3C7HA

Crystal structure of glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with axos-4-0.5.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
487
structure length
487
Chain Sequence
ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 134
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7hA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7hA02
4OMCA 1UYXA 3VT0A 3WQBA 1OH4A 1JHJA 3LIHA 2WBKA 1UYPA 2BERA 2J1TA 4A42A 1HN1A 3SEPA 3T2PA 3R4ZA 3W5NA 3MV11 4PF1A 4QDRA 2W47A 2QQNA 4CU7A 3THCA 1UY4A 1J84A 5DQ0A 3R67A 3AKIA 3PIGA 1GU3A 1H6XA 3C8XA 2QQVA 3A21A 4OZOA 1H6YA 1GOHA 1JZ5A 5CYYA 2ZEWA 3FHAA 3OGSA 2RV9A 4FI9A 1LNSA 1W9TA 1IQDC 3BYKA 2W1UA 1CZTA 2CDPA 3DYOA 3WNKA 4DXSA 3OEAA 4BXSV 1JZ2A 2X8FA 1JZ4A 1JI6A 5B6SA 3HNMA 3K77A 3WASA 2W3JA 5GLMA 1XC6A 2J22A 2RJ2A 1K45A 3T09A 4DUVA 1D7PM 2W1WA 4HG6B 5DPNA 5HPOA 1JZ3A 4DUXA 1DYOA 3C7OA 3BYJA 3NJXA 5J1XA 5AYCA 2L9LA 1PMHX 3C2UA 2VO5A 2W94A 5EJ1B 3D3AA 4LKSA 2QQWA 1YI7A 5FLWA 3WNOA 3K4DA 2VZOA 3C7HA 2VZUA 3ECQA 5JXGA 4M4RA 4OYUA 3VSSA 2XQRA 3QEEA 4XURA 2VQTA 1TG7A 2VMEA 4MADA 3P1IA 2E31A 2ZEYA 4MO3M 1DP0A 3FHQA 4KC7A 4KMQA 1JYVA 3I2JA 2HLEA 4A4AA 1W8OA 2X09A 4RYDA 1NKGA 5AYEA 2VZQA 5FUIA 2YG0A 4A3ZA 4ZZ8A 5JR2A 3FN9A 2J1EA 3IB3A 1NAEA 1UXXX 3OGVA 2WQ8A 3ACFA 1O8PA 3VSZA 2C26A 2ZEXA 1Y4WA 2Y6JA 1F4AA 2EXIA 5B6TA 5LA0A 4O8OA 5FMBA 2W46A 2J1RA 5JUVA 4N2RA 2WO3A 2WN2A 5GLRA 3WPUA 4W50A 3QZ4A 4E8CA 2W92A 2VZ3A 5IYYA 2Y8KA 2C4XA 2VJXA 3I2FA 3WNNA 1Y7BA 3BYNA 3WF1A 3MBWA 3GXUA 4CU9A 5EJZB 3BYLA 2XONA 3WEZA 3T0DA 3P6BA 2Y6LA 2JD9A 2VZSA 3OM7A 3WMYA 2WABA 4YPJA 2QQLA 5JXHA 2EXHA 5JOWA 1K42A 2BZDA 1W0NA 2B9VA 4ARXA 1UWWA 1SG3A 2W87A 1W18A 4QQSA 3OGRA 3DYMA 3C7EA 3ACGA 4LQRA 2Z4FA 1Y9GA 3T08A 3IIIA 5AYDA 1KGYA 1JZ7A 3OG2A 3D60A 2WYSA 1GMMA 5B4XA 1F4HA 1K12A 1JU3A 4OUEA 4BK5A 1CX1A 5JMOA 4XZUG 2WZEA 3QEDA 3K75B 3OBAA 2ADEA 1UMHA 2PQSA 3HJRA 4JKKA 1Y9MA 5FIXA 4UI9L 4UAPA 3NJVA 1UMIA 4CU6A 2VZPA 4P02B 2Y6GA 3AKHA 4PVIA 3HPNA 4TTGA 4KWUA 2WUHA 3HOBA 3LQCA 3LPFA 3VD3A 3CMGA 2JE8A 3JXSA 3I2IA 3AKFA 2VR4A 2BGOA 1W2TA 4KC8A 1EUUA 1UYYA 4LHSA 2HYXA 4CUAA 5A8CA 1NUKA 4QB2A 3NQHA 2AEZA 1OD3A 3WN2A 2R7EB 3AKGA 3T0AA 5CZKA 3WNPA 2X05A 3I3EA 3FL7A 5GLPA 3WSOA 1CZVA 3LE0A 3VSRA 3ACIA 3WATA 4KMIA 1PX4A 1XNTA 3GDBA 2VDTA 3WN1A 4IUGA 1WCQA 2ZEZA 3KF3A 3OM6A 2E32A 3SC7X 4CUBA 4A6OA 3DYPA 5IFPA 1K3IA 3THDA 5ANNA 1L7QA 4DUWA 5G05L 2OKXA 4LPLA 5IHRA 4QX0A 1GOGA 3D61A 2Y64A 4MGSA 3VDBA 3AC0A 2X8SA 1TVGA 4ET7A 1ST8A 1R64A 4GZ9A 2ORZA 3T2QA 2EICA 3VSFA 2VZRA 3WMZA 3UETA 4CUCA 3I3DA 5DN2A 4RN5A 4FFGA 2VZ1A 2YC2A 3F2ZA 4QB6A 2E33A 4D8MA 2QQOA 3ABZA 3SEEA 2QQUA 2LS6A 1UX7A 3BN6A 2WAOA 5GLNA 1XNAA 4ZXEA 4BJ0A 3WN0A 3HNBM 1JU4A 4A45A 1OF3A 1OT5A 1O8SA 5GLLA 4JKLA 2QQIA 4A44A 2E26A 1US3A 2V72A 3BGAA 4TXWA 2YB7A 2VQUA 4XUPA 5JOYA 1I5PA 2EXKA 2VOTA 4JHZA 3VT1A 1UY2A 5A7VB 4QPWA 4DXTA 1ULOA 4JX0A 3KSTA 1CZSA 2X10A 4JKMA 2LW8A 1JZ6A 3K4AA 2BGPA 3WNLA 4KCAA 3ACHA 1W99A 3LIGA 3UESA 4E8DA 4ZZ5A 4O8PA 3LEMA 4COTA 2YFTA 3LFIA 5LCWL 2WAAA 2V4VA 2VZTA 1UZ0A 3T0BA 1PT2A 3ZXLA 3I2GA 1GYDB 4L0PA 3VD4A 2VMDA 4QAWA 2VC9A 1MPXA 4QX1A 3OM5A 2WDBA 4ARYA 5FMDA 5FKBA 3UGGA 2W91A 4PVAA 3RWKX 3LDKA 4AK7A 3VD9A 3LEKA 3W5MA 4N2ZA 4GWJA 4AK6A 1SDDB 1UV4A 3CDZB 4P5YA 1UY0A 1JZ8A 1UY1A 1O59A 2VCBA 3LV4A 2Y6HA 2W1QA 2YFSA 2WZ8A 3I97A 4BK4A 1GYHA 1GOFA 3U37A 3WPVA 4U6DA 3U75A 4AG4A 4AAXA 4DEVA 2RVAA 4EQVA 3C7FA 2BBAA 1OF4A 2XHNA 3MO4A 1UYZA 4N4BA 3WF3A 3WF4A 1GQPA 2XOMA 5A8DA 3EB7A 3HEIA 1WKYA 3UGFA 3K46A 4P00B 3A7QA 2VL4A 1US2A 3LPGA 4CU8A 3UGHA 3SKVA 4P08A 3IAPA 3NNGA 3P2NA 3DECA 3D5ZA 1WL7A 4UDKA 5FK7A 4QDSA 1NX9A 3T2OA 4FFHA 3ZXJA 1OYGA 1J83A 3C7GA 5HXMA 1UXZA 4W8JA 5C71A 3PUIA 4DXRA 3QEFA 4O8NA 2QQJA 3A23A 3WNMA 4M4PA 5A1AA 3TAWA 1PX3A 3LEGA 5G04L 4FFFA 5IJRA 1W8NA 2OXBA 3KF5A 3U14A 1GNYA 4UDKE 4KI5M 3J7HA 4AK5A 2VM9A 1KEXA 2Y6KA 4CVUA 1DLCA 3LDRA 2J1AA 4ZY9A 5LA1A 5I0DA 2C9KA 5GLKA 2ID4A 1W9SA 2QBXA 4MLGA 5DMYA 5C70A 4UDJA 3WF0A 3HN3A 3NRUA 1YQ2A 4MOAA 2B4KA 4DEQA 3VD5A 3LEIA 2XQXA 3CZJA 4PT6A 4UOJA 1UY3A 2JKXA 2WO1A 1L7RA 2CDOA 3MV01 3HNYM 3SKJE 1EUTA 3CU9A 5JXJA 3I2KA 1W9WA 2YC4A 5GLQA 4ONZA 2KD7A 3GGLA 2AEYA 4BDVB 3CZUA 1JYNA 4N1IA 1CIYA 2J7MA 2QQKA 3I3BA 1BHGA 5IFTA 1YRZA 1ULPA 3PIJA 1JYXA 2DCJA 5C0PA 3UNPA 2V5DA 4W4ZA 5JOXA 1SHWB 2QQMA 2ADDA 3ZM8A 2ZXQA 5B4NA 2EXJA 5AY9A 3LF7A 4XVHA 3IDAA 2W5FA 3GM8A 4QX3A 4MGQA 3R4YA 4UDIA 3WPYA 2J1UA 2WO2A 2X8TA 3CIHA 2VCCA 2VZVA 1VKDA 4QB1A 5JXIA 1T2XA 4U6BA 3K1UA 3WPZA 4D47A 4FFIA 3OM4A 3VD7A 4Z2AA 3D5YA 3CQOA 4GWIA 2W9XA 3QC2A 4QDQA 3WF2A 3IAQA 2B4WA 2W95A 1P8JA 5EIYB 2VMCA 4KCBA 2YFZA 2VCAA 3ETPA 3K4ZA 2W1SA 2JDAA 3OEBA 4XUNA 5A7VA 4PQQA 2WN3A 4OMDA 3WAUA 5F7UA 4A41A 2AC1A 3VDAA 3CKHA 3A22A 2J1VA 5FKCA 3PUHA 4UDGA 5FK8A 2DCKA 2DDUA 4XUTA 5GLOA 2VTFA 3E1F1 1JYWA 1RYYA 2J1SA 1PMJX 4D0QA 5JOZA 3I2HA 5LA2A 3OM2A 3OB8A 4XUOA 1YIFA 2EIDA 1GUIA 2EIBA 3EYPA 2YFRA 4QX2A 4XUQA 3MUZ1 3MUY1 3VDCA 2YFUA 2ORXA 5FMCA 1GYEB 4NOVA 3ZXKA 3VT2A 2VMFA 5C7GA 2EIEA 1XPWA
chains in the Genus database with same CATH superfamily
4OMCA 4XHXA 3AFGA 3VT0A 1W6NB 2XKPA 2CNAA 1OH4A 4NWVA 1LODA 1ND3B 4MHRA 2WBKA 1OPOA 1GICA 4M01A 1FYUA 1WZXA 1E5SA 2BERA 4CDQA 2R062 5FZHA 4Z1VA 2ZOEB 3KHBA 4CEYC 4EN0A 2FDJA 3T2PA 1WW6A 2P6CA 1MEC2 1RMU1 4WM7A 3ZXAC 1RUD2 1CAVA 1SBFA 2VVDA 3USUB 4BQ5A 3GJAA 2I07B 1LEDA 4AHYA 3W5NA 1OQDA 2Y26A 4H3WA 4NPMA 2W47A 2P6HA 4YGEA 3WOGA 4K1ZA 3S5QA 2BYVE 3BTAA 4QKFA 5K7PA 4J25A 4GWNA 3R67A 4IE5A 3AKIA 1W03A 5DAXA 1PGL1 1H2KA 2QQVA 1BEV3 4OZOA 3PVNA 1AUYA 1KDKA 4A7YA 4GB31 3N7JA 1G9BA 3U0ZA 4Q1RA 5FAXA 1CPMA 3ALQA 4Q4X1 2HEYF 4YGBA 4H55A 4UWDA 3WW2A 4K8FA 3N9NA 2ZGTA 1DCSA 1NCQC 2D5FA 4QPIC 1F8VA 2RS33 1YNAA 4CCMA 1DZQA 4CSWA 3MPPG 1IQDC 2PYTA 1AYN3 4FOWA 1VRBA 4JDNA 2X8KA 3BYKA 2W1UA 3N35A 4QKBA 1S0BA 1XBFA 1XU1A 5B2GB 4RD7A 1Y43B 1O4TA 1Z7S2 1JI6A 1S2KA 1IG0A 2RM22 4XAEA 1OXCA 2X29A 5F3GA 5I93A 4GJYA 2W3JA 3RZKA 3NNLA 1XC6A 3THPA 5C5UA 5E6HA 1LECA 3T09A 4DUVA 2W1WA 4HG6B 4GH4A 5DPNA 5C9AB 3R05A 1DYOA 3NJXA 5DABA 4PBOA 1OKOA 5J7MA 2YGMA 5FZMA 3QD6A 5EPAA 2KM2A 4Q0VA 4K7JA 1WWYA 3PTRB 3KS7A 2ET7A 3WV6A 1TME1 1ND3C 2W94A 2VNGA 1R1A3 2TUNA 2BOJA 4LKDA 3RWNA 4E4HA 4DFSA 1DLLA 5JOXA 1KFUL 4MV2A 2XDVA 2CV6A 4Z82A 1PGW2 5GLUA 5A32A 4XABA 1PGL2 1BEV2 4OYUA 1DYKA 1HDKA 4YW3A 4NOTA 5LK5A 5DAQA 1TG7A 4NRPA 2XR4A 3P1IA 4MO3M 5ACA3 1DP0A 3FHQA 1JYVA 1IS3A 3I2JA 5FMOS 3AM2A 2HLEA 4A4AA 3MIGA 4RS5B 3ZFGC 3B93A 1NKGA 4NVPA 1RC6A 3AP9A 3IM0A 2VZQA 5FJKA 1OFNA 2K0GA 1RUG1 5EYXA 3FN9A 5JR2A 4FPOB 2CWSA 1AXYA 1M4WA 2XHKA 3NKTA 3OGVA 5ERLA 4XFCA 3VBSC 3ZFEC 2Q5TA 1REDA 3LDBA 1ZZ7A 4OUSA 5B6TA 2Y6JA 5FYYA 3UK9A 2HWF2 2P5BA 3WD5A 3RZGA 5FXVA 3EQEA 2J1RA 3SH3A 4N2RA 4DNYA 1AYM1 3SH5A 3MW3A 1H1IA 1U5YA 5HV0A 4W50A 5FZ4A 2PQQA 2HWE1 1DQ4A 3AL5A 4DY3A 1AX1A 1SACA 3V0BA 2V73A 3U4SA 2DYCA 2RS51 5A3WA 3OY8A 3IDCB 1J58A 3WF1A 2YXSA 4H7LA 3BODA 3MBWA 1VIWB 1XOYA 2JDKA 1N3PA 3SISA 4PLMA 1ZBE3 4CU9A 4K1YA 4CCJA 2F17A 3ZVXA 2XVLA 3P6BA 2JJ6A 2VBPA 2Y6LA 3KGZA 4JGZA 4C1XA 3OM7A 4TLFA 5ABJA 3VDDA 4EE2A 2EXHA 1E5HA 3AMPA 2D44A 2BZDA 4CDQC 4AEDC 2JDYA 1PO11 1TZOA 3T2TA 1VRH3 5A3LA 2MEV3 1T6BX 2XLFA 2UURA 4CP0A 3OGRA 2AUYA 5DAVA 1QJX2 1COV1 1PZ9A 3M70A 3HVDA 4DMIA 3C7EA 3CEWA 4BQ1A 5DAWA 4IEWA 4LQRA 4AI2A 3L2HA 2ZHNA 1IS4A 2WLPA 1SFNA 4EZ4A 4AFAA 4MGYE 4QQ2A 4D69A 4AI3A 2EF6A 1QJFA 4D7TA 4L9BA 3RMYA 3W9AA 1HV0A 1ACCA 3B01A 1BXHA 1FMD2 1SLIA 2OX0A 2XBO1 3IDBB 4XILA 1UL9A 5FZ9A 4C0HA 4B4QA 1LRHA 4BK5A 4RHV2 4XZUG 2WZEA 2F4PA 3J8F2 1S2EA 1FX5A 2Q1MA 4UI9L 4GQ7A 2VUJA 1Q8OA 3NJVA 4XDQA 1XYOA 4LUKA 2Y6GA 4MH0E 2QNKA 2W68A 4PVIA 1CJPA 3HPNA 4TTGA 1JOBA 4KWUA 3KT1A 3GHMA 4P9YA 5FPXA 3LQCA 4C0BA 1RUE2 2PMWB 2VU9A 2PAKA 3VD3A 4BQ3A 1TME2 4F83A 3VBFC 1XYNA 2JIGA 2E53A 4NPLA 2R041 4N53B 1NA1B 5FOJB 1VBA3 4KH9A 5CFCB 1W8FA 2Y0IA 2A6VA 1NE6A 5A8CA 4Z92B 5J98B 3NV3A 1B09A 4QB2A 1DF0A 3MIHA 4OHWA 4P14A 2BFUS 2D5HA 2GALA 4EN6B 1SBEA 3I49A 2WIIB 4IV3B 5CZKA 3NNJA 4FXKB 1W8UA 2YYOA 3R0RA 2X05A 3ZXFA 1W06A 4PF5A 2ZS6B 3FL7A 4CDWB 3JD72 1APNA 3ZMNA 2R063 2E9QA 1H8TC 5C3OA 1H8TA 4GIQA 4DOUA 4NMIA 3GBFA 3SC7X 3NNFA 1AL22 3GCWA 3LA7A 2ILMA 1W6OB 1D0GA 4NHYA 2P3JA 1HQNA 1K3IA 4Y33A 5FLHA 1IGOA 1ASJ2 4Q4V2 4LNVA 5G05L 4A7ZA 1F31A 5IHRA 2G19A 5CKQA 1JH5A 5GLZA 2IVJA 3OYWA 1XYPA 3JB4C 1LTEA 2IVIB 3KHCA 1AL0G 3GZUC 3VSFA 4PHZA 3WMZA 5DN2A 4JCKA 5ISLA 2X5IA 2E33A 4KNCA 2EAKA 4QHBA 5D1IA 4ES8A 4P9IA 4XC9A 3ABZA 4QU2A 4QXCA 2QQUA 2LS6A 1CVNA 1BZWA 3N7KA 3BN6A 4FOVA 4Q4W2 4IXLA 5FPZA 2C5DA 4BJ0A 1ND2B 3WN0A 3QBQA 2VECA 4N90A 1F9KA 4YG6A 1WMDA 2PHRA 2GN7A 4G9SB 4JZRA 4NAMA 5E8AA 3R6SA 4NRMA 4LKEA 3RPQA 4CDUB 1US3A 2V72A 1QGLA 3BGAA 1D4M2 2VH9A 2VQUA 1AYN1 3UV9A 2HWF1 1FATA 1GZTA 5FYZA 1OC1A 1N1TA 2DV9A 1DIWA 1VP6A 2BEOA 3WINE 3SLIA 4CEYB 1IPKA 1DGRA 2JENA 1G9FA 4RR3A 1V70A 3KV5A 3Q9OA 3TOJA 3RGBA 5FTTC 1RUG2 5E89A 4CEWB 4IE7A 1U5IA 5HV4A 3AZVA 2PFWA 1WD4A 2BGPA 2XL7A 3AJYA 2R6QA 1Y3TA 1Q8VA 4YZ1A 1H1AA 1UCXA 1HKDA 4V2WA 5T5OA 2HWC1 3PL0A 1VBC2 1Q5OA 1WMFA 3ZSMA 1DGWA 4ZZ5A 4O8PA 2B9UA 4JHTA 2IWGB 4FCAA 4FBFA 2YFTA 2WAAA 2P17A 2QDRA 3KLSA 3ZXLA 1OLRA 3ACLA 3ZFFA 5JZGA 2UWCA 1GWKA 4Q4Y3 3ILFA 1SPPA 3ELNA 1O5UA 1LGCA 4Q4Y1 2UYBA 4HK9A 4X6QB 2WC2A 5FZDA 3VD4A 5DAPA 4QGNA 4S2DA 5GLWA 3RYPA 4C91A 4EN9B 3H8RA 2JD4A 3OM5A 3L9JT 2W91A 5A7QA 4PIXA 3JQXA 2W0XA 3UYJA 1CWPA 5LWBA 3W5MA 1JUHA 1GYKA 3O0XA 1SDDB 4FPCA 1Z78A 3CDZB 2BU9A 4P5YA 1JZ8A 2GU9A 3S57A 5TSWA 2FCVA 2UU8A 1A78A 1N3QA 2VULA 4KQ7A 4L11A 4UXAA 3JD73 4K3UA 3LV4A 2WZ8A 4JVAA 2JDZA 3JD71 4R9CA 4KBBA 3U75A 2HWE2 4XFGA 3VKFC 2RVAA 4DEVA 2ET1A 3C7FA 1OF4A 1R083 4HVRA 4YSFA 2KA3A 2DBIA 1EAH1 3IMMA 4M3CB 3ZIXA 3O1VA 1RVF3 3T1MA 1QDOA 5BNNB 3WF3A 1RXFA 4CZSA 1GQPA 1A34A 4B1LA 1ULGA 3FLPA 1AF9A 4PDWB 2VL4A 4BLJA 2Q8CA 3ZKUA 4IV1B 4COYA 2FDHA 3IBMA 3O5SA 1U5ZA 4WVVA 1H4HA 1EY2A 1RUC2 1AYM3 4IGPA 4N9IA 3U10A 4OHZA 3P2NA 3D5ZA 4UDKA 1QXPA 1WL7A 1ENRA 2YPJA 4IE4A 3ZSEA 2PLV3 3Q8EA 2GMPA 2LTNA 3WZ1A 1OYGA 3D4KA 4AFDA 2GMEA 3ROUA 5HXMA 4SBVA 2PLV1 3HBKA 3PUIA 4Y1YA 1AR93 4O8NA 5FRAA 2AACA 3A23A 1POV3 2JEMA 2OQ7A 3Q8CA 4LK7A 3M4FA 1VE0A 4M4PA 2HEWF 3RS6A 5BUVA 2ZAHA 1QOSA 2B8MA 5IUQA 3WDWA 3GHNA 5KXBA 3LEGA 4LXLA 5G04L 2PHXA 3GBWA 4FTEA 4FT8A 5AVPA 2OXBA 4XF3A 4IEVA 4LMFA 4HK8A 1LR5A 4MXWB 5CFDB 1C57A 4OZXA 2Y6KA 5JPNB 5CB7A 3NSTA 4CDXC 3LDRA 1BK1A 4XTPA 2XUEA 1D4M1 2J1AA 2H6CA 1WLWA 2YV8A 4ISQA 1WCKA 1FOD2 5GLKA 2Q30A 4K8RB 4MLGA 4HKWA 5C70A 2RDRA 5DZEA 5HCFA 4UDJA 2PHWA 1EYBA 2BOIA 2HWE3 2VOWA 3VHOA 4GMP0 2W08A 2RG4A 4YRDA 2IZWA 2DVAA 3H8OA 4CCEA 3LB9A 5BNNA 4NIGA 1DHKB 3MDPA 4M3CA 1PO21 1LESA 4HSLA 5LY1A 1KD7A 3HNYM 2FDGA 1JMUB 2NPIA 2OYZA 3I2KA 3WP6A 2AREA 5GLQA 2WNVC 2KD7A 3TEZA 1QQP2 5C8WA 4XJ8A 2XJPA 4XW3A 1LOFA 1RUF3 2WNVA 4TLGA 1ODMA 2J7MA 1NLSA 2QQKA 2J42A 3BVCA 1JS9A 5FZCA 4PDWC 5T5JA 5LK7B 3PIJA 4LIUA 4LTAA 1HRV3 1JYXA 4YGCA 4D3WA 1O91A 1N3OA 2D97A 1QIQA 2ARAA 3J4UH 1A8MA 2NM1A 3E5XA 3OUIA 2EXJA 3RFRA 3ZM8A 1V9U1 3H3UA 1NA1C 3ST7A 4UDIA 4WM8A 2J1UA 1VBB1 5F39A 2JIJA 2P4EA 3WHTA 3ZN4A 4RQPA 5FREA 4UBHA 5CBLA 3CNAA 3E5QA 2YGLA 5D8AB 2MNGA 3VZJA 1RINA 2DWRA 3RYKA 3WPZA 1JN2P 5A80A 3PU8A 2QUOA 4AI0A 3OM4A 1TMF2 1ZM1A 1LCLA 1S0IA 4XZPA 1OH3A 2VW2A 4QKDA 4Q4W3 4TN7A 1Q43A 4PBPA 4Q0QA 1QF3A 2JICA 3IAQA 1HX6A 4UF0A 1KQRA 3LOIA 2D98A 5I8YA 3ETPA 3NV1A 1DBNA 5FCCA 4RR3B 2PTMA 2OUHA 3VKMA 5F1RA 3OEBA 3KCXA 4CEYA 2JG9C 4PQQA 2W39A 1BVP1 1UOGA 2CTVA 5J48A 3WAUA 4M0HA 1CGPA 2ARCA 1C1LA 1W04A 3F95A 1AVBA 2ARBA 4PIZA 4S2GA 4Q26A 5FKCA 4Y26A 3WW1A 4YW6A 3O12A 5FK8A 2CGNA 2DCKA 2DDUA 3MLLA 5GLOA 2VTFA 3KZ4C 4JGYB 4R8HA 2VBDA 2WT0A 3W21A 1RYYA 4D0QA 4LIVA 3PLQA 2RDNA 4N43C 5LA2A 3V0AA 5CVRA 3WXPA 4XUOA 1YIFA 4COZA 3PMSA 1GUIA 1URXA 1BBT3 3FX3A 4EZHA 1GBGA 1GZ9A 1HJGA 3MUY1 4GB33 5D8AA 4YVWA 2YFUA 1O4YA 1Z7S3 5FMCA 4UFLA 2DBNA 3TEYA 4WM8B 1OKQA 2EIEA 1Y9QA 1QQP1 1DYPA 1XPWA 1FV2A 2QTWB 2GSYA 1RB8G 3WQBA 3OBZA 1JHJA 3MLJA 4J1XA 1V6KA 2W2IA 5A3MA 2FCTA 1VB4A 2HWD1 4XF4A 3AFKA 1RMU3 3FMGA 4UW3A 3ZPYA 2WNVB 5BV6A 5JPMB 1BLZA 4PJYA 3OD4A 3D0JA 1C4RA 5FZ1A 3VBSB 1XQNA 1WCUA 3MV11 4PF1A 4CDWA 2QQNA 3ZMOA 2B45X 3BYWA 4LBQB 1VMJA 3THCA 1UY4A 5FZ8A 5DQ0A 4LE4A 4ZHNA 1RTVA 3PIGA 2R49A 4JTNA 1YFYA 3C8XA 1ZRCA 1UU4A 3JQWA 5T5LA 1H6YA 3B02A 5IVFA 1IPSA 1JZ5A 4M3CF 5CYYA 1QMJA 1AR81 3PVEA 1W2NA 4C8DA 4HXCA 3DEMA 1FMD3 2ZGRA 4QXBA 5CG9A 4UYBA 2KXLA 1S0FA 1Z0HA 2WZR2 3K51A 5A3PA 2VUCA 1LNSA 4R9BA 1PIV3 1RHI3 4X8NA 4QPIB 1W9TA 2BNNA 4K20A 3OGJA 4QQOA 3POBA 1PIV1 3J8F1 4CDXA 2HWD3 3TRSB 4L2NA 2OPWA 3VKNA 4IGQA 3WNKA 3J8F3 2CSGA 3NKGA 3OJBA 3UKVA 1EP0A 3AZWA 2HWC2 3OEAA 2DVGA 4CCOA 1JZ2A 4QKNA 3VZKA 1VRH2 2QVSB 3GBGA 1JZ4A 2O8OA 1KJRA 3VZOA 3LCPA 2DU1A 5FZOB 4FPEA 5E1RA 3J26N 2HEVF 2EA7A 4JQTA 1K45A 4B29A 1QU0A 2ZZQA 4IGOA 1D7PM 1HXS2 1HB1A 2JG8C 4P9GA 4XCBA 5J09A 3V65A 1D4M3 3WG2A 1LOCA 2GNDA 1MS4A 2L9LA 4YG3A 2E51A 1AR62 5IK8A 4QPGB 1S0DA 4WBBA 1WCSA 4IV1A 5EJ1B 2QQWA 4LKSA 2I45A 1YIPA 4PDWA 5FLWA 2GN3A 3AKTA 2CAVA 2RS31 1GZWA 2ZBJA 4C90A 5JXGA 1ZZBA 1IS6A 2VPVA 3VZNA 4M4RA 5C6CA 4WVMA 3S0MA 3VSSA 3WVJA 3O1UA 3AMMA 4Y5SA 5ACA1 5JDBA 1CONA 4AVBA 5HBAA 3O1MA 1QDCA 4MADA 4WM8C 2E31A 3JU9A 3LD8A 1G9DA 2ZEYA 4MGIE 4XQWA 4OQ8A 3DXUA 1BK0A 2YC0A 1YEWA 5FFOC 3O7OA 3VDDC 2BVBA 2VAUA 4LO7A 4XMIA 2VNVA 4FXGB 5AYEA 1F5FA 5FUIA 2D40A 1FV3A 2YG0A 5IK4A 1V6IA 3IB3A 1OUSA 5F3IA 3S5AA 2A71A 1ASJ3 4Q4V3 3PJQA 3O1SA 3ACFA 1SLTA 1MS5A 1O8PA 1ASJ1 1WBLA 4Q4V1 4AVAA 2WNUC 4LO8A 3ZFEB 1F4AA 1WCDJ 4E2QA 3WHUA 2P3YA 2VOXA 5JUVA 1W6MB 4PI0A 1ZZ6A 4IERA 4LEJA 5T50A 5BPXA 5GLRA 3VLBB 4Q4X2 3PURA 4AK3A 5FP9A 1AR73 3AJZA 2Q8DA 5F37A 2R1BA 2C4XA 5DG2A 4XE9A 4PCRA 1R1A2 1XE7A 2A3WA 1FPN1 2VMHA 3BALA 5JWPA 2A3YA 1RUF2 4P9XA 1ULFA 3ZXGA 4IE0A 4RS5A 5EJZB 4FAHA 1LAJA 3BYLA 2IXJA 1PGW1 3WEZA 2AGSA 2D6PA 4LK6A 5JAXA 1POV0 1LOFC 5JXHA 1OBNA 4QPGC 1YUDA 4D6RA 1A8DA 2A70A 2HWB1 2B42B 4JDOA 3WDTA 4ARXA 2B9VA 2JECA 1V00A 3ZYHA 4XF9A 5A32B 5FPUA 1UKRA 3MPBA 1VJ2A 1K5JA 4MG2A 1UOFA 4QQSA 1V9U3 3TAYA 2BW8A 1U12A 4ZU7A 3WQ0A 1NT0A 2B7YA 2R071 1ND2A 4I01A 3WNXA 1Y9GA 5GALA 3BKZA 1AYN2 5AYDA 1KGYA 1HV1A 1PO12 2R073 5JVVA 4DZGA 1JZ7A 4AF9A 3CL1A 3OG2A 4BISA 1ZZ8A 4CCDA 3FFQA 2WYSA 5A1FA 1R1ZA 4QU1A 1RIRA 1S0EA 4NHLA 3FE5A 2UWBA 3VZLA 5KHIA 3RDIA 5DZFA 3OBAA 3QEDA 2ADEA 1NLRA 1UMHA 2PQSA 4JRAA 5FV3A 3FFZA 4BE3A 1E57A 4GH4C 4YGDA 4DRVA 3AXEA 1AHSA 1AL21 3OYWB 4HL0A 1SBDA 4P02B 5LBCA 1H2NA 1TEIA 4O65A 5FXXA 2WUHA 3HOBA 1IKPA 4XBQA 5FY9A 2P3KA 5FZKA 1RUOA 1I9RA 3WUCA 1RUC3 2VR4A 4XJZA 2NZ9A 2BGOA 2XVGA 4FO9A 4XIOA 4KC8A 4OFGA 5A6XA 5IVBA 1EUUA 1H8TB 2YBPA 5J36A 1PK6A 1UYYA 4LHSA 5FQ0B 2HYXA 1TE1B 2FHRA 2YBKA 3R4SA 3B9CA 2ETEA 4BQWA 1O6UA 2QZ3A 5EWSA 1B35C 3B00A 3N9QA 5GZEA 3VB9A 3RSJA 3H50A 3RNSA 2CWMA 1DQ0A 4IV3A 4RGKA 3T0AA 1REEA 3VBOA 1C8NA 2G9FA 3WNPA 3I3EA 1RUD3 1R091 4QXKA 2NN8A 4Q4X3 1D4VB 5J37A 1CZVA 3OUHA 4GB32 3ACIA 1NY72 2R32A 3QH6A 1XNTA 2WYFA 1QH7A 4NUBA 1O4ZA 4NIHA 2VDTA 3WN1A 3BOWA 3ETQA 2VG9A 2E32A 3J7MA 4AEMA 3OM6A 4N53A 4YM3A 5ANNA 4AFBA 2IXLA 3USSA 4LPLA 4QX0A 1GOGA 3G7DA 3D61A 5A6YA 1HRV1 3DV8A 2XJTA 1VAMA 2X8SA 4CUGA 3S7IA 3PDQA 3AP7A 3E5UA 4YZ4A 1G6NA 3HR9A 4A7KA 1R64A 5JLVA 5K0UC 3WP5A 4GZ9A 1S55A 3T2QA 2EICA 5DDJ3 4B4PA 2PA7A 1MQTC 2RR13 4RN5A 4OI4A 3RMXA 5IVJA 5L7OC 2YC2A 4D8MA 3HQRA 1YQ6A 1QJU1 2BV4A 1QJY3 3IZOA 4HANA 4R9AA 1HB2A 4I0WB 1TMF1 2AR6A 3ZYGA 5A6ZA 4N7UA 5ABJC 1BCXA 2CYFA 1PM4A 2GH2A 1AR83 5BXXA 4BB3A 1HB4A 5CAZA 4XYXA 2JDHA 1JU4A 2K9ZA 2WT2A 1OF3A 1QNWA 1OT5A 3AMQA 4A45A 4AGGA 1C8M3 2WA3A 4CEWC 5FY0A 4ATFA 1UZVA 5GLLA 4UW4A 1D2SA 4EROA 3SH4A 1KXGA 1ALYA 5CADA 1W8HA 4QD2A 5L9VA 3WLUA 2YB7A 4TZDA 4MGZE 5JZGC 4RGGA 4MUVA 4Q29A 1UD1A 4LBLA 2Z42A 3SCHA 5F8PA 5FDBA 4DXTA 1ULOA 1DQ5A 4JGZB 3KSTA 3DPRB 3WCRA 1CZSA 1X33A 2ZX3A 4L99A 3CJXA 5KXDA 2LW8A 1JZ6A 1HRI2 3WNLA 3WDXA 4NHMA 5FXZA 1H4GA 5L73A 1QKQA 3ACHA 1W99A 2HWD2 1EAH3 3LIGA 3UESA 4BH9A 4HVOA 4E8DA 1RUI2 1UAIA 2E63A 3JCIA 3M3CA 3VBHC 2D6MA 3LFIA 2GC2A 5LCWL 2WZR3 1GANA 1KS5A 2QKDA 1KITA 4HPKA 3T3YA 2BPA2 1GP4A 4QT6A 2SLIA 1GYDB 1UW8A 2XJRA 4WV8A 1GP6A 5JSPA 4I3GA 1ULEA 4QAWA 1RUH1 4UFKA 4V2VA 3VBFA 2DTWA 5I0UA 4B3NA 3T4VA 3KQRA 1DDLA 5FMDA 5FKBA 1RL3A 4DXZA 2WR9A 1UZYA 4EWDA 5DZGA 5I0SA 2YDEA 1GR3A 4CP9A 1NXMA 1WLCA 4QQPA 4KWKA 5IK5A 3GZEA 1QY4A 5L7OA 2VUAA 1ENSA 3BTXA 1Q8QA 2W1QA 2BWCA 2DUOA 2P37A 5DUXA 3POJA 4Y20B 2YFSA 3RZLA 1GOFA 1W05A 2TNFA 3AL6A 2B46X 4R9DA 4Y5TA 5LY2A 3U37A 4U6DA 2GC3A 2BBAA 1VBE1 5FZ6A 1VRH1 1UYZA 5I8TA 4XPVA 3WF4A 2XOMA 1I1EA 3HEIA 1WKYA 4A6SA 4M3CE 4Q1PA 2BTVC 4P00B 1JHNA 3SQOA 4WZCA 4RFT0 1C8M2 1US2A 4XQ4A 2WRAA 3LPGA 3CJIC 3UGHA 3WDUA 3SKVA 1OUXA 5EP9A 1GFF2 1MS3A 1HQLA 1E5IA 3NNGA 5IVVA 4SLIA 4EV0A 5FK7A 2XBO3 3DECA 1JBCA 1BBT2 3N9PA 4N43A 5A7SA 1C3HA 4IL7A 1GLHA 2Z5WA 3PVOA 2HBTA 3T2OA 4DQAA 3DKWA 1BKZA 1J83A 3MICA 4EN7B 1UXZA 5FO8B 5KHJA 1W8WA 2LUWA 4ZXKA 3QEFA 1QEXA 4BYYA 3H42B 2WS93 3D8CA 1S0GA 1B35A 4Y1UA 5BYNA 1KDMA 4N8MA 4ZONA 4FFFA 2YBSA 4P9LA 4Q27A 1W8NA 5T52A 3AZXA 3U14A 3AX4A 2RMU1 1O3TA 3J7HA 1UIKA 4GALA 3OBTA 4QHZA 3ZX7A 5F2WA 3H3LA 4KWLA 4N43B 4CVUA 4OQ9A 1LKNA 2BP6A 5A33B 1N1SA 5KBFA 4LULA 5LA1A 3CBNA 5I0DA 1W9SA 5BNPA 3MLKA 4R4XA 3T30A 1ZA4A 4FSJA 3NRUA 1YQ2A 3KCCA 1YQCA 3ZR6A 5FYBA 4CDWC 1ZBA2 4IQPA 4LA3A 3VD5A 4AEDB 1MS0A 3R4DB 2JB8A 5FP4A 4CXWA 3HT2A 2XQXA 3CZJA 2WT1A 4HONA 2JKXA 4BQXA 1XXNA 1QHDA 2WO1A 5FWEA 2P3IA 4LOTA 1JOPA 3SXWA 3MV01 4CCKA 5FYIA 3SKJE 2WL1A 5JXJA 3FUOA 1IHMA 4E2SA 3EO6A 1W9WA 3Q8BA 4S2HA 4WZFA 1PIV2 4ONZA 5HCAA 4BDVB 4N1IA 3FJSA 4HN1A 3I3MA 2K2SA 1GWMA 1XNCA 1BHGA 3PMEA 2ZMNA 2HWB3 4YM0A 2QZ2A 1RUF1 1W0PA 2DCJA 5C0PA 1ND3A 1HRV2 1RUG3 2VTXJ 3NMBA 1SHWB 2JDNA 2VCMA 4QGMA 1IKQA 1F5JA 2QQMA 3JBG2 3KT7A 5FZ3A 5GLVA 5AY9A 3LSDA 3AMHA 1DQ1A 1W2OA 2WFF1 4MGQA 3H1MA 5FP7A 3WPYA 1V6OA 5LBFA 4NIAA 2XJVA 2VY0A 1YO8A 4I09A 3CIHA 5C8CA 1FOD3 3FC0A 4HPKB 1VBB3 4WM7C 1J3RA 1NXD1 3X29B 1HW5A 2ZGUA 4DB5A 5JXIA 2MHFA 4WVZA 5E88A 4U6BA 4WVWA 3K1UA 4RGAA 5D8AC 5FZAA 2YZ4A 3ZYJB 1AR71 3BOPA 3VBHA 1OLME 4FPHA 1W6QA 3WR0A 4E4SA 4Z2AA 1HLCA 1XRUA 3D5YA 4GKYA 2RE9A 4Y22B 1Z7S1 4NO4A 1XSQA 2OIIA 3QC2A 2WNOA 3EBRA 4EN8B 1YYNA 1ZBE1 4KL1A 1PM7A 2E6VA 4JV4A 1DU3D 2YFZA 2WS92 2VCAA 3AP4A 3DPRA 4FPGA 2W52A 2W1SA 3SMHA 2BRTA 4MLOA 4KGQA 4YLZA 1NCQA 1JW6A 2WN3A 4BMBA 4OMDA 4PLOA 2JG9B 4MVTA 5AC92 5F7UA 2YHJA 2D6LX 4YWAA 1QJZA 3MFAA 3ZSLA 3A22A 4JDMA 4FPYA 3WT3A 3RZJA 4GWMA 1YQ8A 1AXKA 4XQDA 4BQ2A 4UDGA 3MHZA 1VMHA 1JYWA 3E1F1 1QOTA 4ISRA 1OLMA 1ULDA 1FOD1 4Y22A 2YROA 1EPZA 4YVSA 4ZU4A 3TN93 3OB8A 2Q1ZB 4YM1A 2CHHA 2EIBA 2ZX4A 4LUMA 1A3KA 3I7DA 1YLLA 1VMFA 4IW3A 4TWTA 4JQRA 1AYM2 4AFMA 3WW3A 2ORXA 3DUIA 3FBYA 5DXDA 5C8CB 1IS5A 5A1LA 5C3SA 1GYEB 3POWA 3MI8A 4NOVA 2NMOA 3OGGA 5FO9B 5J96B 4CXYA 5D2AA 1YCIA 1S0CA 4GAZA 3ZO0B 5EZWA 2VGDA 3HIFA 5FYTA 5GLTA 4Y1VA 3I59B 1RJ7A 1W0OA 1XU2A 2XG3A 4UFHA 1R082 4ZS2A 1RUH2 5GJ6A 3ZFFC 1EV13 2J1TA 4AHZA 4A42A 3AZZA 3R4ZA 4ZS3A 2PHTA 1ZX5A 3BTZA 1RUC1 4JC1A 1F35A 2CY6A 2XL9A 3OPTA 3AYCA 5FZBA 2V4AA 5EFUA 3MW2A 4DO0A 2IXCA 1V0AA 4CU7A 1W8ZA 5FY8A 3TBDA 4BOWA 3VBOB 1GU3A 3THTA 3H0OA 1WLTA 3ZYBA 1EAH2 2HKXA 3NJYA 3A21A 4NR1A 5E16A 5GZGA 1ZRIA 1GOHA 1YFUA 5I0RA 1J3PA 1XJAA 3RJRA 2VOKA 4D7SA 3PHMA 1JYNA 4NIDA 1VB2A 4FPFA 1N1YA 1UOJA 2EIGA 1QXJA 2UWAA 2ZEWA 3S30A 5FQ0A 1PK6B 2JG8A 4DPNA 3ZXEA 1QWRA 2V09A 3FHAA 3L2YA 1MEC3 1WA6X 2PXJA 3VBRB 1MR5A 1CR7A 1OVSA 2JDMA 5K4LA 1LHOA 2YPDA 1AR63 4XJAA 5A33A 3POYA 1RUJ1 2ZKNA 3J7NA 1V6LA 1OA3A 4N9HA 4OI1A 2VW0A 2BGCA 3BU7A 1CZTA 3ES1A 4DXSA 3DYOA 4LBJA 3ZYFA 1DGLA 3M7AA 4Q2FA 4DY5A 3RJ2X 2Z79A 3H3ZA 4YARA 2X8FA 1B35B 4FOQA 4I30A 3ES4A 1W6PA 1RGSA 1AZDA 3AP6A 4NHXA 3VN4A 3WDYA 5B6SA 3HNMA 3ZIWA 4AQSA 5FP8A 1CESA 3WASA 1KRIA 2RMU2 5GLMA 2HWC3 2J22A 1OOPC 3UJOA 3MYXA 5JIUA 1LB2A 3HQXA 2UYAA 2DVFA 3IMNA 4K9SA 1WLDA 5HPOA 5DUWA 3AKQA 3ZN6A 3GNEA 5IVEA 5J1XA 5AYCA 4XJ9A 4NPRA 4AI1A 3O0VA 2R16A 1PMHX 1BJQA 2VO5A 2A5ZA 4IEOA 4L92A 1OVPA 1PMIA 4YW1A 4PLNA 3DF0A 2CGPA 3S7EA 5JI9A 2Q0AA 3D3AA 3CJIA 3C7HA 1MZEA 5LW9A 3ECQA 1RHI1 1NZCA 2PELA 4O61A 4Y4YA 3W59A 3QEEA 4GXLA 5JR7B 2HWF3 3W20A 2VQTA 1WW7A 4BXFA 5F3CA 4KC7A 4Y20A 5A70A 1GSLA 5APAA 1RUNA 1MQTB 5L9RA 1W39A 2H6BA 1OSGA 2ZGLA 3N7LA 5FPAA 1W8OA 2MPFA 1UPSA 1HJFA 4AHXA 4HVQA 4RYDA 2Y0OA 3SCGA 4NAOA 1UOBA 1H8VA 4GMP3 3HN1A 4A3ZA 4F8AA 1LHVA 1VBE3 4NIIA 4ZZ8A 2IXIA 3OPZA 4GMP1 1UXXX 5EV7A 3AVSA 5F6KA 4BIOA 3RRDA 5L36A 2P1BA 2XWJB 3FLTA 5FZIA 4OI0A 2DURA 4PI2A 2ZGQA 1D0HA 3VSZA 2OVUA 5L19A 1Q56A 1RUI1 1Y4WA 2EXIA 2ZGSA 4B7KA 4DIQA 4YW5A 1OA2A 2B5HA 3M3EA 5FMBA 5GZDA 2W46A 1C28A 3H8UA 1CAUA 1SCRA 3BIEA 4O8OA 1VBA2 2ZGOA 1R1A1 5FMOL 2WN2A 3ZFEA 4YVSC 2D6NA 5C4WA 4OULA 2ZGMA 4K21A 2Y8KA 4S2FA 4CRQA 3I2FA 3WNNA 5IVCA 2NYYA 1RUE3 1XNBA 3A0NA 2VE1A 4K6BA 4IEZA 4LBKA 3GXUA 3BIWE 1UKGA 3KB5A 3I4IA 4CE8A 5KWRA 4LE3A 2BQPA 3KM5A 1I3HA 3AZYA 3WY6A 2JD9A 3MIEA 4D6QA 3WMYA 1LHWA 4AFCA 2K46A 2QQLA 2VW1A 3LA2A 4Q8LA 5BNOB 5JOWA 1K42A 3HBZA 4Q4Y2 2ZGNA 3ZR5A 4XETA 3SITA 5AC93 4TYSA 2JB4A 2WQ4A 1PO13 2EALA 2AZ5A 1W18A 1LU1A 1MACA 3H7JA 1HXS1 2PHFA 2BDRA 3DYMA 5CNAA 1EPWA 2FZ1A 3ACGA 4EWAA 4Y1XA 3TN91 2E7AA 4FOYA 3IIIA 4RHV3 5FYCA 4YZ5A 2D6OX 1KJLA 2RS32 2EAAA 2VD7A 2LM3A 4LOSA 4NRQA 4BU2A 2WINB 3D60A 1GMMA 5B4XA 1F4HA 1GP5A 4OHVA 1NZIA 1RJ8A 3KGLA 1K12A 4AWDA 3OTFA 1CX1A 3HAGA 3K75B 1CAXB 1DQ6A 4AXOA 1Y9MA 3FBMA 5FZOA 3AP5A 3VBUA 5EQUA 1BMV1 5C33A 1JYIA 2KR2A 1PVC1 2Y34A 4UAPA 2RR12 1UMIA 1UF2C 4CU6A 2VZPA 3DCQA 2MEV2 3DPRC 3IN9A 1G8WA 3K3OA 5LEKA 1X82A 4IETA 5IWFA 5A3TA 1WD3A 4AQTA 1AR82 1YFXA 3RQ0A 3QACA 3WDVA 3KVBA 1SDWA 3JXSA 1V6MA 4E9KA 1O7FA 1OA4A 1HB3A 1YI9A 2YMZA 1G9CA 4QPIA 3AVRA 3HT1A 3K2OA 4N53C 3AKFA 1LHNA 4HKLA 3GZTB 2C6SA 1HIXA 1C5IA 4HOOA 4U2AA 5LATA 1OURA 1TQ5A 4W6YA 2P2KA 4CUAA 2A1XA 5F5IA 2JE7A 5HI0A 1J1LA 3NQHA 1DGWX 2AEZA 4P9WA 4XEZA 1MS1A 2R7EB 4XJWA 4BA6A 5CA6A 1QOOA 4COVA 4NROA 4CPBD 2GAUA 2VBBA 4LBQA 5L7OB 3WSOA 5GLPA 1EV12 1DFQA 1PX4A 3M8LA 1ZYBA 1V6JA 1SEFA 1XNDA 3PUSA 4IUGA 1WCQA 2ZEZA 4RSUA 5JMCA 5A7PA 3DYPA 4RFRB 4A6OA 5IFPA 3THDA 1L7QA 3D5OA 3NW4A 3JB8A 4DUWA 5FUNA 2OKXA 3G6JB 3N9MA 3WP3A 2BFUL 2Y64A 4MGSA 3VL9A 1YQ5A 3AC0A 3AYEA 2RS52 3EMRA 1PZ8A 1A6CA 4OVEA 4NWWA 2E7TA 3K3NA 4AE2A 1ST8A 1WUVA 3AKSA 4FPJA 2WZPP 3I2DA 5C9AC 2FMYA 3I54A 3URFA 4AAPA 3U78A 1FNYA 4XFBA 3IPVA 4MZUA 4YVWB 4CUCA 5FUPA 4AEKA 3CU7A 3ASIA 3GYDA 1WW4A 2D3RA 4D94A 4QB6A 3OCPA 4RS5C 5H9SA 3ZFGB 3SEEA 3UKTA 3EJKA 5KXCA 3V0AB 4I3PA 4QX5A 3N7MA 3FUQA 4LBMA 4LORA 3HNBM 4AGRA 5KHGA 2WSVA 5BNPC 1O8SA 5C4WC 2LRPA 3NV4A 1W9FA 2D3SA 5IAVA 4JKLA 2IXKA 4AHWA 2E26A 2OA2A 2DCYA 5A7WA 4XUPA 4ASKA 3E97A 3OSDA 1QNYA 3KV4A 2VOTA 4FQZA 1X50A 4QPWA 4I02A 2WNEA 4JX0A 3QLQA 1GQHA 4LT5A 1LHUA 4UF0B 3VUOA 1U0AA 1QJEA 2F6BA 1LOBA 2ZTNA 1RXGA 2X10A 3AMNA 4JKMA 4BMEA 3E6DA 3K4AA 2C1FA 1L7LA 4NE9A 4QMAA 1XSRA 2D43A 4KCAA 5DDJ1 2ZMKA 3BUCA 1VBB2 4HZFA 1V9U2 2XJQA 1RVF1 4ITCA 3DKQA 3ON7A 3LEMA 1UZZA 1KFXL 1QJX1 2WNUA 5FZGA 4CCNA 3H1YA 4KBZA 2VZTA 1LJ7A 5J3UA 1CX4A 3NV2A 1W6MA 2I2SA 1W2UA 2WZR1 4YFWA 5EXOA 4MSVA 4AEJA 4ASLA 1K5MB 2Q1FA 2RS53 4YW2A 2H0BA 2DUPA 5LA9A 1UO9A 2QE3A 3R4UA 1OQ1A 4ARYA 4XOGA 3GCXA 2VVEA 4J6GA 4HMZA 4R52A 3UGGA 2R1DA 3B7MA 4PVAA 1N47A 1J3QA 1ZBE2 2IFRA 3LDKA 4MGKE 4COWA 3LEKA 4AK7A 4GWJA 2RJKA 1NG0A 5FP3A 4AK6A 5FOBB 2NLRA 1UY0A 2XJSA 1STMA 1MZFA 1O59A 2XVKA 4IE6A 5IT6A 1AR72 4QPYA 5LBBA 3CF6E 3MIBA 3WPVA 3GZAA 5DG1A 4AG4A 1YJKA 4AAXA 2GZWA 1BVVA 2Q4SA 3H1WA 2ZGKA 3ZYPA 2Q8OA 4WVMB 4IEUA 4N4BA 1NLQA 5A8DA 1GZWB 1SLCA 2VNOA 3BI3A 3EB7A 5AVAA 3UGFA 3K46A 3A7QA 3AK0A 1PNGA 4ORFA 5CU1A 1UN1A 1X8MA 1H2MA 2BUKA 2ATFA 3MIFA 5FPBA 4CU8A 5C3QA 1CIWA 4QPGA 4P08A 2LALA 1MEC1 3T1LA 5A3UA 1CJDA 2ES3A 4H14A 1NX9A 4HLTA 5SV5A 3ZXJA 3MGUA 5K0UA 4MXWA 5CFDA 1WW5A 4W8JA 5C71A 5LASA 4DXRA 5CG8A 1LGBA 5EYYA 2QQJA 3WNMA 4G3YC 4BCUA 3TAWA 3DN7A 1PVC2 1PX3A 1VALA 3JZVA 4AVSA 3POSA 2DTYA 2RMU3 5FJHA 3KF5A 1OD5A 4JTOA 4UDKE 4AK5A 2VM9A 1KEXA 4CDXB 4X8PA 4EYUA 1LULA 5FLJA 4LLFA 1JXNA 3POEA 1CN1A 1DLCA 5JI7A 3KV9A 2GP3A 4YW4A 3U1XA 1KS4A 2DCZA 4UW6A 4KWJA 3BB6A 4FPLA 1HXS3 4AR2A 4W6XA 4IDZA 5DMYA 3HWJA 3TEXA 3HN3A 3OBRA 1D2QA 1COV2 5L9BA 4MOAA 4DEQA 4XDOA 1M06G 1BQPA 5FZ7A 5T54A 3LEIA 2VXRA 4PQ9A 2VQ0A 3MFCA 4QX7A 4CCCA 3BU0A 4QM9A 1UPIA 2PHLA 3KCYA 4HSJA 2FDIA 3WX5A 3VV1A 2A6YA 2YUEA 4NJ4A 3CU9A 1EUTA 1HN0A 3VBSA 2YU2A 1OOPB 2DCTA 2R0FA 2YC4A 3N9OA 1UQXA 1WMXA 3GGLA 1DZTA 1GNZA 2C0ZA 4HETA 3VZMA 4XFHA 1ZZCA 3TNPB 4LKFA 3U11A 4ATEA 1YRZA 2C24A 5IFTA 1ULPA 5LRRA 2ZZJA 5JSOA 2WKKA 2P34A 1NOVA 4YG0A 2BWAA 2FQPA 4JAAA 3OOXA 4LR4A 5T5PA 2ADDA 4A2UA 5B4NA 2ZXQA 2RS13 1K5MA 3A4UA 3LF7A 4XVHA 2R043 2W5FA 3ILNA 3R4YA 1SPPB 1RUI3 1XE0A 2RDQA 2WO2A 1W28A 2X8TA 3ZFFB 2VZVA 4QB1A 2BJSA 1TL2A 3M1HA 4RR3C 4QGLA 5KHKA 4AVVA 2WNUB 1PO22 2LROA 5A7OA 1CPNA 1HRI3 3JBG1 3UKNA 2AENA 2GNBA 4D47A 4Y24A 3PNAA 3PJYA 3O1OA 1PGSA 3VD7A 4Z07A 2XUMA 5F32A 1RMU2 4Z2WA 2R072 4GWIA 2W9XA 4META 4CEWA 4QDQA 2R061 4JGYA 5C3PA 1YXWA 4OHXA 2B4WA 5FXWA 5EIYB 1SLAA 4JGYC 2VMCA 3ZYRA 1UU6A 3K4ZA 4LO4B 1AR92 4CYDA 4XUNA 4W6WA 3WG4A 4QX8A 3ZXDA 3VDAA 5A7WB 4CDUA 4UW5A 4FAGA 5BNPB 1PZ7A 3I3QA 2MEV1 4DRRA 2WSUA 5C8CC 4XUTA 2I74A 2PAMA 2XLGA 2ARXA 1ENQA 1PMJX 4G4FA 5JOZA 2FCUA 2OPKA 3KD4A 2G1MA 2PHDA 2XLAA 4YVWC 1ZZ9A 3OM2A 3QOPA 3EXUA 3DGTA 4RHV1 3B5LB 1HRI1 2OQ6A 5KXEA 2EIDA 1NY71 3EYPA 3JUUA 2YFRA 3LSEA 3ORJA 3LZZA 2X5IB 1QJY1 5DUUA 4X6RB 3SHRA 5T3NA 4UFIA 4E4ZA 2JKBA 3TNQA 2XJUA 1BYHA 3IPVB 1TMF3 4RQPB 4Q4W1 2A6WA 5F5AA 2VMFA 5FPLA 5C7GA 1IG3A 1WMEA 1ZA7A 4YZ2A 4FTBA 1UYXA 4IEQA 2X53S 4IV1C 3WUDA 3LIHA 1EV11 5FZ0A 5F9TA 2OT7A 2FDFA 1UYPA 3UJQA 4AI9A 4HFSA 3ZDSA 4MX3A 2RDSA 4LBNA 4XFFA 5SV8A 1HN1A 3SEPA 2JDPA 4CP1A 3SNMA 1H1MA 5F5QA 2FDKA 1OOPA 2IFWA 3S6PA 4QDRA 4QQHA 3RI8A 4D7YA 4QHOA 1UIJA 1LEMA 5ACA2 2H0VA 3POGA 1J84A 2WA4A 1CD3G 3VHPA 3Q8AA 3NNMA 1H6XA 2G4IA 3FHIB 5CKMA 5LEJA 1VBC3 2XXZA 2NQYA 4KG8A 3KWVA 1ODNA 3APBA 4IEXA 3QH7A 1V6NA 1R093 2FMDA 3ME2A 4XFAA 4AQ6A 4CP2A 1S1AA 3W58A 1XNKA 5F6LB 3FZ3A 4HT1T 1AR61 3OGSA 1H0BA 2RV9A 4FI9A 4B8EA 4XHBA 3LFMA 1G86A 1QQP3 2JWPA 3U4XA 5C5TA 1RUH3 4IEYA 4FPKA 4H2AA 1UMZA 3MZHA 2QFEA 1AR91 2OS2A 3MW4A 2CDPA 2VXJA 1X9PA 4D6SA 2CL2A 4BXSV 2HBUA 4UT5A 3UT0A 1VAKA 4F7ZA 5FR3A 1JODA 4AOCA 2WWUA 5LZ6A 1CAXA 3K77A 5FWJA 1XB9A 1ZBA1 4KU7A 2R30A 1O3QA 4LBOA 1MVQA 2RJ2A 3FLRA 4ES9A 4GKXA 5K0UB 1NE4A 1ENXA 2RR11 4DUXA 3C7OA 1JZ3A 5IAXA 2WWJA 3BYJA 4R4ZA 1BMV2 3UL2A 4MGTA 2GDFA 1BEV1 5FY4A 1RHI2 3C2UA 4L97A 4LHNA 2PLV2 2CU5A 2ZABA 1F2NA 1OFSA 1DQ2A 1FMD1 2XBO2 4ZKTB 2TBVA 1YI7A 4CPBA 1C1FA 3K4DA 3WNOA 2VZOA 5BY5A 2O14A 5LRSA 2VZUA 3O0WA 1VBD1 5JCTA 1ND2C 1F15A 4AQ2A 5GM0A 1U5XA 2XMLA 3I8TA 4Y4RA 4EJRA 1O3SA 3MEPA 2XQRA 4O7XA 1MS9A 4RQPC 4XURA 2VTXA 4N7IA 4GJZA 5BNOA 4LHLA 2VMEA 3SCFA 3VDDB 1SQ4A 2N7GA 2XPJA 3AXDA 5C3RA 4KMQA 2IC1A 1UX6A 2G9GA 1Q8PA 2O8QA 4URAA 2IUWA 4XXPA 2QJVA 2X09A 1S0JA 2HYKA 2E7QA 4Y1ZA 3AYDA 2UY9A 4ONUA 4JGZC 4BIFA 2RHPA 2J1EA 2F4LA 2DU0A 1NAEA 2DVDA 2ZKLA 4GA9A 3ZKYA 2WQ8A 2SBAA 4O9EA 5GZFA 3WQ1A 3KV6A 4XCAA 2C26A 2ZEXA 3KSCA 1RVF2 2VMGA 5C4WB 2QQPA 2WJSA 5LA0A 4IEPA 2WO3A 1S4CA 3HD8B 5JZGB 1VBE2 3WPUA 2ZMLA 3JBG3 3MF9A 2GC1A 5M0TA 3QZ4A 4E8CA 2W92A 2VZ3A 1RUE1 5IYYA 2VJXA 4YFZA 1O3RA 1Y7BA 1OLQA 3V64A 3BYNA 3Q8FA 4COUA 2ZCWA 3B3QE 3GJBA 3ITQA 3OD0A 2DVBA 2VOVA 1W9YA 1G7YA 1T6GC 1ZNPA 4BPZA 4BHPA 3D6EA 3RZHA 1X7NA 1NQJA 2GNMA 1VAVA 3PU3A 4UFMA 1AXZA 2XONA 3CHXA 5I91A 3T0DA 4XDPA 3RG0A 5FBZA 3O14A 3NL1A 4FQ4A 2VZSA 1OMIA 2WABA 3ILRA 1POQA 3P3PA 4YPJA 1SLBA 2QDNA 2ENRA 3VBUC 3N4MA 4Z8BA 1ZRDA 1W0NA 3M3IA 1SG3A 1UWWA 1W3XA 2WWSA 2W87A 1COV3 4RL7A 4XBNA 3PVBB 2DUQA 2EVXA 2ZAAA 1VR3A 2FZ2A 1SFYA 3WP4A 5FZLA 1AX0A 3TWIA 2AYHA 2Z4FA 3ZFGA 3VHRA 1PNFA 1ZRFA 3T08A 1NCRC 1FPN2 3T4HB 1TNRA 2GP5A 3LAGA 2DF7A 3ZN6B 3ZSKA 4Q8KA 3ZLIA 5HXVA 4AGVA 3KQ4B 1JU3A 4OUEA 1R092 3AB0A 4AYUA 5JMOA 5A3OA 1ZRRA 2A3XA 1PVC3 3HJRA 4JKKA 4YM2A 1NYWA 3AYAA 1RUJ2 1W6PB 5FIXA 4AW7A 1POV1 2OW4A 4QWNA 2XGXA 3RVHA 2ZACA 3AKHA 2A6ZA 2C9AA 3OPWA 3RZMA 3E6BA 3FWEA 3LPFA 4BQ4A 1WGPA 2RM21 2GNTA 2JE8A 3CMGA 3IDEA 3I2IA 4DS0A 3KMHA 3POFA 2ZX0A 4FVVA 5AC91 3CO2A 4LBQD 1W2TA 1W6OA 3DL3A 4AVTA 3V56A 3N3HA 5H9RA 3TEWA 1MVEA 3BCWA 4QXHA 1SCSA 2DFBA 2ZX2A 5CISA 1NUKA 4PIYA 4XTMA 1UNBA 3B69A 1OD3A 3IWZA 4L8QA 5GKAC 5IVYA 1VBC1 3U07A 3TB0A 1SZBA 2AH2A 1PK6C 4INDA 4M0NA 3WN2A 5DUVA 2YY1A 3AKGA 2X5IC 5LBEA 2D93A 1OQEA 1FNZA 2ZA9A 1FAYA 5FPVA 4V1PA 3VSRA 3LE0A 3WCSA 3WATA 5FY1A 4KMIA 3AKRA 3GDBA 3LA3A 4URTA 3WW4A 5CFCA 3KF3A 4MYEA 3RZZA 1GV9A 4CUBA 1NA1A 2V5YA 2A75A 4TSVA 3ZDVA 2VQAA 1AL23 2PHUA 1LENA 2R0HA 4I0AA 4B1MA 3OUJA 1H30A 4A3XA 2CAUA 5FBJA 4OCTA 4BM8A 4B4RA 3VDBA 4Y3OA 1YJLA 2VVFA 1K5MC 1AX2A 1W90A 3B9IA 1SFPA 3HQUA 4LO6B 5FO7B 1TVGA 1X36A 1DZRA 4ET7A 1ZREA 4YZ3A 1GWLA 2ORZA 3J7LA 3VBUB 4B7EA 3GF6A 2DFCA 2VZRA 2GMMA 2WFPA 3TN92 2Q8EA 3UETA 3I3DA 4FFGA 3HMYA 2VZ1A 3F2ZA 2QQOA 2BVVA 4E2GA 4P5HA 4LITA 3BTYA 1UX7A 4XAAA 2WAOA 1TME3 4MXVA 5GLNA 1XNAA 4ZXEA 3N36A 1PVXA 1NCRB 4XXAA 5A6QA 4HN0A 3H8XA 5CKNA 1CQ9A 2OZJA 3PUAA 3O1TA 2WLQA 1PHMA 4C1WA 5IATA 4A44A 2QQIA 3PUQA 1LGNA 4TXWA 1IZ3A 5JOYA 1RUJ3 1I5PA 2JG9A 2EXKA 5IK7A 4LJHA 2BNMA 3VT1A 4JHZA 1UY2A 5F2SA 1AJOA 1JTZX 2FBEA 2GC0A 2GH8A 5A7VB 5ABJB 3MF6A 2VMIA 4NHKA 4QQLA 4UFJA 2HJIA 3KT4A 4GULA 4HBNA 3ZPOA 4W65A 4XMAA 3LGRA 4H7MA 1VLNA 4BLIA 4E4DX 4UBGA 3IT8A 3NJZA 4I2OA 1L3JA 5FZFA 5IW0A 4XACA 4LO5B 5EHDA 2O0OA 1X9TA 1GQGA 1W6QB 2JE9A 3VBHB 3O1PA 1QJX3 3OY8B 5JIAA 2FD8A 3M3OA 3PTYA 4Q0SA 4COTA 3V0BB 5KC5A 3QCWA 1JUIA 2V4VA 2WQZC 1REFA 4OI2A 5KR7A 1UZ0A 3T0BA 4CCLA 1PT2A 1CAUB 3I2GA 4DINB 4ZPIA 5GZCA 5F3EA 1YWKA 4L0PA 2HWB2 2ZHMA 4KU8A 1C8M1 4XBLA 2VMDA 1IOAA 2VC9A 1MPXA 4QX1A 5C2MA 2WDBA 5I8SA 3RI9A 4LHKA 1UZWA 1J1TA 2PAEA 3RWKX 1LOEA 3NAPC 3VD9A 4N2ZA 3NAPA 1UV4A 4QM8A 2RJLA 5BNOC 1G9AA 2VUDA 1Q3EA 1OHFA 1UY1A 1FT9A 3AKPA 1OPMA 3EHKA 5H9QA 1N1VA 1MQTA 2O1QA 1W8TA 2VCBA 2Y6HA 5BNQA 4NN0A 2XB6C 5EJ3A 1LOAA 1I6XA 3I97A 1ZBA3 4BK4A 4XJUA 5FY5A 4BZ4A 1GYHA 4RA0A 1OI6A 3B94A 3TYJA 3M2MA 4KGGA 4EQVA 2XHNA 1X8EA 3MO4A 4YYOA 1R081 4MHUA 1ZVFA 4AEDA 4HKOA 4Q5OA 1LU2A 4AL9A 1JOJA 1CAWB 4CDUC 2Y60A 3CJIB 4JRLA 3E6CC 5KHHA 3DXTA 4AI8A 1JYCA 3NVCA 3P5BA 3IAPA 1S2BA 3J9SA 1VBD3 4AVCA 2IXHA 3NO8A 3D0SA 4QDSA 4YW7A 4LLOA 5FZEA 4XFIA 4FFHA 2NP0A 4GH4B 1QXRA 1QH6A 5C9AA 5BNNC 4YNIA 3C7GA 2WS91 3VKOA 4IV3C 4K40A 5A1AA 1VPHA 3H9AA 5K8SA 2A6XA 3VBOC 1MS8A 1H9WA 4XIKA 5AFEA 4OHYA 5IJRA 2RM23 1GNYA 1O5LA 3M3QA 2YU1A 2ZGPA 4KI5M 1YHFA 5A7NA 3WG1A 1IQAA 3GALA 1GNHA 2Z69A 1SMVA 3MIDA 1RITA 2A7AA 2B39A 1VBA1 1MZ6A 4Q0PA 3VBRC 1WBFA 4ZY9A 2Y33A 1J59A 1HQWA 4OLLA 3VBRA 4Y5Z0 2C9KA 2ID4A 2QBXA 2WFF2 2QCSB 4KG0A 2JG8B 2ZJCA 2JX9A 2JXAA 3WF0A 4ASMB 4Q0UA 3BPSA 4GD4A 1CAWA 2B4KA 4ZU5A 2XH6A 3ZSJA 1ONAA 2VNRA 2NMNA 5CFDC 2XKOA 1RUD1 5CEHA 1SLLA 2ZPXA 1PO23 4PT6A 4UOJA 1UY3A 2D7FA 5HCBA 5K9YA 1Q8SA 3OF1A 1L7RA 2CDOA 2UY8A 5A3NA 2OUJA 5D21A 2WO7A 2A73B 4CXXA 2Z2SB 5FYUA 3WQ7A 2R042 4CP9B 1CAVB 3USUA 2TEPA 4WM7B 2AEYA 2RS12 3CZUA 3KVAA 3LWCA 1CIYA 2G9ZA 1FXZA 3I3BA 3NAPB 1XE8A 2ZHKA 3LKJA 1JYTA 4M00A 1DGRN 4J1WA 4CDQB 5AFBA 1W2AX 1WA4A 2V5DA 3I59A 4W4ZA 3UNPA 5FYSA 5FLIA 4U36A 1W6NA 2BBVA 3VBFB 3ZOIA 3IKWA 3IDAA 2HH9A 3GM8A 4IESA 4QX3A 1IPJA 2CGOA 3VHNA 2RS11 4FTSA 1GKBA 2WFF3 2XWBB 2JDUA 2VCCA 1H2LA 3BPZA 1VKDA 1ULCA 2ZHLA 1I5ZA 5KC6A 3LOBA 1TNFA 1T2XA 1QJU3 1W3VA 4O9GA 3VKLA 4FFIA 5F5CA 1NQDA 3CQOA 4YVSB 1FPN3 3IIAA 4XF0A 5HCHA 4F3JA 3ZN5A 1E5RA 2D3PA 5ANQA 2W95A 1P8JA 3NWKA 5FYVA 3WF2A 3H7YA 5CFCC 4KCBA 3POIA 4CA9A 4FP3A 1MZ5A 2JDAA 4EWEA 5CIRA 4FP2A 5I0TA 5A7VA 3INAA 3ATGA 1GZCA 2Y38A 3P3NA 4AZZA 5FY7A 1LOGA 1NCQB 4A41A 2AC1A 5T55A 3CKHA 3ZYIB 1VBD2 2J1VA 5LB6A 2Y6FA 3PUHA 3VGIA 4BQYA 1YFWA 1QJY2 2D6KA 3ENRA 4OUMA 1NCRA 3CLPA 2J1SA 1C5HA 5FYMA 3I2HA 1AJKA 5DDJ2 3VL8A 3K48A 1FI2A 3C3VA 1DG6A 2OZ6A 4E27A 3O1RA 4QX2A 3N9LA 4XUQA 3MUZ1 2BNOA 4CTEA 4XF1A 3WG3A 3VDCA 1BBT1 4P9JA 3D82A 3A0KA 2PN5A 3RYRA 1H9PA 1YC61 5H9PA 4BWOA 4LA2A 1UU5A 5JSRA 2ERFA 3ZXKA 3I2OA 3VT2A 1QJU2 4I0BA 2ZX1A 5FYHA
chains in the Genus database with same CATH topology
4OMCA 1UYXA 3VT0A 3WQBA 1OH4A 1JHJA 3LIHA 2WBKA 1UYPA 2BERA 2J1TA 4A42A 1HN1A 3SEPA 3T2PA 3R4ZA 3W5NA 3MV11 4PF1A 4QDRA 2W47A 2QQNA 4CU7A 3THCA 1UY4A 1J84A 5DQ0A 3R67A 3AKIA 3PIGA 1GU3A 1H6XA 3C8XA 2QQVA 3A21A 4OZOA 1H6YA 1GOHA 1JZ5A 5CYYA 2ZEWA 3FHAA 3OGSA 2RV9A 4FI9A 1LNSA 1W9TA 1IQDC 3BYKA 2W1UA 1CZTA 2CDPA 3DYOA 3WNKA 4DXSA 3OEAA 4BXSV 1JZ2A 2X8FA 1JZ4A 1JI6A 5B6SA 3HNMA 3K77A 3WASA 2W3JA 5GLMA 1XC6A 2J22A 2RJ2A 1K45A 3T09A 4DUVA 1D7PM 2W1WA 4HG6B 5DPNA 5HPOA 1JZ3A 4DUXA 1DYOA 3C7OA 3BYJA 3NJXA 5J1XA 5AYCA 2L9LA 1PMHX 3C2UA 2VO5A 2W94A 5EJ1B 3D3AA 4LKSA 2QQWA 1YI7A 5FLWA 3WNOA 3K4DA 2VZOA 3C7HA 2VZUA 3ECQA 5JXGA 4M4RA 4OYUA 3VSSA 2XQRA 3QEEA 4XURA 2VQTA 1TG7A 2VMEA 4MADA 3P1IA 2E31A 2ZEYA 4MO3M 1DP0A 3FHQA 4KC7A 4KMQA 1JYVA 3I2JA 2HLEA 4A4AA 1W8OA 2X09A 4RYDA 1NKGA 5AYEA 2VZQA 5FUIA 2YG0A 4A3ZA 4ZZ8A 5JR2A 3FN9A 2J1EA 3IB3A 1NAEA 1UXXX 3OGVA 2WQ8A 3ACFA 1O8PA 3VSZA 2C26A 2ZEXA 1Y4WA 2Y6JA 1F4AA 2EXIA 5B6TA 5LA0A 4O8OA 5FMBA 2W46A 2J1RA 5JUVA 4N2RA 2WO3A 2WN2A 5GLRA 3WPUA 4W50A 3QZ4A 4E8CA 2W92A 2VZ3A 5IYYA 2Y8KA 2C4XA 2VJXA 3I2FA 3WNNA 1Y7BA 3BYNA 3WF1A 3MBWA 3GXUA 4CU9A 5EJZB 3BYLA 2XONA 3WEZA 3T0DA 3P6BA 2Y6LA 2JD9A 2VZSA 3OM7A 3WMYA 2WABA 4YPJA 2QQLA 5JXHA 2EXHA 5JOWA 1K42A 2BZDA 1W0NA 2B9VA 4ARXA 1UWWA 1SG3A 2W87A 1W18A 4QQSA 3OGRA 3DYMA 3C7EA 3ACGA 4LQRA 2Z4FA 1Y9GA 3T08A 3IIIA 5AYDA 1KGYA 1JZ7A 3OG2A 3D60A 2WYSA 1GMMA 5B4XA 1F4HA 1K12A 1JU3A 4OUEA 4BK5A 1CX1A 5JMOA 4XZUG 2WZEA 3QEDA 3K75B 3OBAA 2ADEA 1UMHA 2PQSA 3HJRA 4JKKA 1Y9MA 5FIXA 4UI9L 4UAPA 3NJVA 1UMIA 4CU6A 2VZPA 4P02B 2Y6GA 3AKHA 4PVIA 3HPNA 4TTGA 4KWUA 2WUHA 3HOBA 3LQCA 3LPFA 3VD3A 3CMGA 2JE8A 3JXSA 3I2IA 3AKFA 2VR4A 2BGOA 1W2TA 4KC8A 1EUUA 1UYYA 4LHSA 2HYXA 4CUAA 5A8CA 1NUKA 4QB2A 3NQHA 2AEZA 1OD3A 3WN2A 2R7EB 3AKGA 3T0AA 5CZKA 3WNPA 2X05A 3I3EA 3FL7A 5GLPA 3WSOA 1CZVA 3LE0A 3VSRA 3ACIA 3WATA 4KMIA 1PX4A 1XNTA 3GDBA 2VDTA 3WN1A 4IUGA 1WCQA 2ZEZA 3KF3A 3OM6A 2E32A 3SC7X 4CUBA 4A6OA 3DYPA 5IFPA 1K3IA 3THDA 5ANNA 1L7QA 4DUWA 5G05L 2OKXA 4LPLA 5IHRA 4QX0A 1GOGA 3D61A 2Y64A 4MGSA 3VDBA 3AC0A 2X8SA 1TVGA 4ET7A 1ST8A 1R64A 4GZ9A 2ORZA 3T2QA 2EICA 3VSFA 2VZRA 3WMZA 3UETA 4CUCA 3I3DA 5DN2A 4RN5A 4FFGA 2VZ1A 2YC2A 3F2ZA 4QB6A 2E33A 4D8MA 2QQOA 3ABZA 3SEEA 2QQUA 2LS6A 1UX7A 3BN6A 2WAOA 5GLNA 1XNAA 4ZXEA 4BJ0A 3WN0A 3HNBM 1JU4A 4A45A 1OF3A 1OT5A 1O8SA 5GLLA 4JKLA 2QQIA 4A44A 2E26A 1US3A 2V72A 3BGAA 4TXWA 2YB7A 2VQUA 4XUPA 5JOYA 1I5PA 2EXKA 2VOTA 4JHZA 3VT1A 1UY2A 5A7VB 4QPWA 4DXTA 1ULOA 4JX0A 3KSTA 1CZSA 2X10A 4JKMA 2LW8A 1JZ6A 3K4AA 2BGPA 3WNLA 4KCAA 3ACHA 1W99A 3LIGA 3UESA 4E8DA 4ZZ5A 4O8PA 3LEMA 4COTA 2YFTA 3LFIA 5LCWL 2WAAA 2V4VA 2VZTA 1UZ0A 3T0BA 1PT2A 3ZXLA 3I2GA 1GYDB 4L0PA 3VD4A 2VMDA 4QAWA 2VC9A 1MPXA 4QX1A 3OM5A 2WDBA 4ARYA 5FMDA 5FKBA 3UGGA 2W91A 4PVAA 3RWKX 3LDKA 4AK7A 3VD9A 3LEKA 3W5MA 4N2ZA 4GWJA 4AK6A 1SDDB 1UV4A 3CDZB 4P5YA 1UY0A 1JZ8A 1UY1A 1O59A 2VCBA 3LV4A 2Y6HA 2W1QA 2YFSA 2WZ8A 3I97A 4BK4A 1GYHA 1GOFA 3U37A 3WPVA 4U6DA 3U75A 4AG4A 4AAXA 4DEVA 2RVAA 4EQVA 3C7FA 2BBAA 1OF4A 2XHNA 3MO4A 1UYZA 4N4BA 3WF3A 3WF4A 1GQPA 2XOMA 5A8DA 3EB7A 3HEIA 1WKYA 3UGFA 3K46A 4P00B 3A7QA 2VL4A 1US2A 3LPGA 4CU8A 3UGHA 3SKVA 4P08A 3IAPA 3NNGA 3P2NA 3DECA 3D5ZA 1WL7A 4UDKA 5FK7A 4QDSA 1NX9A 3T2OA 4FFHA 3ZXJA 1OYGA 1J83A 3C7GA 5HXMA 1UXZA 4W8JA 5C71A 3PUIA 4DXRA 3QEFA 4O8NA 2QQJA 3A23A 3WNMA 4M4PA 5A1AA 3TAWA 1PX3A 3LEGA 5G04L 4FFFA 5IJRA 1W8NA 2OXBA 3KF5A 3U14A 1GNYA 4UDKE 4KI5M 3J7HA 4AK5A 2VM9A 1KEXA 2Y6KA 4CVUA 1DLCA 3LDRA 2J1AA 4ZY9A 5LA1A 5I0DA 2C9KA 5GLKA 2ID4A 1W9SA 2QBXA 4MLGA 5DMYA 5C70A 4UDJA 3WF0A 3HN3A 3NRUA 1YQ2A 4MOAA 2B4KA 4DEQA 3VD5A 3LEIA 2XQXA 3CZJA 4PT6A 4UOJA 1UY3A 2JKXA 2WO1A 1L7RA 2CDOA 3MV01 3HNYM 3SKJE 1EUTA 3CU9A 5JXJA 3I2KA 1W9WA 2YC4A 5GLQA 4ONZA 2KD7A 3GGLA 2AEYA 4BDVB 3CZUA 1JYNA 4N1IA 1CIYA 2J7MA 2QQKA 3I3BA 1BHGA 5IFTA 1YRZA 1ULPA 3PIJA 1JYXA 2DCJA 5C0PA 3UNPA 2V5DA 4W4ZA 5JOXA 1SHWB 2QQMA 2ADDA 3ZM8A 2ZXQA 5B4NA 2EXJA 5AY9A 3LF7A 4XVHA 3IDAA 2W5FA 3GM8A 4QX3A 4MGQA 3R4YA 4UDIA 3WPYA 2J1UA 2WO2A 2X8TA 3CIHA 2VCCA 2VZVA 1VKDA 4QB1A 5JXIA 1T2XA 4U6BA 3K1UA 3WPZA 4D47A 4FFIA 3OM4A 3VD7A 4Z2AA 3D5YA 3CQOA 4GWIA 2W9XA 3QC2A 4QDQA 3WF2A 3IAQA 2B4WA 2W95A 1P8JA 5EIYB 2VMCA 4KCBA 2YFZA 2VCAA 3ETPA 3K4ZA 2W1SA 2JDAA 3OEBA 4XUNA 5A7VA 4PQQA 2WN3A 4OMDA 3WAUA 5F7UA 4A41A 2AC1A 3VDAA 3CKHA 3A22A 2J1VA 5FKCA 3PUHA 4UDGA 5FK8A 2DCKA 2DDUA 4XUTA 5GLOA 2VTFA 3E1F1 1JYWA 1RYYA 2J1SA 1PMJX 4D0QA 5JOZA 3I2HA 5LA2A 3OM2A 3OB8A 4XUOA 1YIFA 2EIDA 1GUIA 2EIBA 3EYPA 2YFRA 4QX2A 4XUQA 3MUZ1 3MUY1 3VDCA 2YFUA 2ORXA 5FMCA 1GYEB 4NOVA 3ZXKA 3VT2A 2VMFA 5C7GA 2EIEA 1XPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMC A;  1UYX A;  3VT0 A;  3WQB A;  1OH4 A;  1JHJ A;  3LIH A;  2WBK A;  1UYP A;  2BER A;  2J1T A;  4A42 A;  1HN1 A;  3SEP A;  3T2P A;  3R4Z A;  3W5N A;  3MV1 1;  4PF1 A;  4QDR A;  2W47 A;  2QQN A;  4CU7 A;  3THC A;  1UY4 A;  1J84 A;  5DQ0 A;  3R67 A;  3AKI A;  3PIG A;  1GU3 A;  1H6X A;  3C8X A;  2QQV A;  3A21 A;  4OZO A;  1H6Y A;  1GOH A;  1JZ5 A;  5CYY A;  2ZEW A;  3FHA A;  3OGS A;  2RV9 A;  4FI9 A;  1LNS A;  1W9T A;  1IQD C;  3BYK A;  2W1U A;  1CZT A;  2CDP A;  3DYO A;  3WNK A;  4DXS A;  3OEA A;  4BXS V;  1JZ2 A;  2X8F A;  1JZ4 A;  1JI6 A;  5B6S A;  3HNM A;  3K77 A;  3WAS A;  2W3J A;  5GLM A;  1XC6 A;  2J22 A;  2RJ2 A;  1K45 A;  3T09 A;  4DUV A;  1D7P M;  2W1W A;  4HG6 B;  5DPN A;  5HPO A;  1JZ3 A;  4DUX A;  1DYO A;  3C7O A;  3BYJ A;  3NJX A;  5J1X A;  5AYC A;  2L9L A;  1PMH X;  3C2U A;  2VO5 A;  2W94 A;  5EJ1 B;  3D3A A;  4LKS A;  2QQW A;  1YI7 A;  5FLW A;  3WNO A;  3K4D A;  2VZO A;  3C7H A;  2VZU A;  3ECQ A;  5JXG A;  4M4R A;  4OYU A;  3VSS A;  2XQR A;  3QEE A;  4XUR A;  2VQT A;  1TG7 A;  2VME A;  4MAD A;  3P1I A;  2E31 A;  2ZEY A;  4MO3 M;  1DP0 A;  3FHQ A;  4KC7 A;  4KMQ A;  1JYV A;  3I2J A;  2HLE A;  4A4A A;  1W8O A;  2X09 A;  4RYD A;  1NKG A;  5AYE A;  2VZQ A;  5FUI A;  2YG0 A;  4A3Z A;  4ZZ8 A;  5JR2 A;  3FN9 A;  2J1E A;  3IB3 A;  1NAE A;  1UXX X;  3OGV A;  2WQ8 A;  3ACF A;  1O8P A;  3VSZ A;  2C26 A;  2ZEX A;  1Y4W A;  2Y6J A;  1F4A A;  2EXI A;  5B6T A;  5LA0 A;  4O8O A;  5FMB A;  2W46 A;  2J1R A;  5JUV A;  4N2R A;  2WO3 A;  2WN2 A;  5GLR A;  3WPU A;  4W50 A;  3QZ4 A;  4E8C A;  2W92 A;  2VZ3 A;  5IYY A;  2Y8K A;  2C4X A;  2VJX A;  3I2F A;  3WNN A;  1Y7B A;  3BYN A;  3WF1 A;  3MBW A;  3GXU A;  4CU9 A;  5EJZ B;  3BYL A;  2XON A;  3WEZ A;  3T0D A;  3P6B A;  2Y6L A;  2JD9 A;  2VZS A;  3OM7 A;  3WMY A;  2WAB A;  4YPJ A;  2QQL A;  5JXH A;  2EXH A;  5JOW A;  1K42 A;  2BZD A;  1W0N A;  2B9V A;  4ARX A;  1UWW A;  1SG3 A;  2W87 A;  1W18 A;  4QQS A;  3OGR A;  3DYM A;  3C7E A;  3ACG A;  4LQR A;  2Z4F A;  1Y9G A;  3T08 A;  3III A;  5AYD A;  1KGY A;  1JZ7 A;  3OG2 A;  3D60 A;  2WYS A;  1GMM A;  5B4X A;  1F4H A;  1K12 A;  1JU3 A;  4OUE A;  4BK5 A;  1CX1 A;  5JMO A;  4XZU G;  2WZE A;  3QED A;  3K75 B;  3OBA A;  2ADE A;  1UMH A;  2PQS A;  3HJR A;  4JKK A;  1Y9M A;  5FIX A;  4UI9 L;  4UAP A;  3NJV A;  1UMI A;  4CU6 A;  2VZP A;  4P02 B;  2Y6G A;  3AKH A;  4PVI A;  3HPN A;  4TTG A;  4KWU A;  2WUH A;  3HOB A;  3LQC A;  3LPF A;  3VD3 A;  3CMG A;  2JE8 A;  3JXS A;  3I2I A;  3AKF A;  2VR4 A;  2BGO A;  1W2T A;  4KC8 A;  1EUU A;  1UYY A;  4LHS A;  2HYX A;  4CUA A;  5A8C A;  1NUK A;  4QB2 A;  3NQH A;  2AEZ A;  1OD3 A;  3WN2 A;  2R7E B;  3AKG A;  3T0A A;  5CZK A;  3WNP A;  2X05 A;  3I3E A;  3FL7 A;  5GLP A;  3WSO A;  1CZV A;  3LE0 A;  3VSR A;  3ACI A;  3WAT A;  4KMI A;  1PX4 A;  1XNT A;  3GDB A;  2VDT A;  3WN1 A;  4IUG A;  1WCQ A;  2ZEZ A;  3KF3 A;  3OM6 A;  2E32 A;  3SC7 X;  4CUB A;  4A6O A;  3DYP A;  5IFP A;  1K3I A;  3THD A;  5ANN A;  1L7Q A;  4DUW A;  5G05 L;  2OKX A;  4LPL A;  5IHR A;  4QX0 A;  1GOG A;  3D61 A;  2Y64 A;  4MGS A;  3VDB A;  3AC0 A;  2X8S A;  1TVG A;  4ET7 A;  1ST8 A;  1R64 A;  4GZ9 A;  2ORZ A;  3T2Q A;  2EIC A;  3VSF A;  2VZR A;  3WMZ A;  3UET A;  4CUC A;  3I3D A;  5DN2 A;  4RN5 A;  4FFG A;  2VZ1 A;  2YC2 A;  3F2Z A;  4QB6 A;  2E33 A;  4D8M A;  2QQO A;  3ABZ A;  3SEE A;  2QQU A;  2LS6 A;  1UX7 A;  3BN6 A;  2WAO A;  5GLN A;  1XNA A;  4ZXE A;  4BJ0 A;  3WN0 A;  3HNB M;  1JU4 A;  4A45 A;  1OF3 A;  1OT5 A;  1O8S A;  5GLL A;  4JKL A;  2QQI A;  4A44 A;  2E26 A;  1US3 A;  2V72 A;  3BGA A;  4TXW A;  2YB7 A;  2VQU A;  4XUP A;  5JOY A;  1I5P A;  2EXK A;  2VOT A;  4JHZ A;  3VT1 A;  1UY2 A;  5A7V B;  4QPW A;  4DXT A;  1ULO A;  4JX0 A;  3KST A;  1CZS A;  2X10 A;  4JKM A;  2LW8 A;  1JZ6 A;  3K4A A;  2BGP A;  3WNL A;  4KCA A;  3ACH A;  1W99 A;  3LIG A;  3UES A;  4E8D A;  4ZZ5 A;  4O8P A;  3LEM A;  4COT A;  2YFT A;  3LFI A;  5LCW L;  2WAA A;  2V4V A;  2VZT A;  1UZ0 A;  3T0B A;  1PT2 A;  3ZXL A;  3I2G A;  1GYD B;  4L0P A;  3VD4 A;  2VMD A;  4QAW A;  2VC9 A;  1MPX A;  4QX1 A;  3OM5 A;  2WDB A;  4ARY A;  5FMD A;  5FKB A;  3UGG A;  2W91 A;  4PVA A;  3RWK X;  3LDK A;  4AK7 A;  3VD9 A;  3LEK A;  3W5M A;  4N2Z A;  4GWJ A;  4AK6 A;  1SDD B;  1UV4 A;  3CDZ B;  4P5Y A;  1UY0 A;  1JZ8 A;  1UY1 A;  1O59 A;  2VCB A;  3LV4 A;  2Y6H A;  2W1Q A;  2YFS A;  2WZ8 A;  3I97 A;  4BK4 A;  1GYH A;  1GOF A;  3U37 A;  3WPV A;  4U6D A;  3U75 A;  4AG4 A;  4AAX A;  4DEV A;  2RVA A;  4EQV A;  3C7F A;  2BBA A;  1OF4 A;  2XHN A;  3MO4 A;  1UYZ A;  4N4B A;  3WF3 A;  3WF4 A;  1GQP A;  2XOM A;  5A8D A;  3EB7 A;  3HEI A;  1WKY A;  3UGF A;  3K46 A;  4P00 B;  3A7Q A;  2VL4 A;  1US2 A;  3LPG A;  4CU8 A;  3UGH A;  3SKV A;  4P08 A;  3IAP A;  3NNG A;  3P2N A;  3DEC A;  3D5Z A;  1WL7 A;  4UDK A;  5FK7 A;  4QDS A;  1NX9 A;  3T2O A;  4FFH A;  3ZXJ A;  1OYG A;  1J83 A;  3C7G A;  5HXM A;  1UXZ A;  4W8J A;  5C71 A;  3PUI A;  4DXR A;  3QEF A;  4O8N A;  2QQJ A;  3A23 A;  3WNM A;  4M4P A;  5A1A A;  3TAW A;  1PX3 A;  3LEG A;  5G04 L;  4FFF A;  5IJR A;  1W8N A;  2OXB A;  3KF5 A;  3U14 A;  1GNY A;  4UDK E;  4KI5 M;  3J7H A;  4AK5 A;  2VM9 A;  1KEX A;  2Y6K A;  4CVU A;  1DLC A;  3LDR A;  2J1A A;  4ZY9 A;  5LA1 A;  5I0D A;  2C9K A;  5GLK A;  2ID4 A;  1W9S A;  2QBX A;  4MLG A;  5DMY A;  5C70 A;  4UDJ A;  3WF0 A;  3HN3 A;  3NRU A;  1YQ2 A;  4MOA A;  2B4K A;  4DEQ A;  3VD5 A;  3LEI A;  2XQX A;  3CZJ A;  4PT6 A;  4UOJ A;  1UY3 A;  2JKX A;  2WO1 A;  1L7R A;  2CDO A;  3MV0 1;  3HNY M;  3SKJ E;  1EUT A;  3CU9 A;  5JXJ A;  3I2K A;  1W9W A;  2YC4 A;  5GLQ A;  4ONZ A;  2KD7 A;  3GGL A;  2AEY A;  4BDV B;  3CZU A;  1JYN A;  4N1I A;  1CIY A;  2J7M A;  2QQK A;  3I3B A;  1BHG A;  5IFT A;  1YRZ A;  1ULP A;  3PIJ A;  1JYX A;  2DCJ A;  5C0P A;  3UNP A;  2V5D A;  4W4Z A;  5JOX A;  1SHW B;  2QQM A;  2ADD A;  3ZM8 A;  2ZXQ A;  5B4N A;  2EXJ A;  5AY9 A;  3LF7 A;  4XVH A;  3IDA A;  2W5F A;  3GM8 A;  4QX3 A;  4MGQ A;  3R4Y A;  4UDI A;  3WPY A;  2J1U A;  2WO2 A;  2X8T A;  3CIH A;  2VCC A;  2VZV A;  1VKD A;  4QB1 A;  5JXI A;  1T2X A;  4U6B A;  3K1U A;  3WPZ A;  4D47 A;  4FFI A;  3OM4 A;  3VD7 A;  4Z2A A;  3D5Y A;  3CQO A;  4GWI A;  2W9X A;  3QC2 A;  4QDQ A;  3WF2 A;  3IAQ A;  2B4W A;  2W95 A;  1P8J A;  5EIY B;  2VMC A;  4KCB A;  2YFZ A;  2VCA A;  3ETP A;  3K4Z A;  2W1S A;  2JDA A;  3OEB A;  4XUN A;  5A7V A;  4PQQ A;  2WN3 A;  4OMD A;  3WAU A;  5F7U A;  4A41 A;  2AC1 A;  3VDA A;  3CKH A;  3A22 A;  2J1V A;  5FKC A;  3PUH A;  4UDG A;  5FK8 A;  2DCK A;  2DDU A;  4XUT A;  5GLO A;  2VTF A;  3E1F 1;  1JYW A;  1RYY A;  2J1S A;  1PMJ X;  4D0Q A;  5JOZ A;  3I2H A;  5LA2 A;  3OM2 A;  3OB8 A;  4XUO A;  1YIF A;  2EID A;  1GUI A;  2EIB A;  3EYP A;  2YFR A;  4QX2 A;  4XUQ A;  3MUZ 1;  3MUY 1;  3VDC A;  2YFU A;  2ORX A;  5FMC A;  1GYE B;  4NOV A;  3ZXK A;  3VT2 A;  2VMF A;  5C7G A;  2EIE A;  1XPW A; 
#chains in the Genus database with same CATH topology
 4OMC A;  4XHX A;  3AFG A;  3VT0 A;  1W6N B;  2XKP A;  2CNA A;  1OH4 A;  4NWV A;  1LOD A;  1ND3 B;  4MHR A;  2WBK A;  1OPO A;  1GIC A;  4M01 A;  1FYU A;  1WZX A;  1E5S A;  2BER A;  4CDQ A;  2R06 2;  5FZH A;  4Z1V A;  2ZOE B;  3KHB A;  4CEY C;  4EN0 A;  2FDJ A;  3T2P A;  1WW6 A;  2P6C A;  1MEC 2;  1RMU 1;  4WM7 A;  3ZXA C;  1RUD 2;  1CAV A;  1SBF A;  2VVD A;  3USU B;  4BQ5 A;  3GJA A;  2I07 B;  1LED A;  4AHY A;  3W5N A;  1OQD A;  2Y26 A;  4H3W A;  4NPM A;  2W47 A;  2P6H A;  4YGE A;  3WOG A;  4K1Z A;  3S5Q A;  2BYV E;  3BTA A;  4QKF A;  5K7P A;  4J25 A;  4GWN A;  3R67 A;  4IE5 A;  3AKI A;  1W03 A;  5DAX A;  1PGL 1;  1H2K A;  2QQV A;  1BEV 3;  4OZO A;  3PVN A;  1AUY A;  1KDK A;  4A7Y A;  4GB3 1;  3N7J A;  1G9B A;  3U0Z A;  4Q1R A;  5FAX A;  1CPM A;  3ALQ A;  4Q4X 1;  2HEY F;  4YGB A;  4H55 A;  4UWD A;  3WW2 A;  4K8F A;  3N9N A;  2ZGT A;  1DCS A;  1NCQ C;  2D5F A;  4QPI C;  1F8V A;  2RS3 3;  1YNA A;  4CCM A;  1DZQ A;  4CSW A;  3MPP G;  1IQD C;  2PYT A;  1AYN 3;  4FOW A;  1VRB A;  4JDN A;  2X8K A;  3BYK A;  2W1U A;  3N35 A;  4QKB A;  1S0B A;  1XBF A;  1XU1 A;  5B2G B;  4RD7 A;  1Y43 B;  1O4T A;  1Z7S 2;  1JI6 A;  1S2K A;  1IG0 A;  2RM2 2;  4XAE A;  1OXC A;  2X29 A;  5F3G A;  5I93 A;  4GJY A;  2W3J A;  3RZK A;  3NNL A;  1XC6 A;  3THP A;  5C5U A;  5E6H A;  1LEC A;  3T09 A;  4DUV A;  2W1W A;  4HG6 B;  4GH4 A;  5DPN A;  5C9A B;  3R05 A;  1DYO A;  3NJX A;  5DAB A;  4PBO A;  1OKO A;  5J7M A;  2YGM A;  5FZM A;  3QD6 A;  5EPA A;  2KM2 A;  4Q0V A;  4K7J A;  1WWY A;  3PTR B;  3KS7 A;  2ET7 A;  3WV6 A;  1TME 1;  1ND3 C;  2W94 A;  2VNG A;  1R1A 3;  2TUN A;  2BOJ A;  4LKD A;  3RWN A;  4E4H A;  4DFS A;  1DLL A;  5JOX A;  1KFU L;  4MV2 A;  2XDV A;  2CV6 A;  4Z82 A;  1PGW 2;  5GLU A;  5A32 A;  4XAB A;  1PGL 2;  1BEV 2;  4OYU A;  1DYK A;  1HDK A;  4YW3 A;  4NOT A;  5LK5 A;  5DAQ A;  1TG7 A;  4NRP A;  2XR4 A;  3P1I A;  4MO3 M;  5ACA 3;  1DP0 A;  3FHQ A;  1JYV A;  1IS3 A;  3I2J A;  5FMO S;  3AM2 A;  2HLE A;  4A4A A;  3MIG A;  4RS5 B;  3ZFG C;  3B93 A;  1NKG A;  4NVP A;  1RC6 A;  3AP9 A;  3IM0 A;  2VZQ A;  5FJK A;  1OFN A;  2K0G A;  1RUG 1;  5EYX A;  3FN9 A;  5JR2 A;  4FPO B;  2CWS A;  1AXY A;  1M4W A;  2XHK A;  3NKT A;  3OGV A;  5ERL A;  4XFC A;  3VBS C;  3ZFE C;  2Q5T A;  1RED A;  3LDB A;  1ZZ7 A;  4OUS A;  5B6T A;  2Y6J A;  5FYY A;  3UK9 A;  2HWF 2;  2P5B A;  3WD5 A;  3RZG A;  5FXV A;  3EQE A;  2J1R A;  3SH3 A;  4N2R A;  4DNY A;  1AYM 1;  3SH5 A;  3MW3 A;  1H1I A;  1U5Y A;  5HV0 A;  4W50 A;  5FZ4 A;  2PQQ A;  2HWE 1;  1DQ4 A;  3AL5 A;  4DY3 A;  1AX1 A;  1SAC A;  3V0B A;  2V73 A;  3U4S A;  2DYC A;  2RS5 1;  5A3W A;  3OY8 A;  3IDC B;  1J58 A;  3WF1 A;  2YXS A;  4H7L A;  3BOD A;  3MBW A;  1VIW B;  1XOY A;  2JDK A;  1N3P A;  3SIS A;  4PLM A;  1ZBE 3;  4CU9 A;  4K1Y A;  4CCJ A;  2F17 A;  3ZVX A;  2XVL A;  3P6B A;  2JJ6 A;  2VBP A;  2Y6L A;  3KGZ A;  4JGZ A;  4C1X A;  3OM7 A;  4TLF A;  5ABJ A;  3VDD A;  4EE2 A;  2EXH A;  1E5H A;  3AMP A;  2D44 A;  2BZD A;  4CDQ C;  4AED C;  2JDY A;  1PO1 1;  1TZO A;  3T2T A;  1VRH 3;  5A3L A;  2MEV 3;  1T6B X;  2XLF A;  2UUR A;  4CP0 A;  3OGR A;  2AUY A;  5DAV A;  1QJX 2;  1COV 1;  1PZ9 A;  3M70 A;  3HVD A;  4DMI A;  3C7E A;  3CEW A;  4BQ1 A;  5DAW A;  4IEW A;  4LQR A;  4AI2 A;  3L2H A;  2ZHN A;  1IS4 A;  2WLP A;  1SFN A;  4EZ4 A;  4AFA A;  4MGY E;  4QQ2 A;  4D69 A;  4AI3 A;  2EF6 A;  1QJF A;  4D7T A;  4L9B A;  3RMY A;  3W9A A;  1HV0 A;  1ACC A;  3B01 A;  1BXH A;  1FMD 2;  1SLI A;  2OX0 A;  2XBO 1;  3IDB B;  4XIL A;  1UL9 A;  5FZ9 A;  4C0H A;  4B4Q A;  1LRH A;  4BK5 A;  4RHV 2;  4XZU G;  2WZE A;  2F4P A;  3J8F 2;  1S2E A;  1FX5 A;  2Q1M A;  4UI9 L;  4GQ7 A;  2VUJ A;  1Q8O A;  3NJV A;  4XDQ A;  1XYO A;  4LUK A;  2Y6G A;  4MH0 E;  2QNK A;  2W68 A;  4PVI A;  1CJP A;  3HPN A;  4TTG A;  1JOB A;  4KWU A;  3KT1 A;  3GHM A;  4P9Y A;  5FPX A;  3LQC A;  4C0B A;  1RUE 2;  2PMW B;  2VU9 A;  2PAK A;  3VD3 A;  4BQ3 A;  1TME 2;  4F83 A;  3VBF C;  1XYN A;  2JIG A;  2E53 A;  4NPL A;  2R04 1;  4N53 B;  1NA1 B;  5FOJ B;  1VBA 3;  4KH9 A;  5CFC B;  1W8F A;  2Y0I A;  2A6V A;  1NE6 A;  5A8C A;  4Z92 B;  5J98 B;  3NV3 A;  1B09 A;  4QB2 A;  1DF0 A;  3MIH A;  4OHW A;  4P14 A;  2BFU S;  2D5H A;  2GAL A;  4EN6 B;  1SBE A;  3I49 A;  2WII B;  4IV3 B;  5CZK A;  3NNJ A;  4FXK B;  1W8U A;  2YYO A;  3R0R A;  2X05 A;  3ZXF A;  1W06 A;  4PF5 A;  2ZS6 B;  3FL7 A;  4CDW B;  3JD7 2;  1APN A;  3ZMN A;  2R06 3;  2E9Q A;  1H8T C;  5C3O A;  1H8T A;  4GIQ A;  4DOU A;  4NMI A;  3GBF A;  3SC7 X;  3NNF A;  1AL2 2;  3GCW A;  3LA7 A;  2ILM A;  1W6O B;  1D0G A;  4NHY A;  2P3J A;  1HQN A;  1K3I A;  4Y33 A;  5FLH A;  1IGO A;  1ASJ 2;  4Q4V 2;  4LNV A;  5G05 L;  4A7Z A;  1F31 A;  5IHR A;  2G19 A;  5CKQ A;  1JH5 A;  5GLZ A;  2IVJ A;  3OYW A;  1XYP A;  3JB4 C;  1LTE A;  2IVI B;  3KHC A;  1AL0 G;  3GZU C;  3VSF A;  4PHZ A;  3WMZ A;  5DN2 A;  4JCK A;  5ISL A;  2X5I A;  2E33 A;  4KNC A;  2EAK A;  4QHB A;  5D1I A;  4ES8 A;  4P9I A;  4XC9 A;  3ABZ A;  4QU2 A;  4QXC A;  2QQU A;  2LS6 A;  1CVN A;  1BZW A;  3N7K A;  3BN6 A;  4FOV A;  4Q4W 2;  4IXL A;  5FPZ A;  2C5D A;  4BJ0 A;  1ND2 B;  3WN0 A;  3QBQ A;  2VEC A;  4N90 A;  1F9K A;  4YG6 A;  1WMD A;  2PHR A;  2GN7 A;  4G9S B;  4JZR A;  4NAM A;  5E8A A;  3R6S A;  4NRM A;  4LKE A;  3RPQ A;  4CDU B;  1US3 A;  2V72 A;  1QGL A;  3BGA A;  1D4M 2;  2VH9 A;  2VQU A;  1AYN 1;  3UV9 A;  2HWF 1;  1FAT A;  1GZT A;  5FYZ A;  1OC1 A;  1N1T A;  2DV9 A;  1DIW A;  1VP6 A;  2BEO A;  3WIN E;  3SLI A;  4CEY B;  1IPK A;  1DGR A;  2JEN A;  1G9F A;  4RR3 A;  1V70 A;  3KV5 A;  3Q9O A;  3TOJ A;  3RGB A;  5FTT C;  1RUG 2;  5E89 A;  4CEW B;  4IE7 A;  1U5I A;  5HV4 A;  3AZV A;  2PFW A;  1WD4 A;  2BGP A;  2XL7 A;  3AJY A;  2R6Q A;  1Y3T A;  1Q8V A;  4YZ1 A;  1H1A A;  1UCX A;  1HKD A;  4V2W A;  5T5O A;  2HWC 1;  3PL0 A;  1VBC 2;  1Q5O A;  1WMF A;  3ZSM A;  1DGW A;  4ZZ5 A;  4O8P A;  2B9U A;  4JHT A;  2IWG B;  4FCA A;  4FBF A;  2YFT A;  2WAA A;  2P17 A;  2QDR A;  3KLS A;  3ZXL A;  1OLR A;  3ACL A;  3ZFF A;  5JZG A;  2UWC A;  1GWK A;  4Q4Y 3;  3ILF A;  1SPP A;  3ELN A;  1O5U A;  1LGC A;  4Q4Y 1;  2UYB A;  4HK9 A;  4X6Q B;  2WC2 A;  5FZD A;  3VD4 A;  5DAP A;  4QGN A;  4S2D A;  5GLW A;  3RYP A;  4C91 A;  4EN9 B;  3H8R A;  2JD4 A;  3OM5 A;  3L9J T;  2W91 A;  5A7Q A;  4PIX A;  3JQX A;  2W0X A;  3UYJ A;  1CWP A;  5LWB A;  3W5M A;  1JUH A;  1GYK A;  3O0X A;  1SDD B;  4FPC A;  1Z78 A;  3CDZ B;  2BU9 A;  4P5Y A;  1JZ8 A;  2GU9 A;  3S57 A;  5TSW A;  2FCV A;  2UU8 A;  1A78 A;  1N3Q A;  2VUL A;  4KQ7 A;  4L11 A;  4UXA A;  3JD7 3;  4K3U A;  3LV4 A;  2WZ8 A;  4JVA A;  2JDZ A;  3JD7 1;  4R9C A;  4KBB A;  3U75 A;  2HWE 2;  4XFG A;  3VKF C;  2RVA A;  4DEV A;  2ET1 A;  3C7F A;  1OF4 A;  1R08 3;  4HVR A;  4YSF A;  2KA3 A;  2DBI A;  1EAH 1;  3IMM A;  4M3C B;  3ZIX A;  3O1V A;  1RVF 3;  3T1M A;  1QDO A;  5BNN B;  3WF3 A;  1RXF A;  4CZS A;  1GQP A;  1A34 A;  4B1L A;  1ULG A;  3FLP A;  1AF9 A;  4PDW B;  2VL4 A;  4BLJ A;  2Q8C A;  3ZKU A;  4IV1 B;  4COY A;  2FDH A;  3IBM A;  3O5S A;  1U5Z A;  4WVV A;  1H4H A;  1EY2 A;  1RUC 2;  1AYM 3;  4IGP A;  4N9I A;  3U10 A;  4OHZ A;  3P2N A;  3D5Z A;  4UDK A;  1QXP A;  1WL7 A;  1ENR A;  2YPJ A;  4IE4 A;  3ZSE A;  2PLV 3;  3Q8E A;  2GMP A;  2LTN A;  3WZ1 A;  1OYG A;  3D4K A;  4AFD A;  2GME A;  3ROU A;  5HXM A;  4SBV A;  2PLV 1;  3HBK A;  3PUI A;  4Y1Y A;  1AR9 3;  4O8N A;  5FRA A;  2AAC A;  3A23 A;  1POV 3;  2JEM A;  2OQ7 A;  3Q8C A;  4LK7 A;  3M4F A;  1VE0 A;  4M4P A;  2HEW F;  3RS6 A;  5BUV A;  2ZAH A;  1QOS A;  2B8M A;  5IUQ A;  3WDW A;  3GHN A;  5KXB A;  3LEG A;  4LXL A;  5G04 L;  2PHX A;  3GBW A;  4FTE A;  4FT8 A;  5AVP A;  2OXB A;  4XF3 A;  4IEV A;  4LMF A;  4HK8 A;  1LR5 A;  4MXW B;  5CFD B;  1C57 A;  4OZX A;  2Y6K A;  5JPN B;  5CB7 A;  3NST A;  4CDX C;  3LDR A;  1BK1 A;  4XTP A;  2XUE A;  1D4M 1;  2J1A A;  2H6C A;  1WLW A;  2YV8 A;  4ISQ A;  1WCK A;  1FOD 2;  5GLK A;  2Q30 A;  4K8R B;  4MLG A;  4HKW A;  5C70 A;  2RDR A;  5DZE A;  5HCF A;  4UDJ A;  2PHW A;  1EYB A;  2BOI A;  2HWE 3;  2VOW A;  3VHO A;  4GMP 0;  2W08 A;  2RG4 A;  4YRD A;  2IZW A;  2DVA A;  3H8O A;  4CCE A;  3LB9 A;  5BNN A;  4NIG A;  1DHK B;  3MDP A;  4M3C A;  1PO2 1;  1LES A;  4HSL A;  5LY1 A;  1KD7 A;  3HNY M;  2FDG A;  1JMU B;  2NPI A;  2OYZ A;  3I2K A;  3WP6 A;  2ARE A;  5GLQ A;  2WNV C;  2KD7 A;  3TEZ A;  1QQP 2;  5C8W A;  4XJ8 A;  2XJP A;  4XW3 A;  1LOF A;  1RUF 3;  2WNV A;  4TLG A;  1ODM A;  2J7M A;  1NLS A;  2QQK A;  2J42 A;  3BVC A;  1JS9 A;  5FZC A;  4PDW C;  5T5J A;  5LK7 B;  3PIJ A;  4LIU A;  4LTA A;  1HRV 3;  1JYX A;  4YGC A;  4D3W A;  1O91 A;  1N3O A;  2D97 A;  1QIQ A;  2ARA A;  3J4U H;  1A8M A;  2NM1 A;  3E5X A;  3OUI A;  2EXJ A;  3RFR A;  3ZM8 A;  1V9U 1;  3H3U A;  1NA1 C;  3ST7 A;  4UDI A;  4WM8 A;  2J1U A;  1VBB 1;  5F39 A;  2JIJ A;  2P4E A;  3WHT A;  3ZN4 A;  4RQP A;  5FRE A;  4UBH A;  5CBL A;  3CNA A;  3E5Q A;  2YGL A;  5D8A B;  2MNG A;  3VZJ A;  1RIN A;  2DWR A;  3RYK A;  3WPZ A;  1JN2 P;  5A80 A;  3PU8 A;  2QUO A;  4AI0 A;  3OM4 A;  1TMF 2;  1ZM1 A;  1LCL A;  1S0I A;  4XZP A;  1OH3 A;  2VW2 A;  4QKD A;  4Q4W 3;  4TN7 A;  1Q43 A;  4PBP A;  4Q0Q A;  1QF3 A;  2JIC A;  3IAQ A;  1HX6 A;  4UF0 A;  1KQR A;  3LOI A;  2D98 A;  5I8Y A;  3ETP A;  3NV1 A;  1DBN A;  5FCC A;  4RR3 B;  2PTM A;  2OUH A;  3VKM A;  5F1R A;  3OEB A;  3KCX A;  4CEY A;  2JG9 C;  4PQQ A;  2W39 A;  1BVP 1;  1UOG A;  2CTV A;  5J48 A;  3WAU A;  4M0H A;  1CGP A;  2ARC A;  1C1L A;  1W04 A;  3F95 A;  1AVB A;  2ARB A;  4PIZ A;  4S2G A;  4Q26 A;  5FKC A;  4Y26 A;  3WW1 A;  4YW6 A;  3O12 A;  5FK8 A;  2CGN A;  2DCK A;  2DDU A;  3MLL A;  5GLO A;  2VTF A;  3KZ4 C;  4JGY B;  4R8H A;  2VBD A;  2WT0 A;  3W21 A;  1RYY A;  4D0Q A;  4LIV A;  3PLQ A;  2RDN A;  4N43 C;  5LA2 A;  3V0A A;  5CVR A;  3WXP A;  4XUO A;  1YIF A;  4COZ A;  3PMS A;  1GUI A;  1URX A;  1BBT 3;  3FX3 A;  4EZH A;  1GBG A;  1GZ9 A;  1HJG A;  3MUY 1;  4GB3 3;  5D8A A;  4YVW A;  2YFU A;  1O4Y A;  1Z7S 3;  5FMC A;  4UFL A;  2DBN A;  3TEY A;  4WM8 B;  1OKQ A;  2EIE A;  1Y9Q A;  1QQP 1;  1DYP A;  1XPW A;  1FV2 A;  2QTW B;  2GSY A;  1RB8 G;  3WQB A;  3OBZ A;  1JHJ A;  3MLJ A;  4J1X A;  1V6K A;  2W2I A;  5A3M A;  2FCT A;  1VB4 A;  2HWD 1;  4XF4 A;  3AFK A;  1RMU 3;  3FMG A;  4UW3 A;  3ZPY A;  2WNV B;  5BV6 A;  5JPM B;  1BLZ A;  4PJY A;  3OD4 A;  3D0J A;  1C4R A;  5FZ1 A;  3VBS B;  1XQN A;  1WCU A;  3MV1 1;  4PF1 A;  4CDW A;  2QQN A;  3ZMO A;  2B45 X;  3BYW A;  4LBQ B;  1VMJ A;  3THC A;  1UY4 A;  5FZ8 A;  5DQ0 A;  4LE4 A;  4ZHN A;  1RTV A;  3PIG A;  2R49 A;  4JTN A;  1YFY A;  3C8X A;  1ZRC A;  1UU4 A;  3JQW A;  5T5L A;  1H6Y A;  3B02 A;  5IVF A;  1IPS A;  1JZ5 A;  4M3C F;  5CYY A;  1QMJ A;  1AR8 1;  3PVE A;  1W2N A;  4C8D A;  4HXC A;  3DEM A;  1FMD 3;  2ZGR A;  4QXB A;  5CG9 A;  4UYB A;  2KXL A;  1S0F A;  1Z0H A;  2WZR 2;  3K51 A;  5A3P A;  2VUC A;  1LNS A;  4R9B A;  1PIV 3;  1RHI 3;  4X8N A;  4QPI B;  1W9T A;  2BNN A;  4K20 A;  3OGJ A;  4QQO A;  3POB A;  1PIV 1;  3J8F 1;  4CDX A;  2HWD 3;  3TRS B;  4L2N A;  2OPW A;  3VKN A;  4IGQ A;  3WNK A;  3J8F 3;  2CSG A;  3NKG A;  3OJB A;  3UKV A;  1EP0 A;  3AZW A;  2HWC 2;  3OEA A;  2DVG A;  4CCO A;  1JZ2 A;  4QKN A;  3VZK A;  1VRH 2;  2QVS B;  3GBG A;  1JZ4 A;  2O8O A;  1KJR A;  3VZO A;  3LCP A;  2DU1 A;  5FZO B;  4FPE A;  5E1R A;  3J26 N;  2HEV F;  2EA7 A;  4JQT A;  1K45 A;  4B29 A;  1QU0 A;  2ZZQ A;  4IGO A;  1D7P M;  1HXS 2;  1HB1 A;  2JG8 C;  4P9G A;  4XCB A;  5J09 A;  3V65 A;  1D4M 3;  3WG2 A;  1LOC A;  2GND A;  1MS4 A;  2L9L A;  4YG3 A;  2E51 A;  1AR6 2;  5IK8 A;  4QPG B;  1S0D A;  4WBB A;  1WCS A;  4IV1 A;  5EJ1 B;  2QQW A;  4LKS A;  2I45 A;  1YIP A;  4PDW A;  5FLW A;  2GN3 A;  3AKT A;  2CAV A;  2RS3 1;  1GZW A;  2ZBJ A;  4C90 A;  5JXG A;  1ZZB A;  1IS6 A;  2VPV A;  3VZN A;  4M4R A;  5C6C A;  4WVM A;  3S0M A;  3VSS A;  3WVJ A;  3O1U A;  3AMM A;  4Y5S A;  5ACA 1;  5JDB A;  1CON A;  4AVB A;  5HBA A;  3O1M A;  1QDC A;  4MAD A;  4WM8 C;  2E31 A;  3JU9 A;  3LD8 A;  1G9D A;  2ZEY A;  4MGI E;  4XQW A;  4OQ8 A;  3DXU A;  1BK0 A;  2YC0 A;  1YEW A;  5FFO C;  3O7O A;  3VDD C;  2BVB A;  2VAU A;  4LO7 A;  4XMI A;  2VNV A;  4FXG B;  5AYE A;  1F5F A;  5FUI A;  2D40 A;  1FV3 A;  2YG0 A;  5IK4 A;  1V6I A;  3IB3 A;  1OUS A;  5F3I A;  3S5A A;  2A71 A;  1ASJ 3;  4Q4V 3;  3PJQ A;  3O1S A;  3ACF A;  1SLT A;  1MS5 A;  1O8P A;  1ASJ 1;  1WBL A;  4Q4V 1;  4AVA A;  2WNU C;  4LO8 A;  3ZFE B;  1F4A A;  1WCD J;  4E2Q A;  3WHU A;  2P3Y A;  2VOX A;  5JUV A;  1W6M B;  4PI0 A;  1ZZ6 A;  4IER A;  4LEJ A;  5T50 A;  5BPX A;  5GLR A;  3VLB B;  4Q4X 2;  3PUR A;  4AK3 A;  5FP9 A;  1AR7 3;  3AJZ A;  2Q8D A;  5F37 A;  2R1B A;  2C4X A;  5DG2 A;  4XE9 A;  4PCR A;  1R1A 2;  1XE7 A;  2A3W A;  1FPN 1;  2VMH A;  3BAL A;  5JWP A;  2A3Y A;  1RUF 2;  4P9X A;  1ULF A;  3ZXG A;  4IE0 A;  4RS5 A;  5EJZ B;  4FAH A;  1LAJ A;  3BYL A;  2IXJ A;  1PGW 1;  3WEZ A;  2AGS A;  2D6P A;  4LK6 A;  5JAX A;  1POV 0;  1LOF C;  5JXH A;  1OBN A;  4QPG C;  1YUD A;  4D6R A;  1A8D A;  2A70 A;  2HWB 1;  2B42 B;  4JDO A;  3WDT A;  4ARX A;  2B9V A;  2JEC A;  1V00 A;  3ZYH A;  4XF9 A;  5A32 B;  5FPU A;  1UKR A;  3MPB A;  1VJ2 A;  1K5J A;  4MG2 A;  1UOF A;  4QQS A;  1V9U 3;  3TAY A;  2BW8 A;  1U12 A;  4ZU7 A;  3WQ0 A;  1NT0 A;  2B7Y A;  2R07 1;  1ND2 A;  4I01 A;  3WNX A;  1Y9G A;  5GAL A;  3BKZ A;  1AYN 2;  5AYD A;  1KGY A;  1HV1 A;  1PO1 2;  2R07 3;  5JVV A;  4DZG A;  1JZ7 A;  4AF9 A;  3CL1 A;  3OG2 A;  4BIS A;  1ZZ8 A;  4CCD A;  3FFQ A;  2WYS A;  5A1F A;  1R1Z A;  4QU1 A;  1RIR A;  1S0E A;  4NHL A;  3FE5 A;  2UWB A;  3VZL A;  5KHI A;  3RDI A;  5DZF A;  3OBA A;  3QED A;  2ADE A;  1NLR A;  1UMH A;  2PQS A;  4JRA A;  5FV3 A;  3FFZ A;  4BE3 A;  1E57 A;  4GH4 C;  4YGD A;  4DRV A;  3AXE A;  1AHS A;  1AL2 1;  3OYW B;  4HL0 A;  1SBD A;  4P02 B;  5LBC A;  1H2N A;  1TEI A;  4O65 A;  5FXX A;  2WUH A;  3HOB A;  1IKP A;  4XBQ A;  5FY9 A;  2P3K A;  5FZK A;  1RUO A;  1I9R A;  3WUC A;  1RUC 3;  2VR4 A;  4XJZ A;  2NZ9 A;  2BGO A;  2XVG A;  4FO9 A;  4XIO A;  4KC8 A;  4OFG A;  5A6X A;  5IVB A;  1EUU A;  1H8T B;  2YBP A;  5J36 A;  1PK6 A;  1UYY A;  4LHS A;  5FQ0 B;  2HYX A;  1TE1 B;  2FHR A;  2YBK A;  3R4S A;  3B9C A;  2ETE A;  4BQW A;  1O6U A;  2QZ3 A;  5EWS A;  1B35 C;  3B00 A;  3N9Q A;  5GZE A;  3VB9 A;  3RSJ A;  3H50 A;  3RNS A;  2CWM A;  1DQ0 A;  4IV3 A;  4RGK A;  3T0A A;  1REE A;  3VBO A;  1C8N A;  2G9F A;  3WNP A;  3I3E A;  1RUD 3;  1R09 1;  4QXK A;  2NN8 A;  4Q4X 3;  1D4V B;  5J37 A;  1CZV A;  3OUH A;  4GB3 2;  3ACI A;  1NY7 2;  2R32 A;  3QH6 A;  1XNT A;  2WYF A;  1QH7 A;  4NUB A;  1O4Z A;  4NIH A;  2VDT A;  3WN1 A;  3BOW A;  3ETQ A;  2VG9 A;  2E32 A;  3J7M A;  4AEM A;  3OM6 A;  4N53 A;  4YM3 A;  5ANN A;  4AFB A;  2IXL A;  3USS A;  4LPL A;  4QX0 A;  1GOG A;  3G7D A;  3D61 A;  5A6Y A;  1HRV 1;  3DV8 A;  2XJT A;  1VAM A;  2X8S A;  4CUG A;  3S7I A;  3PDQ A;  3AP7 A;  3E5U A;  4YZ4 A;  1G6N A;  3HR9 A;  4A7K A;  1R64 A;  5JLV A;  5K0U C;  3WP5 A;  4GZ9 A;  1S55 A;  3T2Q A;  2EIC A;  5DDJ 3;  4B4P A;  2PA7 A;  1MQT C;  2RR1 3;  4RN5 A;  4OI4 A;  3RMX A;  5IVJ A;  5L7O C;  2YC2 A;  4D8M A;  3HQR A;  1YQ6 A;  1QJU 1;  2BV4 A;  1QJY 3;  3IZO A;  4HAN A;  4R9A A;  1HB2 A;  4I0W B;  1TMF 1;  2AR6 A;  3ZYG A;  5A6Z A;  4N7U A;  5ABJ C;  1BCX A;  2CYF A;  1PM4 A;  2GH2 A;  1AR8 3;  5BXX A;  4BB3 A;  1HB4 A;  5CAZ A;  4XYX A;  2JDH A;  1JU4 A;  2K9Z A;  2WT2 A;  1OF3 A;  1QNW A;  1OT5 A;  3AMQ A;  4A45 A;  4AGG A;  1C8M 3;  2WA3 A;  4CEW C;  5FY0 A;  4ATF A;  1UZV A;  5GLL A;  4UW4 A;  1D2S A;  4ERO A;  3SH4 A;  1KXG A;  1ALY A;  5CAD A;  1W8H A;  4QD2 A;  5L9V A;  3WLU A;  2YB7 A;  4TZD A;  4MGZ E;  5JZG C;  4RGG A;  4MUV A;  4Q29 A;  1UD1 A;  4LBL A;  2Z42 A;  3SCH A;  5F8P A;  5FDB A;  4DXT A;  1ULO A;  1DQ5 A;  4JGZ B;  3KST A;  3DPR B;  3WCR A;  1CZS A;  1X33 A;  2ZX3 A;  4L99 A;  3CJX A;  5KXD A;  2LW8 A;  1JZ6 A;  1HRI 2;  3WNL A;  3WDX A;  4NHM A;  5FXZ A;  1H4G A;  5L73 A;  1QKQ A;  3ACH A;  1W99 A;  2HWD 2;  1EAH 3;  3LIG A;  3UES A;  4BH9 A;  4HVO A;  4E8D A;  1RUI 2;  1UAI A;  2E63 A;  3JCI A;  3M3C A;  3VBH C;  2D6M A;  3LFI A;  2GC2 A;  5LCW L;  2WZR 3;  1GAN A;  1KS5 A;  2QKD A;  1KIT A;  4HPK A;  3T3Y A;  2BPA 2;  1GP4 A;  4QT6 A;  2SLI A;  1GYD B;  1UW8 A;  2XJR A;  4WV8 A;  1GP6 A;  5JSP A;  4I3G A;  1ULE A;  4QAW A;  1RUH 1;  4UFK A;  4V2V A;  3VBF A;  2DTW A;  5I0U A;  4B3N A;  3T4V A;  3KQR A;  1DDL A;  5FMD A;  5FKB A;  1RL3 A;  4DXZ A;  2WR9 A;  1UZY A;  4EWD A;  5DZG A;  5I0S A;  2YDE A;  1GR3 A;  4CP9 A;  1NXM A;  1WLC A;  4QQP A;  4KWK A;  5IK5 A;  3GZE A;  1QY4 A;  5L7O A;  2VUA A;  1ENS A;  3BTX A;  1Q8Q A;  2W1Q A;  2BWC A;  2DUO A;  2P37 A;  5DUX A;  3POJ A;  4Y20 B;  2YFS A;  3RZL A;  1GOF A;  1W05 A;  2TNF A;  3AL6 A;  2B46 X;  4R9D A;  4Y5T A;  5LY2 A;  3U37 A;  4U6D A;  2GC3 A;  2BBA A;  1VBE 1;  5FZ6 A;  1VRH 1;  1UYZ A;  5I8T A;  4XPV A;  3WF4 A;  2XOM A;  1I1E A;  3HEI A;  1WKY A;  4A6S A;  4M3C E;  4Q1P A;  2BTV C;  4P00 B;  1JHN A;  3SQO A;  4WZC A;  4RFT 0;  1C8M 2;  1US2 A;  4XQ4 A;  2WRA A;  3LPG A;  3CJI C;  3UGH A;  3WDU A;  3SKV A;  1OUX A;  5EP9 A;  1GFF 2;  1MS3 A;  1HQL A;  1E5I A;  3NNG A;  5IVV A;  4SLI A;  4EV0 A;  5FK7 A;  2XBO 3;  3DEC A;  1JBC A;  1BBT 2;  3N9P A;  4N43 A;  5A7S A;  1C3H A;  4IL7 A;  1GLH A;  2Z5W A;  3PVO A;  2HBT A;  3T2O A;  4DQA A;  3DKW A;  1BKZ A;  1J83 A;  3MIC A;  4EN7 B;  1UXZ A;  5FO8 B;  5KHJ A;  1W8W A;  2LUW A;  4ZXK A;  3QEF A;  1QEX A;  4BYY A;  3H42 B;  2WS9 3;  3D8C A;  1S0G A;  1B35 A;  4Y1U A;  5BYN A;  1KDM A;  4N8M A;  4ZON A;  4FFF A;  2YBS A;  4P9L A;  4Q27 A;  1W8N A;  5T52 A;  3AZX A;  3U14 A;  3AX4 A;  2RMU 1;  1O3T A;  3J7H A;  1UIK A;  4GAL A;  3OBT A;  4QHZ A;  3ZX7 A;  5F2W A;  3H3L A;  4KWL A;  4N43 B;  4CVU A;  4OQ9 A;  1LKN A;  2BP6 A;  5A33 B;  1N1S A;  5KBF A;  4LUL A;  5LA1 A;  3CBN A;  5I0D A;  1W9S A;  5BNP A;  3MLK A;  4R4X A;  3T30 A;  1ZA4 A;  4FSJ A;  3NRU A;  1YQ2 A;  3KCC A;  1YQC A;  3ZR6 A;  5FYB A;  4CDW C;  1ZBA 2;  4IQP A;  4LA3 A;  3VD5 A;  4AED B;  1MS0 A;  3R4D B;  2JB8 A;  5FP4 A;  4CXW A;  3HT2 A;  2XQX A;  3CZJ A;  2WT1 A;  4HON A;  2JKX A;  4BQX A;  1XXN A;  1QHD A;  2WO1 A;  5FWE A;  2P3I A;  4LOT A;  1JOP A;  3SXW A;  3MV0 1;  4CCK A;  5FYI A;  3SKJ E;  2WL1 A;  5JXJ A;  3FUO A;  1IHM A;  4E2S A;  3EO6 A;  1W9W A;  3Q8B A;  4S2H A;  4WZF A;  1PIV 2;  4ONZ A;  5HCA A;  4BDV B;  4N1I A;  3FJS A;  4HN1 A;  3I3M A;  2K2S A;  1GWM A;  1XNC A;  1BHG A;  3PME A;  2ZMN A;  2HWB 3;  4YM0 A;  2QZ2 A;  1RUF 1;  1W0P A;  2DCJ A;  5C0P A;  1ND3 A;  1HRV 2;  1RUG 3;  2VTX J;  3NMB A;  1SHW B;  2JDN A;  2VCM A;  4QGM A;  1IKQ A;  1F5J A;  2QQM A;  3JBG 2;  3KT7 A;  5FZ3 A;  5GLV A;  5AY9 A;  3LSD A;  3AMH A;  1DQ1 A;  1W2O A;  2WFF 1;  4MGQ A;  3H1M A;  5FP7 A;  3WPY A;  1V6O A;  5LBF A;  4NIA A;  2XJV A;  2VY0 A;  1YO8 A;  4I09 A;  3CIH A;  5C8C A;  1FOD 3;  3FC0 A;  4HPK B;  1VBB 3;  4WM7 C;  1J3R A;  1NXD 1;  3X29 B;  1HW5 A;  2ZGU A;  4DB5 A;  5JXI A;  2MHF A;  4WVZ A;  5E88 A;  4U6B A;  4WVW A;  3K1U A;  4RGA A;  5D8A C;  5FZA A;  2YZ4 A;  3ZYJ B;  1AR7 1;  3BOP A;  3VBH A;  1OLM E;  4FPH A;  1W6Q A;  3WR0 A;  4E4S A;  4Z2A A;  1HLC A;  1XRU A;  3D5Y A;  4GKY A;  2RE9 A;  4Y22 B;  1Z7S 1;  4NO4 A;  1XSQ A;  2OII A;  3QC2 A;  2WNO A;  3EBR A;  4EN8 B;  1YYN A;  1ZBE 1;  4KL1 A;  1PM7 A;  2E6V A;  4JV4 A;  1DU3 D;  2YFZ A;  2WS9 2;  2VCA A;  3AP4 A;  3DPR A;  4FPG A;  2W52 A;  2W1S A;  3SMH A;  2BRT A;  4MLO A;  4KGQ A;  4YLZ A;  1NCQ A;  1JW6 A;  2WN3 A;  4BMB A;  4OMD A;  4PLO A;  2JG9 B;  4MVT A;  5AC9 2;  5F7U A;  2YHJ A;  2D6L X;  4YWA A;  1QJZ A;  3MFA A;  3ZSL A;  3A22 A;  4JDM A;  4FPY A;  3WT3 A;  3RZJ A;  4GWM A;  1YQ8 A;  1AXK A;  4XQD A;  4BQ2 A;  4UDG A;  3MHZ A;  1VMH A;  1JYW A;  3E1F 1;  1QOT A;  4ISR A;  1OLM A;  1ULD A;  1FOD 1;  4Y22 A;  2YRO A;  1EPZ A;  4YVS A;  4ZU4 A;  3TN9 3;  3OB8 A;  2Q1Z B;  4YM1 A;  2CHH A;  2EIB A;  2ZX4 A;  4LUM A;  1A3K A;  3I7D A;  1YLL A;  1VMF A;  4IW3 A;  4TWT A;  4JQR A;  1AYM 2;  4AFM A;  3WW3 A;  2ORX A;  3DUI A;  3FBY A;  5DXD A;  5C8C B;  1IS5 A;  5A1L A;  5C3S A;  1GYE B;  3POW A;  3MI8 A;  4NOV A;  2NMO A;  3OGG A;  5FO9 B;  5J96 B;  4CXY A;  5D2A A;  1YCI A;  1S0C A;  4GAZ A;  3ZO0 B;  5EZW A;  2VGD A;  3HIF A;  5FYT A;  5GLT A;  4Y1V A;  3I59 B;  1RJ7 A;  1W0O A;  1XU2 A;  2XG3 A;  4UFH A;  1R08 2;  4ZS2 A;  1RUH 2;  5GJ6 A;  3ZFF C;  1EV1 3;  2J1T A;  4AHZ A;  4A42 A;  3AZZ A;  3R4Z A;  4ZS3 A;  2PHT A;  1ZX5 A;  3BTZ A;  1RUC 1;  4JC1 A;  1F35 A;  2CY6 A;  2XL9 A;  3OPT A;  3AYC A;  5FZB A;  2V4A A;  5EFU A;  3MW2 A;  4DO0 A;  2IXC A;  1V0A A;  4CU7 A;  1W8Z A;  5FY8 A;  3TBD A;  4BOW A;  3VBO B;  1GU3 A;  3THT A;  3H0O A;  1WLT A;  3ZYB A;  1EAH 2;  2HKX A;  3NJY A;  3A21 A;  4NR1 A;  5E16 A;  5GZG A;  1ZRI A;  1GOH A;  1YFU A;  5I0R A;  1J3P A;  1XJA A;  3RJR A;  2VOK A;  4D7S A;  3PHM A;  1JYN A;  4NID A;  1VB2 A;  4FPF A;  1N1Y A;  1UOJ A;  2EIG A;  1QXJ A;  2UWA A;  2ZEW A;  3S30 A;  5FQ0 A;  1PK6 B;  2JG8 A;  4DPN A;  3ZXE A;  1QWR A;  2V09 A;  3FHA A;  3L2Y A;  1MEC 3;  1WA6 X;  2PXJ A;  3VBR B;  1MR5 A;  1CR7 A;  1OVS A;  2JDM A;  5K4L A;  1LHO A;  2YPD A;  1AR6 3;  4XJA A;  5A33 A;  3POY A;  1RUJ 1;  2ZKN A;  3J7N A;  1V6L A;  1OA3 A;  4N9H A;  4OI1 A;  2VW0 A;  2BGC A;  3BU7 A;  1CZT A;  3ES1 A;  4DXS A;  3DYO A;  4LBJ A;  3ZYF A;  1DGL A;  3M7A A;  4Q2F A;  4DY5 A;  3RJ2 X;  2Z79 A;  3H3Z A;  4YAR A;  2X8F A;  1B35 B;  4FOQ A;  4I30 A;  3ES4 A;  1W6P A;  1RGS A;  1AZD A;  3AP6 A;  4NHX A;  3VN4 A;  3WDY A;  5B6S A;  3HNM A;  3ZIW A;  4AQS A;  5FP8 A;  1CES A;  3WAS A;  1KRI A;  2RMU 2;  5GLM A;  2HWC 3;  2J22 A;  1OOP C;  3UJO A;  3MYX A;  5JIU A;  1LB2 A;  3HQX A;  2UYA A;  2DVF A;  3IMN A;  4K9S A;  1WLD A;  5HPO A;  5DUW A;  3AKQ A;  3ZN6 A;  3GNE A;  5IVE A;  5J1X A;  5AYC A;  4XJ9 A;  4NPR A;  4AI1 A;  3O0V A;  2R16 A;  1PMH X;  1BJQ A;  2VO5 A;  2A5Z A;  4IEO A;  4L92 A;  1OVP A;  1PMI A;  4YW1 A;  4PLN A;  3DF0 A;  2CGP A;  3S7E A;  5JI9 A;  2Q0A A;  3D3A A;  3CJI A;  3C7H A;  1MZE A;  5LW9 A;  3ECQ A;  1RHI 1;  1NZC A;  2PEL A;  4O61 A;  4Y4Y A;  3W59 A;  3QEE A;  4GXL A;  5JR7 B;  2HWF 3;  3W20 A;  2VQT A;  1WW7 A;  4BXF A;  5F3C A;  4KC7 A;  4Y20 A;  5A70 A;  1GSL A;  5APA A;  1RUN A;  1MQT B;  5L9R A;  1W39 A;  2H6B A;  1OSG A;  2ZGL A;  3N7L A;  5FPA A;  1W8O A;  2MPF A;  1UPS A;  1HJF A;  4AHX A;  4HVQ A;  4RYD A;  2Y0O A;  3SCG A;  4NAO A;  1UOB A;  1H8V A;  4GMP 3;  3HN1 A;  4A3Z A;  4F8A A;  1LHV A;  1VBE 3;  4NII A;  4ZZ8 A;  2IXI A;  3OPZ A;  4GMP 1;  1UXX X;  5EV7 A;  3AVS A;  5F6K A;  4BIO A;  3RRD A;  5L36 A;  2P1B A;  2XWJ B;  3FLT A;  5FZI A;  4OI0 A;  2DUR A;  4PI2 A;  2ZGQ A;  1D0H A;  3VSZ A;  2OVU A;  5L19 A;  1Q56 A;  1RUI 1;  1Y4W A;  2EXI A;  2ZGS A;  4B7K A;  4DIQ A;  4YW5 A;  1OA2 A;  2B5H A;  3M3E A;  5FMB A;  5GZD A;  2W46 A;  1C28 A;  3H8U A;  1CAU A;  1SCR A;  3BIE A;  4O8O A;  1VBA 2;  2ZGO A;  1R1A 1;  5FMO L;  2WN2 A;  3ZFE A;  4YVS C;  2D6N A;  5C4W A;  4OUL A;  2ZGM A;  4K21 A;  2Y8K A;  4S2F A;  4CRQ A;  3I2F A;  3WNN A;  5IVC A;  2NYY A;  1RUE 3;  1XNB A;  3A0N A;  2VE1 A;  4K6B A;  4IEZ A;  4LBK A;  3GXU A;  3BIW E;  1UKG A;  3KB5 A;  3I4I A;  4CE8 A;  5KWR A;  4LE3 A;  2BQP A;  3KM5 A;  1I3H A;  3AZY A;  3WY6 A;  2JD9 A;  3MIE A;  4D6Q A;  3WMY A;  1LHW A;  4AFC A;  2K46 A;  2QQL A;  2VW1 A;  3LA2 A;  4Q8L A;  5BNO B;  5JOW A;  1K42 A;  3HBZ A;  4Q4Y 2;  2ZGN A;  3ZR5 A;  4XET A;  3SIT A;  5AC9 3;  4TYS A;  2JB4 A;  2WQ4 A;  1PO1 3;  2EAL A;  2AZ5 A;  1W18 A;  1LU1 A;  1MAC A;  3H7J A;  1HXS 1;  2PHF A;  2BDR A;  3DYM A;  5CNA A;  1EPW A;  2FZ1 A;  3ACG A;  4EWA A;  4Y1X A;  3TN9 1;  2E7A A;  4FOY A;  3III A;  4RHV 3;  5FYC A;  4YZ5 A;  2D6O X;  1KJL A;  2RS3 2;  2EAA A;  2VD7 A;  2LM3 A;  4LOS A;  4NRQ A;  4BU2 A;  2WIN B;  3D60 A;  1GMM A;  5B4X A;  1F4H A;  1GP5 A;  4OHV A;  1NZI A;  1RJ8 A;  3KGL A;  1K12 A;  4AWD A;  3OTF A;  1CX1 A;  3HAG A;  3K75 B;  1CAX B;  1DQ6 A;  4AXO A;  1Y9M A;  3FBM A;  5FZO A;  3AP5 A;  3VBU A;  5EQU A;  1BMV 1;  5C33 A;  1JYI A;  2KR2 A;  1PVC 1;  2Y34 A;  4UAP A;  2RR1 2;  1UMI A;  1UF2 C;  4CU6 A;  2VZP A;  3DCQ A;  2MEV 2;  3DPR C;  3IN9 A;  1G8W A;  3K3O A;  5LEK A;  1X82 A;  4IET A;  5IWF A;  5A3T A;  1WD3 A;  4AQT A;  1AR8 2;  1YFX A;  3RQ0 A;  3QAC A;  3WDV A;  3KVB A;  1SDW A;  3JXS A;  1V6M A;  4E9K A;  1O7F A;  1OA4 A;  1HB3 A;  1YI9 A;  2YMZ A;  1G9C A;  4QPI A;  3AVR A;  3HT1 A;  3K2O A;  4N53 C;  3AKF A;  1LHN A;  4HKL A;  3GZT B;  2C6S A;  1HIX A;  1C5I A;  4HOO A;  4U2A A;  5LAT A;  1OUR A;  1TQ5 A;  4W6Y A;  2P2K A;  4CUA A;  2A1X A;  5F5I A;  2JE7 A;  5HI0 A;  1J1L A;  3NQH A;  1DGW X;  2AEZ A;  4P9W A;  4XEZ A;  1MS1 A;  2R7E B;  4XJW A;  4BA6 A;  5CA6 A;  1QOO A;  4COV A;  4NRO A;  4CPB D;  2GAU A;  2VBB A;  4LBQ A;  5L7O B;  3WSO A;  5GLP A;  1EV1 2;  1DFQ A;  1PX4 A;  3M8L A;  1ZYB A;  1V6J A;  1SEF A;  1XND A;  3PUS A;  4IUG A;  1WCQ A;  2ZEZ A;  4RSU A;  5JMC A;  5A7P A;  3DYP A;  4RFR B;  4A6O A;  5IFP A;  3THD A;  1L7Q A;  3D5O A;  3NW4 A;  3JB8 A;  4DUW A;  5FUN A;  2OKX A;  3G6J B;  3N9M A;  3WP3 A;  2BFU L;  2Y64 A;  4MGS A;  3VL9 A;  1YQ5 A;  3AC0 A;  3AYE A;  2RS5 2;  3EMR A;  1PZ8 A;  1A6C A;  4OVE A;  4NWW A;  2E7T A;  3K3N A;  4AE2 A;  1ST8 A;  1WUV A;  3AKS A;  4FPJ A;  2WZP P;  3I2D A;  5C9A C;  2FMY A;  3I54 A;  3URF A;  4AAP A;  3U78 A;  1FNY A;  4XFB A;  3IPV A;  4MZU A;  4YVW B;  4CUC A;  5FUP A;  4AEK A;  3CU7 A;  3ASI A;  3GYD A;  1WW4 A;  2D3R A;  4D94 A;  4QB6 A;  3OCP A;  4RS5 C;  5H9S A;  3ZFG B;  3SEE A;  3UKT A;  3EJK A;  5KXC A;  3V0A B;  4I3P A;  4QX5 A;  3N7M A;  3FUQ A;  4LBM A;  4LOR A;  3HNB M;  4AGR A;  5KHG A;  2WSV A;  5BNP C;  1O8S A;  5C4W C;  2LRP A;  3NV4 A;  1W9F A;  2D3S A;  5IAV A;  4JKL A;  2IXK A;  4AHW A;  2E26 A;  2OA2 A;  2DCY A;  5A7W A;  4XUP A;  4ASK A;  3E97 A;  3OSD A;  1QNY A;  3KV4 A;  2VOT A;  4FQZ A;  1X50 A;  4QPW A;  4I02 A;  2WNE A;  4JX0 A;  3QLQ A;  1GQH A;  4LT5 A;  1LHU A;  4UF0 B;  3VUO A;  1U0A A;  1QJE A;  2F6B A;  1LOB A;  2ZTN A;  1RXG A;  2X10 A;  3AMN A;  4JKM A;  4BME A;  3E6D A;  3K4A A;  2C1F A;  1L7L A;  4NE9 A;  4QMA A;  1XSR A;  2D43 A;  4KCA A;  5DDJ 1;  2ZMK A;  3BUC A;  1VBB 2;  4HZF A;  1V9U 2;  2XJQ A;  1RVF 1;  4ITC A;  3DKQ A;  3ON7 A;  3LEM A;  1UZZ A;  1KFX L;  1QJX 1;  2WNU A;  5FZG A;  4CCN A;  3H1Y A;  4KBZ A;  2VZT A;  1LJ7 A;  5J3U A;  1CX4 A;  3NV2 A;  1W6M A;  2I2S A;  1W2U A;  2WZR 1;  4YFW A;  5EXO A;  4MSV A;  4AEJ A;  4ASL A;  1K5M B;  2Q1F A;  2RS5 3;  4YW2 A;  2H0B A;  2DUP A;  5LA9 A;  1UO9 A;  2QE3 A;  3R4U A;  1OQ1 A;  4ARY A;  4XOG A;  3GCX A;  2VVE A;  4J6G A;  4HMZ A;  4R52 A;  3UGG A;  2R1D A;  3B7M A;  4PVA A;  1N47 A;  1J3Q A;  1ZBE 2;  2IFR A;  3LDK A;  4MGK E;  4COW A;  3LEK A;  4AK7 A;  4GWJ A;  2RJK A;  1NG0 A;  5FP3 A;  4AK6 A;  5FOB B;  2NLR A;  1UY0 A;  2XJS A;  1STM A;  1MZF A;  1O59 A;  2XVK A;  4IE6 A;  5IT6 A;  1AR7 2;  4QPY A;  5LBB A;  3CF6 E;  3MIB A;  3WPV A;  3GZA A;  5DG1 A;  4AG4 A;  1YJK A;  4AAX A;  2GZW A;  1BVV A;  2Q4S A;  3H1W A;  2ZGK A;  3ZYP A;  2Q8O A;  4WVM B;  4IEU A;  4N4B A;  1NLQ A;  5A8D A;  1GZW B;  1SLC A;  2VNO A;  3BI3 A;  3EB7 A;  5AVA A;  3UGF A;  3K46 A;  3A7Q A;  3AK0 A;  1PNG A;  4ORF A;  5CU1 A;  1UN1 A;  1X8M A;  1H2M A;  2BUK A;  2ATF A;  3MIF A;  5FPB A;  4CU8 A;  5C3Q A;  1CIW A;  4QPG A;  4P08 A;  2LAL A;  1MEC 1;  3T1L A;  5A3U A;  1CJD A;  2ES3 A;  4H14 A;  1NX9 A;  4HLT A;  5SV5 A;  3ZXJ A;  3MGU A;  5K0U A;  4MXW A;  5CFD A;  1WW5 A;  4W8J A;  5C71 A;  5LAS A;  4DXR A;  5CG8 A;  1LGB A;  5EYY A;  2QQJ A;  3WNM A;  4G3Y C;  4BCU A;  3TAW A;  3DN7 A;  1PVC 2;  1PX3 A;  1VAL A;  3JZV A;  4AVS A;  3POS A;  2DTY A;  2RMU 3;  5FJH A;  3KF5 A;  1OD5 A;  4JTO A;  4UDK E;  4AK5 A;  2VM9 A;  1KEX A;  4CDX B;  4X8P A;  4EYU A;  1LUL A;  5FLJ A;  4LLF A;  1JXN A;  3POE A;  1CN1 A;  1DLC A;  5JI7 A;  3KV9 A;  2GP3 A;  4YW4 A;  3U1X A;  1KS4 A;  2DCZ A;  4UW6 A;  4KWJ A;  3BB6 A;  4FPL A;  1HXS 3;  4AR2 A;  4W6X A;  4IDZ A;  5DMY A;  3HWJ A;  3TEX A;  3HN3 A;  3OBR A;  1D2Q A;  1COV 2;  5L9B A;  4MOA A;  4DEQ A;  4XDO A;  1M06 G;  1BQP A;  5FZ7 A;  5T54 A;  3LEI A;  2VXR A;  4PQ9 A;  2VQ0 A;  3MFC A;  4QX7 A;  4CCC A;  3BU0 A;  4QM9 A;  1UPI A;  2PHL A;  3KCY A;  4HSJ A;  2FDI A;  3WX5 A;  3VV1 A;  2A6Y A;  2YUE A;  4NJ4 A;  3CU9 A;  1EUT A;  1HN0 A;  3VBS A;  2YU2 A;  1OOP B;  2DCT A;  2R0F A;  2YC4 A;  3N9O A;  1UQX A;  1WMX A;  3GGL A;  1DZT A;  1GNZ A;  2C0Z A;  4HET A;  3VZM A;  4XFH A;  1ZZC A;  3TNP B;  4LKF A;  3U11 A;  4ATE A;  1YRZ A;  2C24 A;  5IFT A;  1ULP A;  5LRR A;  2ZZJ A;  5JSO A;  2WKK A;  2P34 A;  1NOV A;  4YG0 A;  2BWA A;  2FQP A;  4JAA A;  3OOX A;  4LR4 A;  5T5P A;  2ADD A;  4A2U A;  5B4N A;  2ZXQ A;  2RS1 3;  1K5M A;  3A4U A;  3LF7 A;  4XVH A;  2R04 3;  2W5F A;  3ILN A;  3R4Y A;  1SPP B;  1RUI 3;  1XE0 A;  2RDQ A;  2WO2 A;  1W28 A;  2X8T A;  3ZFF B;  2VZV A;  4QB1 A;  2BJS A;  1TL2 A;  3M1H A;  4RR3 C;  4QGL A;  5KHK A;  4AVV A;  2WNU B;  1PO2 2;  2LRO A;  5A7O A;  1CPN A;  1HRI 3;  3JBG 1;  3UKN A;  2AEN A;  2GNB A;  4D47 A;  4Y24 A;  3PNA A;  3PJY A;  3O1O A;  1PGS A;  3VD7 A;  4Z07 A;  2XUM A;  5F32 A;  1RMU 2;  4Z2W A;  2R07 2;  4GWI A;  2W9X A;  4MET A;  4CEW A;  4QDQ A;  2R06 1;  4JGY A;  5C3P A;  1YXW A;  4OHX A;  2B4W A;  5FXW A;  5EIY B;  1SLA A;  4JGY C;  2VMC A;  3ZYR A;  1UU6 A;  3K4Z A;  4LO4 B;  1AR9 2;  4CYD A;  4XUN A;  4W6W A;  3WG4 A;  4QX8 A;  3ZXD A;  3VDA A;  5A7W B;  4CDU A;  4UW5 A;  4FAG A;  5BNP B;  1PZ7 A;  3I3Q A;  2MEV 1;  4DRR A;  2WSU A;  5C8C C;  4XUT A;  2I74 A;  2PAM A;  2XLG A;  2ARX A;  1ENQ A;  1PMJ X;  4G4F A;  5JOZ A;  2FCU A;  2OPK A;  3KD4 A;  2G1M A;  2PHD A;  2XLA A;  4YVW C;  1ZZ9 A;  3OM2 A;  3QOP A;  3EXU A;  3DGT A;  4RHV 1;  3B5L B;  1HRI 1;  2OQ6 A;  5KXE A;  2EID A;  1NY7 1;  3EYP A;  3JUU A;  2YFR A;  3LSE A;  3ORJ A;  3LZZ A;  2X5I B;  1QJY 1;  5DUU A;  4X6R B;  3SHR A;  5T3N A;  4UFI A;  4E4Z A;  2JKB A;  3TNQ A;  2XJU A;  1BYH A;  3IPV B;  1TMF 3;  4RQP B;  4Q4W 1;  2A6W A;  5F5A A;  2VMF A;  5FPL A;  5C7G A;  1IG3 A;  1WME A;  1ZA7 A;  4YZ2 A;  4FTB A;  1UYX A;  4IEQ A;  2X53 S;  4IV1 C;  3WUD A;  3LIH A;  1EV1 1;  5FZ0 A;  5F9T A;  2OT7 A;  2FDF A;  1UYP A;  3UJQ A;  4AI9 A;  4HFS A;  3ZDS A;  4MX3 A;  2RDS A;  4LBN A;  4XFF A;  5SV8 A;  1HN1 A;  3SEP A;  2JDP A;  4CP1 A;  3SNM A;  1H1M A;  5F5Q A;  2FDK A;  1OOP A;  2IFW A;  3S6P A;  4QDR A;  4QQH A;  3RI8 A;  4D7Y A;  4QHO A;  1UIJ A;  1LEM A;  5ACA 2;  2H0V A;  3POG A;  1J84 A;  2WA4 A;  1CD3 G;  3VHP A;  3Q8A A;  3NNM A;  1H6X A;  2G4I A;  3FHI B;  5CKM A;  5LEJ A;  1VBC 3;  2XXZ A;  2NQY A;  4KG8 A;  3KWV A;  1ODN A;  3APB A;  4IEX A;  3QH7 A;  1V6N A;  1R09 3;  2FMD A;  3ME2 A;  4XFA A;  4AQ6 A;  4CP2 A;  1S1A A;  3W58 A;  1XNK A;  5F6L B;  3FZ3 A;  4HT1 T;  1AR6 1;  3OGS A;  1H0B A;  2RV9 A;  4FI9 A;  4B8E A;  4XHB A;  3LFM A;  1G86 A;  1QQP 3;  2JWP A;  3U4X A;  5C5T A;  1RUH 3;  4IEY A;  4FPK A;  4H2A A;  1UMZ A;  3MZH A;  2QFE A;  1AR9 1;  2OS2 A;  3MW4 A;  2CDP A;  2VXJ A;  1X9P A;  4D6S A;  2CL2 A;  4BXS V;  2HBU A;  4UT5 A;  3UT0 A;  1VAK A;  4F7Z A;  5FR3 A;  1JOD A;  4AOC A;  2WWU A;  5LZ6 A;  1CAX A;  3K77 A;  5FWJ A;  1XB9 A;  1ZBA 1;  4KU7 A;  2R30 A;  1O3Q A;  4LBO A;  1MVQ A;  2RJ2 A;  3FLR A;  4ES9 A;  4GKX A;  5K0U B;  1NE4 A;  1ENX A;  2RR1 1;  4DUX A;  3C7O A;  1JZ3 A;  5IAX A;  2WWJ A;  3BYJ A;  4R4Z A;  1BMV 2;  3UL2 A;  4MGT A;  2GDF A;  1BEV 1;  5FY4 A;  1RHI 2;  3C2U A;  4L97 A;  4LHN A;  2PLV 2;  2CU5 A;  2ZAB A;  1F2N A;  1OFS A;  1DQ2 A;  1FMD 1;  2XBO 2;  4ZKT B;  2TBV A;  1YI7 A;  4CPB A;  1C1F A;  3K4D A;  3WNO A;  2VZO A;  5BY5 A;  2O14 A;  5LRS A;  2VZU A;  3O0W A;  1VBD 1;  5JCT A;  1ND2 C;  1F15 A;  4AQ2 A;  5GM0 A;  1U5X A;  2XML A;  3I8T A;  4Y4R A;  4EJR A;  1O3S A;  3MEP A;  2XQR A;  4O7X A;  1MS9 A;  4RQP C;  4XUR A;  2VTX A;  4N7I A;  4GJZ A;  5BNO A;  4LHL A;  2VME A;  3SCF A;  3VDD B;  1SQ4 A;  2N7G A;  2XPJ A;  3AXD A;  5C3R A;  4KMQ A;  2IC1 A;  1UX6 A;  2G9G A;  1Q8P A;  2O8Q A;  4URA A;  2IUW A;  4XXP A;  2QJV A;  2X09 A;  1S0J A;  2HYK A;  2E7Q A;  4Y1Z A;  3AYD A;  2UY9 A;  4ONU A;  4JGZ C;  4BIF A;  2RHP A;  2J1E A;  2F4L A;  2DU0 A;  1NAE A;  2DVD A;  2ZKL A;  4GA9 A;  3ZKY A;  2WQ8 A;  2SBA A;  4O9E A;  5GZF A;  3WQ1 A;  3KV6 A;  4XCA A;  2C26 A;  2ZEX A;  3KSC A;  1RVF 2;  2VMG A;  5C4W B;  2QQP A;  2WJS A;  5LA0 A;  4IEP A;  2WO3 A;  1S4C A;  3HD8 B;  5JZG B;  1VBE 2;  3WPU A;  2ZML A;  3JBG 3;  3MF9 A;  2GC1 A;  5M0T A;  3QZ4 A;  4E8C A;  2W92 A;  2VZ3 A;  1RUE 1;  5IYY A;  2VJX A;  4YFZ A;  1O3R A;  1Y7B A;  1OLQ A;  3V64 A;  3BYN A;  3Q8F A;  4COU A;  2ZCW A;  3B3Q E;  3GJB A;  3ITQ A;  3OD0 A;  2DVB A;  2VOV A;  1W9Y A;  1G7Y A;  1T6G C;  1ZNP A;  4BPZ A;  4BHP A;  3D6E A;  3RZH A;  1X7N A;  1NQJ A;  2GNM A;  1VAV A;  3PU3 A;  4UFM A;  1AXZ A;  2XON A;  3CHX A;  5I91 A;  3T0D A;  4XDP A;  3RG0 A;  5FBZ A;  3O14 A;  3NL1 A;  4FQ4 A;  2VZS A;  1OMI A;  2WAB A;  3ILR A;  1POQ A;  3P3P A;  4YPJ A;  1SLB A;  2QDN A;  2ENR A;  3VBU C;  3N4M A;  4Z8B A;  1ZRD A;  1W0N A;  3M3I A;  1SG3 A;  1UWW A;  1W3X A;  2WWS A;  2W87 A;  1COV 3;  4RL7 A;  4XBN A;  3PVB B;  2DUQ A;  2EVX A;  2ZAA A;  1VR3 A;  2FZ2 A;  1SFY A;  3WP4 A;  5FZL A;  1AX0 A;  3TWI A;  2AYH A;  2Z4F A;  3ZFG A;  3VHR A;  1PNF A;  1ZRF A;  3T08 A;  1NCR C;  1FPN 2;  3T4H B;  1TNR A;  2GP5 A;  3LAG A;  2DF7 A;  3ZN6 B;  3ZSK A;  4Q8K A;  3ZLI A;  5HXV A;  4AGV A;  3KQ4 B;  1JU3 A;  4OUE A;  1R09 2;  3AB0 A;  4AYU A;  5JMO A;  5A3O A;  1ZRR A;  2A3X A;  1PVC 3;  3HJR A;  4JKK A;  4YM2 A;  1NYW A;  3AYA A;  1RUJ 2;  1W6P B;  5FIX A;  4AW7 A;  1POV 1;  2OW4 A;  4QWN A;  2XGX A;  3RVH A;  2ZAC A;  3AKH A;  2A6Z A;  2C9A A;  3OPW A;  3RZM A;  3E6B A;  3FWE A;  3LPF A;  4BQ4 A;  1WGP A;  2RM2 1;  2GNT A;  2JE8 A;  3CMG A;  3IDE A;  3I2I A;  4DS0 A;  3KMH A;  3POF A;  2ZX0 A;  4FVV A;  5AC9 1;  3CO2 A;  4LBQ D;  1W2T A;  1W6O A;  3DL3 A;  4AVT A;  3V56 A;  3N3H A;  5H9R A;  3TEW A;  1MVE A;  3BCW A;  4QXH A;  1SCS A;  2DFB A;  2ZX2 A;  5CIS A;  1NUK A;  4PIY A;  4XTM A;  1UNB A;  3B69 A;  1OD3 A;  3IWZ A;  4L8Q A;  5GKA C;  5IVY A;  1VBC 1;  3U07 A;  3TB0 A;  1SZB A;  2AH2 A;  1PK6 C;  4IND A;  4M0N A;  3WN2 A;  5DUV A;  2YY1 A;  3AKG A;  2X5I C;  5LBE A;  2D93 A;  1OQE A;  1FNZ A;  2ZA9 A;  1FAY A;  5FPV A;  4V1P A;  3VSR A;  3LE0 A;  3WCS A;  3WAT A;  5FY1 A;  4KMI A;  3AKR A;  3GDB A;  3LA3 A;  4URT A;  3WW4 A;  5CFC A;  3KF3 A;  4MYE A;  3RZZ A;  1GV9 A;  4CUB A;  1NA1 A;  2V5Y A;  2A75 A;  4TSV A;  3ZDV A;  2VQA A;  1AL2 3;  2PHU A;  1LEN A;  2R0H A;  4I0A A;  4B1M A;  3OUJ A;  1H30 A;  4A3X A;  2CAU A;  5FBJ A;  4OCT A;  4BM8 A;  4B4R A;  3VDB A;  4Y3O A;  1YJL A;  2VVF A;  1K5M C;  1AX2 A;  1W90 A;  3B9I A;  1SFP A;  3HQU A;  4LO6 B;  5FO7 B;  1TVG A;  1X36 A;  1DZR A;  4ET7 A;  1ZRE A;  4YZ3 A;  1GWL A;  2ORZ A;  3J7L A;  3VBU B;  4B7E A;  3GF6 A;  2DFC A;  2VZR A;  2GMM A;  2WFP A;  3TN9 2;  2Q8E A;  3UET A;  3I3D A;  4FFG A;  3HMY A;  2VZ1 A;  3F2Z A;  2QQO A;  2BVV A;  4E2G A;  4P5H A;  4LIT A;  3BTY A;  1UX7 A;  4XAA A;  2WAO A;  1TME 3;  4MXV A;  5GLN A;  1XNA A;  4ZXE A;  3N36 A;  1PVX A;  1NCR B;  4XXA A;  5A6Q A;  4HN0 A;  3H8X A;  5CKN A;  1CQ9 A;  2OZJ A;  3PUA A;  3O1T A;  2WLQ A;  1PHM A;  4C1W A;  5IAT A;  4A44 A;  2QQI A;  3PUQ A;  1LGN A;  4TXW A;  1IZ3 A;  5JOY A;  1RUJ 3;  1I5P A;  2JG9 A;  2EXK A;  5IK7 A;  4LJH A;  2BNM A;  3VT1 A;  4JHZ A;  1UY2 A;  5F2S A;  1AJO A;  1JTZ X;  2FBE A;  2GC0 A;  2GH8 A;  5A7V B;  5ABJ B;  3MF6 A;  2VMI A;  4NHK A;  4QQL A;  4UFJ A;  2HJI A;  3KT4 A;  4GUL A;  4HBN A;  3ZPO A;  4W65 A;  4XMA A;  3LGR A;  4H7M A;  1VLN A;  4BLI A;  4E4D X;  4UBG A;  3IT8 A;  3NJZ A;  4I2O A;  1L3J A;  5FZF A;  5IW0 A;  4XAC A;  4LO5 B;  5EHD A;  2O0O A;  1X9T A;  1GQG A;  1W6Q B;  2JE9 A;  3VBH B;  3O1P A;  1QJX 3;  3OY8 B;  5JIA A;  2FD8 A;  3M3O A;  3PTY A;  4Q0S A;  4COT A;  3V0B B;  5KC5 A;  3QCW A;  1JUI A;  2V4V A;  2WQZ C;  1REF A;  4OI2 A;  5KR7 A;  1UZ0 A;  3T0B A;  4CCL A;  1PT2 A;  1CAU B;  3I2G A;  4DIN B;  4ZPI A;  5GZC A;  5F3E A;  1YWK A;  4L0P A;  2HWB 2;  2ZHM A;  4KU8 A;  1C8M 1;  4XBL A;  2VMD A;  1IOA A;  2VC9 A;  1MPX A;  4QX1 A;  5C2M A;  2WDB A;  5I8S A;  3RI9 A;  4LHK A;  1UZW A;  1J1T A;  2PAE A;  3RWK X;  1LOE A;  3NAP C;  3VD9 A;  4N2Z A;  3NAP A;  1UV4 A;  4QM8 A;  2RJL A;  5BNO C;  1G9A A;  2VUD A;  1Q3E A;  1OHF A;  1UY1 A;  1FT9 A;  3AKP A;  1OPM A;  3EHK A;  5H9Q A;  1N1V A;  1MQT A;  2O1Q A;  1W8T A;  2VCB A;  2Y6H A;  5BNQ A;  4NN0 A;  2XB6 C;  5EJ3 A;  1LOA A;  1I6X A;  3I97 A;  1ZBA 3;  4BK4 A;  4XJU A;  5FY5 A;  4BZ4 A;  1GYH A;  4RA0 A;  1OI6 A;  3B94 A;  3TYJ A;  3M2M A;  4KGG A;  4EQV A;  2XHN A;  1X8E A;  3MO4 A;  4YYO A;  1R08 1;  4MHU A;  1ZVF A;  4AED A;  4HKO A;  4Q5O A;  1LU2 A;  4AL9 A;  1JOJ A;  1CAW B;  4CDU C;  2Y60 A;  3CJI B;  4JRL A;  3E6C C;  5KHH A;  3DXT A;  4AI8 A;  1JYC A;  3NVC A;  3P5B A;  3IAP A;  1S2B A;  3J9S A;  1VBD 3;  4AVC A;  2IXH A;  3NO8 A;  3D0S A;  4QDS A;  4YW7 A;  4LLO A;  5FZE A;  4XFI A;  4FFH A;  2NP0 A;  4GH4 B;  1QXR A;  1QH6 A;  5C9A A;  5BNN C;  4YNI A;  3C7G A;  2WS9 1;  3VKO A;  4IV3 C;  4K40 A;  5A1A A;  1VPH A;  3H9A A;  5K8S A;  2A6X A;  3VBO C;  1MS8 A;  1H9W A;  4XIK A;  5AFE A;  4OHY A;  5IJR A;  2RM2 3;  1GNY A;  1O5L A;  3M3Q A;  2YU1 A;  2ZGP A;  4KI5 M;  1YHF A;  5A7N A;  3WG1 A;  1IQA A;  3GAL A;  1GNH A;  2Z69 A;  1SMV A;  3MID A;  1RIT A;  2A7A A;  2B39 A;  1VBA 1;  1MZ6 A;  4Q0P A;  3VBR C;  1WBF A;  4ZY9 A;  2Y33 A;  1J59 A;  1HQW A;  4OLL A;  3VBR A;  4Y5Z 0;  2C9K A;  2ID4 A;  2QBX A;  2WFF 2;  2QCS B;  4KG0 A;  2JG8 B;  2ZJC A;  2JX9 A;  2JXA A;  3WF0 A;  4ASM B;  4Q0U A;  3BPS A;  4GD4 A;  1CAW A;  2B4K A;  4ZU5 A;  2XH6 A;  3ZSJ A;  1ONA A;  2VNR A;  2NMN A;  5CFD C;  2XKO A;  1RUD 1;  5CEH A;  1SLL A;  2ZPX A;  1PO2 3;  4PT6 A;  4UOJ A;  1UY3 A;  2D7F A;  5HCB A;  5K9Y A;  1Q8S A;  3OF1 A;  1L7R A;  2CDO A;  2UY8 A;  5A3N A;  2OUJ A;  5D21 A;  2WO7 A;  2A73 B;  4CXX A;  2Z2S B;  5FYU A;  3WQ7 A;  2R04 2;  4CP9 B;  1CAV B;  3USU A;  2TEP A;  4WM7 B;  2AEY A;  2RS1 2;  3CZU A;  3KVA A;  3LWC A;  1CIY A;  2G9Z A;  1FXZ A;  3I3B A;  3NAP B;  1XE8 A;  2ZHK A;  3LKJ A;  1JYT A;  4M00 A;  1DGR N;  4J1W A;  4CDQ B;  5AFB A;  1W2A X;  1WA4 A;  2V5D A;  3I59 A;  4W4Z A;  3UNP A;  5FYS A;  5FLI A;  4U36 A;  1W6N A;  2BBV A;  3VBF B;  3ZOI A;  3IKW A;  3IDA A;  2HH9 A;  3GM8 A;  4IES A;  4QX3 A;  1IPJ A;  2CGO A;  3VHN A;  2RS1 1;  4FTS A;  1GKB A;  2WFF 3;  2XWB B;  2JDU A;  2VCC A;  1H2L A;  3BPZ A;  1VKD A;  1ULC A;  2ZHL A;  1I5Z A;  5KC6 A;  3LOB A;  1TNF A;  1T2X A;  1QJU 3;  1W3V A;  4O9G A;  3VKL A;  4FFI A;  5F5C A;  1NQD A;  3CQO A;  4YVS B;  1FPN 3;  3IIA A;  4XF0 A;  5HCH A;  4F3J A;  3ZN5 A;  1E5R A;  2D3P A;  5ANQ A;  2W95 A;  1P8J A;  3NWK A;  5FYV A;  3WF2 A;  3H7Y A;  5CFC C;  4KCB A;  3POI A;  4CA9 A;  4FP3 A;  1MZ5 A;  2JDA A;  4EWE A;  5CIR A;  4FP2 A;  5I0T A;  5A7V A;  3INA A;  3ATG A;  1GZC A;  2Y38 A;  3P3N A;  4AZZ A;  5FY7 A;  1LOG A;  1NCQ B;  4A41 A;  2AC1 A;  5T55 A;  3CKH A;  3ZYI B;  1VBD 2;  2J1V A;  5LB6 A;  2Y6F A;  3PUH A;  3VGI A;  4BQY A;  1YFW A;  1QJY 2;  2D6K A;  3ENR A;  4OUM A;  1NCR A;  3CLP A;  2J1S A;  1C5H A;  5FYM A;  3I2H A;  1AJK A;  5DDJ 2;  3VL8 A;  3K48 A;  1FI2 A;  3C3V A;  1DG6 A;  2OZ6 A;  4E27 A;  3O1R A;  4QX2 A;  3N9L A;  4XUQ A;  3MUZ 1;  2BNO A;  4CTE A;  4XF1 A;  3WG3 A;  3VDC A;  1BBT 1;  4P9J A;  3D82 A;  3A0K A;  2PN5 A;  3RYR A;  1H9P A;  1YC6 1;  5H9P A;  4BWO A;  4LA2 A;  1UU5 A;  5JSR A;  2ERF A;  3ZXK A;  3I2O A;  3VT2 A;  1QJU 2;  4I0B A;  2ZX1 A;  5FYH A; 
#chains in the Genus database with same CATH homology
 4OMC A;  1UYX A;  3VT0 A;  3WQB A;  1OH4 A;  1JHJ A;  3LIH A;  2WBK A;  1UYP A;  2BER A;  2J1T A;  4A42 A;  1HN1 A;  3SEP A;  3T2P A;  3R4Z A;  3W5N A;  3MV1 1;  4PF1 A;  4QDR A;  2W47 A;  2QQN A;  4CU7 A;  3THC A;  1UY4 A;  1J84 A;  5DQ0 A;  3R67 A;  3AKI A;  3PIG A;  1GU3 A;  1H6X A;  3C8X A;  2QQV A;  3A21 A;  4OZO A;  1H6Y A;  1GOH A;  1JZ5 A;  5CYY A;  2ZEW A;  3FHA A;  3OGS A;  2RV9 A;  4FI9 A;  1LNS A;  1W9T A;  1IQD C;  3BYK A;  2W1U A;  1CZT A;  2CDP A;  3DYO A;  3WNK A;  4DXS A;  3OEA A;  4BXS V;  1JZ2 A;  2X8F A;  1JZ4 A;  1JI6 A;  5B6S A;  3HNM A;  3K77 A;  3WAS A;  2W3J A;  5GLM A;  1XC6 A;  2J22 A;  2RJ2 A;  1K45 A;  3T09 A;  4DUV A;  1D7P M;  2W1W A;  4HG6 B;  5DPN A;  5HPO A;  1JZ3 A;  4DUX A;  1DYO A;  3C7O A;  3BYJ A;  3NJX A;  5J1X A;  5AYC A;  2L9L A;  1PMH X;  3C2U A;  2VO5 A;  2W94 A;  5EJ1 B;  3D3A A;  4LKS A;  2QQW A;  1YI7 A;  5FLW A;  3WNO A;  3K4D A;  2VZO A;  3C7H A;  2VZU A;  3ECQ A;  5JXG A;  4M4R A;  4OYU A;  3VSS A;  2XQR A;  3QEE A;  4XUR A;  2VQT A;  1TG7 A;  2VME A;  4MAD A;  3P1I A;  2E31 A;  2ZEY A;  4MO3 M;  1DP0 A;  3FHQ A;  4KC7 A;  4KMQ A;  1JYV A;  3I2J A;  2HLE A;  4A4A A;  1W8O A;  2X09 A;  4RYD A;  1NKG A;  5AYE A;  2VZQ A;  5FUI A;  2YG0 A;  4A3Z A;  4ZZ8 A;  5JR2 A;  3FN9 A;  2J1E A;  3IB3 A;  1NAE A;  1UXX X;  3OGV A;  2WQ8 A;  3ACF A;  1O8P A;  3VSZ A;  2C26 A;  2ZEX A;  1Y4W A;  2Y6J A;  1F4A A;  2EXI A;  5B6T A;  5LA0 A;  4O8O A;  5FMB A;  2W46 A;  2J1R A;  5JUV A;  4N2R A;  2WO3 A;  2WN2 A;  5GLR A;  3WPU A;  4W50 A;  3QZ4 A;  4E8C A;  2W92 A;  2VZ3 A;  5IYY A;  2Y8K A;  2C4X A;  2VJX A;  3I2F A;  3WNN A;  1Y7B A;  3BYN A;  3WF1 A;  3MBW A;  3GXU A;  4CU9 A;  5EJZ B;  3BYL A;  2XON A;  3WEZ A;  3T0D A;  3P6B A;  2Y6L A;  2JD9 A;  2VZS A;  3OM7 A;  3WMY A;  2WAB A;  4YPJ A;  2QQL A;  5JXH A;  2EXH A;  5JOW A;  1K42 A;  2BZD A;  1W0N A;  2B9V A;  4ARX A;  1UWW A;  1SG3 A;  2W87 A;  1W18 A;  4QQS A;  3OGR A;  3DYM A;  3C7E A;  3ACG A;  4LQR A;  2Z4F A;  1Y9G A;  3T08 A;  3III A;  5AYD A;  1KGY A;  1JZ7 A;  3OG2 A;  3D60 A;  2WYS A;  1GMM A;  5B4X A;  1F4H A;  1K12 A;  1JU3 A;  4OUE A;  4BK5 A;  1CX1 A;  5JMO A;  4XZU G;  2WZE A;  3QED A;  3K75 B;  3OBA A;  2ADE A;  1UMH A;  2PQS A;  3HJR A;  4JKK A;  1Y9M A;  5FIX A;  4UI9 L;  4UAP A;  3NJV A;  1UMI A;  4CU6 A;  2VZP A;  4P02 B;  2Y6G A;  3AKH A;  4PVI A;  3HPN A;  4TTG A;  4KWU A;  2WUH A;  3HOB A;  3LQC A;  3LPF A;  3VD3 A;  3CMG A;  2JE8 A;  3JXS A;  3I2I A;  3AKF A;  2VR4 A;  2BGO A;  1W2T A;  4KC8 A;  1EUU A;  1UYY A;  4LHS A;  2HYX A;  4CUA A;  5A8C A;  1NUK A;  4QB2 A;  3NQH A;  2AEZ A;  1OD3 A;  3WN2 A;  2R7E B;  3AKG A;  3T0A A;  5CZK A;  3WNP A;  2X05 A;  3I3E A;  3FL7 A;  5GLP A;  3WSO A;  1CZV A;  3LE0 A;  3VSR A;  3ACI A;  3WAT A;  4KMI A;  1PX4 A;  1XNT A;  3GDB A;  2VDT A;  3WN1 A;  4IUG A;  1WCQ A;  2ZEZ A;  3KF3 A;  3OM6 A;  2E32 A;  3SC7 X;  4CUB A;  4A6O A;  3DYP A;  5IFP A;  1K3I A;  3THD A;  5ANN A;  1L7Q A;  4DUW A;  5G05 L;  2OKX A;  4LPL A;  5IHR A;  4QX0 A;  1GOG A;  3D61 A;  2Y64 A;  4MGS A;  3VDB A;  3AC0 A;  2X8S A;  1TVG A;  4ET7 A;  1ST8 A;  1R64 A;  4GZ9 A;  2ORZ A;  3T2Q A;  2EIC A;  3VSF A;  2VZR A;  3WMZ A;  3UET A;  4CUC A;  3I3D A;  5DN2 A;  4RN5 A;  4FFG A;  2VZ1 A;  2YC2 A;  3F2Z A;  4QB6 A;  2E33 A;  4D8M A;  2QQO A;  3ABZ A;  3SEE A;  2QQU A;  2LS6 A;  1UX7 A;  3BN6 A;  2WAO A;  5GLN A;  1XNA A;  4ZXE A;  4BJ0 A;  3WN0 A;  3HNB M;  1JU4 A;  4A45 A;  1OF3 A;  1OT5 A;  1O8S A;  5GLL A;  4JKL A;  2QQI A;  4A44 A;  2E26 A;  1US3 A;  2V72 A;  3BGA A;  4TXW A;  2YB7 A;  2VQU A;  4XUP A;  5JOY A;  1I5P A;  2EXK A;  2VOT A;  4JHZ A;  3VT1 A;  1UY2 A;  5A7V B;  4QPW A;  4DXT A;  1ULO A;  4JX0 A;  3KST A;  1CZS A;  2X10 A;  4JKM A;  2LW8 A;  1JZ6 A;  3K4A A;  2BGP A;  3WNL A;  4KCA A;  3ACH A;  1W99 A;  3LIG A;  3UES A;  4E8D A;  4ZZ5 A;  4O8P A;  3LEM A;  4COT A;  2YFT A;  3LFI A;  5LCW L;  2WAA A;  2V4V A;  2VZT A;  1UZ0 A;  3T0B A;  1PT2 A;  3ZXL A;  3I2G A;  1GYD B;  4L0P A;  3VD4 A;  2VMD A;  4QAW A;  2VC9 A;  1MPX A;  4QX1 A;  3OM5 A;  2WDB A;  4ARY A;  5FMD A;  5FKB A;  3UGG A;  2W91 A;  4PVA A;  3RWK X;  3LDK A;  4AK7 A;  3VD9 A;  3LEK A;  3W5M A;  4N2Z A;  4GWJ A;  4AK6 A;  1SDD B;  1UV4 A;  3CDZ B;  4P5Y A;  1UY0 A;  1JZ8 A;  1UY1 A;  1O59 A;  2VCB A;  3LV4 A;  2Y6H A;  2W1Q A;  2YFS A;  2WZ8 A;  3I97 A;  4BK4 A;  1GYH A;  1GOF A;  3U37 A;  3WPV A;  4U6D A;  3U75 A;  4AG4 A;  4AAX A;  4DEV A;  2RVA A;  4EQV A;  3C7F A;  2BBA A;  1OF4 A;  2XHN A;  3MO4 A;  1UYZ A;  4N4B A;  3WF3 A;  3WF4 A;  1GQP A;  2XOM A;  5A8D A;  3EB7 A;  3HEI A;  1WKY A;  3UGF A;  3K46 A;  4P00 B;  3A7Q A;  2VL4 A;  1US2 A;  3LPG A;  4CU8 A;  3UGH A;  3SKV A;  4P08 A;  3IAP A;  3NNG A;  3P2N A;  3DEC A;  3D5Z A;  1WL7 A;  4UDK A;  5FK7 A;  4QDS A;  1NX9 A;  3T2O A;  4FFH A;  3ZXJ A;  1OYG A;  1J83 A;  3C7G A;  5HXM A;  1UXZ A;  4W8J A;  5C71 A;  3PUI A;  4DXR A;  3QEF A;  4O8N A;  2QQJ A;  3A23 A;  3WNM A;  4M4P A;  5A1A A;  3TAW A;  1PX3 A;  3LEG A;  5G04 L;  4FFF A;  5IJR A;  1W8N A;  2OXB A;  3KF5 A;  3U14 A;  1GNY A;  4UDK E;  4KI5 M;  3J7H A;  4AK5 A;  2VM9 A;  1KEX A;  2Y6K A;  4CVU A;  1DLC A;  3LDR A;  2J1A A;  4ZY9 A;  5LA1 A;  5I0D A;  2C9K A;  5GLK A;  2ID4 A;  1W9S A;  2QBX A;  4MLG A;  5DMY A;  5C70 A;  4UDJ A;  3WF0 A;  3HN3 A;  3NRU A;  1YQ2 A;  4MOA A;  2B4K A;  4DEQ A;  3VD5 A;  3LEI A;  2XQX A;  3CZJ A;  4PT6 A;  4UOJ A;  1UY3 A;  2JKX A;  2WO1 A;  1L7R A;  2CDO A;  3MV0 1;  3HNY M;  3SKJ E;  1EUT A;  3CU9 A;  5JXJ A;  3I2K A;  1W9W A;  2YC4 A;  5GLQ A;  4ONZ A;  2KD7 A;  3GGL A;  2AEY A;  4BDV B;  3CZU A;  1JYN A;  4N1I A;  1CIY A;  2J7M A;  2QQK A;  3I3B A;  1BHG A;  5IFT A;  1YRZ A;  1ULP A;  3PIJ A;  1JYX A;  2DCJ A;  5C0P A;  3UNP A;  2V5D A;  4W4Z A;  5JOX A;  1SHW B;  2QQM A;  2ADD A;  3ZM8 A;  2ZXQ A;  5B4N A;  2EXJ A;  5AY9 A;  3LF7 A;  4XVH A;  3IDA A;  2W5F A;  3GM8 A;  4QX3 A;  4MGQ A;  3R4Y A;  4UDI A;  3WPY A;  2J1U A;  2WO2 A;  2X8T A;  3CIH A;  2VCC A;  2VZV A;  1VKD A;  4QB1 A;  5JXI A;  1T2X A;  4U6B A;  3K1U A;  3WPZ A;  4D47 A;  4FFI A;  3OM4 A;  3VD7 A;  4Z2A A;  3D5Y A;  3CQO A;  4GWI A;  2W9X A;  3QC2 A;  4QDQ A;  3WF2 A;  3IAQ A;  2B4W A;  2W95 A;  1P8J A;  5EIY B;  2VMC A;  4KCB A;  2YFZ A;  2VCA A;  3ETP A;  3K4Z A;  2W1S A;  2JDA A;  3OEB A;  4XUN A;  5A7V A;  4PQQ A;  2WN3 A;  4OMD A;  3WAU A;  5F7U A;  4A41 A;  2AC1 A;  3VDA A;  3CKH A;  3A22 A;  2J1V A;  5FKC A;  3PUH A;  4UDG A;  5FK8 A;  2DCK A;  2DDU A;  4XUT A;  5GLO A;  2VTF A;  3E1F 1;  1JYW A;  1RYY A;  2J1S A;  1PMJ X;  4D0Q A;  5JOZ A;  3I2H A;  5LA2 A;  3OM2 A;  3OB8 A;  4XUO A;  1YIF A;  2EID A;  1GUI A;  2EIB A;  3EYP A;  2YFR A;  4QX2 A;  4XUQ A;  3MUZ 1;  3MUY 1;  3VDC A;  2YFU A;  2ORX A;  5FMC A;  1GYE B;  4NOV A;  3ZXK A;  3VT2 A;  2VMF A;  5C7G A;  2EIE A;  1XPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...