3C7HA

Crystal structure of glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with axos-4-0.5.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
487
structure length
487
Chain Sequence
b'ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endo-1,4-beta-xylanase
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
total genus 134
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7hA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7hA02
3HEIA 3D3AA 4ET7A 1JZ4A 2VZTA 2WZEA 5CYYA 5FMBA 2W3JA 4KMQA 3WF4A 5HPOA 3VD4A 3WPZA 1DYOA 3ABZA 3JXSA 4DEQA 1XPWA 2VMFA 3K4ZA 3WNNA 3SEPA 3LEMA 4ZZ5A 2YG0A 3UESA 4DUXA 4QPWA 3SC7X 3WPUA 5A8CA 2YFTA 2DCJA 3LF7A 3GM8A 3QEEA 4DXTA 2W1QA 5G05L 2JD9A 3U37A 3I97A 2EICA 4UAPA 1K42A 1JYWA 1JI6A 1F4HA 3T2OA 3LEGA 2QQMA 3LEIA 1RYYA 1GMMA 2JE8A 2W94A 2WO3A 2C4XA 3LQCA 1UYZA 3LE0A 3U14A 1JZ5A 3WN0A 5J1XA 2Y6GA 4QQSA 5B6SA 2J1UA 4CUCA 3WMYA 4UI9L 2EIDA 3K4DA 4N2RA 3BYKA 5B4NA 1PT2A 4O8OA 3VSRA 3K77A 1NKGA 3OM7A 1W2TA 2CDPA 4TTGA 2WBKA 3CMGA 2X8SA 2VCCA 2VC9A 2Y8KA 2V4VA 4AG4A 5JOWA 5AYCA 3MV01 3BGAA 3WQBA 1GYHA 4QB6A 4AK5A 4M4PA 3I3EA 3WNPA 4UDKE 3WF0A 2VCBA 3R4YA 1GOGA 2CDOA 1O8PA 3VT1A 3ZM8A 2BERA 1JYNA 2J7MA 4MGQA 2VZQA 3WATA 2C26A 2J22A 4P08A 4QAWA 2J1TA 2Z4FA 1BHGA 3VDBA 3ETPA 5C70A 1US3A 2VJXA 3P6BA 4RYDA 1TG7A 3E1F1 3I2IA 1JU4A 3MBWA 5LA1A 3AKGA 1OH4A 1MPXA 2EXKA 1JHJA 1JZ7A 4GWIA 5JUVA 1PMJX 2Y6LA 4UDJA 5GLOA 4LHSA 3T2PA 2W47A 1TVGA 4XUQA 2R7EB 3SEEA 2QQVA 2L9LA 3OM5A 5FMDA 2X09A 2RV9A 4L0PA 1H6XA 2J1RA 1OF4A 1IQDC 2EIBA 1O8SA 5IYYA 3LEKA 2VO5A 1Y4WA 1Y9GA 4CUAA 1JYVA 3QZ4A 1WKYA 4D0QA 1NAEA 3OB8A 3AKFA 4FFGA 4KMIA 3VD9A 1SDDB 4D8MA 3I2GA 5EJ1B 2Y6HA 1JU3A 3C7FA 2VZUA 4FFIA 3LPGA 1OYGA 4AK7A 5ANNA 2QQKA 4PVIA 3VSFA 3IIIA 2V72A 3WNMA 5FIXA 4LQRA 3IAQA 3VDAA 5AY9A 3VSSA 3I2FA 2YC2A 1DP0A 5GLRA 3PUHA 2XHNA 3VT0A 1F4AA 4N4BA 3UETA 2VMDA 3WNKA 4QX0A 3BYNA 2ZEYA 5GLLA 3T09A 1GYEB 5C71A 3T0BA 3CIHA 2J1SA 2VZVA 2XQXA 3WF2A 3WF1A 2RVAA 2LW8A 4OYUA 5JOXA 2HLEA 3NQHA 3THDA 4GZ9A 4BK5A 3OM2A 4O8PA 5GLNA 1EUTA 4KCBA 1J84A 3HN3A 3I2JA 3T08A 3VD7A 3R4ZA 1WCQA 4AAXA 4E8DA 3SKVA 2QQWA 3LDRA 1OF3A 1NUKA 1KEXA 4XUOA 4A41A 4U6DA 5FUIA 1UY2A 3WAUA 2WABA 1GYDB 1WL7A 2VR4A 3VD3A 3FN9A 4A4AA 4QX2A 4KCAA 3BN6A 2ZXQA 1GQPA 1GOFA 1P8JA 3D5YA 3ECQA 2X8FA 1GNYA 3CQOA 4KI5M 3PUIA 3KSTA 3FHQA 3MUZ1 4QDSA 2ADEA 1UMIA 2J1VA 2VCAA 4XZUG 4CU6A 4OMCA 3VDCA 5GLPA 5JXIA 4IUGA 1I5PA 3NRUA 3OM6A 5DPNA 3T2QA 3C8XA 4MLGA 1VKDA 2W92A 3FHAA 3ZXKA 2VTFA 1XC6A 3WPYA 2W9XA 1W8NA 1XNAA 4O8NA 3IDAA 2Y64A 2E31A 2VQUA 1K3IA 1W0NA 2BGOA 4Z2AA 2J1EA 3VD5A 3C7EA 1UYPA 5FMCA 3TAWA 5EIYB 3C7OA 3T0DA 3AKIA 3OBAA 1JZ2A 2JDAA 3I3DA 4U6BA 1J83A 4XUPA 2XONA 2W1WA 1CZSA 4QX3A 5LCWL 4RN5A 2ID4A 5LA2A 5A7VB 3OEAA 2QQLA 3R67A 1JYXA 2QBXA 2ORZA 3MO4A 3ZXJA 4XVHA 4CU9A 1YRZA 3NJVA 4PF1A 1UY4A 2QQUA 2ORXA 3CKHA 3WNOA 5IFPA 3CU9A 3T0AA 1PMHX 5EJZB 1UY1A 4HG6B 4CU7A 2LS6A 1YIFA 3A23A 3VSZA 3UGFA 2B4WA 3C7GA 3DYPA 4P00B 3DYOA 4FI9A 2WAOA 2W1SA 4UDIA 2VZOA 2E33A 4UDKA 4MO3M 2X8TA 4BXSV 3BYJA 2DDUA 1JZ6A 3K46A 2B9VA 2HYXA 3ACIA 3OEBA 5JXGA 2WO2A 3WF3A 1Y7BA 1K12A 1CIYA 2WUHA 3QEFA 2JKXA 1OT5A 4A42A 1CZTA 4P5YA 3P2NA 2Y6KA 2PQSA 3HOBA 3J7HA 4BK4A 4A44A 3CDZB 2YB7A 5IHRA 5DN2A 3K1UA 1DLCA 3LPFA 2W87A 4A6OA 2W46A 5C7GA 1GU3A 3ACHA 1GOHA 1UYYA 3K75B 4ARXA 4DXSA 5B4XA 2YFSA 3WEZA 1GUIA 5C0PA 1UX7A 5F7UA 4XURA 3A22A 4OMDA 5GLMA 3OGSA 3U75A 4PQQA 2VZRA 3MUY1 1ST8A 4N1IA 1W9WA 3GXUA 2EXHA 2QQIA 3OM4A 3WASA 1YI7A 2WN3A 3LFIA 2QQOA 1H6YA 3OG2A 4KC7A 1W99A 4FFFA 3F2ZA 2Y6JA 2XQRA 3ACFA 1UY0A 3HPNA 5AYEA 3C7HA 1JZ3A 3KF3A 3THCA 4BJ0A 4AK6A 2VZ1A 3WMZA 3W5MA 1KGYA 3QC2A 3I2HA 3RWKX 4JX0A 4QX1A 4DEVA 4LKSA 4FFHA 5IFTA 3D61A 5HXMA 3VT2A 1PX4A 2VL4A 4OZOA 2DCKA 2WYSA 4UOJA 3NJXA 2VMEA 3OGVA 2ZEWA 4ZY9A 2VDTA 2YFUA 2VZ3A 3ACGA 1L7QA 3IAPA 1UXXX 3P1IA 3LV4A 2YFZA 4QDRA 4XUTA 1LNSA 3IB3A 4QB2A 5B6TA 4JKMA 3W5NA 4YPJA 2V5DA 4JKKA 1JZ8A 2WO1A 2BZDA 2RJ2A 2AEYA 2VZPA 5GLQA 3NNGA 4ARYA 3UGHA 3FL7A 4JHZA 5FKCA 2QQNA 2B4KA 1OD3A 3MV11 5DMYA 2ZEXA 2X05A 1XNTA 4A3ZA 1UZ0A 4COTA 1UYXA 1R64A 3CZJA 4QB1A 2EXIA 4TXWA 3LIGA 3ZXLA 4CU8A 3C2UA 5GLKA 2ADDA 1SG3A 3A7QA 3PIJA 2YC4A 1D7PM 3K4AA 3UGGA 3BYLA 1UWWA 5FLWA 4DUVA 3LIHA 4EQVA 1HN1A 3QEDA 4DXRA 4D47A 3HNYM 1UY3A 3AC0A 3UNPA 2W5FA 4DUWA 5JMOA 2YFRA 3WPVA 4W50A 2WN2A 4E8CA 5A7VA 2WDBA 1T2XA 5CZKA 2EXJA 2E26A 4M4RA 3SKJE 3DECA 5LA0A 1W18A 2KD7A 4ZZ8A 3WN2A 3WN1A 1NX9A 2J1AA 3EB7A 3WNLA 3OGRA 3I2KA 1YQ2A 5I0DA 2VOTA 2VZSA 1K45A 2EIEA 4PVAA 5FKBA 5A8DA 5JOZA 5FK7A 3CZUA 3D60A 4CUBA 4OUEA 4MOAA 2XOMA 5DQ0A 1W8OA 5A1AA 5JXJA 2OXBA 3KF5A 1L7RA 2WAAA 4A45A 1UXZA 4JKLA 1UV4A 3LDKA 4KC8A 2BGPA 1Y9MA 4CVUA 3GDBA 1O59A 2W1UA 2X10A 2VM9A 3AKHA 4MADA 5IJRA 5G04L 4UDGA 1CZVA 2E32A 4NOVA 2WZ8A 3A21A 3EYPA 4BDVB 1UMHA 1W9SA 4PT6A 2VQTA 3D5ZA 3HNBM 3HNMA 2QQJA 3WSOA 5JR2A 2ZEZA 1ULPA 4XUNA 4ZXEA 1W9TA 1EUUA 3DYMA 2AC1A 2BBAA 1US2A 4W4ZA 5FK8A 5JOYA 4GWJA 1CX1A 1SHWB 2AEZA 3I3BA 2C9KA 1PX3A 2WQ8A 3GGLA 1ULOA 4QDQA 4MGSA 4P02B 5JXHA 2VMCA 2W95A 3PIGA 4N2ZA 3HJRA 4LPLA 2OKXA 4ONZA 5AYDA 2W91A 4KWUA 4W8JA
chains in the Genus database with same CATH superfamily
3HEIA 3D3AA 3WW4A 4HPKA 1D0GA 2VG9A 1SFNA 3MIFA 1JZ4A 1QDCA 1AYN3 1RUD2 5CYYA 2IFWA 2A73B 1O7FA 5FMBA 1XB9A 2W3JA 4JRLA 1NY71 3DKQA 1DYOA 4YSFA 2DUQA 3JXSA 4MH0E 3WNNA 1E5SA 4GMP1 4XF9A 2ERFA 4DUXA 4QPWA 4OHWA 1S2BA 1XNDA 4K8FA 1X8MA 3ILFA 5D8AA 2G1MA 2YFTA 3O1TA 3GM8A 3THTA 4Q0SA 2D93A 5A32B 1OSGA 5G05L 2JD9A 3U37A 3VDDB 3EO6A 1NXD1 2VY0A 4M01A 1JYWA 2WS93 1F4HA 1IHMA 3F95A 3OY8A 1NLRA 2JG9B 2WWSA 2WQZC 1GMMA 3POEA 4X8PA 2W94A 4ZHNA 1CJPA 2V4AA 3KQ4B 2HWF2 4PI2A 1UYZA 3P5BA 2FMYA 3KB5A 2D43A 5FOBB 1JZ5A 1BLZA 3DKWA 4GA9A 1HXS1 4C1WA 5C4WC 2YGMA 5B6SA 1LEDA 2XKOA 3WMYA 1JYCA 4YVWB 5GLWA 4UI9L 2DCTA 2YY1A 3VBHA 2D3SA 1VBC2 3K4DA 1XYPA 4ISQA 5EHDA 4N2RA 2C9AA 4R9AA 5B4NA 3ASIA 1LESA 1FT9A 3AP9A 1NCRA 3AXDA 1BCXA 3AP6A 3PVNA 2CDPA 5FAXA 1JBCA 3VL9A 2KR2A 2WBKA 1DZRA 1FMD1 3QD6A 4Q4V2 2E6VA 2V4VA 5JOWA 1RHI2 1N3OA 2BNMA 2W2IA 3IDEA 3KHBA 4BZ4A 4OQ8A 5FJKA 3INAA 1VR3A 4FOWA 1CESA 3LB9A 5F6KA 3VGIA 5J48A 3SQOA 2R041 1YQ6A 1M06G 3WNPA 3MFAA 1OKOA 1ZA7A 4W65A 4XJZA 3WF0A 3R4YA 1IOAA 1OQDA 2VUCA 4JZRA 2OPKA 5L36A 2CDOA 4GWMA 1ENRA 4JAAA 5GZFA 2BERA 5CAZA 1OQ1A 4MGQA 1FOD3 3E5QA 4O65A 5ERLA 4LNVA 2VZQA 4TLFA 4OUSA 4QAWA 4AXOA 2JWPA 1TMF3 2WS91 2Z4FA 5DG1A 3WUCA 3WP4A 5FDBA 2G4IA 5BNNC 3ETPA 2Q0AA 4XFFA 3C3VA 1MS8A 1PZ7A 1US3A 2VJXA 3VBFC 4BB3A 3KV6A 3H0OA 4K21A 4ZPIA 3RI9A 1TG7A 2XH6A 5K8SA 2XJQA 1JU4A 3H3LA 2R0FA 4C1XA 2Q1MA 5FXZA 1CD3G 1GV9A 3ZXEA 5C3RA 5A6ZA 3AZZA 4FBFA 1S0IA 5ISLA 3SH4A 4GWIA 1PMJX 1MZEA 1DBNA 2VMIA 5C5TA 2ZZJA 1I6XA 5IVCA 5GLOA 4IV1C 5KR7A 1BEV1 5FXVA 5GM0A 4S2DA 4XUQA 3SEEA 3ZKYA 3OM5A 1DLLA 2GC3A 1LHOA 3VL8A 2OX0A 1LGNA 4YW5A 4YW2A 3OBRA 4L0PA 5T5OA 4ITCA 4FQZA 1H6XA 2J1RA 2XDVA 2P6CA 3N9LA 4A7ZA 2WLQA 2VO5A 4H55A 1Y4WA 4AOCA 1W2UA 4FTSA 5FYHA 2VD7A 3RZHA 3QZ4A 1WKYA 1OVSA 4E2QA 4CDUC 2WQ4A 3OB8A 4Q8KA 1OA4A 5KXDA 5M0TA 1COV2 2OS2A 5A33B 2Q1FA 1H9PA 2CU5A 2D6LX 1YIPA 4IXLA 4D7YA 1BBT1 5I91A 3FE5A 4AI9A 1IZ3A 2YU1A 4NAOA 3VLBB 5LZ6A 5EJ3A 4XJWA 1V6KA 2FMDA 1W39A 1HJFA 4R9DA 5IATA 1U5XA 1AR62 3LPGA 3VUOA 3AMPA 4JGZB 5ANNA 2QQKA 5FZHA 2R063 3VSFA 3ZOIA 1MS0A 2V72A 2RMU3 2WO7A 4IE7A 4NWWA 3WNMA 4UFJA 1RMU2 5FYBA 2YGLA 4LUMA 4IEWA 5T52A 1KJLA 1FV3A 2XHNA 2DV9A 5E8AA 5FPBA 1Z78A 3PVEA 1F4AA 2VMDA 4IEXA 5C5UA 4EWEA 5DUVA 5E89A 1H8VA 1HQNA 2WS92 3M3IA 3NJZA 1CAUB 2GMMA 1ZZBA 5C71A 4IDZA 4FPYA 2CGNA 4LKEA 3RQ0A 3WF2A 1FXZA 2CGPA 4CCKA 5JOXA 4RR3A 1APNA 3NQHA 1XBFA 4N43B 4XJ9A 2BVVA 2HWB1 3KQRA 3RZJA 4MZUA 3OM2A 4MHUA 5GLNA 1AVBA 3GJAA 5BNNB 2OPWA 1J3PA 3ZIWA 1H0BA 4Q27A 2ZGTA 1GSLA 1QJX2 1X33A 2P5BA 4JDNA 4YM2A 4N43A 4E8DA 1KFXL 3ACLA 4LO5B 3ZFGC 4IW3A 4Q26A 1TEIA 2ZZQA 4YZ5A 1XYOA 4LO6B 1KD7A 4IERA 1KEXA 5FY7A 3VBUA 3U07A 3PURA 1V6IA 3GZTB 1ZVFA 1Y3TA 2Z2SB 1UOFA 4JGYC 2FDIA 3KGLA 4MLOA 3WAUA 1GYDB 1DZTA 3AVSA 2I07B 2JG8C 1WL7A 2P37A 4CEWA 1RHI3 3VD3A 5I8SA 2D3PA 2R061 1DQ1A 2ZAAA 4DFSA 2XMLA 4KCAA 4GAZA 4MX3A 4TN7A 1C3HA 3MIBA 1GQPA 3ECQA 2BGCA 3MEPA 2O1QA 2A70A 3JCIA 3I3QA 2BFUS 4KI5M 3KSTA 4H7LA 3M7AA 1EP0A 3MPBA 2ADEA 1QJU3 2WR9A 5IK8A 1PIV2 4Q4W1 1LTEA 3VZLA 1F5FA 4UFHA 2BYVE 4IE4A 3DXUA 4OMCA 3W9AA 4J1XA 3VDCA 3MFCA 4IGOA 5LBEA 4B29A 3OUHA 5A3NA 5JXIA 2QQPA 3T30A 1I5PA 2JDNA 4IEVA 4CP9B 1UX6A 4PDWB 2DTYA 3MI8A 3NAPC 5LB6A 3ZSMA 4YARA 4QPGC 4YFWA 1POV1 1XC6A 3KCXA 5DDJ1 3HBZA 4LO8A 3FFZA 5H9RA 4JV4A 4CP9A 5BUVA 1W8NA 4O8NA 1EAH1 3VKNA 2Y64A 2E31A 5FYYA 4MYEA 1J59A 3VKOA 4CCJA 1ND2B 4Y4RA 4Z2AA 5J96B 4XXPA 2B8MA 3VD5A 4QQHA 1GZCA 5F3GA 5EIYB 4AGRA 4DMIA 3T1MA 1C8NA 1HX6A 3IPVB 3KM5A 5FZLA 1DGWA 1VBD1 3Q8FA 2XONA 4XUPA 1W8TA 2HEVF 4NIHA 1MZFA 2WNUA 2WFF3 1RMU3 2ZHMA 3ZSEA 2WZR1 3IZOA 3FZ3A 5J09A 4XVHA 4NJ4A 4Q4Y3 5C8WA 3W58A 1W28A 2QQUA 1EAH2 1OLRA 1CN1A 1K5MC 1S55A 2ARAA 3AMNA 3TEZA 4AGGA 3OBTA 4HPKB 1AHSA 2XWJB 3MGUA 3MPPG 5IAXA 4CSWA 3T0AA 1PMHX 4CU7A 4UBHA 3VSZA 4OLLA 3S30A 2P3IA 1ASJ3 3C7GA 3DYPA 5T50A 2WAOA 3R6SA 3U1XA 3VBRC 1LR5A 4WVMA 4CCCA 2MEV1 1A3KA 5IVJA 4XTPA 5C33A 3DV8A 1O5UA 5D8AB 4YZ1A 1W6QB 2Z5WA 1UOBA 3K46A 1V6LA 2B9VA 4P9JA 4QQOA 3R4UA 4WVMB 5I8TA 1WW7A 1K12A 2WUHA 3QEFA 5C2MA 2NM1A 4GULA 3EXUA 1S0CA 4A42A 1RITA 2A6YA 4JQRA 1A8MA 1ZX5A 3T2TA 5I0TA 4LBOA 1K5MA 1BKZA 1YJLA 2D97A 1JMUB 1QH7A 3LAGA 5C8CB 4LK6A 2PYTA 3JQXA 5KXEA 4NRQA 1CQ9A 4LULA 4Z92B 3GNEA 5D2AA 5JZGA 2W46A 4ASMB 5T5PA 5C7GA 1GU3A 1YO8A 3ACHA 4EN0A 4EZ4A 3MLJA 5B2GB 1W6MA 4ARXA 4MUVA 3RJ2X 1MACA 5FP7A 3TBDA 1VBB3 1WBFA 4BMEA 3OOXA 4CZSA 2NQYA 1W6NA 1ZYBA 1JTZX 2ZX4A 5EQUA 3NSTA 2JXAA 3M3OA 5JSOA 1I9RA 4Z8BA 4I01A 5BY5A 4P9YA 2VBDA 3HQXA 2HWE3 5K0UB 1SBDA 3H1MA 3JUUA 1T6GC 1V6MA 2RM23 4QD2A 4Y33A 1GICA 5CFCA 1CAUA 3WASA 2WN3A 3WHUA 4PIZA 4YM1A 4RHV1 3O0VA 2TUNA 2R6QA 1CX4A 2LROA 4P9LA 4DINB 3B02A 2XQRA 1UY0A 1D4M1 1BZWA 4K3UA 1F8VA 3KF3A 1QHDA 4AK6A 1KGYA 2B9UA 2DCZA 2R30A 3WUDA 1CAXA 5CKMA 3RI8A 1IS4A 1VBA2 4BYYA 4FTBA 4AVBA 4A7KA 5LWBA 5HXVA 2ZPXA 4OVEA 3VKLA 1O91A 1QNYA 4HN1A 2OVUA 1SMVA 4XCAA 1SCSA 4CDQB 4ONUA 3BCWA 2PHXA 4CCOA 3HD8B 2PHUA 2XLFA 4XF4A 2DCKA 5EWSA 2IXIA 3OSDA 3PVOA 5I93A 4D7TA 2VMEA 3NJYA 3K2OA 5E1RA 2BNOA 5FUPA 4DIQA 3OGVA 3O0WA 4UBGA 1H2KA 1HRI1 3IAPA 1L7QA 2ZX0A 4CDUB 1Z0HA 2JG9C 5CA6A 1LNSA 3NNFA 2UU8A 4IV3A 3W5NA 4Y20A 4D3WA 1S4CA 5FZGA 1JZ8A 1AL22 5CB7A 4RS5C 2BZDA 4NROA 2ZA9A 4JGYB 4NN0A 2YMZA 4Z07A 2RR12 3MF9A 1W8FA 2IXHA 1YUDA 2RM21 2B4KA 4XABA 4Y20B 2NZ9A 1GP6A 1H8TC 1MEC2 3VBFB 1KJRA 4S2FA 2BRTA 3QH7A 1UYXA 4SBVA 3H7JA 3GCWA 3ZXLA 2VNGA 4E4ZA 4FSJA 5GLKA 3KCYA 1RC6A 5EXOA 1QH6A 5IVYA 3KT1A 3UGGA 1Y9QA 4IE0A 1KXGA 2VH9A 5SV5A 2X53S 3LIHA 1HN1A 3QEDA 2XBO1 1CIWA 1XNBA 1ZBE2 4FO9A 4V2VA 1QJY2 1CR7A 2A6XA 2NMNA 1QKQA 3L9JT 3WPVA 2XJUA 1TME1 3AJZA 4COWA 1YJKA 2WDBA 2NLRA 3AJYA 3GYDA 3KVAA 3MHZA 5CZKA 1WWYA 3CLPA 3WP5A 1VB2A 5FZ9A 2IZWA 2PHWA 3WN2A 2C6SA 2JECA 2KD7A 3AZYA 3S7EA 4ZZ8A 3WN1A 4BMBA 2WSVA 2ZGRA 5BNOA 3EB7A 5IUQA 4XILA 4ES9A 3I2KA 2ARXA 4D69A 4BQWA 4PF5A 4QHBA 1LOGA 3HT2A 4YGCA 4UF0A 2Y38A 3FBMA 4F3JA 1MEC1 1H1MA 5EP9A 5F1RA 2BV4A 5C4WB 2RMU2 2E53A 5BNNA 1BEV2 2W39A 1XNKA 3N35A 5A3LA 4IESA 4AZZA 4UF0B 1H30A 3J8F1 1RUD1 2ZX1A 1U12A 2OXBA 4XF1A 2JG9A 5A1AA 4Y26A 1ONAA 5DZGA 2O8QA 1HV0A 4RGKA 2HEWF 3AVRA 3CO2A 4A45A 4YM0A 2YDEA 4CCLA 3JBG3 3LDKA 4LJHA 5CU1A 1COV3 3QBQA 1HN0A 1OPMA 4A2UA 2DVBA 3KV4A 4CVUA 4G3YC 2ZKNA 2W1UA 1QJY3 2F17A 1H1IA 4GJZA 5A6YA 4BIOA 1OKQA 5IJRA 5K4LA 1GLHA 4HSJA 3VBSA 2JX9A 4FP3A 1CZVA 2P3YA 2XB6C 3AL6A 1I5ZA 3RYRA 4CCNA 2VUJA 2Y6FA 1X82A 2FDJA 5DZEA 5F3IA 3S5AA 3U4SA 4LR4A 4QHOA 1WBLA 3VBSB 2VNOA 1WLTA 2FCTA 1YQ5A 4QGNA 4CEYC 1N3QA 1XYNA 1J3RA 5L7OB 2VMHA 1Q8SA 4J1WA 4Z2WA 3TAYA 4GB33 2FDHA 1C8M3 3BPZA 3V64A 3V65A 3SCGA 1JYTA 4GWJA 4UFIA 1O3TA 3I3BA 1PX3A 2WQ8A 4QDQA 2A7AA 2PQQA 2A1XA 3E6DA 4MGSA 4P02B 4AYUA 1MEC3 5IWFA 5K9YA 4N2ZA 3ELNA 2CTVA 2MEV2 4CP2A 5JIAA 3O1UA 3CU7A 1ZZ8A 1SFYA 1AL0G 4KWUA 4NPLA 4FOQA 4ET7A 2PLV1 2R043 5DZFA 2VXJA 5DXDA 1RUE1 3N3HA 2WZEA 1C4RA 1DHKB 1S0FA 1OLMA 3ZFFA 1S0DA 1JOBA 3JBG1 1V9U1 1E5RA 3AM2A 5FO9B 2PA7A 4UFLA 3DF0A 3SEPA 3VBHC 1NA1B 4ZZ5A 4AFMA 2YG0A 1MZ6A 3FUOA 1N1YA 1XU1A 5KWRA 4KGQA 4LIVA 5IK7A 3THPA 1NOVA 3QEEA 4DXTA 1VLNA 4TZDA 4DQAA 1G9CA 4GMP3 4FPJA 3S7IA 3I97A 3KHCA 2EICA 1SLCA 2VBPA 4UAPA 2D6PA 4XQ4A 4KH9A 1D0HA 3LEGA 2QQMA 3LEIA 4QWNA 3ZYGA 3ZFGB 5KC5A 1U5YA 2JDZA 4LBMA 4BQ4A 3N7KA 1C8M1 5LBFA 1W6QA 3LE0A 3KWVA 5F37A 3J7MA 3U14A 1XXNA 1VAKA 3RFRA 1YFYA 4JGYA 2P2KA 2HWD3 2WNVA 2Y6GA 4HKLA 4CA9A 4MGTA 2VQ0A 1LHUA 1LU1A 2J1UA 3PTYA 1H1AA 2FHRA 4PBOA 2WNEA 3RZZA 3E6CC 2AYHA 4L97A 5LBCA 2EIDA 2WNVB 4LK7A 5DG2A 3BYKA 3N9MA 2A5ZA 4O8OA 3K77A 1NKGA 1PO12 4TWTA 2X5IB 4TTGA 2BEOA 4Y1YA 2VCCA 2VC9A 4HANA 3WLUA 1R092 4DZGA 5I0RA 5AYCA 4MHRA 3PMEA 3MV01 5A3PA 2WINB 3AB0A 3WQBA 4LTAA 4YRDA 1GYHA 4FT8A 1QQP2 4W6WA 2BNNA 4XIOA 4AK5A 1FMD3 1WCUA 3KT7A 2VCBA 3N36A 1EY2A 4FOYA 1VBD2 2YPJA 2X8KA 4HL0A 3POYA 3VT1A 2UY9A 4Q4Y2 2PTMA 2DBNA 2XLAA 3H8OA 1RVF3 4YW6A 4GH4C 2C26A 4JCKA 2I74A 2ZX3A 4P08A 1PO11 1SPPA 3WATA 2FDKA 1V70A 1BHGA 2R1DA 1UKGA 2WWJA 3OYWB 4B4PA 3RWNA 4OI2A 5EYYA 4KWKA 4BQ3A 1CPMA 3E1F1 4HLTA 4QQPA 5LRRA 3RSJA 3I2IA 3B9CA 4QXHA 4AEDB 1OH4A 1MPXA 2V09A 4HFSA 1PVC1 2CY6A 2EXKA 1XOYA 3HBKA 4B8EA 2PHRA 4PLMA 1O3RA 3ZR5A 3POJA 5JUVA 4Q0UA 2ZACA 3ZN6A 3ZSKA 4AI8A 2OZ6A 2QNKA 2ZGPA 2JE9A 2Y6LA 2HWC1 2HWB3 1PGW1 1ULCA 2WNOA 4FPCA 4URAA 3PU3A 1Q56A 1W3VA 1CPNA 3PTRB 4NOTA 2W47A 2ET1A 1JHNA 4FP2A 2RR11 1H2NA 1PNGA 2QCSB 2R7EB 2QQVA 2VOKA 1R093 4X8NA 2DCYA 3OJBA 1OFSA 1PK6C 4JTNA 4KWLA 2TEPA 3ZYRA 1G8WA 2X29A 2P3KA 2AACA 2WNVC 4OHXA 1OF4A 4WM7A 4ZU7A 2BOJA 1O8SA 5BNPA 3LEKA 3IBMA 1W06A 4Q2FA 5IYYA 1Y9GA 4CUAA 4CTEA 4CEYA 1NAEA 4ZS3A 4FFGA 1L3JA 1UO9A 1F9KA 4QM8A 1IS6A 3MF6A 3O7OA 4D8MA 1QJFA 3I2GA 4O7XA 5EJ1B 2Y6HA 3MLLA 5EZWA 1ASJ1 4IV3C 1JU3A 1RUF3 5FJHA 1UNBA 5IVFA 5AC91 5L9BA 2GP5A 1B35A 5L7OA 4XAEA 3RMYA 2SBAA 4AAPA 1IPKA 1GNZA 4QXCA 4C8DA 4LUKA 4AI2A 2D7FA 1PM4A 1VALA 1YQCA 2CV6A 5FIXA 4LQRA 4OI0A 3VDAA 1BMV1 2VECA 2VVEA 5FZAA 1GWLA 3I2FA 2YC2A 4C91A 1ENSA 1DP0A 4QPGA 3N4MA 5FQ0A 5GLRA 3OPWA 1LGBA 4UW5A 5FBZA 3GALA 2VOXA 4ZONA 4OI1A 1LULA 2B46X 3IPVA 4BPZA 3OUJA 2A3WA 1RIRA 4N4BA 1AR93 3UETA 1V0AA 3VHPA 4I0BA 2D3RA 5IAVA 3WNKA 4UW3A 5I0SA 1FI2A 1R1A1 2R0HA 3BYNA 3PUAA 5DAXA 1FX5A 3T09A 1GYEB 1DQ2A 5DABA 3BKZA 5CFDB 3R0RA 2LUWA 4I0AA 2RR13 4LXLA 2AH2A 2RVAA 2W0XA 1WLWA 2BP6A 1EV13 4F8AA 5CNAA 3EQEA 3FJSA 4BK5A 4LEJA 4CPBD 2R16A 1Z7S2 3N9NA 3G6JB 4KBBA 3R4DB 3WOGA 2W68A 1NLSA 1AYN2 1J84A 3HN3A 4XEZA 3ZKUA 2C1FA 1WCQA 2RJLA 2PN5A 5FPLA 3SNMA 5I0UA 3SLIA 4AHYA 4YG0A 2I45A 1YI9A 2BDRA 2LRPA 5ACA3 1ZNPA 3WG3A 2JDHA 2XVLA 3KS7A 3R05A 4GQ7A 3ILNA 4XUOA 4B7EA 1GNHA 4A41A 4U6DA 1RJ7A 1OA2A 4XDOA 5FUIA 2IXLA 2XJSA 5GLZA 2WABA 3AKTA 2AZ5A 2JE7A 5FZ0A 2E63A 4XE9A 1SLAA 3VBSC 4MGIE 3VZOA 2A71A 4N53B 4A4AA 1RTVA 3TN91 4QX2A 4BLJA 3BN6A 4AVCA 1GOFA 2X5IC 3M2MA 1OVPA 4JGZC 1X50A 1OLME 1AJOA 3MUZ1 3D6EA 4QDSA 4YLZA 1IG3A 2FQPA 4XZUG 3S6PA 1ZBA2 2R071 4CU6A 3H8RA 4Z82A 4EE2A 3BOWA 3GHNA 4IUGA 4L2NA 4UW4A 1HRV1 4P5HA 2DTWA 3LSEA 4EN8B 5JWPA 3LOBA 3C8XA 3ILRA 4Q4W3 3SMHA 1O4ZA 1N1VA 2XL7A 4XHXA 4XAAA 4BCUA 1GP4A 1LENA 2BWCA 4X6RB 2E7QA 4H7MA 1GR3A 1G9DA 1XNAA 2P1BA 2VNRA 3IDAA 1Q8PA 2JDUA 1O4TA 2EF6A 2GMPA 4YW7A 2VQUA 2ZS6B 1K3IA 5A7WB 1IQAA 2JDPA 3C7EA 5FMCA 3D0SA 1H9WA 2YU2A 4XACA 1IG0A 2EIGA 2WT2A 1EAH3 4R9CA 4AL9A 5A6XA 1OH3A 3UKNA 2C0ZA 2W1WA 4QX3A 1YC61 1RUG1 4RN5A 2ID4A 5A7VB 3OEAA 2QQLA 3I4IA 1NA1C 4CRQA 2ORZA 2ZGMA 2QVSB 3MO4A 4V2WA 5FZ7A 1PMIA 4H2AA 1ZRDA 4CU9A 1URXA 1WMDA 3N7MA 4BIFA 4L9BA 2I2SA 2R49A 3APBA 3L2YA 3WNOA 5IVBA 4MXWB 2WFF1 2YBPA 2QJVA 2WZR3 3N9OA 4QGLA 4QQLA 4UYBA 1PK6A 4HETA 4CDQC 1I1EA 1YIFA 1ZBA3 4HG6B 2VCMA 3A23A 1PM7A 3DYOA 3WZ1A 4I2OA 4Q4V3 4UDIA 1VP6A 2VZOA 4MXWA 2CWMA 1RUOA 2TNFA 4FAGA 3PUQA 2XPJA 1TME3 4Q4W2 3BYJA 5APAA 5LK5A 1W8WA 3CJXA 2XG3A 1DGRA 2D6NA 4OFGA 5FREA 3KSCA 4KGGA 4RFRB 5BNQA 1AR71 1AR83 1OC1A 4YVSB 2UYBA 1OT5A 3ZYFA 4M00A 4BOWA 1AF9A 1SLBA 4CEYB 5FO7B 2BBVA 5FYSA 3P2NA 4ZS2A 2Y6KA 3NV4A 2DYCA 2FZ1A 4XHBA 4M0HA 4R8HA 4YVSA 3ZXDA 3K1UA 3JB4C 4BLIA 1S0BA 3LWCA 3HT1A 2XJVA 1PGL1 1W6PB 3GCXA 5CKNA 1B35B 3IN9A 1IPSA 4QKDA 1BK1A 3WG2A 5FY8A 1FNYA 2JB8A 4CDXC 5FR3A 5B4XA 4LBQD 5IK5A 4PDWA 1GUIA 3V0AB 2IUWA 1UX7A 5F7UA 1FAYA 2HJIA 2JDMA 3ITQA 4XURA 5C0PA 2A75A 1RUC3 4NWVA 1UPSA 5C3OA 1A34A 4MVTA 4XZPA 4OMDA 4Q0PA 4ASKA 2R062 3OGSA 3U75A 3ZYHA 3VZJA 4OI4A 3MUY1 1ZBA1 2R072 4KU8A 1W9WA 2IXKA 4QPYA 3RYKA 3AP7A 1W90A 2QQIA 1AX0A 1G9AA 4NIGA 2CNAA 3LFIA 5IVVA 1H6YA 3OG2A 4N90A 4KC7A 3WP3A 5HBAA 3ZDSA 3F2ZA 1ZRCA 2Y6JA 3M3EA 5A1FA 4C0BA 1JZ3A 2DF7A 2B7YA 2GN3A 5IT6A 4HK9A 4CDXA 3AMMA 5FPAA 4AI0A 2D5HA 3Q9OA 5L9RA 4WZFA 1IPJA 3HQRA 4GH4A 3GZUC 1D4M3 4JX0A 4QX1A 4DEVA 3IM0A 2UYAA 4NIDA 4FFHA 2E9QA 3BU7A 4OZOA 4WM7C 5DAWA 4ATFA 3POGA 5GLUA 1DYPA 1AYM3 1PZ9A 1YCIA 4ZY9A 2VDTA 3VBOC 1HQLA 3O1MA 4E2SA 3AXEA 4PLOA 1YFWA 3ZIXA 1YYNA 4AVTA 2UWCA 4JKMA 2J42A 4YPJA 3DPRB 4L11A 2VUDA 3Q8EA 1I3HA 2WO1A 1OI6A 2YBKA 1SDWA 5GLQA 2ZMKA 2CL2A 2HEYF 4QPIA 4LT5A 1FV2A 1OD3A 5C8CA 4KU7A 1HB1A 1XNTA 3H1YA 5F8PA 4A3ZA 5FXWA 3BB6A 1UZ0A 5FY1A 4EN6B 3NWKA 3UYJA 4CU8A 1MQTB 5J37A 2WKKA 5T5LA 2ADDA 3MW3A 2LM3A 2D6KA 3PIJA 2EAAA 2YC4A 5H9SA 1W6NB 1LRHA 3BYLA 3WINE 1UWWA 5FLWA 1S0EA 2BPA2 4AQ6A 4XMIA 5CFCC 4D47A 3ORJA 2K2SA 1JODA 1WW5A 2VGDA 3P3NA 4YM3A 5FPXA 2H6BA 5JMOA 3WT3A 2YFRA 1GZWB 5DDJ2 4E8CA 3WDVA 5FPUA 5A7VA 1U5ZA 2DUPA 3IDBB 3OGGA 1SLIA 4AHWA 1R1ZA 3CL1A 1ZRIA 2XBO3 4YW4A 2B45X 4TYSA 4LO7A 4AFDA 2VNVA 4PI0A 3U78A 3SKJE 2Y60A 3DECA 5KXBA 3ZFFB 5LA0A 1DGRN 3VV1A 4AHZA 1OMIA 1RUG2 1UPIA 2EALA 2IXCA 2WT1A 1BEV3 1UZZA 2GAUA 3OGRA 5ABJB 2GZWA 2RS11 4XTMA 3VBUB 5I0DA 1J3QA 4N9HA 1DF0A 5FTTC 3TNPB 2XR4A 3AZWA 2TBVA 2VOTA 4W6XA 3ZFFC 1BYHA 3L2HA 1REDA 2EIEA 1NCQC 4K1ZA 4CP0A 4PVAA 3NMBA 5FK7A 4N7IA 3NNLA 1POQA 1XSQA 4CUBA 1IS5A 1VJ2A 1ACCA 1VBC1 3VBOA 3SCFA 5EYXA 3KV5A 4Y4YA 5JXJA 2YV8A 1DGWX 1FOD2 1WA6X 3KF5A 3AZVA 4N7UA 2WAAA 3USUA 3FLTA 2R1BA 4TSVA 1RUH1 3BTXA 4I3GA 1RL3A 1C28A 3J8F3 2P6HA 1QJU1 2BGPA 2G19A 2GNBA 1Y9MA 2PAMA 2NYYA 4RS5A 2OZJA 2FDGA 3AKSA 5AFBA 3WCRA 5HI0A 5G04L 3NAPA 1EV12 4COUA 1QY4A 3B5LB 4NOVA 3EYPA 2Y0OA 3WDXA 4BDVB 4BQ5A 1QIQA 1AL21 3QACA 4PT6A 1LCLA 2XVKA 5T54A 5JCTA 2VQTA 2X5IA 4LOSA 3OPTA 3HNMA 1NCQA 3ZFEC 1VBA1 5D1IA 1R083 4Y24A 3P3PA 3MDPA 3EMRA 4XUNA 2Q5TA 4ZXEA 4BU2A 1R091 3ZXGA 1W9TA 3J7NA 4Y22B 1LB2A 3DYMA 2AC1A 4NIIA 1LEMA 4K20A 3I7DA 5KHIA 1US2A 4W4ZA 2WT0A 3AP4A 1CX1A 1SHWB 2RS13 1DU3D 5FZIA 4Y22A 4YZ2A 4DB5A 2VMCA 2W95A 1QOOA 4UFKA 3PIGA 1RMU1 3WQ0A 2B39A 4LPLA 1UL9A 3I3MA 5AYDA 1XNCA 1UF2C 3AX4A 1CAVA 4JVAA 4DOUA 1QOTA 1AJKA 2A6VA 5CEHA 4W8JA 1VBC3 1Z7S3 3USSA 3ZN4A 3OYWA 5FP4A 1C8M2 2VVDA 5FY9A 1VB4A 1B09A 1CAVB 3DEMA 3RZMA 4DXZA 4KMQA 1OA3A 1RUH3 3LOIA 4WM8C 4XQWA 4I02A 4YGEA 5GKAC 1ZRFA 3ABZA 4NE9A 3V0BA 1V00A 4RHV2 1RUI1 5A32A 2P4EA 2QDNA 1RUE3 4NHYA 1QWRA 5BXXA 2RS53 4AWDA 4F83A 4N53C 3VB9A 3WPUA 3VHOA 1LHVA 1GZTA 3JZVA 3LF7A 1C57A 4M3CB 2PMWB 3WXPA 2ZGLA 4ZU5A 2DVDA 1ALYA 3DXTA 5FRAA 1TNRA 1A8DA 1PK6B 2GDFA 2JIJA 4JDOA 3ROUA 1FPN3 1RGSA 3WY6A 1GANA 1PO22 1DQ4A 2OIIA 1K42A 5IK4A 2D44A 3T2OA 3BTAA 1WMXA 2AGSA 4M3CA 5KC6A 1RYYA 5FPVA 3N9QA 5JVVA 3PDQA 4H3WA 2C4XA 3LQCA 4QHZA 1MS4A 2XUMA 1RXGA 5A7OA 2RS33 4LBQB 5FY0A 3K3NA 4AF9A 5D21A 3BIEA 5J1XA 3ZDVA 1QJZA 2XVGA 4QX8A 4BA6A 1Q8OA 4CCDA 3O12A 4P9WA 4M3CF 5E6HA 5DDJ3 3WW1A 5GZDA 3JD71 2PAEA 3MICA 4G9SB 5FV3A 4XF0A 4CDWA 4EV0A 1W0OA 4ISRA 3VSRA 4W6YA 1W2TA 3B93A 4IEPA 2XJTA 4Q0QA 5JSRA 1MQTA 3VBHB 4E4SA 3DL3A 1L7LA 2Y8KA 3KLSA 3QOPA 3POWA 1H2LA 1CWPA 4O9GA 1VBD3 4LE3A 4UT5A 1ZZ9A 4AFCA 1NCRB 4IETA 2FDFA 1NE6A 3E5UA 4QB6A 1JXNA 5JMCA 1RVF2 2Q30A 4YVWC 5GZEA 3BTZA 3VZNA 1W9YA 4Q4X1 4Z1VA 2RDRA 2H0BA 1O8PA 4LKFA 4XMAA 3UV9A 4MG2A 1PO23 2OQ7A 1JYNA 2J7MA 1EYBA 1G6NA 5CFDA 1FMD2 1Q8VA 5HV4A 1YFUA 1CVNA 1FPN1 2ZHLA 2DVGA 3VDBA 3BYWA 4EYUA 4Q5OA 5JLVA 3LZZA 1AR91 4RYDA 4A3XA 1AXKA 4S2HA 2V5YA 3AKQA 1UOGA 3MBWA 4NHLA 4Q4X2 5CVRA 1Y43B 2WNUC 4RGAA 2OQ6A 2BFUL 2VTXJ 3SITA 3WHTA 4B1LA 1JN2P 1WD3A 3KV9A 4IEUA 3PHMA 3JD73 2ZBJA 4LHSA 4HBNA 4WZCA 3KMHA 3T2PA 4U36A 1TVGA 3POSA 2L9LA 1POV3 5FMDA 1VBE1 4GD4A 4RS5B 2RV9A 5BV6A 2HWC3 1YLLA 2K9ZA 2ENRA 5HV0A 1AR82 2D5FA 2WL1A 5FMOS 2ZOEB 4R4XA 1VAMA 5F32A 3CJIB 3RRDA 1JYVA 2OT7A 4GALA 4NPMA 4D0QA 1W2OA 4I0WB 3VD9A 4YZ3A 2GC1A 3GBFA 1IS3A 1BJQA 1GWKA 2XXZA 4FPOB 3LD8A 4JGZA 5JDBA 1PNFA 2O0OA 1PHMA 4Y5Z0 3KZ4C 1TMF2 4COVA 4Y3OA 4EN7B 3IWZA 1ZZ7A 3ZPYA 4Q4Y1 4QQ2A 1OYGA 4DRRA 3BTYA 4AK7A 2KA3A 3LDBA 4EROA 4PVIA 5HCBA 3IIIA 4LORA 3URFA 3BUCA 1CAWB 3W59A 3VDDC 3WCSA 2R073 5AY9A 3M3QA 3VSSA 4L92A 4XIKA 4HK8A 2NMOA 3NVCA 1KS5A 4IV1B 1UW8A 1QJEA 2MEV3 4ZXKA 5FYUA 1GP5A 4OZXA 3E5XA 4QX0A 4XW3A 2BWAA 5TSWA 2QDRA 5BNOB 3LCPA 2RDNA 2ES3A 3WG4A 4AK3A 1W2AX 2F4LA 4BQYA 3B69A 3T0BA 5F2SA 1JOJA 2J1SA 2XHKA 1AZDA 3CIHA 4JTOA 3I59A 1G9FA 4Y1VA 3WF1A 3ZXAC 1SPPB 2A3YA 2HLEA 5FZBA 2Z79A 1LOAA 1R1A3 3QLQA 4O8PA 3CF6E 4MGZE 4KCBA 2UY8A 3I2JA 5FPZA 3VD7A 1RUC1 4RR3B 1NQDA 2HWE2 4FOVA 3SKVA 2QQWA 3AZXA 1OF3A 3LDRA 1E5IA 5ABJA 1NZCA 2ILMA 1WLCA 4META 1ND3C 2DURA 2HBTA 4O9EA 2XUEA 4AI3A 1J1TA 5FBJA 4RL7A 5ACA2 4KWJA 3B01A 2Q8OA 3ZFEB 3ZSLA 4YWAA 3U0ZA 4KNCA 1SQ4A 5FYCA 4CDUA 3D82A 2QTWB 5FYVA 3Q8AA 2ZXQA 5DAPA 1C1LA 3JQWA 3ZFEA 1NQJA 1GNYA 3M70A 1VMJA 3FHQA 3RPQA 2ETEA 1UMIA 2VBBA 3MIEA 4QX7A 3VKMA 3RGBA 1NT0A 2PLV2 2FBEA 2YC0A 5FY5A 5J36A 4X6QB 2VU9A 1WCSA 2H6CA 4FVVA 1MS5A 4P14A 4BM8A 4HVQA 5KXCA 3VBRB 5FYZA 3RDIA 4BWOA 2ZMNA 5JR7B 3OM6A 5DPNA 3T2QA 1ZM1A 3TEXA 4BQ1A 3BI3A 2W92A 2WA4A 5J98B 5EFUA 2VTFA 4C90A 4Q1PA 1UAIA 3WPYA 2W9XA 1CJDA 1S1AA 4LHKA 2JG8A 5FP3A 1XE0A 1KFUL 2BGOA 2J1EA 3ZYJB 3TAWA 1GKBA 1ZZ6A 4WVVA 3C7OA 3B94A 4AEMA 3ZMOA 3E6BA 1JZ2A 1DFQA 2JDAA 1YWKA 4ZU4A 4U6BA 3DPRC 3NNMA 4IEOA 2GSYA 2ET7A 4FXKB 5LA2A 3WQ7A 4P9GA 4YYOA 1JYXA 2QBXA 3D5OA 2DFCA 2F4PA 2QZ3A 2A6ZA 2F6BA 3AYDA 1YRZA 3NJVA 4MSVA 1UY4A 3MIDA 2ORXA 3M8LA 3CKHA 3POFA 4PF1A 4MGKE 5C6CA 1HIXA 4DY5A 4K6BA 1KDKA 3X29B 2A6WA 3WV6A 2A3XA 3MIGA 4NO4A 3D4KA 1R082 3W20A 5IFPA 1QJU2 4UW6A 1QJY1 1UY1A 2HKXA 3POIA 2VW2A 4FPLA 4QXKA 1WCDJ 1KRIA 2B4WA 1ZBE3 4P00B 4E27A 4IGPA 2W1SA 5A80A 4GKYA 3A0NA 5T3NA 1FOD1 1QXRA 1MR5A 4CEWC 3J8F2 4BXSV 1DYKA 1WZXA 1JZ6A 1TMF1 4HVOA 3LKJA 2HYXA 4JC1A 5FLIA 4IL7A 5FQ0B 3ACIA 3T4VA 4Q4V1 2WO2A 2XJRA 2ZGQA 3WF3A 4AQSA 5GZCA 4C0HA 1NXMA 1W2NA 2JKXA 5ANQA 5JI7A 1W03A 1CZTA 2FD8A 4P5YA 1B35C 4QKNA 4GJYA 1OFNA 4MXVA 4BK4A 2PQSA 2WLPA 5FZEA 2ZGUA 5LW9A 2WFPA 4LBNA 4QPIB 1D2SA 1UN1A 2YB7A 3CDZB 4XJAA 5CBLA 1NG0A 2HH9A 4QXBA 3WD5A 4INDA 1E5HA 4M0NA 4OHZA 4A6OA 3PMSA 3SCHA 2RDSA 4XFAA 2WZPP 1NZIA 4AGVA 1GOHA 2RG4A 1HXS3 4WVWA 1UYYA 2CAVA 3K75B 1S2EA 4XFBA 2PHFA 4YVWA 5GZGA 1NLQA 3FHIB 3ES1A 4QU2A 3HR9A 3WEZA 3TRSB 1BQPA 4CXWA 1PVC2 1T6BX 1YFXA 3DGTA 4L8QA 5FZ8A 3A22A 2VW0A 4DS0A 5K0UC 3AKPA 2PLV3 3JB8A 5GLMA 1RXFA 1VE0A 1LJ7A 3KVBA 4YG6A 3ZO0B 3AYEA 1AR92 2VZRA 4N1IA 1G7YA 3AP5A 5A7WA 2ARCA 3BPSA 3GXUA 4M3CE 1QEXA 1RUD3 5GALA 1YI7A 3RJRA 4XBQA 4FPKA 5JPNB 3HIFA 1LOBA 1UD1A 1LGCA 1W99A 3I59B 1MS3A 4FFFA 5A3WA 1NY72 4KQ7A 5ABJC 3ACFA 3HPNA 5AYEA 3C7HA 4J6GA 2YHJA 4RQPA 4LBKA 2D6MA 2RDQA 3IT8A 3W5MA 1BVP1 2BW8A 4PDWC 3I2HA 4B4QA 1N1SA 5IW0A 3RWKX 1CONA 1Q3EA 1UIKA 3OCPA 4EN9B 2WFF2 3D61A 1HXS2 3VT2A 1PX4A 2VL4A 2XWBB 4FPHA 1X7NA 5GLTA 4RFT0 5LEKA 1X8EA 3D8CA 1HW5A 4UOJA 1LODA 1FPN2 3FUQA 2RS32 2ZEWA 1Z7S1 1WGPA 3BOPA 2YFUA 3K51A 1OBNA 3ACGA 4GB31 1W05A 4QU1A 1UXXX 4XF3A 5AVPA 2YFZA 4YG3A 3LV4A 5FZ4A 2EAKA 3IB3A 5B6TA 1E57A 5DUWA 2V5DA 3S5QA 1HB4A 1XSRA 3MW2A 4YW3A 4F7ZA 3S0MA 2XKPA 5A7QA 1ZREA 2WWUA 4IEZA 4LA3A 3WQ1A 1UOJA 5L7OC 4IQPA 4AVVA 2AEYA 2VZPA 1W6OB 2RS51 3NNGA 1NYWA 3FL7A 4AFAA 4ARYA 3GBWA 1RUJ3 5FKCA 3TWIA 1POV0 2QQNA 1J1LA 3FBYA 1TL2A 4RSUA 4DO0A 3MV11 5DMYA 5C9AB 1MZ5A 2X05A 4CYDA 1SEFA 4CCMA 3IIAA 5F9TA 1OD5A 1W6OA 2H0VA 3CZJA 3SHRA 4TXWA 1WA4A 2GU9A 2WIIB 4EZHA 1V9U3 5KHKA 3C2UA 1DQ0A 3WDUA 4HT1T 4K1YA 1SG3A 1QF3A 2ZCWA 1ND2C 1Q43A 4XBNA 4COYA 3U10A 3ZSJA 1ASJ2 2WYFA 2HWD2 1CAWA 2RMU1 3CNAA 4UXAA 3UKVA 1OLQA 2WA3A 2HYKA 2WC2A 3N9PA 5AC92 1TE1B 3LA3A 4CCEA 3A4UA 1C1FA 3AFKA 2EXJA 1LECA 3WDYA 5A3MA 2E26A 2PHDA 1TNFA 1PVC3 4LIUA 2JKBA 2GC0A 3PJQA 3J26N 4HOOA 3LA7A 3TB0A 5C8CC 3O1SA 4QM9A 5C3QA 4D6RA 1OQEA 1PVXA 1NX9A 1H4HA 1STMA 2J1AA 3PU8A 2VW1A 4K9SA 3WNLA 4D6SA 5A70A 4QT6A 5ACA1 1YQ2A 5E16A 2AUYA 1MVEA 4XCBA 2VZSA 1K45A 4AEDA 1BK0A 5FY4A 1LAJA 1QU0A 5FKBA 5A8DA 5JOZA 5HCFA 3I54A 3TNQA 3CZUA 1RUJ1 5A1LA 3D60A 1VRBA 2DWRA 1D4VB 2BU9A 5D8AC 2HWC2 4OUEA 4YNIA 3O1OA 4MOAA 2XOMA 3ZYIB 3TN93 5FZFA 1HB2A 4HMZA 1RUI3 5LASA 2XGXA 4OULA 4AVAA 4JKLA 3NKTA 1XQNA 3EJKA 1K5JA 2PHTA 4AEKA 2YBSA 1VAVA 1O3SA 3GDBA 1ND3A 1SBEA 1VRH1 2O14A 4NRMA 5F6LB 3I8TA 2VM9A 5FO8B 1QJX1 2E7AA 4NUBA 5F5CA 2RM22 4NR1A 1Q5OA 3GZEA 1RJ8A 4WBBA 4WVZA 2VAUA 1UQXA 3D0JA 1AR63 4CDWB 2WZ8A 3A21A 3UJQA 4P9XA 4AE2A 1W9SA 1LOFA 4BXFA 2QQJA 5JR2A 3HWJA 2AREA 4DPNA 1V6NA 1ULPA 2VTXA 1SACA 2YUEA 3EHKA 1NCRC 3DN7A 2ZGKA 3GZAA 1OOPA 3H9AA 3IMMA 1YQ8A 2P34A 4LOTA 3OBZA 1VBA3 3N7LA 5JOYA 1R081 4RGGA 1TME2 5FZKA 3GF6A 2C9KA 5BYNA 4LHLA 5FFOC 5H9PA 4QPGB 5JXHA 3WP6A 1WCKA 3J7LA 1GBGA 3WR0A 2OKXA 2ZHKA 4ONZA 4ZKTB 2CHHA 3ZLIA 3SH3A 1QXPA 3ST7A 2W91A 1W8HA 1V6JA 1U5IA 2WSUA 5AVAA 3RNSA 3LSDA 5FZ6A 2MNGA 1VBB1 4R4ZA 1DQ5A 2HWF1 4RQPB 4AR2A 2VZTA 1O3QA 1KDMA 1VMFA 2DUOA 3WF4A 5LBBA 5HPOA 3QH6A 4UWDA 3J4UH 3VD4A 4XBLA 3RZKA 3WPZA 3ES4A 1JOPA 4OHVA 3H3UA 4DEQA 3WX5A 3TEWA 1XPWA 2VMFA 3K4ZA 3LEMA 3O5SA 5AFEA 4BHPA 3ENRA 1WD4A 3UESA 4BQ2A 4FPGA 3CJIC 3NL1A 3OUIA 4PLNA 3SC7X 5A8CA 2DCJA 3CEWA 1QJX3 3AL5A 3M1HA 1OUXA 2B5HA 5FLJA 3RG0A 4QMAA 2DU1A 2W1QA 4RHV3 1AR73 3UT0A 2DBIA 3JU9A 2ZHNA 3ZVXA 1JI6A 3GJBA 4ORFA 4P9IA 2DU0A 1ULFA 4E4DX 3EBRA 1V9U2 4K40A 4PQ9A 1MS1A 2BQPA 2JJ6A 2JE8A 2V73A 2XL9A 2CGOA 3KT4A 2WO3A 4JRAA 2QKDA 2Q8CA 3O1PA 1ULDA 2IVJA 2GMEA 2MHFA 4CP1A 2JDKA 3WN0A 4KG0A 1LOEA 2BVBA 4QQSA 5FUNA 5FWJA 5SV8A 3TN92 3QCWA 4AHXA 4CUCA 2Q8EA 2PELA 1HRI3 1VBE3 4BQXA 5C9AA 4XFCA 5CIRA 3VBFA 3MIHA 1PT2A 1K5MB 5F3EA 1DQ6A 3MZHA 5A6QA 1DG6A 2ZGOA 3OM7A 3RVHA 2Y34A 3FC0A 1NCQB 3B7MA 1D4M2 3CMGA 2X8SA 4AG4A 1TZOA 5JZGB 5F3CA 3ZPOA 1SBFA 2GH8A 3BGAA 2EVXA 2QFEA 1BVVA 4Y1XA 4M4PA 1FNZA 2CSGA 1AYN1 3I3EA 4IV1A 4N8MA 2GNTA 1LHWA 4NHKA 4XFIA 4UDKE 4UFMA 1GOGA 5FZCA 5CISA 3HVDA 2JEMA 1UZWA 5LATA 4PBPA 1KITA 4E9KA 3ZM8A 4NMIA 2UURA 4R52A 5K0UA 2HBUA 4NPRA 4XYXA 4FTEA 2J22A 3PJYA 4WM8A 2VULA 2J1TA 2Z69A 2ZAHA 4I30A 4AQ2A 3WDWA 4GH4B 5C70A 5CFCB 1PO21 5FCCA 3P6BA 5DUXA 3BU0A 2BUKA 5LA1A 3AKGA 2C24A 3ZX7A 1QXJA 4N9IA 4B7KA 4D7SA 3G7DA 4CE8A 2CAUA 4DRVA 1KS4A 5EV7A 5FZ3A 1JHJA 1JZ7A 4RD7A 3O1RA 3DUIA 4LKDA 2R042 4FPFA 2VVFA 4HVRA 4UDJA 1CAXB 2P17A 3HMYA 3NO8A 3VDDA 1HB3A 3VN4A 1IGOA 1JW6A 1X9PA 3H3ZA 4FXGB 4CDQA 5K7PA 2X09A 4OHYA 1IKPA 1AXZA 1WW4A 2KXLA 3IKWA 1ND3B 1IQDC 1A78A 2EIBA 1X36A 3UKTA 3AFGA 3HN1A 4NAMA 3BODA 3NKGA 1XE7A 1OHFA 3S57A 4WV8A 4PHZA 2VMGA 4KMIA 3AKFA 3RYPA 1MS9A 3T3YA 4JDMA 3PNAA 4CDWC 4LBLA 5J3UA 1SDDB 4IV3B 2ARBA 4GWNA 1WLDA 1H4GA 1ZBE1 1RUG3 1UCXA 1VPHA 4HKOA 4XPVA 3C7FA 1DDLA 4COZA 3AYAA 5JAXA 1A6CA 2VZUA 1JYIA 1REFA 2O8OA 3AMHA 4FFIA 4LHNA 4FPEA 1UIJA 4DNYA 2JB4A 3VKFC 1F2NA 3H7YA 4J25A 3WVJA 3IAQA 1WUVA 2ZX2A 1VBE2 4GKXA 5FLHA 4I3PA 4LITA 5KBFA 3PUHA 4XJ8A 1YHFA 3V56A 3UL2A 3VT0A 1W8ZA 2IXJA 1QGLA 3GHMA 1QOSA 1SLTA 4IEYA 3M3CA 1AR72 2WZR2 2E51A 2PHLA 3H42B 2G9ZA 1GQHA 3BALA 3OD0A 4K8RB 2ZEYA 2RJKA 5F5AA 4ATEA 4EWDA 3CHXA 5GLLA 2VOVA 3AKRA 4AEDC 2VZVA 2XQXA 1LU2A 4IEQA 2LW8A 1F15A 1UMZA 4OYUA 1WW6A 3SXWA 1TQ5A 3THDA 2GNMA 4GZ9A 2OYZA 3FLPA 5JPMB 2GN7A 1NA1A 3POBA 1EUTA 1AYM1 2G9GA 3FMGA 5FZDA 3T08A 4AI1A 3UK9A 2NPIA 4HN0A 4QKBA 3VZKA 3R4ZA 1ZA4A 3NV1A 3VBOB 5GJ6A 3I2OA 4AAXA 1GYKA 3PVBB 3J9SA 3VHNA 1PZ8A 1NUKA 3USUB 5BNOC 3DCQA 3R4SA 5EPAA 4XFHA 4XDQA 4LLFA 1HRV2 5FYIA 1UY2A 5C4WA 2IFRA 1GZ9A 2CYFA 1RVF1 2RS12 5A7SA 5LY2A 2VR4A 3FLRA 4G4FA 1W0PA 1HDKA 2Z42A 3RZLA 3FN9A 2OUHA 3ME2A 1REEA 1VMHA 4BISA 2VE1A 1DZQA 4PCRA 3MW4A 1IKQA 2C5DA 4NRPA 5LA9A 4AW7A 1RB8G 2DVAA 4QGMA 1P8JA 3D5YA 3FX3A 3E97A 4V1PA 3DPRA 4NVPA 3OD4A 4URTA 3CQOA 4YW1A 5H9QA 3ZYPA 5C3PA 3PUIA 4LO4B 2X8FA 1ULGA 4DY3A 3O1VA 1COV1 2VCAA 2J1VA 2Q8DA 4LMFA 4AFBA 3RZGA 1W6MB 5GLVA 1DGLA 5A7NA 5GLPA 3ALQA 5FP9A 4E2GA 1V6OA 1WMFA 3NRUA 4MV2A 5IVEA 2YZ4A 4MLGA 1N3PA 1SFPA 1W04A 2OUJA 2UWAA 3FHAA 4CXYA 3ZXKA 1QNWA 2YXSA 3FWEA 1VKDA 1D2QA 4QPIC 1OPOA 3W21A 5CFDC 5T5JA 3U4XA 2JICA 2HWD1 2ZTNA 1ENXA 1DCSA 5E88A 4Q0VA 1W0NA 2AR6A 1H2MA 1ZRRA 2NN8A 5J7MA 1UYPA 3JBG2 1OOPB 4CPBA 3T0DA 3AKIA 2Y0IA 3OBAA 4XOGA 5FYTA 2Q4SA 3I3DA 4YFZA 1J83A 1GZWA 4TLGA 2YPDA 1CZSA 4BE3A 4D6QA 4I09A 3HAGA 5LCWL 2JD4A 1RUF1 3V0BB 1C5IA 2ZMLA 3R67A 3LA2A 1OXCA 4XXAA 3ZXJA 3NV3A 1SZBA 4B3NA 2MPFA 2JIGA 4YVSC 2GH2A 4A6SA 4HXCA 2BJSA 2BOIA 3U11A 4U2AA 4Q8LA 1EPZA 3SH5A 5DAVA 3HQUA 1RUC2 3VZMA 5EJZB 4K7JA 3CU9A 5A3UA 2LS6A 1LOCA 3UGFA 5A7PA 1BBT3 4FI9A 4HSLA 2ZGNA 2VPVA 3JD72 1O6UA 1RUF2 4FAHA 2E33A 4UDKA 4MO3M 3I49A 2X8TA 3ZXFA 1LKNA 1RINA 3B3QE 4IE6A 5FYMA 1BXHA 2DDUA 4SLIA 2RS31 2DFBA 5CG9A 3FFQA 3OEBA 5JXGA 1Y7BA 4WM7B 4OCTA 1CIYA 1NE4A 2XJPA 2CWSA 5C9AC 2GP3A 5FXXA 3WNXA 2LALA 1EV11 4YGBA 5T55A 3ZMNA 3Q8BA 1YEWA 3HOBA 1XE8A 3J7HA 4QX5A 4L99A 4NIAA 4A44A 1U0AA 1F5JA 5IHRA 5DN2A 4GIQA 4HKWA 3NAPB 1DLCA 3LPFA 4FQ4A 1H8TB 2W87A 4AEJA 1C5HA 3O0XA 1JUHA 4IGQA 1G86A 4DXSA 2QZ2A 2FZ2A 2GALA 3VBRA 1UZYA 2RE9A 3ZN5A 2YFSA 1YNAA 2VOWA 1PGSA 1XJAA 1W6PA 3N7JA 1HJGA 4MGYE 2XBO2 5CADA 5FP8A 2FCUA 4ASLA 5F39A 3OGJA 4HONA 2WRAA 2ZABA 3TOJA 4Q29A 1VBB2 5LRSA 5JIUA 4CUGA 1MQTC 1HKDA 1GFF2 2Y33A 4PQQA 3V0AA 1ST8A 2N7GA 1FYUA 4LLOA 3RS6A 3MLKA 4A7YA 2EXHA 4FCAA 1S0GA 3OM4A 1KQRA 3WDTA 5A3TA 5L19A 2QQOA 1OOPC 1SCRA 2K46A 1N1TA 2YROA 3A0KA 4HZFA 1PIV1 2E7TA 2Y26A 5F5IA 4CDXB 3TYJA 1RHI1 4XDPA 5JZGC 1PGW2 4QKFA 1MVQA 1QDOA 3THCA 4CEWB 4KG8A 4BJ0A 2VZ1A 4WM8B 1OUSA 4E4HA 2IC1A 3WMZA 2P3JA 1PO13 1QQP1 5KHJA 3QC2A 2RHPA 5HCAA 1AX2A 4PJYA 3I2DA 2ATFA 1ODNA 3M4FA 4XJUA 1AL23 2G9FA 2VUAA 2W08A 3IMNA 4LKSA 4XETA 5A3OA 5HXMA 5IFTA 1W8UA 4Y5TA 4B1MA 1W3XA 2WYSA 3NJXA 1UU4A 1O5LA 2IVIB 3ZN6B 3CJIA 1VRH2 4LA2A 1XU2A 4N53A 2VZ3A 3OY8B 2ZJCA 3P1IA 5FWEA 4B4RA 5L9VA 2UWBA 1Q8QA 4QDRA 4R9BA 4XUTA 3UJOA 3ZYBA 2JDYA 1OURA 1SLLA 1QMJA 3KGZA 4QB2A 5DAQA 1JUIA 1RUH2 2AENA 1AX1A 4EWAA 1HLCA 4EJRA 4JKKA 1DIWA 3AMQA 4PIXA 3AYCA 4LBQA 1N47A 3KD4A 1FATA 2RJ2A 3NW4A 1S0JA 3UGHA 1LHNA 2NP0A 3ATGA 4JHZA 3OPZA 4Q1RA 5BNPB 4YGDA 3NNJA 1HRI2 4D94A 4JHTA 1R1A2 2ZEXA 5KHHA 4Y5SA 1UU5A 4S2GA 3K48A 4COTA 1PIV3 4QB1A 1R64A 3TEYA 2EXIA 1AUYA 3LIGA 5F2WA 2YYOA 3GBGA 3BIWE 3RMXA 3WG1A 3A7QA 3O14A 3WW2A 5AC93 4XC9A 1D7PM 2OA2A 3K4AA 1AR81 3T4HB 1HV1A 2D98A 4AQTA 4EQVA 4DUVA 5JSPA 2WJSA 3PUSA 1QQP3 1RUJ2 3VHRA 4DXRA 3HNYM 1UY3A 3H1WA 1BBT2 3AC0A 3SISA 3UNPA 2W5FA 4DUWA 5CG8A 2D40A 3K3OA 2B42B 4RA0A 2QUOA 2WN2A 4W50A 5DUUA 1RUE2 2VXRA 5CKQA 1GWMA 5FZOB 4AVSA 4GXLA 1T2XA 1ZZCA 5L73A 3IDCB 4ES8A 1J58A 2VQAA 1JH5A 4NHXA 1S2KA 2SLIA 2LTNA 4N43C 4M4RA 4IE5A 4OQ9A 1HQWA 5KHGA 1W18A 5FZOA 4YZ4A 5FMOL 3VBUC 4LE4A 4H14A 2Q1ZB 1CGPA 3H8UA 4XFGA 5I8YA 2PFWA 1XRUA 5JI9A 3KCCA 4KBZA 2BTVC 5FZ1A 3H50A 1WMEA 1RUI2 2GC2A 1LOFC 2HWF3 4RR3C 5FZMA 4CXXA 4Y1ZA 1JS9A 5LK7B 3ETQA 1AXYA 3PLQA 4LBJA 3OTFA 2HWB2 5DQ0A 1W8OA 5LEJA 3PL0A 1L7RA 3LGRA 3ZFGA 2OW4A 1VIWB 2D6OX 1UXZA 1UV4A 2GNDA 1ENQA 1W9FA 2PXJA 4KC8A 2W52A 2IWGB 4GB32 2HWE1 5F5QA 1O59A 2X10A 3AKHA 3MYXA 4BH9A 2DVFA 2QE3A 2EA7A 4MADA 5LY1A 4Q4X3 4UDGA 1F31A 2R32A 3B9IA 1ODMA 1H8TA 3CBNA 2E32A 2RS52 4XQDA 3ZR6A 4Y1UA 1PGL2 1UKRA 2FCVA 1VRH3 4JQTA 5A33A 1BMV2 1UMHA 4KL1A 3BVCA 5FOJB 3HNBM 2K0GA 3T1LA 5BNPC 3D5ZA 3NV2A 4GMP0 2PAKA 3WSOA 2JG8B 2XLGA 2ZEZA 1AR61 3ON7A 3LFMA 4PIYA 4O61A 1ND2A 1UU6A 5C3SA 1EUUA 4OUMA 1X9TA 1M4WA 1GQGA 1HRV3 2BBAA 1O4YA 3Q8CA 3WW3A 1YXWA 3AK0A 5FK8A 1G9BA 1F35A 2AEZA 3GGLA 1ULOA 2ZKLA 5HCHA 5BPXA 4RQPC 2ZGSA 2WNUB 4NHMA 3HJRA 1UZVA 1ULEA 3B00A 3OF1A 1AYM2 3H8XA 1EPWA 1RUNA 2KM2A 2JENA
chains in the Genus database with same CATH topology
3HEIA 3D3AA 4ET7A 1JZ4A 2VZTA 2WZEA 5CYYA 5FMBA 2W3JA 4KMQA 3WF4A 5HPOA 3VD4A 3WPZA 1DYOA 3ABZA 3JXSA 4DEQA 1XPWA 2VMFA 3K4ZA 3WNNA 3SEPA 3LEMA 4ZZ5A 2YG0A 3UESA 4DUXA 4QPWA 3SC7X 3WPUA 5A8CA 2YFTA 2DCJA 3LF7A 3GM8A 3QEEA 4DXTA 2W1QA 5G05L 2JD9A 3U37A 3I97A 2EICA 4UAPA 1K42A 1JYWA 1JI6A 1F4HA 3T2OA 3LEGA 2QQMA 3LEIA 1RYYA 1GMMA 2JE8A 2W94A 2WO3A 2C4XA 3LQCA 1UYZA 3LE0A 3U14A 1JZ5A 3WN0A 5J1XA 2Y6GA 4QQSA 5B6SA 2J1UA 4CUCA 3WMYA 4UI9L 2EIDA 3K4DA 4N2RA 3BYKA 5B4NA 1PT2A 4O8OA 3VSRA 3K77A 1NKGA 3OM7A 1W2TA 2CDPA 4TTGA 2WBKA 3CMGA 2X8SA 2VCCA 2VC9A 2Y8KA 2V4VA 4AG4A 5JOWA 5AYCA 3MV01 3BGAA 3WQBA 1GYHA 4QB6A 4AK5A 4M4PA 3I3EA 3WNPA 4UDKE 3WF0A 2VCBA 3R4YA 1GOGA 2CDOA 1O8PA 3VT1A 3ZM8A 2BERA 1JYNA 2J7MA 4MGQA 2VZQA 3WATA 2C26A 2J22A 4P08A 4QAWA 2J1TA 2Z4FA 1BHGA 3VDBA 3ETPA 5C70A 1US3A 2VJXA 3P6BA 4RYDA 1TG7A 3E1F1 3I2IA 1JU4A 3MBWA 5LA1A 3AKGA 1OH4A 1MPXA 2EXKA 1JHJA 1JZ7A 4GWIA 5JUVA 1PMJX 2Y6LA 4UDJA 5GLOA 4LHSA 3T2PA 2W47A 1TVGA 4XUQA 2R7EB 3SEEA 2QQVA 2L9LA 3OM5A 5FMDA 2X09A 2RV9A 4L0PA 1H6XA 2J1RA 1OF4A 1IQDC 2EIBA 1O8SA 5IYYA 3LEKA 2VO5A 1Y4WA 1Y9GA 4CUAA 1JYVA 3QZ4A 1WKYA 4D0QA 1NAEA 3OB8A 3AKFA 4FFGA 4KMIA 3VD9A 1SDDB 4D8MA 3I2GA 5EJ1B 2Y6HA 1JU3A 3C7FA 2VZUA 4FFIA 3LPGA 1OYGA 4AK7A 5ANNA 2QQKA 4PVIA 3VSFA 3IIIA 2V72A 3WNMA 5FIXA 4LQRA 3IAQA 3VDAA 5AY9A 3VSSA 3I2FA 2YC2A 1DP0A 5GLRA 3PUHA 2XHNA 3VT0A 1F4AA 4N4BA 3UETA 2VMDA 3WNKA 4QX0A 3BYNA 2ZEYA 5GLLA 3T09A 1GYEB 5C71A 3T0BA 3CIHA 2J1SA 2VZVA 2XQXA 3WF2A 3WF1A 2RVAA 2LW8A 4OYUA 5JOXA 2HLEA 3NQHA 3THDA 4GZ9A 4BK5A 3OM2A 4O8PA 5GLNA 1EUTA 4KCBA 1J84A 3HN3A 3I2JA 3T08A 3VD7A 3R4ZA 1WCQA 4AAXA 4E8DA 3SKVA 2QQWA 3LDRA 1OF3A 1NUKA 1KEXA 4XUOA 4A41A 4U6DA 5FUIA 1UY2A 3WAUA 2WABA 1GYDB 1WL7A 2VR4A 3VD3A 3FN9A 4A4AA 4QX2A 4KCAA 3BN6A 2ZXQA 1GQPA 1GOFA 1P8JA 3D5YA 3ECQA 2X8FA 1GNYA 3CQOA 4KI5M 3PUIA 3KSTA 3FHQA 3MUZ1 4QDSA 2ADEA 1UMIA 2J1VA 2VCAA 4XZUG 4CU6A 4OMCA 3VDCA 5GLPA 5JXIA 4IUGA 1I5PA 3NRUA 3OM6A 5DPNA 3T2QA 3C8XA 4MLGA 1VKDA 2W92A 3FHAA 3ZXKA 2VTFA 1XC6A 3WPYA 2W9XA 1W8NA 1XNAA 4O8NA 3IDAA 2Y64A 2E31A 2VQUA 1K3IA 1W0NA 2BGOA 4Z2AA 2J1EA 3VD5A 3C7EA 1UYPA 5FMCA 3TAWA 5EIYB 3C7OA 3T0DA 3AKIA 3OBAA 1JZ2A 2JDAA 3I3DA 4U6BA 1J83A 4XUPA 2XONA 2W1WA 1CZSA 4QX3A 5LCWL 4RN5A 2ID4A 5LA2A 5A7VB 3OEAA 2QQLA 3R67A 1JYXA 2QBXA 2ORZA 3MO4A 3ZXJA 4XVHA 4CU9A 1YRZA 3NJVA 4PF1A 1UY4A 2QQUA 2ORXA 3CKHA 3WNOA 5IFPA 3CU9A 3T0AA 1PMHX 5EJZB 1UY1A 4HG6B 4CU7A 2LS6A 1YIFA 3A23A 3VSZA 3UGFA 2B4WA 3C7GA 3DYPA 4P00B 3DYOA 4FI9A 2WAOA 2W1SA 4UDIA 2VZOA 2E33A 4UDKA 4MO3M 2X8TA 4BXSV 3BYJA 2DDUA 1JZ6A 3K46A 2B9VA 2HYXA 3ACIA 3OEBA 5JXGA 2WO2A 3WF3A 1Y7BA 1K12A 1CIYA 2WUHA 3QEFA 2JKXA 1OT5A 4A42A 1CZTA 4P5YA 3P2NA 2Y6KA 2PQSA 3HOBA 3J7HA 4BK4A 4A44A 3CDZB 2YB7A 5IHRA 5DN2A 3K1UA 1DLCA 3LPFA 2W87A 4A6OA 2W46A 5C7GA 1GU3A 3ACHA 1GOHA 1UYYA 3K75B 4ARXA 4DXSA 5B4XA 2YFSA 3WEZA 1GUIA 5C0PA 1UX7A 5F7UA 4XURA 3A22A 4OMDA 5GLMA 3OGSA 3U75A 4PQQA 2VZRA 3MUY1 1ST8A 4N1IA 1W9WA 3GXUA 2EXHA 2QQIA 3OM4A 3WASA 1YI7A 2WN3A 3LFIA 2QQOA 1H6YA 3OG2A 4KC7A 1W99A 4FFFA 3F2ZA 2Y6JA 2XQRA 3ACFA 1UY0A 3HPNA 5AYEA 3C7HA 1JZ3A 3KF3A 3THCA 4BJ0A 4AK6A 2VZ1A 3WMZA 3W5MA 1KGYA 3QC2A 3I2HA 3RWKX 4JX0A 4QX1A 4DEVA 4LKSA 4FFHA 5IFTA 3D61A 5HXMA 3VT2A 1PX4A 2VL4A 4OZOA 2DCKA 2WYSA 4UOJA 3NJXA 2VMEA 3OGVA 2ZEWA 4ZY9A 2VDTA 2YFUA 2VZ3A 3ACGA 1L7QA 3IAPA 1UXXX 3P1IA 3LV4A 2YFZA 4QDRA 4XUTA 1LNSA 3IB3A 4QB2A 5B6TA 4JKMA 3W5NA 4YPJA 2V5DA 4JKKA 1JZ8A 2WO1A 2BZDA 2RJ2A 2AEYA 2VZPA 5GLQA 3NNGA 4ARYA 3UGHA 3FL7A 4JHZA 5FKCA 2QQNA 2B4KA 1OD3A 3MV11 5DMYA 2ZEXA 2X05A 1XNTA 4A3ZA 1UZ0A 4COTA 1UYXA 1R64A 3CZJA 4QB1A 2EXIA 4TXWA 3LIGA 3ZXLA 4CU8A 3C2UA 5GLKA 2ADDA 1SG3A 3A7QA 3PIJA 2YC4A 1D7PM 3K4AA 3UGGA 3BYLA 1UWWA 5FLWA 4DUVA 3LIHA 4EQVA 1HN1A 3QEDA 4DXRA 4D47A 3HNYM 1UY3A 3AC0A 3UNPA 2W5FA 4DUWA 5JMOA 2YFRA 3WPVA 4W50A 2WN2A 4E8CA 5A7VA 2WDBA 1T2XA 5CZKA 2EXJA 2E26A 4M4RA 3SKJE 3DECA 5LA0A 1W18A 2KD7A 4ZZ8A 3WN2A 3WN1A 1NX9A 2J1AA 3EB7A 3WNLA 3OGRA 3I2KA 1YQ2A 5I0DA 2VOTA 2VZSA 1K45A 2EIEA 4PVAA 5FKBA 5A8DA 5JOZA 5FK7A 3CZUA 3D60A 4CUBA 4OUEA 4MOAA 2XOMA 5DQ0A 1W8OA 5A1AA 5JXJA 2OXBA 3KF5A 1L7RA 2WAAA 4A45A 1UXZA 4JKLA 1UV4A 3LDKA 4KC8A 2BGPA 1Y9MA 4CVUA 3GDBA 1O59A 2W1UA 2X10A 2VM9A 3AKHA 4MADA 5IJRA 5G04L 4UDGA 1CZVA 2E32A 4NOVA 2WZ8A 3A21A 3EYPA 4BDVB 1UMHA 1W9SA 4PT6A 2VQTA 3D5ZA 3HNBM 3HNMA 2QQJA 3WSOA 5JR2A 2ZEZA 1ULPA 4XUNA 4ZXEA 1W9TA 1EUUA 3DYMA 2AC1A 2BBAA 1US2A 4W4ZA 5FK8A 5JOYA 4GWJA 1CX1A 1SHWB 2AEZA 3I3BA 2C9KA 1PX3A 2WQ8A 3GGLA 1ULOA 4QDQA 4MGSA 4P02B 5JXHA 2VMCA 2W95A 3PIGA 4N2ZA 3HJRA 4LPLA 2OKXA 4ONZA 5AYDA 2W91A 4KWUA 4W8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEI A;  3D3A A;  4ET7 A;  1JZ4 A;  2VZT A;  2WZE A;  5CYY A;  5FMB A;  2W3J A;  4KMQ A;  3WF4 A;  5HPO A;  3VD4 A;  3WPZ A;  1DYO A;  3ABZ A;  3JXS A;  4DEQ A;  1XPW A;  2VMF A;  3K4Z A;  3WNN A;  3SEP A;  3LEM A;  4ZZ5 A;  2YG0 A;  3UES A;  4DUX A;  4QPW A;  3SC7 X;  3WPU A;  5A8C A;  2YFT A;  2DCJ A;  3LF7 A;  3GM8 A;  3QEE A;  4DXT A;  2W1Q A;  5G05 L;  2JD9 A;  3U37 A;  3I97 A;  2EIC A;  4UAP A;  1K42 A;  1JYW A;  1JI6 A;  1F4H A;  3T2O A;  3LEG A;  2QQM A;  3LEI A;  1RYY A;  1GMM A;  2JE8 A;  2W94 A;  2WO3 A;  2C4X A;  3LQC A;  1UYZ A;  3LE0 A;  3U14 A;  1JZ5 A;  3WN0 A;  5J1X A;  2Y6G A;  4QQS A;  5B6S A;  2J1U A;  4CUC A;  3WMY A;  4UI9 L;  2EID A;  3K4D A;  4N2R A;  3BYK A;  5B4N A;  1PT2 A;  4O8O A;  3VSR A;  3K77 A;  1NKG A;  3OM7 A;  1W2T A;  2CDP A;  4TTG A;  2WBK A;  3CMG A;  2X8S A;  2VCC A;  2VC9 A;  2Y8K A;  2V4V A;  4AG4 A;  5JOW A;  5AYC A;  3MV0 1;  3BGA A;  3WQB A;  1GYH A;  4QB6 A;  4AK5 A;  4M4P A;  3I3E A;  3WNP A;  4UDK E;  3WF0 A;  2VCB A;  3R4Y A;  1GOG A;  2CDO A;  1O8P A;  3VT1 A;  3ZM8 A;  2BER A;  1JYN A;  2J7M A;  4MGQ A;  2VZQ A;  3WAT A;  2C26 A;  2J22 A;  4P08 A;  4QAW A;  2J1T A;  2Z4F A;  1BHG A;  3VDB A;  3ETP A;  5C70 A;  1US3 A;  2VJX A;  3P6B A;  4RYD A;  1TG7 A;  3E1F 1;  3I2I A;  1JU4 A;  3MBW A;  5LA1 A;  3AKG A;  1OH4 A;  1MPX A;  2EXK A;  1JHJ A;  1JZ7 A;  4GWI A;  5JUV A;  1PMJ X;  2Y6L A;  4UDJ A;  5GLO A;  4LHS A;  3T2P A;  2W47 A;  1TVG A;  4XUQ A;  2R7E B;  3SEE A;  2QQV A;  2L9L A;  3OM5 A;  5FMD A;  2X09 A;  2RV9 A;  4L0P A;  1H6X A;  2J1R A;  1OF4 A;  1IQD C;  2EIB A;  1O8S A;  5IYY A;  3LEK A;  2VO5 A;  1Y4W A;  1Y9G A;  4CUA A;  1JYV A;  3QZ4 A;  1WKY A;  4D0Q A;  1NAE A;  3OB8 A;  3AKF A;  4FFG A;  4KMI A;  3VD9 A;  1SDD B;  4D8M A;  3I2G A;  5EJ1 B;  2Y6H A;  1JU3 A;  3C7F A;  2VZU A;  4FFI A;  3LPG A;  1OYG A;  4AK7 A;  5ANN A;  2QQK A;  4PVI A;  3VSF A;  3III A;  2V72 A;  3WNM A;  5FIX A;  4LQR A;  3IAQ A;  3VDA A;  5AY9 A;  3VSS A;  3I2F A;  2YC2 A;  1DP0 A;  5GLR A;  3PUH A;  2XHN A;  3VT0 A;  1F4A A;  4N4B A;  3UET A;  2VMD A;  3WNK A;  4QX0 A;  3BYN A;  2ZEY A;  5GLL A;  3T09 A;  1GYE B;  5C71 A;  3T0B A;  3CIH A;  2J1S A;  2VZV A;  2XQX A;  3WF2 A;  3WF1 A;  2RVA A;  2LW8 A;  4OYU A;  5JOX A;  2HLE A;  3NQH A;  3THD A;  4GZ9 A;  4BK5 A;  3OM2 A;  4O8P A;  5GLN A;  1EUT A;  4KCB A;  1J84 A;  3HN3 A;  3I2J A;  3T08 A;  3VD7 A;  3R4Z A;  1WCQ A;  4AAX A;  4E8D A;  3SKV A;  2QQW A;  3LDR A;  1OF3 A;  1NUK A;  1KEX A;  4XUO A;  4A41 A;  4U6D A;  5FUI A;  1UY2 A;  3WAU A;  2WAB A;  1GYD B;  1WL7 A;  2VR4 A;  3VD3 A;  3FN9 A;  4A4A A;  4QX2 A;  4KCA A;  3BN6 A;  2ZXQ A;  1GQP A;  1GOF A;  1P8J A;  3D5Y A;  3ECQ A;  2X8F A;  1GNY A;  3CQO A;  4KI5 M;  3PUI A;  3KST A;  3FHQ A;  3MUZ 1;  4QDS A;  2ADE A;  1UMI A;  2J1V A;  2VCA A;  4XZU G;  4CU6 A;  4OMC A;  3VDC A;  5GLP A;  5JXI A;  4IUG A;  1I5P A;  3NRU A;  3OM6 A;  5DPN A;  3T2Q A;  3C8X A;  4MLG A;  1VKD A;  2W92 A;  3FHA A;  3ZXK A;  2VTF A;  1XC6 A;  3WPY A;  2W9X A;  1W8N A;  1XNA A;  4O8N A;  3IDA A;  2Y64 A;  2E31 A;  2VQU A;  1K3I A;  1W0N A;  2BGO A;  4Z2A A;  2J1E A;  3VD5 A;  3C7E A;  1UYP A;  5FMC A;  3TAW A;  5EIY B;  3C7O A;  3T0D A;  3AKI A;  3OBA A;  1JZ2 A;  2JDA A;  3I3D A;  4U6B A;  1J83 A;  4XUP A;  2XON A;  2W1W A;  1CZS A;  4QX3 A;  5LCW L;  4RN5 A;  2ID4 A;  5LA2 A;  5A7V B;  3OEA A;  2QQL A;  3R67 A;  1JYX A;  2QBX A;  2ORZ A;  3MO4 A;  3ZXJ A;  4XVH A;  4CU9 A;  1YRZ A;  3NJV A;  4PF1 A;  1UY4 A;  2QQU A;  2ORX A;  3CKH A;  3WNO A;  5IFP A;  3CU9 A;  3T0A A;  1PMH X;  5EJZ B;  1UY1 A;  4HG6 B;  4CU7 A;  2LS6 A;  1YIF A;  3A23 A;  3VSZ A;  3UGF A;  2B4W A;  3C7G A;  3DYP A;  4P00 B;  3DYO A;  4FI9 A;  2WAO A;  2W1S A;  4UDI A;  2VZO A;  2E33 A;  4UDK A;  4MO3 M;  2X8T A;  4BXS V;  3BYJ A;  2DDU A;  1JZ6 A;  3K46 A;  2B9V A;  2HYX A;  3ACI A;  3OEB A;  5JXG A;  2WO2 A;  3WF3 A;  1Y7B A;  1K12 A;  1CIY A;  2WUH A;  3QEF A;  2JKX A;  1OT5 A;  4A42 A;  1CZT A;  4P5Y A;  3P2N A;  2Y6K A;  2PQS A;  3HOB A;  3J7H A;  4BK4 A;  4A44 A;  3CDZ B;  2YB7 A;  5IHR A;  5DN2 A;  3K1U A;  1DLC A;  3LPF A;  2W87 A;  4A6O A;  2W46 A;  5C7G A;  1GU3 A;  3ACH A;  1GOH A;  1UYY A;  3K75 B;  4ARX A;  4DXS A;  5B4X A;  2YFS A;  3WEZ A;  1GUI A;  5C0P A;  1UX7 A;  5F7U A;  4XUR A;  3A22 A;  4OMD A;  5GLM A;  3OGS A;  3U75 A;  4PQQ A;  2VZR A;  3MUY 1;  1ST8 A;  4N1I A;  1W9W A;  3GXU A;  2EXH A;  2QQI A;  3OM4 A;  3WAS A;  1YI7 A;  2WN3 A;  3LFI A;  2QQO A;  1H6Y A;  3OG2 A;  4KC7 A;  1W99 A;  4FFF A;  3F2Z A;  2Y6J A;  2XQR A;  3ACF A;  1UY0 A;  3HPN A;  5AYE A;  3C7H A;  1JZ3 A;  3KF3 A;  3THC A;  4BJ0 A;  4AK6 A;  2VZ1 A;  3WMZ A;  3W5M A;  1KGY A;  3QC2 A;  3I2H A;  3RWK X;  4JX0 A;  4QX1 A;  4DEV A;  4LKS A;  4FFH A;  5IFT A;  3D61 A;  5HXM A;  3VT2 A;  1PX4 A;  2VL4 A;  4OZO A;  2DCK A;  2WYS A;  4UOJ A;  3NJX A;  2VME A;  3OGV A;  2ZEW A;  4ZY9 A;  2VDT A;  2YFU A;  2VZ3 A;  3ACG A;  1L7Q A;  3IAP A;  1UXX X;  3P1I A;  3LV4 A;  2YFZ A;  4QDR A;  4XUT A;  1LNS A;  3IB3 A;  4QB2 A;  5B6T A;  4JKM A;  3W5N A;  4YPJ A;  2V5D A;  4JKK A;  1JZ8 A;  2WO1 A;  2BZD A;  2RJ2 A;  2AEY A;  2VZP A;  5GLQ A;  3NNG A;  4ARY A;  3UGH A;  3FL7 A;  4JHZ A;  5FKC A;  2QQN A;  2B4K A;  1OD3 A;  3MV1 1;  5DMY A;  2ZEX A;  2X05 A;  1XNT A;  4A3Z A;  1UZ0 A;  4COT A;  1UYX A;  1R64 A;  3CZJ A;  4QB1 A;  2EXI A;  4TXW A;  3LIG A;  3ZXL A;  4CU8 A;  3C2U A;  5GLK A;  2ADD A;  1SG3 A;  3A7Q A;  3PIJ A;  2YC4 A;  1D7P M;  3K4A A;  3UGG A;  3BYL A;  1UWW A;  5FLW A;  4DUV A;  3LIH A;  4EQV A;  1HN1 A;  3QED A;  4DXR A;  4D47 A;  3HNY M;  1UY3 A;  3AC0 A;  3UNP A;  2W5F A;  4DUW A;  5JMO A;  2YFR A;  3WPV A;  4W50 A;  2WN2 A;  4E8C A;  5A7V A;  2WDB A;  1T2X A;  5CZK A;  2EXJ A;  2E26 A;  4M4R A;  3SKJ E;  3DEC A;  5LA0 A;  1W18 A;  2KD7 A;  4ZZ8 A;  3WN2 A;  3WN1 A;  1NX9 A;  2J1A A;  3EB7 A;  3WNL A;  3OGR A;  3I2K A;  1YQ2 A;  5I0D A;  2VOT A;  2VZS A;  1K45 A;  2EIE A;  4PVA A;  5FKB A;  5A8D A;  5JOZ A;  5FK7 A;  3CZU A;  3D60 A;  4CUB A;  4OUE A;  4MOA A;  2XOM A;  5DQ0 A;  1W8O A;  5A1A A;  5JXJ A;  2OXB A;  3KF5 A;  1L7R A;  2WAA A;  4A45 A;  1UXZ A;  4JKL A;  1UV4 A;  3LDK A;  4KC8 A;  2BGP A;  1Y9M A;  4CVU A;  3GDB A;  1O59 A;  2W1U A;  2X10 A;  2VM9 A;  3AKH A;  4MAD A;  5IJR A;  5G04 L;  4UDG A;  1CZV A;  2E32 A;  4NOV A;  2WZ8 A;  3A21 A;  3EYP A;  4BDV B;  1UMH A;  1W9S A;  4PT6 A;  2VQT A;  3D5Z A;  3HNB M;  3HNM A;  2QQJ A;  3WSO A;  5JR2 A;  2ZEZ A;  1ULP A;  4XUN A;  4ZXE A;  1W9T A;  1EUU A;  3DYM A;  2AC1 A;  2BBA A;  1US2 A;  4W4Z A;  5FK8 A;  5JOY A;  4GWJ A;  1CX1 A;  1SHW B;  2AEZ A;  3I3B A;  2C9K A;  1PX3 A;  2WQ8 A;  3GGL A;  1ULO A;  4QDQ A;  4MGS A;  4P02 B;  5JXH A;  2VMC A;  2W95 A;  3PIG A;  4N2Z A;  3HJR A;  4LPL A;  2OKX A;  4ONZ A;  5AYD A;  2W91 A;  4KWU A;  4W8J A; 
#chains in the Genus database with same CATH topology
 3HEI A;  3D3A A;  3WW4 A;  4HPK A;  1D0G A;  2VG9 A;  1SFN A;  3MIF A;  1JZ4 A;  1QDC A;  1AYN 3;  1RUD 2;  5CYY A;  2IFW A;  2A73 B;  1O7F A;  5FMB A;  1XB9 A;  2W3J A;  4JRL A;  1NY7 1;  3DKQ A;  1DYO A;  4YSF A;  2DUQ A;  3JXS A;  4MH0 E;  3WNN A;  1E5S A;  4GMP 1;  4XF9 A;  2ERF A;  4DUX A;  4QPW A;  4OHW A;  1S2B A;  1XND A;  4K8F A;  1X8M A;  3ILF A;  5D8A A;  2G1M A;  2YFT A;  3O1T A;  3GM8 A;  3THT A;  4Q0S A;  2D93 A;  5A32 B;  1OSG A;  5G05 L;  2JD9 A;  3U37 A;  3VDD B;  3EO6 A;  1NXD 1;  2VY0 A;  4M01 A;  1JYW A;  2WS9 3;  1F4H A;  1IHM A;  3F95 A;  3OY8 A;  1NLR A;  2JG9 B;  2WWS A;  2WQZ C;  1GMM A;  3POE A;  4X8P A;  2W94 A;  4ZHN A;  1CJP A;  2V4A A;  3KQ4 B;  2HWF 2;  4PI2 A;  1UYZ A;  3P5B A;  2FMY A;  3KB5 A;  2D43 A;  5FOB B;  1JZ5 A;  1BLZ A;  3DKW A;  4GA9 A;  1HXS 1;  4C1W A;  5C4W C;  2YGM A;  5B6S A;  1LED A;  2XKO A;  3WMY A;  1JYC A;  4YVW B;  5GLW A;  4UI9 L;  2DCT A;  2YY1 A;  3VBH A;  2D3S A;  1VBC 2;  3K4D A;  1XYP A;  4ISQ A;  5EHD A;  4N2R A;  2C9A A;  4R9A A;  5B4N A;  3ASI A;  1LES A;  1FT9 A;  3AP9 A;  1NCR A;  3AXD A;  1BCX A;  3AP6 A;  3PVN A;  2CDP A;  5FAX A;  1JBC A;  3VL9 A;  2KR2 A;  2WBK A;  1DZR A;  1FMD 1;  3QD6 A;  4Q4V 2;  2E6V A;  2V4V A;  5JOW A;  1RHI 2;  1N3O A;  2BNM A;  2W2I A;  3IDE A;  3KHB A;  4BZ4 A;  4OQ8 A;  5FJK A;  3INA A;  1VR3 A;  4FOW A;  1CES A;  3LB9 A;  5F6K A;  3VGI A;  5J48 A;  3SQO A;  2R04 1;  1YQ6 A;  1M06 G;  3WNP A;  3MFA A;  1OKO A;  1ZA7 A;  4W65 A;  4XJZ A;  3WF0 A;  3R4Y A;  1IOA A;  1OQD A;  2VUC A;  4JZR A;  2OPK A;  5L36 A;  2CDO A;  4GWM A;  1ENR A;  4JAA A;  5GZF A;  2BER A;  5CAZ A;  1OQ1 A;  4MGQ A;  1FOD 3;  3E5Q A;  4O65 A;  5ERL A;  4LNV A;  2VZQ A;  4TLF A;  4OUS A;  4QAW A;  4AXO A;  2JWP A;  1TMF 3;  2WS9 1;  2Z4F A;  5DG1 A;  3WUC A;  3WP4 A;  5FDB A;  2G4I A;  5BNN C;  3ETP A;  2Q0A A;  4XFF A;  3C3V A;  1MS8 A;  1PZ7 A;  1US3 A;  2VJX A;  3VBF C;  4BB3 A;  3KV6 A;  3H0O A;  4K21 A;  4ZPI A;  3RI9 A;  1TG7 A;  2XH6 A;  5K8S A;  2XJQ A;  1JU4 A;  3H3L A;  2R0F A;  4C1X A;  2Q1M A;  5FXZ A;  1CD3 G;  1GV9 A;  3ZXE A;  5C3R A;  5A6Z A;  3AZZ A;  4FBF A;  1S0I A;  5ISL A;  3SH4 A;  4GWI A;  1PMJ X;  1MZE A;  1DBN A;  2VMI A;  5C5T A;  2ZZJ A;  1I6X A;  5IVC A;  5GLO A;  4IV1 C;  5KR7 A;  1BEV 1;  5FXV A;  5GM0 A;  4S2D A;  4XUQ A;  3SEE A;  3ZKY A;  3OM5 A;  1DLL A;  2GC3 A;  1LHO A;  3VL8 A;  2OX0 A;  1LGN A;  4YW5 A;  4YW2 A;  3OBR A;  4L0P A;  5T5O A;  4ITC A;  4FQZ A;  1H6X A;  2J1R A;  2XDV A;  2P6C A;  3N9L A;  4A7Z A;  2WLQ A;  2VO5 A;  4H55 A;  1Y4W A;  4AOC A;  1W2U A;  4FTS A;  5FYH A;  2VD7 A;  3RZH A;  3QZ4 A;  1WKY A;  1OVS A;  4E2Q A;  4CDU C;  2WQ4 A;  3OB8 A;  4Q8K A;  1OA4 A;  5KXD A;  5M0T A;  1COV 2;  2OS2 A;  5A33 B;  2Q1F A;  1H9P A;  2CU5 A;  2D6L X;  1YIP A;  4IXL A;  4D7Y A;  1BBT 1;  5I91 A;  3FE5 A;  4AI9 A;  1IZ3 A;  2YU1 A;  4NAO A;  3VLB B;  5LZ6 A;  5EJ3 A;  4XJW A;  1V6K A;  2FMD A;  1W39 A;  1HJF A;  4R9D A;  5IAT A;  1U5X A;  1AR6 2;  3LPG A;  3VUO A;  3AMP A;  4JGZ B;  5ANN A;  2QQK A;  5FZH A;  2R06 3;  3VSF A;  3ZOI A;  1MS0 A;  2V72 A;  2RMU 3;  2WO7 A;  4IE7 A;  4NWW A;  3WNM A;  4UFJ A;  1RMU 2;  5FYB A;  2YGL A;  4LUM A;  4IEW A;  5T52 A;  1KJL A;  1FV3 A;  2XHN A;  2DV9 A;  5E8A A;  5FPB A;  1Z78 A;  3PVE A;  1F4A A;  2VMD A;  4IEX A;  5C5U A;  4EWE A;  5DUV A;  5E89 A;  1H8V A;  1HQN A;  2WS9 2;  3M3I A;  3NJZ A;  1CAU B;  2GMM A;  1ZZB A;  5C71 A;  4IDZ A;  4FPY A;  2CGN A;  4LKE A;  3RQ0 A;  3WF2 A;  1FXZ A;  2CGP A;  4CCK A;  5JOX A;  4RR3 A;  1APN A;  3NQH A;  1XBF A;  4N43 B;  4XJ9 A;  2BVV A;  2HWB 1;  3KQR A;  3RZJ A;  4MZU A;  3OM2 A;  4MHU A;  5GLN A;  1AVB A;  3GJA A;  5BNN B;  2OPW A;  1J3P A;  3ZIW A;  1H0B A;  4Q27 A;  2ZGT A;  1GSL A;  1QJX 2;  1X33 A;  2P5B A;  4JDN A;  4YM2 A;  4N43 A;  4E8D A;  1KFX L;  3ACL A;  4LO5 B;  3ZFG C;  4IW3 A;  4Q26 A;  1TEI A;  2ZZQ A;  4YZ5 A;  1XYO A;  4LO6 B;  1KD7 A;  4IER A;  1KEX A;  5FY7 A;  3VBU A;  3U07 A;  3PUR A;  1V6I A;  3GZT B;  1ZVF A;  1Y3T A;  2Z2S B;  1UOF A;  4JGY C;  2FDI A;  3KGL A;  4MLO A;  3WAU A;  1GYD B;  1DZT A;  3AVS A;  2I07 B;  2JG8 C;  1WL7 A;  2P37 A;  4CEW A;  1RHI 3;  3VD3 A;  5I8S A;  2D3P A;  2R06 1;  1DQ1 A;  2ZAA A;  4DFS A;  2XML A;  4KCA A;  4GAZ A;  4MX3 A;  4TN7 A;  1C3H A;  3MIB A;  1GQP A;  3ECQ A;  2BGC A;  3MEP A;  2O1Q A;  2A70 A;  3JCI A;  3I3Q A;  2BFU S;  4KI5 M;  3KST A;  4H7L A;  3M7A A;  1EP0 A;  3MPB A;  2ADE A;  1QJU 3;  2WR9 A;  5IK8 A;  1PIV 2;  4Q4W 1;  1LTE A;  3VZL A;  1F5F A;  4UFH A;  2BYV E;  4IE4 A;  3DXU A;  4OMC A;  3W9A A;  4J1X A;  3VDC A;  3MFC A;  4IGO A;  5LBE A;  4B29 A;  3OUH A;  5A3N A;  5JXI A;  2QQP A;  3T30 A;  1I5P A;  2JDN A;  4IEV A;  4CP9 B;  1UX6 A;  4PDW B;  2DTY A;  3MI8 A;  3NAP C;  5LB6 A;  3ZSM A;  4YAR A;  4QPG C;  4YFW A;  1POV 1;  1XC6 A;  3KCX A;  5DDJ 1;  3HBZ A;  4LO8 A;  3FFZ A;  5H9R A;  4JV4 A;  4CP9 A;  5BUV A;  1W8N A;  4O8N A;  1EAH 1;  3VKN A;  2Y64 A;  2E31 A;  5FYY A;  4MYE A;  1J59 A;  3VKO A;  4CCJ A;  1ND2 B;  4Y4R A;  4Z2A A;  5J96 B;  4XXP A;  2B8M A;  3VD5 A;  4QQH A;  1GZC A;  5F3G A;  5EIY B;  4AGR A;  4DMI A;  3T1M A;  1C8N A;  1HX6 A;  3IPV B;  3KM5 A;  5FZL A;  1DGW A;  1VBD 1;  3Q8F A;  2XON A;  4XUP A;  1W8T A;  2HEV F;  4NIH A;  1MZF A;  2WNU A;  2WFF 3;  1RMU 3;  2ZHM A;  3ZSE A;  2WZR 1;  3IZO A;  3FZ3 A;  5J09 A;  4XVH A;  4NJ4 A;  4Q4Y 3;  5C8W A;  3W58 A;  1W28 A;  2QQU A;  1EAH 2;  1OLR A;  1CN1 A;  1K5M C;  1S55 A;  2ARA A;  3AMN A;  3TEZ A;  4AGG A;  3OBT A;  4HPK B;  1AHS A;  2XWJ B;  3MGU A;  3MPP G;  5IAX A;  4CSW A;  3T0A A;  1PMH X;  4CU7 A;  4UBH A;  3VSZ A;  4OLL A;  3S30 A;  2P3I A;  1ASJ 3;  3C7G A;  3DYP A;  5T50 A;  2WAO A;  3R6S A;  3U1X A;  3VBR C;  1LR5 A;  4WVM A;  4CCC A;  2MEV 1;  1A3K A;  5IVJ A;  4XTP A;  5C33 A;  3DV8 A;  1O5U A;  5D8A B;  4YZ1 A;  1W6Q B;  2Z5W A;  1UOB A;  3K46 A;  1V6L A;  2B9V A;  4P9J A;  4QQO A;  3R4U A;  4WVM B;  5I8T A;  1WW7 A;  1K12 A;  2WUH A;  3QEF A;  5C2M A;  2NM1 A;  4GUL A;  3EXU A;  1S0C A;  4A42 A;  1RIT A;  2A6Y A;  4JQR A;  1A8M A;  1ZX5 A;  3T2T A;  5I0T A;  4LBO A;  1K5M A;  1BKZ A;  1YJL A;  2D97 A;  1JMU B;  1QH7 A;  3LAG A;  5C8C B;  4LK6 A;  2PYT A;  3JQX A;  5KXE A;  4NRQ A;  1CQ9 A;  4LUL A;  4Z92 B;  3GNE A;  5D2A A;  5JZG A;  2W46 A;  4ASM B;  5T5P A;  5C7G A;  1GU3 A;  1YO8 A;  3ACH A;  4EN0 A;  4EZ4 A;  3MLJ A;  5B2G B;  1W6M A;  4ARX A;  4MUV A;  3RJ2 X;  1MAC A;  5FP7 A;  3TBD A;  1VBB 3;  1WBF A;  4BME A;  3OOX A;  4CZS A;  2NQY A;  1W6N A;  1ZYB A;  1JTZ X;  2ZX4 A;  5EQU A;  3NST A;  2JXA A;  3M3O A;  5JSO A;  1I9R A;  4Z8B A;  4I01 A;  5BY5 A;  4P9Y A;  2VBD A;  3HQX A;  2HWE 3;  5K0U B;  1SBD A;  3H1M A;  3JUU A;  1T6G C;  1V6M A;  2RM2 3;  4QD2 A;  4Y33 A;  1GIC A;  5CFC A;  1CAU A;  3WAS A;  2WN3 A;  3WHU A;  4PIZ A;  4YM1 A;  4RHV 1;  3O0V A;  2TUN A;  2R6Q A;  1CX4 A;  2LRO A;  4P9L A;  4DIN B;  3B02 A;  2XQR A;  1UY0 A;  1D4M 1;  1BZW A;  4K3U A;  1F8V A;  3KF3 A;  1QHD A;  4AK6 A;  1KGY A;  2B9U A;  2DCZ A;  2R30 A;  3WUD A;  1CAX A;  5CKM A;  3RI8 A;  1IS4 A;  1VBA 2;  4BYY A;  4FTB A;  4AVB A;  4A7K A;  5LWB A;  5HXV A;  2ZPX A;  4OVE A;  3VKL A;  1O91 A;  1QNY A;  4HN1 A;  2OVU A;  1SMV A;  4XCA A;  1SCS A;  4CDQ B;  4ONU A;  3BCW A;  2PHX A;  4CCO A;  3HD8 B;  2PHU A;  2XLF A;  4XF4 A;  2DCK A;  5EWS A;  2IXI A;  3OSD A;  3PVO A;  5I93 A;  4D7T A;  2VME A;  3NJY A;  3K2O A;  5E1R A;  2BNO A;  5FUP A;  4DIQ A;  3OGV A;  3O0W A;  4UBG A;  1H2K A;  1HRI 1;  3IAP A;  1L7Q A;  2ZX0 A;  4CDU B;  1Z0H A;  2JG9 C;  5CA6 A;  1LNS A;  3NNF A;  2UU8 A;  4IV3 A;  3W5N A;  4Y20 A;  4D3W A;  1S4C A;  5FZG A;  1JZ8 A;  1AL2 2;  5CB7 A;  4RS5 C;  2BZD A;  4NRO A;  2ZA9 A;  4JGY B;  4NN0 A;  2YMZ A;  4Z07 A;  2RR1 2;  3MF9 A;  1W8F A;  2IXH A;  1YUD A;  2RM2 1;  2B4K A;  4XAB A;  4Y20 B;  2NZ9 A;  1GP6 A;  1H8T C;  1MEC 2;  3VBF B;  1KJR A;  4S2F A;  2BRT A;  3QH7 A;  1UYX A;  4SBV A;  3H7J A;  3GCW A;  3ZXL A;  2VNG A;  4E4Z A;  4FSJ A;  5GLK A;  3KCY A;  1RC6 A;  5EXO A;  1QH6 A;  5IVY A;  3KT1 A;  3UGG A;  1Y9Q A;  4IE0 A;  1KXG A;  2VH9 A;  5SV5 A;  2X53 S;  3LIH A;  1HN1 A;  3QED A;  2XBO 1;  1CIW A;  1XNB A;  1ZBE 2;  4FO9 A;  4V2V A;  1QJY 2;  1CR7 A;  2A6X A;  2NMN A;  1QKQ A;  3L9J T;  3WPV A;  2XJU A;  1TME 1;  3AJZ A;  4COW A;  1YJK A;  2WDB A;  2NLR A;  3AJY A;  3GYD A;  3KVA A;  3MHZ A;  5CZK A;  1WWY A;  3CLP A;  3WP5 A;  1VB2 A;  5FZ9 A;  2IZW A;  2PHW A;  3WN2 A;  2C6S A;  2JEC A;  2KD7 A;  3AZY A;  3S7E A;  4ZZ8 A;  3WN1 A;  4BMB A;  2WSV A;  2ZGR A;  5BNO A;  3EB7 A;  5IUQ A;  4XIL A;  4ES9 A;  3I2K A;  2ARX A;  4D69 A;  4BQW A;  4PF5 A;  4QHB A;  1LOG A;  3HT2 A;  4YGC A;  4UF0 A;  2Y38 A;  3FBM A;  4F3J A;  1MEC 1;  1H1M A;  5EP9 A;  5F1R A;  2BV4 A;  5C4W B;  2RMU 2;  2E53 A;  5BNN A;  1BEV 2;  2W39 A;  1XNK A;  3N35 A;  5A3L A;  4IES A;  4AZZ A;  4UF0 B;  1H30 A;  3J8F 1;  1RUD 1;  2ZX1 A;  1U12 A;  2OXB A;  4XF1 A;  2JG9 A;  5A1A A;  4Y26 A;  1ONA A;  5DZG A;  2O8Q A;  1HV0 A;  4RGK A;  2HEW F;  3AVR A;  3CO2 A;  4A45 A;  4YM0 A;  2YDE A;  4CCL A;  3JBG 3;  3LDK A;  4LJH A;  5CU1 A;  1COV 3;  3QBQ A;  1HN0 A;  1OPM A;  4A2U A;  2DVB A;  3KV4 A;  4CVU A;  4G3Y C;  2ZKN A;  2W1U A;  1QJY 3;  2F17 A;  1H1I A;  4GJZ A;  5A6Y A;  4BIO A;  1OKQ A;  5IJR A;  5K4L A;  1GLH A;  4HSJ A;  3VBS A;  2JX9 A;  4FP3 A;  1CZV A;  2P3Y A;  2XB6 C;  3AL6 A;  1I5Z A;  3RYR A;  4CCN A;  2VUJ A;  2Y6F A;  1X82 A;  2FDJ A;  5DZE A;  5F3I A;  3S5A A;  3U4S A;  4LR4 A;  4QHO A;  1WBL A;  3VBS B;  2VNO A;  1WLT A;  2FCT A;  1YQ5 A;  4QGN A;  4CEY C;  1N3Q A;  1XYN A;  1J3R A;  5L7O B;  2VMH A;  1Q8S A;  4J1W A;  4Z2W A;  3TAY A;  4GB3 3;  2FDH A;  1C8M 3;  3BPZ A;  3V64 A;  3V65 A;  3SCG A;  1JYT A;  4GWJ A;  4UFI A;  1O3T A;  3I3B A;  1PX3 A;  2WQ8 A;  4QDQ A;  2A7A A;  2PQQ A;  2A1X A;  3E6D A;  4MGS A;  4P02 B;  4AYU A;  1MEC 3;  5IWF A;  5K9Y A;  4N2Z A;  3ELN A;  2CTV A;  2MEV 2;  4CP2 A;  5JIA A;  3O1U A;  3CU7 A;  1ZZ8 A;  1SFY A;  1AL0 G;  4KWU A;  4NPL A;  4FOQ A;  4ET7 A;  2PLV 1;  2R04 3;  5DZF A;  2VXJ A;  5DXD A;  1RUE 1;  3N3H A;  2WZE A;  1C4R A;  1DHK B;  1S0F A;  1OLM A;  3ZFF A;  1S0D A;  1JOB A;  3JBG 1;  1V9U 1;  1E5R A;  3AM2 A;  5FO9 B;  2PA7 A;  4UFL A;  3DF0 A;  3SEP A;  3VBH C;  1NA1 B;  4ZZ5 A;  4AFM A;  2YG0 A;  1MZ6 A;  3FUO A;  1N1Y A;  1XU1 A;  5KWR A;  4KGQ A;  4LIV A;  5IK7 A;  3THP A;  1NOV A;  3QEE A;  4DXT A;  1VLN A;  4TZD A;  4DQA A;  1G9C A;  4GMP 3;  4FPJ A;  3S7I A;  3I97 A;  3KHC A;  2EIC A;  1SLC A;  2VBP A;  4UAP A;  2D6P A;  4XQ4 A;  4KH9 A;  1D0H A;  3LEG A;  2QQM A;  3LEI A;  4QWN A;  3ZYG A;  3ZFG B;  5KC5 A;  1U5Y A;  2JDZ A;  4LBM A;  4BQ4 A;  3N7K A;  1C8M 1;  5LBF A;  1W6Q A;  3LE0 A;  3KWV A;  5F37 A;  3J7M A;  3U14 A;  1XXN A;  1VAK A;  3RFR A;  1YFY A;  4JGY A;  2P2K A;  2HWD 3;  2WNV A;  2Y6G A;  4HKL A;  4CA9 A;  4MGT A;  2VQ0 A;  1LHU A;  1LU1 A;  2J1U A;  3PTY A;  1H1A A;  2FHR A;  4PBO A;  2WNE A;  3RZZ A;  3E6C C;  2AYH A;  4L97 A;  5LBC A;  2EID A;  2WNV B;  4LK7 A;  5DG2 A;  3BYK A;  3N9M A;  2A5Z A;  4O8O A;  3K77 A;  1NKG A;  1PO1 2;  4TWT A;  2X5I B;  4TTG A;  2BEO A;  4Y1Y A;  2VCC A;  2VC9 A;  4HAN A;  3WLU A;  1R09 2;  4DZG A;  5I0R A;  5AYC A;  4MHR A;  3PME A;  3MV0 1;  5A3P A;  2WIN B;  3AB0 A;  3WQB A;  4LTA A;  4YRD A;  1GYH A;  4FT8 A;  1QQP 2;  4W6W A;  2BNN A;  4XIO A;  4AK5 A;  1FMD 3;  1WCU A;  3KT7 A;  2VCB A;  3N36 A;  1EY2 A;  4FOY A;  1VBD 2;  2YPJ A;  2X8K A;  4HL0 A;  3POY A;  3VT1 A;  2UY9 A;  4Q4Y 2;  2PTM A;  2DBN A;  2XLA A;  3H8O A;  1RVF 3;  4YW6 A;  4GH4 C;  2C26 A;  4JCK A;  2I74 A;  2ZX3 A;  4P08 A;  1PO1 1;  1SPP A;  3WAT A;  2FDK A;  1V70 A;  1BHG A;  2R1D A;  1UKG A;  2WWJ A;  3OYW B;  4B4P A;  3RWN A;  4OI2 A;  5EYY A;  4KWK A;  4BQ3 A;  1CPM A;  3E1F 1;  4HLT A;  4QQP A;  5LRR A;  3RSJ A;  3I2I A;  3B9C A;  4QXH A;  4AED B;  1OH4 A;  1MPX A;  2V09 A;  4HFS A;  1PVC 1;  2CY6 A;  2EXK A;  1XOY A;  3HBK A;  4B8E A;  2PHR A;  4PLM A;  1O3R A;  3ZR5 A;  3POJ A;  5JUV A;  4Q0U A;  2ZAC A;  3ZN6 A;  3ZSK A;  4AI8 A;  2OZ6 A;  2QNK A;  2ZGP A;  2JE9 A;  2Y6L A;  2HWC 1;  2HWB 3;  1PGW 1;  1ULC A;  2WNO A;  4FPC A;  4URA A;  3PU3 A;  1Q56 A;  1W3V A;  1CPN A;  3PTR B;  4NOT A;  2W47 A;  2ET1 A;  1JHN A;  4FP2 A;  2RR1 1;  1H2N A;  1PNG A;  2QCS B;  2R7E B;  2QQV A;  2VOK A;  1R09 3;  4X8N A;  2DCY A;  3OJB A;  1OFS A;  1PK6 C;  4JTN A;  4KWL A;  2TEP A;  3ZYR A;  1G8W A;  2X29 A;  2P3K A;  2AAC A;  2WNV C;  4OHX A;  1OF4 A;  4WM7 A;  4ZU7 A;  2BOJ A;  1O8S A;  5BNP A;  3LEK A;  3IBM A;  1W06 A;  4Q2F A;  5IYY A;  1Y9G A;  4CUA A;  4CTE A;  4CEY A;  1NAE A;  4ZS3 A;  4FFG A;  1L3J A;  1UO9 A;  1F9K A;  4QM8 A;  1IS6 A;  3MF6 A;  3O7O A;  4D8M A;  1QJF A;  3I2G A;  4O7X A;  5EJ1 B;  2Y6H A;  3MLL A;  5EZW A;  1ASJ 1;  4IV3 C;  1JU3 A;  1RUF 3;  5FJH A;  1UNB A;  5IVF A;  5AC9 1;  5L9B A;  2GP5 A;  1B35 A;  5L7O A;  4XAE A;  3RMY A;  2SBA A;  4AAP A;  1IPK A;  1GNZ A;  4QXC A;  4C8D A;  4LUK A;  4AI2 A;  2D7F A;  1PM4 A;  1VAL A;  1YQC A;  2CV6 A;  5FIX A;  4LQR A;  4OI0 A;  3VDA A;  1BMV 1;  2VEC A;  2VVE A;  5FZA A;  1GWL A;  3I2F A;  2YC2 A;  4C91 A;  1ENS A;  1DP0 A;  4QPG A;  3N4M A;  5FQ0 A;  5GLR A;  3OPW A;  1LGB A;  4UW5 A;  5FBZ A;  3GAL A;  2VOX A;  4ZON A;  4OI1 A;  1LUL A;  2B46 X;  3IPV A;  4BPZ A;  3OUJ A;  2A3W A;  1RIR A;  4N4B A;  1AR9 3;  3UET A;  1V0A A;  3VHP A;  4I0B A;  2D3R A;  5IAV A;  3WNK A;  4UW3 A;  5I0S A;  1FI2 A;  1R1A 1;  2R0H A;  3BYN A;  3PUA A;  5DAX A;  1FX5 A;  3T09 A;  1GYE B;  1DQ2 A;  5DAB A;  3BKZ A;  5CFD B;  3R0R A;  2LUW A;  4I0A A;  2RR1 3;  4LXL A;  2AH2 A;  2RVA A;  2W0X A;  1WLW A;  2BP6 A;  1EV1 3;  4F8A A;  5CNA A;  3EQE A;  3FJS A;  4BK5 A;  4LEJ A;  4CPB D;  2R16 A;  1Z7S 2;  3N9N A;  3G6J B;  4KBB A;  3R4D B;  3WOG A;  2W68 A;  1NLS A;  1AYN 2;  1J84 A;  3HN3 A;  4XEZ A;  3ZKU A;  2C1F A;  1WCQ A;  2RJL A;  2PN5 A;  5FPL A;  3SNM A;  5I0U A;  3SLI A;  4AHY A;  4YG0 A;  2I45 A;  1YI9 A;  2BDR A;  2LRP A;  5ACA 3;  1ZNP A;  3WG3 A;  2JDH A;  2XVL A;  3KS7 A;  3R05 A;  4GQ7 A;  3ILN A;  4XUO A;  4B7E A;  1GNH A;  4A41 A;  4U6D A;  1RJ7 A;  1OA2 A;  4XDO A;  5FUI A;  2IXL A;  2XJS A;  5GLZ A;  2WAB A;  3AKT A;  2AZ5 A;  2JE7 A;  5FZ0 A;  2E63 A;  4XE9 A;  1SLA A;  3VBS C;  4MGI E;  3VZO A;  2A71 A;  4N53 B;  4A4A A;  1RTV A;  3TN9 1;  4QX2 A;  4BLJ A;  3BN6 A;  4AVC A;  1GOF A;  2X5I C;  3M2M A;  1OVP A;  4JGZ C;  1X50 A;  1OLM E;  1AJO A;  3MUZ 1;  3D6E A;  4QDS A;  4YLZ A;  1IG3 A;  2FQP A;  4XZU G;  3S6P A;  1ZBA 2;  2R07 1;  4CU6 A;  3H8R A;  4Z82 A;  4EE2 A;  3BOW A;  3GHN A;  4IUG A;  4L2N A;  4UW4 A;  1HRV 1;  4P5H A;  2DTW A;  3LSE A;  4EN8 B;  5JWP A;  3LOB A;  3C8X A;  3ILR A;  4Q4W 3;  3SMH A;  1O4Z A;  1N1V A;  2XL7 A;  4XHX A;  4XAA A;  4BCU A;  1GP4 A;  1LEN A;  2BWC A;  4X6R B;  2E7Q A;  4H7M A;  1GR3 A;  1G9D A;  1XNA A;  2P1B A;  2VNR A;  3IDA A;  1Q8P A;  2JDU A;  1O4T A;  2EF6 A;  2GMP A;  4YW7 A;  2VQU A;  2ZS6 B;  1K3I A;  5A7W B;  1IQA A;  2JDP A;  3C7E A;  5FMC A;  3D0S A;  1H9W A;  2YU2 A;  4XAC A;  1IG0 A;  2EIG A;  2WT2 A;  1EAH 3;  4R9C A;  4AL9 A;  5A6X A;  1OH3 A;  3UKN A;  2C0Z A;  2W1W A;  4QX3 A;  1YC6 1;  1RUG 1;  4RN5 A;  2ID4 A;  5A7V B;  3OEA A;  2QQL A;  3I4I A;  1NA1 C;  4CRQ A;  2ORZ A;  2ZGM A;  2QVS B;  3MO4 A;  4V2W A;  5FZ7 A;  1PMI A;  4H2A A;  1ZRD A;  4CU9 A;  1URX A;  1WMD A;  3N7M A;  4BIF A;  4L9B A;  2I2S A;  2R49 A;  3APB A;  3L2Y A;  3WNO A;  5IVB A;  4MXW B;  2WFF 1;  2YBP A;  2QJV A;  2WZR 3;  3N9O A;  4QGL A;  4QQL A;  4UYB A;  1PK6 A;  4HET A;  4CDQ C;  1I1E A;  1YIF A;  1ZBA 3;  4HG6 B;  2VCM A;  3A23 A;  1PM7 A;  3DYO A;  3WZ1 A;  4I2O A;  4Q4V 3;  4UDI A;  1VP6 A;  2VZO A;  4MXW A;  2CWM A;  1RUO A;  2TNF A;  4FAG A;  3PUQ A;  2XPJ A;  1TME 3;  4Q4W 2;  3BYJ A;  5APA A;  5LK5 A;  1W8W A;  3CJX A;  2XG3 A;  1DGR A;  2D6N A;  4OFG A;  5FRE A;  3KSC A;  4KGG A;  4RFR B;  5BNQ A;  1AR7 1;  1AR8 3;  1OC1 A;  4YVS B;  2UYB A;  1OT5 A;  3ZYF A;  4M00 A;  4BOW A;  1AF9 A;  1SLB A;  4CEY B;  5FO7 B;  2BBV A;  5FYS A;  3P2N A;  4ZS2 A;  2Y6K A;  3NV4 A;  2DYC A;  2FZ1 A;  4XHB A;  4M0H A;  4R8H A;  4YVS A;  3ZXD A;  3K1U A;  3JB4 C;  4BLI A;  1S0B A;  3LWC A;  3HT1 A;  2XJV A;  1PGL 1;  1W6P B;  3GCX A;  5CKN A;  1B35 B;  3IN9 A;  1IPS A;  4QKD A;  1BK1 A;  3WG2 A;  5FY8 A;  1FNY A;  2JB8 A;  4CDX C;  5FR3 A;  5B4X A;  4LBQ D;  5IK5 A;  4PDW A;  1GUI A;  3V0A B;  2IUW A;  1UX7 A;  5F7U A;  1FAY A;  2HJI A;  2JDM A;  3ITQ A;  4XUR A;  5C0P A;  2A75 A;  1RUC 3;  4NWV A;  1UPS A;  5C3O A;  1A34 A;  4MVT A;  4XZP A;  4OMD A;  4Q0P A;  4ASK A;  2R06 2;  3OGS A;  3U75 A;  3ZYH A;  3VZJ A;  4OI4 A;  3MUY 1;  1ZBA 1;  2R07 2;  4KU8 A;  1W9W A;  2IXK A;  4QPY A;  3RYK A;  3AP7 A;  1W90 A;  2QQI A;  1AX0 A;  1G9A A;  4NIG A;  2CNA A;  3LFI A;  5IVV A;  1H6Y A;  3OG2 A;  4N90 A;  4KC7 A;  3WP3 A;  5HBA A;  3ZDS A;  3F2Z A;  1ZRC A;  2Y6J A;  3M3E A;  5A1F A;  4C0B A;  1JZ3 A;  2DF7 A;  2B7Y A;  2GN3 A;  5IT6 A;  4HK9 A;  4CDX A;  3AMM A;  5FPA A;  4AI0 A;  2D5H A;  3Q9O A;  5L9R A;  4WZF A;  1IPJ A;  3HQR A;  4GH4 A;  3GZU C;  1D4M 3;  4JX0 A;  4QX1 A;  4DEV A;  3IM0 A;  2UYA A;  4NID A;  4FFH A;  2E9Q A;  3BU7 A;  4OZO A;  4WM7 C;  5DAW A;  4ATF A;  3POG A;  5GLU A;  1DYP A;  1AYM 3;  1PZ9 A;  1YCI A;  4ZY9 A;  2VDT A;  3VBO C;  1HQL A;  3O1M A;  4E2S A;  3AXE A;  4PLO A;  1YFW A;  3ZIX A;  1YYN A;  4AVT A;  2UWC A;  4JKM A;  2J42 A;  4YPJ A;  3DPR B;  4L11 A;  2VUD A;  3Q8E A;  1I3H A;  2WO1 A;  1OI6 A;  2YBK A;  1SDW A;  5GLQ A;  2ZMK A;  2CL2 A;  2HEY F;  4QPI A;  4LT5 A;  1FV2 A;  1OD3 A;  5C8C A;  4KU7 A;  1HB1 A;  1XNT A;  3H1Y A;  5F8P A;  4A3Z A;  5FXW A;  3BB6 A;  1UZ0 A;  5FY1 A;  4EN6 B;  3NWK A;  3UYJ A;  4CU8 A;  1MQT B;  5J37 A;  2WKK A;  5T5L A;  2ADD A;  3MW3 A;  2LM3 A;  2D6K A;  3PIJ A;  2EAA A;  2YC4 A;  5H9S A;  1W6N B;  1LRH A;  3BYL A;  3WIN E;  1UWW A;  5FLW A;  1S0E A;  2BPA 2;  4AQ6 A;  4XMI A;  5CFC C;  4D47 A;  3ORJ A;  2K2S A;  1JOD A;  1WW5 A;  2VGD A;  3P3N A;  4YM3 A;  5FPX A;  2H6B A;  5JMO A;  3WT3 A;  2YFR A;  1GZW B;  5DDJ 2;  4E8C A;  3WDV A;  5FPU A;  5A7V A;  1U5Z A;  2DUP A;  3IDB B;  3OGG A;  1SLI A;  4AHW A;  1R1Z A;  3CL1 A;  1ZRI A;  2XBO 3;  4YW4 A;  2B45 X;  4TYS A;  4LO7 A;  4AFD A;  2VNV A;  4PI0 A;  3U78 A;  3SKJ E;  2Y60 A;  3DEC A;  5KXB A;  3ZFF B;  5LA0 A;  1DGR N;  3VV1 A;  4AHZ A;  1OMI A;  1RUG 2;  1UPI A;  2EAL A;  2IXC A;  2WT1 A;  1BEV 3;  1UZZ A;  2GAU A;  3OGR A;  5ABJ B;  2GZW A;  2RS1 1;  4XTM A;  3VBU B;  5I0D A;  1J3Q A;  4N9H A;  1DF0 A;  5FTT C;  3TNP B;  2XR4 A;  3AZW A;  2TBV A;  2VOT A;  4W6X A;  3ZFF C;  1BYH A;  3L2H A;  1RED A;  2EIE A;  1NCQ C;  4K1Z A;  4CP0 A;  4PVA A;  3NMB A;  5FK7 A;  4N7I A;  3NNL A;  1POQ A;  1XSQ A;  4CUB A;  1IS5 A;  1VJ2 A;  1ACC A;  1VBC 1;  3VBO A;  3SCF A;  5EYX A;  3KV5 A;  4Y4Y A;  5JXJ A;  2YV8 A;  1DGW X;  1FOD 2;  1WA6 X;  3KF5 A;  3AZV A;  4N7U A;  2WAA A;  3USU A;  3FLT A;  2R1B A;  4TSV A;  1RUH 1;  3BTX A;  4I3G A;  1RL3 A;  1C28 A;  3J8F 3;  2P6H A;  1QJU 1;  2BGP A;  2G19 A;  2GNB A;  1Y9M A;  2PAM A;  2NYY A;  4RS5 A;  2OZJ A;  2FDG A;  3AKS A;  5AFB A;  3WCR A;  5HI0 A;  5G04 L;  3NAP A;  1EV1 2;  4COU A;  1QY4 A;  3B5L B;  4NOV A;  3EYP A;  2Y0O A;  3WDX A;  4BDV B;  4BQ5 A;  1QIQ A;  1AL2 1;  3QAC A;  4PT6 A;  1LCL A;  2XVK A;  5T54 A;  5JCT A;  2VQT A;  2X5I A;  4LOS A;  3OPT A;  3HNM A;  1NCQ A;  3ZFE C;  1VBA 1;  5D1I A;  1R08 3;  4Y24 A;  3P3P A;  3MDP A;  3EMR A;  4XUN A;  2Q5T A;  4ZXE A;  4BU2 A;  1R09 1;  3ZXG A;  1W9T A;  3J7N A;  4Y22 B;  1LB2 A;  3DYM A;  2AC1 A;  4NII A;  1LEM A;  4K20 A;  3I7D A;  5KHI A;  1US2 A;  4W4Z A;  2WT0 A;  3AP4 A;  1CX1 A;  1SHW B;  2RS1 3;  1DU3 D;  5FZI A;  4Y22 A;  4YZ2 A;  4DB5 A;  2VMC A;  2W95 A;  1QOO A;  4UFK A;  3PIG A;  1RMU 1;  3WQ0 A;  2B39 A;  4LPL A;  1UL9 A;  3I3M A;  5AYD A;  1XNC A;  1UF2 C;  3AX4 A;  1CAV A;  4JVA A;  4DOU A;  1QOT A;  1AJK A;  2A6V A;  5CEH A;  4W8J A;  1VBC 3;  1Z7S 3;  3USS A;  3ZN4 A;  3OYW A;  5FP4 A;  1C8M 2;  2VVD A;  5FY9 A;  1VB4 A;  1B09 A;  1CAV B;  3DEM A;  3RZM A;  4DXZ A;  4KMQ A;  1OA3 A;  1RUH 3;  3LOI A;  4WM8 C;  4XQW A;  4I02 A;  4YGE A;  5GKA C;  1ZRF A;  3ABZ A;  4NE9 A;  3V0B A;  1V00 A;  4RHV 2;  1RUI 1;  5A32 A;  2P4E A;  2QDN A;  1RUE 3;  4NHY A;  1QWR A;  5BXX A;  2RS5 3;  4AWD A;  4F83 A;  4N53 C;  3VB9 A;  3WPU A;  3VHO A;  1LHV A;  1GZT A;  3JZV A;  3LF7 A;  1C57 A;  4M3C B;  2PMW B;  3WXP A;  2ZGL A;  4ZU5 A;  2DVD A;  1ALY A;  3DXT A;  5FRA A;  1TNR A;  1A8D A;  1PK6 B;  2GDF A;  2JIJ A;  4JDO A;  3ROU A;  1FPN 3;  1RGS A;  3WY6 A;  1GAN A;  1PO2 2;  1DQ4 A;  2OII A;  1K42 A;  5IK4 A;  2D44 A;  3T2O A;  3BTA A;  1WMX A;  2AGS A;  4M3C A;  5KC6 A;  1RYY A;  5FPV A;  3N9Q A;  5JVV A;  3PDQ A;  4H3W A;  2C4X A;  3LQC A;  4QHZ A;  1MS4 A;  2XUM A;  1RXG A;  5A7O A;  2RS3 3;  4LBQ B;  5FY0 A;  3K3N A;  4AF9 A;  5D21 A;  3BIE A;  5J1X A;  3ZDV A;  1QJZ A;  2XVG A;  4QX8 A;  4BA6 A;  1Q8O A;  4CCD A;  3O12 A;  4P9W A;  4M3C F;  5E6H A;  5DDJ 3;  3WW1 A;  5GZD A;  3JD7 1;  2PAE A;  3MIC A;  4G9S B;  5FV3 A;  4XF0 A;  4CDW A;  4EV0 A;  1W0O A;  4ISR A;  3VSR A;  4W6Y A;  1W2T A;  3B93 A;  4IEP A;  2XJT A;  4Q0Q A;  5JSR A;  1MQT A;  3VBH B;  4E4S A;  3DL3 A;  1L7L A;  2Y8K A;  3KLS A;  3QOP A;  3POW A;  1H2L A;  1CWP A;  4O9G A;  1VBD 3;  4LE3 A;  4UT5 A;  1ZZ9 A;  4AFC A;  1NCR B;  4IET A;  2FDF A;  1NE6 A;  3E5U A;  4QB6 A;  1JXN A;  5JMC A;  1RVF 2;  2Q30 A;  4YVW C;  5GZE A;  3BTZ A;  3VZN A;  1W9Y A;  4Q4X 1;  4Z1V A;  2RDR A;  2H0B A;  1O8P A;  4LKF A;  4XMA A;  3UV9 A;  4MG2 A;  1PO2 3;  2OQ7 A;  1JYN A;  2J7M A;  1EYB A;  1G6N A;  5CFD A;  1FMD 2;  1Q8V A;  5HV4 A;  1YFU A;  1CVN A;  1FPN 1;  2ZHL A;  2DVG A;  3VDB A;  3BYW A;  4EYU A;  4Q5O A;  5JLV A;  3LZZ A;  1AR9 1;  4RYD A;  4A3X A;  1AXK A;  4S2H A;  2V5Y A;  3AKQ A;  1UOG A;  3MBW A;  4NHL A;  4Q4X 2;  5CVR A;  1Y43 B;  2WNU C;  4RGA A;  2OQ6 A;  2BFU L;  2VTX J;  3SIT A;  3WHT A;  4B1L A;  1JN2 P;  1WD3 A;  3KV9 A;  4IEU A;  3PHM A;  3JD7 3;  2ZBJ A;  4LHS A;  4HBN A;  4WZC A;  3KMH A;  3T2P A;  4U36 A;  1TVG A;  3POS A;  2L9L A;  1POV 3;  5FMD A;  1VBE 1;  4GD4 A;  4RS5 B;  2RV9 A;  5BV6 A;  2HWC 3;  1YLL A;  2K9Z A;  2ENR A;  5HV0 A;  1AR8 2;  2D5F A;  2WL1 A;  5FMO S;  2ZOE B;  4R4X A;  1VAM A;  5F32 A;  3CJI B;  3RRD A;  1JYV A;  2OT7 A;  4GAL A;  4NPM A;  4D0Q A;  1W2O A;  4I0W B;  3VD9 A;  4YZ3 A;  2GC1 A;  3GBF A;  1IS3 A;  1BJQ A;  1GWK A;  2XXZ A;  4FPO B;  3LD8 A;  4JGZ A;  5JDB A;  1PNF A;  2O0O A;  1PHM A;  4Y5Z 0;  3KZ4 C;  1TMF 2;  4COV A;  4Y3O A;  4EN7 B;  3IWZ A;  1ZZ7 A;  3ZPY A;  4Q4Y 1;  4QQ2 A;  1OYG A;  4DRR A;  3BTY A;  4AK7 A;  2KA3 A;  3LDB A;  4ERO A;  4PVI A;  5HCB A;  3III A;  4LOR A;  3URF A;  3BUC A;  1CAW B;  3W59 A;  3VDD C;  3WCS A;  2R07 3;  5AY9 A;  3M3Q A;  3VSS A;  4L92 A;  4XIK A;  4HK8 A;  2NMO A;  3NVC A;  1KS5 A;  4IV1 B;  1UW8 A;  1QJE A;  2MEV 3;  4ZXK A;  5FYU A;  1GP5 A;  4OZX A;  3E5X A;  4QX0 A;  4XW3 A;  2BWA A;  5TSW A;  2QDR A;  5BNO B;  3LCP A;  2RDN A;  2ES3 A;  3WG4 A;  4AK3 A;  1W2A X;  2F4L A;  4BQY A;  3B69 A;  3T0B A;  5F2S A;  1JOJ A;  2J1S A;  2XHK A;  1AZD A;  3CIH A;  4JTO A;  3I59 A;  1G9F A;  4Y1V A;  3WF1 A;  3ZXA C;  1SPP B;  2A3Y A;  2HLE A;  5FZB A;  2Z79 A;  1LOA A;  1R1A 3;  3QLQ A;  4O8P A;  3CF6 E;  4MGZ E;  4KCB A;  2UY8 A;  3I2J A;  5FPZ A;  3VD7 A;  1RUC 1;  4RR3 B;  1NQD A;  2HWE 2;  4FOV A;  3SKV A;  2QQW A;  3AZX A;  1OF3 A;  3LDR A;  1E5I A;  5ABJ A;  1NZC A;  2ILM A;  1WLC A;  4MET A;  1ND3 C;  2DUR A;  2HBT A;  4O9E A;  2XUE A;  4AI3 A;  1J1T A;  5FBJ A;  4RL7 A;  5ACA 2;  4KWJ A;  3B01 A;  2Q8O A;  3ZFE B;  3ZSL A;  4YWA A;  3U0Z A;  4KNC A;  1SQ4 A;  5FYC A;  4CDU A;  3D82 A;  2QTW B;  5FYV A;  3Q8A A;  2ZXQ A;  5DAP A;  1C1L A;  3JQW A;  3ZFE A;  1NQJ A;  1GNY A;  3M70 A;  1VMJ A;  3FHQ A;  3RPQ A;  2ETE A;  1UMI A;  2VBB A;  3MIE A;  4QX7 A;  3VKM A;  3RGB A;  1NT0 A;  2PLV 2;  2FBE A;  2YC0 A;  5FY5 A;  5J36 A;  4X6Q B;  2VU9 A;  1WCS A;  2H6C A;  4FVV A;  1MS5 A;  4P14 A;  4BM8 A;  4HVQ A;  5KXC A;  3VBR B;  5FYZ A;  3RDI A;  4BWO A;  2ZMN A;  5JR7 B;  3OM6 A;  5DPN A;  3T2Q A;  1ZM1 A;  3TEX A;  4BQ1 A;  3BI3 A;  2W92 A;  2WA4 A;  5J98 B;  5EFU A;  2VTF A;  4C90 A;  4Q1P A;  1UAI A;  3WPY A;  2W9X A;  1CJD A;  1S1A A;  4LHK A;  2JG8 A;  5FP3 A;  1XE0 A;  1KFU L;  2BGO A;  2J1E A;  3ZYJ B;  3TAW A;  1GKB A;  1ZZ6 A;  4WVV A;  3C7O A;  3B94 A;  4AEM A;  3ZMO A;  3E6B A;  1JZ2 A;  1DFQ A;  2JDA A;  1YWK A;  4ZU4 A;  4U6B A;  3DPR C;  3NNM A;  4IEO A;  2GSY A;  2ET7 A;  4FXK B;  5LA2 A;  3WQ7 A;  4P9G A;  4YYO A;  1JYX A;  2QBX A;  3D5O A;  2DFC A;  2F4P A;  2QZ3 A;  2A6Z A;  2F6B A;  3AYD A;  1YRZ A;  3NJV A;  4MSV A;  1UY4 A;  3MID A;  2ORX A;  3M8L A;  3CKH A;  3POF A;  4PF1 A;  4MGK E;  5C6C A;  1HIX A;  4DY5 A;  4K6B A;  1KDK A;  3X29 B;  2A6W A;  3WV6 A;  2A3X A;  3MIG A;  4NO4 A;  3D4K A;  1R08 2;  3W20 A;  5IFP A;  1QJU 2;  4UW6 A;  1QJY 1;  1UY1 A;  2HKX A;  3POI A;  2VW2 A;  4FPL A;  4QXK A;  1WCD J;  1KRI A;  2B4W A;  1ZBE 3;  4P00 B;  4E27 A;  4IGP A;  2W1S A;  5A80 A;  4GKY A;  3A0N A;  5T3N A;  1FOD 1;  1QXR A;  1MR5 A;  4CEW C;  3J8F 2;  4BXS V;  1DYK A;  1WZX A;  1JZ6 A;  1TMF 1;  4HVO A;  3LKJ A;  2HYX A;  4JC1 A;  5FLI A;  4IL7 A;  5FQ0 B;  3ACI A;  3T4V A;  4Q4V 1;  2WO2 A;  2XJR A;  2ZGQ A;  3WF3 A;  4AQS A;  5GZC A;  4C0H A;  1NXM A;  1W2N A;  2JKX A;  5ANQ A;  5JI7 A;  1W03 A;  1CZT A;  2FD8 A;  4P5Y A;  1B35 C;  4QKN A;  4GJY A;  1OFN A;  4MXV A;  4BK4 A;  2PQS A;  2WLP A;  5FZE A;  2ZGU A;  5LW9 A;  2WFP A;  4LBN A;  4QPI B;  1D2S A;  1UN1 A;  2YB7 A;  3CDZ B;  4XJA A;  5CBL A;  1NG0 A;  2HH9 A;  4QXB A;  3WD5 A;  4IND A;  1E5H A;  4M0N A;  4OHZ A;  4A6O A;  3PMS A;  3SCH A;  2RDS A;  4XFA A;  2WZP P;  1NZI A;  4AGV A;  1GOH A;  2RG4 A;  1HXS 3;  4WVW A;  1UYY A;  2CAV A;  3K75 B;  1S2E A;  4XFB A;  2PHF A;  4YVW A;  5GZG A;  1NLQ A;  3FHI B;  3ES1 A;  4QU2 A;  3HR9 A;  3WEZ A;  3TRS B;  1BQP A;  4CXW A;  1PVC 2;  1T6B X;  1YFX A;  3DGT A;  4L8Q A;  5FZ8 A;  3A22 A;  2VW0 A;  4DS0 A;  5K0U C;  3AKP A;  2PLV 3;  3JB8 A;  5GLM A;  1RXF A;  1VE0 A;  1LJ7 A;  3KVB A;  4YG6 A;  3ZO0 B;  3AYE A;  1AR9 2;  2VZR A;  4N1I A;  1G7Y A;  3AP5 A;  5A7W A;  2ARC A;  3BPS A;  3GXU A;  4M3C E;  1QEX A;  1RUD 3;  5GAL A;  1YI7 A;  3RJR A;  4XBQ A;  4FPK A;  5JPN B;  3HIF A;  1LOB A;  1UD1 A;  1LGC A;  1W99 A;  3I59 B;  1MS3 A;  4FFF A;  5A3W A;  1NY7 2;  4KQ7 A;  5ABJ C;  3ACF A;  3HPN A;  5AYE A;  3C7H A;  4J6G A;  2YHJ A;  4RQP A;  4LBK A;  2D6M A;  2RDQ A;  3IT8 A;  3W5M A;  1BVP 1;  2BW8 A;  4PDW C;  3I2H A;  4B4Q A;  1N1S A;  5IW0 A;  3RWK X;  1CON A;  1Q3E A;  1UIK A;  3OCP A;  4EN9 B;  2WFF 2;  3D61 A;  1HXS 2;  3VT2 A;  1PX4 A;  2VL4 A;  2XWB B;  4FPH A;  1X7N A;  5GLT A;  4RFT 0;  5LEK A;  1X8E A;  3D8C A;  1HW5 A;  4UOJ A;  1LOD A;  1FPN 2;  3FUQ A;  2RS3 2;  2ZEW A;  1Z7S 1;  1WGP A;  3BOP A;  2YFU A;  3K51 A;  1OBN A;  3ACG A;  4GB3 1;  1W05 A;  4QU1 A;  1UXX X;  4XF3 A;  5AVP A;  2YFZ A;  4YG3 A;  3LV4 A;  5FZ4 A;  2EAK A;  3IB3 A;  5B6T A;  1E57 A;  5DUW A;  2V5D A;  3S5Q A;  1HB4 A;  1XSR A;  3MW2 A;  4YW3 A;  4F7Z A;  3S0M A;  2XKP A;  5A7Q A;  1ZRE A;  2WWU A;  4IEZ A;  4LA3 A;  3WQ1 A;  1UOJ A;  5L7O C;  4IQP A;  4AVV A;  2AEY A;  2VZP A;  1W6O B;  2RS5 1;  3NNG A;  1NYW A;  3FL7 A;  4AFA A;  4ARY A;  3GBW A;  1RUJ 3;  5FKC A;  3TWI A;  1POV 0;  2QQN A;  1J1L A;  3FBY A;  1TL2 A;  4RSU A;  4DO0 A;  3MV1 1;  5DMY A;  5C9A B;  1MZ5 A;  2X05 A;  4CYD A;  1SEF A;  4CCM A;  3IIA A;  5F9T A;  1OD5 A;  1W6O A;  2H0V A;  3CZJ A;  3SHR A;  4TXW A;  1WA4 A;  2GU9 A;  2WII B;  4EZH A;  1V9U 3;  5KHK A;  3C2U A;  1DQ0 A;  3WDU A;  4HT1 T;  4K1Y A;  1SG3 A;  1QF3 A;  2ZCW A;  1ND2 C;  1Q43 A;  4XBN A;  4COY A;  3U10 A;  3ZSJ A;  1ASJ 2;  2WYF A;  2HWD 2;  1CAW A;  2RMU 1;  3CNA A;  4UXA A;  3UKV A;  1OLQ A;  2WA3 A;  2HYK A;  2WC2 A;  3N9P A;  5AC9 2;  1TE1 B;  3LA3 A;  4CCE A;  3A4U A;  1C1F A;  3AFK A;  2EXJ A;  1LEC A;  3WDY A;  5A3M A;  2E26 A;  2PHD A;  1TNF A;  1PVC 3;  4LIU A;  2JKB A;  2GC0 A;  3PJQ A;  3J26 N;  4HOO A;  3LA7 A;  3TB0 A;  5C8C C;  3O1S A;  4QM9 A;  5C3Q A;  4D6R A;  1OQE A;  1PVX A;  1NX9 A;  1H4H A;  1STM A;  2J1A A;  3PU8 A;  2VW1 A;  4K9S A;  3WNL A;  4D6S A;  5A70 A;  4QT6 A;  5ACA 1;  1YQ2 A;  5E16 A;  2AUY A;  1MVE A;  4XCB A;  2VZS A;  1K45 A;  4AED A;  1BK0 A;  5FY4 A;  1LAJ A;  1QU0 A;  5FKB A;  5A8D A;  5JOZ A;  5HCF A;  3I54 A;  3TNQ A;  3CZU A;  1RUJ 1;  5A1L A;  3D60 A;  1VRB A;  2DWR A;  1D4V B;  2BU9 A;  5D8A C;  2HWC 2;  4OUE A;  4YNI A;  3O1O A;  4MOA A;  2XOM A;  3ZYI B;  3TN9 3;  5FZF A;  1HB2 A;  4HMZ A;  1RUI 3;  5LAS A;  2XGX A;  4OUL A;  4AVA A;  4JKL A;  3NKT A;  1XQN A;  3EJK A;  1K5J A;  2PHT A;  4AEK A;  2YBS A;  1VAV A;  1O3S A;  3GDB A;  1ND3 A;  1SBE A;  1VRH 1;  2O14 A;  4NRM A;  5F6L B;  3I8T A;  2VM9 A;  5FO8 B;  1QJX 1;  2E7A A;  4NUB A;  5F5C A;  2RM2 2;  4NR1 A;  1Q5O A;  3GZE A;  1RJ8 A;  4WBB A;  4WVZ A;  2VAU A;  1UQX A;  3D0J A;  1AR6 3;  4CDW B;  2WZ8 A;  3A21 A;  3UJQ A;  4P9X A;  4AE2 A;  1W9S A;  1LOF A;  4BXF A;  2QQJ A;  5JR2 A;  3HWJ A;  2ARE A;  4DPN A;  1V6N A;  1ULP A;  2VTX A;  1SAC A;  2YUE A;  3EHK A;  1NCR C;  3DN7 A;  2ZGK A;  3GZA A;  1OOP A;  3H9A A;  3IMM A;  1YQ8 A;  2P34 A;  4LOT A;  3OBZ A;  1VBA 3;  3N7L A;  5JOY A;  1R08 1;  4RGG A;  1TME 2;  5FZK A;  3GF6 A;  2C9K A;  5BYN A;  4LHL A;  5FFO C;  5H9P A;  4QPG B;  5JXH A;  3WP6 A;  1WCK A;  3J7L A;  1GBG A;  3WR0 A;  2OKX A;  2ZHK A;  4ONZ A;  4ZKT B;  2CHH A;  3ZLI A;  3SH3 A;  1QXP A;  3ST7 A;  2W91 A;  1W8H A;  1V6J A;  1U5I A;  2WSU A;  5AVA A;  3RNS A;  3LSD A;  5FZ6 A;  2MNG A;  1VBB 1;  4R4Z A;  1DQ5 A;  2HWF 1;  4RQP B;  4AR2 A;  2VZT A;  1O3Q A;  1KDM A;  1VMF A;  2DUO A;  3WF4 A;  5LBB A;  5HPO A;  3QH6 A;  4UWD A;  3J4U H;  3VD4 A;  4XBL A;  3RZK A;  3WPZ A;  3ES4 A;  1JOP A;  4OHV A;  3H3U A;  4DEQ A;  3WX5 A;  3TEW A;  1XPW A;  2VMF A;  3K4Z A;  3LEM A;  3O5S A;  5AFE A;  4BHP A;  3ENR A;  1WD4 A;  3UES A;  4BQ2 A;  4FPG A;  3CJI C;  3NL1 A;  3OUI A;  4PLN A;  3SC7 X;  5A8C A;  2DCJ A;  3CEW A;  1QJX 3;  3AL5 A;  3M1H A;  1OUX A;  2B5H A;  5FLJ A;  3RG0 A;  4QMA A;  2DU1 A;  2W1Q A;  4RHV 3;  1AR7 3;  3UT0 A;  2DBI A;  3JU9 A;  2ZHN A;  3ZVX A;  1JI6 A;  3GJB A;  4ORF A;  4P9I A;  2DU0 A;  1ULF A;  4E4D X;  3EBR A;  1V9U 2;  4K40 A;  4PQ9 A;  1MS1 A;  2BQP A;  2JJ6 A;  2JE8 A;  2V73 A;  2XL9 A;  2CGO A;  3KT4 A;  2WO3 A;  4JRA A;  2QKD A;  2Q8C A;  3O1P A;  1ULD A;  2IVJ A;  2GME A;  2MHF A;  4CP1 A;  2JDK A;  3WN0 A;  4KG0 A;  1LOE A;  2BVB A;  4QQS A;  5FUN A;  5FWJ A;  5SV8 A;  3TN9 2;  3QCW A;  4AHX A;  4CUC A;  2Q8E A;  2PEL A;  1HRI 3;  1VBE 3;  4BQX A;  5C9A A;  4XFC A;  5CIR A;  3VBF A;  3MIH A;  1PT2 A;  1K5M B;  5F3E A;  1DQ6 A;  3MZH A;  5A6Q A;  1DG6 A;  2ZGO A;  3OM7 A;  3RVH A;  2Y34 A;  3FC0 A;  1NCQ B;  3B7M A;  1D4M 2;  3CMG A;  2X8S A;  4AG4 A;  1TZO A;  5JZG B;  5F3C A;  3ZPO A;  1SBF A;  2GH8 A;  3BGA A;  2EVX A;  2QFE A;  1BVV A;  4Y1X A;  4M4P A;  1FNZ A;  2CSG A;  1AYN 1;  3I3E A;  4IV1 A;  4N8M A;  2GNT A;  1LHW A;  4NHK A;  4XFI A;  4UDK E;  4UFM A;  1GOG A;  5FZC A;  5CIS A;  3HVD A;  2JEM A;  1UZW A;  5LAT A;  4PBP A;  1KIT A;  4E9K A;  3ZM8 A;  4NMI A;  2UUR A;  4R52 A;  5K0U A;  2HBU A;  4NPR A;  4XYX A;  4FTE A;  2J22 A;  3PJY A;  4WM8 A;  2VUL A;  2J1T A;  2Z69 A;  2ZAH A;  4I30 A;  4AQ2 A;  3WDW A;  4GH4 B;  5C70 A;  5CFC B;  1PO2 1;  5FCC A;  3P6B A;  5DUX A;  3BU0 A;  2BUK A;  5LA1 A;  3AKG A;  2C24 A;  3ZX7 A;  1QXJ A;  4N9I A;  4B7K A;  4D7S A;  3G7D A;  4CE8 A;  2CAU A;  4DRV A;  1KS4 A;  5EV7 A;  5FZ3 A;  1JHJ A;  1JZ7 A;  4RD7 A;  3O1R A;  3DUI A;  4LKD A;  2R04 2;  4FPF A;  2VVF A;  4HVR A;  4UDJ A;  1CAX B;  2P17 A;  3HMY A;  3NO8 A;  3VDD A;  1HB3 A;  3VN4 A;  1IGO A;  1JW6 A;  1X9P A;  3H3Z A;  4FXG B;  4CDQ A;  5K7P A;  2X09 A;  4OHY A;  1IKP A;  1AXZ A;  1WW4 A;  2KXL A;  3IKW A;  1ND3 B;  1IQD C;  1A78 A;  2EIB A;  1X36 A;  3UKT A;  3AFG A;  3HN1 A;  4NAM A;  3BOD A;  3NKG A;  1XE7 A;  1OHF A;  3S57 A;  4WV8 A;  4PHZ A;  2VMG A;  4KMI A;  3AKF A;  3RYP A;  1MS9 A;  3T3Y A;  4JDM A;  3PNA A;  4CDW C;  4LBL A;  5J3U A;  1SDD B;  4IV3 B;  2ARB A;  4GWN A;  1WLD A;  1H4G A;  1ZBE 1;  1RUG 3;  1UCX A;  1VPH A;  4HKO A;  4XPV A;  3C7F A;  1DDL A;  4COZ A;  3AYA A;  5JAX A;  1A6C A;  2VZU A;  1JYI A;  1REF A;  2O8O A;  3AMH A;  4FFI A;  4LHN A;  4FPE A;  1UIJ A;  4DNY A;  2JB4 A;  3VKF C;  1F2N A;  3H7Y A;  4J25 A;  3WVJ A;  3IAQ A;  1WUV A;  2ZX2 A;  1VBE 2;  4GKX A;  5FLH A;  4I3P A;  4LIT A;  5KBF A;  3PUH A;  4XJ8 A;  1YHF A;  3V56 A;  3UL2 A;  3VT0 A;  1W8Z A;  2IXJ A;  1QGL A;  3GHM A;  1QOS A;  1SLT A;  4IEY A;  3M3C A;  1AR7 2;  2WZR 2;  2E51 A;  2PHL A;  3H42 B;  2G9Z A;  1GQH A;  3BAL A;  3OD0 A;  4K8R B;  2ZEY A;  2RJK A;  5F5A A;  4ATE A;  4EWD A;  3CHX A;  5GLL A;  2VOV A;  3AKR A;  4AED C;  2VZV A;  2XQX A;  1LU2 A;  4IEQ A;  2LW8 A;  1F15 A;  1UMZ A;  4OYU A;  1WW6 A;  3SXW A;  1TQ5 A;  3THD A;  2GNM A;  4GZ9 A;  2OYZ A;  3FLP A;  5JPM B;  2GN7 A;  1NA1 A;  3POB A;  1EUT A;  1AYM 1;  2G9G A;  3FMG A;  5FZD A;  3T08 A;  4AI1 A;  3UK9 A;  2NPI A;  4HN0 A;  4QKB A;  3VZK A;  3R4Z A;  1ZA4 A;  3NV1 A;  3VBO B;  5GJ6 A;  3I2O A;  4AAX A;  1GYK A;  3PVB B;  3J9S A;  3VHN A;  1PZ8 A;  1NUK A;  3USU B;  5BNO C;  3DCQ A;  3R4S A;  5EPA A;  4XFH A;  4XDQ A;  4LLF A;  1HRV 2;  5FYI A;  1UY2 A;  5C4W A;  2IFR A;  1GZ9 A;  2CYF A;  1RVF 1;  2RS1 2;  5A7S A;  5LY2 A;  2VR4 A;  3FLR A;  4G4F A;  1W0P A;  1HDK A;  2Z42 A;  3RZL A;  3FN9 A;  2OUH A;  3ME2 A;  1REE A;  1VMH A;  4BIS A;  2VE1 A;  1DZQ A;  4PCR A;  3MW4 A;  1IKQ A;  2C5D A;  4NRP A;  5LA9 A;  4AW7 A;  1RB8 G;  2DVA A;  4QGM A;  1P8J A;  3D5Y A;  3FX3 A;  3E97 A;  4V1P A;  3DPR A;  4NVP A;  3OD4 A;  4URT A;  3CQO A;  4YW1 A;  5H9Q A;  3ZYP A;  5C3P A;  3PUI A;  4LO4 B;  2X8F A;  1ULG A;  4DY3 A;  3O1V A;  1COV 1;  2VCA A;  2J1V A;  2Q8D A;  4LMF A;  4AFB A;  3RZG A;  1W6M B;  5GLV A;  1DGL A;  5A7N A;  5GLP A;  3ALQ A;  5FP9 A;  4E2G A;  1V6O A;  1WMF A;  3NRU A;  4MV2 A;  5IVE A;  2YZ4 A;  4MLG A;  1N3P A;  1SFP A;  1W04 A;  2OUJ A;  2UWA A;  3FHA A;  4CXY A;  3ZXK A;  1QNW A;  2YXS A;  3FWE A;  1VKD A;  1D2Q A;  4QPI C;  1OPO A;  3W21 A;  5CFD C;  5T5J A;  3U4X A;  2JIC A;  2HWD 1;  2ZTN A;  1ENX A;  1DCS A;  5E88 A;  4Q0V A;  1W0N A;  2AR6 A;  1H2M A;  1ZRR A;  2NN8 A;  5J7M A;  1UYP A;  3JBG 2;  1OOP B;  4CPB A;  3T0D A;  3AKI A;  2Y0I A;  3OBA A;  4XOG A;  5FYT A;  2Q4S A;  3I3D A;  4YFZ A;  1J83 A;  1GZW A;  4TLG A;  2YPD A;  1CZS A;  4BE3 A;  4D6Q A;  4I09 A;  3HAG A;  5LCW L;  2JD4 A;  1RUF 1;  3V0B B;  1C5I A;  2ZML A;  3R67 A;  3LA2 A;  1OXC A;  4XXA A;  3ZXJ A;  3NV3 A;  1SZB A;  4B3N A;  2MPF A;  2JIG A;  4YVS C;  2GH2 A;  4A6S A;  4HXC A;  2BJS A;  2BOI A;  3U11 A;  4U2A A;  4Q8L A;  1EPZ A;  3SH5 A;  5DAV A;  3HQU A;  1RUC 2;  3VZM A;  5EJZ B;  4K7J A;  3CU9 A;  5A3U A;  2LS6 A;  1LOC A;  3UGF A;  5A7P A;  1BBT 3;  4FI9 A;  4HSL A;  2ZGN A;  2VPV A;  3JD7 2;  1O6U A;  1RUF 2;  4FAH A;  2E33 A;  4UDK A;  4MO3 M;  3I49 A;  2X8T A;  3ZXF A;  1LKN A;  1RIN A;  3B3Q E;  4IE6 A;  5FYM A;  1BXH A;  2DDU A;  4SLI A;  2RS3 1;  2DFB A;  5CG9 A;  3FFQ A;  3OEB A;  5JXG A;  1Y7B A;  4WM7 B;  4OCT A;  1CIY A;  1NE4 A;  2XJP A;  2CWS A;  5C9A C;  2GP3 A;  5FXX A;  3WNX A;  2LAL A;  1EV1 1;  4YGB A;  5T55 A;  3ZMN A;  3Q8B A;  1YEW A;  3HOB A;  1XE8 A;  3J7H A;  4QX5 A;  4L99 A;  4NIA A;  4A44 A;  1U0A A;  1F5J A;  5IHR A;  5DN2 A;  4GIQ A;  4HKW A;  3NAP B;  1DLC A;  3LPF A;  4FQ4 A;  1H8T B;  2W87 A;  4AEJ A;  1C5H A;  3O0X A;  1JUH A;  4IGQ A;  1G86 A;  4DXS A;  2QZ2 A;  2FZ2 A;  2GAL A;  3VBR A;  1UZY A;  2RE9 A;  3ZN5 A;  2YFS A;  1YNA A;  2VOW A;  1PGS A;  1XJA A;  1W6P A;  3N7J A;  1HJG A;  4MGY E;  2XBO 2;  5CAD A;  5FP8 A;  2FCU A;  4ASL A;  5F39 A;  3OGJ A;  4HON A;  2WRA A;  2ZAB A;  3TOJ A;  4Q29 A;  1VBB 2;  5LRS A;  5JIU A;  4CUG A;  1MQT C;  1HKD A;  1GFF 2;  2Y33 A;  4PQQ A;  3V0A A;  1ST8 A;  2N7G A;  1FYU A;  4LLO A;  3RS6 A;  3MLK A;  4A7Y A;  2EXH A;  4FCA A;  1S0G A;  3OM4 A;  1KQR A;  3WDT A;  5A3T A;  5L19 A;  2QQO A;  1OOP C;  1SCR A;  2K46 A;  1N1T A;  2YRO A;  3A0K A;  4HZF A;  1PIV 1;  2E7T A;  2Y26 A;  5F5I A;  4CDX B;  3TYJ A;  1RHI 1;  4XDP A;  5JZG C;  1PGW 2;  4QKF A;  1MVQ A;  1QDO A;  3THC A;  4CEW B;  4KG8 A;  4BJ0 A;  2VZ1 A;  4WM8 B;  1OUS A;  4E4H A;  2IC1 A;  3WMZ A;  2P3J A;  1PO1 3;  1QQP 1;  5KHJ A;  3QC2 A;  2RHP A;  5HCA A;  1AX2 A;  4PJY A;  3I2D A;  2ATF A;  1ODN A;  3M4F A;  4XJU A;  1AL2 3;  2G9F A;  2VUA A;  2W08 A;  3IMN A;  4LKS A;  4XET A;  5A3O A;  5HXM A;  5IFT A;  1W8U A;  4Y5T A;  4B1M A;  1W3X A;  2WYS A;  3NJX A;  1UU4 A;  1O5L A;  2IVI B;  3ZN6 B;  3CJI A;  1VRH 2;  4LA2 A;  1XU2 A;  4N53 A;  2VZ3 A;  3OY8 B;  2ZJC A;  3P1I A;  5FWE A;  4B4R A;  5L9V A;  2UWB A;  1Q8Q A;  4QDR A;  4R9B A;  4XUT A;  3UJO A;  3ZYB A;  2JDY A;  1OUR A;  1SLL A;  1QMJ A;  3KGZ A;  4QB2 A;  5DAQ A;  1JUI A;  1RUH 2;  2AEN A;  1AX1 A;  4EWA A;  1HLC A;  4EJR A;  4JKK A;  1DIW A;  3AMQ A;  4PIX A;  3AYC A;  4LBQ A;  1N47 A;  3KD4 A;  1FAT A;  2RJ2 A;  3NW4 A;  1S0J A;  3UGH A;  1LHN A;  2NP0 A;  3ATG A;  4JHZ A;  3OPZ A;  4Q1R A;  5BNP B;  4YGD A;  3NNJ A;  1HRI 2;  4D94 A;  4JHT A;  1R1A 2;  2ZEX A;  5KHH A;  4Y5S A;  1UU5 A;  4S2G A;  3K48 A;  4COT A;  1PIV 3;  4QB1 A;  1R64 A;  3TEY A;  2EXI A;  1AUY A;  3LIG A;  5F2W A;  2YYO A;  3GBG A;  3BIW E;  3RMX A;  3WG1 A;  3A7Q A;  3O14 A;  3WW2 A;  5AC9 3;  4XC9 A;  1D7P M;  2OA2 A;  3K4A A;  1AR8 1;  3T4H B;  1HV1 A;  2D98 A;  4AQT A;  4EQV A;  4DUV A;  5JSP A;  2WJS A;  3PUS A;  1QQP 3;  1RUJ 2;  3VHR A;  4DXR A;  3HNY M;  1UY3 A;  3H1W A;  1BBT 2;  3AC0 A;  3SIS A;  3UNP A;  2W5F A;  4DUW A;  5CG8 A;  2D40 A;  3K3O A;  2B42 B;  4RA0 A;  2QUO A;  2WN2 A;  4W50 A;  5DUU A;  1RUE 2;  2VXR A;  5CKQ A;  1GWM A;  5FZO B;  4AVS A;  4GXL A;  1T2X A;  1ZZC A;  5L73 A;  3IDC B;  4ES8 A;  1J58 A;  2VQA A;  1JH5 A;  4NHX A;  1S2K A;  2SLI A;  2LTN A;  4N43 C;  4M4R A;  4IE5 A;  4OQ9 A;  1HQW A;  5KHG A;  1W18 A;  5FZO A;  4YZ4 A;  5FMO L;  3VBU C;  4LE4 A;  4H14 A;  2Q1Z B;  1CGP A;  3H8U A;  4XFG A;  5I8Y A;  2PFW A;  1XRU A;  5JI9 A;  3KCC A;  4KBZ A;  2BTV C;  5FZ1 A;  3H50 A;  1WME A;  1RUI 2;  2GC2 A;  1LOF C;  2HWF 3;  4RR3 C;  5FZM A;  4CXX A;  4Y1Z A;  1JS9 A;  5LK7 B;  3ETQ A;  1AXY A;  3PLQ A;  4LBJ A;  3OTF A;  2HWB 2;  5DQ0 A;  1W8O A;  5LEJ A;  3PL0 A;  1L7R A;  3LGR A;  3ZFG A;  2OW4 A;  1VIW B;  2D6O X;  1UXZ A;  1UV4 A;  2GND A;  1ENQ A;  1W9F A;  2PXJ A;  4KC8 A;  2W52 A;  2IWG B;  4GB3 2;  2HWE 1;  5F5Q A;  1O59 A;  2X10 A;  3AKH A;  3MYX A;  4BH9 A;  2DVF A;  2QE3 A;  2EA7 A;  4MAD A;  5LY1 A;  4Q4X 3;  4UDG A;  1F31 A;  2R32 A;  3B9I A;  1ODM A;  1H8T A;  3CBN A;  2E32 A;  2RS5 2;  4XQD A;  3ZR6 A;  4Y1U A;  1PGL 2;  1UKR A;  2FCV A;  1VRH 3;  4JQT A;  5A33 A;  1BMV 2;  1UMH A;  4KL1 A;  3BVC A;  5FOJ B;  3HNB M;  2K0G A;  3T1L A;  5BNP C;  3D5Z A;  3NV2 A;  4GMP 0;  2PAK A;  3WSO A;  2JG8 B;  2XLG A;  2ZEZ A;  1AR6 1;  3ON7 A;  3LFM A;  4PIY A;  4O61 A;  1ND2 A;  1UU6 A;  5C3S A;  1EUU A;  4OUM A;  1X9T A;  1M4W A;  1GQG A;  1HRV 3;  2BBA A;  1O4Y A;  3Q8C A;  3WW3 A;  1YXW A;  3AK0 A;  5FK8 A;  1G9B A;  1F35 A;  2AEZ A;  3GGL A;  1ULO A;  2ZKL A;  5HCH A;  5BPX A;  4RQP C;  2ZGS A;  2WNU B;  4NHM A;  3HJR A;  1UZV A;  1ULE A;  3B00 A;  3OF1 A;  1AYM 2;  3H8X A;  1EPW A;  1RUN A;  2KM2 A;  2JEN A; 
#chains in the Genus database with same CATH homology
 3HEI A;  3D3A A;  4ET7 A;  1JZ4 A;  2VZT A;  2WZE A;  5CYY A;  5FMB A;  2W3J A;  4KMQ A;  3WF4 A;  5HPO A;  3VD4 A;  3WPZ A;  1DYO A;  3ABZ A;  3JXS A;  4DEQ A;  1XPW A;  2VMF A;  3K4Z A;  3WNN A;  3SEP A;  3LEM A;  4ZZ5 A;  2YG0 A;  3UES A;  4DUX A;  4QPW A;  3SC7 X;  3WPU A;  5A8C A;  2YFT A;  2DCJ A;  3LF7 A;  3GM8 A;  3QEE A;  4DXT A;  2W1Q A;  5G05 L;  2JD9 A;  3U37 A;  3I97 A;  2EIC A;  4UAP A;  1K42 A;  1JYW A;  1JI6 A;  1F4H A;  3T2O A;  3LEG A;  2QQM A;  3LEI A;  1RYY A;  1GMM A;  2JE8 A;  2W94 A;  2WO3 A;  2C4X A;  3LQC A;  1UYZ A;  3LE0 A;  3U14 A;  1JZ5 A;  3WN0 A;  5J1X A;  2Y6G A;  4QQS A;  5B6S A;  2J1U A;  4CUC A;  3WMY A;  4UI9 L;  2EID A;  3K4D A;  4N2R A;  3BYK A;  5B4N A;  1PT2 A;  4O8O A;  3VSR A;  3K77 A;  1NKG A;  3OM7 A;  1W2T A;  2CDP A;  4TTG A;  2WBK A;  3CMG A;  2X8S A;  2VCC A;  2VC9 A;  2Y8K A;  2V4V A;  4AG4 A;  5JOW A;  5AYC A;  3MV0 1;  3BGA A;  3WQB A;  1GYH A;  4QB6 A;  4AK5 A;  4M4P A;  3I3E A;  3WNP A;  4UDK E;  3WF0 A;  2VCB A;  3R4Y A;  1GOG A;  2CDO A;  1O8P A;  3VT1 A;  3ZM8 A;  2BER A;  1JYN A;  2J7M A;  4MGQ A;  2VZQ A;  3WAT A;  2C26 A;  2J22 A;  4P08 A;  4QAW A;  2J1T A;  2Z4F A;  1BHG A;  3VDB A;  3ETP A;  5C70 A;  1US3 A;  2VJX A;  3P6B A;  4RYD A;  1TG7 A;  3E1F 1;  3I2I A;  1JU4 A;  3MBW A;  5LA1 A;  3AKG A;  1OH4 A;  1MPX A;  2EXK A;  1JHJ A;  1JZ7 A;  4GWI A;  5JUV A;  1PMJ X;  2Y6L A;  4UDJ A;  5GLO A;  4LHS A;  3T2P A;  2W47 A;  1TVG A;  4XUQ A;  2R7E B;  3SEE A;  2QQV A;  2L9L A;  3OM5 A;  5FMD A;  2X09 A;  2RV9 A;  4L0P A;  1H6X A;  2J1R A;  1OF4 A;  1IQD C;  2EIB A;  1O8S A;  5IYY A;  3LEK A;  2VO5 A;  1Y4W A;  1Y9G A;  4CUA A;  1JYV A;  3QZ4 A;  1WKY A;  4D0Q A;  1NAE A;  3OB8 A;  3AKF A;  4FFG A;  4KMI A;  3VD9 A;  1SDD B;  4D8M A;  3I2G A;  5EJ1 B;  2Y6H A;  1JU3 A;  3C7F A;  2VZU A;  4FFI A;  3LPG A;  1OYG A;  4AK7 A;  5ANN A;  2QQK A;  4PVI A;  3VSF A;  3III A;  2V72 A;  3WNM A;  5FIX A;  4LQR A;  3IAQ A;  3VDA A;  5AY9 A;  3VSS A;  3I2F A;  2YC2 A;  1DP0 A;  5GLR A;  3PUH A;  2XHN A;  3VT0 A;  1F4A A;  4N4B A;  3UET A;  2VMD A;  3WNK A;  4QX0 A;  3BYN A;  2ZEY A;  5GLL A;  3T09 A;  1GYE B;  5C71 A;  3T0B A;  3CIH A;  2J1S A;  2VZV A;  2XQX A;  3WF2 A;  3WF1 A;  2RVA A;  2LW8 A;  4OYU A;  5JOX A;  2HLE A;  3NQH A;  3THD A;  4GZ9 A;  4BK5 A;  3OM2 A;  4O8P A;  5GLN A;  1EUT A;  4KCB A;  1J84 A;  3HN3 A;  3I2J A;  3T08 A;  3VD7 A;  3R4Z A;  1WCQ A;  4AAX A;  4E8D A;  3SKV A;  2QQW A;  3LDR A;  1OF3 A;  1NUK A;  1KEX A;  4XUO A;  4A41 A;  4U6D A;  5FUI A;  1UY2 A;  3WAU A;  2WAB A;  1GYD B;  1WL7 A;  2VR4 A;  3VD3 A;  3FN9 A;  4A4A A;  4QX2 A;  4KCA A;  3BN6 A;  2ZXQ A;  1GQP A;  1GOF A;  1P8J A;  3D5Y A;  3ECQ A;  2X8F A;  1GNY A;  3CQO A;  4KI5 M;  3PUI A;  3KST A;  3FHQ A;  3MUZ 1;  4QDS A;  2ADE A;  1UMI A;  2J1V A;  2VCA A;  4XZU G;  4CU6 A;  4OMC A;  3VDC A;  5GLP A;  5JXI A;  4IUG A;  1I5P A;  3NRU A;  3OM6 A;  5DPN A;  3T2Q A;  3C8X A;  4MLG A;  1VKD A;  2W92 A;  3FHA A;  3ZXK A;  2VTF A;  1XC6 A;  3WPY A;  2W9X A;  1W8N A;  1XNA A;  4O8N A;  3IDA A;  2Y64 A;  2E31 A;  2VQU A;  1K3I A;  1W0N A;  2BGO A;  4Z2A A;  2J1E A;  3VD5 A;  3C7E A;  1UYP A;  5FMC A;  3TAW A;  5EIY B;  3C7O A;  3T0D A;  3AKI A;  3OBA A;  1JZ2 A;  2JDA A;  3I3D A;  4U6B A;  1J83 A;  4XUP A;  2XON A;  2W1W A;  1CZS A;  4QX3 A;  5LCW L;  4RN5 A;  2ID4 A;  5LA2 A;  5A7V B;  3OEA A;  2QQL A;  3R67 A;  1JYX A;  2QBX A;  2ORZ A;  3MO4 A;  3ZXJ A;  4XVH A;  4CU9 A;  1YRZ A;  3NJV A;  4PF1 A;  1UY4 A;  2QQU A;  2ORX A;  3CKH A;  3WNO A;  5IFP A;  3CU9 A;  3T0A A;  1PMH X;  5EJZ B;  1UY1 A;  4HG6 B;  4CU7 A;  2LS6 A;  1YIF A;  3A23 A;  3VSZ A;  3UGF A;  2B4W A;  3C7G A;  3DYP A;  4P00 B;  3DYO A;  4FI9 A;  2WAO A;  2W1S A;  4UDI A;  2VZO A;  2E33 A;  4UDK A;  4MO3 M;  2X8T A;  4BXS V;  3BYJ A;  2DDU A;  1JZ6 A;  3K46 A;  2B9V A;  2HYX A;  3ACI A;  3OEB A;  5JXG A;  2WO2 A;  3WF3 A;  1Y7B A;  1K12 A;  1CIY A;  2WUH A;  3QEF A;  2JKX A;  1OT5 A;  4A42 A;  1CZT A;  4P5Y A;  3P2N A;  2Y6K A;  2PQS A;  3HOB A;  3J7H A;  4BK4 A;  4A44 A;  3CDZ B;  2YB7 A;  5IHR A;  5DN2 A;  3K1U A;  1DLC A;  3LPF A;  2W87 A;  4A6O A;  2W46 A;  5C7G A;  1GU3 A;  3ACH A;  1GOH A;  1UYY A;  3K75 B;  4ARX A;  4DXS A;  5B4X A;  2YFS A;  3WEZ A;  1GUI A;  5C0P A;  1UX7 A;  5F7U A;  4XUR A;  3A22 A;  4OMD A;  5GLM A;  3OGS A;  3U75 A;  4PQQ A;  2VZR A;  3MUY 1;  1ST8 A;  4N1I A;  1W9W A;  3GXU A;  2EXH A;  2QQI A;  3OM4 A;  3WAS A;  1YI7 A;  2WN3 A;  3LFI A;  2QQO A;  1H6Y A;  3OG2 A;  4KC7 A;  1W99 A;  4FFF A;  3F2Z A;  2Y6J A;  2XQR A;  3ACF A;  1UY0 A;  3HPN A;  5AYE A;  3C7H A;  1JZ3 A;  3KF3 A;  3THC A;  4BJ0 A;  4AK6 A;  2VZ1 A;  3WMZ A;  3W5M A;  1KGY A;  3QC2 A;  3I2H A;  3RWK X;  4JX0 A;  4QX1 A;  4DEV A;  4LKS A;  4FFH A;  5IFT A;  3D61 A;  5HXM A;  3VT2 A;  1PX4 A;  2VL4 A;  4OZO A;  2DCK A;  2WYS A;  4UOJ A;  3NJX A;  2VME A;  3OGV A;  2ZEW A;  4ZY9 A;  2VDT A;  2YFU A;  2VZ3 A;  3ACG A;  1L7Q A;  3IAP A;  1UXX X;  3P1I A;  3LV4 A;  2YFZ A;  4QDR A;  4XUT A;  1LNS A;  3IB3 A;  4QB2 A;  5B6T A;  4JKM A;  3W5N A;  4YPJ A;  2V5D A;  4JKK A;  1JZ8 A;  2WO1 A;  2BZD A;  2RJ2 A;  2AEY A;  2VZP A;  5GLQ A;  3NNG A;  4ARY A;  3UGH A;  3FL7 A;  4JHZ A;  5FKC A;  2QQN A;  2B4K A;  1OD3 A;  3MV1 1;  5DMY A;  2ZEX A;  2X05 A;  1XNT A;  4A3Z A;  1UZ0 A;  4COT A;  1UYX A;  1R64 A;  3CZJ A;  4QB1 A;  2EXI A;  4TXW A;  3LIG A;  3ZXL A;  4CU8 A;  3C2U A;  5GLK A;  2ADD A;  1SG3 A;  3A7Q A;  3PIJ A;  2YC4 A;  1D7P M;  3K4A A;  3UGG A;  3BYL A;  1UWW A;  5FLW A;  4DUV A;  3LIH A;  4EQV A;  1HN1 A;  3QED A;  4DXR A;  4D47 A;  3HNY M;  1UY3 A;  3AC0 A;  3UNP A;  2W5F A;  4DUW A;  5JMO A;  2YFR A;  3WPV A;  4W50 A;  2WN2 A;  4E8C A;  5A7V A;  2WDB A;  1T2X A;  5CZK A;  2EXJ A;  2E26 A;  4M4R A;  3SKJ E;  3DEC A;  5LA0 A;  1W18 A;  2KD7 A;  4ZZ8 A;  3WN2 A;  3WN1 A;  1NX9 A;  2J1A A;  3EB7 A;  3WNL A;  3OGR A;  3I2K A;  1YQ2 A;  5I0D A;  2VOT A;  2VZS A;  1K45 A;  2EIE A;  4PVA A;  5FKB A;  5A8D A;  5JOZ A;  5FK7 A;  3CZU A;  3D60 A;  4CUB A;  4OUE A;  4MOA A;  2XOM A;  5DQ0 A;  1W8O A;  5A1A A;  5JXJ A;  2OXB A;  3KF5 A;  1L7R A;  2WAA A;  4A45 A;  1UXZ A;  4JKL A;  1UV4 A;  3LDK A;  4KC8 A;  2BGP A;  1Y9M A;  4CVU A;  3GDB A;  1O59 A;  2W1U A;  2X10 A;  2VM9 A;  3AKH A;  4MAD A;  5IJR A;  5G04 L;  4UDG A;  1CZV A;  2E32 A;  4NOV A;  2WZ8 A;  3A21 A;  3EYP A;  4BDV B;  1UMH A;  1W9S A;  4PT6 A;  2VQT A;  3D5Z A;  3HNB M;  3HNM A;  2QQJ A;  3WSO A;  5JR2 A;  2ZEZ A;  1ULP A;  4XUN A;  4ZXE A;  1W9T A;  1EUU A;  3DYM A;  2AC1 A;  2BBA A;  1US2 A;  4W4Z A;  5FK8 A;  5JOY A;  4GWJ A;  1CX1 A;  1SHW B;  2AEZ A;  3I3B A;  2C9K A;  1PX3 A;  2WQ8 A;  3GGL A;  1ULO A;  4QDQ A;  4MGS A;  4P02 B;  5JXH A;  2VMC A;  2W95 A;  3PIG A;  4N2Z A;  3HJR A;  4LPL A;  2OKX A;  4ONZ A;  5AYD A;  2W91 A;  4KWU A;  4W8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...