3C7EA

Crystal structure of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
487
structure length
487
Chain Sequence
b'ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endo-1,4-beta-xylanase
publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 133
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7eA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7eA02
4LPLA 3LQCA 2WZ8A 3CIHA 1ST8A 4A45A 5JOZA 5JOWA 4W4ZA 1JZ3A 1KEXA 4A6OA 4UI9L 1JZ7A 3ACFA 4KMIA 2OKXA 4CU6A 3C7OA 3GDBA 2W91A 5C71A 2BERA 4CVUA 3BGAA 2EXIA 4UDKA 3PUIA 1RYYA 3JXSA 3T0AA 2X09A 3T09A 1W2TA 3F2ZA 1UY3A 1WKYA 2Y8KA 5IJRA 4AK6A 1GQPA 5EJZB 2ZEZA 4DXRA 1UYZA 3CU9A 3KSTA 3ETPA 1OF3A 4E8CA 3LFIA 4P08A 5AYEA 3CZJA 3LE0A 1GU3A 2JDAA 3VD5A 3WPVA 3LEGA 2WABA 1JU3A 2WDBA 3IIIA 4ARXA 1Y7BA 2QQUA 3C7GA 5AYCA 1W9TA 2VR4A 2VZ1A 3WNLA 5GLPA 1H6XA 5EJ1B 4O8OA 3AKGA 3LIHA 1UYPA 1EUUA 3QEEA 1PX3A 4EQVA 4UAPA 2AC1A 2X05A 4KWUA 3PUHA 3TAWA 3LDKA 2JD9A 1SG3A 2YC2A 1PT2A 2ORXA 2J1VA 4MOAA 1JZ8A 3NRUA 4AAXA 3RWKX 2V4VA 4IUGA 1UMIA 4DEQA 3WPUA 3W5NA 3D5YA 4CUAA 1HN1A 1O59A 3A22A 5HPOA 3WN1A 4ZY9A 2QQNA 1P8JA 2BGOA 3HPNA 3K4ZA 5B4NA 3P6BA 3I2KA 5FLWA 5A7VB 1PMJX 4CU8A 4PVAA 1UZ0A 3WAUA 3FHAA 1OF4A 3KF5A 2WO3A 3WMZA 2XOMA 5I0DA 5A1AA 4D0QA 5G05L 5JXIA 4MLGA 3A23A 2WAAA 3C7HA 4XUPA 2DCKA 3ZXLA 4DUWA 1UY4A 4JX0A 3C8XA 2YFUA 3UESA 3HJRA 3U37A 4KC7A 5FKBA 1CZVA 3DECA 2BGPA 3BYLA 4ET7A 3WQBA 5FIXA 4XUQA 2C4XA 1R64A 3WNNA 2V72A 5JXHA 2W5FA 4QQSA 2E33A 5F7UA 2E32A 2VMCA 2WN2A 2VZSA 4A4AA 2BZDA 4PVIA 5IHRA 3LEMA 3LPFA 4RYDA 3WN2A 5JUVA 3QEDA 2W95A 1CX1A 3I2IA 3CZUA 4AG4A 1UMHA 2HYXA 1OD3A 2E26A 1MPXA 1JZ4A 3VT2A 4TXWA 1GOHA 4QX3A 2Y6LA 2XHNA 2WQ8A 4M4PA 1TVGA 4N1IA 4BJ0A 3I3BA 2ORZA 3VD7A 2C26A 3WN0A 1OYGA 2L9LA 1GUIA 2J22A 3P2NA 3DYOA 2WO2A 3SEPA 4QB6A 1K42A 3VD3A 1ULOA 1UY1A 5LA1A 3A7QA 1XNAA 3IAQA 2B4WA 1UXZA 2WAOA 3ACHA 1XPWA 4PF1A 3LEIA 3T0BA 3U75A 2EXJA 4N4BA 1JYNA 3K77A 2W94A 2W3JA 2VZOA 2W92A 3ZXKA 2VM9A 2VZPA 4GZ9A 3WF0A 3ZXJA 1CZSA 1K3IA 1H6YA 3UETA 1DLCA 2KD7A 3CQOA 5GLOA 3P1IA 2VL4A 1BHGA 2VMFA 1O8SA 2VZUA 3VD9A 3LIGA 4PQQA 2JE8A 2B9VA 1I5PA 1JU4A 2YFZA 1JYXA 3OM2A 4FFFA 4A41A 3ACGA 5CYYA 3VD4A 1JYVA 3NJXA 1JZ2A 4ARYA 3OB8A 3THCA 4ZZ8A 2ZEYA 5FMCA 5FMDA 5LCWL 2ZXQA 3OG2A 3OEBA 4GWJA 3UGHA 2VZRA 2YFRA 5A7VA 3T08A 3U14A 4DUXA 3ZM8A 4DEVA 1J83A 2QQOA 2J1SA 2ADDA 5A8CA 4AK7A 5DMYA 4JHZA 3WF1A 1Y9MA 4M4RA 2WO1A 3D60A 3VDAA 3R4YA 3OEAA 1Y9GA 1GNYA 5G04L 4COTA 4D47A 3AC0A 3I2FA 4FFGA 3VSFA 3ABZA 1SDDB 3WMYA 3DYPA 3C2UA 1WCQA 3D3AA 4LKSA 4CU9A 2VZ3A 2W1UA 3UGFA 4BK5A 4Z2AA 5A8DA 2J1RA 3MBWA 4QB2A 4QB1A 2ADEA 4LQRA 2QBXA 3WASA 1L7QA 2VMEA 3WF3A 3D5ZA 5JXJA 2W46A 2X8TA 5J1XA 4UDGA 3NJVA 5LA2A 3WF4A 2LW8A 3I2JA 3WNMA 5FK7A 2ID4A 5JMOA 3PIGA 3K4AA 2DDUA 1JI6A 1ULPA 1W8OA 3GGLA 2EIDA 3NQHA 2QQLA 4MGQA 1WL7A 2VZVA 3ACIA 4FFIA 4U6BA 5CZKA 4FFHA 3K75B 3PIJA 4P5YA 2X8FA 4ONZA 1UV4A 3VSZA 2VCBA 4CU7A 2EICA 1JZ6A 2WZEA 1O8PA 5C70A 3D61A 1SHWB 3CKHA 2J1AA 3BYJA 3LPGA 2XONA 2VCCA 1GYEB 4JKLA 4RN5A 2YFSA 1W8NA 3WNKA 4JKMA 1GMMA 3MUY1 4L0PA 4QDSA 1NAEA 1CZTA 3GXUA 1UYYA 4KI5M 3K4DA 1JYWA 5DPNA 4U6DA 3EYPA 4XZUG 2AEZA 1CIYA 1D7PM 2QQMA 1PMHX 4D8MA 1NKGA 2W47A 3FL7A 4QDRA 3VT1A 1Y4WA 3WF2A 4W8JA 2EIEA 3WNOA 3K46A 4P00B 4A42A 1GYDB 1W18A 2W1SA 4P02B 1YIFA 2VTFA 3W5MA 2LS6A 5B4XA 3HNYM 3T2OA 4KC8A 4DXSA 1GOGA 4UDJA 4O8PA 4NOVA 4DUVA 1F4AA 2J1UA 5EIYB 1XNTA 2Y6KA 4MADA 4A44A 3R67A 2DCJA 5GLQA 5B6SA 3LEKA 3I97A 4XUOA 4OMDA 4MO3M 1W99A 1JHJA 2J1EA 1OH4A 2WN3A 5DN2A 1OT5A 1XC6A 3A21A 4KCAA 2VJXA 3WSOA 1IQDC 4OYUA 5FMBA 3C7FA 3MV11 4XUNA 4OMCA 5FK8A 1K45A 4W50A 2W1WA 1YRZA 3WEZA 3GM8A 2YG0A 2EXKA 2WBKA 1F4HA 1JZ5A 3I3EA 5JR2A 3OGRA 2E31A 3I2GA 3THDA 3WNPA 2R7EB 5IFPA 1UY2A 2X8SA 4QDQA 2VDTA 1TG7A 1US3A 3C7EA 3FHQA 4OUEA 3T2QA 3OGVA 2B4KA 3MUZ1 2EIBA 3LF7A 3R4ZA 4GWIA 1KGYA 5GLNA 2VCAA 1VKDA 1PX4A 1UYXA 3AKHA 2EXHA 2YC4A 2YFTA 3ECQA 2VO5A 1UWWA 2VZTA 3NNGA 2JKXA 1T2XA 3OGSA 1W0NA 2WUHA 3SKJE 2C9KA 3OM7A 2RJ2A 3IAPA 1L7RA 4FI9A 2ZEWA 4A3ZA 1DYOA 4CUBA 2W1QA 3MV01 2AEYA 2VC9A 5C0PA 3WPZA 2VQUA 4QX2A 4ZZ5A 2VQTA 4ZXEA 2RV9A 3WPYA 3T2PA 1UY0A 4N2RA 5AYDA 2QQJA 3I3DA 1YQ2A 3KF3A 2Y6GA 4KMQA 3CMGA 3MO4A 3BYKA 4UDKE 2BBAA 1NX9A 3UNPA 3VT0A 3OM5A 2ZEXA 2X10A 5GLKA 4N2ZA 3DYMA 3HOBA 5GLLA 3IB3A 1J84A 1NUKA 3T0DA 3UGGA 4KCBA 5FUIA 1EUTA 2PQSA 4OZOA 4QX0A 5AY9A 2VMDA 5IYYA 5IFTA 4BK4A 5GLMA 5C7GA 1W9SA 4HG6B 2VOTA 3HN3A 4PT6A 1GOFA 2CDOA 1DP0A 3AKFA 4XURA 3CDZB 2Y64A 2V5DA 4AK5A 4QAWA 4CUCA 5JXGA 4BDVB 3SC7X 2Y6JA 2OXBA 3EB7A 4QPWA 5JOXA 2QQWA 4DXTA 2J7MA 2YB7A 3QEFA 4O8NA 2VZQA 2J1TA 2Z4FA 4BXSV 3OBAA 5B6TA 3IDAA 2QQIA 4TTGA 3VDCA 1UXXX 4JKKA 4UDIA 2XQRA 2XQXA 3HNBM 3VSRA 3QZ4A 3VDBA 3SEEA 3E1F1 5ANNA 3HEIA 4QX1A 1GYHA 1LNSA 3J7HA 5DQ0A 4YPJA 3OM6A 5LA0A 1US2A 3AKIA 2WYSA 1K12A 5HXMA 2W9XA 3BN6A 3WATA 2QQVA 5FKCA 3I2HA 4LHSA 3LDRA 5JOYA 1W9WA 2Y6HA 4XVHA 5GLRA 1UX7A 3K1UA 2HLEA 3BYNA 2RVAA 3SKVA 3OM4A 3QC2A 4E8DA 2QQKA 4UOJA 2CDPA 3LV4A 3HNMA 4MGSA 4XUTA 2W87A 3VSSA 3FN9A 1YI7A
chains in the Genus database with same CATH superfamily
1PVC3 4K20A 4XTMA 5FY1A 2XBO3 4IV3B 4ZU5A 4CDQB 4N43B 1PO13 1QXJA 3ILRA 4QPGB 5JOWA 3H8RA 1O91A 2ZX4A 2YZ4A 4WM7C 2RDSA 2PMWB 4JTNA 5FYVA 1JZ7A 3ACFA 3FFQA 4S2FA 5FPZA 2OKXA 3GDBA 2W91A 4IEWA 4NROA 5C2MA 4IGPA 1W6PB 1IHMA 3PUIA 1RYYA 3JXSA 3AKQA 4GWNA 5CNAA 1UOGA 4IEPA 4Q4W3 4Q0UA 4SLIA 1W2NA 4BIOA 4BU2A 1UY3A 3PUSA 5FZ7A 4IETA 2Q4SA 2I74A 1ZRFA 1GR3A 1MS4A 5EJZB 1BCXA 1ND3C 1UYZA 5A80A 1SDWA 2ZMNA 1G9DA 4Y24A 1HRV2 3LFIA 1QJY3 5E16A 2RDQA 3LE0A 1LEDA 3GYDA 3ILNA 1C3HA 3MDPA 3CJIC 4MX3A 5C8CA 1ASJ2 1F35A 3E5XA 3WPVA 2WNVA 3LDBA 1PGSA 2IWGB 4N53A 1U5ZA 4QKDA 4NIGA 1JTZX 1S4CA 1TMF2 1LESA 2WS93 4KBBA 3CJIB 5J36A 2VQAA 3AZZA 1Q43A 3C7GA 1W9TA 2VR4A 1C5IA 4Q4Y3 3WNLA 3ZYGA 4YARA 1RUOA 1BMV2 2D3SA 1QNYA 5CFDB 5GLPA 1LGBA 1RUJ3 2WRAA 4NHXA 4JGYA 3RI8A 4AYUA 4RGKA 4R9DA 1V6OA 1DGLA 4INDA 3NNMA 4LOTA 1PVC2 4KWUA 1A78A 1GZ9A 4LBQA 1PT2A 1V6NA 2YGLA 1UOFA 1W04A 3RZZA 2ZA9A 3VBOA 3KVAA 4NOTA 4IUGA 1UMIA 2WSVA 4XFCA 2R49A 5D8AC 1OA2A 2CWSA 5T55A 3W5NA 5F8PA 3S30A 3VBFA 3D5YA 2FMDA 5EZWA 4M00A 3WINE 4CCMA 3NO8A 1C4RA 3HT2A 4IV1C 4G3YC 5D8AB 2QQNA 4MHRA 4XCAA 1FMD1 1HDKA 3HPNA 1YCIA 2E53A 4NWVA 4XC9A 3K4ZA 4JDNA 1RMU2 2CY6A 2IXHA 4IV1B 4ZS3A 1PMJX 1DIWA 4QT6A 4FTBA 3NV4A 4CU8A 1F9KA 3I4IA 3WAUA 3FHAA 3KF5A 5C3SA 3H0OA 2C0ZA 5I0DA 1YYNA 3KHBA 3FC0A 5G05L 4NPRA 1RUI1 1ZX5A 3SH4A 2BOJA 1RVF3 2ZGLA 3CF6E 2VXRA 4HOOA 5FCCA 5I91A 2BWCA 5I0UA 2HWD2 2WS92 2WAAA 3C7HA 4XUPA 2DCKA 3IDEA 2D7FA 4Y5Z0 2E51A 4JX0A 4MV2A 4AGVA 5FP7A 4DPNA 4KG8A 4OZXA 4NAMA 3AL5A 4Q4Y2 2VMIA 3DECA 1RUJ2 2MEV1 5FPBA 2C4XA 1L7LA 4FTSA 2OYZA 1VBC1 4HT1T 5LA9A 4W6YA 4KH9A 5FUNA 2V72A 5HCFA 3EQEA 5IWFA 1SEFA 2B9UA 4IE6A 4CDXB 3ZDVA 4TLFA 2BZDA 2ZGMA 1JN2P 4YZ5A 5F3CA 4PVIA 4CDQA 4N43A 3BU0A 1ALYA 4QPGA 2C5DA 5FBJA 4Q27A 3AX4A 1OA4A 4U2AA 1UZYA 2OUJA 1AR91 3O1RA 4CEYB 4K7JA 5F9TA 3W21A 4DFSA 4XDQA 2LRPA 1LEMA 2I45A 3FJSA 3I2IA 4YFZA 3BOPA 1RUD3 2JDYA 3POGA 1OD3A 2AR6A 1MPXA 3PURA 4WM7A 4Y3OA 2ZKLA 1W6OB 1ULFA 1BKZA 3M8LA 1HB3A 3M3CA 5F2WA 2NYYA 4AVCA 2A70A 3MI8A 4QX3A 2Y6LA 1GKBA 5DZGA 5GM0A 4M4PA 4GJYA 3VZNA 4N1IA 3H1WA 1JH5A 5DZEA 4S2GA 4YGCA 2P17A 1RVF2 4QD2A 3MF9A 4TLGA 5L7OC 1OYGA 2J22A 1ND3A 1DZRA 2VUAA 3GHMA 2AGSA 2WO2A 2XKOA 4LXLA 4R9AA 5T3NA 1K42A 3VD3A 2HBTA 1PO23 4FQZA 1ULOA 3GZAA 3MW3A 3ZR5A 5L7OB 2DUPA 2GZWA 4XHBA 3IAQA 4OHZA 1WUVA 4WM8A 2YU1A 3CJIA 1VIWB 2DTWA 1OOPC 4J6GA 1REEA 3ZYJB 1YHFA 3U75A 1S0CA 2FDJA 3KCYA 5IK4A 3LGRA 2RM21 3POEA 5FZKA 4CP2A 1JYNA 5ANQA 1JHNA 3DUIA 3WY6A 4H7MA 5LZ6A 3ZXKA 1W39A 2VM9A 5FY9A 4Y33A 1OOPB 2WZR1 1CZSA 4Q4V2 3JD73 1H6YA 3UETA 3AVRA 2KD7A 4K1YA 1XYOA 1ULCA 4NRQA 3TBDA 3GALA 4DINB 2AENA 3Q8EA 1CONA 2JDPA 5HV0A 5L9RA 1LULA 4XOGA 4P9XA 1UL9A 1DF0A 1RUC1 1UKGA 2VXJA 2WT2A 2C24A 4JQTA 1CPMA 1JU4A 5M0TA 3WG2A 1JYXA 1ENQA 1NLRA 1RUD2 3OM2A 4E2QA 3LA2A 2ARXA 5D8AA 5BNNC 1JYVA 1JUHA 4IGQA 1H4HA 4YW3A 1JZ2A 2WR9A 4ARYA 3ZN6A 3AM2A 2WYFA 5FMCA 5FMDA 3OG2A 1VR3A 3R6SA 4IV1A 1QGLA 1ZRIA 4E4ZA 4JCKA 5BNNB 2WC2A 3T08A 2AACA 2OVUA 1DQ5A 2J1SA 5A8CA 2PN5A 3PNAA 3WF1A 1Y9MA 3H7YA 4YM1A 4ZKTB 4LLOA 4M4RA 2WO1A 1HX6A 4MGKE 5ACA2 1QNWA 5IK7A 3LZZA 1GQHA 1QKQA 1Y9GA 2WA4A 1MS8A 4D47A 4IDZA 4YW5A 2HJIA 2MNGA 2P3JA 2VULA 4BQ5A 4QKNA 3H8XA 3ABZA 1SDDB 2HWF3 1CR7A 4OUMA 3OTFA 2XLFA 3DYPA 3QD6A 2ZHNA 3ZN4A 1WCQA 1VBA3 2BGCA 5T5LA 1LOGA 2ARAA 2Z5WA 5FXVA 3N9LA 4COVA 4ATEA 1PZ8A 2FBEA 4HSLA 2ADEA 3SCFA 4MYEA 4UFKA 5JXJA 4TSVA 3RYPA 1KITA 2W46A 4AHXA 3ZSJA 5J1XA 1RXGA 3BPSA 5H9PA 5JMOA 2D3PA 1W2OA 3ZSMA 2ZBJA 4AQTA 3NQHA 4JAAA 2A75A 1WL7A 4A6SA 3PJQA 2MEV3 2WJSA 3PUAA 2XDVA 2ZGTA 5LEKA 3QH7A 3K75B 1BYHA 1W8FA 3PIJA 1S55A 2Z2SB 1UV4A 2VCBA 2ZX3A 4GMP0 1VJ2A 2XJPA 2O14A 1BEV3 1KS5A 5FBZA 4QX7A 2B46X 1U12A 2X29A 4WZFA 4QPIC 4Y1VA 3VKFC 4C8DA 1Q8PA 3NAPB 3UV9A 2WNEA 2R062 5C70A 3D61A 1APNA 2G9ZA 4QM8A 4WVZA 3OCPA 2N7GA 3R4SA 1DQ4A 2BDRA 4DO0A 1MZFA 4BH9A 2VTXA 1ZBA1 4XF9A 2CSGA 1DQ1A 2JG9B 3N7KA 2SBAA 1S0BA 3FZ3A 3MUY1 4L0PA 4P9WA 4PCRA 3TNPB 5C3PA 1GSLA 5L7OA 5FZMA 1S2BA 1SQ4A 2HWF2 4KI5M 4O9EA 5IAXA 2VUCA 3AP4A 1JMUB 5JIAA 3ZYFA 1VBA2 3MW4A 4RA0A 3TOJA 1CIYA 1KRIA 2FHRA 4UFMA 4XJUA 2QQMA 1TL2A 3ZPOA 2R043 4D8MA 2OQ6A 3VKMA 5JPMB 4AK3A 4YZ4A 2R6QA 2P1BA 3M1HA 3E97A 4LBKA 4R4XA 1WGPA 3WNOA 5IVFA 1UIJA 1WMDA 1W18A 1HQLA 3LA3A 2H0BA 2VTFA 4HBNA 3W5MA 2LS6A 1AR82 5ABJC 3M3QA 3T2OA 1O4TA 2A5ZA 4PBPA 4XEZA 4O8PA 3PTRB 1CAXA 2EALA 2FDGA 1H2NA 1W0OA 2J1UA 3APBA 4NOVA 4LBLA 2PXJA 2Y6KA 4AQ6A 4AWDA 1OSGA 2PAKA 3U4SA 5CEHA 1BEV2 2VH9A 3LEKA 1PGL2 2W0XA 4XUOA 2GP5A 4DZGA 3E5QA 5F37A 3HAGA 4AEDC 3B5LB 4UFIA 2WN3A 4XCBA 1ENRA 1XC6A 3A0NA 2X53S 4O65A 5A3UA 4KCAA 1EAH2 4YZ3A 5EYYA 3AMHA 5BNNA 4DB5A 4NHMA 3NW4A 3GBFA 3AMPA 5JR7B 2PHDA 4OMCA 5CFCC 1FPN1 3I59A 1WLCA 2W1WA 1YRZA 3WEZA 3GM8A 4AVBA 4Q0SA 3VKLA 3FE5A 1S2EA 5C5UA 1CD3G 1NZCA 1S2KA 5DG2A 5FZIA 5CFCB 2XB6C 5T5OA 1M06G 3OGRA 4GULA 5JAXA 3ZXGA 4LO5B 3KHCA 4YVSC 4C0BA 3ZYHA 5D1IA 2JIGA 4ZS2A 1S0DA 1VBB3 3FHIB 2ZZJA 1U5YA 3T2QA 3OGVA 3MUZ1 2DVAA 2LTNA 3OBTA 4FBFA 5J09A 2J42A 3VZKA 4RSUA 1KGYA 1W8HA 4LLFA 5LY2A 5GLNA 2VCAA 4Q0QA 1PK6B 4ORFA 3GBGA 1REFA 1UWWA 2GC0A 2VZTA 3OUJA 2XWJB 3ZFFC 3G6JB 1X8MA 1WW5A 1DDLA 4WZCA 5CKQA 1OH3A 5FO9B 3KV6A 4NN0A 4OQ9A 2WUHA 3IZOA 3SKJE 3U78A 3OM7A 1LODA 3S6PA 3ZFFB 5IK8A 5A3WA 1CX4A 2UWCA 2W1QA 2AEYA 3ZXEA 3VL8A 1AR71 4ZZ5A 1OPOA 1AR61 1V00A 3PVBB 2WT1A 3AL6A 3MZHA 3UL2A 3T2PA 1HXS1 2YU2A 3E5UA 2BVBA 4AFAA 2DU0A 3OPTA 4QPIA 3LOBA 3ZX7A 1AHSA 5FO7B 3MO4A 5FP4A 3BYKA 2BBAA 2PAEA 1W8ZA 1HV1A 4RS5B 4YW1A 1RUH1 4BISA 4P9YA 3OBZA 2QZ3A 2X10A 4AI2A 3DYMA 3HOBA 3VHRA 1BJQA 3NNFA 3J8F3 5A3NA 2RS32 1VBB2 2G9GA 5K4LA 5J48A 1G8WA 1NUKA 4CEWC 3T0DA 3RGBA 4LJHA 1FV3A 1I1EA 3ZVXA 1EUTA 1PZ9A 1W9YA 4WV8A 1X82A 2VMDA 1R1A2 4XILA 3WLUA 4B7EA 3BCWA 4YW4A 4CEWB 4RGGA 1Q8OA 1W9SA 1LTEA 3HN3A 1OA3A 5KBFA 1V6JA 5LBCA 4YM0A 5CKMA 3VDDC 3WHTA 1FOD1 1RUG3 3RDIA 4AK5A 5JXGA 1YWKA 1XU2A 4E4HA 3POJA 4XFAA 4QPWA 1VMFA 4UW5A 5ABJA 1J58A 4A7KA 2WINB 4YG3A 4AEMA 4DXTA 1JYTA 3USUB 2VZQA 5LBBA 4BXSV 3R0RA 1WCSA 1REDA 4PI2A 1RL3A 4F7ZA 5IATA 2GNMA 4JKKA 5FOJB 2XQRA 1SLBA 3V64A 2DV9A 1BBT3 1ZRDA 3MHZA 5FDBA 4ASLA 4XFBA 3KB5A 4JRAA 2VNRA 4AEDA 1N1TA 2HWE1 5KHHA 2NZ9A 3VGIA 1LENA 1DGRN 4KWLA 4ZU7A 3PLQA 1WW7A 4V1PA 4CP1A 3AP5A 4OHVA 1ZZ7A 2A7AA 5CFCA 3CO2A 3WDWA 1NXD1 4Y5SA 5DQ0A 1AL21 1W6NA 1SBDA 5GZEA 2X5IB 1GLHA 3DN7A 1MR5A 3M70A 3WT3A 2I07B 1ZBE3 3BN6A 3WATA 2QQVA 1W06A 4DNYA 2PHWA 4DXZA 1KD7A 5JIUA 4YVSA 1ZZ8A 4EZ4A 4I02A 1BK1A 5A7QA 1UX7A 3KT1A 3T4VA 1COV3 4QGLA 4XJ9A 1RUG2 3ZFEC 1ASJ1 1GYKA 1XXNA 2WWUA 4CP9B 4RFRB 1YQCA 1DQ6A 2VU9A 2D3RA 5DUVA 2W87A 5FZDA 2UY8A 3U0ZA 1TMF1 3WUCA 5AC91 3FN9A 5E8AA 1Z78A 3ZFEB 1C57A 4LPLA 3V0BB 3J7LA 5JI9A 1HRI2 2XL9A 3M2MA 3ZN5A 1ST8A 3ZFFA 4XE9A 3RZGA 4UI9L 5E1RA 3NWKA 1BBT2 3N7JA 5JSRA 2O0OA 4CU6A 3C7OA 4XAAA 1PVC1 2ZHLA 4LK7A 1A8MA 3MLLA 1KXGA 1Q8VA 1W8UA 2XBO1 3BGAA 2XMLA 4LIUA 1G7YA 2DVGA 1PO11 2X09A 3RMYA 3JB4C 4B1MA 1W2TA 3T09A 5CAZA 1WKYA 2Y8KA 1YUDA 2D6PA 1Y9QA 4XFFA 5FMOS 3ZDSA 5A3TA 2ZEZA 3IDBB 5BNOC 4NIDA 1IPJA 3ETPA 3Q9OA 3RZMA 3DXUA 2EA7A 2YBPA 3IMMA 1NG0A 4P08A 4Q4W1 2ET7A 5F5AA 3TNQA 3ST7A 4AZZA 3DGTA 1GU3A 2JDAA 5A6QA 1ZBE2 1UF2C 2B8MA 4FQ4A 5HCHA 3IMNA 4I30A 1DGWX 1F2NA 4COUA 5CG9A 1QJY1 1QJZA 3I7DA 3LSEA 1JU3A 2QKDA 3B3QE 3B00A 3NJZA 4AEKA 3ACLA 4D69A 4ARXA 1VB2A 4P9JA 1COV2 4QX5A 4CEWA 2DVFA 5FXZA 1WW6A 5EJ1B 1IG3A 2K46A 3Q8AA 3LIHA 5FQ0A 2HWD1 1EUUA 5FYBA 2WS91 2WQ4A 1NYWA 2JJ6A 1O4ZA 4YG6A 2Y33A 3QEEA 4AAPA 4GQ7A 4Y1YA 2Q1ZB 3D8CA 1VRBA 1ZZCA 4Q2FA 3PVNA 4FPOB 1H1IA 2JD9A 3QACA 4Q4Y1 4BWOA 1LHUA 3B9CA 3W20A 1SG3A 3ETQA 1RUJ1 3VDDA 1JOJA 2ORXA 3ES1A 5T54A 2ENRA 3USUA 1HJGA 4Q8LA 5FYCA 4AAXA 5J7MA 1QH7A 1NCRC 1JZ8A 1G6NA 4AVTA 4Q5OA 1NQJA 3GHNA 4C91A 3WPUA 1C5HA 2VOVA 3UYJA 5C8CB 3AB0A 1O5LA 3A22A 5GLZA 5L73A 5KHKA 1NCRB 1R082 4DS0A 3M3EA 2VOWA 4NRPA 5EXOA 4LMFA 3ZMOA 5FFOC 1P8JA 4P9IA 1DYPA 1QXPA 4I2OA 1X7NA 1WD4A 1HV0A 5BYNA 1D2SA 1W3VA 2XJUA 1UZ0A 2JWPA 4JGYB 4JRLA 3WD5A 1WCUA 4YZ1A 3JZVA 3K3OA 5JXIA 5K7PA 1W6QA 3A23A 2UWBA 3LOIA 2XH6A 3RZHA 1C8NA 3MIBA 3AVSA 5LY1A 4NUBA 5LBFA 3ZXLA 3C8XA 3VBOB 1PM7A 4KC7A 4MXWA 3GZTB 3P3NA 4IE7A 2PHUA 4Q4X3 1RVF1 1R092 4ET7A 3ZKUA 5FIXA 4H55A 1YFYA 1XU1A 3OUHA 1WW4A 1WCDJ 4XJWA 2V4AA 5HV4A 1LHWA 3WNNA 5BV6A 1W28A 2BFUS 5F7UA 2B39A 2ZGPA 3D6EA 2DWRA 2K9ZA 3ZO0B 3S7IA 3ZFEA 3V0BA 4Q29A 4CXYA 4NAOA 5FY4A 5APAA 5F5IA 1CESA 3VZOA 3LPFA 1HRV3 1LJ7A 4FP2A 4RYDA 3WN2A 2O8QA 4FAGA 1CX1A 1LHOA 1DLLA 4K8RB 4S2HA 1GZCA 4LHKA 5BXXA 3CZUA 4AG4A 1ASJ3 3VHNA 1GWLA 2QUOA 1W8TA 2GH8A 4O7XA 4LBOA 3VT2A 3WW2A 2XHNA 5FZ0A 3N9MA 1BZWA 4Q0VA 3ORJA 4UXAA 4Z2WA 1RUD1 2HWC2 1Q8SA 5FZLA 1ZA7A 2ORZA 3SQOA 2C26A 4Q26A 2VQ0A 5DG1A 2H0VA 4XACA 5J96B 1GUIA 4NHLA 5BNOA 3SEPA 2CAUA 1ZNPA 3AYCA 4FVVA 3UJOA 4XXPA 2YUEA 2R30A 1V70A 3RS6A 4RR3A 4Q4X2 1XNAA 1CIWA 4FXGB 4IW3A 1UZWA 2ZS6B 4FPJA 4XMIA 3I3MA 3ACHA 1NXMA 4COZA 3OOXA 2A3XA 4YFWA 2RS53 3E6BA 1XSRA 1PO21 4AVAA 1IKQA 2Y0OA 4Y1UA 1CN1A 5ACA1 2JDNA 2QE3A 3DPRA 3MPPG 4WM7B 4XJZA 1MZ6A 4K9SA 1AYM2 2VZPA 4NE9A 4YRDA 4AFDA 1GP4A 1K3IA 2IZWA 3BTAA 1QQP2 4K3UA 5I0SA 2W52A 2XVLA 5GLOA 2YBSA 3KQRA 1PMIA 3VKNA 3JB8A 4MGYE 2XJQA 2DYCA 1E5IA 1RMU3 2VMFA 3WP5A 3LIGA 4CYDA 3VD9A 4E4SA 3BUCA 1I5ZA 1GANA 5DDJ3 3JD71 4PQQA 4LE4A 1ND3B 2JE8A 1GZTA 4WM8C 4Z1VA 2B9VA 2VMGA 5CU1A 1Y3TA 2V5YA 1NCRA 3SH3A 4UW3A 5CYYA 2HWD3 5D2AA 5A3MA 4LBJA 4FOQA 4WM8B 1FNZA 1IPSA 3MW2A 4Z92B 1F8VA 2A3YA 4JTOA 2BTVC 2R0HA 1WMEA 4GWJA 5GZGA 1XOYA 1NY71 1EP0A 2VZRA 2OT7A 5A1FA 4XBQA 5KC6A 3ASIA 3FBYA 3ZM8A 1QJEA 1XSQA 1J83A 2QQOA 4C90A 5DMYA 4GKYA 1PGW2 4CUGA 3WNXA 4BHPA 2CAVA 3AZVA 3ME2A 5FXWA 3R4YA 5FMOL 3CU7A 4GWMA 4H3WA 1NA1A 4Q1RA 2GNDA 5G04L 3AC0A 2RS52 2BUKA 3WW1A 4FFGA 3VSFA 2RDNA 1LOEA 3J4UH 3WQ1A 3WMYA 2R32A 2XLAA 3NNJA 4FPKA 3ROUA 4IGOA 4LA2A 1XYPA 3AYEA 3N3HA 2WZPP 4Z2AA 2JENA 1N1VA 2J1RA 1X36A 3PHMA 3ZN6B 3KV9A 4H7LA 2HWF1 2Z69A 4LQRA 4AF9A 3WASA 1GFF2 2BP6A 3WF3A 1VBA1 3D5ZA 2GN3A 5DDJ2 1KFXL 2PLV3 3I2JA 2Y38A 4GAZA 2PHFA 1DYKA 4X6QB 5F2SA 3PIGA 1ACCA 4I0WB 3GGLA 4E4DX 1ENXA 3N4MA 2DCYA 4MGQA 2VZVA 2OZ6A 3ACIA 4LULA 5JSPA 4U6BA 3O0XA 4FFHA 4MHUA 3ZMNA 1UO9A 1O3SA 4ONZA 3PU8A 4COWA 1UW8A 2EICA 2BJSA 2XJRA 5FLJA 2Y60A 5JVVA 4HMZA 1VBD2 3IKWA 4NHYA 1SHWB 2J1AA 1B35A 1BEV1 2VCCA 3TN93 1RGSA 4JKLA 4RN5A 1PGL1 2HEWF 4R9BA 4DY3A 2YFSA 1W8NA 5FV3A 4Q4V3 3WNKA 4JKMA 4DQAA 1XB9A 2B5HA 4XW3A 4XQWA 3WP4A 1DCSA 3VUOA 1NAEA 2PHLA 1MQTC 5LRSA 2BVVA 4MH0E 1EAH1 4IEXA 1G86A 3GXUA 5C3QA 2D93A 2AUYA 2PQQA 3TYJA 2JECA 3EYPA 5BNPC 5GALA 5JLVA 3K48A 3ZR6A 4EN0A 1WD3A 5FRAA 2W47A 3FL7A 3RQ0A 4AI1A 4QDRA 2XHKA 2GN7A 3RZJA 3VT1A 3T4HB 1Y4WA 4GMP3 3SCGA 4XDPA 2GDFA 1JOBA 4QMAA 5BNPB 4WVWA 2EIEA 2PLV2 5C4WC 3RG0A 2R041 4P02B 5FZGA 1HB2A 4CCLA 2NMOA 1HB4A 1H8TC 4DUVA 1XRUA 3POIA 5C3RA 2FDFA 2YHJA 4MADA 4B7KA 4A44A 2BFUL 4UT5A 1NT0A 3TB0A 3R67A 2ZMKA 4YW6A 5ACA3 2KM2A 1CAUA 1H8TB 1W6MB 2WSUA 3UJQA 4AVSA 4MO3M 1W99A 1JHJA 4LIVA 1OH4A 1OXCA 2X8KA 2BWAA 1C1FA 2GMMA 4L11A 3TAYA 4D3WA 1X33A 2VJXA 1ZM1A 5JCTA 3WSOA 3POYA 4OYUA 4QXCA 3TN92 5L19A 3V65A 3HQXA 2VOKA 2YDEA 3HQRA 3LA7A 5FK8A 4B1LA 5LEJA 4W50A 1DGRA 4CXXA 4DRVA 5IVEA 4HLTA 1UKRA 2Q1FA 1HJFA 3DL3A 3AFGA 1X50A 3MYXA 5A3PA 1QU0A 3WV6A 4OULA 3BYNA 3JBG3 4F83A 2BRTA 1FAYA 5ERLA 4YW2A 2XXZA 4AI3A 3I3EA 3M3OA 2OA2A 5DAPA 1POV0 3VLBB 1LAJA 2A1XA 1CAXB 1MZEA 3I2GA 1S0JA 1JW6A 2WWJA 5FUPA 5EHDA 3WNPA 2VG9A 1AYN3 1CWPA 1UY2A 4QDQA 3MLKA 3GZUC 3DF0A 5FZ3A 2D5FA 4OUEA 4BOWA 4D6RA 2CTVA 1SZBA 2VCMA 2UYAA 2B4KA 1MS3A 3FFZA 5SV5A 3R4ZA 4GB33 3PVOA 3SNMA 2VVFA 4LR4A 1RB8G 4XETA 1FI2A 3AKHA 2YFTA 1VBB1 2YGMA 2LUWA 2VO5A 1N1SA 2R063 3I59B 1XBFA 1AUYA 2OQ7A 1ODMA 2R073 3NNGA 3AYAA 1AF9A 5KXEA 3RMXA 4QHZA 2C9KA 1AVBA 4BB3A 1ULDA 1L7RA 1ODNA 2VW2A 4FI9A 4YSFA 1HB1A 1HLCA 1LKNA 3QH6A 1V0AA 2Z79A 3K3NA 3WPZA 2GSYA 2VY0A 2BBVA 2IVJA 3K2OA 4QX2A 2ERFA 4ZXEA 3NSTA 1RUF3 2HEYF 5IVYA 3WPYA 1HKDA 4TN7A 3HWJA 4KG0A 4MXVA 3HVDA 3RJRA 4ES9A 3BTXA 1D2QA 3I3DA 3RSJA 1YQ2A 2ZGNA 4PLOA 3VBRC 3N9NA 5FAXA 5IT6A 2PHTA 3EMRA 3RPQA 3JBG2 2DTYA 4ZU4A 2WFF3 1IZ3A 4CRQA 3UNPA 2XKPA 4ZONA 2ZEXA 3VBRB 5GLKA 4E9KA 4URAA 1AR83 1AYN2 3LKJA 5J3UA 5GLLA 1J3RA 4AEJA 3NV2A 1JODA 3B01A 1MQTA 4CCCA 2FCVA 2GALA 5IAVA 3RYKA 3UGGA 4KCBA 2PQSA 4C1XA 3JCIA 4GB32 2VOXA 5BNPA 5AY9A 3KVBA 3WP6A 4AXOA 3J8F1 5IFTA 1GBGA 4BK4A 3TEXA 2JB8A 1RHI3 1UU6A 1YQ8A 2R1BA 4HL0A 4HG6B 4PBOA 5K0UC 2VOTA 4PT6A 1GOFA 4RGAA 3O7OA 2R072 5EPAA 2K0GA 4PI0A 4XURA 1V9U3 1EAH3 4CDWC 3V0AB 4FXKB 2VE1A 4QPIB 5F5QA 3O1UA 5C4WA 2V5DA 4TZDA 4QAWA 5K0UB 3SC7X 2Y6JA 3B94A 2F6BA 3S57A 4CDWB 4AHZA 4EWDA 2J7MA 3WDUA 2BNMA 1H8TA 1W6MA 2Z4FA 4MZUA 3USSA 1RUG1 3BALA 1SCSA 1XE8A 2PFWA 1RUF2 3QBQA 5B6TA 4XBNA 5FYYA 2A6YA 4Z8BA 1UPSA 1UXXX 4C1WA 2KA3A 2VVDA 2DVBA 4L97A 3PUQA 1I6XA 1ZRRA 2W68A 2XQXA 5A70A 3WQ0A 3HNBM 3KT7A 3QZ4A 1OUSA 3OJBA 4PJYA 2E7TA 3IWZA 1W03A 2WFF2 1PNGA 4D7SA 4QX1A 1NCQC 1BBT1 4WVVA 1FMD2 1JYCA 2FDIA 4XF1A 2DVDA 3PU3A 3N35A 2DCTA 1UPIA 2ZX2A 2RR13 4CDQC 1US2A 3OPZA 5LA0A 1NCQB 3AKIA 1OLQA 2WYSA 5HXMA 2W9XA 5ABJB 4UBGA 5JWPA 4XDOA 2WWSA 3HMYA 2VBBA 2HYKA 2VECA 1IPKA 3I2HA 3D5OA 3P3PA 5FPXA 2AYHA 5I93A 1RHI2 2IC1A 2VVEA 3LDRA 3D4KA 5FLHA 4BQXA 4XVHA 4JDMA 5JOYA 5DAQA 3N9QA 5ISLA 1V9U2 2RVAA 3IDCB 1ZBE1 2WT0A 1UOBA 3HBZA 4X8NA 3SKVA 5I0RA 5T52A 3H1MA 4E8DA 3QC2A 2OUHA 5FZFA 2IXKA 1O3TA 2ZPXA 4LO8A 4UOJA 4AEDB 4CCKA 2VTXJ 3D82A 5FTTC 3N7MA 1YI7A 4HK8A 1TNFA 3LQCA 1COV1 3AZYA 1NLQA 3CIHA 3O1VA 2PYTA 4LHNA 5EYXA 2JDZA 4A45A 1W6NB 4Y5TA 4W4ZA 3WCSA 5JOZA 3WCRA 1JZ3A 1MVEA 4A6OA 3WDTA 4BZ4A 1IS3A 2QDRA 4KMIA 3N9PA 1K5JA 2XLGA 5FJKA 3ZLIA 5C71A 1LOCA 2BNNA 2EIGA 2EXIA 1YJLA 2RS33 4FPLA 4JVAA 3T0AA 3ZXAC 2ZMLA 5T5JA 1YFXA 1AR92 4YVSB 3F2ZA 5IJRA 1YFWA 1FX5A 2MPFA 2PA7A 2EAAA 1GQPA 3CU9A 1IGOA 1EPZA 1R1A3 1PIV3 1LCLA 1OF3A 4E8CA 2H6CA 1OQDA 2RR12 3VBRA 3CZJA 5AYEA 2GC2A 3PJYA 4H14A 5CG8A 2CGOA 3J9SA 4O9GA 4D6SA 3ES4A 1Q8QA 4HONA 4EZHA 2AREA 3KD4A 3RYRA 3LEGA 1Z0HA 4AGRA 3ZIXA 1YLLA 3RZKA 1Y7BA 3AJYA 1W90A 3POFA 5FYUA 1W0PA 4HVOA 5AYCA 4CSWA 1VBE3 2GNBA 1H6XA 2NP0A 4O8OA 3AKGA 2F17A 2TBVA 4FPHA 4F3JA 1A6CA 1U5XA 3V0AA 5F39A 1EPWA 5FJHA 2TEPA 4EQVA 4UAPA 3Q8FA 4FAHA 3SLIA 1QJX2 1SBFA 4KU7A 5K0UA 4B4RA 3N9OA 3TAWA 5DAWA 4XHXA 4AOCA 1SACA 2YC2A 4PIZA 3WDXA 4CDWA 1T6BX 4CDUA 4CPBA 2WZR2 2J1VA 3T30A 2JIJA 1DQ2A 4ITCA 1S1AA 2V4VA 5FYMA 3ZOIA 4O61A 1D4M3 2Y0IA 1IOAA 3VBSC 1FT9A 5FYTA 4AR2A 4EN7B 3MFAA 3RI9A 1HN1A 1O59A 3WQ7A 1FV2A 1LOFC 3WN1A 3ILFA 5E6HA 4ZY9A 1RUC2 3AFKA 3U07A 1MS5A 4JC1A 4LBMA 4M01A 3UKTA 3VBSB 2GNTA 2BGOA 1YC61 2HEVF 1PIV2 2IFWA 1FYUA 3R4DB 5GZFA 3OPWA 3I2KA 3ZIWA 5KXCA 3RJ2X 5FLWA 1OFNA 3BB6A 4OVEA 5FQ0B 3VZLA 2WFPA 3WMZA 2BOIA 3O1MA 2XOMA 1HW5A 2ZGQA 3KT4A 3NKTA 4D0QA 5A1AA 3ZPYA 4GIQA 1NCQA 3N7LA 3OGGA 4UBHA 2A6ZA 5BY5A 3O0VA 3CEWA 3VDDB 3IPVB 3BI3A 4DUWA 1UY4A 3J7MA 2FD8A 2HH9A 2NLRA 1HRI3 1N1YA 3HJRA 3KZ4C 5FO8B 2P5BA 1VBE2 1CQ9A 1CZVA 1ZYBA 3IM0A 4NVPA 3BYLA 4DMIA 4GXLA 1SFPA 3U1XA 4XUQA 3H8OA 5FP3A 2G19A 3WG4A 1R64A 4EWAA 4ATFA 5FR3A 5JXHA 1H4GA 4Q4X1 4QQSA 1XNBA 2E32A 2VMCA 3FLPA 3U10A 2P3IA 3G7DA 5F6LB 3TWIA 3WG3A 4LUMA 1XE7A 4A4AA 3I49A 4V2VA 1Z7S2 1D4M2 1VRH2 2ET1A 4BQYA 5JZGA 3LEMA 4QHBA 2IUWA 4R52A 5GKAC 4QHOA 1OURA 3OSDA 2PTMA 3O12A 1W6QB 1AYM1 5JUVA 2W95A 2Q30A 1GZWA 3RFRA 3LAGA 4N90A 5CBLA 3O1TA 3Q8CA 3AYDA 3OGJA 1LU1A 2HYXA 2JD4A 1QDCA 2E26A 2ZACA 4MGIE 4MXWB 1HRV1 4SBVA 1ULEA 3WDVA 3KWVA 4KU8A 1X9PA 3QLQA 3AZWA 2BV4A 2CU5A 4JGZC 5IW0A 1GOHA 1YQ6A 3THPA 3IIAA 4CCEA 4BMEA 4BJ0A 5B2GB 4LO7A 3I3BA 5I8SA 2DUOA 2XWBB 2P2KA 4JGZB 1TE1B 2DU1A 3MIEA 1I9RA 3P2NA 4EYUA 4NO4A 1DHKB 4AFMA 5CA6A 5A7SA 1GNZA 2XVGA 1IG0A 3UK9A 5A3LA 2AZ5A 1BMV1 4QKBA 1H30A 3A7QA 2Q8CA 3LB9A 1F5FA 3ALQA 1OVPA 3VBHC 3WDYA 1WLDA 2D6OX 4AI8A 1NQDA 2GH2A 4BIFA 1AX2A 2B4WA 2OS2A 1WLWA 1YFUA 3LEIA 1V6LA 1VMJA 2ZGUA 4IEYA 4QPYA 2BW8A 3HBKA 4ES8A 4N4BA 1PGW1 2WKKA 1WLTA 5IVCA 3VBHB 2YXSA 2K2SA 1RINA 2WO7A 4GZ9A 1JBCA 5JI7A 1R083 3S5AA 2IXIA 4L2NA 1DLCA 2RS51 3CQOA 4I3PA 4HANA 2BEOA 4NPLA 3HD8B 2ARCA 2VL4A 1LECA 4G4FA 4RR3C 3ON7A 3ENRA 3MPBA 4JZRA 2JXAA 5CB7A 1J3QA 5BNOB 1I5PA 3RZLA 1HQNA 1RMU1 2R0FA 5A7WA 4RR3B 5FZ9A 1TME3 3VD4A 5DDJ1 3VBSA 3DPRC 1JS9A 1KJRA 4BQ1A 3MGUA 2ZEYA 2JDMA 4HK9A 1AL0G 1OHFA 2ZABA 4Y22A 5FYSA 5LCWL 2FDKA 1A34A 1LOFA 2ZGOA 5FZOB 1R093 4LBNA 4AL9A 3DPRB 1QOTA 3EO6A 4DUXA 2MHFA 1YNAA 2GAUA 5A7NA 3MIHA 2ADDA 4E2GA 3CNAA 4AK7A 1XNCA 4LORA 3H3LA 2VW0A 3VDAA 4EROA 2G9FA 3OEAA 3VKOA 3IPVA 4L92A 1C8M3 5DUWA 5T50A 2VPVA 1GICA 4COTA 2D6LX 2UURA 3I2FA 4AI9A 4UW6A 1TNRA 5DXDA 3ZFGC 3M3IA 4FTEA 4Y4YA 2YC0A 5LK5A 1NOVA 3D3AA 4LKSA 4CU9A 2YYOA 3UGFA 2G4IA 1O3QA 5A8DA 3VV1A 3MBWA 1UX6A 1POV1 4N7IA 4LBQD 4QB2A 3IT8A 3ZFGB 1A8DA 1UAIA 2QBXA 2VMHA 1SLAA 1OVSA 2ZAAA 4EN8B 2ATFA 3SXWA 4QXKA 3B69A 5LA2A 3WUDA 2C6SA 2LW8A 3WNMA 1RITA 2ID4A 1UQXA 3K4AA 1NA1C 5FP9A 2HWC3 3FX3A 4JDOA 1ZA4A 2EIDA 4NPMA 2QQLA 4P9LA 4PLNA 4AFBA 5IVJA 4QX8A 2TNFA 1TME2 4XF3A 1WCKA 2UWAA 4FFIA 5CZKA 4QKFA 3ZYPA 3POWA 4NIHA 3SMHA 1H2MA 2PLV1 3DEMA 1NA1B 2WL1A 1BQPA 1L3JA 3HR9A 2H6BA 1JZ6A 2OIIA 2XPJA 4HSJA 4HN1A 1MZ5A 3M4FA 1QY4A 4XMAA 2RE9A 3S0MA 1HN0A 3CKHA 4CP0A 4R8HA 3BYJA 3T2TA 4LKDA 2XONA 1AR72 1GYEB 4JGZA 1AR62 1OD5A 1SFYA 2YROA 3GCWA 1AYM3 3THTA 1C8M2 2BQPA 1QQP3 1HXS2 4K1ZA 4IEZA 3DCQA 4XF0A 2C1FA 3GJAA 1IQAA 1UYYA 5H9SA 2JKBA 3K4DA 3TN91 4IESA 3WHUA 1JYWA 5DPNA 4AQSA 3NV3A 3POBA 3UKNA 1W9FA 2GMEA 1JYIA 4Q4V1 1JXNA 1MEC3 4OLLA 2KR2A 2WNUC 1PMHX 5FPLA 5KHIA 3BYWA 1AJKA 2JEMA 4GA9A 4LTAA 4M3CF 5DAVA 3VBHA 4ONUA 4LNVA 1QDOA 5F3EA 1WZXA 1RJ7A 4EJRA 1B35C 1CAVA 1QOOA 4CCNA 2WNUB 4FSJA 3AXDA 3LD8A 3K46A 3BIEA 1O3RA 4A42A 4LOSA 1GYDB 2W1SA 1PNFA 2RDRA 4XJ8A 1LHVA 1OMIA 3INAA 3HNYM 3KS7A 5FP8A 4KC8A 4DXSA 1B35B 2ZX0A 3AP6A 2KXLA 1AXYA 4GD4A 4GMP1 1NLSA 2RMU3 3PMEA 3VBUC 4WBBA 5H9QA 5LBEA 4Y1ZA 4EWEA 2YV8A 4B4QA 5B6SA 1W3XA 3VHOA 1AX1A 4BQ4A 1IS5A 1FOD2 4GH4C 2E6VA 3SCHA 2FDHA 5C3OA 4XAEA 4YVWA 1K5MC 5EQUA 2J1EA 3VBUB 3WXPA 1S0FA 1OT5A 3A21A 3POSA 5FZOA 4GH4B 2FMYA 2YPDA 3C7FA 1QJU2 3Q8BA 4FPGA 4FP3A 1K45A 3S7EA 5FZAA 2YG0A 1B09A 3F95A 3PDQA 1QHDA 3GCXA 3H9AA 3OY8A 5A6YA 1XE0A 2WBKA 3U4XA 2HWE2 2ZGSA 5JMCA 4S2DA 1V6IA 2DFBA 1MEC2 1OC1A 3FUQA 4DRRA 2DUQA 1EV13 3EJKA 1G9CA 2R7EB 2P6HA 2CL2A 4IE0A 5A1LA 1GWKA 5IFPA 2X8SA 2VDTA 3JBG1 1AL22 3FHQA 5FZ1A 1CAUB 2RJKA 3KM5A 3KGLA 4DOUA 3ZFGA 3RRDA 2EIBA 1E5HA 3PL0A 1AYN1 3FBMA 1A3KA 1GQGA 2WQZC 4GWIA 4YZ2A 2ZJCA 1KS4A 5C8WA 1DG6A 1VKDA 2EXHA 2YC4A 1VBD3 2RMU2 1OI6A 4A7ZA 2FCTA 1POQA 5KR7A 1Q56A 4B29A 4EN6B 4AW7A 2JKXA 5FWJA 4GB31 2I2SA 2ILMA 3BOWA 3MEPA 4OHWA 2RS12 4XFHA 2RJ2A 1ZZ9A 2A6VA 4KBZA 2R061 2ZEWA 4A3ZA 3UKVA 5CFDC 3AKPA 2R071 5D21A 1QWRA 1POV3 1BK0A 5E88A 3RNSA 5AC92 5GLUA 5C0PA 2JDKA 2VQUA 4IEVA 4OQ8A 3HQUA 2VQTA 2Q1MA 5KXDA 2HWB2 4W6WA 5A7OA 1URXA 3VB9A 1UY0A 3WR0A 4U36A 1ONAA 2Y6GA 5FZEA 3PMSA 1UMZA 2XBO2 2UU8A 4XZPA 1RUF1 3ZXDA 1H1MA 3I3QA 3CHXA 1PO12 3OYWB 1XNKA 4UDKE 4NHKA 5A33B 1QMJA 1VMHA 3DKQA 3OD0A 3BTYA 3OM5A 1EV12 4N2ZA 2DBNA 1QIQA 2UYBA 1OKQA 3IB3A 2ETEA 2VNOA 2WFF1 1BVVA 4Q4W2 4URTA 4BXFA 2A6WA 4FPFA 4HETA 2R1DA 2YMZA 3K51A 4G9SB 2P3YA 1AR81 5KC5A 1ZVFA 3KSCA 4QX0A 4AQ2A 4CXWA 5IVVA 2DURA 5FWEA 2WNUA 3CL1A 3WOGA 1LR5A 1UOJA 1UU5A 3R05A 5GLMA 4IXLA 4WVMA 5C7GA 4BQ2A 1QJY2 2CDOA 4N8MA 4MLOA 1J1LA 4D7YA 4HN0A 3CDZB 3FLRA 4OCTA 2Y64A 4LT5A 2XUEA 4CUCA 1RHI1 5T5PA 3EB7A 3O0WA 1M4WA 3JQXA 1OBNA 1V9U1 4QM9A 2YB7A 1J59A 3QEFA 2CYFA 1N3PA 4IEOA 3OBAA 2NN8A 3IDAA 1H9WA 1H2KA 4GALA 4XQ4A 3VBUA 4TTGA 3VDCA 3V56A 4UDIA 4EV0A 1MQTB 5EJ3A 3IN9A 4LO4B 4GH4A 1N47A 4N9IA 4UFHA 4RHV3 2CV6A 2EAKA 4CDXC 2LROA 1K5MA 2P37A 3B93A 4R4ZA 1O5UA 1RUE3 1ZRCA 4XABA 4COYA 1GYHA 1LNSA 4CEYC 4IV3A 4A7YA 4J1WA 5SV8A 1CJDA 2WNOA 4N9HA 1DGWA 5C4WB 3OM6A 5FYZA 4PLMA 2IXCA 3M7AA 1K12A 4HXCA 1W6PA 2QCSB 3EXUA 4RD7A 3A4UA 5FKCA 2QFEA 1N3QA 1FXZA 4YG0A 1HIXA 2RR11 3WVJA 3RVHA 5GLRA 1OKOA 4BM8A 3H3ZA 5J37A 1IKPA 1IS6A 5IVBA 1XYNA 1ZZ6A 2PHRA 2QQKA 5CVRA 1NE4A 1QEXA 1UU4A 3GJBA 3LV4A 1SFNA 3MFCA 4XUTA 3VSSA 4A2UA 1SLCA 1F31A 5K9YA 2QDNA 2WZ8A 3AZXA 1TQ5A 5KXBA 5DAXA 1CJPA 3J26N 3LSDA 3T1LA 1KEXA 5EV7A 3KQ4B 3GF6A 3ATGA 4XTPA 4RHV2 2BERA 4CVUA 4NR1A 1QJX1 5CFDA 2NMNA 2ZCWA 4UYBA 5FZ6A 4UDKA 2V73A 4FCAA 1RUE2 2NQYA 2ZZQA 1GWMA 4FOWA 4AK6A 4NIIA 1LRHA 4DXRA 3KSTA 5F1RA 3OYWA 4QQ2A 1JUIA 2RS31 5A33A 2BPA2 4IL7A 5FPUA 2D5HA 4QQPA 4ZXKA 3AKRA 4YM3A 4LITA 3WX5A 3VD5A 1RC6A 1R1A1 2XJTA 1FATA 1KFUL 5F32A 1PIV1 3TEWA 2Y26A 4E27A 1BLZA 2WABA 2WDBA 3H42B 3PVEA 2VGDA 1PM4A 5IK5A 4B8EA 3IIIA 4UF0B 4XBLA 1X9TA 2QQUA 2QZ2A 4LK6A 4W65A 4BLJA 1E57A 5LWBA 3H3UA 4META 2VZ1A 5A32B 4IE4A 4P9GA 1KDMA 1NZIA 5A6ZA 2XJVA 3NJYA 5BNQA 1UYPA 2V09A 3W58A 5AFEA 2JE7A 4B3NA 5FOBB 1PX3A 3B02A 2AC1A 2X05A 4RFT0 4KWJA 5GLWA 3PUHA 1PO22 1C28A 3LDKA 4PHZA 5BPXA 1VBE1 3L2YA 2P34A 4CCJA 5C9AC 1UIKA 5CKNA 4KNCA 2E7AA 1AX0A 2WIIB 2Q8OA 4MOAA 1WBLA 3NRUA 4EE2A 3RWKX 1FMD3 1YIPA 1DU3D 4BYYA 4DEQA 5C9AB 1TZOA 4Y4RA 1BVP1 1T6GC 3BIWE 3JUUA 3EHKA 4CUAA 4OHXA 4CA9A 5HPOA 1S0IA 4NJ4A 5HBAA 2QQPA 3O1SA 3DXTA 3FLTA 4FPEA 5FY5A 3JD72 1RUNA 1H8VA 2D40A 4OUSA 4QU1A 1Z7S1 3FUOA 1CAWB 1D4M1 1VAVA 1VRH1 2YBKA 4CPBD 5B4NA 1WMXA 1RUI3 1WA4A 4IQPA 1OUXA 4ASMB 3P6BA 3AMNA 1D0HA 4CDXA 5A7VB 1U5IA 4HKWA 2JDUA 3VZMA 4PVAA 4QXHA 1U0AA 4C0HA 4CDUC 1OF4A 4YM2A 2WO3A 1MS1A 1WMFA 2O8OA 2P4EA 3VZJA 1JOPA 5DUUA 4KGGA 5CISA 5F3IA 1DQ0A 1NY72 2QJVA 4MLGA 2WLQA 5FYHA 1V6MA 4CEYA 3BKZA 4CTEA 4YLZA 4CDUB 5GLVA 4I09A 4MVTA 3NAPC 2NM1A 3T3YA 2QNKA 1VBC3 2YFUA 3UESA 1DZTA 3U37A 3VL9A 4CCOA 2IXLA 1W6OA 5FLIA 5FKBA 1SLIA 1OQ1A 1SMVA 2BGPA 4IEUA 1CGPA 2Y34A 3WQBA 1W8WA 2ES3A 4OI1A 4UWDA 4Q8KA 2P3KA 2BNOA 4XFIA 3LCPA 1F5JA 2JG9C 3J7NA 1HRI1 1TEIA 3NKGA 4AVVA 5AFBA 1VB4A 2D97A 2W5FA 1H0BA 2E33A 4GKXA 5FYIA 3TRSB 1AR93 2WN2A 1W2UA 3MF6A 5H9RA 1HQWA 4TWTA 3KCCA 2Z42A 2VZSA 1V6KA 4LE3A 2CNAA 3HIFA 4DY5A 5IHRA 4LUKA 2DF7A 3MIGA 4ZHNA 1ND2C 5TSWA 2QVSB 3QEDA 4JV4A 1LOBA 4LO6B 4MSVA 3RWNA 4BPZA 5C6CA 2P6CA 2RHPA 5FPAA 1QH6A 3KGZA 4PQ9A 1UMHA 3X29B 1RUI2 1JZ4A 2XL7A 1ND2B 1OOPA 4D6QA 5C33A 2XR4A 4TXWA 4YGDA 2XUMA 2YPJA 1PVXA 3L2HA 1VALA 2WQ8A 3AP9A 5GZCA 1TVGA 4I0AA 2B7YA 4P14A 3ZKYA 5I0TA 2G1MA 3VD7A 1WA6X 3WN0A 5LRRA 2MEV2 1UD1A 2L9LA 5JZGC 1UZZA 3DYOA 4DIQA 4YGEA 2B45X 1LB2A 3I8TA 4QB6A 4HFSA 3P5BA 1VBC2 3NL1A 1QJX3 2RJLA 2RM23 1UY1A 4HKOA 4IE5A 5LA1A 4BE3A 5JZGB 1RXFA 1UXZA 1XQNA 2WAOA 3H8UA 4UF0A 2WZR3 1OLRA 1XPWA 4PF1A 4MUVA 4AHWA 1GZWB 2R16A 3T0BA 5A32A 5HI0A 4R9CA 2EXJA 1PZ7A 1NE6A 2W3JA 2W94A 2VZOA 3K77A 5FY8A 5FZHA 5FY0A 4XIOA 2W92A 3H1YA 3I2DA 3WF0A 3ZXJA 4L9BA 4ASKA 4JQRA 4JHTA 1RUC3 2A6XA 3OBRA 1DBNA 3CLPA 4QQOA 3WG1A 4CCDA 2FQPA 2JICA 4YGBA 3QOPA 5LASA 2ZGRA 3P1IA 4BCUA 4AE2A 1OFSA 1BHGA 3KMHA 1O8SA 2VZUA 3KLSA 4TYSA 5A3OA 1E5RA 3AXEA 1R081 3LFMA 5C9AA 2R042 1D0GA 1VAMA 1G9FA 3O14A 4Y1XA 3SITA 1VPHA 2WLPA 2YFZA 5F5CA 3ZXFA 5JPNB 4ISRA 2DFCA 4FFFA 4A41A 1N3OA 3ACGA 1XJAA 1KQRA 4KWKA 5FXXA 1LU2A 4I01A 1AZDA 1VAKA 3NJXA 1PK6C 4YYOA 1O6UA 1CAWA 1RJ8A 3OB8A 4RQPC 1AXKA 1YXWA 3THCA 3IBMA 2ZXQA 4ZZ8A 3OEBA 3UGHA 2JG8C 1MS0A 2YFRA 3OUIA 5A7VA 1Q3EA 2EVXA 1MS9A 4FT8A 1TME1 4OI4A 4P5HA 2VUJA 4QQLA 1GV9A 3U14A 4DEVA 4RQPB 1E5SA 2NPIA 5LW9A 3PTYA 2JG8B 2OPWA 4JHZA 2RM22 4J1XA 4K21A 3D60A 1SPPB 1W05A 1R091 1IS4A 4M3CB 2DCZA 5FPVA 2Q8EA 1GNYA 2ZX1A 4XQDA 3ZSEA 3U11A 3HT1A 4B4PA 1QJFA 1Z7S3 1VRH3 5KHJA 2E63A 4H2AA 1CPNA 2B42B 2F4PA 3C2UA 2RG4A 3NAPA 3NVCA 5KHGA 3UT0A 4M3CE 5A7WB 1C8M1 4QQHA 2VZ3A 5C5TA 2W1UA 2AH2A 3CBNA 1UZVA 4YWAA 4BK5A 4RS5C 5EWSA 4BLIA 3A0KA 1UN1A 4QB1A 4Y22B 1L7QA 5FZ8A 2VMEA 5AVPA 3WP3A 1QXRA 2JB4A 1BXHA 2X8TA 2JG9A 4UDGA 3NJVA 3WF4A 1SLLA 5FK7A 4HPKB 1LOAA 2DDUA 1JI6A 1ULPA 1W8OA 4LEJA 3ITQA 2D44A 4IEQA 1ZZBA 1YEWA 1ULGA 3L9JT 1YQ5A 4QWNA 1Q5OA 4EN9B 1KJLA 1ENSA 4J25A 4P5YA 2X8FA 3VSZA 3BODA 4CU7A 2CGNA 1ND2A 2HWC1 2OPKA 2WZEA 1LGCA 4HKLA 1O8PA 4K40A 3ZSLA 4AFCA 1ZBA3 2OZJA 3KCXA 3WW3A 5DUXA 3HN1A 2FZ1A 5FREA 3S5QA 2VW1A 3LPGA 2UY9A 3O1PA 3H50A 1OPMA 4HVRA 4I0BA 1MVQA 5DABA 3AKSA 1GMMA 2E9QA 2WA3A 4XXAA 4FPCA 2CWMA 4QDSA 5LB6A 1CZTA 2ARBA 2GP3A 3JQWA 4M0NA 1W2AX 4XYXA 3EBRA 5F6KA 2W2IA 1QJU1 4U6DA 2AEZA 1QOSA 4XPVA 2OX0A 4XZUG 1QQP1 1D7PM 1EY2A 1VP6A 2ZHMA 3FMGA 4MGZE 4OI2A 5FY7A 1NKGA 2YY1A 2VBPA 3GNEA 4XIKA 2BU9A 3AP7A 4L8QA 3SH5A 5KWRA 2VNVA 3WF2A 2ZGKA 4W8JA 1MEC1 3ZYRA 5JDBA 3D0JA 4P00B 3DV8A 1YIFA 4Y20B 2X5IC 3B7MA 4W6XA 5F3GA 4BQWA 1DZQA 4OHYA 5B4XA 1RIRA 4UFJA 2ZAHA 1GOGA 3J8F2 2Q8DA 4UDJA 3N36A 3CJXA 1F4AA 5EIYB 5CADA 1D4VB 1C1LA 1XNTA 3I54A 5BUVA 3URFA 2Q5TA 3WW4A 2DCJA 5GLQA 3AJZA 3ZYIB 3O5SA 2FCUA 5HXVA 5K8SA 3I97A 2CGPA 4OMDA 1FPN3 1ZBA2 2RMU1 4CZSA 1STMA 1SCRA 3MIDA 5DN2A 2A73B 2Q0AA 1H1AA 1IQDC 5FMBA 4F8AA 5EFUA 5HCAA 1PK6A 3O1OA 3MV11 2XG3A 2RS11 1H9PA 4RQPA 4ISQA 4LKFA 4XUNA 4Z82A 5LK7B 1S0GA 1WWYA 2GC1A 2IFRA 2ZKNA 2F4LA 1CAVB 2JG8A 2PELA 1KDKA 2QTWB 2EXKA 2D6KA 4KGQA 3H7JA 2GU9A 3AKTA 1SPPA 4I3GA 4M3CA 1YJKA 4XF4A 5FZ4A 2HWB1 1F4HA 1JZ5A 4K8FA 5JR2A 2E31A 1AJOA 5AVAA 3THDA 4YVWC 3AMQA 4K6BA 1H2LA 4E2SA 2ZOEB 1TG7A 1US3A 2HBUA 3C7EA 4IERA 4LKEA 4RL7A 5HCBA 4LHLA 4Z07A 4YVWB 1EV11 2D98A 4Q1PA 4PDWC 2VNGA 3LF7A 3WZ1A 3ZSKA 5I8TA 5GJ6A 4CE8A 2E7QA 2C9AA 1PX4A 1UYXA 5E89A 4RS5A 3R4UA 2SLIA 1G9BA 3ECQA 3TEZA 2XGXA 4HPKA 3BPZA 2BYVE 4PDWB 5L9VA 3GBWA 2VBDA 4QU2A 1J3PA 5FZCA 1AR73 1SLTA 1T2XA 3OGSA 3OY8B 1AR63 5L9BA 1W0NA 4N7UA 3OF1A 3ZYBA 1FPN2 1VBD1 4MG2A 3IAPA 3T1MA 3BTZA 1HXS3 1DYOA 4CUBA 5GLTA 5I8YA 2CHHA 1OLME 2IXJA 2JX9A 3DKWA 3MV01 2VC9A 4NRMA 1AXZA 5DZFA 2O1QA 1LGNA 2VAUA 1LHNA 2RV9A 2GC3A 4OFGA 4QGNA 3D0SA 5J98B 5A7PA 4A3XA 3AK0A 3FWEA 4PIXA 1RUH3 4N2RA 5AYDA 3NNLA 2QQJA 4BMBA 1O7FA 1WBFA 3KF3A 1SBEA 3CMGA 2DBIA 1S0EA 4KMQA 3ELNA 2D6NA 3TEYA 2LM3A 2TUNA 4XJAA 1MACA 1NX9A 5C8CC 3VT0A 4AGGA 2WNVC 5CIRA 2FZ2A 3MICA 2OW4A 4N53C 4GJZA 4NIAA 1UCXA 3OM4A 3QCWA 5FZBA 3VN4A 5L36A 4OI0A 2Y6FA 3BU7A 3KV4A 1J84A 2WNVB 3NV1A 4N53B 2VD7A 3SISA 5FUIA 1GNHA 4OZOA 4JGYC 1FOD3 1EYBA 5IYYA 1F15A 4FO9A 5EP9A 4X6RB 1FNYA 1I3HA 4Y20A 1DP0A 3AKFA 4D7TA 4FOYA 2D43A 4BQ3A 1QJU3 1GP6A 1X8EA 1J1TA 2GMPA 2VUDA 2W08A 4NWWA 3VBOC 4MGTA 1Y43B 1VE0A 2X5IA 4BDVB 2OXBA 5JOXA 2QQWA 3E6CC 4HZFA 4LBQB 3VBFC 1CVNA 2LALA 4M0HA 4O8NA 2D6MA 2HKXA 2J1TA 3JU9A 1VLNA 2W39A 2HWE3 2QQIA 4QGMA 4PIYA 3VBFB 1RUH2 3B9IA 1UNBA 2PHXA 2ZTNA 3VSRA 3E6DA 4CP9A 1AL23 1YI9A 4UFLA 5GZDA 1GP5A 3W9AA 3VDBA 2IVIB 3E1F1 4FPYA 3SEEA 5ANNA 4BA6A 4HVQA 4WVMB 3HEIA 2PAMA 1O4YA 1OQEA 5IUQA 4RHV1 2XJSA 3J7HA 1R1ZA 3SHRA 4YPJA 4AI0A 3BVCA 3KV5A 3C3VA 3VHPA 3AMMA 4KL1A 1RUE1 3GZEA 4AHYA 5A6XA 3I2OA 1XNDA 2A3WA 4Y26A 4L99A 2EF6A 3LWCA 4YW7A 1DFQA 2RS13 4LA3A 4LHSA 1G9AA 2XVKA 4V2WA 2ZHKA 1W9WA 2Y6HA 4XFGA 5LATA 4D94A 3K1UA 1TMF3 5AC93 2HLEA 4ZPIA 3OD4A 2JE9A 4Q0PA 5JSOA 4X8PA 4YNIA 3MLJA 2HWB3 3NMBA 4PF5A 4UW4A 1K5MB 2CDPA 4IV3C 4PDWA 4QXBA 4N43C 1OLMA 2JDHA 3HNMA 4MGSA 4QPGC 4FOVA 3MIFA 3W59A 1YO8A 4KQ7A 2A71A 1ZREA 1QF3A 1RTVA 1PHMA 4NMIA
chains in the Genus database with same CATH topology
4LPLA 3LQCA 2WZ8A 3CIHA 1ST8A 4A45A 5JOZA 5JOWA 4W4ZA 1JZ3A 1KEXA 4A6OA 4UI9L 1JZ7A 3ACFA 4KMIA 2OKXA 4CU6A 3C7OA 3GDBA 2W91A 5C71A 2BERA 4CVUA 3BGAA 2EXIA 4UDKA 3PUIA 1RYYA 3JXSA 3T0AA 2X09A 3T09A 1W2TA 3F2ZA 1UY3A 1WKYA 2Y8KA 5IJRA 4AK6A 1GQPA 5EJZB 2ZEZA 4DXRA 1UYZA 3CU9A 3KSTA 3ETPA 1OF3A 4E8CA 3LFIA 4P08A 5AYEA 3CZJA 3LE0A 1GU3A 2JDAA 3VD5A 3WPVA 3LEGA 2WABA 1JU3A 2WDBA 3IIIA 4ARXA 1Y7BA 2QQUA 3C7GA 5AYCA 1W9TA 2VR4A 2VZ1A 3WNLA 5GLPA 1H6XA 5EJ1B 4O8OA 3AKGA 3LIHA 1UYPA 1EUUA 3QEEA 1PX3A 4EQVA 4UAPA 2AC1A 2X05A 4KWUA 3PUHA 3TAWA 3LDKA 2JD9A 1SG3A 2YC2A 1PT2A 2ORXA 2J1VA 4MOAA 1JZ8A 3NRUA 4AAXA 3RWKX 2V4VA 4IUGA 1UMIA 4DEQA 3WPUA 3W5NA 3D5YA 4CUAA 1HN1A 1O59A 3A22A 5HPOA 3WN1A 4ZY9A 2QQNA 1P8JA 2BGOA 3HPNA 3K4ZA 5B4NA 3P6BA 3I2KA 5FLWA 5A7VB 1PMJX 4CU8A 4PVAA 1UZ0A 3WAUA 3FHAA 1OF4A 3KF5A 2WO3A 3WMZA 2XOMA 5I0DA 5A1AA 4D0QA 5G05L 5JXIA 4MLGA 3A23A 2WAAA 3C7HA 4XUPA 2DCKA 3ZXLA 4DUWA 1UY4A 4JX0A 3C8XA 2YFUA 3UESA 3HJRA 3U37A 4KC7A 5FKBA 1CZVA 3DECA 2BGPA 3BYLA 4ET7A 3WQBA 5FIXA 4XUQA 2C4XA 1R64A 3WNNA 2V72A 5JXHA 2W5FA 4QQSA 2E33A 5F7UA 2E32A 2VMCA 2WN2A 2VZSA 4A4AA 2BZDA 4PVIA 5IHRA 3LEMA 3LPFA 4RYDA 3WN2A 5JUVA 3QEDA 2W95A 1CX1A 3I2IA 3CZUA 4AG4A 1UMHA 2HYXA 1OD3A 2E26A 1MPXA 1JZ4A 3VT2A 4TXWA 1GOHA 4QX3A 2Y6LA 2XHNA 2WQ8A 4M4PA 1TVGA 4N1IA 4BJ0A 3I3BA 2ORZA 3VD7A 2C26A 3WN0A 1OYGA 2L9LA 1GUIA 2J22A 3P2NA 3DYOA 2WO2A 3SEPA 4QB6A 1K42A 3VD3A 1ULOA 1UY1A 5LA1A 3A7QA 1XNAA 3IAQA 2B4WA 1UXZA 2WAOA 3ACHA 1XPWA 4PF1A 3LEIA 3T0BA 3U75A 2EXJA 4N4BA 1JYNA 3K77A 2W94A 2W3JA 2VZOA 2W92A 3ZXKA 2VM9A 2VZPA 4GZ9A 3WF0A 3ZXJA 1CZSA 1K3IA 1H6YA 3UETA 1DLCA 2KD7A 3CQOA 5GLOA 3P1IA 2VL4A 1BHGA 2VMFA 1O8SA 2VZUA 3VD9A 3LIGA 4PQQA 2JE8A 2B9VA 1I5PA 1JU4A 2YFZA 1JYXA 3OM2A 4FFFA 4A41A 3ACGA 5CYYA 3VD4A 1JYVA 3NJXA 1JZ2A 4ARYA 3OB8A 3THCA 4ZZ8A 2ZEYA 5FMCA 5FMDA 5LCWL 2ZXQA 3OG2A 3OEBA 4GWJA 3UGHA 2VZRA 2YFRA 5A7VA 3T08A 3U14A 4DUXA 3ZM8A 4DEVA 1J83A 2QQOA 2J1SA 2ADDA 5A8CA 4AK7A 5DMYA 4JHZA 3WF1A 1Y9MA 4M4RA 2WO1A 3D60A 3VDAA 3R4YA 3OEAA 1Y9GA 1GNYA 5G04L 4COTA 4D47A 3AC0A 3I2FA 4FFGA 3VSFA 3ABZA 1SDDB 3WMYA 3DYPA 3C2UA 1WCQA 3D3AA 4LKSA 4CU9A 2VZ3A 2W1UA 3UGFA 4BK5A 4Z2AA 5A8DA 2J1RA 3MBWA 4QB2A 4QB1A 2ADEA 4LQRA 2QBXA 3WASA 1L7QA 2VMEA 3WF3A 3D5ZA 5JXJA 2W46A 2X8TA 5J1XA 4UDGA 3NJVA 5LA2A 3WF4A 2LW8A 3I2JA 3WNMA 5FK7A 2ID4A 5JMOA 3PIGA 3K4AA 2DDUA 1JI6A 1ULPA 1W8OA 3GGLA 2EIDA 3NQHA 2QQLA 4MGQA 1WL7A 2VZVA 3ACIA 4FFIA 4U6BA 5CZKA 4FFHA 3K75B 3PIJA 4P5YA 2X8FA 4ONZA 1UV4A 3VSZA 2VCBA 4CU7A 2EICA 1JZ6A 2WZEA 1O8PA 5C70A 3D61A 1SHWB 3CKHA 2J1AA 3BYJA 3LPGA 2XONA 2VCCA 1GYEB 4JKLA 4RN5A 2YFSA 1W8NA 3WNKA 4JKMA 1GMMA 3MUY1 4L0PA 4QDSA 1NAEA 1CZTA 3GXUA 1UYYA 4KI5M 3K4DA 1JYWA 5DPNA 4U6DA 3EYPA 4XZUG 2AEZA 1CIYA 1D7PM 2QQMA 1PMHX 4D8MA 1NKGA 2W47A 3FL7A 4QDRA 3VT1A 1Y4WA 3WF2A 4W8JA 2EIEA 3WNOA 3K46A 4P00B 4A42A 1GYDB 1W18A 2W1SA 4P02B 1YIFA 2VTFA 3W5MA 2LS6A 5B4XA 3HNYM 3T2OA 4KC8A 4DXSA 1GOGA 4UDJA 4O8PA 4NOVA 4DUVA 1F4AA 2J1UA 5EIYB 1XNTA 2Y6KA 4MADA 4A44A 3R67A 2DCJA 5GLQA 5B6SA 3LEKA 3I97A 4XUOA 4OMDA 4MO3M 1W99A 1JHJA 2J1EA 1OH4A 2WN3A 5DN2A 1OT5A 1XC6A 3A21A 4KCAA 2VJXA 3WSOA 1IQDC 4OYUA 5FMBA 3C7FA 3MV11 4XUNA 4OMCA 5FK8A 1K45A 4W50A 2W1WA 1YRZA 3WEZA 3GM8A 2YG0A 2EXKA 2WBKA 1F4HA 1JZ5A 3I3EA 5JR2A 3OGRA 2E31A 3I2GA 3THDA 3WNPA 2R7EB 5IFPA 1UY2A 2X8SA 4QDQA 2VDTA 1TG7A 1US3A 3C7EA 3FHQA 4OUEA 3T2QA 3OGVA 2B4KA 3MUZ1 2EIBA 3LF7A 3R4ZA 4GWIA 1KGYA 5GLNA 2VCAA 1VKDA 1PX4A 1UYXA 3AKHA 2EXHA 2YC4A 2YFTA 3ECQA 2VO5A 1UWWA 2VZTA 3NNGA 2JKXA 1T2XA 3OGSA 1W0NA 2WUHA 3SKJE 2C9KA 3OM7A 2RJ2A 3IAPA 1L7RA 4FI9A 2ZEWA 4A3ZA 1DYOA 4CUBA 2W1QA 3MV01 2AEYA 2VC9A 5C0PA 3WPZA 2VQUA 4QX2A 4ZZ5A 2VQTA 4ZXEA 2RV9A 3WPYA 3T2PA 1UY0A 4N2RA 5AYDA 2QQJA 3I3DA 1YQ2A 3KF3A 2Y6GA 4KMQA 3CMGA 3MO4A 3BYKA 4UDKE 2BBAA 1NX9A 3UNPA 3VT0A 3OM5A 2ZEXA 2X10A 5GLKA 4N2ZA 3DYMA 3HOBA 5GLLA 3IB3A 1J84A 1NUKA 3T0DA 3UGGA 4KCBA 5FUIA 1EUTA 2PQSA 4OZOA 4QX0A 5AY9A 2VMDA 5IYYA 5IFTA 4BK4A 5GLMA 5C7GA 1W9SA 4HG6B 2VOTA 3HN3A 4PT6A 1GOFA 2CDOA 1DP0A 3AKFA 4XURA 3CDZB 2Y64A 2V5DA 4AK5A 4QAWA 4CUCA 5JXGA 4BDVB 3SC7X 2Y6JA 2OXBA 3EB7A 4QPWA 5JOXA 2QQWA 4DXTA 2J7MA 2YB7A 3QEFA 4O8NA 2VZQA 2J1TA 2Z4FA 4BXSV 3OBAA 5B6TA 3IDAA 2QQIA 4TTGA 3VDCA 1UXXX 4JKKA 4UDIA 2XQRA 2XQXA 3HNBM 3VSRA 3QZ4A 3VDBA 3SEEA 3E1F1 5ANNA 3HEIA 4QX1A 1GYHA 1LNSA 3J7HA 5DQ0A 4YPJA 3OM6A 5LA0A 1US2A 3AKIA 2WYSA 1K12A 5HXMA 2W9XA 3BN6A 3WATA 2QQVA 5FKCA 3I2HA 4LHSA 3LDRA 5JOYA 1W9WA 2Y6HA 4XVHA 5GLRA 1UX7A 3K1UA 2HLEA 3BYNA 2RVAA 3SKVA 3OM4A 3QC2A 4E8DA 2QQKA 4UOJA 2CDPA 3LV4A 3HNMA 4MGSA 4XUTA 2W87A 3VSSA 3FN9A 1YI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LPL A;  3LQC A;  2WZ8 A;  3CIH A;  1ST8 A;  4A45 A;  5JOZ A;  5JOW A;  4W4Z A;  1JZ3 A;  1KEX A;  4A6O A;  4UI9 L;  1JZ7 A;  3ACF A;  4KMI A;  2OKX A;  4CU6 A;  3C7O A;  3GDB A;  2W91 A;  5C71 A;  2BER A;  4CVU A;  3BGA A;  2EXI A;  4UDK A;  3PUI A;  1RYY A;  3JXS A;  3T0A A;  2X09 A;  3T09 A;  1W2T A;  3F2Z A;  1UY3 A;  1WKY A;  2Y8K A;  5IJR A;  4AK6 A;  1GQP A;  5EJZ B;  2ZEZ A;  4DXR A;  1UYZ A;  3CU9 A;  3KST A;  3ETP A;  1OF3 A;  4E8C A;  3LFI A;  4P08 A;  5AYE A;  3CZJ A;  3LE0 A;  1GU3 A;  2JDA A;  3VD5 A;  3WPV A;  3LEG A;  2WAB A;  1JU3 A;  2WDB A;  3III A;  4ARX A;  1Y7B A;  2QQU A;  3C7G A;  5AYC A;  1W9T A;  2VR4 A;  2VZ1 A;  3WNL A;  5GLP A;  1H6X A;  5EJ1 B;  4O8O A;  3AKG A;  3LIH A;  1UYP A;  1EUU A;  3QEE A;  1PX3 A;  4EQV A;  4UAP A;  2AC1 A;  2X05 A;  4KWU A;  3PUH A;  3TAW A;  3LDK A;  2JD9 A;  1SG3 A;  2YC2 A;  1PT2 A;  2ORX A;  2J1V A;  4MOA A;  1JZ8 A;  3NRU A;  4AAX A;  3RWK X;  2V4V A;  4IUG A;  1UMI A;  4DEQ A;  3WPU A;  3W5N A;  3D5Y A;  4CUA A;  1HN1 A;  1O59 A;  3A22 A;  5HPO A;  3WN1 A;  4ZY9 A;  2QQN A;  1P8J A;  2BGO A;  3HPN A;  3K4Z A;  5B4N A;  3P6B A;  3I2K A;  5FLW A;  5A7V B;  1PMJ X;  4CU8 A;  4PVA A;  1UZ0 A;  3WAU A;  3FHA A;  1OF4 A;  3KF5 A;  2WO3 A;  3WMZ A;  2XOM A;  5I0D A;  5A1A A;  4D0Q A;  5G05 L;  5JXI A;  4MLG A;  3A23 A;  2WAA A;  3C7H A;  4XUP A;  2DCK A;  3ZXL A;  4DUW A;  1UY4 A;  4JX0 A;  3C8X A;  2YFU A;  3UES A;  3HJR A;  3U37 A;  4KC7 A;  5FKB A;  1CZV A;  3DEC A;  2BGP A;  3BYL A;  4ET7 A;  3WQB A;  5FIX A;  4XUQ A;  2C4X A;  1R64 A;  3WNN A;  2V72 A;  5JXH A;  2W5F A;  4QQS A;  2E33 A;  5F7U A;  2E32 A;  2VMC A;  2WN2 A;  2VZS A;  4A4A A;  2BZD A;  4PVI A;  5IHR A;  3LEM A;  3LPF A;  4RYD A;  3WN2 A;  5JUV A;  3QED A;  2W95 A;  1CX1 A;  3I2I A;  3CZU A;  4AG4 A;  1UMH A;  2HYX A;  1OD3 A;  2E26 A;  1MPX A;  1JZ4 A;  3VT2 A;  4TXW A;  1GOH A;  4QX3 A;  2Y6L A;  2XHN A;  2WQ8 A;  4M4P A;  1TVG A;  4N1I A;  4BJ0 A;  3I3B A;  2ORZ A;  3VD7 A;  2C26 A;  3WN0 A;  1OYG A;  2L9L A;  1GUI A;  2J22 A;  3P2N A;  3DYO A;  2WO2 A;  3SEP A;  4QB6 A;  1K42 A;  3VD3 A;  1ULO A;  1UY1 A;  5LA1 A;  3A7Q A;  1XNA A;  3IAQ A;  2B4W A;  1UXZ A;  2WAO A;  3ACH A;  1XPW A;  4PF1 A;  3LEI A;  3T0B A;  3U75 A;  2EXJ A;  4N4B A;  1JYN A;  3K77 A;  2W94 A;  2W3J A;  2VZO A;  2W92 A;  3ZXK A;  2VM9 A;  2VZP A;  4GZ9 A;  3WF0 A;  3ZXJ A;  1CZS A;  1K3I A;  1H6Y A;  3UET A;  1DLC A;  2KD7 A;  3CQO A;  5GLO A;  3P1I A;  2VL4 A;  1BHG A;  2VMF A;  1O8S A;  2VZU A;  3VD9 A;  3LIG A;  4PQQ A;  2JE8 A;  2B9V A;  1I5P A;  1JU4 A;  2YFZ A;  1JYX A;  3OM2 A;  4FFF A;  4A41 A;  3ACG A;  5CYY A;  3VD4 A;  1JYV A;  3NJX A;  1JZ2 A;  4ARY A;  3OB8 A;  3THC A;  4ZZ8 A;  2ZEY A;  5FMC A;  5FMD A;  5LCW L;  2ZXQ A;  3OG2 A;  3OEB A;  4GWJ A;  3UGH A;  2VZR A;  2YFR A;  5A7V A;  3T08 A;  3U14 A;  4DUX A;  3ZM8 A;  4DEV A;  1J83 A;  2QQO A;  2J1S A;  2ADD A;  5A8C A;  4AK7 A;  5DMY A;  4JHZ A;  3WF1 A;  1Y9M A;  4M4R A;  2WO1 A;  3D60 A;  3VDA A;  3R4Y A;  3OEA A;  1Y9G A;  1GNY A;  5G04 L;  4COT A;  4D47 A;  3AC0 A;  3I2F A;  4FFG A;  3VSF A;  3ABZ A;  1SDD B;  3WMY A;  3DYP A;  3C2U A;  1WCQ A;  3D3A A;  4LKS A;  4CU9 A;  2VZ3 A;  2W1U A;  3UGF A;  4BK5 A;  4Z2A A;  5A8D A;  2J1R A;  3MBW A;  4QB2 A;  4QB1 A;  2ADE A;  4LQR A;  2QBX A;  3WAS A;  1L7Q A;  2VME A;  3WF3 A;  3D5Z A;  5JXJ A;  2W46 A;  2X8T A;  5J1X A;  4UDG A;  3NJV A;  5LA2 A;  3WF4 A;  2LW8 A;  3I2J A;  3WNM A;  5FK7 A;  2ID4 A;  5JMO A;  3PIG A;  3K4A A;  2DDU A;  1JI6 A;  1ULP A;  1W8O A;  3GGL A;  2EID A;  3NQH A;  2QQL A;  4MGQ A;  1WL7 A;  2VZV A;  3ACI A;  4FFI A;  4U6B A;  5CZK A;  4FFH A;  3K75 B;  3PIJ A;  4P5Y A;  2X8F A;  4ONZ A;  1UV4 A;  3VSZ A;  2VCB A;  4CU7 A;  2EIC A;  1JZ6 A;  2WZE A;  1O8P A;  5C70 A;  3D61 A;  1SHW B;  3CKH A;  2J1A A;  3BYJ A;  3LPG A;  2XON A;  2VCC A;  1GYE B;  4JKL A;  4RN5 A;  2YFS A;  1W8N A;  3WNK A;  4JKM A;  1GMM A;  3MUY 1;  4L0P A;  4QDS A;  1NAE A;  1CZT A;  3GXU A;  1UYY A;  4KI5 M;  3K4D A;  1JYW A;  5DPN A;  4U6D A;  3EYP A;  4XZU G;  2AEZ A;  1CIY A;  1D7P M;  2QQM A;  1PMH X;  4D8M A;  1NKG A;  2W47 A;  3FL7 A;  4QDR A;  3VT1 A;  1Y4W A;  3WF2 A;  4W8J A;  2EIE A;  3WNO A;  3K46 A;  4P00 B;  4A42 A;  1GYD B;  1W18 A;  2W1S A;  4P02 B;  1YIF A;  2VTF A;  3W5M A;  2LS6 A;  5B4X A;  3HNY M;  3T2O A;  4KC8 A;  4DXS A;  1GOG A;  4UDJ A;  4O8P A;  4NOV A;  4DUV A;  1F4A A;  2J1U A;  5EIY B;  1XNT A;  2Y6K A;  4MAD A;  4A44 A;  3R67 A;  2DCJ A;  5GLQ A;  5B6S A;  3LEK A;  3I97 A;  4XUO A;  4OMD A;  4MO3 M;  1W99 A;  1JHJ A;  2J1E A;  1OH4 A;  2WN3 A;  5DN2 A;  1OT5 A;  1XC6 A;  3A21 A;  4KCA A;  2VJX A;  3WSO A;  1IQD C;  4OYU A;  5FMB A;  3C7F A;  3MV1 1;  4XUN A;  4OMC A;  5FK8 A;  1K45 A;  4W50 A;  2W1W A;  1YRZ A;  3WEZ A;  3GM8 A;  2YG0 A;  2EXK A;  2WBK A;  1F4H A;  1JZ5 A;  3I3E A;  5JR2 A;  3OGR A;  2E31 A;  3I2G A;  3THD A;  3WNP A;  2R7E B;  5IFP A;  1UY2 A;  2X8S A;  4QDQ A;  2VDT A;  1TG7 A;  1US3 A;  3C7E A;  3FHQ A;  4OUE A;  3T2Q A;  3OGV A;  2B4K A;  3MUZ 1;  2EIB A;  3LF7 A;  3R4Z A;  4GWI A;  1KGY A;  5GLN A;  2VCA A;  1VKD A;  1PX4 A;  1UYX A;  3AKH A;  2EXH A;  2YC4 A;  2YFT A;  3ECQ A;  2VO5 A;  1UWW A;  2VZT A;  3NNG A;  2JKX A;  1T2X A;  3OGS A;  1W0N A;  2WUH A;  3SKJ E;  2C9K A;  3OM7 A;  2RJ2 A;  3IAP A;  1L7R A;  4FI9 A;  2ZEW A;  4A3Z A;  1DYO A;  4CUB A;  2W1Q A;  3MV0 1;  2AEY A;  2VC9 A;  5C0P A;  3WPZ A;  2VQU A;  4QX2 A;  4ZZ5 A;  2VQT A;  4ZXE A;  2RV9 A;  3WPY A;  3T2P A;  1UY0 A;  4N2R A;  5AYD A;  2QQJ A;  3I3D A;  1YQ2 A;  3KF3 A;  2Y6G A;  4KMQ A;  3CMG A;  3MO4 A;  3BYK A;  4UDK E;  2BBA A;  1NX9 A;  3UNP A;  3VT0 A;  3OM5 A;  2ZEX A;  2X10 A;  5GLK A;  4N2Z A;  3DYM A;  3HOB A;  5GLL A;  3IB3 A;  1J84 A;  1NUK A;  3T0D A;  3UGG A;  4KCB A;  5FUI A;  1EUT A;  2PQS A;  4OZO A;  4QX0 A;  5AY9 A;  2VMD A;  5IYY A;  5IFT A;  4BK4 A;  5GLM A;  5C7G A;  1W9S A;  4HG6 B;  2VOT A;  3HN3 A;  4PT6 A;  1GOF A;  2CDO A;  1DP0 A;  3AKF A;  4XUR A;  3CDZ B;  2Y64 A;  2V5D A;  4AK5 A;  4QAW A;  4CUC A;  5JXG A;  4BDV B;  3SC7 X;  2Y6J A;  2OXB A;  3EB7 A;  4QPW A;  5JOX A;  2QQW A;  4DXT A;  2J7M A;  2YB7 A;  3QEF A;  4O8N A;  2VZQ A;  2J1T A;  2Z4F A;  4BXS V;  3OBA A;  5B6T A;  3IDA A;  2QQI A;  4TTG A;  3VDC A;  1UXX X;  4JKK A;  4UDI A;  2XQR A;  2XQX A;  3HNB M;  3VSR A;  3QZ4 A;  3VDB A;  3SEE A;  3E1F 1;  5ANN A;  3HEI A;  4QX1 A;  1GYH A;  1LNS A;  3J7H A;  5DQ0 A;  4YPJ A;  3OM6 A;  5LA0 A;  1US2 A;  3AKI A;  2WYS A;  1K12 A;  5HXM A;  2W9X A;  3BN6 A;  3WAT A;  2QQV A;  5FKC A;  3I2H A;  4LHS A;  3LDR A;  5JOY A;  1W9W A;  2Y6H A;  4XVH A;  5GLR A;  1UX7 A;  3K1U A;  2HLE A;  3BYN A;  2RVA A;  3SKV A;  3OM4 A;  3QC2 A;  4E8D A;  2QQK A;  4UOJ A;  2CDP A;  3LV4 A;  3HNM A;  4MGS A;  4XUT A;  2W87 A;  3VSS A;  3FN9 A;  1YI7 A; 
#chains in the Genus database with same CATH topology
 1PVC 3;  4K20 A;  4XTM A;  5FY1 A;  2XBO 3;  4IV3 B;  4ZU5 A;  4CDQ B;  4N43 B;  1PO1 3;  1QXJ A;  3ILR A;  4QPG B;  5JOW A;  3H8R A;  1O91 A;  2ZX4 A;  2YZ4 A;  4WM7 C;  2RDS A;  2PMW B;  4JTN A;  5FYV A;  1JZ7 A;  3ACF A;  3FFQ A;  4S2F A;  5FPZ A;  2OKX A;  3GDB A;  2W91 A;  4IEW A;  4NRO A;  5C2M A;  4IGP A;  1W6P B;  1IHM A;  3PUI A;  1RYY A;  3JXS A;  3AKQ A;  4GWN A;  5CNA A;  1UOG A;  4IEP A;  4Q4W 3;  4Q0U A;  4SLI A;  1W2N A;  4BIO A;  4BU2 A;  1UY3 A;  3PUS A;  5FZ7 A;  4IET A;  2Q4S A;  2I74 A;  1ZRF A;  1GR3 A;  1MS4 A;  5EJZ B;  1BCX A;  1ND3 C;  1UYZ A;  5A80 A;  1SDW A;  2ZMN A;  1G9D A;  4Y24 A;  1HRV 2;  3LFI A;  1QJY 3;  5E16 A;  2RDQ A;  3LE0 A;  1LED A;  3GYD A;  3ILN A;  1C3H A;  3MDP A;  3CJI C;  4MX3 A;  5C8C A;  1ASJ 2;  1F35 A;  3E5X A;  3WPV A;  2WNV A;  3LDB A;  1PGS A;  2IWG B;  4N53 A;  1U5Z A;  4QKD A;  4NIG A;  1JTZ X;  1S4C A;  1TMF 2;  1LES A;  2WS9 3;  4KBB A;  3CJI B;  5J36 A;  2VQA A;  3AZZ A;  1Q43 A;  3C7G A;  1W9T A;  2VR4 A;  1C5I A;  4Q4Y 3;  3WNL A;  3ZYG A;  4YAR A;  1RUO A;  1BMV 2;  2D3S A;  1QNY A;  5CFD B;  5GLP A;  1LGB A;  1RUJ 3;  2WRA A;  4NHX A;  4JGY A;  3RI8 A;  4AYU A;  4RGK A;  4R9D A;  1V6O A;  1DGL A;  4IND A;  3NNM A;  4LOT A;  1PVC 2;  4KWU A;  1A78 A;  1GZ9 A;  4LBQ A;  1PT2 A;  1V6N A;  2YGL A;  1UOF A;  1W04 A;  3RZZ A;  2ZA9 A;  3VBO A;  3KVA A;  4NOT A;  4IUG A;  1UMI A;  2WSV A;  4XFC A;  2R49 A;  5D8A C;  1OA2 A;  2CWS A;  5T55 A;  3W5N A;  5F8P A;  3S30 A;  3VBF A;  3D5Y A;  2FMD A;  5EZW A;  4M00 A;  3WIN E;  4CCM A;  3NO8 A;  1C4R A;  3HT2 A;  4IV1 C;  4G3Y C;  5D8A B;  2QQN A;  4MHR A;  4XCA A;  1FMD 1;  1HDK A;  3HPN A;  1YCI A;  2E53 A;  4NWV A;  4XC9 A;  3K4Z A;  4JDN A;  1RMU 2;  2CY6 A;  2IXH A;  4IV1 B;  4ZS3 A;  1PMJ X;  1DIW A;  4QT6 A;  4FTB A;  3NV4 A;  4CU8 A;  1F9K A;  3I4I A;  3WAU A;  3FHA A;  3KF5 A;  5C3S A;  3H0O A;  2C0Z A;  5I0D A;  1YYN A;  3KHB A;  3FC0 A;  5G05 L;  4NPR A;  1RUI 1;  1ZX5 A;  3SH4 A;  2BOJ A;  1RVF 3;  2ZGL A;  3CF6 E;  2VXR A;  4HOO A;  5FCC A;  5I91 A;  2BWC A;  5I0U A;  2HWD 2;  2WS9 2;  2WAA A;  3C7H A;  4XUP A;  2DCK A;  3IDE A;  2D7F A;  4Y5Z 0;  2E51 A;  4JX0 A;  4MV2 A;  4AGV A;  5FP7 A;  4DPN A;  4KG8 A;  4OZX A;  4NAM A;  3AL5 A;  4Q4Y 2;  2VMI A;  3DEC A;  1RUJ 2;  2MEV 1;  5FPB A;  2C4X A;  1L7L A;  4FTS A;  2OYZ A;  1VBC 1;  4HT1 T;  5LA9 A;  4W6Y A;  4KH9 A;  5FUN A;  2V72 A;  5HCF A;  3EQE A;  5IWF A;  1SEF A;  2B9U A;  4IE6 A;  4CDX B;  3ZDV A;  4TLF A;  2BZD A;  2ZGM A;  1JN2 P;  4YZ5 A;  5F3C A;  4PVI A;  4CDQ A;  4N43 A;  3BU0 A;  1ALY A;  4QPG A;  2C5D A;  5FBJ A;  4Q27 A;  3AX4 A;  1OA4 A;  4U2A A;  1UZY A;  2OUJ A;  1AR9 1;  3O1R A;  4CEY B;  4K7J A;  5F9T A;  3W21 A;  4DFS A;  4XDQ A;  2LRP A;  1LEM A;  2I45 A;  3FJS A;  3I2I A;  4YFZ A;  3BOP A;  1RUD 3;  2JDY A;  3POG A;  1OD3 A;  2AR6 A;  1MPX A;  3PUR A;  4WM7 A;  4Y3O A;  2ZKL A;  1W6O B;  1ULF A;  1BKZ A;  3M8L A;  1HB3 A;  3M3C A;  5F2W A;  2NYY A;  4AVC A;  2A70 A;  3MI8 A;  4QX3 A;  2Y6L A;  1GKB A;  5DZG A;  5GM0 A;  4M4P A;  4GJY A;  3VZN A;  4N1I A;  3H1W A;  1JH5 A;  5DZE A;  4S2G A;  4YGC A;  2P17 A;  1RVF 2;  4QD2 A;  3MF9 A;  4TLG A;  5L7O C;  1OYG A;  2J22 A;  1ND3 A;  1DZR A;  2VUA A;  3GHM A;  2AGS A;  2WO2 A;  2XKO A;  4LXL A;  4R9A A;  5T3N A;  1K42 A;  3VD3 A;  2HBT A;  1PO2 3;  4FQZ A;  1ULO A;  3GZA A;  3MW3 A;  3ZR5 A;  5L7O B;  2DUP A;  2GZW A;  4XHB A;  3IAQ A;  4OHZ A;  1WUV A;  4WM8 A;  2YU1 A;  3CJI A;  1VIW B;  2DTW A;  1OOP C;  4J6G A;  1REE A;  3ZYJ B;  1YHF A;  3U75 A;  1S0C A;  2FDJ A;  3KCY A;  5IK4 A;  3LGR A;  2RM2 1;  3POE A;  5FZK A;  4CP2 A;  1JYN A;  5ANQ A;  1JHN A;  3DUI A;  3WY6 A;  4H7M A;  5LZ6 A;  3ZXK A;  1W39 A;  2VM9 A;  5FY9 A;  4Y33 A;  1OOP B;  2WZR 1;  1CZS A;  4Q4V 2;  3JD7 3;  1H6Y A;  3UET A;  3AVR A;  2KD7 A;  4K1Y A;  1XYO A;  1ULC A;  4NRQ A;  3TBD A;  3GAL A;  4DIN B;  2AEN A;  3Q8E A;  1CON A;  2JDP A;  5HV0 A;  5L9R A;  1LUL A;  4XOG A;  4P9X A;  1UL9 A;  1DF0 A;  1RUC 1;  1UKG A;  2VXJ A;  2WT2 A;  2C24 A;  4JQT A;  1CPM A;  1JU4 A;  5M0T A;  3WG2 A;  1JYX A;  1ENQ A;  1NLR A;  1RUD 2;  3OM2 A;  4E2Q A;  3LA2 A;  2ARX A;  5D8A A;  5BNN C;  1JYV A;  1JUH A;  4IGQ A;  1H4H A;  4YW3 A;  1JZ2 A;  2WR9 A;  4ARY A;  3ZN6 A;  3AM2 A;  2WYF A;  5FMC A;  5FMD A;  3OG2 A;  1VR3 A;  3R6S A;  4IV1 A;  1QGL A;  1ZRI A;  4E4Z A;  4JCK A;  5BNN B;  2WC2 A;  3T08 A;  2AAC A;  2OVU A;  1DQ5 A;  2J1S A;  5A8C A;  2PN5 A;  3PNA A;  3WF1 A;  1Y9M A;  3H7Y A;  4YM1 A;  4ZKT B;  4LLO A;  4M4R A;  2WO1 A;  1HX6 A;  4MGK E;  5ACA 2;  1QNW A;  5IK7 A;  3LZZ A;  1GQH A;  1QKQ A;  1Y9G A;  2WA4 A;  1MS8 A;  4D47 A;  4IDZ A;  4YW5 A;  2HJI A;  2MNG A;  2P3J A;  2VUL A;  4BQ5 A;  4QKN A;  3H8X A;  3ABZ A;  1SDD B;  2HWF 3;  1CR7 A;  4OUM A;  3OTF A;  2XLF A;  3DYP A;  3QD6 A;  2ZHN A;  3ZN4 A;  1WCQ A;  1VBA 3;  2BGC A;  5T5L A;  1LOG A;  2ARA A;  2Z5W A;  5FXV A;  3N9L A;  4COV A;  4ATE A;  1PZ8 A;  2FBE A;  4HSL A;  2ADE A;  3SCF A;  4MYE A;  4UFK A;  5JXJ A;  4TSV A;  3RYP A;  1KIT A;  2W46 A;  4AHX A;  3ZSJ A;  5J1X A;  1RXG A;  3BPS A;  5H9P A;  5JMO A;  2D3P A;  1W2O A;  3ZSM A;  2ZBJ A;  4AQT A;  3NQH A;  4JAA A;  2A75 A;  1WL7 A;  4A6S A;  3PJQ A;  2MEV 3;  2WJS A;  3PUA A;  2XDV A;  2ZGT A;  5LEK A;  3QH7 A;  3K75 B;  1BYH A;  1W8F A;  3PIJ A;  1S55 A;  2Z2S B;  1UV4 A;  2VCB A;  2ZX3 A;  4GMP 0;  1VJ2 A;  2XJP A;  2O14 A;  1BEV 3;  1KS5 A;  5FBZ A;  4QX7 A;  2B46 X;  1U12 A;  2X29 A;  4WZF A;  4QPI C;  4Y1V A;  3VKF C;  4C8D A;  1Q8P A;  3NAP B;  3UV9 A;  2WNE A;  2R06 2;  5C70 A;  3D61 A;  1APN A;  2G9Z A;  4QM8 A;  4WVZ A;  3OCP A;  2N7G A;  3R4S A;  1DQ4 A;  2BDR A;  4DO0 A;  1MZF A;  4BH9 A;  2VTX A;  1ZBA 1;  4XF9 A;  2CSG A;  1DQ1 A;  2JG9 B;  3N7K A;  2SBA A;  1S0B A;  3FZ3 A;  3MUY 1;  4L0P A;  4P9W A;  4PCR A;  3TNP B;  5C3P A;  1GSL A;  5L7O A;  5FZM A;  1S2B A;  1SQ4 A;  2HWF 2;  4KI5 M;  4O9E A;  5IAX A;  2VUC A;  3AP4 A;  1JMU B;  5JIA A;  3ZYF A;  1VBA 2;  3MW4 A;  4RA0 A;  3TOJ A;  1CIY A;  1KRI A;  2FHR A;  4UFM A;  4XJU A;  2QQM A;  1TL2 A;  3ZPO A;  2R04 3;  4D8M A;  2OQ6 A;  3VKM A;  5JPM B;  4AK3 A;  4YZ4 A;  2R6Q A;  2P1B A;  3M1H A;  3E97 A;  4LBK A;  4R4X A;  1WGP A;  3WNO A;  5IVF A;  1UIJ A;  1WMD A;  1W18 A;  1HQL A;  3LA3 A;  2H0B A;  2VTF A;  4HBN A;  3W5M A;  2LS6 A;  1AR8 2;  5ABJ C;  3M3Q A;  3T2O A;  1O4T A;  2A5Z A;  4PBP A;  4XEZ A;  4O8P A;  3PTR B;  1CAX A;  2EAL A;  2FDG A;  1H2N A;  1W0O A;  2J1U A;  3APB A;  4NOV A;  4LBL A;  2PXJ A;  2Y6K A;  4AQ6 A;  4AWD A;  1OSG A;  2PAK A;  3U4S A;  5CEH A;  1BEV 2;  2VH9 A;  3LEK A;  1PGL 2;  2W0X A;  4XUO A;  2GP5 A;  4DZG A;  3E5Q A;  5F37 A;  3HAG A;  4AED C;  3B5L B;  4UFI A;  2WN3 A;  4XCB A;  1ENR A;  1XC6 A;  3A0N A;  2X53 S;  4O65 A;  5A3U A;  4KCA A;  1EAH 2;  4YZ3 A;  5EYY A;  3AMH A;  5BNN A;  4DB5 A;  4NHM A;  3NW4 A;  3GBF A;  3AMP A;  5JR7 B;  2PHD A;  4OMC A;  5CFC C;  1FPN 1;  3I59 A;  1WLC A;  2W1W A;  1YRZ A;  3WEZ A;  3GM8 A;  4AVB A;  4Q0S A;  3VKL A;  3FE5 A;  1S2E A;  5C5U A;  1CD3 G;  1NZC A;  1S2K A;  5DG2 A;  5FZI A;  5CFC B;  2XB6 C;  5T5O A;  1M06 G;  3OGR A;  4GUL A;  5JAX A;  3ZXG A;  4LO5 B;  3KHC A;  4YVS C;  4C0B A;  3ZYH A;  5D1I A;  2JIG A;  4ZS2 A;  1S0D A;  1VBB 3;  3FHI B;  2ZZJ A;  1U5Y A;  3T2Q A;  3OGV A;  3MUZ 1;  2DVA A;  2LTN A;  3OBT A;  4FBF A;  5J09 A;  2J42 A;  3VZK A;  4RSU A;  1KGY A;  1W8H A;  4LLF A;  5LY2 A;  5GLN A;  2VCA A;  4Q0Q A;  1PK6 B;  4ORF A;  3GBG A;  1REF A;  1UWW A;  2GC0 A;  2VZT A;  3OUJ A;  2XWJ B;  3ZFF C;  3G6J B;  1X8M A;  1WW5 A;  1DDL A;  4WZC A;  5CKQ A;  1OH3 A;  5FO9 B;  3KV6 A;  4NN0 A;  4OQ9 A;  2WUH A;  3IZO A;  3SKJ E;  3U78 A;  3OM7 A;  1LOD A;  3S6P A;  3ZFF B;  5IK8 A;  5A3W A;  1CX4 A;  2UWC A;  2W1Q A;  2AEY A;  3ZXE A;  3VL8 A;  1AR7 1;  4ZZ5 A;  1OPO A;  1AR6 1;  1V00 A;  3PVB B;  2WT1 A;  3AL6 A;  3MZH A;  3UL2 A;  3T2P A;  1HXS 1;  2YU2 A;  3E5U A;  2BVB A;  4AFA A;  2DU0 A;  3OPT A;  4QPI A;  3LOB A;  3ZX7 A;  1AHS A;  5FO7 B;  3MO4 A;  5FP4 A;  3BYK A;  2BBA A;  2PAE A;  1W8Z A;  1HV1 A;  4RS5 B;  4YW1 A;  1RUH 1;  4BIS A;  4P9Y A;  3OBZ A;  2QZ3 A;  2X10 A;  4AI2 A;  3DYM A;  3HOB A;  3VHR A;  1BJQ A;  3NNF A;  3J8F 3;  5A3N A;  2RS3 2;  1VBB 2;  2G9G A;  5K4L A;  5J48 A;  1G8W A;  1NUK A;  4CEW C;  3T0D A;  3RGB A;  4LJH A;  1FV3 A;  1I1E A;  3ZVX A;  1EUT A;  1PZ9 A;  1W9Y A;  4WV8 A;  1X82 A;  2VMD A;  1R1A 2;  4XIL A;  3WLU A;  4B7E A;  3BCW A;  4YW4 A;  4CEW B;  4RGG A;  1Q8O A;  1W9S A;  1LTE A;  3HN3 A;  1OA3 A;  5KBF A;  1V6J A;  5LBC A;  4YM0 A;  5CKM A;  3VDD C;  3WHT A;  1FOD 1;  1RUG 3;  3RDI A;  4AK5 A;  5JXG A;  1YWK A;  1XU2 A;  4E4H A;  3POJ A;  4XFA A;  4QPW A;  1VMF A;  4UW5 A;  5ABJ A;  1J58 A;  4A7K A;  2WIN B;  4YG3 A;  4AEM A;  4DXT A;  1JYT A;  3USU B;  2VZQ A;  5LBB A;  4BXS V;  3R0R A;  1WCS A;  1RED A;  4PI2 A;  1RL3 A;  4F7Z A;  5IAT A;  2GNM A;  4JKK A;  5FOJ B;  2XQR A;  1SLB A;  3V64 A;  2DV9 A;  1BBT 3;  1ZRD A;  3MHZ A;  5FDB A;  4ASL A;  4XFB A;  3KB5 A;  4JRA A;  2VNR A;  4AED A;  1N1T A;  2HWE 1;  5KHH A;  2NZ9 A;  3VGI A;  1LEN A;  1DGR N;  4KWL A;  4ZU7 A;  3PLQ A;  1WW7 A;  4V1P A;  4CP1 A;  3AP5 A;  4OHV A;  1ZZ7 A;  2A7A A;  5CFC A;  3CO2 A;  3WDW A;  1NXD 1;  4Y5S A;  5DQ0 A;  1AL2 1;  1W6N A;  1SBD A;  5GZE A;  2X5I B;  1GLH A;  3DN7 A;  1MR5 A;  3M70 A;  3WT3 A;  2I07 B;  1ZBE 3;  3BN6 A;  3WAT A;  2QQV A;  1W06 A;  4DNY A;  2PHW A;  4DXZ A;  1KD7 A;  5JIU A;  4YVS A;  1ZZ8 A;  4EZ4 A;  4I02 A;  1BK1 A;  5A7Q A;  1UX7 A;  3KT1 A;  3T4V A;  1COV 3;  4QGL A;  4XJ9 A;  1RUG 2;  3ZFE C;  1ASJ 1;  1GYK A;  1XXN A;  2WWU A;  4CP9 B;  4RFR B;  1YQC A;  1DQ6 A;  2VU9 A;  2D3R A;  5DUV A;  2W87 A;  5FZD A;  2UY8 A;  3U0Z A;  1TMF 1;  3WUC A;  5AC9 1;  3FN9 A;  5E8A A;  1Z78 A;  3ZFE B;  1C57 A;  4LPL A;  3V0B B;  3J7L A;  5JI9 A;  1HRI 2;  2XL9 A;  3M2M A;  3ZN5 A;  1ST8 A;  3ZFF A;  4XE9 A;  3RZG A;  4UI9 L;  5E1R A;  3NWK A;  1BBT 2;  3N7J A;  5JSR A;  2O0O A;  4CU6 A;  3C7O A;  4XAA A;  1PVC 1;  2ZHL A;  4LK7 A;  1A8M A;  3MLL A;  1KXG A;  1Q8V A;  1W8U A;  2XBO 1;  3BGA A;  2XML A;  4LIU A;  1G7Y A;  2DVG A;  1PO1 1;  2X09 A;  3RMY A;  3JB4 C;  4B1M A;  1W2T A;  3T09 A;  5CAZ A;  1WKY A;  2Y8K A;  1YUD A;  2D6P A;  1Y9Q A;  4XFF A;  5FMO S;  3ZDS A;  5A3T A;  2ZEZ A;  3IDB B;  5BNO C;  4NID A;  1IPJ A;  3ETP A;  3Q9O A;  3RZM A;  3DXU A;  2EA7 A;  2YBP A;  3IMM A;  1NG0 A;  4P08 A;  4Q4W 1;  2ET7 A;  5F5A A;  3TNQ A;  3ST7 A;  4AZZ A;  3DGT A;  1GU3 A;  2JDA A;  5A6Q A;  1ZBE 2;  1UF2 C;  2B8M A;  4FQ4 A;  5HCH A;  3IMN A;  4I30 A;  1DGW X;  1F2N A;  4COU A;  5CG9 A;  1QJY 1;  1QJZ A;  3I7D A;  3LSE A;  1JU3 A;  2QKD A;  3B3Q E;  3B00 A;  3NJZ A;  4AEK A;  3ACL A;  4D69 A;  4ARX A;  1VB2 A;  4P9J A;  1COV 2;  4QX5 A;  4CEW A;  2DVF A;  5FXZ A;  1WW6 A;  5EJ1 B;  1IG3 A;  2K46 A;  3Q8A A;  3LIH A;  5FQ0 A;  2HWD 1;  1EUU A;  5FYB A;  2WS9 1;  2WQ4 A;  1NYW A;  2JJ6 A;  1O4Z A;  4YG6 A;  2Y33 A;  3QEE A;  4AAP A;  4GQ7 A;  4Y1Y A;  2Q1Z B;  3D8C A;  1VRB A;  1ZZC A;  4Q2F A;  3PVN A;  4FPO B;  1H1I A;  2JD9 A;  3QAC A;  4Q4Y 1;  4BWO A;  1LHU A;  3B9C A;  3W20 A;  1SG3 A;  3ETQ A;  1RUJ 1;  3VDD A;  1JOJ A;  2ORX A;  3ES1 A;  5T54 A;  2ENR A;  3USU A;  1HJG A;  4Q8L A;  5FYC A;  4AAX A;  5J7M A;  1QH7 A;  1NCR C;  1JZ8 A;  1G6N A;  4AVT A;  4Q5O A;  1NQJ A;  3GHN A;  4C91 A;  3WPU A;  1C5H A;  2VOV A;  3UYJ A;  5C8C B;  3AB0 A;  1O5L A;  3A22 A;  5GLZ A;  5L73 A;  5KHK A;  1NCR B;  1R08 2;  4DS0 A;  3M3E A;  2VOW A;  4NRP A;  5EXO A;  4LMF A;  3ZMO A;  5FFO C;  1P8J A;  4P9I A;  1DYP A;  1QXP A;  4I2O A;  1X7N A;  1WD4 A;  1HV0 A;  5BYN A;  1D2S A;  1W3V A;  2XJU A;  1UZ0 A;  2JWP A;  4JGY B;  4JRL A;  3WD5 A;  1WCU A;  4YZ1 A;  3JZV A;  3K3O A;  5JXI A;  5K7P A;  1W6Q A;  3A23 A;  2UWB A;  3LOI A;  2XH6 A;  3RZH A;  1C8N A;  3MIB A;  3AVS A;  5LY1 A;  4NUB A;  5LBF A;  3ZXL A;  3C8X A;  3VBO B;  1PM7 A;  4KC7 A;  4MXW A;  3GZT B;  3P3N A;  4IE7 A;  2PHU A;  4Q4X 3;  1RVF 1;  1R09 2;  4ET7 A;  3ZKU A;  5FIX A;  4H55 A;  1YFY A;  1XU1 A;  3OUH A;  1WW4 A;  1WCD J;  4XJW A;  2V4A A;  5HV4 A;  1LHW A;  3WNN A;  5BV6 A;  1W28 A;  2BFU S;  5F7U A;  2B39 A;  2ZGP A;  3D6E A;  2DWR A;  2K9Z A;  3ZO0 B;  3S7I A;  3ZFE A;  3V0B A;  4Q29 A;  4CXY A;  4NAO A;  5FY4 A;  5APA A;  5F5I A;  1CES A;  3VZO A;  3LPF A;  1HRV 3;  1LJ7 A;  4FP2 A;  4RYD A;  3WN2 A;  2O8Q A;  4FAG A;  1CX1 A;  1LHO A;  1DLL A;  4K8R B;  4S2H A;  1GZC A;  4LHK A;  5BXX A;  3CZU A;  4AG4 A;  1ASJ 3;  3VHN A;  1GWL A;  2QUO A;  1W8T A;  2GH8 A;  4O7X A;  4LBO A;  3VT2 A;  3WW2 A;  2XHN A;  5FZ0 A;  3N9M A;  1BZW A;  4Q0V A;  3ORJ A;  4UXA A;  4Z2W A;  1RUD 1;  2HWC 2;  1Q8S A;  5FZL A;  1ZA7 A;  2ORZ A;  3SQO A;  2C26 A;  4Q26 A;  2VQ0 A;  5DG1 A;  2H0V A;  4XAC A;  5J96 B;  1GUI A;  4NHL A;  5BNO A;  3SEP A;  2CAU A;  1ZNP A;  3AYC A;  4FVV A;  3UJO A;  4XXP A;  2YUE A;  2R30 A;  1V70 A;  3RS6 A;  4RR3 A;  4Q4X 2;  1XNA A;  1CIW A;  4FXG B;  4IW3 A;  1UZW A;  2ZS6 B;  4FPJ A;  4XMI A;  3I3M A;  3ACH A;  1NXM A;  4COZ A;  3OOX A;  2A3X A;  4YFW A;  2RS5 3;  3E6B A;  1XSR A;  1PO2 1;  4AVA A;  1IKQ A;  2Y0O A;  4Y1U A;  1CN1 A;  5ACA 1;  2JDN A;  2QE3 A;  3DPR A;  3MPP G;  4WM7 B;  4XJZ A;  1MZ6 A;  4K9S A;  1AYM 2;  2VZP A;  4NE9 A;  4YRD A;  4AFD A;  1GP4 A;  1K3I A;  2IZW A;  3BTA A;  1QQP 2;  4K3U A;  5I0S A;  2W52 A;  2XVL A;  5GLO A;  2YBS A;  3KQR A;  1PMI A;  3VKN A;  3JB8 A;  4MGY E;  2XJQ A;  2DYC A;  1E5I A;  1RMU 3;  2VMF A;  3WP5 A;  3LIG A;  4CYD A;  3VD9 A;  4E4S A;  3BUC A;  1I5Z A;  1GAN A;  5DDJ 3;  3JD7 1;  4PQQ A;  4LE4 A;  1ND3 B;  2JE8 A;  1GZT A;  4WM8 C;  4Z1V A;  2B9V A;  2VMG A;  5CU1 A;  1Y3T A;  2V5Y A;  1NCR A;  3SH3 A;  4UW3 A;  5CYY A;  2HWD 3;  5D2A A;  5A3M A;  4LBJ A;  4FOQ A;  4WM8 B;  1FNZ A;  1IPS A;  3MW2 A;  4Z92 B;  1F8V A;  2A3Y A;  4JTO A;  2BTV C;  2R0H A;  1WME A;  4GWJ A;  5GZG A;  1XOY A;  1NY7 1;  1EP0 A;  2VZR A;  2OT7 A;  5A1F A;  4XBQ A;  5KC6 A;  3ASI A;  3FBY A;  3ZM8 A;  1QJE A;  1XSQ A;  1J83 A;  2QQO A;  4C90 A;  5DMY A;  4GKY A;  1PGW 2;  4CUG A;  3WNX A;  4BHP A;  2CAV A;  3AZV A;  3ME2 A;  5FXW A;  3R4Y A;  5FMO L;  3CU7 A;  4GWM A;  4H3W A;  1NA1 A;  4Q1R A;  2GND A;  5G04 L;  3AC0 A;  2RS5 2;  2BUK A;  3WW1 A;  4FFG A;  3VSF A;  2RDN A;  1LOE A;  3J4U H;  3WQ1 A;  3WMY A;  2R32 A;  2XLA A;  3NNJ A;  4FPK A;  3ROU A;  4IGO A;  4LA2 A;  1XYP A;  3AYE A;  3N3H A;  2WZP P;  4Z2A A;  2JEN A;  1N1V A;  2J1R A;  1X36 A;  3PHM A;  3ZN6 B;  3KV9 A;  4H7L A;  2HWF 1;  2Z69 A;  4LQR A;  4AF9 A;  3WAS A;  1GFF 2;  2BP6 A;  3WF3 A;  1VBA 1;  3D5Z A;  2GN3 A;  5DDJ 2;  1KFX L;  2PLV 3;  3I2J A;  2Y38 A;  4GAZ A;  2PHF A;  1DYK A;  4X6Q B;  5F2S A;  3PIG A;  1ACC A;  4I0W B;  3GGL A;  4E4D X;  1ENX A;  3N4M A;  2DCY A;  4MGQ A;  2VZV A;  2OZ6 A;  3ACI A;  4LUL A;  5JSP A;  4U6B A;  3O0X A;  4FFH A;  4MHU A;  3ZMN A;  1UO9 A;  1O3S A;  4ONZ A;  3PU8 A;  4COW A;  1UW8 A;  2EIC A;  2BJS A;  2XJR A;  5FLJ A;  2Y60 A;  5JVV A;  4HMZ A;  1VBD 2;  3IKW A;  4NHY A;  1SHW B;  2J1A A;  1B35 A;  1BEV 1;  2VCC A;  3TN9 3;  1RGS A;  4JKL A;  4RN5 A;  1PGL 1;  2HEW F;  4R9B A;  4DY3 A;  2YFS A;  1W8N A;  5FV3 A;  4Q4V 3;  3WNK A;  4JKM A;  4DQA A;  1XB9 A;  2B5H A;  4XW3 A;  4XQW A;  3WP4 A;  1DCS A;  3VUO A;  1NAE A;  2PHL A;  1MQT C;  5LRS A;  2BVV A;  4MH0 E;  1EAH 1;  4IEX A;  1G86 A;  3GXU A;  5C3Q A;  2D93 A;  2AUY A;  2PQQ A;  3TYJ A;  2JEC A;  3EYP A;  5BNP C;  5GAL A;  5JLV A;  3K48 A;  3ZR6 A;  4EN0 A;  1WD3 A;  5FRA A;  2W47 A;  3FL7 A;  3RQ0 A;  4AI1 A;  4QDR A;  2XHK A;  2GN7 A;  3RZJ A;  3VT1 A;  3T4H B;  1Y4W A;  4GMP 3;  3SCG A;  4XDP A;  2GDF A;  1JOB A;  4QMA A;  5BNP B;  4WVW A;  2EIE A;  2PLV 2;  5C4W C;  3RG0 A;  2R04 1;  4P02 B;  5FZG A;  1HB2 A;  4CCL A;  2NMO A;  1HB4 A;  1H8T C;  4DUV A;  1XRU A;  3POI A;  5C3R A;  2FDF A;  2YHJ A;  4MAD A;  4B7K A;  4A44 A;  2BFU L;  4UT5 A;  1NT0 A;  3TB0 A;  3R67 A;  2ZMK A;  4YW6 A;  5ACA 3;  2KM2 A;  1CAU A;  1H8T B;  1W6M B;  2WSU A;  3UJQ A;  4AVS A;  4MO3 M;  1W99 A;  1JHJ A;  4LIV A;  1OH4 A;  1OXC A;  2X8K A;  2BWA A;  1C1F A;  2GMM A;  4L11 A;  3TAY A;  4D3W A;  1X33 A;  2VJX A;  1ZM1 A;  5JCT A;  3WSO A;  3POY A;  4OYU A;  4QXC A;  3TN9 2;  5L19 A;  3V65 A;  3HQX A;  2VOK A;  2YDE A;  3HQR A;  3LA7 A;  5FK8 A;  4B1L A;  5LEJ A;  4W50 A;  1DGR A;  4CXX A;  4DRV A;  5IVE A;  4HLT A;  1UKR A;  2Q1F A;  1HJF A;  3DL3 A;  3AFG A;  1X50 A;  3MYX A;  5A3P A;  1QU0 A;  3WV6 A;  4OUL A;  3BYN A;  3JBG 3;  4F83 A;  2BRT A;  1FAY A;  5ERL A;  4YW2 A;  2XXZ A;  4AI3 A;  3I3E A;  3M3O A;  2OA2 A;  5DAP A;  1POV 0;  3VLB B;  1LAJ A;  2A1X A;  1CAX B;  1MZE A;  3I2G A;  1S0J A;  1JW6 A;  2WWJ A;  5FUP A;  5EHD A;  3WNP A;  2VG9 A;  1AYN 3;  1CWP A;  1UY2 A;  4QDQ A;  3MLK A;  3GZU C;  3DF0 A;  5FZ3 A;  2D5F A;  4OUE A;  4BOW A;  4D6R A;  2CTV A;  1SZB A;  2VCM A;  2UYA A;  2B4K A;  1MS3 A;  3FFZ A;  5SV5 A;  3R4Z A;  4GB3 3;  3PVO A;  3SNM A;  2VVF A;  4LR4 A;  1RB8 G;  4XET A;  1FI2 A;  3AKH A;  2YFT A;  1VBB 1;  2YGM A;  2LUW A;  2VO5 A;  1N1S A;  2R06 3;  3I59 B;  1XBF A;  1AUY A;  2OQ7 A;  1ODM A;  2R07 3;  3NNG A;  3AYA A;  1AF9 A;  5KXE A;  3RMX A;  4QHZ A;  2C9K A;  1AVB A;  4BB3 A;  1ULD A;  1L7R A;  1ODN A;  2VW2 A;  4FI9 A;  4YSF A;  1HB1 A;  1HLC A;  1LKN A;  3QH6 A;  1V0A A;  2Z79 A;  3K3N A;  3WPZ A;  2GSY A;  2VY0 A;  2BBV A;  2IVJ A;  3K2O A;  4QX2 A;  2ERF A;  4ZXE A;  3NST A;  1RUF 3;  2HEY F;  5IVY A;  3WPY A;  1HKD A;  4TN7 A;  3HWJ A;  4KG0 A;  4MXV A;  3HVD A;  3RJR A;  4ES9 A;  3BTX A;  1D2Q A;  3I3D A;  3RSJ A;  1YQ2 A;  2ZGN A;  4PLO A;  3VBR C;  3N9N A;  5FAX A;  5IT6 A;  2PHT A;  3EMR A;  3RPQ A;  3JBG 2;  2DTY A;  4ZU4 A;  2WFF 3;  1IZ3 A;  4CRQ A;  3UNP A;  2XKP A;  4ZON A;  2ZEX A;  3VBR B;  5GLK A;  4E9K A;  4URA A;  1AR8 3;  1AYN 2;  3LKJ A;  5J3U A;  5GLL A;  1J3R A;  4AEJ A;  3NV2 A;  1JOD A;  3B01 A;  1MQT A;  4CCC A;  2FCV A;  2GAL A;  5IAV A;  3RYK A;  3UGG A;  4KCB A;  2PQS A;  4C1X A;  3JCI A;  4GB3 2;  2VOX A;  5BNP A;  5AY9 A;  3KVB A;  3WP6 A;  4AXO A;  3J8F 1;  5IFT A;  1GBG A;  4BK4 A;  3TEX A;  2JB8 A;  1RHI 3;  1UU6 A;  1YQ8 A;  2R1B A;  4HL0 A;  4HG6 B;  4PBO A;  5K0U C;  2VOT A;  4PT6 A;  1GOF A;  4RGA A;  3O7O A;  2R07 2;  5EPA A;  2K0G A;  4PI0 A;  4XUR A;  1V9U 3;  1EAH 3;  4CDW C;  3V0A B;  4FXK B;  2VE1 A;  4QPI B;  5F5Q A;  3O1U A;  5C4W A;  2V5D A;  4TZD A;  4QAW A;  5K0U B;  3SC7 X;  2Y6J A;  3B94 A;  2F6B A;  3S57 A;  4CDW B;  4AHZ A;  4EWD A;  2J7M A;  3WDU A;  2BNM A;  1H8T A;  1W6M A;  2Z4F A;  4MZU A;  3USS A;  1RUG 1;  3BAL A;  1SCS A;  1XE8 A;  2PFW A;  1RUF 2;  3QBQ A;  5B6T A;  4XBN A;  5FYY A;  2A6Y A;  4Z8B A;  1UPS A;  1UXX X;  4C1W A;  2KA3 A;  2VVD A;  2DVB A;  4L97 A;  3PUQ A;  1I6X A;  1ZRR A;  2W68 A;  2XQX A;  5A70 A;  3WQ0 A;  3HNB M;  3KT7 A;  3QZ4 A;  1OUS A;  3OJB A;  4PJY A;  2E7T A;  3IWZ A;  1W03 A;  2WFF 2;  1PNG A;  4D7S A;  4QX1 A;  1NCQ C;  1BBT 1;  4WVV A;  1FMD 2;  1JYC A;  2FDI A;  4XF1 A;  2DVD A;  3PU3 A;  3N35 A;  2DCT A;  1UPI A;  2ZX2 A;  2RR1 3;  4CDQ C;  1US2 A;  3OPZ A;  5LA0 A;  1NCQ B;  3AKI A;  1OLQ A;  2WYS A;  5HXM A;  2W9X A;  5ABJ B;  4UBG A;  5JWP A;  4XDO A;  2WWS A;  3HMY A;  2VBB A;  2HYK A;  2VEC A;  1IPK A;  3I2H A;  3D5O A;  3P3P A;  5FPX A;  2AYH A;  5I93 A;  1RHI 2;  2IC1 A;  2VVE A;  3LDR A;  3D4K A;  5FLH A;  4BQX A;  4XVH A;  4JDM A;  5JOY A;  5DAQ A;  3N9Q A;  5ISL A;  1V9U 2;  2RVA A;  3IDC B;  1ZBE 1;  2WT0 A;  1UOB A;  3HBZ A;  4X8N A;  3SKV A;  5I0R A;  5T52 A;  3H1M A;  4E8D A;  3QC2 A;  2OUH A;  5FZF A;  2IXK A;  1O3T A;  2ZPX A;  4LO8 A;  4UOJ A;  4AED B;  4CCK A;  2VTX J;  3D82 A;  5FTT C;  3N7M A;  1YI7 A;  4HK8 A;  1TNF A;  3LQC A;  1COV 1;  3AZY A;  1NLQ A;  3CIH A;  3O1V A;  2PYT A;  4LHN A;  5EYX A;  2JDZ A;  4A45 A;  1W6N B;  4Y5T A;  4W4Z A;  3WCS A;  5JOZ A;  3WCR A;  1JZ3 A;  1MVE A;  4A6O A;  3WDT A;  4BZ4 A;  1IS3 A;  2QDR A;  4KMI A;  3N9P A;  1K5J A;  2XLG A;  5FJK A;  3ZLI A;  5C71 A;  1LOC A;  2BNN A;  2EIG A;  2EXI A;  1YJL A;  2RS3 3;  4FPL A;  4JVA A;  3T0A A;  3ZXA C;  2ZML A;  5T5J A;  1YFX A;  1AR9 2;  4YVS B;  3F2Z A;  5IJR A;  1YFW A;  1FX5 A;  2MPF A;  2PA7 A;  2EAA A;  1GQP A;  3CU9 A;  1IGO A;  1EPZ A;  1R1A 3;  1PIV 3;  1LCL A;  1OF3 A;  4E8C A;  2H6C A;  1OQD A;  2RR1 2;  3VBR A;  3CZJ A;  5AYE A;  2GC2 A;  3PJY A;  4H14 A;  5CG8 A;  2CGO A;  3J9S A;  4O9G A;  4D6S A;  3ES4 A;  1Q8Q A;  4HON A;  4EZH A;  2ARE A;  3KD4 A;  3RYR A;  3LEG A;  1Z0H A;  4AGR A;  3ZIX A;  1YLL A;  3RZK A;  1Y7B A;  3AJY A;  1W90 A;  3POF A;  5FYU A;  1W0P A;  4HVO A;  5AYC A;  4CSW A;  1VBE 3;  2GNB A;  1H6X A;  2NP0 A;  4O8O A;  3AKG A;  2F17 A;  2TBV A;  4FPH A;  4F3J A;  1A6C A;  1U5X A;  3V0A A;  5F39 A;  1EPW A;  5FJH A;  2TEP A;  4EQV A;  4UAP A;  3Q8F A;  4FAH A;  3SLI A;  1QJX 2;  1SBF A;  4KU7 A;  5K0U A;  4B4R A;  3N9O A;  3TAW A;  5DAW A;  4XHX A;  4AOC A;  1SAC A;  2YC2 A;  4PIZ A;  3WDX A;  4CDW A;  1T6B X;  4CDU A;  4CPB A;  2WZR 2;  2J1V A;  3T30 A;  2JIJ A;  1DQ2 A;  4ITC A;  1S1A A;  2V4V A;  5FYM A;  3ZOI A;  4O61 A;  1D4M 3;  2Y0I A;  1IOA A;  3VBS C;  1FT9 A;  5FYT A;  4AR2 A;  4EN7 B;  3MFA A;  3RI9 A;  1HN1 A;  1O59 A;  3WQ7 A;  1FV2 A;  1LOF C;  3WN1 A;  3ILF A;  5E6H A;  4ZY9 A;  1RUC 2;  3AFK A;  3U07 A;  1MS5 A;  4JC1 A;  4LBM A;  4M01 A;  3UKT A;  3VBS B;  2GNT A;  2BGO A;  1YC6 1;  2HEV F;  1PIV 2;  2IFW A;  1FYU A;  3R4D B;  5GZF A;  3OPW A;  3I2K A;  3ZIW A;  5KXC A;  3RJ2 X;  5FLW A;  1OFN A;  3BB6 A;  4OVE A;  5FQ0 B;  3VZL A;  2WFP A;  3WMZ A;  2BOI A;  3O1M A;  2XOM A;  1HW5 A;  2ZGQ A;  3KT4 A;  3NKT A;  4D0Q A;  5A1A A;  3ZPY A;  4GIQ A;  1NCQ A;  3N7L A;  3OGG A;  4UBH A;  2A6Z A;  5BY5 A;  3O0V A;  3CEW A;  3VDD B;  3IPV B;  3BI3 A;  4DUW A;  1UY4 A;  3J7M A;  2FD8 A;  2HH9 A;  2NLR A;  1HRI 3;  1N1Y A;  3HJR A;  3KZ4 C;  5FO8 B;  2P5B A;  1VBE 2;  1CQ9 A;  1CZV A;  1ZYB A;  3IM0 A;  4NVP A;  3BYL A;  4DMI A;  4GXL A;  1SFP A;  3U1X A;  4XUQ A;  3H8O A;  5FP3 A;  2G19 A;  3WG4 A;  1R64 A;  4EWA A;  4ATF A;  5FR3 A;  5JXH A;  1H4G A;  4Q4X 1;  4QQS A;  1XNB A;  2E32 A;  2VMC A;  3FLP A;  3U10 A;  2P3I A;  3G7D A;  5F6L B;  3TWI A;  3WG3 A;  4LUM A;  1XE7 A;  4A4A A;  3I49 A;  4V2V A;  1Z7S 2;  1D4M 2;  1VRH 2;  2ET1 A;  4BQY A;  5JZG A;  3LEM A;  4QHB A;  2IUW A;  4R52 A;  5GKA C;  4QHO A;  1OUR A;  3OSD A;  2PTM A;  3O12 A;  1W6Q B;  1AYM 1;  5JUV A;  2W95 A;  2Q30 A;  1GZW A;  3RFR A;  3LAG A;  4N90 A;  5CBL A;  3O1T A;  3Q8C A;  3AYD A;  3OGJ A;  1LU1 A;  2HYX A;  2JD4 A;  1QDC A;  2E26 A;  2ZAC A;  4MGI E;  4MXW B;  1HRV 1;  4SBV A;  1ULE A;  3WDV A;  3KWV A;  4KU8 A;  1X9P A;  3QLQ A;  3AZW A;  2BV4 A;  2CU5 A;  4JGZ C;  5IW0 A;  1GOH A;  1YQ6 A;  3THP A;  3IIA A;  4CCE A;  4BME A;  4BJ0 A;  5B2G B;  4LO7 A;  3I3B A;  5I8S A;  2DUO A;  2XWB B;  2P2K A;  4JGZ B;  1TE1 B;  2DU1 A;  3MIE A;  1I9R A;  3P2N A;  4EYU A;  4NO4 A;  1DHK B;  4AFM A;  5CA6 A;  5A7S A;  1GNZ A;  2XVG A;  1IG0 A;  3UK9 A;  5A3L A;  2AZ5 A;  1BMV 1;  4QKB A;  1H30 A;  3A7Q A;  2Q8C A;  3LB9 A;  1F5F A;  3ALQ A;  1OVP A;  3VBH C;  3WDY A;  1WLD A;  2D6O X;  4AI8 A;  1NQD A;  2GH2 A;  4BIF A;  1AX2 A;  2B4W A;  2OS2 A;  1WLW A;  1YFU A;  3LEI A;  1V6L A;  1VMJ A;  2ZGU A;  4IEY A;  4QPY A;  2BW8 A;  3HBK A;  4ES8 A;  4N4B A;  1PGW 1;  2WKK A;  1WLT A;  5IVC A;  3VBH B;  2YXS A;  2K2S A;  1RIN A;  2WO7 A;  4GZ9 A;  1JBC A;  5JI7 A;  1R08 3;  3S5A A;  2IXI A;  4L2N A;  1DLC A;  2RS5 1;  3CQO A;  4I3P A;  4HAN A;  2BEO A;  4NPL A;  3HD8 B;  2ARC A;  2VL4 A;  1LEC A;  4G4F A;  4RR3 C;  3ON7 A;  3ENR A;  3MPB A;  4JZR A;  2JXA A;  5CB7 A;  1J3Q A;  5BNO B;  1I5P A;  3RZL A;  1HQN A;  1RMU 1;  2R0F A;  5A7W A;  4RR3 B;  5FZ9 A;  1TME 3;  3VD4 A;  5DDJ 1;  3VBS A;  3DPR C;  1JS9 A;  1KJR A;  4BQ1 A;  3MGU A;  2ZEY A;  2JDM A;  4HK9 A;  1AL0 G;  1OHF A;  2ZAB A;  4Y22 A;  5FYS A;  5LCW L;  2FDK A;  1A34 A;  1LOF A;  2ZGO A;  5FZO B;  1R09 3;  4LBN A;  4AL9 A;  3DPR B;  1QOT A;  3EO6 A;  4DUX A;  2MHF A;  1YNA A;  2GAU A;  5A7N A;  3MIH A;  2ADD A;  4E2G A;  3CNA A;  4AK7 A;  1XNC A;  4LOR A;  3H3L A;  2VW0 A;  3VDA A;  4ERO A;  2G9F A;  3OEA A;  3VKO A;  3IPV A;  4L92 A;  1C8M 3;  5DUW A;  5T50 A;  2VPV A;  1GIC A;  4COT A;  2D6L X;  2UUR A;  3I2F A;  4AI9 A;  4UW6 A;  1TNR A;  5DXD A;  3ZFG C;  3M3I A;  4FTE A;  4Y4Y A;  2YC0 A;  5LK5 A;  1NOV A;  3D3A A;  4LKS A;  4CU9 A;  2YYO A;  3UGF A;  2G4I A;  1O3Q A;  5A8D A;  3VV1 A;  3MBW A;  1UX6 A;  1POV 1;  4N7I A;  4LBQ D;  4QB2 A;  3IT8 A;  3ZFG B;  1A8D A;  1UAI A;  2QBX A;  2VMH A;  1SLA A;  1OVS A;  2ZAA A;  4EN8 B;  2ATF A;  3SXW A;  4QXK A;  3B69 A;  5LA2 A;  3WUD A;  2C6S A;  2LW8 A;  3WNM A;  1RIT A;  2ID4 A;  1UQX A;  3K4A A;  1NA1 C;  5FP9 A;  2HWC 3;  3FX3 A;  4JDO A;  1ZA4 A;  2EID A;  4NPM A;  2QQL A;  4P9L A;  4PLN A;  4AFB A;  5IVJ A;  4QX8 A;  2TNF A;  1TME 2;  4XF3 A;  1WCK A;  2UWA A;  4FFI A;  5CZK A;  4QKF A;  3ZYP A;  3POW A;  4NIH A;  3SMH A;  1H2M A;  2PLV 1;  3DEM A;  1NA1 B;  2WL1 A;  1BQP A;  1L3J A;  3HR9 A;  2H6B A;  1JZ6 A;  2OII A;  2XPJ A;  4HSJ A;  4HN1 A;  1MZ5 A;  3M4F A;  1QY4 A;  4XMA A;  2RE9 A;  3S0M A;  1HN0 A;  3CKH A;  4CP0 A;  4R8H A;  3BYJ A;  3T2T A;  4LKD A;  2XON A;  1AR7 2;  1GYE B;  4JGZ A;  1AR6 2;  1OD5 A;  1SFY A;  2YRO A;  3GCW A;  1AYM 3;  3THT A;  1C8M 2;  2BQP A;  1QQP 3;  1HXS 2;  4K1Z A;  4IEZ A;  3DCQ A;  4XF0 A;  2C1F A;  3GJA A;  1IQA A;  1UYY A;  5H9S A;  2JKB A;  3K4D A;  3TN9 1;  4IES A;  3WHU A;  1JYW A;  5DPN A;  4AQS A;  3NV3 A;  3POB A;  3UKN A;  1W9F A;  2GME A;  1JYI A;  4Q4V 1;  1JXN A;  1MEC 3;  4OLL A;  2KR2 A;  2WNU C;  1PMH X;  5FPL A;  5KHI A;  3BYW A;  1AJK A;  2JEM A;  4GA9 A;  4LTA A;  4M3C F;  5DAV A;  3VBH A;  4ONU A;  4LNV A;  1QDO A;  5F3E A;  1WZX A;  1RJ7 A;  4EJR A;  1B35 C;  1CAV A;  1QOO A;  4CCN A;  2WNU B;  4FSJ A;  3AXD A;  3LD8 A;  3K46 A;  3BIE A;  1O3R A;  4A42 A;  4LOS A;  1GYD B;  2W1S A;  1PNF A;  2RDR A;  4XJ8 A;  1LHV A;  1OMI A;  3INA A;  3HNY M;  3KS7 A;  5FP8 A;  4KC8 A;  4DXS A;  1B35 B;  2ZX0 A;  3AP6 A;  2KXL A;  1AXY A;  4GD4 A;  4GMP 1;  1NLS A;  2RMU 3;  3PME A;  3VBU C;  4WBB A;  5H9Q A;  5LBE A;  4Y1Z A;  4EWE A;  2YV8 A;  4B4Q A;  5B6S A;  1W3X A;  3VHO A;  1AX1 A;  4BQ4 A;  1IS5 A;  1FOD 2;  4GH4 C;  2E6V A;  3SCH A;  2FDH A;  5C3O A;  4XAE A;  4YVW A;  1K5M C;  5EQU A;  2J1E A;  3VBU B;  3WXP A;  1S0F A;  1OT5 A;  3A21 A;  3POS A;  5FZO A;  4GH4 B;  2FMY A;  2YPD A;  3C7F A;  1QJU 2;  3Q8B A;  4FPG A;  4FP3 A;  1K45 A;  3S7E A;  5FZA A;  2YG0 A;  1B09 A;  3F95 A;  3PDQ A;  1QHD A;  3GCX A;  3H9A A;  3OY8 A;  5A6Y A;  1XE0 A;  2WBK A;  3U4X A;  2HWE 2;  2ZGS A;  5JMC A;  4S2D A;  1V6I A;  2DFB A;  1MEC 2;  1OC1 A;  3FUQ A;  4DRR A;  2DUQ A;  1EV1 3;  3EJK A;  1G9C A;  2R7E B;  2P6H A;  2CL2 A;  4IE0 A;  5A1L A;  1GWK A;  5IFP A;  2X8S A;  2VDT A;  3JBG 1;  1AL2 2;  3FHQ A;  5FZ1 A;  1CAU B;  2RJK A;  3KM5 A;  3KGL A;  4DOU A;  3ZFG A;  3RRD A;  2EIB A;  1E5H A;  3PL0 A;  1AYN 1;  3FBM A;  1A3K A;  1GQG A;  2WQZ C;  4GWI A;  4YZ2 A;  2ZJC A;  1KS4 A;  5C8W A;  1DG6 A;  1VKD A;  2EXH A;  2YC4 A;  1VBD 3;  2RMU 2;  1OI6 A;  4A7Z A;  2FCT A;  1POQ A;  5KR7 A;  1Q56 A;  4B29 A;  4EN6 B;  4AW7 A;  2JKX A;  5FWJ A;  4GB3 1;  2I2S A;  2ILM A;  3BOW A;  3MEP A;  4OHW A;  2RS1 2;  4XFH A;  2RJ2 A;  1ZZ9 A;  2A6V A;  4KBZ A;  2R06 1;  2ZEW A;  4A3Z A;  3UKV A;  5CFD C;  3AKP A;  2R07 1;  5D21 A;  1QWR A;  1POV 3;  1BK0 A;  5E88 A;  3RNS A;  5AC9 2;  5GLU A;  5C0P A;  2JDK A;  2VQU A;  4IEV A;  4OQ8 A;  3HQU A;  2VQT A;  2Q1M A;  5KXD A;  2HWB 2;  4W6W A;  5A7O A;  1URX A;  3VB9 A;  1UY0 A;  3WR0 A;  4U36 A;  1ONA A;  2Y6G A;  5FZE A;  3PMS A;  1UMZ A;  2XBO 2;  2UU8 A;  4XZP A;  1RUF 1;  3ZXD A;  1H1M A;  3I3Q A;  3CHX A;  1PO1 2;  3OYW B;  1XNK A;  4UDK E;  4NHK A;  5A33 B;  1QMJ A;  1VMH A;  3DKQ A;  3OD0 A;  3BTY A;  3OM5 A;  1EV1 2;  4N2Z A;  2DBN A;  1QIQ A;  2UYB A;  1OKQ A;  3IB3 A;  2ETE A;  2VNO A;  2WFF 1;  1BVV A;  4Q4W 2;  4URT A;  4BXF A;  2A6W A;  4FPF A;  4HET A;  2R1D A;  2YMZ A;  3K51 A;  4G9S B;  2P3Y A;  1AR8 1;  5KC5 A;  1ZVF A;  3KSC A;  4QX0 A;  4AQ2 A;  4CXW A;  5IVV A;  2DUR A;  5FWE A;  2WNU A;  3CL1 A;  3WOG A;  1LR5 A;  1UOJ A;  1UU5 A;  3R05 A;  5GLM A;  4IXL A;  4WVM A;  5C7G A;  4BQ2 A;  1QJY 2;  2CDO A;  4N8M A;  4MLO A;  1J1L A;  4D7Y A;  4HN0 A;  3CDZ B;  3FLR A;  4OCT A;  2Y64 A;  4LT5 A;  2XUE A;  4CUC A;  1RHI 1;  5T5P A;  3EB7 A;  3O0W A;  1M4W A;  3JQX A;  1OBN A;  1V9U 1;  4QM9 A;  2YB7 A;  1J59 A;  3QEF A;  2CYF A;  1N3P A;  4IEO A;  3OBA A;  2NN8 A;  3IDA A;  1H9W A;  1H2K A;  4GAL A;  4XQ4 A;  3VBU A;  4TTG A;  3VDC A;  3V56 A;  4UDI A;  4EV0 A;  1MQT B;  5EJ3 A;  3IN9 A;  4LO4 B;  4GH4 A;  1N47 A;  4N9I A;  4UFH A;  4RHV 3;  2CV6 A;  2EAK A;  4CDX C;  2LRO A;  1K5M A;  2P37 A;  3B93 A;  4R4Z A;  1O5U A;  1RUE 3;  1ZRC A;  4XAB A;  4COY A;  1GYH A;  1LNS A;  4CEY C;  4IV3 A;  4A7Y A;  4J1W A;  5SV8 A;  1CJD A;  2WNO A;  4N9H A;  1DGW A;  5C4W B;  3OM6 A;  5FYZ A;  4PLM A;  2IXC A;  3M7A A;  1K12 A;  4HXC A;  1W6P A;  2QCS B;  3EXU A;  4RD7 A;  3A4U A;  5FKC A;  2QFE A;  1N3Q A;  1FXZ A;  4YG0 A;  1HIX A;  2RR1 1;  3WVJ A;  3RVH A;  5GLR A;  1OKO A;  4BM8 A;  3H3Z A;  5J37 A;  1IKP A;  1IS6 A;  5IVB A;  1XYN A;  1ZZ6 A;  2PHR A;  2QQK A;  5CVR A;  1NE4 A;  1QEX A;  1UU4 A;  3GJB A;  3LV4 A;  1SFN A;  3MFC A;  4XUT A;  3VSS A;  4A2U A;  1SLC A;  1F31 A;  5K9Y A;  2QDN A;  2WZ8 A;  3AZX A;  1TQ5 A;  5KXB A;  5DAX A;  1CJP A;  3J26 N;  3LSD A;  3T1L A;  1KEX A;  5EV7 A;  3KQ4 B;  3GF6 A;  3ATG A;  4XTP A;  4RHV 2;  2BER A;  4CVU A;  4NR1 A;  1QJX 1;  5CFD A;  2NMN A;  2ZCW A;  4UYB A;  5FZ6 A;  4UDK A;  2V73 A;  4FCA A;  1RUE 2;  2NQY A;  2ZZQ A;  1GWM A;  4FOW A;  4AK6 A;  4NII A;  1LRH A;  4DXR A;  3KST A;  5F1R A;  3OYW A;  4QQ2 A;  1JUI A;  2RS3 1;  5A33 A;  2BPA 2;  4IL7 A;  5FPU A;  2D5H A;  4QQP A;  4ZXK A;  3AKR A;  4YM3 A;  4LIT A;  3WX5 A;  3VD5 A;  1RC6 A;  1R1A 1;  2XJT A;  1FAT A;  1KFU L;  5F32 A;  1PIV 1;  3TEW A;  2Y26 A;  4E27 A;  1BLZ A;  2WAB A;  2WDB A;  3H42 B;  3PVE A;  2VGD A;  1PM4 A;  5IK5 A;  4B8E A;  3III A;  4UF0 B;  4XBL A;  1X9T A;  2QQU A;  2QZ2 A;  4LK6 A;  4W65 A;  4BLJ A;  1E57 A;  5LWB A;  3H3U A;  4MET A;  2VZ1 A;  5A32 B;  4IE4 A;  4P9G A;  1KDM A;  1NZI A;  5A6Z A;  2XJV A;  3NJY A;  5BNQ A;  1UYP A;  2V09 A;  3W58 A;  5AFE A;  2JE7 A;  4B3N A;  5FOB B;  1PX3 A;  3B02 A;  2AC1 A;  2X05 A;  4RFT 0;  4KWJ A;  5GLW A;  3PUH A;  1PO2 2;  1C28 A;  3LDK A;  4PHZ A;  5BPX A;  1VBE 1;  3L2Y A;  2P34 A;  4CCJ A;  5C9A C;  1UIK A;  5CKN A;  4KNC A;  2E7A A;  1AX0 A;  2WII B;  2Q8O A;  4MOA A;  1WBL A;  3NRU A;  4EE2 A;  3RWK X;  1FMD 3;  1YIP A;  1DU3 D;  4BYY A;  4DEQ A;  5C9A B;  1TZO A;  4Y4R A;  1BVP 1;  1T6G C;  3BIW E;  3JUU A;  3EHK A;  4CUA A;  4OHX A;  4CA9 A;  5HPO A;  1S0I A;  4NJ4 A;  5HBA A;  2QQP A;  3O1S A;  3DXT A;  3FLT A;  4FPE A;  5FY5 A;  3JD7 2;  1RUN A;  1H8V A;  2D40 A;  4OUS A;  4QU1 A;  1Z7S 1;  3FUO A;  1CAW B;  1D4M 1;  1VAV A;  1VRH 1;  2YBK A;  4CPB D;  5B4N A;  1WMX A;  1RUI 3;  1WA4 A;  4IQP A;  1OUX A;  4ASM B;  3P6B A;  3AMN A;  1D0H A;  4CDX A;  5A7V B;  1U5I A;  4HKW A;  2JDU A;  3VZM A;  4PVA A;  4QXH A;  1U0A A;  4C0H A;  4CDU C;  1OF4 A;  4YM2 A;  2WO3 A;  1MS1 A;  1WMF A;  2O8O A;  2P4E A;  3VZJ A;  1JOP A;  5DUU A;  4KGG A;  5CIS A;  5F3I A;  1DQ0 A;  1NY7 2;  2QJV A;  4MLG A;  2WLQ A;  5FYH A;  1V6M A;  4CEY A;  3BKZ A;  4CTE A;  4YLZ A;  4CDU B;  5GLV A;  4I09 A;  4MVT A;  3NAP C;  2NM1 A;  3T3Y A;  2QNK A;  1VBC 3;  2YFU A;  3UES A;  1DZT A;  3U37 A;  3VL9 A;  4CCO A;  2IXL A;  1W6O A;  5FLI A;  5FKB A;  1SLI A;  1OQ1 A;  1SMV A;  2BGP A;  4IEU A;  1CGP A;  2Y34 A;  3WQB A;  1W8W A;  2ES3 A;  4OI1 A;  4UWD A;  4Q8K A;  2P3K A;  2BNO A;  4XFI A;  3LCP A;  1F5J A;  2JG9 C;  3J7N A;  1HRI 1;  1TEI A;  3NKG A;  4AVV A;  5AFB A;  1VB4 A;  2D97 A;  2W5F A;  1H0B A;  2E33 A;  4GKX A;  5FYI A;  3TRS B;  1AR9 3;  2WN2 A;  1W2U A;  3MF6 A;  5H9R A;  1HQW A;  4TWT A;  3KCC A;  2Z42 A;  2VZS A;  1V6K A;  4LE3 A;  2CNA A;  3HIF A;  4DY5 A;  5IHR A;  4LUK A;  2DF7 A;  3MIG A;  4ZHN A;  1ND2 C;  5TSW A;  2QVS B;  3QED A;  4JV4 A;  1LOB A;  4LO6 B;  4MSV A;  3RWN A;  4BPZ A;  5C6C A;  2P6C A;  2RHP A;  5FPA A;  1QH6 A;  3KGZ A;  4PQ9 A;  1UMH A;  3X29 B;  1RUI 2;  1JZ4 A;  2XL7 A;  1ND2 B;  1OOP A;  4D6Q A;  5C33 A;  2XR4 A;  4TXW A;  4YGD A;  2XUM A;  2YPJ A;  1PVX A;  3L2H A;  1VAL A;  2WQ8 A;  3AP9 A;  5GZC A;  1TVG A;  4I0A A;  2B7Y A;  4P14 A;  3ZKY A;  5I0T A;  2G1M A;  3VD7 A;  1WA6 X;  3WN0 A;  5LRR A;  2MEV 2;  1UD1 A;  2L9L A;  5JZG C;  1UZZ A;  3DYO A;  4DIQ A;  4YGE A;  2B45 X;  1LB2 A;  3I8T A;  4QB6 A;  4HFS A;  3P5B A;  1VBC 2;  3NL1 A;  1QJX 3;  2RJL A;  2RM2 3;  1UY1 A;  4HKO A;  4IE5 A;  5LA1 A;  4BE3 A;  5JZG B;  1RXF A;  1UXZ A;  1XQN A;  2WAO A;  3H8U A;  4UF0 A;  2WZR 3;  1OLR A;  1XPW A;  4PF1 A;  4MUV A;  4AHW A;  1GZW B;  2R16 A;  3T0B A;  5A32 A;  5HI0 A;  4R9C A;  2EXJ A;  1PZ7 A;  1NE6 A;  2W3J A;  2W94 A;  2VZO A;  3K77 A;  5FY8 A;  5FZH A;  5FY0 A;  4XIO A;  2W92 A;  3H1Y A;  3I2D A;  3WF0 A;  3ZXJ A;  4L9B A;  4ASK A;  4JQR A;  4JHT A;  1RUC 3;  2A6X A;  3OBR A;  1DBN A;  3CLP A;  4QQO A;  3WG1 A;  4CCD A;  2FQP A;  2JIC A;  4YGB A;  3QOP A;  5LAS A;  2ZGR A;  3P1I A;  4BCU A;  4AE2 A;  1OFS A;  1BHG A;  3KMH A;  1O8S A;  2VZU A;  3KLS A;  4TYS A;  5A3O A;  1E5R A;  3AXE A;  1R08 1;  3LFM A;  5C9A A;  2R04 2;  1D0G A;  1VAM A;  1G9F A;  3O14 A;  4Y1X A;  3SIT A;  1VPH A;  2WLP A;  2YFZ A;  5F5C A;  3ZXF A;  5JPN B;  4ISR A;  2DFC A;  4FFF A;  4A41 A;  1N3O A;  3ACG A;  1XJA A;  1KQR A;  4KWK A;  5FXX A;  1LU2 A;  4I01 A;  1AZD A;  1VAK A;  3NJX A;  1PK6 C;  4YYO A;  1O6U A;  1CAW A;  1RJ8 A;  3OB8 A;  4RQP C;  1AXK A;  1YXW A;  3THC A;  3IBM A;  2ZXQ A;  4ZZ8 A;  3OEB A;  3UGH A;  2JG8 C;  1MS0 A;  2YFR A;  3OUI A;  5A7V A;  1Q3E A;  2EVX A;  1MS9 A;  4FT8 A;  1TME 1;  4OI4 A;  4P5H A;  2VUJ A;  4QQL A;  1GV9 A;  3U14 A;  4DEV A;  4RQP B;  1E5S A;  2NPI A;  5LW9 A;  3PTY A;  2JG8 B;  2OPW A;  4JHZ A;  2RM2 2;  4J1X A;  4K21 A;  3D60 A;  1SPP B;  1W05 A;  1R09 1;  1IS4 A;  4M3C B;  2DCZ A;  5FPV A;  2Q8E A;  1GNY A;  2ZX1 A;  4XQD A;  3ZSE A;  3U11 A;  3HT1 A;  4B4P A;  1QJF A;  1Z7S 3;  1VRH 3;  5KHJ A;  2E63 A;  4H2A A;  1CPN A;  2B42 B;  2F4P A;  3C2U A;  2RG4 A;  3NAP A;  3NVC A;  5KHG A;  3UT0 A;  4M3C E;  5A7W B;  1C8M 1;  4QQH A;  2VZ3 A;  5C5T A;  2W1U A;  2AH2 A;  3CBN A;  1UZV A;  4YWA A;  4BK5 A;  4RS5 C;  5EWS A;  4BLI A;  3A0K A;  1UN1 A;  4QB1 A;  4Y22 B;  1L7Q A;  5FZ8 A;  2VME A;  5AVP A;  3WP3 A;  1QXR A;  2JB4 A;  1BXH A;  2X8T A;  2JG9 A;  4UDG A;  3NJV A;  3WF4 A;  1SLL A;  5FK7 A;  4HPK B;  1LOA A;  2DDU A;  1JI6 A;  1ULP A;  1W8O A;  4LEJ A;  3ITQ A;  2D44 A;  4IEQ A;  1ZZB A;  1YEW A;  1ULG A;  3L9J T;  1YQ5 A;  4QWN A;  1Q5O A;  4EN9 B;  1KJL A;  1ENS A;  4J25 A;  4P5Y A;  2X8F A;  3VSZ A;  3BOD A;  4CU7 A;  2CGN A;  1ND2 A;  2HWC 1;  2OPK A;  2WZE A;  1LGC A;  4HKL A;  1O8P A;  4K40 A;  3ZSL A;  4AFC A;  1ZBA 3;  2OZJ A;  3KCX A;  3WW3 A;  5DUX A;  3HN1 A;  2FZ1 A;  5FRE A;  3S5Q A;  2VW1 A;  3LPG A;  2UY9 A;  3O1P A;  3H50 A;  1OPM A;  4HVR A;  4I0B A;  1MVQ A;  5DAB A;  3AKS A;  1GMM A;  2E9Q A;  2WA3 A;  4XXA A;  4FPC A;  2CWM A;  4QDS A;  5LB6 A;  1CZT A;  2ARB A;  2GP3 A;  3JQW A;  4M0N A;  1W2A X;  4XYX A;  3EBR A;  5F6K A;  2W2I A;  1QJU 1;  4U6D A;  2AEZ A;  1QOS A;  4XPV A;  2OX0 A;  4XZU G;  1QQP 1;  1D7P M;  1EY2 A;  1VP6 A;  2ZHM A;  3FMG A;  4MGZ E;  4OI2 A;  5FY7 A;  1NKG A;  2YY1 A;  2VBP A;  3GNE A;  4XIK A;  2BU9 A;  3AP7 A;  4L8Q A;  3SH5 A;  5KWR A;  2VNV A;  3WF2 A;  2ZGK A;  4W8J A;  1MEC 1;  3ZYR A;  5JDB A;  3D0J A;  4P00 B;  3DV8 A;  1YIF A;  4Y20 B;  2X5I C;  3B7M A;  4W6X A;  5F3G A;  4BQW A;  1DZQ A;  4OHY A;  5B4X A;  1RIR A;  4UFJ A;  2ZAH A;  1GOG A;  3J8F 2;  2Q8D A;  4UDJ A;  3N36 A;  3CJX A;  1F4A A;  5EIY B;  5CAD A;  1D4V B;  1C1L A;  1XNT A;  3I54 A;  5BUV A;  3URF A;  2Q5T A;  3WW4 A;  2DCJ A;  5GLQ A;  3AJZ A;  3ZYI B;  3O5S A;  2FCU A;  5HXV A;  5K8S A;  3I97 A;  2CGP A;  4OMD A;  1FPN 3;  1ZBA 2;  2RMU 1;  4CZS A;  1STM A;  1SCR A;  3MID A;  5DN2 A;  2A73 B;  2Q0A A;  1H1A A;  1IQD C;  5FMB A;  4F8A A;  5EFU A;  5HCA A;  1PK6 A;  3O1O A;  3MV1 1;  2XG3 A;  2RS1 1;  1H9P A;  4RQP A;  4ISQ A;  4LKF A;  4XUN A;  4Z82 A;  5LK7 B;  1S0G A;  1WWY A;  2GC1 A;  2IFR A;  2ZKN A;  2F4L A;  1CAV B;  2JG8 A;  2PEL A;  1KDK A;  2QTW B;  2EXK A;  2D6K A;  4KGQ A;  3H7J A;  2GU9 A;  3AKT A;  1SPP A;  4I3G A;  4M3C A;  1YJK A;  4XF4 A;  5FZ4 A;  2HWB 1;  1F4H A;  1JZ5 A;  4K8F A;  5JR2 A;  2E31 A;  1AJO A;  5AVA A;  3THD A;  4YVW C;  3AMQ A;  4K6B A;  1H2L A;  4E2S A;  2ZOE B;  1TG7 A;  1US3 A;  2HBU A;  3C7E A;  4IER A;  4LKE A;  4RL7 A;  5HCB A;  4LHL A;  4Z07 A;  4YVW B;  1EV1 1;  2D98 A;  4Q1P A;  4PDW C;  2VNG A;  3LF7 A;  3WZ1 A;  3ZSK A;  5I8T A;  5GJ6 A;  4CE8 A;  2E7Q A;  2C9A A;  1PX4 A;  1UYX A;  5E89 A;  4RS5 A;  3R4U A;  2SLI A;  1G9B A;  3ECQ A;  3TEZ A;  2XGX A;  4HPK A;  3BPZ A;  2BYV E;  4PDW B;  5L9V A;  3GBW A;  2VBD A;  4QU2 A;  1J3P A;  5FZC A;  1AR7 3;  1SLT A;  1T2X A;  3OGS A;  3OY8 B;  1AR6 3;  5L9B A;  1W0N A;  4N7U A;  3OF1 A;  3ZYB A;  1FPN 2;  1VBD 1;  4MG2 A;  3IAP A;  3T1M A;  3BTZ A;  1HXS 3;  1DYO A;  4CUB A;  5GLT A;  5I8Y A;  2CHH A;  1OLM E;  2IXJ A;  2JX9 A;  3DKW A;  3MV0 1;  2VC9 A;  4NRM A;  1AXZ A;  5DZF A;  2O1Q A;  1LGN A;  2VAU A;  1LHN A;  2RV9 A;  2GC3 A;  4OFG A;  4QGN A;  3D0S A;  5J98 B;  5A7P A;  4A3X A;  3AK0 A;  3FWE A;  4PIX A;  1RUH 3;  4N2R A;  5AYD A;  3NNL A;  2QQJ A;  4BMB A;  1O7F A;  1WBF A;  3KF3 A;  1SBE A;  3CMG A;  2DBI A;  1S0E A;  4KMQ A;  3ELN A;  2D6N A;  3TEY A;  2LM3 A;  2TUN A;  4XJA A;  1MAC A;  1NX9 A;  5C8C C;  3VT0 A;  4AGG A;  2WNV C;  5CIR A;  2FZ2 A;  3MIC A;  2OW4 A;  4N53 C;  4GJZ A;  4NIA A;  1UCX A;  3OM4 A;  3QCW A;  5FZB A;  3VN4 A;  5L36 A;  4OI0 A;  2Y6F A;  3BU7 A;  3KV4 A;  1J84 A;  2WNV B;  3NV1 A;  4N53 B;  2VD7 A;  3SIS A;  5FUI A;  1GNH A;  4OZO A;  4JGY C;  1FOD 3;  1EYB A;  5IYY A;  1F15 A;  4FO9 A;  5EP9 A;  4X6R B;  1FNY A;  1I3H A;  4Y20 A;  1DP0 A;  3AKF A;  4D7T A;  4FOY A;  2D43 A;  4BQ3 A;  1QJU 3;  1GP6 A;  1X8E A;  1J1T A;  2GMP A;  2VUD A;  2W08 A;  4NWW A;  3VBO C;  4MGT A;  1Y43 B;  1VE0 A;  2X5I A;  4BDV B;  2OXB A;  5JOX A;  2QQW A;  3E6C C;  4HZF A;  4LBQ B;  3VBF C;  1CVN A;  2LAL A;  4M0H A;  4O8N A;  2D6M A;  2HKX A;  2J1T A;  3JU9 A;  1VLN A;  2W39 A;  2HWE 3;  2QQI A;  4QGM A;  4PIY A;  3VBF B;  1RUH 2;  3B9I A;  1UNB A;  2PHX A;  2ZTN A;  3VSR A;  3E6D A;  4CP9 A;  1AL2 3;  1YI9 A;  4UFL A;  5GZD A;  1GP5 A;  3W9A A;  3VDB A;  2IVI B;  3E1F 1;  4FPY A;  3SEE A;  5ANN A;  4BA6 A;  4HVQ A;  4WVM B;  3HEI A;  2PAM A;  1O4Y A;  1OQE A;  5IUQ A;  4RHV 1;  2XJS A;  3J7H A;  1R1Z A;  3SHR A;  4YPJ A;  4AI0 A;  3BVC A;  3KV5 A;  3C3V A;  3VHP A;  3AMM A;  4KL1 A;  1RUE 1;  3GZE A;  4AHY A;  5A6X A;  3I2O A;  1XND A;  2A3W A;  4Y26 A;  4L99 A;  2EF6 A;  3LWC A;  4YW7 A;  1DFQ A;  2RS1 3;  4LA3 A;  4LHS A;  1G9A A;  2XVK A;  4V2W A;  2ZHK A;  1W9W A;  2Y6H A;  4XFG A;  5LAT A;  4D94 A;  3K1U A;  1TMF 3;  5AC9 3;  2HLE A;  4ZPI A;  3OD4 A;  2JE9 A;  4Q0P A;  5JSO A;  4X8P A;  4YNI A;  3MLJ A;  2HWB 3;  3NMB A;  4PF5 A;  4UW4 A;  1K5M B;  2CDP A;  4IV3 C;  4PDW A;  4QXB A;  4N43 C;  1OLM A;  2JDH A;  3HNM A;  4MGS A;  4QPG C;  4FOV A;  3MIF A;  3W59 A;  1YO8 A;  4KQ7 A;  2A71 A;  1ZRE A;  1QF3 A;  1RTV A;  1PHM A;  4NMI A; 
#chains in the Genus database with same CATH homology
 4LPL A;  3LQC A;  2WZ8 A;  3CIH A;  1ST8 A;  4A45 A;  5JOZ A;  5JOW A;  4W4Z A;  1JZ3 A;  1KEX A;  4A6O A;  4UI9 L;  1JZ7 A;  3ACF A;  4KMI A;  2OKX A;  4CU6 A;  3C7O A;  3GDB A;  2W91 A;  5C71 A;  2BER A;  4CVU A;  3BGA A;  2EXI A;  4UDK A;  3PUI A;  1RYY A;  3JXS A;  3T0A A;  2X09 A;  3T09 A;  1W2T A;  3F2Z A;  1UY3 A;  1WKY A;  2Y8K A;  5IJR A;  4AK6 A;  1GQP A;  5EJZ B;  2ZEZ A;  4DXR A;  1UYZ A;  3CU9 A;  3KST A;  3ETP A;  1OF3 A;  4E8C A;  3LFI A;  4P08 A;  5AYE A;  3CZJ A;  3LE0 A;  1GU3 A;  2JDA A;  3VD5 A;  3WPV A;  3LEG A;  2WAB A;  1JU3 A;  2WDB A;  3III A;  4ARX A;  1Y7B A;  2QQU A;  3C7G A;  5AYC A;  1W9T A;  2VR4 A;  2VZ1 A;  3WNL A;  5GLP A;  1H6X A;  5EJ1 B;  4O8O A;  3AKG A;  3LIH A;  1UYP A;  1EUU A;  3QEE A;  1PX3 A;  4EQV A;  4UAP A;  2AC1 A;  2X05 A;  4KWU A;  3PUH A;  3TAW A;  3LDK A;  2JD9 A;  1SG3 A;  2YC2 A;  1PT2 A;  2ORX A;  2J1V A;  4MOA A;  1JZ8 A;  3NRU A;  4AAX A;  3RWK X;  2V4V A;  4IUG A;  1UMI A;  4DEQ A;  3WPU A;  3W5N A;  3D5Y A;  4CUA A;  1HN1 A;  1O59 A;  3A22 A;  5HPO A;  3WN1 A;  4ZY9 A;  2QQN A;  1P8J A;  2BGO A;  3HPN A;  3K4Z A;  5B4N A;  3P6B A;  3I2K A;  5FLW A;  5A7V B;  1PMJ X;  4CU8 A;  4PVA A;  1UZ0 A;  3WAU A;  3FHA A;  1OF4 A;  3KF5 A;  2WO3 A;  3WMZ A;  2XOM A;  5I0D A;  5A1A A;  4D0Q A;  5G05 L;  5JXI A;  4MLG A;  3A23 A;  2WAA A;  3C7H A;  4XUP A;  2DCK A;  3ZXL A;  4DUW A;  1UY4 A;  4JX0 A;  3C8X A;  2YFU A;  3UES A;  3HJR A;  3U37 A;  4KC7 A;  5FKB A;  1CZV A;  3DEC A;  2BGP A;  3BYL A;  4ET7 A;  3WQB A;  5FIX A;  4XUQ A;  2C4X A;  1R64 A;  3WNN A;  2V72 A;  5JXH A;  2W5F A;  4QQS A;  2E33 A;  5F7U A;  2E32 A;  2VMC A;  2WN2 A;  2VZS A;  4A4A A;  2BZD A;  4PVI A;  5IHR A;  3LEM A;  3LPF A;  4RYD A;  3WN2 A;  5JUV A;  3QED A;  2W95 A;  1CX1 A;  3I2I A;  3CZU A;  4AG4 A;  1UMH A;  2HYX A;  1OD3 A;  2E26 A;  1MPX A;  1JZ4 A;  3VT2 A;  4TXW A;  1GOH A;  4QX3 A;  2Y6L A;  2XHN A;  2WQ8 A;  4M4P A;  1TVG A;  4N1I A;  4BJ0 A;  3I3B A;  2ORZ A;  3VD7 A;  2C26 A;  3WN0 A;  1OYG A;  2L9L A;  1GUI A;  2J22 A;  3P2N A;  3DYO A;  2WO2 A;  3SEP A;  4QB6 A;  1K42 A;  3VD3 A;  1ULO A;  1UY1 A;  5LA1 A;  3A7Q A;  1XNA A;  3IAQ A;  2B4W A;  1UXZ A;  2WAO A;  3ACH A;  1XPW A;  4PF1 A;  3LEI A;  3T0B A;  3U75 A;  2EXJ A;  4N4B A;  1JYN A;  3K77 A;  2W94 A;  2W3J A;  2VZO A;  2W92 A;  3ZXK A;  2VM9 A;  2VZP A;  4GZ9 A;  3WF0 A;  3ZXJ A;  1CZS A;  1K3I A;  1H6Y A;  3UET A;  1DLC A;  2KD7 A;  3CQO A;  5GLO A;  3P1I A;  2VL4 A;  1BHG A;  2VMF A;  1O8S A;  2VZU A;  3VD9 A;  3LIG A;  4PQQ A;  2JE8 A;  2B9V A;  1I5P A;  1JU4 A;  2YFZ A;  1JYX A;  3OM2 A;  4FFF A;  4A41 A;  3ACG A;  5CYY A;  3VD4 A;  1JYV A;  3NJX A;  1JZ2 A;  4ARY A;  3OB8 A;  3THC A;  4ZZ8 A;  2ZEY A;  5FMC A;  5FMD A;  5LCW L;  2ZXQ A;  3OG2 A;  3OEB A;  4GWJ A;  3UGH A;  2VZR A;  2YFR A;  5A7V A;  3T08 A;  3U14 A;  4DUX A;  3ZM8 A;  4DEV A;  1J83 A;  2QQO A;  2J1S A;  2ADD A;  5A8C A;  4AK7 A;  5DMY A;  4JHZ A;  3WF1 A;  1Y9M A;  4M4R A;  2WO1 A;  3D60 A;  3VDA A;  3R4Y A;  3OEA A;  1Y9G A;  1GNY A;  5G04 L;  4COT A;  4D47 A;  3AC0 A;  3I2F A;  4FFG A;  3VSF A;  3ABZ A;  1SDD B;  3WMY A;  3DYP A;  3C2U A;  1WCQ A;  3D3A A;  4LKS A;  4CU9 A;  2VZ3 A;  2W1U A;  3UGF A;  4BK5 A;  4Z2A A;  5A8D A;  2J1R A;  3MBW A;  4QB2 A;  4QB1 A;  2ADE A;  4LQR A;  2QBX A;  3WAS A;  1L7Q A;  2VME A;  3WF3 A;  3D5Z A;  5JXJ A;  2W46 A;  2X8T A;  5J1X A;  4UDG A;  3NJV A;  5LA2 A;  3WF4 A;  2LW8 A;  3I2J A;  3WNM A;  5FK7 A;  2ID4 A;  5JMO A;  3PIG A;  3K4A A;  2DDU A;  1JI6 A;  1ULP A;  1W8O A;  3GGL A;  2EID A;  3NQH A;  2QQL A;  4MGQ A;  1WL7 A;  2VZV A;  3ACI A;  4FFI A;  4U6B A;  5CZK A;  4FFH A;  3K75 B;  3PIJ A;  4P5Y A;  2X8F A;  4ONZ A;  1UV4 A;  3VSZ A;  2VCB A;  4CU7 A;  2EIC A;  1JZ6 A;  2WZE A;  1O8P A;  5C70 A;  3D61 A;  1SHW B;  3CKH A;  2J1A A;  3BYJ A;  3LPG A;  2XON A;  2VCC A;  1GYE B;  4JKL A;  4RN5 A;  2YFS A;  1W8N A;  3WNK A;  4JKM A;  1GMM A;  3MUY 1;  4L0P A;  4QDS A;  1NAE A;  1CZT A;  3GXU A;  1UYY A;  4KI5 M;  3K4D A;  1JYW A;  5DPN A;  4U6D A;  3EYP A;  4XZU G;  2AEZ A;  1CIY A;  1D7P M;  2QQM A;  1PMH X;  4D8M A;  1NKG A;  2W47 A;  3FL7 A;  4QDR A;  3VT1 A;  1Y4W A;  3WF2 A;  4W8J A;  2EIE A;  3WNO A;  3K46 A;  4P00 B;  4A42 A;  1GYD B;  1W18 A;  2W1S A;  4P02 B;  1YIF A;  2VTF A;  3W5M A;  2LS6 A;  5B4X A;  3HNY M;  3T2O A;  4KC8 A;  4DXS A;  1GOG A;  4UDJ A;  4O8P A;  4NOV A;  4DUV A;  1F4A A;  2J1U A;  5EIY B;  1XNT A;  2Y6K A;  4MAD A;  4A44 A;  3R67 A;  2DCJ A;  5GLQ A;  5B6S A;  3LEK A;  3I97 A;  4XUO A;  4OMD A;  4MO3 M;  1W99 A;  1JHJ A;  2J1E A;  1OH4 A;  2WN3 A;  5DN2 A;  1OT5 A;  1XC6 A;  3A21 A;  4KCA A;  2VJX A;  3WSO A;  1IQD C;  4OYU A;  5FMB A;  3C7F A;  3MV1 1;  4XUN A;  4OMC A;  5FK8 A;  1K45 A;  4W50 A;  2W1W A;  1YRZ A;  3WEZ A;  3GM8 A;  2YG0 A;  2EXK A;  2WBK A;  1F4H A;  1JZ5 A;  3I3E A;  5JR2 A;  3OGR A;  2E31 A;  3I2G A;  3THD A;  3WNP A;  2R7E B;  5IFP A;  1UY2 A;  2X8S A;  4QDQ A;  2VDT A;  1TG7 A;  1US3 A;  3C7E A;  3FHQ A;  4OUE A;  3T2Q A;  3OGV A;  2B4K A;  3MUZ 1;  2EIB A;  3LF7 A;  3R4Z A;  4GWI A;  1KGY A;  5GLN A;  2VCA A;  1VKD A;  1PX4 A;  1UYX A;  3AKH A;  2EXH A;  2YC4 A;  2YFT A;  3ECQ A;  2VO5 A;  1UWW A;  2VZT A;  3NNG A;  2JKX A;  1T2X A;  3OGS A;  1W0N A;  2WUH A;  3SKJ E;  2C9K A;  3OM7 A;  2RJ2 A;  3IAP A;  1L7R A;  4FI9 A;  2ZEW A;  4A3Z A;  1DYO A;  4CUB A;  2W1Q A;  3MV0 1;  2AEY A;  2VC9 A;  5C0P A;  3WPZ A;  2VQU A;  4QX2 A;  4ZZ5 A;  2VQT A;  4ZXE A;  2RV9 A;  3WPY A;  3T2P A;  1UY0 A;  4N2R A;  5AYD A;  2QQJ A;  3I3D A;  1YQ2 A;  3KF3 A;  2Y6G A;  4KMQ A;  3CMG A;  3MO4 A;  3BYK A;  4UDK E;  2BBA A;  1NX9 A;  3UNP A;  3VT0 A;  3OM5 A;  2ZEX A;  2X10 A;  5GLK A;  4N2Z A;  3DYM A;  3HOB A;  5GLL A;  3IB3 A;  1J84 A;  1NUK A;  3T0D A;  3UGG A;  4KCB A;  5FUI A;  1EUT A;  2PQS A;  4OZO A;  4QX0 A;  5AY9 A;  2VMD A;  5IYY A;  5IFT A;  4BK4 A;  5GLM A;  5C7G A;  1W9S A;  4HG6 B;  2VOT A;  3HN3 A;  4PT6 A;  1GOF A;  2CDO A;  1DP0 A;  3AKF A;  4XUR A;  3CDZ B;  2Y64 A;  2V5D A;  4AK5 A;  4QAW A;  4CUC A;  5JXG A;  4BDV B;  3SC7 X;  2Y6J A;  2OXB A;  3EB7 A;  4QPW A;  5JOX A;  2QQW A;  4DXT A;  2J7M A;  2YB7 A;  3QEF A;  4O8N A;  2VZQ A;  2J1T A;  2Z4F A;  4BXS V;  3OBA A;  5B6T A;  3IDA A;  2QQI A;  4TTG A;  3VDC A;  1UXX X;  4JKK A;  4UDI A;  2XQR A;  2XQX A;  3HNB M;  3VSR A;  3QZ4 A;  3VDB A;  3SEE A;  3E1F 1;  5ANN A;  3HEI A;  4QX1 A;  1GYH A;  1LNS A;  3J7H A;  5DQ0 A;  4YPJ A;  3OM6 A;  5LA0 A;  1US2 A;  3AKI A;  2WYS A;  1K12 A;  5HXM A;  2W9X A;  3BN6 A;  3WAT A;  2QQV A;  5FKC A;  3I2H A;  4LHS A;  3LDR A;  5JOY A;  1W9W A;  2Y6H A;  4XVH A;  5GLR A;  1UX7 A;  3K1U A;  2HLE A;  3BYN A;  2RVA A;  3SKV A;  3OM4 A;  3QC2 A;  4E8D A;  2QQK A;  4UOJ A;  2CDP A;  3LV4 A;  3HNM A;  4MGS A;  4XUT A;  2W87 A;  3VSS A;  3FN9 A;  1YI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...