCR B;  3A0K A;  1GP6 A;  3H50 A;  3LE0 A;  1SBE A;  3LIG A;  3ORJ A;  4XUN A;  4BDV B;  5A3L A;  3PIG A;  4U6D A;  2VBB A;  5FCC A;  1AR7 3;  2X5I B;  3ME2 A;  4W8J A;  3OY8 B;  2VTF A;  3C7E A;  2G1M A;  3IM0 A;  1AJO A;  2RS1 3;  1FNY A;  5FK8 A;  4YW7 A;  5F32 A;  2NMN A;  3T1M A;  1N3P A;  3AKQ A;  2VVD A;  2B4W A;  3N7L A;  1UD1 A;  1W2T A;  4IE5 A;  4B7K A;  4NIG A;  4B7E A;  1NUK A;  5F3E A;  4EWA A;  3GDB A;  1PM4 A;  4UAP A;  5LRR A;  1X82 A;  3BTA A;  3UL2 A;  1CON A;  1VKD A;  4RD7 A;  3LEI A;  4MGZ E;  4Q4X 1;  3WAT A;  4PDW A;  1W3V A;  3BTZ A;  2E26 A;  4AQS A;  2PHL A;  2WSU A;  2E7Q A;  4QWN A;  5CFC B;  4LO4 B;  3K4A A;  4YZ2 A;  1RVF 3;  4LNV A;  4OCT A;  4DRV A;  4HLT A;  4MGS A;  4FPE A;  1W06 A;  5T50 A;  1LRH A;  1W6Q A;  4RS5 B;  3VDA A;  3HBK A;  3WDW A;  1VBB 2;  3CKH A;  2JE8 A;  3KB5 A;  1N1T A;  2WNE A;  4KMI A;  4CEW C;  1XNC A;  2JG8 B;  2CTV A;  2LRP A;  2OZJ A;  2PHU A;  1MPX A;  3AMQ A;  1W6P A;  5DZF A;  2VZO A;  1JS9 A;  1RUD 2;  2BTV C;  5FP8 A;  1W9S A;  5BYN A;  5LEJ A;  3MBW A;  2WT2 A;  4FPH A;  1ZYB A;  3GF6 A;  4NPL A;  4Y24 A;  2YV8 A;  2FDK A;  1OMI A;  2R0H A;  1XSR A;  5JR2 A;  3R4U A;  2TUN A;  2LS6 A;  1ND3 C;  5HBA A;  3PJY A;  2VUL A;  2YPJ A;  3AKI A;  5LW9 A;  2OII A;  1PX4 A;  1W39 A;  3RFR A;  5FV3 A;  4FTB A;  4XYX A;  1F8V A;  2OXB A;  1QQP 1;  3FHQ A;  3SKV A;  1SLL A;  3UT0 A;  4Q4X 3;  4LKS A;  2Z42 A;  4M3C E;  4QD2 A;  5LRS A;  3LDB A;  5B2G B;  3K46 A;  5TSW A;  2NM1 A;  2Q4S A;  3IBM A;  1QIQ A;  1YO8 A;  3EO6 A;  1US2 A;  3CHX A;  1BEV 3;  3BIW E;  3H8O A;  1PMH X;  1YQ8 A;  4CXX A;  5I0U A;  4WVM B;  4L8Q A;  5FWE A;  5FPV A;  4TYS A;  2P3I A;  2D98 A;  3D5Y A;  4KU7 A;  1KRI A;  2YPD A;  1W2N A;  4RN5 A;  1I5Z A;  4OUL A;  1SDW A;  2HJI A;  3FC0 A;  4XOG A;  3KV6 A;  4YW2 A;  1LU2 A;  4KQ7 A;  1IOA A;  4FBF A;  3BB6 A;  5GLT A;  2MHF A;  2QBX A;  3ZYI B;  1TEI A;  1R08 2;  1AVB A;  1HRI 1;  1LOA A;  1ZZ8 A;  2PHX A;  4QKB A;  1H9P A;  5AC9 2;  1I1E A;  3GXU A;  2V72 A;  3E6B A;  3EBR A;  1VRH 1;  3G7D A;  5LWB A;  4GXL A;  1A78 A;  1HRV 1;  1H8T B;  1R09 2;  2ZZQ A;  3CIH A;  5DAX A;  4CEY C;  5LBE A;  4OHW A;  1W2O A;  2SLI A;  5LA0 A;  4YWA A;  4TZD A;  2VZT A;  2W1W A;  2Y60 A;  1S4C A;  1DQ4 A;  5FZE A;  2ZGM A;  2FZ1 A;  5GLP A;  3S5A A;  1QQP 3;  4ISQ A;  5CIR A;  2A3W A;  1Q8S A;  3OF1 A;  1OVS A;  2E31 A;  4BK5 A;  5GLZ A;  5KWR A;  5FPL A;  4COU A;  4FVV A;  2B7Y A;  3C7H A;  3KSC A;  5C3Q A;  2ATF A;  1UU4 A;  4W6W A;  3WDY A;  3IB3 A;  3MW2 A;  4XHB A;  5IAV A;  4S2F A;  5IVB A;  1Q8O A;  4I09 A;  1HN0 A;  1K5M B;  1WZX A;  2C9A A;  4SBV A;  3VBO B;  2P1B A;  1CD3 G;  1GWL A;  1KDK A;  4WM8 C;  1JOJ A;  4XFB A;  5B4X A;  3WF0 A;  1F4H A;  3BOD A;  5KXD A;  1RUN A;  3PIJ A;  4XJW A;  4CP1 A;  4YSF A;  4JV4 A;  5FR3 A;  2P3Y A;  3AL5 A;  1ZM1 A;  2UUR A;  5DAB A;  3RZH A;  5FUI A;  1HRI 3;  3QZ4 A;  4YAR A;  4CZS A;  2P4E A;  1MEC 1;  4XAA A;  3WT3 A;  5FZ6 A;  3S30 A;  3K4Z A;  2W9X A;  1VRH 3;  4YFZ A;  3WPV A;  3AL6 A;  1HRV 3;  3J7H A;  3WUC A;  2ZX1 A;  4HET A;  2CV6 A;  2DBN A;  2D6K A;  4IEZ A;  3O1V A;  1REE A;  5LK7 B;  1JZ5 A;  3OYW A;  1RJ8 A;  3PU8 A;  2XVK A;  3GBF A;  2MEV 2;  2VNO A;  4O61 A;  4IND A;  1G9C A;  5CFD C;  3MV0 1;  4DEQ A;  4UW5 A;  2XJT A;  2ZEW A;  2UWB A;  4HK9 A;  1FI2 A;  2VUC A;  4NOV A;  2EXJ A;  1FXZ A;  2R06 1;  1VB2 A;  1OQD A;  3IPV A;  1SPP A;  3ZN5 A;  5JIA A;  3D82 A;  4CEW B;  2ZGR A;  1VMJ A;  1WW7 A;  5E88 A;  4Q0U A;  3D61 A;  4EWE A;  1GUI A;  1DCS A;  3NAP A;  1BLZ A;  2BU9 A;  2NN8 A;  1UAI A;  2PEL A;  4O7X A;  3ACH A;  1K3I A;  1ND2 A;  3VD9 A;  5EYX A;  2ETE A;  2Q5T A;  1TMF 1;  3GYD A;  1ND3 B;  5A1F A;  1APN A;  2VCA A;  1W6N A;  2H0B A;  5I8T A;  1Y9Q A;  1MEC 3;  1VBD 1;  4N43 B;  3OGG A;  3WPZ A;  3W5N A;  3NKG A;  1GV9 A;  3U78 A;  4NE9 A;  4BLI A;  3T0B A;  4R9A A;  5C7G A;  4URT A;  3ZXD A;  4AGG A;  2VBD A;  4YGE A;  4TLF A;  4BCU A;  2RHP A;  5J36 A;  1FAT A;  1KJR A;  2O1Q A;  4M3C A;  3USU B;  4BQ1 A;  5FYI A;  1XSQ A;  3JUU A;  2VGD A;  4A4A A;  2QQJ A;  4NHY A;  2WT1 A;  4HPK A;  3BU7 A;  3S6P A;  4E8D A;  3I2K A;  5FP3 A;  4IGO A;  2YFU A;  5K0U B;  1A8M A;  1V6M A;  1N1Y A;  1US3 A;  2R06 3;  1WW6 A;  3D3A A;  3I2I A;  4XBN A;  1B35 C;  2OS2 A;  2CY6 A;  4LKE A;  4HVO A;  3LF7 A;  2ES3 A;  2XLG A;  3GCW A;  1XU1 A;  1KQR A;  5LB6 A;  3AB0 A;  5KBF A;  3ZYR A;  1XND A;  2VEC A;  5A1A A;  2PLV 2;  4HKO A;  4OHV A;  4YM2 A;  3V56 A;  2DUR A;  2A6Y A;  2QJV A;  3I2G A;  1TMF 3;  4QDS A;  3I97 A;  4QX3 A;  4XUP A;  3VBH C;  4ZKT B;  3H8R A;  4CEY B;  1XXN A;  1QMJ A;  3VT1 A;  3MO4 A;  5FY8 A;  2FCT A;  2JDP A;  3DYO A;  1VBD 3;  2VME A;  2R07 3;  1PO2 1;  1SAC A;  2PFW A;  4XFA A;  5FPA A;  1PIV 1;  3RMX A;  2VQT A;  2WWJ A;  2QZ3 A;  3MLJ A;  4RGG A;  4AQ6 A;  2JE9 A;  1OD5 A;  4FP2 A;  4F3J A;  5LY1 A;  3Q8E A;  4PF1 A;  2BEO A;  3D0S A;  5ISL A;  5E16 A;  1CAU B;  2VU9 A;  5FKB A;  3VLB B;  2EIE A;  4N7I A;  1S0C A;  3NQH A;  3NVC A;  3UJQ A;  3ZXJ A;  4JDN A;  2D6N A;  3AYA A;  2QQK A;  2N7G A;  2YFS A;  3BKZ A;  1YIP A;  3SH4 A;  3QH7 A;  4KG8 A;  3WAS A;  1MS3 A;  4XJZ A;  3R4S A;  5FJK A;  2CU5 A;  3GM8 A;  4WM8 B;  4BLJ A;  4AVB A;  4QQH A;  4Q4V 1;  3NNF A;  5FYZ A;  5A7O A;  4Y1Z A;  5F3I A;  3H7J A;  4CUG A;  4NOT A;  4XZU G;  1O7F A;  1WME A;  4EZH A;  1NXD 1;  3THP A;  2R04 1;  2DCZ A;  3R6S A;  2WO7 A;  1HB4 A;  4Q4Y 2;  5A32 B;  3DEM A;  5C4W C;  3T0A A;  2RM2 1;  3VBU C;  2C6S A;  3ZXL A;  2WS9 3;  2VUD A;  2I2S A;  3P3P A;  1TG7 A;  1PO2 3;  1JYW A;  3I4I A;  1PIV 3;  2BJS A;  1GU3 A;  2JDY A;  3IT8 A;  1LHN A;  5A7V A;  3PTY A;  1WWY A;  4LIT A;  5CFD B;  5D8A A;  5KXE A;  4ZU4 A;  3WMZ A;  1QNY A;  4IV1 B;  1CZV A;  1D4V B;  2AUY A;  2MPF A;  1GWM A;  4M01 A;  4RR3 B;  1QH6 A;  3KT1 A;  2Y6K A;  3KGZ A;  1CAV A;  3IMM A;  5AY9 A;  3MLL A;  4I3G A;  4MGY E;  2PMW B;  1Q8V A;  3ZMN A;  1KEX A;  4A7Z A;  4QX5 A;  3I59 A;  5KXC A;  4Q4V 3;  5KR7 A;  1JOP A;  3PUQ A;  5CKQ A;  3ZLI A;  4BQ3 A;  5L9V A;  3LV4 A;  1SZB A;  2P3J A;  3BIE A;  1KD7 A;  4EN6 B;  4MAD A;  3PVE A;  1QJU 1;  3ZN4 A;  1OHF A;  3POS A;  3RI9 A;  2VOX A;  4E2Q A;  4BIS A;  4K8F A;  3WHT A;  3WPY A;  3H3L A;  5F5I A;  1PNF A;  4QPI A;  4BH9 A;  5BNQ A;  1JYX A;  2CGO A;  4Q26 A;  3C2U A;  1CAX A;  2RM2 3;  3DEC A;  3AZX A;  1WA4 A;  4LIV A;  5GLM A;  2Q8O A;  1QJX 2;  5FZC A;  1RUC 2;  2P6H A;  2R1B A;  4P9L A;  3U4S A;  2GC2 A;  2HBT A;  4AI8 A;  3PJQ A;  1A34 A;  2X8S A;  2FDH A;  2RV9 A;  5C4W A;  2XB6 C;  1ZBE 2;  2ARB A;  2WNU A;  3A23 A;  3AKP A;  4N53 A;  1JH5 A;  5A7W B;  3VHO A;  5B6S A;  1YI7 A;  2FCV A;  5FZA A;  4YM0 A;  3NO8 A;  4LHK A;  5A70 A;  1B35 B;  2ORX A;  5FMO L;  3TBD A;  4LXL A;  3T09 A;  5LA2 A;  4ES8 A;  2DVD A;  1DLL A;  1JHJ A;  3G6J B;  5T5L A;  1H4H A;  2XML A;  1QH7 A;  3P3N A;  4OLL A;  5FY4 A;  5F7U A;  2Z5W A;  1NE6 A;  1YXW A;  5FJH A;  2DTY A;  3VBH B;  1QJU 3;  1W6O B;  3I2J A;  1T6G C;  3AYD A;  1GKB A;  3VHR A;  1QOO A;  2YC4 A;  2B8M A;  3CU7 A;  1CZT A;  4LO8 A;  2A6V A;  3UKT A;  2EIB A;  5T52 A;  2QQI A;  2VNV A;  1TME 2;  4RSU A;  4IE6 A;  4JQT A;  3EYP A;  5JMC A;  2XR4 A;  4GH4 A;  2W47 A;  1W99 A;  4JKK A;  3SCH A;  3WNK A;  3KT4 A;  2XON A;  4L9B A;  3OGV A;  3AZZ A;  2YGL A;  1ST8 A;  1UU6 A;  4J1X A;  5FZI A;  3WQB A;  4BXS V;  4IQP A;  4IXL A;  4XUR A;  5D21 A;  1FOD 2;  4KWJ A;  3TWI A;  1PVC 2;  4WM7 C;  1MS4 A;  4XTP A;  3KWV A;  1XNB A;  1NY7 1;  2J7M A;  2WR9 A;  3Q9O A;  3B02 A;  1K5J A;  2GH8 A;  2EID A;  1QHD A;  3PLQ A;  4XFG A;  4YRD A;  5F1R A;  1MS5 A;  5FK7 A;  5A3P A;  3F2Z A;  1RTV A;  2D6L X;  1J3P A;  3ENR A;  4I0B A;  3WSO A;  1X50 A;  1RUI 1;  3O0V A;  5FUP A;  3ZSK A;  4GWJ A;  4OI4 A;  4XUO A;  4A45 A;  1TNR A;  2WN2 A;  4MV2 A;  4AAX A;  2IWG B;  3VBU B;  1KFX L;  3WDV A;  2ZJC A;  1BZW A;  1LEC A;  4GJY A;  5JAX A;  3N9N A;  1LUL A;  2XLA A;  3VBF A;  1FPN 1;  4YG3 A;  1SLB A;  3WNP A;  2QKD A;  2HYK A;  5C8C B;  3LOB A;  5AYC A;  2VMF A;  4MET A;  5CNA A;  4GUL A;  2GP3 A;  4XF1 A;  5JXJ A;  1PMI A;  1VP6 A;  4GMP 0;  1UKG A;  2EAK A;  1ENR A;  2JEN A;  2MNG A;  4Y3O A;  3I49 A;  1SLI A;  4XMA A;  5DZE A;  1WL7 A;  4DIN B;  1GZW B;  3AX4 A;  3NNJ A;  2RR1 1;  3SEP A;  3MIH A;  3ZFF A;  3ELN A;  5FZ7 A;  1MZE A;  1RUF 1;  4FXG B;  4RFR B;  3HNY M;  1IPK A;  1NYW A;  4BQX A;  1XC6 A;  4Q1P A;  3T2Q A;  2WZP P;  5C3S A;  1PGS A;  3VZK A;  3OM7 A;  1RUI 3;  1JZ4 A;  3O1M A;  4FQZ A;  3SKJ E;  5KC6 A;  1L7Q A;  2KXL A;  3HJR A;  3IAQ A;  4QX1 A;  2VQA A;  4Z07 A;  2VO5 A;  5FLW A;  3PVB B;  4BU2 A;  2YU2 A;  1VAK A;  1XJA A;  2VZV A;  3GZT B;  3TNQ A;  1LU1 A;  4XAE A;  5GJ6 A;  3PVN A;  1IHM A;  3RMY A;  1DGR N;  3C7G A;  4XJU A;  1JZ3 A;  2H0V A;  5FO7 B;  3ZSJ A;  5JOW A;  3KGL A;  3JD7 2;  1YWK A;  1UZZ A;  4P9I A;  2KD7 A;  1VJ2 A;  2YBP A;  3AP9 A;  3M2M A;  2FD8 A;  4MXW A;  4Z2W A;  4UI9 L;  2VVE A;  4HON A;  4F7Z A;  4MZU A;  4OHY A;  3RYK A;  3O14 A;  2CYF A;  4WZC A;  5EV7 A;  4BQ2 A;  3B7M A;  1HB3 A;  2BWC A;  4W6Y A;  2WQ8 A;  2XJR A;  2OVU A;  3AKS A;  3VHP A;  2RR1 3;  3ZYH A;  3WNX A;  3LFM A;  5IJR A;  4JCK A;  1RUF 3;  3ZKY A;  3K4D A;  1GBG A;  4FPF A;  4ARX A;  4D94 A;  4QM8 A;  4BMB A;  3E1F 1;  5FPU A;  2JX9 A;  1QXR A;  4E2G A;  3TEY A;  4WV8 A;  4AVS A;  1T2X A;  1Q56 A;  1MQT A;  5C3P A;  1GP5 A;  3R05 A;  3BYJ A;  4HL0 A;  3POY A;  1YCI A;  4TWT A;  4ZS3 A;  4PVA A;  4FI9 A;  5IWF A;  3H8U A;  1Z78 A;  2CAV A;  4MHU A;  4EWD A;  1UZW A;  1WLT A;  1YHF A;  2VOV A;  2WZE A;  5FXX A;  4A7K A;  2BUK A;  3AP6 A;  3WG4 A;  1BCX A;  1AF9 A;  1VBA 2;  5L9B A;  3WW1 A;  4AEK A;  2VZP A;  2ADD A;  3ZVX A;  1VBC 2;  4IEY A;  5HCB A;  4RGA A;  3FUO A;  3J4U H;  1PZ9 A;  4D69 A;  2GN3 A;  4QQS A;  4WM7 B;  3HEI A;  4OVE A;  3HQX A;  4XZP A;  5ANQ A;  4BQ5 A;  3VN4 A;  1W28 A;  2X29 A;  1IG0 A;  1FAY A;  1LAJ A;  4AL9 A;  1QF3 A;  4NHM A;  2IFR A;  4HMZ A;  4PLN A;  5B4N A;  1XNT A;  2VZ1 A;  3ZFG C;  3PTR B;  3T2P A;  1RUJ 2;  4K8R B;  4QU1 A;  4PHZ A;  4UBG A;  4WBB A;  1C5I A;  2AGS A;  4XF4 A;  4BME A;  4HZF A;  1Y4W A;  2Q1F A;  1IPS A;  1RC6 A;  1C3H A;  5H9S A;  2XLF A;  1YRZ A;  1O59 A;  3VT2 A;  2GNT A;  4ISR A;  1WCS A;  4L97 A;  4CYD A;  2E33 A;  3HAG A;  4BE3 A;  2X10 A;  3U07 A;  4QQO A;  3VDB A;  5JZG A;  4LBO A;  4DRR A;  3KV4 A;  2B5H A;  2ET1 A;  3P6B A;  3W58 A;  5J37 A;  3DXT A;  3WEZ A;  4FPG A;  5EIY B;  2R30 A;  4U2A A;  1URX A;  3ALQ A;  3RS6 A;  4XPV A;  5SV8 A;  2VOT A;  3OGS A;  5I8S A;  3OUJ A;  1V0A A;  1SBF A;  1QJY 2;  2QDN A;  4Y33 A;  1NX9 A;  2RS1 2;  2Q30 A;  2QZ2 A;  5FLI A;  5I0D A;  4LO7 A;  2HWE 1;  2JDZ A;  3Q8C A;  4I02 A;  1MZ5 A;  2IC1 A;  5J98 B;  1DQ5 A;  4DPN A;  2JD9 A;  3MZH A;  1CIW A;  4PI0 A;  4XE9 A;  1OYG A;  4RL7 A;  1L7L A;  1VMH A;  5IK5 A;  3QBQ A;  2GMP A;  4HBN A;  5LBB A;  2WA3 A;  4RS5 C;  1LOG A;  1JYC A;  1OH3 A;  2W1Q A;  2Y34 A;  3HMY A;  4XC9 A;  3ZFG A;  4E2S A;  1DFQ A;  2WT0 A;  1RVF 2;  2GZW A;  4K3U A;  2VQU A;  4XTM A;  4ONZ A;  2G19 A;  1C1L A;  3KV9 A;  2BVV A;  2E6V A;  1HQW A;  1YFX A;  2IXK A;  3UKV A;  1PVX A;  2VTX J;  1RED A;  3WQ1 A;  4UF0 A;  1VLN A;  1W0N A;  1NT0 A;  1DQ2 A;  2J1S A;  2PAM A;  3CZJ A;  4QPW A;  1FYU A;  4NVP A;  2ZHL A;  4AFC A;  2B45 X;  1JU3 A;  1UY3 A;  1CWP A;  5A6X A;  3FE5 A;  1NCR A;  1AR9 2;  1DYP A;  4P5H A;  4OZO A;  4FOY A;  4PBP A;  4XCA A;  4H55 A;  4XAC A;  5FAX A;  3GAL A;  1GNZ A;  4K40 A;  2X5I A;  2YBS A;  4F83 A;  2JEM A;  3OY8 A;  1LOF C;  1HQN A;  2VCB A;  3HNM A;  4A42 A;  4CDX C;  1AXK A;  1E5R A;  2UWA A;  2O8Q A;  2J1A A;  2HWE 3;  3RNS A;  5A33 B;  3TN9 1;  5HI0 A;  4OQ8 A;  1YYN A;  3LGR A;  1AR6 2;  1EV1 1;  1O3R A;  2GH2 A;  2ZBJ A;  3I3E A;  2C0Z A;  1UKR A;  2HWF 1;  4YVS C;  2WBK A;  3O0W A;  3T4H B;  2R32 A;  4XF3 A;  2X53 S;  1BEV 2;  4HKL A;  2B46 X;  1BQP A;  4LBM A;  3O1T A;  2WO1 A;  3FBM A;  3W20 A;  5LZ6 A;  1HQL A;  1V9U 1;  3IAP A;  3THC A;  4DNY A;  5CFC A;  1PX3 A;  2FDF A;  2BOJ A;  1OA2 A;  3VB9 A;  2TEP A;  4X8N A;  1GOF A;  5LY2 A;  3T30 A;  4Q0P A;  4BOW A;  3Q8F A;  4RS5 A;  1H2N A;  2OZ6 A;  2XUE A;  3LZZ A;  5JSO A;  1ASJ 1;  5CBL A;  1OLR A;  3RZZ A;  1W8O A;  1WD4 A;  3CMG A;  4I0W B;  3CNA A;  2RMU 2;  1JUH A;  3ETQ A;  3HIF A;  5FZ9 A;  2JG8 A;  1DU3 D;  1ONA A;  3WAU A;  2R16 A;  2W52 A;  2OUH A;  1GQP A;  2JG9 C;  2VW0 A;  1RMU 1;  2RS5 2;  5FXZ A;  2P34 A;  2WFF 1;  1MVQ A;  1O8P A;  3FHA A;  1D7P M;  2OW4 A;  2WQZ C;  1LCL A;  4AHX A;  2GNM A;  1DYO A;  3TN9 3;  4IGP A;  2C24 A;  4MO3 M;  3W21 A;  1VAL A;  1J1T A;  5DPN A;  1EV1 3;  5HCH A;  2XJQ A;  1GZT A;  3NL1 A;  1BXH A;  2HWF 3;  3RQ0 A;  3ZYJ B;  1FMD 1;  2ARE A;  5BNN A;  1GR3 A;  4KBB A;  1K5M C;  3BYL A;  5KHH A;  1G9A A;  4YW3 A;  5JI9 A;  1H6X A;  1JZ2 A;  2ARX A;  3E5X A;  2XH6 A;  2Q8D A;  3RVH A;  4YNI A;  4AAP A;  2Y6L A;  4MVT A;  2DF7 A;  4NRO A;  3J8F 2;  1OA3 A;  4I2O A;  1YJK A;  4AVC A;  3QC2 A;  4WVM A;  3VSF A;  2ZGS A;  1POV 0;  2ZGN A;  4YVW B;  3ABZ A;  1W9F A;  4IEU A;  2HWB 2;  4CU6 A;  2ZMN A;  1ASJ 3;  4LA2 A;  1IKQ A;  3BOP A;  1YEW A;  2G9Z A;  2DVA A;  1Q3E A;  2HWD 2;  3KV5 A;  4NJ4 A;  4C91 A;  5J3U A;  5F9T A;  4PI2 A;  1DQ1 A;  3NV4 A;  1J3R A;  1I3H A;  3MUY 1;  2RDR A;  3B94 A;  3OOX A;  3AFK A;  1KDM A;  3KF5 A;  2BBV A;  1C1F A;  1RMU 3;  1H2K A;  2E7T A;  3V64 A;  3B9C A;  2WFF 3;  2HLE A;  4CCE A;  4D3W A;  1D4M 2;  3L2H A;  1H8T A;  4KH9 A;  4XFI A;  1W03 A;  5ACA 3;  4UYB A;  2VZS A;  2EXI A;  1NA1 B;  4X6R B;  1UX7 A;  3BYW A;  3S5Q A;  4N2R A;  1FMD 3;  4LOR A;  3GHM A;  1Q8Q A;  2XJU A;  1Z7S 1;  1NCQ C;  3ZSM A;  4FFH A;  3JQX A;  3WNO A;  1UV4 A;  1QJZ A;  3O1P A;  4NII A;  3FWE A;  3WQ0 A;  1WW5 A;  5IFT A;  5AYD A;  1WLC A;  2X8K A;  4IV3 B;  4K1Z A;  4HFS A;  2EXH A;  3VD5 A;  1KFU L;  4TLG A;  3GBW A;  3LB9 A;  4QMA A;  2W2I A;  1K5M A;  2W92 A;  4TN7 A;  1VBE 2;  4WVZ A;  3RWK X;  3VBO A;  5JCT A;  4N43 C;  2W87 A;  3I7D A;  2BVB A;  2LM3 A;  4ZXK A;  2I45 A;  4R4X A;  5JWP A;  4GZ9 A;  2DYC A;  1RUG 1;  2XQX A;  1L7R A;  2D43 A;  4CDX B;  3WNL A;  3NNL A;  3WN1 A;  3CJI C;  3MIG A;  3WW2 A;  1H30 A;  4QGM A;  3RWN A;  2GN7 A;  1DYK A;  1RL3 A;  1G8W A;  1DZQ A;  4GQ7 A;  5FXW A;  2FDJ A;  4BA6 A;  2ADE A;  2YG0 A;  4K1Y A;  4YVS B;  5FTT C;  4QPG C;  2A6W A;  5F6K A;  2B4K A;  5K0U C;  2QQM A;  2AR6 A;  1SCR A;  1S0J A;  2J1U A;  2EF6 A;  4MGT A;  2YB7 A;  1HJG A;  5H9P A;  2ZHM A;  5C9A B;  4Q8L A;  1R1A 1;  4AFM A;  1LOE A;  2VAU A;  3AVS A;  4KNC A;  4UDJ A;  3FMG A;  1Z7S 3;  2WFP A;  2VH9 A;  5JXG A;  2XHK A;  1YNA A;  1F9K A;  3DN7 A;  4LPL A;  4S2D A;  5FYB A;  4AVT A;  4DUV A;  2ZHN A;  1EUU A;  4JHZ A;  4KU8 A;  2A6Z A;  4AQ2 A;  4LHN A;  4XQW A;  3LOI A;  4C8D A;  5E89 A;  4NR1 A;  4CXW A;  1NQJ A;  2YFR A;  4CEW A;  1SLC A;  3PU3 A;  1XYN A;  4AVV A;  4Z8B A;  5C71 A;  4AE2 A;  2ZGO A;  1I5P A;  4N8M A;  2P6C A;  2YBK A;  3NV1 A;  2F4L A;  2B39 A;  5T5P A;  2JG9 B;  3MFC A;  4LR4 A;  3UNP A;  1ENS A;  3INA A;  3ZKU A;  3WG2 A;  3III A;  1RUG 3;  3FHI B;  5GAL A;  5KHI A;  5GLO A;  1GP4 A;  2YYO A;  3E97 A;  1ND3 A;  2R07 2;  3HOB A;  4H3W A;  2VPV A;  3TAY A;  1PO1 2;  4XCB A;  4ATF A;  5IHR A;  3N4M A;  4AI3 A;  2WZR 2;  4N43 A;  1LKN A;  3WY6 A;  4FOV A;  2XPJ A;  4AK3 A;  2UY9 A;  5BNP C;  1QU0 A;  4UW6 A;  3MID A;  2E7A A;  4UFH A;  4XBQ A;  3KT7 A;  2FDG A;  1PNG A;  5CEH A;  3KLS A;  4D6S A;  4RHV 2;  5APA A;  3A7Q A;  3WCR A;  4B4R A;  3VKF C;  1R1A 3;  3SXW A;  2XWB B;  3USU A;  2BFU L;  1MR5 A;  4UFM A;  1H6Y A;  4H7L A;  5FZM A;  4ZZ8 A;  4CCM A;  1K45 A;  3ZR6 A;  4MLG A;  3MUZ 1;  1VBB 1;  3H9A A;  1YQ2 A;  4I01 A;  5IFP A;  3PMS A;  2NP0 A;  3Q8A A;  4PVI A;  1OKQ A;  5K0U A;  2R7E B;  3FLP A;  3PUA A;  1W04 A;  4QXB A;  2V5Y A;  4OMD A;  1J3Q A;  2VCM A;  4ZU5 A;  4Q2F A;  4IEV A;  5FMO S;  3UGG A;  1UMZ A;  1AYM 2;  1E5H A;  3QH6 A;  2EVX A;  2W46 A;  2ZGL A;  3LA7 A;  5FRA A;  1RB8 G;  2A70 A;  1LEN A;  2F17 A;  2DUP A;  2B42 B;  2A6X A;  2WS9 2;  3MEP A;  4LJH A;  3KHC A;  1DG6 A;  2VDT A;  4IV1 C;  3HVD A;  4CEY A;  2V73 A;  2QQN A;  3CEW A;  3MV1 1;  4M0H A;  4P9W A;  4AYU A;  3AP4 A;  5J48 A;  5L36 A;  2WO2 A;  1V70 A;  3LA3 A;  4RR3 C;  1REF A;  1J84 A;  1LHW A;  4JGZ B;  1NCQ B;  4Q0V A;  1G6N A;  1ULD A;  2YUE A;  3OBR A;  1GQH A;  1Q43 A;  3HBZ A;  1TL2 A;  4JQR A;  4KWU A;  3ITQ A;  2CGN A;  1CAU A;  4JTN A;  2Q8E A;  2VMD A;  3BVC A;  4A3X A;  4YGB A;  5AFE A;  3TYJ A;  5JOY A;  4OYU A;  5F2W A;  4PT6 A;  2QVS B;  1OLM E;  1KIT A;  4Q4V 2;  3ZO0 B;  3EJK A;  1KS5 A;  2NYY A;  1IS6 A;  3I2D A;  4P14 A;  4WM8 A;  3I3B A;  3NV2 A;  3AKF A;  2WQ4 A;  4FPK A;  4Z92 B;  3WF2 A;  1R08 1;  1R1Z A;  4MH0 E;  2HEW F;  1DP0 A;  1XPW A;  3C8X A;  3CJI B;  3SIS A;  2WDB A;  5AC9 1;  5BNN B;  2J1R A;  3IDA A;  4MHR A;  1EPZ A;  4LBK A;  5CB7 A;  1ULF A;  1XRU A;  3WG1 A;  4DEV A;  3LPF A;  1LOC A;  4C0B A;  3U10 A;  5GZF A;  1RUE 1;  1WD3 A;  1R09 1;  1DHK B;  3K3O A;  4K20 A;  5DAV A;  2Y6J A;  4AEJ A;  3KQ4 B;  4OUM A;  1ZRF A;  4FPO B;  5A32 A;  4GAL A;  4QPG B;  1BKZ A;  1PHM A;  3AKT A;  3S0M A;  5HPO A;  2W1S A;  3JBG 2;  1OUS A;  2FCU A;  4MX3 A;  5L7O C;  2D6M A;  5IVF A;  4LHL A;  4XJ8 A;  4N4B A;  4ONU A;  2O14 A;  4W50 A;  1SFN A;  4DIQ A;  1UF2 C;  1GWK A;  2W95 A;  3AMM A;  2C5D A;  5CFD A;  1UXX X;  3POE A;  5FY1 A;  5IUQ A;  3WXP A;  2Y6F A;  2A73 B;  2XBO 2;  2WUH A;  3KCX A;  2JDA A;  1RJ7 A;  4L11 A;  1UX6 A;  3EMR A;  1MAC A;  5F5A A;  1G9D A;  4EJR A;  2HWC 2;  2V09 A;  4AGR A;  1UY4 A;  1YLL A;  4QAW A;  4UOJ A;  1OOP C;  1R08 3;  1W8Z A;  3JXS A;  1MS1 A;  2VNR A;  5HXV A;  5AC9 3;  2WL1 A;  2AYH A;  1G86 A;  2UU8 A;  3CZU A;  2G9F A;  2EAL A;  4DXZ A;  1C28 A;  3AJZ A;  1UOJ A;  1RUE 3;  1R09 3;  3OYW B;  4LUM A;  4RA0 A;  2QE3 A;  3ZDV A;  5BNP B;  3N9L A;  4HOO A;  4ZY9 A;  3KST A;  1RIN A;  1R64 A;  3KMH A;  5D2A A;  4IEQ A;  5C5U A;  4DZG A;  1HV1 A;  2MEV 1;  2DTW A;  4D7Y A;  3QLQ A;  5BNO C;  1XYP A;  3WZ1 A;  3WF4 A;  1S1A A;  5DAP A;  3JQW A;  3MIB A;  5AYE A;  5K8S A;  4DS0 A;  3BAL A;  3KZ4 C;  4GA9 A;  4UFK A;  2I07 B;  1WCQ A;  3GJA A;  3VD7 A;  5IAX A;  4AZZ A;  1U5Y A;  5A7W A;  4H7M A;  3POJ A;  4XMI A;  4XXA A;  1UZ0 A;  5FZO B;  4RQP C;  4ASK A;  5C3R A;  2Y64 A;  1UQX A;  1B35 A;  2E63 A;  4EE2 A;  5C5T A;  2J1V A;  4Y1X A;  1UU5 A;  3FLR A;  4HAN A;  1V6J A;  3MPP G;  5FZ1 A;  4MGQ A;  3WDU A;  3UGH A;  2BBA A;  1JBC A;  1ODM A;  1ZRI A;  1LGC A;  1YFY A;  2ZTN A;  2YC0 A;  2VZR A;  1OFN A;  4NN0 A;  2QTW B;  3T2T A;  1F35 A;  1CJP A;  2C9K A;  4O9E A;  1UY2 A;  3VBH A;  3O0X A;  1W6O A;  3S7I A;  2IFW A;  5C8C C;  1HIX A;  2ZEY A;  4K21 A;  5HV0 A;  1WCU A;  3WD5 A;  4PJY A;  5A3U A;  1AX0 A;  4HSJ A;  2EA7 A;  4K7J A;  5FLJ A;  3O1S A;  1BMV 2;  1AR8 2;  1J58 A;  2XG3 A;  3H1M A;  5EZW A;  5FIX A;  2XKP A;  2ZAA A;  5F3C A;  4CDW B;  1YJL A;  3OPW A;  1ZRR A;  1S2K A;  3RJ2 X;  4F8A A;  3DYM A;  4UBH A;  4BHP A;  1XNK A;  2DFC A;  3FN9 A;  2CNA A;  5CKN A;  3N9Q A;  2R04 3;  3QAC A;  5KHK A;  4Y1U A;  4CUC A;  1OLM A;  4QDR A;  2QQU A;  1H1I A;  4LUK A;  3WF1 A;  4GMP 1;  3JZV A;  1B09 A;  2WIN B;  2PAK A;  3LDR A;  2GNB A;  4CP9 B;  3SMH A;  2PLV 1;  2BRT A;  1RUI 2;  4AWD A;  1ACC A;  2LTN A;  3MLK A;  3THT A;  3LEM A;  5JUV A;  3K51 A;  4LO5 B;  3ZYP A;  1H4G A;  3AZY A;  5HXM A;  3AKH A;  1OFS A;  2GAL A;  5FXV A;  1O6U A;  4Y20 A;  3NNG A;  1HV0 A;  2PXJ A;  4JHT A;  3VBU A;  5FFO C;  2XVL A;  3V65 A;  5H9R A;  4UFJ A;  5L7O B;  1W9T A;  3FFQ A;  5T5O A;  3IKW A;  1VAV A;  1ZBA 2;  4S2H A;  3TRS B;  5CZK A;  2JE7 A;  5G04 L;  3WN2 A;  3JCI A;  3WG3 A;  3LIH A;  3NNM A;  3NJV A;  3ZXG A;  2GMM A;  5J96 B;  5C8C A;  3R0R A;  1MS8 A;  1XE7 A;  1DQ0 A;  2ZKN A;  4P00 B;  5FZK A;  5HCF A;  4OHX A;  1UMI A;  2Y26 A;  4AFD A;  1RHI 2;  4B1M A;  2QNK A;  3NW4 A;  1I9R A;  4IEX A;  3WP3 A;  2ZGQ A;  1GLH A;  5A7Q A;  1KXG A;  1UIJ A;  4FAH A;  2YGM A;  5CKM A;  5IK8 A;  4LBQ B;  3NRU A;  1OOP B;  4GMP 3;  1GZW A;  1AYN 2;  1UZV A;  5EP9 A;  1JMU B;  2NLR A;  4COT A;  4NUB A;  3AXE A;  2PLV 3;  2R6Q A;  3GZA A;  5F8P A;  1AXY A;  2VUJ A;  4FPC A;  1SG3 A;  5GKA C;  4Q4Y 1;  3DPR C;  3CL1 A;  3HT2 A;  5A7V B;  3MF6 A;  4Y22 A;  5A3T A;  3VBR C;  2W5F A;  5IW0 A;  4XAB A;  1DZR A;  5JOX A;  1OKO A;  2J1T A;  4ET7 A;  1PGW 2;  2Y6H A;  4NAO A;  3POF A;  5BNO B;  1QOT A;  1EP0 A;  4Q27 A;  2CHH A;  4IW3 A;  2RJ2 A;  5I8Y A;  5LBF A;  1QDC A;  2WLP A;  3QEE A;  1M4W A;  1S2B A;  2QQP A;  4A6S A;  2R49 A;  4YW6 A;  5ANN A;  1UL9 A;  4HN0 A;  4FTE A;  3WCS A;  4ORF A;  2Y38 A;  4RQP B;  4YZ5 A;  1M06 G;  5ABJ B;  4O8O A;  2QCS B;  4CRQ A;  5FPX A;  2ZZJ A;  4C0H A;  3AJY A;  4LKF A;  1VE0 A;  4W4Z A;  2FQP A;  3TEX A;  3ZN6 A;  4COW A;  1UYZ A;  4ASL A;  4XFF A;  3WF3 A;  1JW6 A;  5BY5 A;  2W68 A;  5F5Q A;  1UO9 A;  2JD4 A;  4FO9 A;  3ZMO A;  2VMH A;  1COV 2;  4Q8K A;  3HQU A;  1O5L A;  5LA9 A;  2ZHK A;  4LUL A;  1IQA A;  4Q4Y 3;  2EXK A;  2P5B A;  2WRA A;  1UMH A;  3SLI A;  3OUH A;  4JDO A;  4AXO A;  4J6G A;  3ES4 A;  2JKB A;  1LB2 A;  4NIA A;  3VDD B;  1QJX 1;  3P5B A;  3URF A;  3X29 B;  1RUH 2;  1RUC 1;  2W39 A;  3AFG A;  4P5Y A;  5FZH A;  1JOB A;  3WUD A;  4AHZ A;  4Z2A A;  2VJX A;  3V0B B;  3CQO A;  4Y4Y A;  1WMF A;  4AHW A;  2XWJ B;  3J7M A;  3WNM A;  2BNO A;  3DV8 A;  1LHU A;  2ZAB A;  4QX0 A;  4COY A;  1ZBE 1;  1QEX A;  1BBT 2;  2C26 A;  4NRM A;  3H1Y A;  3H3U A;  1C57 A;  5FPZ A;  5FYT A;  3C7O A;  1W0P A;  4OHZ A;  2QFE A;  1HX6 A;  5DG2 A;  4WM7 A;  3V0A A;  3N3H A;  5FMC A;  1ZZC A;  3BUC A;  3DCQ A;  1KGY A;  4C90 A;  1XU2 A;  4QKF A;  3M70 A;  3T1L A;  3O1U A;  5ERL A;  3ZSE A;  4E4Z A;  1UW8 A;  4GB3 2;  1DBN A;  3VZJ A;  5A6Q A;  3OUI A;  1JN2 P;  1PZ8 A;  1YC6 1;  4NMI A;  5DDJ 2;  1BK0 A;  4CXY A;  1UYP A;  2ENR A;  4XIO A;  5FZB A;  3D6E A;  3S57 A;  3PL0 A;  3BPZ A;  3NMB A;  4BB3 A;  4AED C;  3AKR A;  5A6Z A;  1FPN 3;  3ZFE C;  1DZT A;  1POQ A;  2ORZ A;  5JVV A;  3WNN A;  4BQW A;  1V00 A;  1P8J A;  4KC7 A;  1AJK A;  2D6P A;  1TME 1;  2A75 A;  4B1L A;  1N3Q A;  4DQA A;  2AEY A;  2KA3 A;  1ZA4 A;  3WW3 A;  1JZ6 A;  2XXZ A;  3NJZ A;  3IN9 A;  4QXK A;  4XVH A;  3QCW A;  1ULO A;  1QJX 3;  3RGB A;  4HK8 A;  2GC1 A;  4CDU C;  3WN0 A;  4SLI A;  3LA2 A;  1X9T A;  1O4T A;  2BER A;  1C8M 2;  4UWD A;  4QX2 A;  4JGY C;  4FPY A;  1EAH 2;  1OD3 A;  1FOD 1;  1ZBE 3;  3O12 A;  3ZYF A;  1PVC 1;  3OEB A;  1TQ5 A;  2OQ7 A;  3PUI A;  3HN1 A;  4BYY A;  4QPY A;  1S0F A;  2IXC A;  4FCA A;  4LBL A;  4Q4W 2;  2Y0O A;  4NRP A;  1RGS A;  4AQT A;  1GYH A;  2O8O A;  3OD4 A;  2LAL A;  1HXS 2;  2PTM A;  1JZ8 A;  1V6O A;  5L9R A;  5GZD A;  3H1W A;  2FDI A;  4JRA A;  1PZ7 A;  3EHK A;  4ZS2 A;  1O3S A;  2OT7 A;  3ZIW A;  3VKL A;  2G4I A;  4GD4 A;  5CVR A;  3DPR B;  3IDB B;  4P9G A;  5IK4 A;  1AL2 1;  3MIE A;  1QXJ A;  1JHN A;  4LBQ D;  2VL4 A;  1SFP A;  4GIQ A;  2P17 A;  2P2K A;  1BK1 A;  1WMX A;  1MS9 A;  5A7P A;  5F39 A;  4XUT A;  2IVJ A;  3VBR B;  3O1R A;  4N7U A;  2FMD A;  3OBT A;  3ROU A;  1N1S A;  4NHL A;  5FZG A;  1TME 3;  4ZPI A;  3ILF A;  3I3D A;  3CO2 A;  4JKL A;  4RGK A;  4Y5T A;  2AEZ A;  3ZIX A;  2BGO A;  1X8M A;  2DCY A;  4NHK A;  4R9C A;  2IXJ A;  4YG0 A;  4LT5 A;  3VSR A;  3I8T A;  4XF0 A;  4YZ4 A;  5DUW A;  3OM2 A;  2BOI A;  3ZDS A;  4DUW A;  2EIG A;  3N7K A;  1FOD 3;  2Q1Z B;  1PVC 3;  2W0X A;  2Y0I A;  5FQ0 B;  2AAC A;  5EJZ B;  3ACG A;  2JJ6 A;  3O5S A;  5F6L B;  4N90 A;  4BWO A;  5J1X A;  4KCB A;  4N9I A;  3CF6 E;  5FDB A;  3FUQ A;  2CL2 A;  3UET A;  3LKJ A;  1ZRC A;  3L9J T;  2G9G A;  3KVA A;  4Y4R A;  1I6X A;  4PCR A;  4XUQ A;  5K7P A;  4AK7 A;  2WSV A;  3POI A;  4XJ9 A;  3LD8 A;  5A33 A;  1LES A;  3OM5 A;  2D40 A;  3I2O A;  1AL2 3;  2HWF 2;  2YMZ A;  1A3K A;  1NKG A;  1CZS A;  5FZL A;  4W6X A;  3K77 A;  3AP7 A;  2VR4 A;  4YPJ A;  3CBN A;  1N47 A;  4YVW C;  1AR7 2;  1RYY A;  2YZ4 A;  5FBJ A;  1PM7 A;  4LE4 A;  1CIY A;  2ZKL A;  5J09 A;  3WQ7 A;  3JD7 1;  2RE9 A;  2W08 A;  4MXW B;  4NWW A;  4QB6 A;  1PGL 2;  3PHM A;  1JTZ X;  4MLO A;  2D5H A;  2A3Y A;  1ZNP A;  5IVC A;  3DXU A;  2GAU A;  1OF3 A;  1D0G A;  3AMP A;  1CAW B;  1X36 A;  2KM2 A;  2A7A A;  1WLD A;  3OCP A;  1TZO A;  5IVJ A;  5E1R A;  4JKM A;  5FKC A;  4JVA A;  1O3Q A;  5FWJ A;  4BZ4 A;  3ST7 A;  2X05 A;  1IS5 A;  2WNV C;  1POV 1;  1A8D A;  1JYN A;  4CPB D;  2W3J A;  3TEZ A;  1NA1 C;  1GNH A;  3FLT A;  1YFW A;  4AI2 A;  1OT5 A;  3VL8 A;  3PUS A;  1CQ9 A;  3CDZ B;  4AED B;  2PHT A;  3QD6 A;  2L9L A;  3HR9 A;  5JLV A;  3ZFE B;  1DDL A;  1Y7B A;  1UYX A;  5ACA 2;  3I2F A;  1OXC A;  1LOB A;  1X9P A;  1GZ9 A;  2ZAC A;  5JR7 B;  3AP5 A;  4BK4 A;  3UJO A;  2XQR A;  4IV3 C;  4B4P A;  2LRO A;  4CDU B;  4CDQ C;  1Y9G A;  1O8S A;  3B69 A;  1VBA 1;  1VBC 1;  1V6I A;  4JGY B;  2GP5 A;  4MOA A;  1CR7 A;  2PQQ A;  3JD7 3;  1EPW A;  1YI9 A;  1CGP A;  5C2M A;  1GQG A;  4DMI A;  2OA2 A;  1W6M B;  2BPA 2;  4L0P A;  2BFU S;  1WUV A;  3VBS C;  4DOU A;  4CU7 A;  4YVW A;  5JXH A;  4DXT A;  4KI5 M;  5E8A A;  3APB A;  4HG6 B;  4Q4X 2;  5EPA A;  5F2S A;  2Q8C A;  4BXF A;  1RUJ 1;  3OJB A;  2OPK A;  4XIL A;  1NLR A;  1OUR A;  3RDI A;  3E6C C;  1POV 3;  1PK6 C;  4PQQ A;  2YHJ A;  1UN1 A;  2XJP A;  2VMI A;  5LBC A;  5C9A C;  4QB2 A;  3RZG A;  5JIU A;  3FZ3 A;  3GBG A;  2DUO A;  1X7N A;  1LGB A;  4NWV A;  4UW4 A;  1DGL A;  4ZXE A;  4MSV A;  3HWJ A;  3A4U A;  5FBZ A;  4NHX A;  5JZG B;  1J83 A;  5LAT A;  3CJX A;  1IKP A;  1S0I A;  3I54 A;  4LQR A;  4YYO A;  4AI9 A;  4E4H A;  3WX5 A;  5GZE A;  3W59 A;  1O4Y A;  1IG3 A;  2VZQ A;  2WZ8 A;  4MG2 A;  3DGT A;  5GZC A;  1ODN A;  1VBA 3;  2RS3 1;  1QKQ A;  2UWC A;  1J1L A;  2ZGU A;  3KF3 A;  1VBC 3;  3KM5 A;  2JEC A;  3MW4 A;  3D5Z A;  2GC0 A;  2VCC A;  5JOZ A;  5KXB A;  1G9F A;  4XDP A;  4MGI E;  2XKO A;  1QWR A;  1ULE A;  2J1E A;  4HN1 A;  4PQ9 A;  2IZW A;  5K4L A;  3MDP A;  4IV3 A;  4O65 A;  1QJY 1;  4PDW C;  2JIG A;  4CVU A;  4PF5 A;  1QQP 2;  1BHG A;  1GMM A;  4ZON A;  5DUV A;  2NZ9 A;  4CUB A;  4ZZ5 A;  1CN1 A;  3U11 A;  3BTX A; 
#chains in the Genus database with same CATH homology
 1JYX A;  3C2U A;  4DXR A;  3DEC A;  4DUX A;  2V5D A;  2VDT A;  5B6T A;  1DLC A;  2ZEX A;  2QQN A;  2X8F A;  3MV1 1;  5GLM A;  3BYN A;  5C0P A;  1CX1 A;  2WO2 A;  2ZXQ A;  2X8S A;  1J84 A;  1SDD B;  2RV9 A;  3HNB M;  3A23 A;  3VT0 A;  5B6S A;  4KWU A;  1YI7 A;  2VMD A;  2ORX A;  5JOY A;  4OYU A;  3T09 A;  5LA2 A;  4PT6 A;  1JHJ A;  3VD4 A;  4TTG A;  2XOM A;  4ARY A;  3AKF A;  2RVA A;  3I3B A;  5F7U A;  2PQS A;  3WF2 A;  4RYD A;  3LFI A;  3R4Y A;  1DP0 A;  1XPW A;  3C8X A;  3I2J A;  2WDB A;  2J1R A;  3IDA A;  1OH4 A;  4DEV A;  2YC4 A;  1IQD C;  1CZT A;  3LPF A;  2EIB A;  2QQI A;  2Y6J A;  4KMQ A;  2WAA A;  2WAB A;  3EYP A;  3WNK A;  2W47 A;  1W99 A;  3ACI A;  4JKK A;  4DXS A;  2YC2 A;  2W1S A;  5HPO A;  2XON A;  4UDI A;  2Z4F A;  3OGV A;  2W91 A;  2QQV A;  2VMC A;  3A21 A;  4N4B A;  3SC7 X;  3QED A;  1ST8 A;  4W50 A;  1JU4 A;  4BXS V;  4XUR A;  1K42 A;  2W95 A;  1UYY A;  1UXX X;  3R4Z A;  1NAE A;  3T08 A;  4P02 B;  3UES A;  2WN3 A;  2WUH A;  1TVG A;  2J7M A;  2JDA A;  4IUG A;  1GOH A;  2EID A;  2J22 A;  5FK7 A;  4EQV A;  5A8D A;  2Y8K A;  3T2O A;  3F2Z A;  1UY4 A;  2LW8 A;  4A41 A;  3WSO A;  4M4P A;  4QAW A;  2EIC A;  4UOJ A;  5A8C A;  1XNA A;  2VC9 A;  4GWJ A;  4XUO A;  4A45 A;  3JXS A;  2WN2 A;  4AAX A;  1GNY A;  3CZU A;  5GLQ A;  4OUE A;  4A44 A;  3R67 A;  3BGA A;  3ETP A;  4AK5 A;  4D0Q A;  3A22 A;  4ZY9 A;  3KST A;  5JXI A;  4P08 A;  3QEF A;  3WNP A;  1R64 A;  5FMB A;  5AYC A;  2VMF A;  5JXJ A;  3EB7 A;  3CU9 A;  5GLR A;  3WF4 A;  5AYE A;  4CU8 A;  4N1I A;  4D8M A;  1UY1 A;  4GWI A;  1WCQ A;  1WL7 A;  5EJ1 B;  3VD7 A;  2AC1 A;  4KCA A;  2HYX A;  1UZ0 A;  2Y64 A;  3SEP A;  3U37 A;  2J1V A;  3HNY M;  3FL7 A;  4MGQ A;  1XC6 A;  3T2Q A;  3LPG A;  3UGH A;  2BBA A;  3ZXK A;  3OM7 A;  1JZ4 A;  1W9W A;  2VZR A;  3OM4 A;  3SKJ E;  3AKG A;  1L7Q A;  2C9K A;  3HJR A;  1UY2 A;  4M4R A;  3IAQ A;  3LEK A;  3OG2 A;  5LA1 A;  4QX1 A;  1F4A A;  5CYY A;  2VO5 A;  5FLW A;  3LDK A;  3HPN A;  2DCK A;  2ZEY A;  2VZV A;  2X09 A;  4OMC A;  3C7G A;  3I2H A;  3U75 A;  1JZ3 A;  5JOW A;  3OB8 A;  2KD7 A;  2ZEZ A;  5FIX A;  1OF4 A;  2BGP A;  3BYK A;  4UI9 L;  2QQO A;  3OBA A;  3DYM A;  3DYP A;  2YFT A;  3FN9 A;  2Y6G A;  3ACF A;  3UGF A;  4BJ0 A;  3LEG A;  5G05 L;  2WQ8 A;  4CUC A;  1JI6 A;  4QDR A;  2QQU A;  3WF1 A;  5IJR A;  3LDR A;  3LQC A;  4ARX A;  3K4D A;  3TAW A;  1PT2 A;  3D60 A;  3HN3 A;  1ULP A;  3E1F 1;  2CDO A;  2B9V A;  5IYY A;  1T2X A;  1UWW A;  1GOG A;  1UY0 A;  3LEM A;  3OM6 A;  5JUV A;  3BYJ A;  4AK6 A;  3AKH A;  5HXM A;  2BZD A;  4PVA A;  4FI9 A;  3NNG A;  3VD3 A;  1WKY A;  2WZE A;  1W9T A;  1YIF A;  1LNS A;  2VZP A;  3OGR A;  2ADD A;  5CZK A;  2X8T A;  5G04 L;  3WN2 A;  4QQS A;  3HEI A;  3GGL A;  3LIH A;  3NJV A;  3LIG A;  3LE0 A;  4BDV B;  4XUN A;  3WPU A;  4P00 B;  3PIG A;  4U6D A;  1UMI A;  4W8J A;  2VTF A;  3C7E A;  3P2N A;  3ZM8 A;  4FFG A;  5B4N A;  5FK8 A;  1XNT A;  2VZ1 A;  3T2P A;  2B4W A;  4KC8 A;  1W2T A;  3NRU A;  1NUK A;  4FFF A;  3GDB A;  4UAP A;  1Y4W A;  1VKD A;  4COT A;  3LEI A;  3WAT A;  4CUA A;  4UDK E;  2E26 A;  3T0D A;  1SG3 A;  1YRZ A;  1O59 A;  3VT2 A;  3ECQ A;  2E33 A;  5A7V B;  3K4A A;  2W5F A;  2X10 A;  5JOX A;  4MGS A;  2J1T A;  4ET7 A;  3VDB A;  3WMY A;  3P6B A;  3VDA A;  2Y6H A;  3WEZ A;  4D47 A;  3CKH A;  5EIY B;  2JE8 A;  2RJ2 A;  4KMI A;  3QEE A;  2VOT A;  2QQL A;  3OGS A;  4AG4 A;  1MPX A;  5ANN A;  2VZO A;  1W9S A;  3MBW A;  1NX9 A;  4O8O A;  5JR2 A;  2LS6 A;  5I0D A;  3PUH A;  4W4Z A;  3AKI A;  1UYZ A;  2JD9 A;  1PX4 A;  3WF3 A;  1OYG A;  2OXB A;  5DN2 A;  3FHQ A;  3SKV A;  3VSS A;  4LKS A;  3W5M A;  2W1Q A;  3K46 A;  2EXK A;  1US2 A;  3U14 A;  5JMO A;  1UMH A;  2VQU A;  1PMH X;  4ONZ A;  2ID4 A;  4P5Y A;  4Z2A A;  3D5Y A;  2VJX A;  2OKX A;  3CQO A;  4RN5 A;  3WNM A;  4QX0 A;  1W0N A;  2J1S A;  2C26 A;  3CZJ A;  4QPW A;  3C7O A;  1JU3 A;  2QBX A;  1UY3 A;  1Y9M A;  5FMC A;  4OZO A;  2W94 A;  4JX0 A;  4QDQ A;  1KGY A;  3GXU A;  2V72 A;  1GYD B;  1UXZ A;  2JKX A;  2VCB A;  3HNM A;  3CIH A;  4A42 A;  2J1A A;  5LA0 A;  3K75 B;  1UYP A;  2VZT A;  2W1W A;  3I3E A;  5GLP A;  2ORZ A;  2WBK A;  4BK5 A;  3WNN A;  2E31 A;  5GLN A;  2DDU A;  4FFI A;  1P8J A;  4KC7 A;  3C7H A;  4A6O A;  4O8N A;  2WO1 A;  1JZ6 A;  2AEY A;  3IB3 A;  4XVH A;  3IAP A;  3THC A;  1GYE B;  1ULO A;  1EUT A;  1PX3 A;  1GOF A;  3WN0 A;  5FMD A;  2BER A;  4O8P A;  2WYS A;  4QX2 A;  5B4X A;  1OD3 A;  3WF0 A;  1F4H A;  5C70 A;  3OEB A;  1W8O A;  3CMG A;  2WO3 A;  3PUI A;  3PIJ A;  5GLL A;  3WAU A;  2XHN A;  4E8C A;  5FUI A;  3QZ4 A;  1GYH A;  1GQP A;  1JZ8 A;  3K4Z A;  2W9X A;  3WPV A;  1O8P A;  3FHA A;  1D7P M;  1PMJ X;  3J7H A;  1DYO A;  3OEA A;  4MO3 M;  3THD A;  4A3Z A;  5DPN A;  4UDK A;  2VL4 A;  1JZ5 A;  2WAO A;  2VM9 A;  4XUT A;  3MV0 1;  3BYL A;  4DEQ A;  1W8N A;  2ZEW A;  1JZ2 A;  1H6X A;  1JZ7 A;  4NOV A;  3I3D A;  4JKL A;  2EXJ A;  2Y6L A;  2AEZ A;  2BGO A;  1SHW B;  3VSR A;  3QC2 A;  5DQ0 A;  3VSF A;  2VZ3 A;  3D61 A;  1GUI A;  3ABZ A;  2CDP A;  3OM2 A;  4DUW A;  4CU6 A;  3ACH A;  1K3I A;  3VD9 A;  5EJZ B;  1W18 A;  3ACG A;  3K1U A;  5J1X A;  4KCB A;  2VCA A;  3BN6 A;  2W1U A;  3MUY 1;  3UET A;  3KF5 A;  2DCJ A;  2V4V A;  4TXW A;  4XUQ A;  3WPZ A;  2HLE A;  3W5N A;  4AK7 A;  4UDG A;  3T0B A;  5C7G A;  4QB1 A;  3C7F A;  3OM5 A;  2VZS A;  2EXI A;  1UX7 A;  1NKG A;  1CZS A;  3K77 A;  4YPJ A;  2VR4 A;  4N2R A;  4A4A A;  2QQJ A;  3P1I A;  4E8D A;  1RYY A;  4FFH A;  3I2K A;  2VZU A;  2YFU A;  1CIY A;  3WNO A;  1UV4 A;  1US3 A;  4U6B A;  3I2I A;  3D3A A;  4QB6 A;  5IFT A;  5AYD A;  3LF7 A;  3VD5 A;  2EXH A;  2C4X A;  2W92 A;  3RWK X;  1OF3 A;  5A1A A;  2W87 A;  3I2G A;  4JKM A;  4GZ9 A;  5FKC A;  4QDS A;  3I97 A;  2XQX A;  1L7R A;  4QX3 A;  4XUP A;  3WNL A;  2X05 A;  2E32 A;  3WN1 A;  3VT1 A;  3MO4 A;  1JYN A;  2W3J A;  3DYO A;  2VME A;  1OT5 A;  3AC0 A;  3CDZ B;  2L9L A;  2VQT A;  1JYV A;  2YG0 A;  2ADE A;  1Y7B A;  1UYX A;  3SEE A;  2B4K A;  4PF1 A;  5DMY A;  2QQM A;  3I2F A;  2J1U A;  2YB7 A;  5FKB A;  2EIE A;  3NQH A;  4BK4 A;  3ZXJ A;  4UDJ A;  2XQR A;  2QQK A;  2YFS A;  5JXG A;  3WAS A;  4LPL A;  1O8S A;  1Y9G A;  4DUV A;  4JHZ A;  1EUU A;  3GM8 A;  4LHS A;  4MOA A;  2YFR A;  4L0P A;  4XZU G;  5C71 A;  5LCW L;  4CU7 A;  1I5P A;  5JXH A;  4DXT A;  4KI5 M;  4HG6 B;  3VDC A;  3UNP A;  3III A;  3T0A A;  5GLO A;  3ZXL A;  4CU9 A;  4PQQ A;  3HOB A;  5IHR A;  1TG7 A;  4QB2 A;  1JYW A;  1GU3 A;  4ZXE A;  5A7V A;  3WMZ A;  1CZV A;  1K12 A;  1J83 A;  3A7Q A;  4LQR A;  2YFZ A;  1H6Y A;  2VZQ A;  2WZ8 A;  2Y6K A;  1K45 A;  4ZZ8 A;  4MLG A;  5AY9 A;  3MUZ 1;  1YQ2 A;  5IFP A;  4N2Z A;  3KF3 A;  4PVI A;  3D5Z A;  5GLK A;  1KEX A;  2VCC A;  2R7E B;  5JOZ A;  3LV4 A;  2J1E A;  4OMD A;  1HN1 A;  4MAD A;  2QQW A;  3UGG A;  3NJX A;  4CVU A;  3VSZ A;  1BHG A;  1GMM A;  4CUB A;  4ZZ5 A;  3WPY A;  2W46 A;  3WQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...