3C7HA

Crystal structure of glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with axos-4-0.5.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
487
structure length
487
Chain Sequence
ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 134
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7hA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7hA02
1O8PA 4DUXA 3AKIA 1GUIA 4P00B 3MUY1 2EXIA 3OM7A 4XZUG 1ULPA 2RV9A 5GLKA 5GLLA 5AYCA 2W1WA 3IIIA 3VSZA 2EXKA 3FL7A 4MO3M 1Y9GA 3OM4A 3AKHA 3KF5A 3EYPA 1TVGA 1EUTA 5AYEA 1OYGA 4E8CA 4UDJA 2CDOA 5A8DA 4FFFA 4JKLA 2VMFA 4ARXA 3IAPA 4QAWA 3OM2A 4O8OA 2VC9A 1K3IA 4BXSV 4D47A 3LDRA 4CUCA 4UDIA 1YIFA 3WAUA 1JZ2A 5FK7A 5AY9A 1UY2A 4BDVB 3C7EA 5JXJA 4L0PA 4DUWA 3LQCA 3K4DA 1JZ3A 4N2RA 2WN3A 5IJRA 3VDCA 2JKXA 3CKHA 5JOXA 3I2FA 2AEZA 3WPZA 1JYXA 1NAEA 2YG0A 1UYZA 1YRZA 2E26A 2AC1A 4DXSA 1JU3A 1RYYA 1Y9MA 3JXSA 4NOVA 2X8FA 3VD5A 2HYXA 2Y6KA 3K77A 1DYOA 3LF7A 4MGQA 2QQMA 3VD9A 4A42A 1R64A 1SHWB 1UXXX 5JUVA 4UDGA 3WQBA 3K75B 3DYOA 4D0QA 2L9LA 3ETPA 2V4VA 5LA0A 3CZUA 3P2NA 5GLRA 3VSFA 4EQVA 3P6BA 2W1UA 4QB2A 2J22A 2W94A 3OGRA 3ZXKA 4AK7A 3OGSA 4UDKE 3C7GA 5HXMA 1JI6A 3CMGA 1JYNA 1GU3A 3WN2A 2ZEXA 3VT2A 3WPYA 2RJ2A 3LIGA 1J84A 2VZSA 4GWJA 2VZ3A 3A7QA 5FKBA 3WNKA 1MPXA 5A7VA 3OEAA 2J1UA 1UY3A 3HNMA 5JR2A 1W8NA 5DPNA 3UGHA 4JX0A 2X8SA 1GQPA 2W1QA 1L7RA 3T08A 2AEYA 1K45A 4M4RA 4KI5M 1JZ7A 2QQLA 1UYXA 3LFIA 1I5PA 3WF3A 3I3BA 4MLGA 5GLOA 3UNPA 1L7QA 4AAXA 1WL7A 4QDSA 4IUGA 2W92A 1W9SA 2B4KA 3THDA 4QX0A 1W8OA 3T2QA 2QQOA 2VTFA 4DEQA 4QDQA 3U14A 2RVAA 3PUIA 3WN0A 2HLEA 2QQNA 2ZEZA 3NQHA 2C26A 3LDKA 2EIBA 4CU7A 2ORZA 2J7MA 4DEVA 3LEGA 4QB1A 5DQ0A 3K46A 4ARYA 3HEIA 3I2GA 2J1SA 3MV01 5GLNA 5HPOA 4OZOA 3CIHA 4O8NA 3D5ZA 1JYVA 2Y6LA 4KCAA 3CZJA 2B4WA 2E31A 1UV4A 3OM5A 4A45A 3VD4A 2VZRA 3P1IA 1H6YA 3OB8A 3ZXJA 1F4AA 4ONZA 5FKCA 1PT2A 3SEEA 4MOAA 1YQ2A 2R7EB 4CVUA 2VM9A 2VO5A 2WAOA 2XOMA 4FFHA 4M4PA 1NUKA 2YC2A 5EJ1B 3CU9A 3LPGA 2WYSA 3BGAA 1XNTA 1UY0A 1OT5A 2QQVA 2W87A 1PX4A 4TTGA 3IB3A 4KMQA 2W46A 2DCKA 1K42A 5FUIA 2DDUA 2WO3A 1Y4WA 1CZTA 3LIHA 2W5FA 4XUPA 3GM8A 3I2KA 1W9WA 3WN1A 4YPJA 1UYYA 2VQUA 2ZEWA 2BZDA 1VKDA 5IFTA 3ACIA 3LEMA 4GZ9A 4XURA 4BK4A 4COTA 5A7VB 1PMJX 1LNSA 5B4XA 3MUZ1 3I2JA 4D8MA 4JKKA 3R4ZA 2J1AA 3U37A 4FI9A 1EUUA 5CZKA 1UYPA 1P8JA 3C2UA 4GWIA 3I2IA 2W95A 3HOBA 3WNLA 1US2A 5F7UA 1UY1A 2V72A 3LV4A 1JHJA 2ID4A 5IYYA 3WNMA 5JOZA 4QB6A 5LA2A 4UAPA 3NRUA 2WUHA 3T0AA 1TG7A 1PMHX 1GMMA 2OKXA 2VZVA 2BERA 5IFPA 4QX3A 2ZXQA 3DYPA 2QQKA 4P08A 3A23A 4KC7A 3AKGA 5LCWL 3QEDA 4XUOA 1W0NA 3U75A 5GLMA 1T2XA 3CDZB 4DXRA 2B9VA 3SKJE 1J83A 2WO2A 5B6SA 4U6DA 2VOTA 3R67A 1BHGA 4QX2A 3A22A 1ULOA 3C7FA 3OEBA 4QX1A 3WF0A 3BYKA 4A6OA 3DYMA 2WDBA 3OBAA 3VDAA 4RN5A 3T2PA 4BK5A 5FMBA 1GOFA 2VMDA 2X09A 5JMOA 2BBAA 3HNYM 3T2OA 3VD3A 5B4NA 3UGGA 2VL4A 1GOGA 4QDRA 4CUAA 2EXHA 2V5DA 3K4ZA 5C71A 5EJZB 3RWKX 2XONA 2YFRA 1F4HA 4ZXEA 3AKFA 4XUQA 3QEFA 2XQRA 4A3ZA 5FIXA 5I0DA 3QC2A 2VZUA 2KD7A 4PT6A 4CU6A 3LEIA 3OG2A 4W4ZA 3C8XA 1NKGA 3D60A 2C9KA 4UDKA 5C7GA 3K1UA 3WEZA 3D3AA 1H6XA 1GYDB 3VSSA 3NJVA 1GYHA 2EICA 4PF1A 2C4XA 4KMIA 2EXJA 4KWUA 1UXZA 3KF3A 3I2HA 3J7HA 4N4BA 4CUBA 4XUTA 2QQWA 1UX7A 3IAQA 4JKMA 4XVHA 1OD3A 4W50A 3SC7X 4AG4A 4XUNA 2WZEA 3VD7A 4PVAA 2QBXA 1D7PM 2JE8A 5FMDA 1UZ0A 3WNPA 1YI7A 4DXTA 3KSTA 2VZOA 5JXHA 1UMHA 1CZVA 2VCBA 3WPVA 3NJXA 4OYUA 5EIYB 3OM6A 1OH4A 2VR4A 2VZQA 1CIYA 3MBWA 4A4AA 1W2TA 1KEXA 4Z2AA 1W9TA 5C0PA 2W47A 3NNGA 3DECA 1IQDC 5DN2A 1CX1A 5ANNA 3PUHA 5CYYA 1ST8A 4QPWA 4KCBA 2WABA 3HN3A 4RYDA 3R4YA 5GLPA 1US3A 4LHSA 5G04L 3UETA 4ZZ5A 3LE0A 3T0DA 4PQQA 3GXUA 1JZ5A 5G05L 3T09A 3FHAA 4E8DA 1GYEB 1K12A 3D5YA 2W3JA 2WZ8A 2VJXA 3K4AA 4ZZ8A 2YFTA 3QEEA 1DP0A 2VZPA 5GLQA 1WKYA 4P02B 4U6BA 1UY4A 2J1RA 3WMYA 1OF4A 5JOWA 3HPNA 1SG3A 4ZY9A 3PIJA 3WPUA 3C7OA 3VSRA 4OMCA 4W8JA 3ACGA 2XHNA 2Y6GA 2VZTA 2Z4FA 4P5YA 3LEKA 3ECQA 2X05A 1NX9A 5LA1A 2VMEA 3WASA 3BYJA 3WNNA 1JZ8A 3W5NA 1XNAA 2VQTA 2YFUA 4MGSA 2Y64A 2WAAA 4UI9L 1UWWA 2VDTA 2ORXA 3WMZA 2W91A 2W1SA 3BN6A 3CQOA 2VCAA 4OUEA 4O8PA 4HG6B 2JDAA 1HN1A 4MADA 2WN2A 4AK5A 5JOYA 3FHQA 2E33A 4BJ0A 2QQJA 2WBKA 4TXWA 1UMIA 1XC6A 3GDBA 4A44A 1O8SA 5AYDA 2QQUA 2W9XA 5A8CA 3W5MA 1W18A 3SKVA 3HNBM 1PX3A 1JU4A 2ZEYA 3C7HA 4DUVA 1DLCA 4QQSA 3WF2A 2J1EA 2Y8KA 3MO4A 3OGVA 3THCA 4CU8A 4UOJA 4N1IA 3EB7A 1JZ4A 5FLWA 1CZSA 3WF4A 5DMYA 3VT0A 2EIDA 3FN9A 1GOHA 1SDDB 2CDPA 2OXBA 3WSOA 1JYWA 3ACHA 5FK8A 4N2ZA 1JZ6A 2WQ8A 3BYLA 3D61A 2BGOA 3ZXLA 4FFGA 5J1XA 2Y6HA 2EIEA 1XPWA 2QQIA 4LQRA 4FFIA 4A41A 3VDBA 2DCJA 1GNYA 3WF1A 3AC0A 2WO1A 4ET7A 1WCQA 3PIGA 4PVIA 3I3DA 3LPFA 3MV11 1OF3A 3I3EA 4JHZA 4OMDA 3UESA 3ACFA 4LKSA 3ZM8A 4LPLA 2ADDA 2VCCA 2LS6A 3E1F1 2VZ1A 3QZ4A 2Y6JA 5IHRA 1KGYA 2YB7A 2XQXA 1Y7BA 2E32A 2YC4A 3GGLA 5A1AA 2JD9A 2YFSA 3UGFA 3T0BA 5C70A 1W99A 3A21A 3ABZA 2ADEA 2J1TA 3F2ZA 2J1VA 3WATA 3TAWA 2PQSA 4CU9A 4KC8A 1O59A 5FMCA 5B6TA 5JXGA 3SEPA 2LW8A 3WNOA 2VMCA 2BGPA 3HJRA 2YFZA 3VT1A 2X10A 2X8TA 3BYNA 5JXIA 3I97A 4AK6A 3IDAA
chains in the Genus database with same CATH superfamily
2HWD1 1O8PA 5GLZA 2ZCWA 4PLOA 3I54A 4ZU5A 1PK6A 2EXIA 1SLIA 2OQ6A 2PLV1 3GZTB 4GWMA 5LY1A 3NO8A 3OM7A 1PM7A 1ND2A 1LOEA 1SLAA 1VJ2A 2D98A 3V64A 2AZ5A 3WG1A 5AYCA 2OZJA 3JUUA 3Q8EA 3N9NA 3LSEA 3OM4A 2JDYA 1AXYA 3AKHA 1H8VA 2GH2A 3PUSA 4QM8A 2ZGNA 4IEVA 1MEC1 5F2SA 1VBE3 4YARA 5AYEA 1NZIA 4MVTA 1DQ1A 5A8DA 4RD7A 4YSFA 4WVMA 2QVSB 3JQXA 3ZFEA 1LHWA 1HV1A 2JD4A 3OBZA 3ZFGB 3ZSLA 5K0UC 3BOPA 5F32A 3VBSB 4JHTA 5BNQA 1S2EA 3LDRA 1HXS1 1ZZ9A 2ZMNA 4MXVA 3H1WA 5DAWA 5FLJA 5T5LA 1NCQA 4R9BA 2PAEA 3UV9A 4BISA 1TL2A 3TNPB 1RUOA 5LATA 4IE6A 5A1LA 5AY9A 1UY2A 1ZRIA 2UYBA 4Q0UA 1RUH1 4MGTA 4BDVB 1N3QA 1RMU1 4DUWA 3LQCA 2TBVA 4HSJA 1ND3B 2D6OX 4KQ7A 2CY6A 4V2WA 3H0OA 4BQ5A 4D6SA 4N2RA 1VPHA 1OBNA 4QGNA 1QU0A 2RDRA 5I93A 3POIA 3WPZA 1WCUA 2WS93 1NAEA 2VUDA 3ON7A 4RR3A 2HWB2 1AZDA 1LAJA 3VKNA 1SPPB 1JU3A 1JH5A 1TZOA 1Y9MA 3JZVA 5FZ9A 4CCLA 3JXSA 1COV2 2ARCA 2FQPA 4E2GA 5BNNC 5FYBA 2FDFA 3MHZA 1JHNA 3NV4A 5BNNB 1PO11 2RS33 4G4FA 4Y4RA 4ZU4A 2DBIA 3U0ZA 2HYXA 3MF9A 1MEC2 2RR13 4AFAA 3LF7A 3DUIA 1VBC3 1WZXA 2ZHKA 2QQMA 4IV1A 4CP9A 5L7OB 4OHYA 1UXXX 2VW1A 1I5ZA 3NV3A 4LE3A 4KBZA 4KG8A 2L9LA 2V4VA 4FOVA 2WQ4A 4Q0QA 4NN0A 1HQNA 3VSFA 4GQ7A 3M3EA 2GNMA 3OGGA 2O8QA 3OGRA 2WNVC 5GLWA 3OGSA 5FZ4A 3AJYA 4K8RB 2PHDA 2FDIA 5IVFA 4CCDA 2IXIA 2X5IB 1GU3A 1ULDA 4FPGA 2HEVF 3WN2A 2ZEXA 3PURA 5JZGC 2X5IA 5T5OA 5A1FA 2RJ2A 3H8OA 4JZRA 2FMDA 3JBG2 4XF4A 3SCGA 3FFZA 1T6GC 1MPXA 4AAPA 2BFUL 2HWF2 5JR2A 4XABA 1OA2A 5EYYA 4S2HA 3ILRA 3GJAA 4S2FA 3IMNA 4CEYB 2JECA 2WSUA 3B5LB 3S7IA 3VB9A 4AHWA 1GQPA 2SBAA 1L7RA 2GDFA 1N3OA 1S0JA 2IXLA 1X33A 1HRV1 4CDXC 5A3PA 1JZ7A 2QQLA 4UW4A 3LFIA 4EN7B 2ZX3A 3VBHB 3Q8FA 4HK9A 1DU3D 2E9QA 1IPKA 4F83A 1RHI1 1PIV1 2W92A 3JBG1 4NWVA 4XFIA 4QDQA 2B42B 1QKQA 2X53S 3KWVA 4XC9A 1K5MC 1VBA1 3IT8A 4I09A 4RR3B 2IXCA 4YVWA 2Q8CA 3U14A 4PIXA 3H8UA 3PUIA 4AL9A 5KXBA 3WN0A 2ZEZA 2BRTA 4QQ2A 4QKDA 5FJHA 1N1YA 1DQ2A 1HDKA 2EIBA 2JG9B 2D6KA 4HL0A 5F2WA 4OZXA 1SCSA 2WIIB 1NY71 2KR2A 1RUD1 5EXOA 5H9RA 1ZM1A 3KM5A 1E5RA 3LEGA 5DQ0A 4DIQA 3K51A 2UWBA 4ARYA 2LUWA 3HEIA 4LTAA 2IFRA 4XQWA 1AR61 4Y5Z0 1PO22 2DUQA 2VCMA 4BZ4A 3DEMA 1TMF1 1MS1A 3AYAA 1SLLA 1VAKA 3CIHA 3FFQA 3PVOA 4XFCA 4EN6B 1UD1A 3DPRB 4UWDA 3WD5A 1PMIA 2BDRA 4HKOA 3BVCA 3H7JA 3W21A 3ZFEB 1H6YA 4CDQB 5HCAA 3CF6E 3ZXJA 3PTYA 1F4AA 1VRBA 2YBSA 3VHRA 1JTZX 2WQZC 4IL7A 4RS5C 3RI9A 5KXDA 2VM9A 2WAOA 2XOMA 2CTVA 1YYNA 2ZMKA 5DG2A 5IW0A 2C9AA 3RI8A 5AC92 1LOBA 3KT4A 2P1BA 1MZEA 2WYSA 1WMXA 3AFGA 1NXMA 1LGNA 5C5TA 5C6CA 3RS6A 1UY0A 1V6KA 5FFOC 1XXNA 1CESA 4HK8A 1Y3TA 1PX4A 3WHTA 1AL23 1G9DA 4K1ZA 2DCKA 1K5MB 4XFFA 1UPIA 2QZ2A 2XG3A 4CXXA 2WA4A 2ERFA 3N35A 1RJ7A 2HWD2 2VBDA 5EQUA 3I2KA 4N90A 5DDJ3 1CD3G 2VQUA 5DAXA 3AXDA 1G9FA 1WBFA 5C5UA 4I3PA 4PDWC 4XXPA 1MZFA 3NKGA 5FZMA 3T1MA 4IEWA 2R041 1VRH1 1RUF1 4CP0A 5CG9A 2PXJA 1UL9A 1DQ6A 4AFMA 4MGZE 2VULA 3T1LA 5BNOA 3BI3A 3GALA 2BOIA 4QHBA 4JRLA 1PMJX 4COVA 1LNSA 2WNVA 3S7EA 4JGYB 2VMHA 3LB9A 4KWKA 5J36A 3QH7A 3I4IA 4I0BA 2J1AA 3U37A 1QJY1 1EUUA 2Z5WA 5CZKA 5F6KA 1HRI3 1PGL1 2VAUA 3U78A 3C2UA 2OIIA 4Y22A 3WP6A 2W95A 3I2IA 5E88A 3WNLA 5LRRA 3B01A 1UY1A 2V72A 2VTXA 1H8TB 1NG0A 4WM7C 1S2BA 2W08A 1GR3A 5F3CA 1IG3A 2VUJA 4AQ6A 3T0AA 2MEV3 1GMMA 1MQTA 4LITA 2BQPA 1V00A 4YW7A 2ATFA 2DF7A 2XJUA 4E27A 3LOBA 3DYPA 2HWB1 4EV0A 4QPGB 3AKGA 2DV9A 4AI3A 2PAKA 4BIFA 1LGBA 3QEDA 1H1IA 1W0NA 3SH3A 5BYNA 1T2XA 4FPOB 4NRMA 3L9JT 1NZCA 1B35C 1FMD1 3N3HA 2WO2A 4EN0A 1BHGA 5F3GA 3GYDA 2VQ0A 3VKFC 3C7FA 3OEBA 4QX1A 1APNA 1UZYA 2Q30A 4IQPA 4RGKA 4Q4W2 3DYMA 3ZSKA 1CAUA 1S0FA 2WDBA 1TME1 2XJPA 3GHNA 3OBAA 3IKWA 4P9LA 1RUE2 5ABJA 2QCSB 5FMBA 5FYCA 4LUMA 1RUG1 4HPKB 1N1SA 2VMDA 4BQ2A 5JMOA 2BBAA 2VXRA 3D4KA 3OUHA 4XZPA 5LY2A 1LCLA 1ULEA 1QOTA 4TSVA 5F39A 3RSJA 2VL4A 1KDKA 4DPNA 1AHSA 4QDRA 4CRQA 5GZEA 5SV5A 5F5QA 3WW1A 2EXHA 2W0XA 3HAGA 5JDBA 5C71A 4Z82A 4JVAA 5FY4A 1R082 5M0TA 5CFDB 4L97A 5I91A 3EMRA 5FBJA 3CO2A 3QEFA 2VECA 5I0DA 2UWAA 2ZX2A 2ARBA 1YI9A 2VZUA 1OHFA 4MH0E 5FZCA 4AHZA 3RZLA 4W4ZA 2A7AA 4FPEA 3C8XA 1NKGA 2XXZA 3VBRA 4D3WA 4UDKA 4EN9B 3D3AA 4GD4A 4XJAA 3J8F1 1GYHA 3VDDC 3CJIB 1D0GA 2ZTNA 3RQ0A 5FUNA 1S0CA 2RS51 2WNUA 4AYUA 2DURA 2PELA 4KWUA 5JCTA 1FOD3 1B35B 2BOJA 3FZ3A 4FQZA 1QJX3 4QQHA 3MICA 2R072 1S2KA 3K3OA 4NR1A 4S2GA 4F7ZA 1DZQA 1OFSA 3AKRA 4XVHA 3WG2A 1OD3A 2ZX0A 4W50A 3SC7X 4ZHNA 2YZ4A 4LHLA 1W8UA 2WYFA 4PVAA 5FOBB 1OVSA 5LWBA 3NAPB 1DG6A 1C57A 1HB3A 1UZ0A 2B45X 2BP6A 3AL6A 4PQ9A 5FMDA 3WNPA 5AC91 1GSLA 3PU8A 1UMHA 3L2YA 1CZVA 5GKAC 1X8EA 1DGLA 3OD0A 1GKBA 1TME2 3SCFA 4YZ2A 1MS5A 5D21A 2D7FA 4OYUA 1OLRA 2EA7A 3ZIXA 2HWE1 1HRI2 5A6ZA 1FPN2 1F31A 2JG8A 3LA2A 3MBWA 4A4AA 2DVFA 1Z7S3 4Y1YA 2HKXA 2OS2A 4XF1A 3SHRA 5A70A 2W47A 3NNGA 3DECA 1IQDC 1ODNA 3N7LA 4OUMA 4PI2A 1CX1A 5CYYA 1LOFA 4XBNA 4AGRA 1POV1 3TOJA 4JDMA 3K3NA 3EO6A 2WABA 5C9AB 5FP3A 4BE3A 3B93A 3VN4A 5I8SA 3Q9OA 2P6CA 3AM2A 2XMLA 4JGZA 4N53A 2GALA 3UETA 5FZFA 3WXPA 2VW0A 4IV3C 2HWF1 4R9AA 5KXEA 3V0AA 3PVEA 1K12A 2W3JA 5HCFA 4CDUB 2FDGA 3CHXA 4NHXA 1HRI1 1MS4A 4LO5B 4IEYA 1HRV2 4COUA 1VBE1 2IC1A 2Z79A 1OF4A 3PJQA 3EJKA 1W8WA 3HQUA 4W8JA 5E89A 3THTA 2Y6GA 1Z78A 2B9UA 1V6IA 3MPBA 4AEMA 5BNOC 3MIHA 3WNNA 3NNFA 3ME2A 4DNYA 2Y64A 4HBNA 1UWWA 2ORXA 3J9SA 2W91A 1AL0G 5C4WA 4GXLA 4JDOA 1NYWA 2ZX1A 2GC2A 4QQOA 5A3NA 5IK5A 4TZDA 2W52A 2ZGSA 5FYHA 3ZN5A 4NIIA 5DAPA 4AVBA 4WM7B 1POQA 3U11A 5BUVA 2CSGA 1JN2P 3NSTA 4XQ4A 5FPUA 1UMZA 2E33A 4KWJA 4BJ0A 3MZHA 4YW4A 1UMIA 1ENRA 3BOWA 5GLTA 1Q8SA 2YDEA 4XMAA 3SKVA 1YJKA 4GJZA 4XXAA 2Q4SA 1QJFA 4HOOA 3ZR5A 2ZEYA 1QHDA 1VR3A 5FZOB 1AXKA 2CAVA 3C7HA 4D69A 4NUBA 4X6RB 1IS6A 1DLCA 2JKBA 3B3QE 1V9U2 1LECA 4QQSA 4W65A 3PUAA 4ZXKA 3I7DA 4XOGA 3ZSJA 1BMV2 4BB3A 1DQ0A 2Y8KA 3ZYHA 5D8AB 2QDRA 3N7MA 5BNNA 5FMOL 1JZ4A 2LM3A 3BUCA 4FTSA 5FLWA 4G9SB 1CZSA 3GNEA 1UU5A 1FMD2 2RDQA 2EIDA 4A3XA 4AI9A 1D4M3 2VGDA 3BIEA 2QJVA 2CDPA 3PJYA 2RM23 2OXBA 2QQPA 2RJLA 3WSOA 5FK8A 1RUJ2 5F5AA 3HMYA 5BV6A 1JZ6A 3BYLA 5BNPA 2BGOA 2ZGUA 5J1XA 1QH6A 1Q5OA 2EIEA 1QDCA 4Z1VA 2Q5TA 1GNYA 4H3WA 2UURA 2Z42A 3JBG3 3KCXA 1WCQA 3PIGA 1PIV3 1HLCA 3O1SA 1NLRA 3MFAA 2FCUA 4YVSA 3MV11 1OF3A 2IXJA 2I07B 4OMDA 1M4WA 2NPIA 3MLKA 5FZGA 3ACFA 1MZ5A 4LKSA 3VV1A 3AXEA 1YC61 2VOKA 4LPLA 4LULA 2ADDA 3FBMA 1IPSA 1F9KA 3E1F1 3FUQA 3KCCA 3BTXA 3QLQA 4OI1A 5LBCA 1RUC2 4TLGA 1NE6A 5EZWA 1Y7BA 2LRPA 4WVMB 1BEV3 2B8MA 1G8WA 5BY5A 3UGFA 1IZ3A 3OYWB 3JU9A 2Q1FA 3A21A 4LR4A 3WP4A 1IHMA 4LKFA 1SBEA 4BQWA 2J1TA 3F2ZA 3ORJA 4YM0A 3WATA 4Z92B 4CU9A 1JMUB 2ZAAA 3USUB 1EV13 4K20A 4KC8A 1O59A 4WVVA 3KCYA 2WT2A 2XBO2 4IERA 4RR3C 4IE4A 4QXHA 3A0KA 4NPLA 2X10A 2ZGOA 3ILFA 4LBMA 2CU5A 1YQ5A 5KC5A 5J96B 2P5BA 1UIKA 4Q4X2 3AKIA 4EZ4A 2XGXA 1GUIA 3VBOB 4AZZA 4FXKB 5FY1A 1UX6A 1G9BA 1WW5A 1FT9A 3ATGA 2QTWB 2EXKA 3FL7A 4B3NA 2DCTA 2NYYA 1ND3C 1SEFA 1OUXA 3KF5A 3EYPA 3KT7A 5CFCB 5DDJ2 4AOCA 4D6QA 1EUTA 2BNMA 4EWAA 1LB2A 2VQAA 4AQTA 2CDOA 3J7MA 4YG6A 4FFFA 2Q8OA 4AK3A 1W6NA 4FPKA 1ND3A 2BUKA 3FLPA 4QAWA 3EBRA 4XCAA 4YW5A 3AP4A 4C8DA 3LA7A 3PVNA 3V0BB 5FLHA 2G1MA 2CGPA 2Y6FA 1OLMA 4CUCA 4UDIA 1K5JA 1ZBE1 3K48A 3S5AA 4Y4YA 3WAUA 4KNCA 1ALYA 4XDOA 1VBC2 5FWEA 2JG8B 1XNDA 2JDZA 3VBSA 1JZ3A 1W2NA 2WN3A 4MZUA 4R9DA 4Q4W3 5IJRA 1NY72 2JKXA 1CN1A 2PHRA 3MEPA 3BU7A 2IUWA 3R05A 4UBGA 5JOXA 2AEZA 4KG0A 1S0EA 5BXXA 4BQ1A 2YG0A 1YFXA 1W3VA 1QNYA 1RINA 2AC1A 2E26A 4FQ4A 4Q2FA 1LKNA 1RYYA 1RUH2 2JE9A 4XFBA 1WD3A 5IVYA 2PAMA 4NOVA 3ELNA 4AQSA 2NN8A 1MS3A 1YJLA 4JQTA 1YFWA 2X8FA 3VD5A 1AR92 3BCWA 5CIRA 3M3OA 3K77A 1DYOA 1WLCA 4K1YA 2PA7A 1UPSA 5J98B 2A3WA 1A6CA 1R64A 1SHWB 4Q4V1 2XJRA 3ZSMA 3ZOIA 3WQBA 3U4SA 4UDGA 2B5HA 2VUCA 5CKQA 3GJBA 3K75B 3P2NA 3OSDA 4QX5A 4NRQA 5GLRA 3TB0A 1QJX1 2K46A 2G4IA 1QEXA 1W0PA 2UYAA 2W1UA 4FPLA 5F3EA 3O1PA 2J22A 3ZXKA 5SV8A 4XACA 3RVHA 4QPIC 3WQ7A 1NOVA 5A33A 2DTWA 4IEPA 3C7GA 3UJOA 3VBUA 5KC6A 5FZDA 4DRVA 3WDVA 3WP5A 3CMGA 1LESA 1XRUA 2GNBA 2GN7A 3NL1A 2YU1A 4IEUA 5JMCA 3VT2A 3WPYA 1ENSA 3B9CA 1J84A 2V5YA 1LODA 2VZSA 2Z69A 3VHPA 1N3PA 4BM8A 4JGYA 4A2UA 5LK7B 3WNKA 1AYN1 2RS52 4LOSA 4O7XA 4LO7A 4N43C 3PTRB 2J1UA 5A6YA 1BCXA 5KHJA 5A7VA 1R093 4FPYA 4R9CA 2RS13 2B39A 4A7KA 5AFEA 1G6NA 2P17A 3UGHA 2ZJCA 3WW3A 1AR91 1ZX5A 5FY7A 5KHGA 2X8SA 5KBFA 5L9BA 4F3JA 2W1QA 1OQDA 2GZWA 3I59A 1IS5A 2AEYA 1K45A 4M4RA 3LZZA 2PHLA 1U12A 2DBNA 4HT1T 4B1LA 1W9FA 1QQP3 1UU6A 1ZRRA 1XU2A 2CYFA 1R083 5J48A 1CVNA 5GLOA 4LT5A 1W03A 2DU1A 5FREA 4J25A 5FXZA 4IUGA 4ATFA 4Q0SA 4QX0A 4Y20A 3T2QA 3ROUA 3DKWA 4OI2A 4FT8A 1W6OA 5AFBA 1E57A 3R4SA 1RUC1 2QQNA 4O9EA 2C26A 3LDKA 2FBEA 1IOAA 2XBO3 3LA3A 5A6QA 2I2SA 4NIHA 1HB2A 5FQ0B 3D8CA 2ZABA 1QMJA 4QX7A 2EAKA 3M1HA 3M3QA 4IEQA 5DZEA 5L19A 1GWKA 2R073 3I2GA 4WVZA 1FXZA 3MV01 2R043 3OD4A 4QD2A 4OZOA 4RS5B 4BWOA 3KVBA 1WLTA 1RL3A 1JYVA 3GF6A 2WJSA 2XJSA 1DGRA 2R49A 3CZJA 3NJYA 4PCRA 4LO4B 4NHYA 1HRV3 2RE9A 4AHYA 4Z8BA 2VZRA 4I01A 3P1IA 3TAYA 3DPRA 4ORFA 5FKCA 1W28A 2W39A 2K9ZA 4L11A 4Y33A 4OLLA 2R7EB 4NPMA 4CVUA 2IXHA 1AL21 3FUOA 3RZGA 1FOD2 1U5ZA 3KV5A 4FFHA 4L2NA 4M4PA 1OUSA 2TNFA 1NUKA 3GBGA 2YC2A 2NP0A 3CU9A 1AVBA 1VLNA 4E4ZA 2K0GA 5IVBA 3BGAA 1XNTA 1QJY3 4MXWB 5DZFA 5F3IA 4FBFA 2D93A 1RHI2 1LTEA 1OOPC 5DUVA 1NLQA 4J6GA 3RDIA 1QY4A 2W87A 2A6ZA 3AZYA 4K7JA 4I02A 4N8MA 2W46A 1K42A 1ACCA 1EYBA 2CGOA 1NA1A 1QNWA 1Y4WA 1ZNPA 1RUF3 2ENRA 3LIHA 3MYXA 2W5FA 4FPCA 2XH6A 3GM8A 1KS4A 3N9OA 4YPJA 1TME3 3H3UA 1UCXA 2BBVA 2ZEWA 3ZPYA 3ACIA 4H7LA 1X9TA 3LEMA 1DBNA 3USUA 2PHXA 2R071 5FDBA 1AJKA 5C8CB 2EALA 1AR63 5A32B 3JQWA 3DN7A 4HANA 5E8AA 3NNLA 2XUMA 4JQRA 3TN92 4XURA 1ZRDA 1PVC1 4COTA 4L8QA 3JCIA 3SCHA 5B4XA 3MUZ1 5C9AC 3I2JA 4D8MA 5FZLA 4QMAA 5FJKA 5J7MA 3R4ZA 3N9MA 4XMIA 2RDSA 4B7EA 1H0BA 5I0SA 2WKKA 2KXLA 3Q8CA 4UFHA 2FMYA 3DF0A 3ZFEC 2YXSA 4JC1A 3ZFFC 3WX5A 2FCTA 2G9GA 4QKFA 4JTOA 5F7UA 5K4LA 3ZN6B 3LV4A 1JHJA 4LHNA 3A0NA 3MIBA 4W6XA 5FZAA 3S57A 1LOCA 2VNRA 1JYTA 2VE1A 2WZPP 3X29B 1Q8PA 4XDQA 2I74A 2WUHA 1ZBE3 2VVDA 2W2IA 2XJTA 3O12A 5FXWA 5GLVA 4DINB 3RFRA 2BERA 1CONA 1OA3A 3DXUA 3RGBA 5LEKA 3S5QA 3TYJA 5CKMA 4XBQA 1AR83 2FD8A 4KC7A 3U4XA 5LASA 4NIAA 5LCWL 1MS0A 4OI4A 2ZGQA 2Q1MA 3AMMA 1R092 4LHKA 1NCRB 3CDZB 1XJAA 1WLWA 4DXRA 1VBB2 2ZHLA 4NOTA 1C5IA 3KHCA 2B46X 3O0XA 2CAUA 4JDNA 3AP5A 3NV2A 4F8AA 1J83A 1JYCA 1SBDA 5F37A 1BK1A 5B6SA 4AE2A 1SFYA 3R67A 1LENA 1SDWA 2OVUA 1LHUA 3A22A 1ULOA 1ULCA 1JXNA 4QX2A 4BH9A 1STMA 1PZ9A 4XPVA 4BQXA 1DGWX 5JSPA 5A8CA 2XDVA 5J09A 2A6VA 1QXJA 5JIUA 4RN5A 1PK6C 1HJGA 4BK5A 2UY9A 3ZYGA 1E5IA 4IE7A 2P3JA 1GOFA 4KWLA 5CFDC 1QJU2 2GMPA 5B4NA 1PVC2 3UJQA 4XHBA 3UGGA 1AYM2 2OYZA 2OPKA 3MF6A 1GZWA 1W6MB 2CWMA 1CAWA 4Q5OA 5A80A 5K7PA 1NCQC 3R4DB 1V6OA 3ZKUA 2V5DA 3K4ZA 2XBO1 2XONA 4ZXEA 3AKFA 3POSA 2ZGRA 1KS5A 4MX3A 1UQXA 4A6SA 1VRH2 3I2DA 4AEDA 4PT6A 3OG2A 1DHKB 3M70A 2V4AA 5JIAA 2O8OA 4R8HA 1CX4A 2A6XA 4K8FA 1IKQA 3K1UA 3WEZA 1H6XA 3ZO0B 1QJEA 3PU3A 4YG3A 2EICA 3B94A 3FE5A 4O9GA 2MEV1 1W06A 3HT2A 4PF1A 4XIKA 3ST7A 5L7OC 2Y26A 3VKLA 4CCKA 3HT1A 3KF3A 1POV3 4CEWC 2E7QA 2C6SA 5LB6A 1PGSA 3I49A 4ASKA 1HJFA 3ENRA 3O7OA 1MS9A 1NXD1 1R1A2 2QQWA 4Y1ZA 2WINB 4CDUA 5FYZA 3O1UA 4AG4A 4QU1A 4XUNA 2VD7A 1W8HA 2WZEA 3ZIWA 2QBXA 2JE8A 3UKNA 4ES9A 3OBRA 2VPVA 1YI7A 4DXTA 3KSTA 2VZOA 5GZGA 3L2HA 3BODA 4QPIA 3WQ1A 1CAVA 2KA3A 1O4TA 4PI0A 5FV3A 1NLSA 3GHMA 5ISLA 3NJXA 4YZ3A 3OM6A 1OH4A 3FC0A 5LBEA 4AF9A 2ILMA 1H8TC 2VNVA 4JGZB 2O0OA 3AVRA 2AYHA 3IM0A 4SLIA 3IMMA 5K0UB 1GP5A 2OQ7A 3PUHA 5FLIA 5I0UA 3ZFGA 1ST8A 2BWCA 4XW3A 1UAIA 3ZN6A 3KD4A 4M3CF 5IAVA 1WMFA 4MGKE 4RYDA 5FZEA 4COYA 3R4YA 5GLPA 3D5OA 2JXAA 5CFCC 1LJ7A 2ZBJA 2EIGA 3LE0A 3TWIA 3U10A 2RMU2 4CZSA 1ASJ1 3T0DA 1WW6A 2HBUA 4OFGA 3VZLA 1FV2A 4C0HA 3FHAA 5H9PA 4PLNA 4XQDA 2WT0A 1GYEB 2A5ZA 2MNGA 5CVRA 3D5YA 1AYN3 2R062 1CJPA 2E7TA 4O65A 2VZPA 5CNAA 5GLQA 3NJZA 1O91A 3R4UA 4YVWC 1AJOA 5IVCA 4LIUA 5JOWA 3HPNA 1HQWA 4RGAA 3VSRA 5JI7A 2Q8EA 2BYVE 3I59B 2FZ2A 3TEWA 3ZXFA 1QIQA 4P5YA 3O1RA 2BVVA 5FP8A 1D2SA 2QDNA 3MIFA 1W04A 4YZ4A 4MG2A 5DDJ1 1NA1B 1RJ8A 2XVGA 2JENA 4HONA 5LBFA 1PVXA 2VQTA 3OCPA 2W68A 4MGSA 2BEOA 2VBPA 4GKYA 3WVJA 2WAAA 2WO7A 3FJSA 2VDTA 4RQPC 4E4HA 4LJHA 1PO13 4B4PA 2GMMA 2VCAA 4OUEA 1GLHA 3HD8B 2P6HA 3VBRB 2JICA 2HH9A 5DAQA 3M3CA 4PLMA 1E5HA 4H7MA 4YFZA 4HZFA 3CL1A 3ZMNA 3UT0A 3UKTA 4HN1A 2XVKA 3O1OA 2QQUA 5AYDA 4DZGA 5T54A 1VBB1 2JDKA 4EE2A 2BFUS 1CPNA 4H55A 5JZGA 1O3RA 1C8M2 2YGLA 4NVPA 4YZ1A 2YV8A 5CEHA 3NV1A 1Y9QA 4GJYA 3LCPA 1ENQA 4N43A 3T4VA 3O0WA 1W90A 5ACA1 1L7LA 4IETA 4LLOA 4RQPB 4UXAA 1DZRA 1Z7S1 3VBFA 3BKZA 2GNTA 1YHFA 3MIGA 3C3VA 3MO4A 2D40A 3THCA 4CCNA 4N1IA 2IXKA 3EB7A 4YLZA 1R091 2JDNA 1QF3A 4A7ZA 4CDXA 2N7GA 1VBA2 3MLJA 1GZCA 5FY0A 4GH4A 2HWC3 4BQYA 3SNMA 5DMYA 4L99A 2XLAA 1G9CA 1WW7A 3FN9A 4XILA 1LEDA 1SDDB 1AF9A 3EXUA 4NROA 4B8EA 5A3MA 1EAH3 1W6OB 1TE1B 1PZ8A 3KT1A 4META 3BYJA 4XJWA 1H2LA 3E5UA 3VBHC 2IVIB 2O14A 4N2ZA 1QWRA 1LRHA 1E5SA 1ZA4A 3ZXLA 1DCSA 1VALA 1ZZ8A 4N9IA 1XPWA 4LQRA 1OD5A 1C1FA 2TUNA 4A41A 5HI0A 3ES4A 4CEYC 1VAMA 5EP9A 4EJRA 4ET7A 2XLFA 2XB6C 1ULFA 2DUOA 2RS53 3I3DA 1W2UA 3LPFA 1SQ4A 1XNCA 4GIQA 4AVSA 2CWSA 4N43B 5A7OA 4I0WB 3KHBA 4RFRB 1EP0A 2R0HA 3I3EA 4JHZA 5CBLA 5JI9A 5FYUA 4URTA 2FZ1A 1AX2A 2JDUA 1IKPA 3ZM8A 2ET1A 5JZGB 2E63A 5IATA 5K9YA 1KDMA 4HXCA 3ZXGA 4AEJA 2PHWA 2X5IC 4XAEA 1PNGA 2Y6JA 5AVPA 5IHRA 3N4MA 1BBT2 1LULA 2XQXA 3T3YA 4XF3A 1W6NB 2YC4A 3GGLA 4CTEA 2JD9A 2JG9A 5A1AA 2YFSA 1KITA 1XE7A 3DCQA 1BVP1 1W99A 2UWCA 5DUWA 2Y0OA 4QWNA 5CFCA 5A7WA 1ZVFA 3AMQA 3HR9A 3I2OA 2J1VA 3TAWA 4P9IA 1LHNA 4WVWA 2CGNA 5FMCA 4J1XA 5B6TA 1OC1A 5T50A 4FCAA 2YUEA 2F4LA 5JR7B 1TNRA 4HFSA 2BGPA 4IV1C 4M01A 1DYKA 3T30A 3VT1A 1XE8A 3MIDA 4INDA 1UKGA 2ZZJA 3BPSA 5JXIA 3I97A 2BV4A 2R042 4D7YA 5ABJC 4RA0A 2YBKA 3MUY1 1TNFA 1ULPA 3OYWA 1V6LA 5GLKA 3Q8BA 1UOBA 1RVF1 3MW2A 2R32A 2W1WA 3IIIA 1RUI2 5DUUA 5F5IA 4LKDA 1Y9GA 3AK0A 4MO3M 3ZYBA 1TVGA 2D6MA 3QCWA 4AR2A 2VG9A 4E8CA 3OF1A 3ZDVA 4UDJA 2HWB3 2XJQA 3AMPA 4JKLA 5FZ0A 1H2KA 3IAPA 3OM2A 5A3OA 1K3IA 1EPWA 4BXSV 4CE8A 2DTYA 2GC1A 5K0UA 1PO12 1YQ6A 2YC0A 1RMU2 3J8F3 3ZYPA 4U36A 3WZ1A 3AZZA 4YW1A 4L0PA 2WL1A 4N7UA 2G19A 3K4DA 4YM2A 3VZNA 1CAVB 3ZXAC 2XVLA 3VDCA 1WBLA 1GWLA 2B7YA 4XTPA 4ZU7A 4ISRA 1RITA 3CKHA 3VBFC 3I2FA 1XYOA 3B69A 1BEV1 3W20A 1DQ5A 2ZAHA 3H1MA 2Y38A 3URFA 2DVGA 1UYZA 4Q8LA 2BNOA 4XJZA 4Y24A 5FY9A 3LDBA 4LO6B 5JWPA 1X82A 2IFWA 2D3SA 1OLQA 1HQLA 2RM22 3VBOA 1OH3A 1UZWA 5LEJA 2LTNA 4BA6A 3WDTA 2XPJA 4A42A 3M7AA 4OQ9A 1UF2C 4IW3A 3D0SA 4FP2A 2H6CA 4ES8A 2G9ZA 2WLQA 2X29A 3BALA 1Q8VA 2JE7A 1OQEA 1VBB3 4URAA 4WM8A 2WNEA 5FMOS 2X8KA 3QH6A 1QXRA 5CKNA 4UDKE 2JG8C 4Q4V2 5HXMA 3FX3A 3QACA 3H3LA 1JYNA 2BVBA 1VBD2 2WWSA 4O61A 3KQRA 2RM21 3ZFFB 1V6MA 3ZFGC 2P2KA 3E5QA 5B2GB 4GWJA 2VZ3A 2AREA 1CAWB 3MGUA 4BLIA 4LIVA 1VB2A 4E4DX 1H2NA 3OEAA 2XWJB 1QJU3 2XKPA 2HWC2 1UY3A 2ET7A 4Q4W1 5E1RA 1PK6B 5JSRA 2ZOEB 2ZKNA 5FO8B 5C4WB 4LLFA 5C8CC 4COWA 3FHIB 1ZZCA 3T08A 4PBPA 3KMHA 1FOD1 2ARAA 4KI5M 2DCYA 1J58A 1I5PA 3WF3A 3I3BA 5F1RA 3WNXA 1ZRCA 4MLGA 4Q4X1 2BJSA 4LUKA 4CXWA 2IZWA 3UNPA 1OKOA 4Z07A 3GZEA 2JDPA 1W9SA 3THDA 4NIGA 3MIEA 3WG3A 2QQOA 1ND2C 4IV1B 4UYBA 1QOOA 3ZSEA 4DEQA 3KSCA 2JJ6A 3WINE 4CXYA 2XWBB 2RVAA 1MACA 4P14A 4BYYA 1PVC3 3SQOA 3NQHA 1NT0A 1VBD1 1VIWB 3HQRA 1GNZA 3KV9A 2RHPA 4MXWA 3ZYIB 1KXGA 4CU7A 2BPA2 2J7MA 1OSGA 3B9IA 3S30A 4B1MA 4JTNA 4DY5A 2RMU3 2VBBA 5GLNA 1UZVA 2P37A 5HPOA 1XNBA 2JIJA 5E16A 5FPBA 3D5ZA 3LKJA 3LWCA 2CHHA 4ASMB 5EV7A 4QX8A 3AL5A 5FZ6A 1EPZA 1W2OA 1FATA 1YNAA 4FVVA 2F17A 1OURA 2E31A 1WWYA 1UV4A 1ZBA3 4A45A 2PQQA 2OW4A 4YG0A 2A6YA 1HW5A 3OB8A 4GMP0 5FXVA 4MOAA 4JV4A 1RB8G 1PM4A 2GMEA 2P34A 1H4GA 3NAPA 4XCBA 2GP5A 2PLV2 1BVVA 2E51A 4XJUA 4GB31 4WM7A 5EJ1B 1DQ4A 1FMD3 3POFA 1AR62 5J37A 5T55A 3INAA 1OT5A 4FAGA 3E6CC 4D6RA 3MDPA 2KM2A 4EWDA 2LALA 4H2AA 5C3OA 4Y20B 5EPAA 2WNUB 4U2AA 1ND2B 2WO3A 5F9TA 2ZGMA 1CZTA 1ODMA 2Y0IA 4XUPA 1AR93 1JOBA 1XB9A 2GNDA 2DYCA 2JB4A 1W9WA 5FWJA 3P5BA 3TEZA 1UYYA 1PIV2 5FYMA 1QQP2 2BZDA 1GV9A 3AMHA 5BNPC 2C5DA 1RUG3 5JSOA 1VKDA 4AK7A 2ZA9A 5FY8A 3BTYA 4YGBA 4B7KA 1BMV1 5FPAA 4XETA 4GZ9A 4EROA 1QJZA 5GZFA 1RXGA 4I0AA 4L9BA 3ZR6A 4BK4A 1YQCA 2GU9A 1DZTA 3ALQA 5A7VB 1D4VB 4ASLA 1YWKA 5FYYA 4P9XA 1MVQA 1RVF2 3T4HB 4YW2A 5TSWA 4TLFA 3OY8A 2H6BA 1P8JA 2HWD3 4CDQC 4LBQB 4GWIA 2PMWB 3HOBA 5A7PA 1D4M2 1US2A 1H9WA 3V56A 4B4QA 4EZHA 3PHMA 2ID4A 1I1EA 3WNMA 5JOZA 1WD4A 2V73A 4QB6A 1A78A 4UAPA 4LOTA 5C8WA 2P3YA 1UOGA 1F2NA 4AFDA 1TG7A 4RS5A 1WW4A 1URXA 2VVEA 2IWGB 3ETQA 4IGQA 4UF0B 4YGDA 5D2AA 1VMFA 1LEMA 3U07A 3DGTA 4P08A 2ZGPA 4XAAA 4ISQA 2HJIA 2R6QA 3N9PA 3H9AA 3QBQA 5A6XA 2WT1A 3JD73 4XUOA 5C3QA 4GAZA 2CNAA 1JUIA 3U75A 5C3PA 3WDUA 3AP9A 2YPDA 3NWKA 3VGIA 3DV8A 4YFWA 5DG1A 1NQJA 1RIRA 2GSYA 5HXVA 4C1WA 4GH4B 2B9VA 1GZ9A 1W8TA 4B4RA 3RJRA 2LROA 1MVEA 4U6DA 2VOTA 1CPMA 4Q0PA 1OXCA 1COV1 4LBOA 3CJIC 4LK7A 4OI0A 3RZHA 2EAAA 3GZUC 1DIWA 4Q4Y3 1XE0A 2WFF1 4ZS3A 4BOWA 5CISA 5CU1A 1LU2A 3KV4A 4XJ8A 3VBFB 4FOQA 2A75A 5EHDA 1XU1A 3M4FA 4RHV3 3VDAA 1ZZ7A 3EQEA 3T2PA 1C8M3 3D6EA 3HVDA 2HWE2 1MQTB 3RYKA 2X09A 1EV12 3J7LA 3VZOA 5HCHA 3W59A 3IDBB 1H2MA 3HNYM 1J1LA 4XFHA 3T2OA 1LOFC 3VKMA 1YFYA 2VNOA 5BPXA 2VH9A 1GOGA 3CBNA 3VBSC 5FTTC 4R4ZA 2J42A 3WP3A 4E2QA 4D94A 2HYKA 3RZKA 1RUC3 4Q26A 1O4ZA 4JGZC 4YRDA 2GC3A 3DL3A 5IWFA 5JPNB 5EJZB 3RWKX 2RJKA 3AB0A 4HLTA 2YFRA 3NW4A 2AUYA 3VBUB 5A33B 2WNVB 3QC2A 2KD7A 4CU6A 1NQDA 1W6PB 1ZBA2 3FMGA 3D60A 1RHI3 2C9KA 5FZ3A 1Q43A 5LA9A 3SISA 3PLQA 1GYDB 3VSSA 1RUNA 1REEA 1Q8OA 4I3GA 5ACA2 2VMGA 2WRAA 2DFBA 5ABJB 4KMIA 1UXZA 4X6QB 3I2HA 3VKOA 4M0HA 4XIOA 4XF9A 4DXZA 4OQ8A 3AYDA 2C0ZA 2A3XA 1MR5A 4XUTA 3FLRA 1F8VA 3IAQA 5I0RA 2XKOA 4NHKA 3TEXA 5LBBA 4QPGC 4X8PA 4NPRA 3PNAA 1OKQA 4P9GA 3VD7A 2HEYF 2JX9A 3N36A 1GBGA 4YNIA 2D44A 2PHTA 5IK4A 5DZGA 1LR5A 1ULGA 3AKQA 4GB32 1S4CA 3WG4A 2VCBA 3USSA 1BQPA 1FNZA 1BBT3 1XSRA 3ACLA 4QQLA 3WPVA 2D6PA 1H1AA 5GJ6A 5EIYB 3KLSA 5I8TA 1KJLA 2PLV3 5FUPA 1RUG2 2QE3A 3WLUA 4E2SA 5IK8A 1W2TA 2ZZQA 1AX0A 4N7IA 4Z2AA 2FDKA 5C0PA 2QFEA 1O3TA 3N9LA 2YHJA 3S0MA 4BHPA 4MYEA 3H50A 1WCSA 3WCRA 3E5XA 2AENA 1FYUA 2Q0AA 4QPWA 4LKEA 3BYWA 4LEJA 3SLIA 2BGCA 3CLPA 1ZBE2 3MPPG 4AVAA 1AYM3 2QZ3A 3OJBA 4IEZA 4LBQA 5K8SA 1US3A 1VBC1 4AHXA 1L3JA 2BNNA 1S0IA 1XYPA 2HWC1 5G05L 2YROA 3ZPOA 2PYTA 3DKQA 2E53A 3UYJA 2A71A 2JDHA 4GKXA 4PHZA 4TWTA 1FX5A 1RTVA 2ZS6B 1PO21 2YFTA 1RMU3 4IXLA 1F35A 1FPN3 1YQ8A 3QEEA 1RUH3 1R1A1 1Z7S2 5JVVA 1IS3A 1WKYA 2V09A 2J1RA 4FP3A 4OULA 1SG3A 1IS4A 3WPUA 3C7OA 5FYVA 3RRDA 1PZ7A 4COZA 1AR72 2WNUC 1WCDJ 4NWWA 1VMHA 1RUI1 3GCWA 2VZTA 2Z4FA 3W58A 1DDLA 1TMF3 3E6DA 3LEKA 2C1FA 1NX9A 2XHKA 3QD6A 2JEMA 4FXGB 3WASA 1JZ8A 5AC93 1K5MA 2DCZA 4UI9L 3AZWA 4C0BA 3WMZA 3BN6A 2HWE3 3CQOA 3KB5A 4NAOA 1GZTA 2JDAA 2Q8DA 4JAAA 4EYUA 5J3UA 1SFPA 4JCKA 3I3MA 4MADA 4AFCA 1XNKA 3P3PA 2FHRA 3HBKA 3RPQA 3LFMA 4OHXA 2XR4A 3AFKA 2QQJA 1R1ZA 4QXCA 4UFJA 4A44A 3GDBA 1IGOA 3OBTA 1O8SA 4FPFA 3N9QA 4BMEA 1RGSA 1W18A 4QKNA 4BQ3A 3HNBM 3AJZA 3RJ2X 1QJY2 1JU4A 4CCCA 2E7AA 4LO8A 1OLME 5FO7B 2BTVC 3VLBB 3VBRC 4PIYA 4DUVA 1W6MA 4Q4V3 4TYSA 1FV3A 4R4XA 2MEV2 4AI8A 3B7MA 4YVSB 3WF2A 3M8LA 5A3TA 4DQAA 1HN0A 3LAGA 2J1EA 4WM8B 1RUF2 5I8YA 4NMIA 4HN0A 1W3XA 3POEA 4KGGA 1RUE1 3OGVA 2WLPA 1KD7A 3FBYA 3FLTA 3G7DA 1U5XA 4Y5SA 1OMIA 1QXPA 1EV11 5BNPB 2WS92 1WLDA 4FOWA 3AYEA 2VOWA 3HBZA 3WF4A 4QQPA 3VT0A 4GA9A 3O1MA 4AI1A 1NCRA 1JUHA 1RUJ1 2ZGKA 4H14A 4YVWB 1MEC3 2RR12 5EFUA 2HBTA 5A3LA 1JYWA 1AL22 3ACHA 3ZLIA 2ZACA 2WQ8A 1ZRFA 1SLCA 3H7YA 1OOPB 4BU2A 4C90A 4IE0A 5L9VA 2DVDA 4FFIA 2NMOA 4ZPIA 3E6BA 2Z2SB 3WF1A 3AC0A 2WO1A 1EAH1 4YVSC 3RYRA 4IDZA 3H42B 4X8NA 4BCUA 2GC0A 5C9AA 5H9SA 4CEYA 5KXCA 2CL2A 3PMSA 3WDXA 3AKSA 3JB4C 1N1VA 1HB1A 2VCCA 4CDWB 3CNAA 3LD8A 1U5YA 1RUD3 2AACA 4KL1A 5FPZA 2EVXA 4BMBA 1KGYA 1YLLA 2YB7A 2WS91 3WDYA 5ACA3 5FO9B 4KU8A 5EWSA 1X50A 3IDCB 3ZFFA 5C70A 1POV0 2TEPA 3TN91 4LNVA 2VNGA 3WUDA 2PQSA 1YO8A 1X36A 1VMJA 4XEZA 2AH2A 1W6QA 5F5CA 1Q3EA 3NKTA 4OHVA 2FDHA 3OOXA 2LW8A 4ZONA 1V9U3 4CCJA 1HXS3 2VMCA 3WNOA 3HIFA 2D3PA 4KGQA 2YFZA 5FZIA 2E6VA 3CJXA 2X8TA 1GYKA 4Y1VA 3BYNA 4AK6A 1BJQA 3IDAA 1DLLA 1W2AX 1YUDA 4DUXA 4P00B 1YEWA 1PHMA 4XZUG 5ERLA 2VVFA 4AGVA 5T52A 1UN1A 2RV9A 5GLLA 3IPVB 5EYXA 3VSZA 3POGA 4CPBA 1SFNA 3B02A 3POWA 4HSLA 1W9YA 5CFDA 5A3UA 1OYGA 1W05A 1AUYA 1I3HA 2OX0A 4KH9A 1JBCA 3ZN4A 3VUOA 1XOYA 4L92A 5FP4A 2VOVA 2VMFA 4M0NA 4AEKA 5L73A 1ENXA 3WR0A 4ARXA 2ETEA 2H0VA 1GANA 3O1TA 3W9AA 2VC9A 4O8OA 4OHWA 5FYIA 1LHVA 2A6WA 4D47A 3AX4A 2JB8A 1ASJ3 1W8ZA 1YIFA 3OPTA 3VL9A 5HV4A 3SH4A 1JZ2A 2OZ6A 4NJ4A 5FK7A 3RZZA 3OTFA 2XJVA 3C7EA 5DABA 5JXJA 1MQTC 1BKZA 3O5SA 4Q4Y2 4S2DA 1CAUB 3T2TA 4XFAA 1FNYA 3G6JB 1DFQA 1QJX2 2OA2A 3WW4A 3NAPC 3HQXA 2VTXJ 5APAA 3THPA 5HCBA 1JYXA 3RMYA 2R30A 2H0BA 1YRZA 4FAHA 5FQ0A 3KGLA 4DXSA 4E4SA 4SBVA 4HETA 4ITCA 4I30A 1SACA 4JRAA 4XBLA 4AXOA 4M3CA 2P3KA 3ES1A 1NCRC 4Q1RA 2Y6KA 2VOXA 1YCIA 3IBMA 2AR6A 3MW4A 1RVF3 4MGQA 4MGYE 4WZCA 5AVAA 5JUVA 3TEYA 3VD9A 3KQ4B 2GAUA 5C2MA 2XUEA 3EHKA 1QDOA 4AGGA 1CIWA 3PL0A 3DYOA 2PHFA 3ETPA 1YFUA 4D0QA 5LA0A 3CZUA 4PDWA 3WDWA 2VUAA 4UT5A 4XFGA 3RG0A 2WA3A 3BPZA 4EQVA 3P6BA 4QB2A 1Z0HA 4K40A 4Q4X3 1O4YA 1W6PA 1UOJA 2W94A 1C1LA 1KFUL 2D5FA 2VMIA 1CAXA 3VBUC 1W39A 4XTMA 1A8DA 4CA9A 5CAZA 3TNQA 1H8TA 4ONUA 1JI6A 4QHZA 4W6WA 3PMEA 4EN8B 1COV3 1KRIA 1LHOA 1RUI3 2MPFA 5FYSA 1DF0A 1S0BA 1VE0A 5IAXA 2RS32 4K21A 3LIGA 5HV0A 4YW3A 3A7QA 4NHMA 2R16A 3MI8A 5FKBA 4DMIA 1D2QA 1W0OA 4J1WA 3HNMA 1ZYBA 4CP1A 2SLIA 1W8NA 2GN3A 5DPNA 2DFCA 5C3SA 3HN1A 4JX0A 2WZR2 2GH8A 1SBFA 4IEOA 4Y5TA 5KHKA 4FSJA 4N53C 1UYXA 1J59A 1F15A 1AYM1 3E97A 5LW9A 1V6JA 3J7NA 2D3RA 4CSWA 5KWRA 1WL7A 1L7QA 2YPJA 4AAXA 4QDSA 4Z2WA 1JODA 1HKDA 1QOSA 2B4KA 4RFT0 1AXZA 1W8OA 2RMU1 2VTFA 4K6BA 4D7TA 3D0JA 1H4HA 3PDQA 2PHUA 4IESA 2D5HA 2HLEA 1J3RA 3A4UA 4YWAA 4QKBA 1GQHA 1J3QA 1MZ6A 1RUJ3 1REFA 3MW3A 4W6YA 2ORZA 3POJA 5GM0A 1QH7A 4FTBA 4Y1XA 4DEVA 4QB1A 3K46A 1GQGA 3KV6A 4UF0A 2J1SA 5T3NA 3JD71 2WFF2 1HB4A 4CDWA 4NRPA 3TBDA 4MUVA 4LBJA 5IVJA 4O8NA 1ZA7A 3BTAA 2Y6LA 4KCAA 2AGSA 4CDQA 1KFXL 3V0BA 2B4WA 3OM5A 3VD4A 1I9RA 1AR81 3O0VA 5FP9A 1S55A 1O3QA 3N7KA 4QHOA 4ONZA 4MSVA 1AR73 1GFF2 3FWEA 4YYOA 3SEEA 1AR82 1PT2A 3DPRC 3TRSB 4I2OA 4NIDA 1YXWA 1YQ2A 2RR11 3M2MA 2NM1A 3OY8B 4JGYC 4MV2A 1PNFA 2VO5A 3IDEA 3POYA 3SH5A 1VBA3 4BQ4A 4GALA 3AP7A 4M3CE 1O5LA 3LPGA 2ARXA 4YGEA 5A7SA 3Q8AA 1R081 1XBFA 3B00A 5EJ3A 3TN93 1QQP1 2D97A 1I6XA 2QQVA 5GZDA 1F5JA 2YGMA 4TTGA 3IB3A 2I45A 4GWNA 4KMQA 2A70A 2RS12 4Q29A 1ZZ6A 3KS7A 5FUIA 4FTEA 3AZXA 1V70A 2DDUA 5IVVA 4NAMA 1UW8A 2RS11 4MHRA 1C8M1 1PGW2 3PUQA 3WN1A 5FP7A 5C33A 1G9AA 1DGWA 4QT6A 5C3RA 2OPWA 3ZMOA 5HBAA 5IFTA 3KVAA 5IT6A 4CDUC 3KGZA 1TQ5A 3ITQA 5CA6A 5FZKA 5FZOA 4LXLA 4AWDA 5C4WC 2D6NA 5CB7A 1OI6A 2FDJA 4KU7A 1A8MA 1CWPA 1RXFA 1W6QB 1VB4A 4R52A 4LBKA 1GICA 1OFNA 3CEWA 3KZ4C 3ZX7A 1Q8QA 4OUSA 4JKKA 4E9KA 3BU0A 1VBD3 4FI9A 4OHZA 2RDNA 2YMZA 3H8XA 1UYPA 3SXWA 2ZX4A 1VRH3 2D43A 1G7YA 5L9RA 2WWJA 3GZAA 5FCCA 3WOGA 4CCEA 1C4RA 2ZPXA 4N9HA 3WY6A 1UIJA 3D82A 4P9JA 3H1YA 5FXXA 2XL9A 4LMFA 5IYYA 5FRAA 4M00A 4DFSA 1GWMA 3MFCA 5LA2A 3UL2A 5IK7A 5A3WA 4B29A 3NRUA 3SITA 4NO4A 1NE4A 2EF6A 1PMHX 5KHHA 2WC2A 2OKXA 2VZVA 4G3YC 3DXTA 5IFPA 1H30A 2ZHMA 3WV6A 2GP3A 4QX3A 4RHV2 2ZXQA 4IV3A 2UY8A 2JG9C 2QQKA 4Y1UA 3A23A 1V6NA 1NA1C 5L7OA 1JS9A 4YGCA 5LZ6A 5GLMA 4IE5A 2PFWA 1HX6A 4D7SA 1OOPA 4PJYA 3WHUA 4AI2A 1OA4A 3MLLA 5DXDA 3SKJE 2YY1A 3WCSA 2NLRA 2XL7A 4DY3A 1ZREA 5T5PA 1RUD2 3J4UH 3GBFA 5D8AA 2QNKA 4XDPA 3WF0A 4N53B 5FBZA 1C28A 4CYDA 3BYKA 3R0RA 4YW6A 4A6OA 4IV3B 1WA6X 2Y34A 4Q0VA 1CR7A 4LA3A 4NHLA 4ZS2A 1PGL2 3BIWE 3OUJA 4QXKA 2R1BA 1S0GA 4AI0A 4HKWA 3VD3A 1GP6A 4Q4Y1 3RMXA 2RS31 3OGJA 4OCTA 4RSUA 4AEDB 1UOFA 3RNSA 4DS0A 1T6BX 2P4EA 3F95A 2ZGTA 3ZYRA 5LRSA 2NZ9A 3I8TA 3PVBB 3WT3A 4P9WA 4QGLA 1V9U1 4CUAA 1CGPA 2VW2A 4UW5A 3R6SA 4XE9A 1FPN1 1PO23 1WMEA 1R1A3 4AVVA 1F4HA 3OPZA 4FPHA 5F8PA 1SCRA 4AQ2A 5CG8A 4XUQA 1GZWB 2XQRA 5FIXA 4A3ZA 1C5HA 2PN5A 4IGOA 1VP6A 1FI2A 3LEIA 4UFMA 3GBWA 4WV8A 1UZZA 4RGGA 3ZDSA 5A32A 5C7GA 3ZYFA 3NVCA 1S1AA 5C8CA 3APBA 4Y3OA 2D6LX 1N1TA 2G9FA 3NJVA 1OPOA 3VBOC 2C4XA 4HVOA 1GNHA 1H9PA 1QGLA 1WA4A 1H1MA 2EXJA 1OPMA 2NMNA 4PIZA 1X8MA 2C24A 5DAVA 3J7HA 1IQAA 3ILNA 3ZXEA 2UU8A 4GH4C 4MHUA 4N4BA 4WZFA 4CUBA 1FAYA 2WSVA 1JOJA 4UFKA 2Y33A 4HMZA 3UK9A 3S6PA 1LOAA 1N47A 2WFF3 5CADA 1UX7A 4K9SA 4JKMA 2BU9A 1WGPA 1O5UA 1C3HA 1SPPA 3VDDB 3J8F2 4UW6A 4C1XA 1BZWA 3AKPA 2A3YA 4KBBA 3V0AB 2F6BA 1D7PM 2A1XA 4XF0A 1KQRA 5FZ1A 4XJ9A 3ZVXA 1X9PA 5JXHA 5L36A 3I3QA 3POBA 3IZOA 2K2SA 4CPBD 3RYPA 2R061 1D0HA 2VR4A 3GCXA 2VZQA 3CU7A 5GZCA 2ES3A 4FO9A 1CIYA 3U1XA 1KEXA 5FPVA 4MGIE 4DRRA 1W9TA 1NCQB 4CDWC 3HWJA 2DVAA 2OT7A 5DN2A 5ANNA 4DOUA 5FYTA 3NNJA 4HPKA 2WNOA 4AVCA 2YYOA 3AZVA 4AEDC 1X7NA 1LGCA 4KCBA 4LE4A 1Y43B 2OUHA 3HN3A 1TMF2 4LBLA 1VBE2 4DO0A 1WMDA 1BEV2 2VU9A 4OVEA 1U0AA 1D4M1 3AP6A 1OQ1A 1XSQA 4LHSA 4Q1PA 4UW3A 4YM1A 5G04L 4YM3A 4ZZ5A 1YIPA 3GXUA 4LBQD 4PQQA 1JZ5A 2QKDA 2FCVA 2IVJA 5GALA 1LOGA 3T09A 3O1VA 4E8DA 1EAH2 2ZGLA 2WZ8A 1ASJ2 2VJXA 3K4AA 4PBOA 3JD72 4ZZ8A 4XYXA 5E6HA 1F5FA 1G86A 1M06G 1GP4A 1DP0A 4CUGA 4P02B 4UFLA 4U6BA 3N7JA 3RZJA 1UY4A 4C91A 3WMYA 3PIJA 1BYHA 1WUVA 4WBBA 1UNBA 2VY0A 4LK6A 4OMCA 4QPGA 3UKVA 4CEWA 4QPYA 3ACGA 2XHNA 3M3IA 3CJIA 2HEWF 3ECQA 2X05A 4IEXA 1V0AA 4HVRA 2VMEA 4FPJA 5LK5A 5D8AC 5LA1A 1B35A 2Q1ZB 1C8NA 3LOIA 3W5NA 1XNAA 2YFUA 4QM9A 2OUJA 4WM8C 2W1SA 1J1TA 2CV6A 5FPXA 5A7WB 4HG6B 4O8PA 1AYN2 1B09A 2F4PA 2JDMA 2R063 4BIOA 1ZZBA 1SLTA 1HN1A 2WR9A 1O3SA 4A7YA 1A34A 1BLZA 1ONAA 4P9YA 2WN2A 5JOYA 3RZMA 4AK5A 3FHQA 2DWRA 3J26N 4RL7A 5I0TA 3IN9A 1MS8A 2WBKA 4TXWA 2MHFA 1XC6A 4GB33 3BTZA 1O6UA 2W9XA 1UKRA 1CAXB 4P5HA 5FZ8A 4YZ5A 4QXBA 3W5MA 1UO9A 2A73B 1Q56A 1XYNA 4CP9B 1PX3A 4IGPA 4LORA 1JOPA 1SMVA 4V2VA 5FZBA 3V65A 5GLUA 5D1IA 5A7QA 1BXHA 4HVQA 5H9QA 3VZKA 1BK0A 4CP2A 4AW7A 5T5JA 1XQNA 4GULA 1SLBA 3WQ0A 1PGW1 2WZR3 3H8RA 1S0DA 4CCOA 3NMBA 1DGRN 4PDWB 2BW8A 4CU8A 4UOJA 4M3CB 1CQ9A 2WFPA 1BBT1 3AKTA 4QGMA 2JWPA 1QJU1 1LU1A 3IIAA 3LGRA 4GMP1 1WCKA 5DUXA 4QU2A 3NNMA 2HWF3 3OUIA 5FY5A 3VZMA 4Q27A 2R1DA 1DYPA 1GOHA 5A7NA 1JW6A 3K2OA 4XHXA 4ATEA 5ANQA 3WUCA 3ZKYA 5FOJB 5KHIA 2XLGA 3OPWA 1KJRA 2P3IA 3JB8A 2YBPA 4V1PA 3AVSA 3D61A 4HKLA 4CDXB 1O7FA 1JYIA 4FFGA 2Y6HA 5FPLA 2QQIA 3ZXDA 4UBHA 2WWUA 4UFIA 3VDBA 4LA2A 2DCJA 4K3UA 2JIGA 3SMHA 3O14A 4ZKTB 4RQPA 4RHV1 5JAXA 4PVIA 1UU4A 3VHOA 1SZBA 2NQYA 1AX1A 5FZHA 4FOYA 3UESA 5KR7A 5FAXA 5JPMB 4PF5A 1IPJA 1HXS2 3H3ZA 1REDA 1A3KA 2VXJA 1IG0A 1OVPA 5IUQA 3WW2A 2ZKLA 3VHNA 2DU0A 2LS6A 2O1QA 2VZ1A 3LSDA 3QOPA 5FZ7A 5FR3A 3QZ4A 1HV0A 4AFBA 2Y60A 4AVTA 1RC6A 3VL8A 1TEIA 4BPZA 2BWAA 2E32A 2RG4A 3VZJA 3IPVA 4Y22B 4QPIB 1CJDA 3T0BA 5JLVA 3RWNA 2R0FA 3ABZA 3ZYJB 1U5IA 2DVBA 1HIXA 2ADEA 4BLJA 1RUE3 2ZMLA 4GMP3 4TN7A 4EWEA 1J3PA 4MLOA 3VDDA 3ASIA 3AYCA 5BNOB 1VAVA 3AMNA 1AR71 2QUOA 4DB5A 5JXGA 2YU2A 3P3NA 3SEPA 5IVEA 3BB6A 4Y26A 2WZR1 2DUPA 3HJRA 3VBHA 2PTMA 3IWZA 4BXFA 5F6LB 1W8FA 4CCMA 4LBNA 4NE9A 4CEWB 2ZHNA 1ZBA1 1EY2A 4ZY9A 4Q8KA
chains in the Genus database with same CATH topology
1O8PA 4DUXA 3AKIA 1GUIA 4P00B 3MUY1 2EXIA 3OM7A 4XZUG 1ULPA 2RV9A 5GLKA 5GLLA 5AYCA 2W1WA 3IIIA 3VSZA 2EXKA 3FL7A 4MO3M 1Y9GA 3OM4A 3AKHA 3KF5A 3EYPA 1TVGA 1EUTA 5AYEA 1OYGA 4E8CA 4UDJA 2CDOA 5A8DA 4FFFA 4JKLA 2VMFA 4ARXA 3IAPA 4QAWA 3OM2A 4O8OA 2VC9A 1K3IA 4BXSV 4D47A 3LDRA 4CUCA 4UDIA 1YIFA 3WAUA 1JZ2A 5FK7A 5AY9A 1UY2A 4BDVB 3C7EA 5JXJA 4L0PA 4DUWA 3LQCA 3K4DA 1JZ3A 4N2RA 2WN3A 5IJRA 3VDCA 2JKXA 3CKHA 5JOXA 3I2FA 2AEZA 3WPZA 1JYXA 1NAEA 2YG0A 1UYZA 1YRZA 2E26A 2AC1A 4DXSA 1JU3A 1RYYA 1Y9MA 3JXSA 4NOVA 2X8FA 3VD5A 2HYXA 2Y6KA 3K77A 1DYOA 3LF7A 4MGQA 2QQMA 3VD9A 4A42A 1R64A 1SHWB 1UXXX 5JUVA 4UDGA 3WQBA 3K75B 3DYOA 4D0QA 2L9LA 3ETPA 2V4VA 5LA0A 3CZUA 3P2NA 5GLRA 3VSFA 4EQVA 3P6BA 2W1UA 4QB2A 2J22A 2W94A 3OGRA 3ZXKA 4AK7A 3OGSA 4UDKE 3C7GA 5HXMA 1JI6A 3CMGA 1JYNA 1GU3A 3WN2A 2ZEXA 3VT2A 3WPYA 2RJ2A 3LIGA 1J84A 2VZSA 4GWJA 2VZ3A 3A7QA 5FKBA 3WNKA 1MPXA 5A7VA 3OEAA 2J1UA 1UY3A 3HNMA 5JR2A 1W8NA 5DPNA 3UGHA 4JX0A 2X8SA 1GQPA 2W1QA 1L7RA 3T08A 2AEYA 1K45A 4M4RA 4KI5M 1JZ7A 2QQLA 1UYXA 3LFIA 1I5PA 3WF3A 3I3BA 4MLGA 5GLOA 3UNPA 1L7QA 4AAXA 1WL7A 4QDSA 4IUGA 2W92A 1W9SA 2B4KA 3THDA 4QX0A 1W8OA 3T2QA 2QQOA 2VTFA 4DEQA 4QDQA 3U14A 2RVAA 3PUIA 3WN0A 2HLEA 2QQNA 2ZEZA 3NQHA 2C26A 3LDKA 2EIBA 4CU7A 2ORZA 2J7MA 4DEVA 3LEGA 4QB1A 5DQ0A 3K46A 4ARYA 3HEIA 3I2GA 2J1SA 3MV01 5GLNA 5HPOA 4OZOA 3CIHA 4O8NA 3D5ZA 1JYVA 2Y6LA 4KCAA 3CZJA 2B4WA 2E31A 1UV4A 3OM5A 4A45A 3VD4A 2VZRA 3P1IA 1H6YA 3OB8A 3ZXJA 1F4AA 4ONZA 5FKCA 1PT2A 3SEEA 4MOAA 1YQ2A 2R7EB 4CVUA 2VM9A 2VO5A 2WAOA 2XOMA 4FFHA 4M4PA 1NUKA 2YC2A 5EJ1B 3CU9A 3LPGA 2WYSA 3BGAA 1XNTA 1UY0A 1OT5A 2QQVA 2W87A 1PX4A 4TTGA 3IB3A 4KMQA 2W46A 2DCKA 1K42A 5FUIA 2DDUA 2WO3A 1Y4WA 1CZTA 3LIHA 2W5FA 4XUPA 3GM8A 3I2KA 1W9WA 3WN1A 4YPJA 1UYYA 2VQUA 2ZEWA 2BZDA 1VKDA 5IFTA 3ACIA 3LEMA 4GZ9A 4XURA 4BK4A 4COTA 5A7VB 1PMJX 1LNSA 5B4XA 3MUZ1 3I2JA 4D8MA 4JKKA 3R4ZA 2J1AA 3U37A 4FI9A 1EUUA 5CZKA 1UYPA 1P8JA 3C2UA 4GWIA 3I2IA 2W95A 3HOBA 3WNLA 1US2A 5F7UA 1UY1A 2V72A 3LV4A 1JHJA 2ID4A 5IYYA 3WNMA 5JOZA 4QB6A 5LA2A 4UAPA 3NRUA 2WUHA 3T0AA 1TG7A 1PMHX 1GMMA 2OKXA 2VZVA 2BERA 5IFPA 4QX3A 2ZXQA 3DYPA 2QQKA 4P08A 3A23A 4KC7A 3AKGA 5LCWL 3QEDA 4XUOA 1W0NA 3U75A 5GLMA 1T2XA 3CDZB 4DXRA 2B9VA 3SKJE 1J83A 2WO2A 5B6SA 4U6DA 2VOTA 3R67A 1BHGA 4QX2A 3A22A 1ULOA 3C7FA 3OEBA 4QX1A 3WF0A 3BYKA 4A6OA 3DYMA 2WDBA 3OBAA 3VDAA 4RN5A 3T2PA 4BK5A 5FMBA 1GOFA 2VMDA 2X09A 5JMOA 2BBAA 3HNYM 3T2OA 3VD3A 5B4NA 3UGGA 2VL4A 1GOGA 4QDRA 4CUAA 2EXHA 2V5DA 3K4ZA 5C71A 5EJZB 3RWKX 2XONA 2YFRA 1F4HA 4ZXEA 3AKFA 4XUQA 3QEFA 2XQRA 4A3ZA 5FIXA 5I0DA 3QC2A 2VZUA 2KD7A 4PT6A 4CU6A 3LEIA 3OG2A 4W4ZA 3C8XA 1NKGA 3D60A 2C9KA 4UDKA 5C7GA 3K1UA 3WEZA 3D3AA 1H6XA 1GYDB 3VSSA 3NJVA 1GYHA 2EICA 4PF1A 2C4XA 4KMIA 2EXJA 4KWUA 1UXZA 3KF3A 3I2HA 3J7HA 4N4BA 4CUBA 4XUTA 2QQWA 1UX7A 3IAQA 4JKMA 4XVHA 1OD3A 4W50A 3SC7X 4AG4A 4XUNA 2WZEA 3VD7A 4PVAA 2QBXA 1D7PM 2JE8A 5FMDA 1UZ0A 3WNPA 1YI7A 4DXTA 3KSTA 2VZOA 5JXHA 1UMHA 1CZVA 2VCBA 3WPVA 3NJXA 4OYUA 5EIYB 3OM6A 1OH4A 2VR4A 2VZQA 1CIYA 3MBWA 4A4AA 1W2TA 1KEXA 4Z2AA 1W9TA 5C0PA 2W47A 3NNGA 3DECA 1IQDC 5DN2A 1CX1A 5ANNA 3PUHA 5CYYA 1ST8A 4QPWA 4KCBA 2WABA 3HN3A 4RYDA 3R4YA 5GLPA 1US3A 4LHSA 5G04L 3UETA 4ZZ5A 3LE0A 3T0DA 4PQQA 3GXUA 1JZ5A 5G05L 3T09A 3FHAA 4E8DA 1GYEB 1K12A 3D5YA 2W3JA 2WZ8A 2VJXA 3K4AA 4ZZ8A 2YFTA 3QEEA 1DP0A 2VZPA 5GLQA 1WKYA 4P02B 4U6BA 1UY4A 2J1RA 3WMYA 1OF4A 5JOWA 3HPNA 1SG3A 4ZY9A 3PIJA 3WPUA 3C7OA 3VSRA 4OMCA 4W8JA 3ACGA 2XHNA 2Y6GA 2VZTA 2Z4FA 4P5YA 3LEKA 3ECQA 2X05A 1NX9A 5LA1A 2VMEA 3WASA 3BYJA 3WNNA 1JZ8A 3W5NA 1XNAA 2VQTA 2YFUA 4MGSA 2Y64A 2WAAA 4UI9L 1UWWA 2VDTA 2ORXA 3WMZA 2W91A 2W1SA 3BN6A 3CQOA 2VCAA 4OUEA 4O8PA 4HG6B 2JDAA 1HN1A 4MADA 2WN2A 4AK5A 5JOYA 3FHQA 2E33A 4BJ0A 2QQJA 2WBKA 4TXWA 1UMIA 1XC6A 3GDBA 4A44A 1O8SA 5AYDA 2QQUA 2W9XA 5A8CA 3W5MA 1W18A 3SKVA 3HNBM 1PX3A 1JU4A 2ZEYA 3C7HA 4DUVA 1DLCA 4QQSA 3WF2A 2J1EA 2Y8KA 3MO4A 3OGVA 3THCA 4CU8A 4UOJA 4N1IA 3EB7A 1JZ4A 5FLWA 1CZSA 3WF4A 5DMYA 3VT0A 2EIDA 3FN9A 1GOHA 1SDDB 2CDPA 2OXBA 3WSOA 1JYWA 3ACHA 5FK8A 4N2ZA 1JZ6A 2WQ8A 3BYLA 3D61A 2BGOA 3ZXLA 4FFGA 5J1XA 2Y6HA 2EIEA 1XPWA 2QQIA 4LQRA 4FFIA 4A41A 3VDBA 2DCJA 1GNYA 3WF1A 3AC0A 2WO1A 4ET7A 1WCQA 3PIGA 4PVIA 3I3DA 3LPFA 3MV11 1OF3A 3I3EA 4JHZA 4OMDA 3UESA 3ACFA 4LKSA 3ZM8A 4LPLA 2ADDA 2VCCA 2LS6A 3E1F1 2VZ1A 3QZ4A 2Y6JA 5IHRA 1KGYA 2YB7A 2XQXA 1Y7BA 2E32A 2YC4A 3GGLA 5A1AA 2JD9A 2YFSA 3UGFA 3T0BA 5C70A 1W99A 3A21A 3ABZA 2ADEA 2J1TA 3F2ZA 2J1VA 3WATA 3TAWA 2PQSA 4CU9A 4KC8A 1O59A 5FMCA 5B6TA 5JXGA 3SEPA 2LW8A 3WNOA 2VMCA 2BGPA 3HJRA 2YFZA 3VT1A 2X10A 2X8TA 3BYNA 5JXIA 3I97A 4AK6A 3IDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8P A;  4DUX A;  3AKI A;  1GUI A;  4P00 B;  3MUY 1;  2EXI A;  3OM7 A;  4XZU G;  1ULP A;  2RV9 A;  5GLK A;  5GLL A;  5AYC A;  2W1W A;  3III A;  3VSZ A;  2EXK A;  3FL7 A;  4MO3 M;  1Y9G A;  3OM4 A;  3AKH A;  3KF5 A;  3EYP A;  1TVG A;  1EUT A;  5AYE A;  1OYG A;  4E8C A;  4UDJ A;  2CDO A;  5A8D A;  4FFF A;  4JKL A;  2VMF A;  4ARX A;  3IAP A;  4QAW A;  3OM2 A;  4O8O A;  2VC9 A;  1K3I A;  4BXS V;  4D47 A;  3LDR A;  4CUC A;  4UDI A;  1YIF A;  3WAU A;  1JZ2 A;  5FK7 A;  5AY9 A;  1UY2 A;  4BDV B;  3C7E A;  5JXJ A;  4L0P A;  4DUW A;  3LQC A;  3K4D A;  1JZ3 A;  4N2R A;  2WN3 A;  5IJR A;  3VDC A;  2JKX A;  3CKH A;  5JOX A;  3I2F A;  2AEZ A;  3WPZ A;  1JYX A;  1NAE A;  2YG0 A;  1UYZ A;  1YRZ A;  2E26 A;  2AC1 A;  4DXS A;  1JU3 A;  1RYY A;  1Y9M A;  3JXS A;  4NOV A;  2X8F A;  3VD5 A;  2HYX A;  2Y6K A;  3K77 A;  1DYO A;  3LF7 A;  4MGQ A;  2QQM A;  3VD9 A;  4A42 A;  1R64 A;  1SHW B;  1UXX X;  5JUV A;  4UDG A;  3WQB A;  3K75 B;  3DYO A;  4D0Q A;  2L9L A;  3ETP A;  2V4V A;  5LA0 A;  3CZU A;  3P2N A;  5GLR A;  3VSF A;  4EQV A;  3P6B A;  2W1U A;  4QB2 A;  2J22 A;  2W94 A;  3OGR A;  3ZXK A;  4AK7 A;  3OGS A;  4UDK E;  3C7G A;  5HXM A;  1JI6 A;  3CMG A;  1JYN A;  1GU3 A;  3WN2 A;  2ZEX A;  3VT2 A;  3WPY A;  2RJ2 A;  3LIG A;  1J84 A;  2VZS A;  4GWJ A;  2VZ3 A;  3A7Q A;  5FKB A;  3WNK A;  1MPX A;  5A7V A;  3OEA A;  2J1U A;  1UY3 A;  3HNM A;  5JR2 A;  1W8N A;  5DPN A;  3UGH A;  4JX0 A;  2X8S A;  1GQP A;  2W1Q A;  1L7R A;  3T08 A;  2AEY A;  1K45 A;  4M4R A;  4KI5 M;  1JZ7 A;  2QQL A;  1UYX A;  3LFI A;  1I5P A;  3WF3 A;  3I3B A;  4MLG A;  5GLO A;  3UNP A;  1L7Q A;  4AAX A;  1WL7 A;  4QDS A;  4IUG A;  2W92 A;  1W9S A;  2B4K A;  3THD A;  4QX0 A;  1W8O A;  3T2Q A;  2QQO A;  2VTF A;  4DEQ A;  4QDQ A;  3U14 A;  2RVA A;  3PUI A;  3WN0 A;  2HLE A;  2QQN A;  2ZEZ A;  3NQH A;  2C26 A;  3LDK A;  2EIB A;  4CU7 A;  2ORZ A;  2J7M A;  4DEV A;  3LEG A;  4QB1 A;  5DQ0 A;  3K46 A;  4ARY A;  3HEI A;  3I2G A;  2J1S A;  3MV0 1;  5GLN A;  5HPO A;  4OZO A;  3CIH A;  4O8N A;  3D5Z A;  1JYV A;  2Y6L A;  4KCA A;  3CZJ A;  2B4W A;  2E31 A;  1UV4 A;  3OM5 A;  4A45 A;  3VD4 A;  2VZR A;  3P1I A;  1H6Y A;  3OB8 A;  3ZXJ A;  1F4A A;  4ONZ A;  5FKC A;  1PT2 A;  3SEE A;  4MOA A;  1YQ2 A;  2R7E B;  4CVU A;  2VM9 A;  2VO5 A;  2WAO A;  2XOM A;  4FFH A;  4M4P A;  1NUK A;  2YC2 A;  5EJ1 B;  3CU9 A;  3LPG A;  2WYS A;  3BGA A;  1XNT A;  1UY0 A;  1OT5 A;  2QQV A;  2W87 A;  1PX4 A;  4TTG A;  3IB3 A;  4KMQ A;  2W46 A;  2DCK A;  1K42 A;  5FUI A;  2DDU A;  2WO3 A;  1Y4W A;  1CZT A;  3LIH A;  2W5F A;  4XUP A;  3GM8 A;  3I2K A;  1W9W A;  3WN1 A;  4YPJ A;  1UYY A;  2VQU A;  2ZEW A;  2BZD A;  1VKD A;  5IFT A;  3ACI A;  3LEM A;  4GZ9 A;  4XUR A;  4BK4 A;  4COT A;  5A7V B;  1PMJ X;  1LNS A;  5B4X A;  3MUZ 1;  3I2J A;  4D8M A;  4JKK A;  3R4Z A;  2J1A A;  3U37 A;  4FI9 A;  1EUU A;  5CZK A;  1UYP A;  1P8J A;  3C2U A;  4GWI A;  3I2I A;  2W95 A;  3HOB A;  3WNL A;  1US2 A;  5F7U A;  1UY1 A;  2V72 A;  3LV4 A;  1JHJ A;  2ID4 A;  5IYY A;  3WNM A;  5JOZ A;  4QB6 A;  5LA2 A;  4UAP A;  3NRU A;  2WUH A;  3T0A A;  1TG7 A;  1PMH X;  1GMM A;  2OKX A;  2VZV A;  2BER A;  5IFP A;  4QX3 A;  2ZXQ A;  3DYP A;  2QQK A;  4P08 A;  3A23 A;  4KC7 A;  3AKG A;  5LCW L;  3QED A;  4XUO A;  1W0N A;  3U75 A;  5GLM A;  1T2X A;  3CDZ B;  4DXR A;  2B9V A;  3SKJ E;  1J83 A;  2WO2 A;  5B6S A;  4U6D A;  2VOT A;  3R67 A;  1BHG A;  4QX2 A;  3A22 A;  1ULO A;  3C7F A;  3OEB A;  4QX1 A;  3WF0 A;  3BYK A;  4A6O A;  3DYM A;  2WDB A;  3OBA A;  3VDA A;  4RN5 A;  3T2P A;  4BK5 A;  5FMB A;  1GOF A;  2VMD A;  2X09 A;  5JMO A;  2BBA A;  3HNY M;  3T2O A;  3VD3 A;  5B4N A;  3UGG A;  2VL4 A;  1GOG A;  4QDR A;  4CUA A;  2EXH A;  2V5D A;  3K4Z A;  5C71 A;  5EJZ B;  3RWK X;  2XON A;  2YFR A;  1F4H A;  4ZXE A;  3AKF A;  4XUQ A;  3QEF A;  2XQR A;  4A3Z A;  5FIX A;  5I0D A;  3QC2 A;  2VZU A;  2KD7 A;  4PT6 A;  4CU6 A;  3LEI A;  3OG2 A;  4W4Z A;  3C8X A;  1NKG A;  3D60 A;  2C9K A;  4UDK A;  5C7G A;  3K1U A;  3WEZ A;  3D3A A;  1H6X A;  1GYD B;  3VSS A;  3NJV A;  1GYH A;  2EIC A;  4PF1 A;  2C4X A;  4KMI A;  2EXJ A;  4KWU A;  1UXZ A;  3KF3 A;  3I2H A;  3J7H A;  4N4B A;  4CUB A;  4XUT A;  2QQW A;  1UX7 A;  3IAQ A;  4JKM A;  4XVH A;  1OD3 A;  4W50 A;  3SC7 X;  4AG4 A;  4XUN A;  2WZE A;  3VD7 A;  4PVA A;  2QBX A;  1D7P M;  2JE8 A;  5FMD A;  1UZ0 A;  3WNP A;  1YI7 A;  4DXT A;  3KST A;  2VZO A;  5JXH A;  1UMH A;  1CZV A;  2VCB A;  3WPV A;  3NJX A;  4OYU A;  5EIY B;  3OM6 A;  1OH4 A;  2VR4 A;  2VZQ A;  1CIY A;  3MBW A;  4A4A A;  1W2T A;  1KEX A;  4Z2A A;  1W9T A;  5C0P A;  2W47 A;  3NNG A;  3DEC A;  1IQD C;  5DN2 A;  1CX1 A;  5ANN A;  3PUH A;  5CYY A;  1ST8 A;  4QPW A;  4KCB A;  2WAB A;  3HN3 A;  4RYD A;  3R4Y A;  5GLP A;  1US3 A;  4LHS A;  5G04 L;  3UET A;  4ZZ5 A;  3LE0 A;  3T0D A;  4PQQ A;  3GXU A;  1JZ5 A;  5G05 L;  3T09 A;  3FHA A;  4E8D A;  1GYE B;  1K12 A;  3D5Y A;  2W3J A;  2WZ8 A;  2VJX A;  3K4A A;  4ZZ8 A;  2YFT A;  3QEE A;  1DP0 A;  2VZP A;  5GLQ A;  1WKY A;  4P02 B;  4U6B A;  1UY4 A;  2J1R A;  3WMY A;  1OF4 A;  5JOW A;  3HPN A;  1SG3 A;  4ZY9 A;  3PIJ A;  3WPU A;  3C7O A;  3VSR A;  4OMC A;  4W8J A;  3ACG A;  2XHN A;  2Y6G A;  2VZT A;  2Z4F A;  4P5Y A;  3LEK A;  3ECQ A;  2X05 A;  1NX9 A;  5LA1 A;  2VME A;  3WAS A;  3BYJ A;  3WNN A;  1JZ8 A;  3W5N A;  1XNA A;  2VQT A;  2YFU A;  4MGS A;  2Y64 A;  2WAA A;  4UI9 L;  1UWW A;  2VDT A;  2ORX A;  3WMZ A;  2W91 A;  2W1S A;  3BN6 A;  3CQO A;  2VCA A;  4OUE A;  4O8P A;  4HG6 B;  2JDA A;  1HN1 A;  4MAD A;  2WN2 A;  4AK5 A;  5JOY A;  3FHQ A;  2E33 A;  4BJ0 A;  2QQJ A;  2WBK A;  4TXW A;  1UMI A;  1XC6 A;  3GDB A;  4A44 A;  1O8S A;  5AYD A;  2QQU A;  2W9X A;  5A8C A;  3W5M A;  1W18 A;  3SKV A;  3HNB M;  1PX3 A;  1JU4 A;  2ZEY A;  3C7H A;  4DUV A;  1DLC A;  4QQS A;  3WF2 A;  2J1E A;  2Y8K A;  3MO4 A;  3OGV A;  3THC A;  4CU8 A;  4UOJ A;  4N1I A;  3EB7 A;  1JZ4 A;  5FLW A;  1CZS A;  3WF4 A;  5DMY A;  3VT0 A;  2EID A;  3FN9 A;  1GOH A;  1SDD B;  2CDP A;  2OXB A;  3WSO A;  1JYW A;  3ACH A;  5FK8 A;  4N2Z A;  1JZ6 A;  2WQ8 A;  3BYL A;  3D61 A;  2BGO A;  3ZXL A;  4FFG A;  5J1X A;  2Y6H A;  2EIE A;  1XPW A;  2QQI A;  4LQR A;  4FFI A;  4A41 A;  3VDB A;  2DCJ A;  1GNY A;  3WF1 A;  3AC0 A;  2WO1 A;  4ET7 A;  1WCQ A;  3PIG A;  4PVI A;  3I3D A;  3LPF A;  3MV1 1;  1OF3 A;  3I3E A;  4JHZ A;  4OMD A;  3UES A;  3ACF A;  4LKS A;  3ZM8 A;  4LPL A;  2ADD A;  2VCC A;  2LS6 A;  3E1F 1;  2VZ1 A;  3QZ4 A;  2Y6J A;  5IHR A;  1KGY A;  2YB7 A;  2XQX A;  1Y7B A;  2E32 A;  2YC4 A;  3GGL A;  5A1A A;  2JD9 A;  2YFS A;  3UGF A;  3T0B A;  5C70 A;  1W99 A;  3A21 A;  3ABZ A;  2ADE A;  2J1T A;  3F2Z A;  2J1V A;  3WAT A;  3TAW A;  2PQS A;  4CU9 A;  4KC8 A;  1O59 A;  5FMC A;  5B6T A;  5JXG A;  3SEP A;  2LW8 A;  3WNO A;  2VMC A;  2BGP A;  3HJR A;  2YFZ A;  3VT1 A;  2X10 A;  2X8T A;  3BYN A;  5JXI A;  3I97 A;  4AK6 A;  3IDA A; 
#chains in the Genus database with same CATH topology
 2HWD 1;  1O8P A;  5GLZ A;  2ZCW A;  4PLO A;  3I54 A;  4ZU5 A;  1PK6 A;  2EXI A;  1SLI A;  2OQ6 A;  2PLV 1;  3GZT B;  4GWM A;  5LY1 A;  3NO8 A;  3OM7 A;  1PM7 A;  1ND2 A;  1LOE A;  1SLA A;  1VJ2 A;  2D98 A;  3V64 A;  2AZ5 A;  3WG1 A;  5AYC A;  2OZJ A;  3JUU A;  3Q8E A;  3N9N A;  3LSE A;  3OM4 A;  2JDY A;  1AXY A;  3AKH A;  1H8V A;  2GH2 A;  3PUS A;  4QM8 A;  2ZGN A;  4IEV A;  1MEC 1;  5F2S A;  1VBE 3;  4YAR A;  5AYE A;  1NZI A;  4MVT A;  1DQ1 A;  5A8D A;  4RD7 A;  4YSF A;  4WVM A;  2QVS B;  3JQX A;  3ZFE A;  1LHW A;  1HV1 A;  2JD4 A;  3OBZ A;  3ZFG B;  3ZSL A;  5K0U C;  3BOP A;  5F32 A;  3VBS B;  4JHT A;  5BNQ A;  1S2E A;  3LDR A;  1HXS 1;  1ZZ9 A;  2ZMN A;  4MXV A;  3H1W A;  5DAW A;  5FLJ A;  5T5L A;  1NCQ A;  4R9B A;  2PAE A;  3UV9 A;  4BIS A;  1TL2 A;  3TNP B;  1RUO A;  5LAT A;  4IE6 A;  5A1L A;  5AY9 A;  1UY2 A;  1ZRI A;  2UYB A;  4Q0U A;  1RUH 1;  4MGT A;  4BDV B;  1N3Q A;  1RMU 1;  4DUW A;  3LQC A;  2TBV A;  4HSJ A;  1ND3 B;  2D6O X;  4KQ7 A;  2CY6 A;  4V2W A;  3H0O A;  4BQ5 A;  4D6S A;  4N2R A;  1VPH A;  1OBN A;  4QGN A;  1QU0 A;  2RDR A;  5I93 A;  3POI A;  3WPZ A;  1WCU A;  2WS9 3;  1NAE A;  2VUD A;  3ON7 A;  4RR3 A;  2HWB 2;  1AZD A;  1LAJ A;  3VKN A;  1SPP B;  1JU3 A;  1JH5 A;  1TZO A;  1Y9M A;  3JZV A;  5FZ9 A;  4CCL A;  3JXS A;  1COV 2;  2ARC A;  2FQP A;  4E2G A;  5BNN C;  5FYB A;  2FDF A;  3MHZ A;  1JHN A;  3NV4 A;  5BNN B;  1PO1 1;  2RS3 3;  4G4F A;  4Y4R A;  4ZU4 A;  2DBI A;  3U0Z A;  2HYX A;  3MF9 A;  1MEC 2;  2RR1 3;  4AFA A;  3LF7 A;  3DUI A;  1VBC 3;  1WZX A;  2ZHK A;  2QQM A;  4IV1 A;  4CP9 A;  5L7O B;  4OHY A;  1UXX X;  2VW1 A;  1I5Z A;  3NV3 A;  4LE3 A;  4KBZ A;  4KG8 A;  2L9L A;  2V4V A;  4FOV A;  2WQ4 A;  4Q0Q A;  4NN0 A;  1HQN A;  3VSF A;  4GQ7 A;  3M3E A;  2GNM A;  3OGG A;  2O8Q A;  3OGR A;  2WNV C;  5GLW A;  3OGS A;  5FZ4 A;  3AJY A;  4K8R B;  2PHD A;  2FDI A;  5IVF A;  4CCD A;  2IXI A;  2X5I B;  1GU3 A;  1ULD A;  4FPG A;  2HEV F;  3WN2 A;  2ZEX A;  3PUR A;  5JZG C;  2X5I A;  5T5O A;  5A1F A;  2RJ2 A;  3H8O A;  4JZR A;  2FMD A;  3JBG 2;  4XF4 A;  3SCG A;  3FFZ A;  1T6G C;  1MPX A;  4AAP A;  2BFU L;  2HWF 2;  5JR2 A;  4XAB A;  1OA2 A;  5EYY A;  4S2H A;  3ILR A;  3GJA A;  4S2F A;  3IMN A;  4CEY B;  2JEC A;  2WSU A;  3B5L B;  3S7I A;  3VB9 A;  4AHW A;  1GQP A;  2SBA A;  1L7R A;  2GDF A;  1N3O A;  1S0J A;  2IXL A;  1X33 A;  1HRV 1;  4CDX C;  5A3P A;  1JZ7 A;  2QQL A;  4UW4 A;  3LFI A;  4EN7 B;  2ZX3 A;  3VBH B;  3Q8F A;  4HK9 A;  1DU3 D;  2E9Q A;  1IPK A;  4F83 A;  1RHI 1;  1PIV 1;  2W92 A;  3JBG 1;  4NWV A;  4XFI A;  4QDQ A;  2B42 B;  1QKQ A;  2X53 S;  3KWV A;  4XC9 A;  1K5M C;  1VBA 1;  3IT8 A;  4I09 A;  4RR3 B;  2IXC A;  4YVW A;  2Q8C A;  3U14 A;  4PIX A;  3H8U A;  3PUI A;  4AL9 A;  5KXB A;  3WN0 A;  2ZEZ A;  2BRT A;  4QQ2 A;  4QKD A;  5FJH A;  1N1Y A;  1DQ2 A;  1HDK A;  2EIB A;  2JG9 B;  2D6K A;  4HL0 A;  5F2W A;  4OZX A;  1SCS A;  2WII B;  1NY7 1;  2KR2 A;  1RUD 1;  5EXO A;  5H9R A;  1ZM1 A;  3KM5 A;  1E5R A;  3LEG A;  5DQ0 A;  4DIQ A;  3K51 A;  2UWB A;  4ARY A;  2LUW A;  3HEI A;  4LTA A;  2IFR A;  4XQW A;  1AR6 1;  4Y5Z 0;  1PO2 2;  2DUQ A;  2VCM A;  4BZ4 A;  3DEM A;  1TMF 1;  1MS1 A;  3AYA A;  1SLL A;  1VAK A;  3CIH A;  3FFQ A;  3PVO A;  4XFC A;  4EN6 B;  1UD1 A;  3DPR B;  4UWD A;  3WD5 A;  1PMI A;  2BDR A;  4HKO A;  3BVC A;  3H7J A;  3W21 A;  3ZFE B;  1H6Y A;  4CDQ B;  5HCA A;  3CF6 E;  3ZXJ A;  3PTY A;  1F4A A;  1VRB A;  2YBS A;  3VHR A;  1JTZ X;  2WQZ C;  4IL7 A;  4RS5 C;  3RI9 A;  5KXD A;  2VM9 A;  2WAO A;  2XOM A;  2CTV A;  1YYN A;  2ZMK A;  5DG2 A;  5IW0 A;  2C9A A;  3RI8 A;  5AC9 2;  1LOB A;  3KT4 A;  2P1B A;  1MZE A;  2WYS A;  1WMX A;  3AFG A;  1NXM A;  1LGN A;  5C5T A;  5C6C A;  3RS6 A;  1UY0 A;  1V6K A;  5FFO C;  1XXN A;  1CES A;  4HK8 A;  1Y3T A;  1PX4 A;  3WHT A;  1AL2 3;  1G9D A;  4K1Z A;  2DCK A;  1K5M B;  4XFF A;  1UPI A;  2QZ2 A;  2XG3 A;  4CXX A;  2WA4 A;  2ERF A;  3N35 A;  1RJ7 A;  2HWD 2;  2VBD A;  5EQU A;  3I2K A;  4N90 A;  5DDJ 3;  1CD3 G;  2VQU A;  5DAX A;  3AXD A;  1G9F A;  1WBF A;  5C5U A;  4I3P A;  4PDW C;  4XXP A;  1MZF A;  3NKG A;  5FZM A;  3T1M A;  4IEW A;  2R04 1;  1VRH 1;  1RUF 1;  4CP0 A;  5CG9 A;  2PXJ A;  1UL9 A;  1DQ6 A;  4AFM A;  4MGZ E;  2VUL A;  3T1L A;  5BNO A;  3BI3 A;  3GAL A;  2BOI A;  4QHB A;  4JRL A;  1PMJ X;  4COV A;  1LNS A;  2WNV A;  3S7E A;  4JGY B;  2VMH A;  3LB9 A;  4KWK A;  5J36 A;  3QH7 A;  3I4I A;  4I0B A;  2J1A A;  3U37 A;  1QJY 1;  1EUU A;  2Z5W A;  5CZK A;  5F6K A;  1HRI 3;  1PGL 1;  2VAU A;  3U78 A;  3C2U A;  2OII A;  4Y22 A;  3WP6 A;  2W95 A;  3I2I A;  5E88 A;  3WNL A;  5LRR A;  3B01 A;  1UY1 A;  2V72 A;  2VTX A;  1H8T B;  1NG0 A;  4WM7 C;  1S2B A;  2W08 A;  1GR3 A;  5F3C A;  1IG3 A;  2VUJ A;  4AQ6 A;  3T0A A;  2MEV 3;  1GMM A;  1MQT A;  4LIT A;  2BQP A;  1V00 A;  4YW7 A;  2ATF A;  2DF7 A;  2XJU A;  4E27 A;  3LOB A;  3DYP A;  2HWB 1;  4EV0 A;  4QPG B;  3AKG A;  2DV9 A;  4AI3 A;  2PAK A;  4BIF A;  1LGB A;  3QED A;  1H1I A;  1W0N A;  3SH3 A;  5BYN A;  1T2X A;  4FPO B;  4NRM A;  3L9J T;  1NZC A;  1B35 C;  1FMD 1;  3N3H A;  2WO2 A;  4EN0 A;  1BHG A;  5F3G A;  3GYD A;  2VQ0 A;  3VKF C;  3C7F A;  3OEB A;  4QX1 A;  1APN A;  1UZY A;  2Q30 A;  4IQP A;  4RGK A;  4Q4W 2;  3DYM A;  3ZSK A;  1CAU A;  1S0F A;  2WDB A;  1TME 1;  2XJP A;  3GHN A;  3OBA A;  3IKW A;  4P9L A;  1RUE 2;  5ABJ A;  2QCS B;  5FMB A;  5FYC A;  4LUM A;  1RUG 1;  4HPK B;  1N1S A;  2VMD A;  4BQ2 A;  5JMO A;  2BBA A;  2VXR A;  3D4K A;  3OUH A;  4XZP A;  5LY2 A;  1LCL A;  1ULE A;  1QOT A;  4TSV A;  5F39 A;  3RSJ A;  2VL4 A;  1KDK A;  4DPN A;  1AHS A;  4QDR A;  4CRQ A;  5GZE A;  5SV5 A;  5F5Q A;  3WW1 A;  2EXH A;  2W0X A;  3HAG A;  5JDB A;  5C71 A;  4Z82 A;  4JVA A;  5FY4 A;  1R08 2;  5M0T A;  5CFD B;  4L97 A;  5I91 A;  3EMR A;  5FBJ A;  3CO2 A;  3QEF A;  2VEC A;  5I0D A;  2UWA A;  2ZX2 A;  2ARB A;  1YI9 A;  2VZU A;  1OHF A;  4MH0 E;  5FZC A;  4AHZ A;  3RZL A;  4W4Z A;  2A7A A;  4FPE A;  3C8X A;  1NKG A;  2XXZ A;  3VBR A;  4D3W A;  4UDK A;  4EN9 B;  3D3A A;  4GD4 A;  4XJA A;  3J8F 1;  1GYH A;  3VDD C;  3CJI B;  1D0G A;  2ZTN A;  3RQ0 A;  5FUN A;  1S0C A;  2RS5 1;  2WNU A;  4AYU A;  2DUR A;  2PEL A;  4KWU A;  5JCT A;  1FOD 3;  1B35 B;  2BOJ A;  3FZ3 A;  4FQZ A;  1QJX 3;  4QQH A;  3MIC A;  2R07 2;  1S2K A;  3K3O A;  4NR1 A;  4S2G A;  4F7Z A;  1DZQ A;  1OFS A;  3AKR A;  4XVH A;  3WG2 A;  1OD3 A;  2ZX0 A;  4W50 A;  3SC7 X;  4ZHN A;  2YZ4 A;  4LHL A;  1W8U A;  2WYF A;  4PVA A;  5FOB B;  1OVS A;  5LWB A;  3NAP B;  1DG6 A;  1C57 A;  1HB3 A;  1UZ0 A;  2B45 X;  2BP6 A;  3AL6 A;  4PQ9 A;  5FMD A;  3WNP A;  5AC9 1;  1GSL A;  3PU8 A;  1UMH A;  3L2Y A;  1CZV A;  5GKA C;  1X8E A;  1DGL A;  3OD0 A;  1GKB A;  1TME 2;  3SCF A;  4YZ2 A;  1MS5 A;  5D21 A;  2D7F A;  4OYU A;  1OLR A;  2EA7 A;  3ZIX A;  2HWE 1;  1HRI 2;  5A6Z A;  1FPN 2;  1F31 A;  2JG8 A;  3LA2 A;  3MBW A;  4A4A A;  2DVF A;  1Z7S 3;  4Y1Y A;  2HKX A;  2OS2 A;  4XF1 A;  3SHR A;  5A70 A;  2W47 A;  3NNG A;  3DEC A;  1IQD C;  1ODN A;  3N7L A;  4OUM A;  4PI2 A;  1CX1 A;  5CYY A;  1LOF A;  4XBN A;  4AGR A;  1POV 1;  3TOJ A;  4JDM A;  3K3N A;  3EO6 A;  2WAB A;  5C9A B;  5FP3 A;  4BE3 A;  3B93 A;  3VN4 A;  5I8S A;  3Q9O A;  2P6C A;  3AM2 A;  2XML A;  4JGZ A;  4N53 A;  2GAL A;  3UET A;  5FZF A;  3WXP A;  2VW0 A;  4IV3 C;  2HWF 1;  4R9A A;  5KXE A;  3V0A A;  3PVE A;  1K12 A;  2W3J A;  5HCF A;  4CDU B;  2FDG A;  3CHX A;  4NHX A;  1HRI 1;  1MS4 A;  4LO5 B;  4IEY A;  1HRV 2;  4COU A;  1VBE 1;  2IC1 A;  2Z79 A;  1OF4 A;  3PJQ A;  3EJK A;  1W8W A;  3HQU A;  4W8J A;  5E89 A;  3THT A;  2Y6G A;  1Z78 A;  2B9U A;  1V6I A;  3MPB A;  4AEM A;  5BNO C;  3MIH A;  3WNN A;  3NNF A;  3ME2 A;  4DNY A;  2Y64 A;  4HBN A;  1UWW A;  2ORX A;  3J9S A;  2W91 A;  1AL0 G;  5C4W A;  4GXL A;  4JDO A;  1NYW A;  2ZX1 A;  2GC2 A;  4QQO A;  5A3N A;  5IK5 A;  4TZD A;  2W52 A;  2ZGS A;  5FYH A;  3ZN5 A;  4NII A;  5DAP A;  4AVB A;  4WM7 B;  1POQ A;  3U11 A;  5BUV A;  2CSG A;  1JN2 P;  3NST A;  4XQ4 A;  5FPU A;  1UMZ A;  2E33 A;  4KWJ A;  4BJ0 A;  3MZH A;  4YW4 A;  1UMI A;  1ENR A;  3BOW A;  5GLT A;  1Q8S A;  2YDE A;  4XMA A;  3SKV A;  1YJK A;  4GJZ A;  4XXA A;  2Q4S A;  1QJF A;  4HOO A;  3ZR5 A;  2ZEY A;  1QHD A;  1VR3 A;  5FZO B;  1AXK A;  2CAV A;  3C7H A;  4D69 A;  4NUB A;  4X6R B;  1IS6 A;  1DLC A;  2JKB A;  3B3Q E;  1V9U 2;  1LEC A;  4QQS A;  4W65 A;  3PUA A;  4ZXK A;  3I7D A;  4XOG A;  3ZSJ A;  1BMV 2;  4BB3 A;  1DQ0 A;  2Y8K A;  3ZYH A;  5D8A B;  2QDR A;  3N7M A;  5BNN A;  5FMO L;  1JZ4 A;  2LM3 A;  3BUC A;  4FTS A;  5FLW A;  4G9S B;  1CZS A;  3GNE A;  1UU5 A;  1FMD 2;  2RDQ A;  2EID A;  4A3X A;  4AI9 A;  1D4M 3;  2VGD A;  3BIE A;  2QJV A;  2CDP A;  3PJY A;  2RM2 3;  2OXB A;  2QQP A;  2RJL A;  3WSO A;  5FK8 A;  1RUJ 2;  5F5A A;  3HMY A;  5BV6 A;  1JZ6 A;  3BYL A;  5BNP A;  2BGO A;  2ZGU A;  5J1X A;  1QH6 A;  1Q5O A;  2EIE A;  1QDC A;  4Z1V A;  2Q5T A;  1GNY A;  4H3W A;  2UUR A;  2Z42 A;  3JBG 3;  3KCX A;  1WCQ A;  3PIG A;  1PIV 3;  1HLC A;  3O1S A;  1NLR A;  3MFA A;  2FCU A;  4YVS A;  3MV1 1;  1OF3 A;  2IXJ A;  2I07 B;  4OMD A;  1M4W A;  2NPI A;  3MLK A;  5FZG A;  3ACF A;  1MZ5 A;  4LKS A;  3VV1 A;  3AXE A;  1YC6 1;  2VOK A;  4LPL A;  4LUL A;  2ADD A;  3FBM A;  1IPS A;  1F9K A;  3E1F 1;  3FUQ A;  3KCC A;  3BTX A;  3QLQ A;  4OI1 A;  5LBC A;  1RUC 2;  4TLG A;  1NE6 A;  5EZW A;  1Y7B A;  2LRP A;  4WVM B;  1BEV 3;  2B8M A;  1G8W A;  5BY5 A;  3UGF A;  1IZ3 A;  3OYW B;  3JU9 A;  2Q1F A;  3A21 A;  4LR4 A;  3WP4 A;  1IHM A;  4LKF A;  1SBE A;  4BQW A;  2J1T A;  3F2Z A;  3ORJ A;  4YM0 A;  3WAT A;  4Z92 B;  4CU9 A;  1JMU B;  2ZAA A;  3USU B;  1EV1 3;  4K20 A;  4KC8 A;  1O59 A;  4WVV A;  3KCY A;  2WT2 A;  2XBO 2;  4IER A;  4RR3 C;  4IE4 A;  4QXH A;  3A0K A;  4NPL A;  2X10 A;  2ZGO A;  3ILF A;  4LBM A;  2CU5 A;  1YQ5 A;  5KC5 A;  5J96 B;  2P5B A;  1UIK A;  4Q4X 2;  3AKI A;  4EZ4 A;  2XGX A;  1GUI A;  3VBO B;  4AZZ A;  4FXK B;  5FY1 A;  1UX6 A;  1G9B A;  1WW5 A;  1FT9 A;  3ATG A;  2QTW B;  2EXK A;  3FL7 A;  4B3N A;  2DCT A;  2NYY A;  1ND3 C;  1SEF A;  1OUX A;  3KF5 A;  3EYP A;  3KT7 A;  5CFC B;  5DDJ 2;  4AOC A;  4D6Q A;  1EUT A;  2BNM A;  4EWA A;  1LB2 A;  2VQA A;  4AQT A;  2CDO A;  3J7M A;  4YG6 A;  4FFF A;  2Q8O A;  4AK3 A;  1W6N A;  4FPK A;  1ND3 A;  2BUK A;  3FLP A;  4QAW A;  3EBR A;  4XCA A;  4YW5 A;  3AP4 A;  4C8D A;  3LA7 A;  3PVN A;  3V0B B;  5FLH A;  2G1M A;  2CGP A;  2Y6F A;  1OLM A;  4CUC A;  4UDI A;  1K5J A;  1ZBE 1;  3K48 A;  3S5A A;  4Y4Y A;  3WAU A;  4KNC A;  1ALY A;  4XDO A;  1VBC 2;  5FWE A;  2JG8 B;  1XND A;  2JDZ A;  3VBS A;  1JZ3 A;  1W2N A;  2WN3 A;  4MZU A;  4R9D A;  4Q4W 3;  5IJR A;  1NY7 2;  2JKX A;  1CN1 A;  2PHR A;  3MEP A;  3BU7 A;  2IUW A;  3R05 A;  4UBG A;  5JOX A;  2AEZ A;  4KG0 A;  1S0E A;  5BXX A;  4BQ1 A;  2YG0 A;  1YFX A;  1W3V A;  1QNY A;  1RIN A;  2AC1 A;  2E26 A;  4FQ4 A;  4Q2F A;  1LKN A;  1RYY A;  1RUH 2;  2JE9 A;  4XFB A;  1WD3 A;  5IVY A;  2PAM A;  4NOV A;  3ELN A;  4AQS A;  2NN8 A;  1MS3 A;  1YJL A;  4JQT A;  1YFW A;  2X8F A;  3VD5 A;  1AR9 2;  3BCW A;  5CIR A;  3M3O A;  3K77 A;  1DYO A;  1WLC A;  4K1Y A;  2PA7 A;  1UPS A;  5J98 B;  2A3W A;  1A6C A;  1R64 A;  1SHW B;  4Q4V 1;  2XJR A;  3ZSM A;  3ZOI A;  3WQB A;  3U4S A;  4UDG A;  2B5H A;  2VUC A;  5CKQ A;  3GJB A;  3K75 B;  3P2N A;  3OSD A;  4QX5 A;  4NRQ A;  5GLR A;  3TB0 A;  1QJX 1;  2K46 A;  2G4I A;  1QEX A;  1W0P A;  2UYA A;  2W1U A;  4FPL A;  5F3E A;  3O1P A;  2J22 A;  3ZXK A;  5SV8 A;  4XAC A;  3RVH A;  4QPI C;  3WQ7 A;  1NOV A;  5A33 A;  2DTW A;  4IEP A;  3C7G A;  3UJO A;  3VBU A;  5KC6 A;  5FZD A;  4DRV A;  3WDV A;  3WP5 A;  3CMG A;  1LES A;  1XRU A;  2GNB A;  2GN7 A;  3NL1 A;  2YU1 A;  4IEU A;  5JMC A;  3VT2 A;  3WPY A;  1ENS A;  3B9C A;  1J84 A;  2V5Y A;  1LOD A;  2VZS A;  2Z69 A;  3VHP A;  1N3P A;  4BM8 A;  4JGY A;  4A2U A;  5LK7 B;  3WNK A;  1AYN 1;  2RS5 2;  4LOS A;  4O7X A;  4LO7 A;  4N43 C;  3PTR B;  2J1U A;  5A6Y A;  1BCX A;  5KHJ A;  5A7V A;  1R09 3;  4FPY A;  4R9C A;  2RS1 3;  2B39 A;  4A7K A;  5AFE A;  1G6N A;  2P17 A;  3UGH A;  2ZJC A;  3WW3 A;  1AR9 1;  1ZX5 A;  5FY7 A;  5KHG A;  2X8S A;  5KBF A;  5L9B A;  4F3J A;  2W1Q A;  1OQD A;  2GZW A;  3I59 A;  1IS5 A;  2AEY A;  1K45 A;  4M4R A;  3LZZ A;  2PHL A;  1U12 A;  2DBN A;  4HT1 T;  4B1L A;  1W9F A;  1QQP 3;  1UU6 A;  1ZRR A;  1XU2 A;  2CYF A;  1R08 3;  5J48 A;  1CVN A;  5GLO A;  4LT5 A;  1W03 A;  2DU1 A;  5FRE A;  4J25 A;  5FXZ A;  4IUG A;  4ATF A;  4Q0S A;  4QX0 A;  4Y20 A;  3T2Q A;  3ROU A;  3DKW A;  4OI2 A;  4FT8 A;  1W6O A;  5AFB A;  1E57 A;  3R4S A;  1RUC 1;  2QQN A;  4O9E A;  2C26 A;  3LDK A;  2FBE A;  1IOA A;  2XBO 3;  3LA3 A;  5A6Q A;  2I2S A;  4NIH A;  1HB2 A;  5FQ0 B;  3D8C A;  2ZAB A;  1QMJ A;  4QX7 A;  2EAK A;  3M1H A;  3M3Q A;  4IEQ A;  5DZE A;  5L19 A;  1GWK A;  2R07 3;  3I2G A;  4WVZ A;  1FXZ A;  3MV0 1;  2R04 3;  3OD4 A;  4QD2 A;  4OZO A;  4RS5 B;  4BWO A;  3KVB A;  1WLT A;  1RL3 A;  1JYV A;  3GF6 A;  2WJS A;  2XJS A;  1DGR A;  2R49 A;  3CZJ A;  3NJY A;  4PCR A;  4LO4 B;  4NHY A;  1HRV 3;  2RE9 A;  4AHY A;  4Z8B A;  2VZR A;  4I01 A;  3P1I A;  3TAY A;  3DPR A;  4ORF A;  5FKC A;  1W28 A;  2W39 A;  2K9Z A;  4L11 A;  4Y33 A;  4OLL A;  2R7E B;  4NPM A;  4CVU A;  2IXH A;  1AL2 1;  3FUO A;  3RZG A;  1FOD 2;  1U5Z A;  3KV5 A;  4FFH A;  4L2N A;  4M4P A;  1OUS A;  2TNF A;  1NUK A;  3GBG A;  2YC2 A;  2NP0 A;  3CU9 A;  1AVB A;  1VLN A;  4E4Z A;  2K0G A;  5IVB A;  3BGA A;  1XNT A;  1QJY 3;  4MXW B;  5DZF A;  5F3I A;  4FBF A;  2D93 A;  1RHI 2;  1LTE A;  1OOP C;  5DUV A;  1NLQ A;  4J6G A;  3RDI A;  1QY4 A;  2W87 A;  2A6Z A;  3AZY A;  4K7J A;  4I02 A;  4N8M A;  2W46 A;  1K42 A;  1ACC A;  1EYB A;  2CGO A;  1NA1 A;  1QNW A;  1Y4W A;  1ZNP A;  1RUF 3;  2ENR A;  3LIH A;  3MYX A;  2W5F A;  4FPC A;  2XH6 A;  3GM8 A;  1KS4 A;  3N9O A;  4YPJ A;  1TME 3;  3H3U A;  1UCX A;  2BBV A;  2ZEW A;  3ZPY A;  3ACI A;  4H7L A;  1X9T A;  3LEM A;  1DBN A;  3USU A;  2PHX A;  2R07 1;  5FDB A;  1AJK A;  5C8C B;  2EAL A;  1AR6 3;  5A32 B;  3JQW A;  3DN7 A;  4HAN A;  5E8A A;  3NNL A;  2XUM A;  4JQR A;  3TN9 2;  4XUR A;  1ZRD A;  1PVC 1;  4COT A;  4L8Q A;  3JCI A;  3SCH A;  5B4X A;  3MUZ 1;  5C9A C;  3I2J A;  4D8M A;  5FZL A;  4QMA A;  5FJK A;  5J7M A;  3R4Z A;  3N9M A;  4XMI A;  2RDS A;  4B7E A;  1H0B A;  5I0S A;  2WKK A;  2KXL A;  3Q8C A;  4UFH A;  2FMY A;  3DF0 A;  3ZFE C;  2YXS A;  4JC1 A;  3ZFF C;  3WX5 A;  2FCT A;  2G9G A;  4QKF A;  4JTO A;  5F7U A;  5K4L A;  3ZN6 B;  3LV4 A;  1JHJ A;  4LHN A;  3A0N A;  3MIB A;  4W6X A;  5FZA A;  3S57 A;  1LOC A;  2VNR A;  1JYT A;  2VE1 A;  2WZP P;  3X29 B;  1Q8P A;  4XDQ A;  2I74 A;  2WUH A;  1ZBE 3;  2VVD A;  2W2I A;  2XJT A;  3O12 A;  5FXW A;  5GLV A;  4DIN B;  3RFR A;  2BER A;  1CON A;  1OA3 A;  3DXU A;  3RGB A;  5LEK A;  3S5Q A;  3TYJ A;  5CKM A;  4XBQ A;  1AR8 3;  2FD8 A;  4KC7 A;  3U4X A;  5LAS A;  4NIA A;  5LCW L;  1MS0 A;  4OI4 A;  2ZGQ A;  2Q1M A;  3AMM A;  1R09 2;  4LHK A;  1NCR B;  3CDZ B;  1XJA A;  1WLW A;  4DXR A;  1VBB 2;  2ZHL A;  4NOT A;  1C5I A;  3KHC A;  2B46 X;  3O0X A;  2CAU A;  4JDN A;  3AP5 A;  3NV2 A;  4F8A A;  1J83 A;  1JYC A;  1SBD A;  5F37 A;  1BK1 A;  5B6S A;  4AE2 A;  1SFY A;  3R67 A;  1LEN A;  1SDW A;  2OVU A;  1LHU A;  3A22 A;  1ULO A;  1ULC A;  1JXN A;  4QX2 A;  4BH9 A;  1STM A;  1PZ9 A;  4XPV A;  4BQX A;  1DGW X;  5JSP A;  5A8C A;  2XDV A;  5J09 A;  2A6V A;  1QXJ A;  5JIU A;  4RN5 A;  1PK6 C;  1HJG A;  4BK5 A;  2UY9 A;  3ZYG A;  1E5I A;  4IE7 A;  2P3J A;  1GOF A;  4KWL A;  5CFD C;  1QJU 2;  2GMP A;  5B4N A;  1PVC 2;  3UJQ A;  4XHB A;  3UGG A;  1AYM 2;  2OYZ A;  2OPK A;  3MF6 A;  1GZW A;  1W6M B;  2CWM A;  1CAW A;  4Q5O A;  5A80 A;  5K7P A;  1NCQ C;  3R4D B;  1V6O A;  3ZKU A;  2V5D A;  3K4Z A;  2XBO 1;  2XON A;  4ZXE A;  3AKF A;  3POS A;  2ZGR A;  1KS5 A;  4MX3 A;  1UQX A;  4A6S A;  1VRH 2;  3I2D A;  4AED A;  4PT6 A;  3OG2 A;  1DHK B;  3M70 A;  2V4A A;  5JIA A;  2O8O A;  4R8H A;  1CX4 A;  2A6X A;  4K8F A;  1IKQ A;  3K1U A;  3WEZ A;  1H6X A;  3ZO0 B;  1QJE A;  3PU3 A;  4YG3 A;  2EIC A;  3B94 A;  3FE5 A;  4O9G A;  2MEV 1;  1W06 A;  3HT2 A;  4PF1 A;  4XIK A;  3ST7 A;  5L7O C;  2Y26 A;  3VKL A;  4CCK A;  3HT1 A;  3KF3 A;  1POV 3;  4CEW C;  2E7Q A;  2C6S A;  5LB6 A;  1PGS A;  3I49 A;  4ASK A;  1HJF A;  3ENR A;  3O7O A;  1MS9 A;  1NXD 1;  1R1A 2;  2QQW A;  4Y1Z A;  2WIN B;  4CDU A;  5FYZ A;  3O1U A;  4AG4 A;  4QU1 A;  4XUN A;  2VD7 A;  1W8H A;  2WZE A;  3ZIW A;  2QBX A;  2JE8 A;  3UKN A;  4ES9 A;  3OBR A;  2VPV A;  1YI7 A;  4DXT A;  3KST A;  2VZO A;  5GZG A;  3L2H A;  3BOD A;  4QPI A;  3WQ1 A;  1CAV A;  2KA3 A;  1O4T A;  4PI0 A;  5FV3 A;  1NLS A;  3GHM A;  5ISL A;  3NJX A;  4YZ3 A;  3OM6 A;  1OH4 A;  3FC0 A;  5LBE A;  4AF9 A;  2ILM A;  1H8T C;  2VNV A;  4JGZ B;  2O0O A;  3AVR A;  2AYH A;  3IM0 A;  4SLI A;  3IMM A;  5K0U B;  1GP5 A;  2OQ7 A;  3PUH A;  5FLI A;  5I0U A;  3ZFG A;  1ST8 A;  2BWC A;  4XW3 A;  1UAI A;  3ZN6 A;  3KD4 A;  4M3C F;  5IAV A;  1WMF A;  4MGK E;  4RYD A;  5FZE A;  4COY A;  3R4Y A;  5GLP A;  3D5O A;  2JXA A;  5CFC C;  1LJ7 A;  2ZBJ A;  2EIG A;  3LE0 A;  3TWI A;  3U10 A;  2RMU 2;  4CZS A;  1ASJ 1;  3T0D A;  1WW6 A;  2HBU A;  4OFG A;  3VZL A;  1FV2 A;  4C0H A;  3FHA A;  5H9P A;  4PLN A;  4XQD A;  2WT0 A;  1GYE B;  2A5Z A;  2MNG A;  5CVR A;  3D5Y A;  1AYN 3;  2R06 2;  1CJP A;  2E7T A;  4O65 A;  2VZP A;  5CNA A;  5GLQ A;  3NJZ A;  1O91 A;  3R4U A;  4YVW C;  1AJO A;  5IVC A;  4LIU A;  5JOW A;  3HPN A;  1HQW A;  4RGA A;  3VSR A;  5JI7 A;  2Q8E A;  2BYV E;  3I59 B;  2FZ2 A;  3TEW A;  3ZXF A;  1QIQ A;  4P5Y A;  3O1R A;  2BVV A;  5FP8 A;  1D2S A;  2QDN A;  3MIF A;  1W04 A;  4YZ4 A;  4MG2 A;  5DDJ 1;  1NA1 B;  1RJ8 A;  2XVG A;  2JEN A;  4HON A;  5LBF A;  1PVX A;  2VQT A;  3OCP A;  2W68 A;  4MGS A;  2BEO A;  2VBP A;  4GKY A;  3WVJ A;  2WAA A;  2WO7 A;  3FJS A;  2VDT A;  4RQP C;  4E4H A;  4LJH A;  1PO1 3;  4B4P A;  2GMM A;  2VCA A;  4OUE A;  1GLH A;  3HD8 B;  2P6H A;  3VBR B;  2JIC A;  2HH9 A;  5DAQ A;  3M3C A;  4PLM A;  1E5H A;  4H7M A;  4YFZ A;  4HZF A;  3CL1 A;  3ZMN A;  3UT0 A;  3UKT A;  4HN1 A;  2XVK A;  3O1O A;  2QQU A;  5AYD A;  4DZG A;  5T54 A;  1VBB 1;  2JDK A;  4EE2 A;  2BFU S;  1CPN A;  4H55 A;  5JZG A;  1O3R A;  1C8M 2;  2YGL A;  4NVP A;  4YZ1 A;  2YV8 A;  5CEH A;  3NV1 A;  1Y9Q A;  4GJY A;  3LCP A;  1ENQ A;  4N43 A;  3T4V A;  3O0W A;  1W90 A;  5ACA 1;  1L7L A;  4IET A;  4LLO A;  4RQP B;  4UXA A;  1DZR A;  1Z7S 1;  3VBF A;  3BKZ A;  2GNT A;  1YHF A;  3MIG A;  3C3V A;  3MO4 A;  2D40 A;  3THC A;  4CCN A;  4N1I A;  2IXK A;  3EB7 A;  4YLZ A;  1R09 1;  2JDN A;  1QF3 A;  4A7Z A;  4CDX A;  2N7G A;  1VBA 2;  3MLJ A;  1GZC A;  5FY0 A;  4GH4 A;  2HWC 3;  4BQY A;  3SNM A;  5DMY A;  4L99 A;  2XLA A;  1G9C A;  1WW7 A;  3FN9 A;  4XIL A;  1LED A;  1SDD B;  1AF9 A;  3EXU A;  4NRO A;  4B8E A;  5A3M A;  1EAH 3;  1W6O B;  1TE1 B;  1PZ8 A;  3KT1 A;  4MET A;  3BYJ A;  4XJW A;  1H2L A;  3E5U A;  3VBH C;  2IVI B;  2O14 A;  4N2Z A;  1QWR A;  1LRH A;  1E5S A;  1ZA4 A;  3ZXL A;  1DCS A;  1VAL A;  1ZZ8 A;  4N9I A;  1XPW A;  4LQR A;  1OD5 A;  1C1F A;  2TUN A;  4A41 A;  5HI0 A;  3ES4 A;  4CEY C;  1VAM A;  5EP9 A;  4EJR A;  4ET7 A;  2XLF A;  2XB6 C;  1ULF A;  2DUO A;  2RS5 3;  3I3D A;  1W2U A;  3LPF A;  1SQ4 A;  1XNC A;  4GIQ A;  4AVS A;  2CWS A;  4N43 B;  5A7O A;  4I0W B;  3KHB A;  4RFR B;  1EP0 A;  2R0H A;  3I3E A;  4JHZ A;  5CBL A;  5JI9 A;  5FYU A;  4URT A;  2FZ1 A;  1AX2 A;  2JDU A;  1IKP A;  3ZM8 A;  2ET1 A;  5JZG B;  2E63 A;  5IAT A;  5K9Y A;  1KDM A;  4HXC A;  3ZXG A;  4AEJ A;  2PHW A;  2X5I C;  4XAE A;  1PNG A;  2Y6J A;  5AVP A;  5IHR A;  3N4M A;  1BBT 2;  1LUL A;  2XQX A;  3T3Y A;  4XF3 A;  1W6N B;  2YC4 A;  3GGL A;  4CTE A;  2JD9 A;  2JG9 A;  5A1A A;  2YFS A;  1KIT A;  1XE7 A;  3DCQ A;  1BVP 1;  1W99 A;  2UWC A;  5DUW A;  2Y0O A;  4QWN A;  5CFC A;  5A7W A;  1ZVF A;  3AMQ A;  3HR9 A;  3I2O A;  2J1V A;  3TAW A;  4P9I A;  1LHN A;  4WVW A;  2CGN A;  5FMC A;  4J1X A;  5B6T A;  1OC1 A;  5T50 A;  4FCA A;  2YUE A;  2F4L A;  5JR7 B;  1TNR A;  4HFS A;  2BGP A;  4IV1 C;  4M01 A;  1DYK A;  3T30 A;  3VT1 A;  1XE8 A;  3MID A;  4IND A;  1UKG A;  2ZZJ A;  3BPS A;  5JXI A;  3I97 A;  2BV4 A;  2R04 2;  4D7Y A;  5ABJ C;  4RA0 A;  2YBK A;  3MUY 1;  1TNF A;  1ULP A;  3OYW A;  1V6L A;  5GLK A;  3Q8B A;  1UOB A;  1RVF 1;  3MW2 A;  2R32 A;  2W1W A;  3III A;  1RUI 2;  5DUU A;  5F5I A;  4LKD A;  1Y9G A;  3AK0 A;  4MO3 M;  3ZYB A;  1TVG A;  2D6M A;  3QCW A;  4AR2 A;  2VG9 A;  4E8C A;  3OF1 A;  3ZDV A;  4UDJ A;  2HWB 3;  2XJQ A;  3AMP A;  4JKL A;  5FZ0 A;  1H2K A;  3IAP A;  3OM2 A;  5A3O A;  1K3I A;  1EPW A;  4BXS V;  4CE8 A;  2DTY A;  2GC1 A;  5K0U A;  1PO1 2;  1YQ6 A;  2YC0 A;  1RMU 2;  3J8F 3;  3ZYP A;  4U36 A;  3WZ1 A;  3AZZ A;  4YW1 A;  4L0P A;  2WL1 A;  4N7U A;  2G19 A;  3K4D A;  4YM2 A;  3VZN A;  1CAV B;  3ZXA C;  2XVL A;  3VDC A;  1WBL A;  1GWL A;  2B7Y A;  4XTP A;  4ZU7 A;  4ISR A;  1RIT A;  3CKH A;  3VBF C;  3I2F A;  1XYO A;  3B69 A;  1BEV 1;  3W20 A;  1DQ5 A;  2ZAH A;  3H1M A;  2Y38 A;  3URF A;  2DVG A;  1UYZ A;  4Q8L A;  2BNO A;  4XJZ A;  4Y24 A;  5FY9 A;  3LDB A;  4LO6 B;  5JWP A;  1X82 A;  2IFW A;  2D3S A;  1OLQ A;  1HQL A;  2RM2 2;  3VBO A;  1OH3 A;  1UZW A;  5LEJ A;  2LTN A;  4BA6 A;  3WDT A;  2XPJ A;  4A42 A;  3M7A A;  4OQ9 A;  1UF2 C;  4IW3 A;  3D0S A;  4FP2 A;  2H6C A;  4ES8 A;  2G9Z A;  2WLQ A;  2X29 A;  3BAL A;  1Q8V A;  2JE7 A;  1OQE A;  1VBB 3;  4URA A;  4WM8 A;  2WNE A;  5FMO S;  2X8K A;  3QH6 A;  1QXR A;  5CKN A;  4UDK E;  2JG8 C;  4Q4V 2;  5HXM A;  3FX3 A;  3QAC A;  3H3L A;  1JYN A;  2BVB A;  1VBD 2;  2WWS A;  4O61 A;  3KQR A;  2RM2 1;  3ZFF B;  1V6M A;  3ZFG C;  2P2K A;  3E5Q A;  5B2G B;  4GWJ A;  2VZ3 A;  2ARE A;  1CAW B;  3MGU A;  4BLI A;  4LIV A;  1VB2 A;  4E4D X;  1H2N A;  3OEA A;  2XWJ B;  1QJU 3;  2XKP A;  2HWC 2;  1UY3 A;  2ET7 A;  4Q4W 1;  5E1R A;  1PK6 B;  5JSR A;  2ZOE B;  2ZKN A;  5FO8 B;  5C4W B;  4LLF A;  5C8C C;  4COW A;  3FHI B;  1ZZC A;  3T08 A;  4PBP A;  3KMH A;  1FOD 1;  2ARA A;  4KI5 M;  2DCY A;  1J58 A;  1I5P A;  3WF3 A;  3I3B A;  5F1R A;  3WNX A;  1ZRC A;  4MLG A;  4Q4X 1;  2BJS A;  4LUK A;  4CXW A;  2IZW A;  3UNP A;  1OKO A;  4Z07 A;  3GZE A;  2JDP A;  1W9S A;  3THD A;  4NIG A;  3MIE A;  3WG3 A;  2QQO A;  1ND2 C;  4IV1 B;  4UYB A;  1QOO A;  3ZSE A;  4DEQ A;  3KSC A;  2JJ6 A;  3WIN E;  4CXY A;  2XWB B;  2RVA A;  1MAC A;  4P14 A;  4BYY A;  1PVC 3;  3SQO A;  3NQH A;  1NT0 A;  1VBD 1;  1VIW B;  3HQR A;  1GNZ A;  3KV9 A;  2RHP A;  4MXW A;  3ZYI B;  1KXG A;  4CU7 A;  2BPA 2;  2J7M A;  1OSG A;  3B9I A;  3S30 A;  4B1M A;  4JTN A;  4DY5 A;  2RMU 3;  2VBB A;  5GLN A;  1UZV A;  2P37 A;  5HPO A;  1XNB A;  2JIJ A;  5E16 A;  5FPB A;  3D5Z A;  3LKJ A;  3LWC A;  2CHH A;  4ASM B;  5EV7 A;  4QX8 A;  3AL5 A;  5FZ6 A;  1EPZ A;  1W2O A;  1FAT A;  1YNA A;  4FVV A;  2F17 A;  1OUR A;  2E31 A;  1WWY A;  1UV4 A;  1ZBA 3;  4A45 A;  2PQQ A;  2OW4 A;  4YG0 A;  2A6Y A;  1HW5 A;  3OB8 A;  4GMP 0;  5FXV A;  4MOA A;  4JV4 A;  1RB8 G;  1PM4 A;  2GME A;  2P34 A;  1H4G A;  3NAP A;  4XCB A;  2GP5 A;  2PLV 2;  1BVV A;  2E51 A;  4XJU A;  4GB3 1;  4WM7 A;  5EJ1 B;  1DQ4 A;  1FMD 3;  3POF A;  1AR6 2;  5J37 A;  5T55 A;  3INA A;  1OT5 A;  4FAG A;  3E6C C;  4D6R A;  3MDP A;  2KM2 A;  4EWD A;  2LAL A;  4H2A A;  5C3O A;  4Y20 B;  5EPA A;  2WNU B;  4U2A A;  1ND2 B;  2WO3 A;  5F9T A;  2ZGM A;  1CZT A;  1ODM A;  2Y0I A;  4XUP A;  1AR9 3;  1JOB A;  1XB9 A;  2GND A;  2DYC A;  2JB4 A;  1W9W A;  5FWJ A;  3P5B A;  3TEZ A;  1UYY A;  1PIV 2;  5FYM A;  1QQP 2;  2BZD A;  1GV9 A;  3AMH A;  5BNP C;  2C5D A;  1RUG 3;  5JSO A;  1VKD A;  4AK7 A;  2ZA9 A;  5FY8 A;  3BTY A;  4YGB A;  4B7K A;  1BMV 1;  5FPA A;  4XET A;  4GZ9 A;  4ERO A;  1QJZ A;  5GZF A;  1RXG A;  4I0A A;  4L9B A;  3ZR6 A;  4BK4 A;  1YQC A;  2GU9 A;  1DZT A;  3ALQ A;  5A7V B;  1D4V B;  4ASL A;  1YWK A;  5FYY A;  4P9X A;  1MVQ A;  1RVF 2;  3T4H B;  4YW2 A;  5TSW A;  4TLF A;  3OY8 A;  2H6B A;  1P8J A;  2HWD 3;  4CDQ C;  4LBQ B;  4GWI A;  2PMW B;  3HOB A;  5A7P A;  1D4M 2;  1US2 A;  1H9W A;  3V56 A;  4B4Q A;  4EZH A;  3PHM A;  2ID4 A;  1I1E A;  3WNM A;  5JOZ A;  1WD4 A;  2V73 A;  4QB6 A;  1A78 A;  4UAP A;  4LOT A;  5C8W A;  2P3Y A;  1UOG A;  1F2N A;  4AFD A;  1TG7 A;  4RS5 A;  1WW4 A;  1URX A;  2VVE A;  2IWG B;  3ETQ A;  4IGQ A;  4UF0 B;  4YGD A;  5D2A A;  1VMF A;  1LEM A;  3U07 A;  3DGT A;  4P08 A;  2ZGP A;  4XAA A;  4ISQ A;  2HJI A;  2R6Q A;  3N9P A;  3H9A A;  3QBQ A;  5A6X A;  2WT1 A;  3JD7 3;  4XUO A;  5C3Q A;  4GAZ A;  2CNA A;  1JUI A;  3U75 A;  5C3P A;  3WDU A;  3AP9 A;  2YPD A;  3NWK A;  3VGI A;  3DV8 A;  4YFW A;  5DG1 A;  1NQJ A;  1RIR A;  2GSY A;  5HXV A;  4C1W A;  4GH4 B;  2B9V A;  1GZ9 A;  1W8T A;  4B4R A;  3RJR A;  2LRO A;  1MVE A;  4U6D A;  2VOT A;  1CPM A;  4Q0P A;  1OXC A;  1COV 1;  4LBO A;  3CJI C;  4LK7 A;  4OI0 A;  3RZH A;  2EAA A;  3GZU C;  1DIW A;  4Q4Y 3;  1XE0 A;  2WFF 1;  4ZS3 A;  4BOW A;  5CIS A;  5CU1 A;  1LU2 A;  3KV4 A;  4XJ8 A;  3VBF B;  4FOQ A;  2A75 A;  5EHD A;  1XU1 A;  3M4F A;  4RHV 3;  3VDA A;  1ZZ7 A;  3EQE A;  3T2P A;  1C8M 3;  3D6E A;  3HVD A;  2HWE 2;  1MQT B;  3RYK A;  2X09 A;  1EV1 2;  3J7L A;  3VZO A;  5HCH A;  3W59 A;  3IDB B;  1H2M A;  3HNY M;  1J1L A;  4XFH A;  3T2O A;  1LOF C;  3VKM A;  1YFY A;  2VNO A;  5BPX A;  2VH9 A;  1GOG A;  3CBN A;  3VBS C;  5FTT C;  4R4Z A;  2J42 A;  3WP3 A;  4E2Q A;  4D94 A;  2HYK A;  3RZK A;  1RUC 3;  4Q26 A;  1O4Z A;  4JGZ C;  4YRD A;  2GC3 A;  3DL3 A;  5IWF A;  5JPN B;  5EJZ B;  3RWK X;  2RJK A;  3AB0 A;  4HLT A;  2YFR A;  3NW4 A;  2AUY A;  3VBU B;  5A33 B;  2WNV B;  3QC2 A;  2KD7 A;  4CU6 A;  1NQD A;  1W6P B;  1ZBA 2;  3FMG A;  3D60 A;  1RHI 3;  2C9K A;  5FZ3 A;  1Q43 A;  5LA9 A;  3SIS A;  3PLQ A;  1GYD B;  3VSS A;  1RUN A;  1REE A;  1Q8O A;  4I3G A;  5ACA 2;  2VMG A;  2WRA A;  2DFB A;  5ABJ B;  4KMI A;  1UXZ A;  4X6Q B;  3I2H A;  3VKO A;  4M0H A;  4XIO A;  4XF9 A;  4DXZ A;  4OQ8 A;  3AYD A;  2C0Z A;  2A3X A;  1MR5 A;  4XUT A;  3FLR A;  1F8V A;  3IAQ A;  5I0R A;  2XKO A;  4NHK A;  3TEX A;  5LBB A;  4QPG C;  4X8P A;  4NPR A;  3PNA A;  1OKQ A;  4P9G A;  3VD7 A;  2HEY F;  2JX9 A;  3N36 A;  1GBG A;  4YNI A;  2D44 A;  2PHT A;  5IK4 A;  5DZG A;  1LR5 A;  1ULG A;  3AKQ A;  4GB3 2;  1S4C A;  3WG4 A;  2VCB A;  3USS A;  1BQP A;  1FNZ A;  1BBT 3;  1XSR A;  3ACL A;  4QQL A;  3WPV A;  2D6P A;  1H1A A;  5GJ6 A;  5EIY B;  3KLS A;  5I8T A;  1KJL A;  2PLV 3;  5FUP A;  1RUG 2;  2QE3 A;  3WLU A;  4E2S A;  5IK8 A;  1W2T A;  2ZZQ A;  1AX0 A;  4N7I A;  4Z2A A;  2FDK A;  5C0P A;  2QFE A;  1O3T A;  3N9L A;  2YHJ A;  3S0M A;  4BHP A;  4MYE A;  3H50 A;  1WCS A;  3WCR A;  3E5X A;  2AEN A;  1FYU A;  2Q0A A;  4QPW A;  4LKE A;  3BYW A;  4LEJ A;  3SLI A;  2BGC A;  3CLP A;  1ZBE 2;  3MPP G;  4AVA A;  1AYM 3;  2QZ3 A;  3OJB A;  4IEZ A;  4LBQ A;  5K8S A;  1US3 A;  1VBC 1;  4AHX A;  1L3J A;  2BNN A;  1S0I A;  1XYP A;  2HWC 1;  5G05 L;  2YRO A;  3ZPO A;  2PYT A;  3DKQ A;  2E53 A;  3UYJ A;  2A71 A;  2JDH A;  4GKX A;  4PHZ A;  4TWT A;  1FX5 A;  1RTV A;  2ZS6 B;  1PO2 1;  2YFT A;  1RMU 3;  4IXL A;  1F35 A;  1FPN 3;  1YQ8 A;  3QEE A;  1RUH 3;  1R1A 1;  1Z7S 2;  5JVV A;  1IS3 A;  1WKY A;  2V09 A;  2J1R A;  4FP3 A;  4OUL A;  1SG3 A;  1IS4 A;  3WPU A;  3C7O A;  5FYV A;  3RRD A;  1PZ7 A;  4COZ A;  1AR7 2;  2WNU C;  1WCD J;  4NWW A;  1VMH A;  1RUI 1;  3GCW A;  2VZT A;  2Z4F A;  3W58 A;  1DDL A;  1TMF 3;  3E6D A;  3LEK A;  2C1F A;  1NX9 A;  2XHK A;  3QD6 A;  2JEM A;  4FXG B;  3WAS A;  1JZ8 A;  5AC9 3;  1K5M A;  2DCZ A;  4UI9 L;  3AZW A;  4C0B A;  3WMZ A;  3BN6 A;  2HWE 3;  3CQO A;  3KB5 A;  4NAO A;  1GZT A;  2JDA A;  2Q8D A;  4JAA A;  4EYU A;  5J3U A;  1SFP A;  4JCK A;  3I3M A;  4MAD A;  4AFC A;  1XNK A;  3P3P A;  2FHR A;  3HBK A;  3RPQ A;  3LFM A;  4OHX A;  2XR4 A;  3AFK A;  2QQJ A;  1R1Z A;  4QXC A;  4UFJ A;  4A44 A;  3GDB A;  1IGO A;  3OBT A;  1O8S A;  4FPF A;  3N9Q A;  4BME A;  1RGS A;  1W18 A;  4QKN A;  4BQ3 A;  3HNB M;  3AJZ A;  3RJ2 X;  1QJY 2;  1JU4 A;  4CCC A;  2E7A A;  4LO8 A;  1OLM E;  5FO7 B;  2BTV C;  3VLB B;  3VBR C;  4PIY A;  4DUV A;  1W6M A;  4Q4V 3;  4TYS A;  1FV3 A;  4R4X A;  2MEV 2;  4AI8 A;  3B7M A;  4YVS B;  3WF2 A;  3M8L A;  5A3T A;  4DQA A;  1HN0 A;  3LAG A;  2J1E A;  4WM8 B;  1RUF 2;  5I8Y A;  4NMI A;  4HN0 A;  1W3X A;  3POE A;  4KGG A;  1RUE 1;  3OGV A;  2WLP A;  1KD7 A;  3FBY A;  3FLT A;  3G7D A;  1U5X A;  4Y5S A;  1OMI A;  1QXP A;  1EV1 1;  5BNP B;  2WS9 2;  1WLD A;  4FOW A;  3AYE A;  2VOW A;  3HBZ A;  3WF4 A;  4QQP A;  3VT0 A;  4GA9 A;  3O1M A;  4AI1 A;  1NCR A;  1JUH A;  1RUJ 1;  2ZGK A;  4H14 A;  4YVW B;  1MEC 3;  2RR1 2;  5EFU A;  2HBT A;  5A3L A;  1JYW A;  1AL2 2;  3ACH A;  3ZLI A;  2ZAC A;  2WQ8 A;  1ZRF A;  1SLC A;  3H7Y A;  1OOP B;  4BU2 A;  4C90 A;  4IE0 A;  5L9V A;  2DVD A;  4FFI A;  2NMO A;  4ZPI A;  3E6B A;  2Z2S B;  3WF1 A;  3AC0 A;  2WO1 A;  1EAH 1;  4YVS C;  3RYR A;  4IDZ A;  3H42 B;  4X8N A;  4BCU A;  2GC0 A;  5C9A A;  5H9S A;  4CEY A;  5KXC A;  2CL2 A;  3PMS A;  3WDX A;  3AKS A;  3JB4 C;  1N1V A;  1HB1 A;  2VCC A;  4CDW B;  3CNA A;  3LD8 A;  1U5Y A;  1RUD 3;  2AAC A;  4KL1 A;  5FPZ A;  2EVX A;  4BMB A;  1KGY A;  1YLL A;  2YB7 A;  2WS9 1;  3WDY A;  5ACA 3;  5FO9 B;  4KU8 A;  5EWS A;  1X50 A;  3IDC B;  3ZFF A;  5C70 A;  1POV 0;  2TEP A;  3TN9 1;  4LNV A;  2VNG A;  3WUD A;  2PQS A;  1YO8 A;  1X36 A;  1VMJ A;  4XEZ A;  2AH2 A;  1W6Q A;  5F5C A;  1Q3E A;  3NKT A;  4OHV A;  2FDH A;  3OOX A;  2LW8 A;  4ZON A;  1V9U 3;  4CCJ A;  1HXS 3;  2VMC A;  3WNO A;  3HIF A;  2D3P A;  4KGQ A;  2YFZ A;  5FZI A;  2E6V A;  3CJX A;  2X8T A;  1GYK A;  4Y1V A;  3BYN A;  4AK6 A;  1BJQ A;  3IDA A;  1DLL A;  1W2A X;  1YUD A;  4DUX A;  4P00 B;  1YEW A;  1PHM A;  4XZU G;  5ERL A;  2VVF A;  4AGV A;  5T52 A;  1UN1 A;  2RV9 A;  5GLL A;  3IPV B;  5EYX A;  3VSZ A;  3POG A;  4CPB A;  1SFN A;  3B02 A;  3POW A;  4HSL A;  1W9Y A;  5CFD A;  5A3U A;  1OYG A;  1W05 A;  1AUY A;  1I3H A;  2OX0 A;  4KH9 A;  1JBC A;  3ZN4 A;  3VUO A;  1XOY A;  4L92 A;  5FP4 A;  2VOV A;  2VMF A;  4M0N A;  4AEK A;  5L73 A;  1ENX A;  3WR0 A;  4ARX A;  2ETE A;  2H0V A;  1GAN A;  3O1T A;  3W9A A;  2VC9 A;  4O8O A;  4OHW A;  5FYI A;  1LHV A;  2A6W A;  4D47 A;  3AX4 A;  2JB8 A;  1ASJ 3;  1W8Z A;  1YIF A;  3OPT A;  3VL9 A;  5HV4 A;  3SH4 A;  1JZ2 A;  2OZ6 A;  4NJ4 A;  5FK7 A;  3RZZ A;  3OTF A;  2XJV A;  3C7E A;  5DAB A;  5JXJ A;  1MQT C;  1BKZ A;  3O5S A;  4Q4Y 2;  4S2D A;  1CAU B;  3T2T A;  4XFA A;  1FNY A;  3G6J B;  1DFQ A;  1QJX 2;  2OA2 A;  3WW4 A;  3NAP C;  3HQX A;  2VTX J;  5APA A;  3THP A;  5HCB A;  1JYX A;  3RMY A;  2R30 A;  2H0B A;  1YRZ A;  4FAH A;  5FQ0 A;  3KGL A;  4DXS A;  4E4S A;  4SBV A;  4HET A;  4ITC A;  4I30 A;  1SAC A;  4JRA A;  4XBL A;  4AXO A;  4M3C A;  2P3K A;  3ES1 A;  1NCR C;  4Q1R A;  2Y6K A;  2VOX A;  1YCI A;  3IBM A;  2AR6 A;  3MW4 A;  1RVF 3;  4MGQ A;  4MGY E;  4WZC A;  5AVA A;  5JUV A;  3TEY A;  3VD9 A;  3KQ4 B;  2GAU A;  5C2M A;  2XUE A;  3EHK A;  1QDO A;  4AGG A;  1CIW A;  3PL0 A;  3DYO A;  2PHF A;  3ETP A;  1YFU A;  4D0Q A;  5LA0 A;  3CZU A;  4PDW A;  3WDW A;  2VUA A;  4UT5 A;  4XFG A;  3RG0 A;  2WA3 A;  3BPZ A;  4EQV A;  3P6B A;  4QB2 A;  1Z0H A;  4K40 A;  4Q4X 3;  1O4Y A;  1W6P A;  1UOJ A;  2W94 A;  1C1L A;  1KFU L;  2D5F A;  2VMI A;  1CAX A;  3VBU C;  1W39 A;  4XTM A;  1A8D A;  4CA9 A;  5CAZ A;  3TNQ A;  1H8T A;  4ONU A;  1JI6 A;  4QHZ A;  4W6W A;  3PME A;  4EN8 B;  1COV 3;  1KRI A;  1LHO A;  1RUI 3;  2MPF A;  5FYS A;  1DF0 A;  1S0B A;  1VE0 A;  5IAX A;  2RS3 2;  4K21 A;  3LIG A;  5HV0 A;  4YW3 A;  3A7Q A;  4NHM A;  2R16 A;  3MI8 A;  5FKB A;  4DMI A;  1D2Q A;  1W0O A;  4J1W A;  3HNM A;  1ZYB A;  4CP1 A;  2SLI A;  1W8N A;  2GN3 A;  5DPN A;  2DFC A;  5C3S A;  3HN1 A;  4JX0 A;  2WZR 2;  2GH8 A;  1SBF A;  4IEO A;  4Y5T A;  5KHK A;  4FSJ A;  4N53 C;  1UYX A;  1J59 A;  1F15 A;  1AYM 1;  3E97 A;  5LW9 A;  1V6J A;  3J7N A;  2D3R A;  4CSW A;  5KWR A;  1WL7 A;  1L7Q A;  2YPJ A;  4AAX A;  4QDS A;  4Z2W A;  1JOD A;  1HKD A;  1QOS A;  2B4K A;  4RFT 0;  1AXZ A;  1W8O A;  2RMU 1;  2VTF A;  4K6B A;  4D7T A;  3D0J A;  1H4H A;  3PDQ A;  2PHU A;  4IES A;  2D5H A;  2HLE A;  1J3R A;  3A4U A;  4YWA A;  4QKB A;  1GQH A;  1J3Q A;  1MZ6 A;  1RUJ 3;  1REF A;  3MW3 A;  4W6Y A;  2ORZ A;  3POJ A;  5GM0 A;  1QH7 A;  4FTB A;  4Y1X A;  4DEV A;  4QB1 A;  3K46 A;  1GQG A;  3KV6 A;  4UF0 A;  2J1S A;  5T3N A;  3JD7 1;  2WFF 2;  1HB4 A;  4CDW A;  4NRP A;  3TBD A;  4MUV A;  4LBJ A;  5IVJ A;  4O8N A;  1ZA7 A;  3BTA A;  2Y6L A;  4KCA A;  2AGS A;  4CDQ A;  1KFX L;  3V0B A;  2B4W A;  3OM5 A;  3VD4 A;  1I9R A;  1AR8 1;  3O0V A;  5FP9 A;  1S55 A;  1O3Q A;  3N7K A;  4QHO A;  4ONZ A;  4MSV A;  1AR7 3;  1GFF 2;  3FWE A;  4YYO A;  3SEE A;  1AR8 2;  1PT2 A;  3DPR C;  3TRS B;  4I2O A;  4NID A;  1YXW A;  1YQ2 A;  2RR1 1;  3M2M A;  2NM1 A;  3OY8 B;  4JGY C;  4MV2 A;  1PNF A;  2VO5 A;  3IDE A;  3POY A;  3SH5 A;  1VBA 3;  4BQ4 A;  4GAL A;  3AP7 A;  4M3C E;  1O5L A;  3LPG A;  2ARX A;  4YGE A;  5A7S A;  3Q8A A;  1R08 1;  1XBF A;  3B00 A;  5EJ3 A;  3TN9 3;  1QQP 1;  2D97 A;  1I6X A;  2QQV A;  5GZD A;  1F5J A;  2YGM A;  4TTG A;  3IB3 A;  2I45 A;  4GWN A;  4KMQ A;  2A70 A;  2RS1 2;  4Q29 A;  1ZZ6 A;  3KS7 A;  5FUI A;  4FTE A;  3AZX A;  1V70 A;  2DDU A;  5IVV A;  4NAM A;  1UW8 A;  2RS1 1;  4MHR A;  1C8M 1;  1PGW 2;  3PUQ A;  3WN1 A;  5FP7 A;  5C33 A;  1G9A A;  1DGW A;  4QT6 A;  5C3R A;  2OPW A;  3ZMO A;  5HBA A;  5IFT A;  3KVA A;  5IT6 A;  4CDU C;  3KGZ A;  1TQ5 A;  3ITQ A;  5CA6 A;  5FZK A;  5FZO A;  4LXL A;  4AWD A;  5C4W C;  2D6N A;  5CB7 A;  1OI6 A;  2FDJ A;  4KU7 A;  1A8M A;  1CWP A;  1RXF A;  1W6Q B;  1VB4 A;  4R52 A;  4LBK A;  1GIC A;  1OFN A;  3CEW A;  3KZ4 C;  3ZX7 A;  1Q8Q A;  4OUS A;  4JKK A;  4E9K A;  3BU0 A;  1VBD 3;  4FI9 A;  4OHZ A;  2RDN A;  2YMZ A;  3H8X A;  1UYP A;  3SXW A;  2ZX4 A;  1VRH 3;  2D43 A;  1G7Y A;  5L9R A;  2WWJ A;  3GZA A;  5FCC A;  3WOG A;  4CCE A;  1C4R A;  2ZPX A;  4N9H A;  3WY6 A;  1UIJ A;  3D82 A;  4P9J A;  3H1Y A;  5FXX A;  2XL9 A;  4LMF A;  5IYY A;  5FRA A;  4M00 A;  4DFS A;  1GWM A;  3MFC A;  5LA2 A;  3UL2 A;  5IK7 A;  5A3W A;  4B29 A;  3NRU A;  3SIT A;  4NO4 A;  1NE4 A;  2EF6 A;  1PMH X;  5KHH A;  2WC2 A;  2OKX A;  2VZV A;  4G3Y C;  3DXT A;  5IFP A;  1H30 A;  2ZHM A;  3WV6 A;  2GP3 A;  4QX3 A;  4RHV 2;  2ZXQ A;  4IV3 A;  2UY8 A;  2JG9 C;  2QQK A;  4Y1U A;  3A23 A;  1V6N A;  1NA1 C;  5L7O A;  1JS9 A;  4YGC A;  5LZ6 A;  5GLM A;  4IE5 A;  2PFW A;  1HX6 A;  4D7S A;  1OOP A;  4PJY A;  3WHU A;  4AI2 A;  1OA4 A;  3MLL A;  5DXD A;  3SKJ E;  2YY1 A;  3WCS A;  2NLR A;  2XL7 A;  4DY3 A;  1ZRE A;  5T5P A;  1RUD 2;  3J4U H;  3GBF A;  5D8A A;  2QNK A;  4XDP A;  3WF0 A;  4N53 B;  5FBZ A;  1C28 A;  4CYD A;  3BYK A;  3R0R A;  4YW6 A;  4A6O A;  4IV3 B;  1WA6 X;  2Y34 A;  4Q0V A;  1CR7 A;  4LA3 A;  4NHL A;  4ZS2 A;  1PGL 2;  3BIW E;  3OUJ A;  4QXK A;  2R1B A;  1S0G A;  4AI0 A;  4HKW A;  3VD3 A;  1GP6 A;  4Q4Y 1;  3RMX A;  2RS3 1;  3OGJ A;  4OCT A;  4RSU A;  4AED B;  1UOF A;  3RNS A;  4DS0 A;  1T6B X;  2P4E A;  3F95 A;  2ZGT A;  3ZYR A;  5LRS A;  2NZ9 A;  3I8T A;  3PVB B;  3WT3 A;  4P9W A;  4QGL A;  1V9U 1;  4CUA A;  1CGP A;  2VW2 A;  4UW5 A;  3R6S A;  4XE9 A;  1FPN 1;  1PO2 3;  1WME A;  1R1A 3;  4AVV A;  1F4H A;  3OPZ A;  4FPH A;  5F8P A;  1SCR A;  4AQ2 A;  5CG8 A;  4XUQ A;  1GZW B;  2XQR A;  5FIX A;  4A3Z A;  1C5H A;  2PN5 A;  4IGO A;  1VP6 A;  1FI2 A;  3LEI A;  4UFM A;  3GBW A;  4WV8 A;  1UZZ A;  4RGG A;  3ZDS A;  5A32 A;  5C7G A;  3ZYF A;  3NVC A;  1S1A A;  5C8C A;  3APB A;  4Y3O A;  2D6L X;  1N1T A;  2G9F A;  3NJV A;  1OPO A;  3VBO C;  2C4X A;  4HVO A;  1GNH A;  1H9P A;  1QGL A;  1WA4 A;  1H1M A;  2EXJ A;  1OPM A;  2NMN A;  4PIZ A;  1X8M A;  2C24 A;  5DAV A;  3J7H A;  1IQA A;  3ILN A;  3ZXE A;  2UU8 A;  4GH4 C;  4MHU A;  4N4B A;  4WZF A;  4CUB A;  1FAY A;  2WSV A;  1JOJ A;  4UFK A;  2Y33 A;  4HMZ A;  3UK9 A;  3S6P A;  1LOA A;  1N47 A;  2WFF 3;  5CAD A;  1UX7 A;  4K9S A;  4JKM A;  2BU9 A;  1WGP A;  1O5U A;  1C3H A;  1SPP A;  3VDD B;  3J8F 2;  4UW6 A;  4C1X A;  1BZW A;  3AKP A;  2A3Y A;  4KBB A;  3V0A B;  2F6B A;  1D7P M;  2A1X A;  4XF0 A;  1KQR A;  5FZ1 A;  4XJ9 A;  3ZVX A;  1X9P A;  5JXH A;  5L36 A;  3I3Q A;  3POB A;  3IZO A;  2K2S A;  4CPB D;  3RYP A;  2R06 1;  1D0H A;  2VR4 A;  3GCX A;  2VZQ A;  3CU7 A;  5GZC A;  2ES3 A;  4FO9 A;  1CIY A;  3U1X A;  1KEX A;  5FPV A;  4MGI E;  4DRR A;  1W9T A;  1NCQ B;  4CDW C;  3HWJ A;  2DVA A;  2OT7 A;  5DN2 A;  5ANN A;  4DOU A;  5FYT A;  3NNJ A;  4HPK A;  2WNO A;  4AVC A;  2YYO A;  3AZV A;  4AED C;  1X7N A;  1LGC A;  4KCB A;  4LE4 A;  1Y43 B;  2OUH A;  3HN3 A;  1TMF 2;  4LBL A;  1VBE 2;  4DO0 A;  1WMD A;  1BEV 2;  2VU9 A;  4OVE A;  1U0A A;  1D4M 1;  3AP6 A;  1OQ1 A;  1XSQ A;  4LHS A;  4Q1P A;  4UW3 A;  4YM1 A;  5G04 L;  4YM3 A;  4ZZ5 A;  1YIP A;  3GXU A;  4LBQ D;  4PQQ A;  1JZ5 A;  2QKD A;  2FCV A;  2IVJ A;  5GAL A;  1LOG A;  3T09 A;  3O1V A;  4E8D A;  1EAH 2;  2ZGL A;  2WZ8 A;  1ASJ 2;  2VJX A;  3K4A A;  4PBO A;  3JD7 2;  4ZZ8 A;  4XYX A;  5E6H A;  1F5F A;  1G86 A;  1M06 G;  1GP4 A;  1DP0 A;  4CUG A;  4P02 B;  4UFL A;  4U6B A;  3N7J A;  3RZJ A;  1UY4 A;  4C91 A;  3WMY A;  3PIJ A;  1BYH A;  1WUV A;  4WBB A;  1UNB A;  2VY0 A;  4LK6 A;  4OMC A;  4QPG A;  3UKV A;  4CEW A;  4QPY A;  3ACG A;  2XHN A;  3M3I A;  3CJI A;  2HEW F;  3ECQ A;  2X05 A;  4IEX A;  1V0A A;  4HVR A;  2VME A;  4FPJ A;  5LK5 A;  5D8A C;  5LA1 A;  1B35 A;  2Q1Z B;  1C8N A;  3LOI A;  3W5N A;  1XNA A;  2YFU A;  4QM9 A;  2OUJ A;  4WM8 C;  2W1S A;  1J1T A;  2CV6 A;  5FPX A;  5A7W B;  4HG6 B;  4O8P A;  1AYN 2;  1B09 A;  2F4P A;  2JDM A;  2R06 3;  4BIO A;  1ZZB A;  1SLT A;  1HN1 A;  2WR9 A;  1O3S A;  4A7Y A;  1A34 A;  1BLZ A;  1ONA A;  4P9Y A;  2WN2 A;  5JOY A;  3RZM A;  4AK5 A;  3FHQ A;  2DWR A;  3J26 N;  4RL7 A;  5I0T A;  3IN9 A;  1MS8 A;  2WBK A;  4TXW A;  2MHF A;  1XC6 A;  4GB3 3;  3BTZ A;  1O6U A;  2W9X A;  1UKR A;  1CAX B;  4P5H A;  5FZ8 A;  4YZ5 A;  4QXB A;  3W5M A;  1UO9 A;  2A73 B;  1Q56 A;  1XYN A;  4CP9 B;  1PX3 A;  4IGP A;  4LOR A;  1JOP A;  1SMV A;  4V2V A;  5FZB A;  3V65 A;  5GLU A;  5D1I A;  5A7Q A;  1BXH A;  4HVQ A;  5H9Q A;  3VZK A;  1BK0 A;  4CP2 A;  4AW7 A;  5T5J A;  1XQN A;  4GUL A;  1SLB A;  3WQ0 A;  1PGW 1;  2WZR 3;  3H8R A;  1S0D A;  4CCO A;  3NMB A;  1DGR N;  4PDW B;  2BW8 A;  4CU8 A;  4UOJ A;  4M3C B;  1CQ9 A;  2WFP A;  1BBT 1;  3AKT A;  4QGM A;  2JWP A;  1QJU 1;  1LU1 A;  3IIA A;  3LGR A;  4GMP 1;  1WCK A;  5DUX A;  4QU2 A;  3NNM A;  2HWF 3;  3OUI A;  5FY5 A;  3VZM A;  4Q27 A;  2R1D A;  1DYP A;  1GOH A;  5A7N A;  1JW6 A;  3K2O A;  4XHX A;  4ATE A;  5ANQ A;  3WUC A;  3ZKY A;  5FOJ B;  5KHI A;  2XLG A;  3OPW A;  1KJR A;  2P3I A;  3JB8 A;  2YBP A;  4V1P A;  3AVS A;  3D61 A;  4HKL A;  4CDX B;  1O7F A;  1JYI A;  4FFG A;  2Y6H A;  5FPL A;  2QQI A;  3ZXD A;  4UBH A;  2WWU A;  4UFI A;  3VDB A;  4LA2 A;  2DCJ A;  4K3U A;  2JIG A;  3SMH A;  3O14 A;  4ZKT B;  4RQP A;  4RHV 1;  5JAX A;  4PVI A;  1UU4 A;  3VHO A;  1SZB A;  2NQY A;  1AX1 A;  5FZH A;  4FOY A;  3UES A;  5KR7 A;  5FAX A;  5JPM B;  4PF5 A;  1IPJ A;  1HXS 2;  3H3Z A;  1RED A;  1A3K A;  2VXJ A;  1IG0 A;  1OVP A;  5IUQ A;  3WW2 A;  2ZKL A;  3VHN A;  2DU0 A;  2LS6 A;  2O1Q A;  2VZ1 A;  3LSD A;  3QOP A;  5FZ7 A;  5FR3 A;  3QZ4 A;  1HV0 A;  4AFB A;  2Y60 A;  4AVT A;  1RC6 A;  3VL8 A;  1TEI A;  4BPZ A;  2BWA A;  2E32 A;  2RG4 A;  3VZJ A;  3IPV A;  4Y22 B;  4QPI B;  1CJD A;  3T0B A;  5JLV A;  3RWN A;  2R0F A;  3ABZ A;  3ZYJ B;  1U5I A;  2DVB A;  1HIX A;  2ADE A;  4BLJ A;  1RUE 3;  2ZML A;  4GMP 3;  4TN7 A;  4EWE A;  1J3P A;  4MLO A;  3VDD A;  3ASI A;  3AYC A;  5BNO B;  1VAV A;  3AMN A;  1AR7 1;  2QUO A;  4DB5 A;  5JXG A;  2YU2 A;  3P3N A;  3SEP A;  5IVE A;  3BB6 A;  4Y26 A;  2WZR 1;  2DUP A;  3HJR A;  3VBH A;  2PTM A;  3IWZ A;  4BXF A;  5F6L B;  1W8F A;  4CCM A;  4LBN A;  4NE9 A;  4CEW B;  2ZHN A;  1ZBA 1;  1EY2 A;  4ZY9 A;  4Q8K A; 
#chains in the Genus database with same CATH homology
 1O8P A;  4DUX A;  3AKI A;  1GUI A;  4P00 B;  3MUY 1;  2EXI A;  3OM7 A;  4XZU G;  1ULP A;  2RV9 A;  5GLK A;  5GLL A;  5AYC A;  2W1W A;  3III A;  3VSZ A;  2EXK A;  3FL7 A;  4MO3 M;  1Y9G A;  3OM4 A;  3AKH A;  3KF5 A;  3EYP A;  1TVG A;  1EUT A;  5AYE A;  1OYG A;  4E8C A;  4UDJ A;  2CDO A;  5A8D A;  4FFF A;  4JKL A;  2VMF A;  4ARX A;  3IAP A;  4QAW A;  3OM2 A;  4O8O A;  2VC9 A;  1K3I A;  4BXS V;  4D47 A;  3LDR A;  4CUC A;  4UDI A;  1YIF A;  3WAU A;  1JZ2 A;  5FK7 A;  5AY9 A;  1UY2 A;  4BDV B;  3C7E A;  5JXJ A;  4L0P A;  4DUW A;  3LQC A;  3K4D A;  1JZ3 A;  4N2R A;  2WN3 A;  5IJR A;  3VDC A;  2JKX A;  3CKH A;  5JOX A;  3I2F A;  2AEZ A;  3WPZ A;  1JYX A;  1NAE A;  2YG0 A;  1UYZ A;  1YRZ A;  2E26 A;  2AC1 A;  4DXS A;  1JU3 A;  1RYY A;  1Y9M A;  3JXS A;  4NOV A;  2X8F A;  3VD5 A;  2HYX A;  2Y6K A;  3K77 A;  1DYO A;  3LF7 A;  4MGQ A;  2QQM A;  3VD9 A;  4A42 A;  1R64 A;  1SHW B;  1UXX X;  5JUV A;  4UDG A;  3WQB A;  3K75 B;  3DYO A;  4D0Q A;  2L9L A;  3ETP A;  2V4V A;  5LA0 A;  3CZU A;  3P2N A;  5GLR A;  3VSF A;  4EQV A;  3P6B A;  2W1U A;  4QB2 A;  2J22 A;  2W94 A;  3OGR A;  3ZXK A;  4AK7 A;  3OGS A;  4UDK E;  3C7G A;  5HXM A;  1JI6 A;  3CMG A;  1JYN A;  1GU3 A;  3WN2 A;  2ZEX A;  3VT2 A;  3WPY A;  2RJ2 A;  3LIG A;  1J84 A;  2VZS A;  4GWJ A;  2VZ3 A;  3A7Q A;  5FKB A;  3WNK A;  1MPX A;  5A7V A;  3OEA A;  2J1U A;  1UY3 A;  3HNM A;  5JR2 A;  1W8N A;  5DPN A;  3UGH A;  4JX0 A;  2X8S A;  1GQP A;  2W1Q A;  1L7R A;  3T08 A;  2AEY A;  1K45 A;  4M4R A;  4KI5 M;  1JZ7 A;  2QQL A;  1UYX A;  3LFI A;  1I5P A;  3WF3 A;  3I3B A;  4MLG A;  5GLO A;  3UNP A;  1L7Q A;  4AAX A;  1WL7 A;  4QDS A;  4IUG A;  2W92 A;  1W9S A;  2B4K A;  3THD A;  4QX0 A;  1W8O A;  3T2Q A;  2QQO A;  2VTF A;  4DEQ A;  4QDQ A;  3U14 A;  2RVA A;  3PUI A;  3WN0 A;  2HLE A;  2QQN A;  2ZEZ A;  3NQH A;  2C26 A;  3LDK A;  2EIB A;  4CU7 A;  2ORZ A;  2J7M A;  4DEV A;  3LEG A;  4QB1 A;  5DQ0 A;  3K46 A;  4ARY A;  3HEI A;  3I2G A;  2J1S A;  3MV0 1;  5GLN A;  5HPO A;  4OZO A;  3CIH A;  4O8N A;  3D5Z A;  1JYV A;  2Y6L A;  4KCA A;  3CZJ A;  2B4W A;  2E31 A;  1UV4 A;  3OM5 A;  4A45 A;  3VD4 A;  2VZR A;  3P1I A;  1H6Y A;  3OB8 A;  3ZXJ A;  1F4A A;  4ONZ A;  5FKC A;  1PT2 A;  3SEE A;  4MOA A;  1YQ2 A;  2R7E B;  4CVU A;  2VM9 A;  2VO5 A;  2WAO A;  2XOM A;  4FFH A;  4M4P A;  1NUK A;  2YC2 A;  5EJ1 B;  3CU9 A;  3LPG A;  2WYS A;  3BGA A;  1XNT A;  1UY0 A;  1OT5 A;  2QQV A;  2W87 A;  1PX4 A;  4TTG A;  3IB3 A;  4KMQ A;  2W46 A;  2DCK A;  1K42 A;  5FUI A;  2DDU A;  2WO3 A;  1Y4W A;  1CZT A;  3LIH A;  2W5F A;  4XUP A;  3GM8 A;  3I2K A;  1W9W A;  3WN1 A;  4YPJ A;  1UYY A;  2VQU A;  2ZEW A;  2BZD A;  1VKD A;  5IFT A;  3ACI A;  3LEM A;  4GZ9 A;  4XUR A;  4BK4 A;  4COT A;  5A7V B;  1PMJ X;  1LNS A;  5B4X A;  3MUZ 1;  3I2J A;  4D8M A;  4JKK A;  3R4Z A;  2J1A A;  3U37 A;  4FI9 A;  1EUU A;  5CZK A;  1UYP A;  1P8J A;  3C2U A;  4GWI A;  3I2I A;  2W95 A;  3HOB A;  3WNL A;  1US2 A;  5F7U A;  1UY1 A;  2V72 A;  3LV4 A;  1JHJ A;  2ID4 A;  5IYY A;  3WNM A;  5JOZ A;  4QB6 A;  5LA2 A;  4UAP A;  3NRU A;  2WUH A;  3T0A A;  1TG7 A;  1PMH X;  1GMM A;  2OKX A;  2VZV A;  2BER A;  5IFP A;  4QX3 A;  2ZXQ A;  3DYP A;  2QQK A;  4P08 A;  3A23 A;  4KC7 A;  3AKG A;  5LCW L;  3QED A;  4XUO A;  1W0N A;  3U75 A;  5GLM A;  1T2X A;  3CDZ B;  4DXR A;  2B9V A;  3SKJ E;  1J83 A;  2WO2 A;  5B6S A;  4U6D A;  2VOT A;  3R67 A;  1BHG A;  4QX2 A;  3A22 A;  1ULO A;  3C7F A;  3OEB A;  4QX1 A;  3WF0 A;  3BYK A;  4A6O A;  3DYM A;  2WDB A;  3OBA A;  3VDA A;  4RN5 A;  3T2P A;  4BK5 A;  5FMB A;  1GOF A;  2VMD A;  2X09 A;  5JMO A;  2BBA A;  3HNY M;  3T2O A;  3VD3 A;  5B4N A;  3UGG A;  2VL4 A;  1GOG A;  4QDR A;  4CUA A;  2EXH A;  2V5D A;  3K4Z A;  5C71 A;  5EJZ B;  3RWK X;  2XON A;  2YFR A;  1F4H A;  4ZXE A;  3AKF A;  4XUQ A;  3QEF A;  2XQR A;  4A3Z A;  5FIX A;  5I0D A;  3QC2 A;  2VZU A;  2KD7 A;  4PT6 A;  4CU6 A;  3LEI A;  3OG2 A;  4W4Z A;  3C8X A;  1NKG A;  3D60 A;  2C9K A;  4UDK A;  5C7G A;  3K1U A;  3WEZ A;  3D3A A;  1H6X A;  1GYD B;  3VSS A;  3NJV A;  1GYH A;  2EIC A;  4PF1 A;  2C4X A;  4KMI A;  2EXJ A;  4KWU A;  1UXZ A;  3KF3 A;  3I2H A;  3J7H A;  4N4B A;  4CUB A;  4XUT A;  2QQW A;  1UX7 A;  3IAQ A;  4JKM A;  4XVH A;  1OD3 A;  4W50 A;  3SC7 X;  4AG4 A;  4XUN A;  2WZE A;  3VD7 A;  4PVA A;  2QBX A;  1D7P M;  2JE8 A;  5FMD A;  1UZ0 A;  3WNP A;  1YI7 A;  4DXT A;  3KST A;  2VZO A;  5JXH A;  1UMH A;  1CZV A;  2VCB A;  3WPV A;  3NJX A;  4OYU A;  5EIY B;  3OM6 A;  1OH4 A;  2VR4 A;  2VZQ A;  1CIY A;  3MBW A;  4A4A A;  1W2T A;  1KEX A;  4Z2A A;  1W9T A;  5C0P A;  2W47 A;  3NNG A;  3DEC A;  1IQD C;  5DN2 A;  1CX1 A;  5ANN A;  3PUH A;  5CYY A;  1ST8 A;  4QPW A;  4KCB A;  2WAB A;  3HN3 A;  4RYD A;  3R4Y A;  5GLP A;  1US3 A;  4LHS A;  5G04 L;  3UET A;  4ZZ5 A;  3LE0 A;  3T0D A;  4PQQ A;  3GXU A;  1JZ5 A;  5G05 L;  3T09 A;  3FHA A;  4E8D A;  1GYE B;  1K12 A;  3D5Y A;  2W3J A;  2WZ8 A;  2VJX A;  3K4A A;  4ZZ8 A;  2YFT A;  3QEE A;  1DP0 A;  2VZP A;  5GLQ A;  1WKY A;  4P02 B;  4U6B A;  1UY4 A;  2J1R A;  3WMY A;  1OF4 A;  5JOW A;  3HPN A;  1SG3 A;  4ZY9 A;  3PIJ A;  3WPU A;  3C7O A;  3VSR A;  4OMC A;  4W8J A;  3ACG A;  2XHN A;  2Y6G A;  2VZT A;  2Z4F A;  4P5Y A;  3LEK A;  3ECQ A;  2X05 A;  1NX9 A;  5LA1 A;  2VME A;  3WAS A;  3BYJ A;  3WNN A;  1JZ8 A;  3W5N A;  1XNA A;  2VQT A;  2YFU A;  4MGS A;  2Y64 A;  2WAA A;  4UI9 L;  1UWW A;  2VDT A;  2ORX A;  3WMZ A;  2W91 A;  2W1S A;  3BN6 A;  3CQO A;  2VCA A;  4OUE A;  4O8P A;  4HG6 B;  2JDA A;  1HN1 A;  4MAD A;  2WN2 A;  4AK5 A;  5JOY A;  3FHQ A;  2E33 A;  4BJ0 A;  2QQJ A;  2WBK A;  4TXW A;  1UMI A;  1XC6 A;  3GDB A;  4A44 A;  1O8S A;  5AYD A;  2QQU A;  2W9X A;  5A8C A;  3W5M A;  1W18 A;  3SKV A;  3HNB M;  1PX3 A;  1JU4 A;  2ZEY A;  3C7H A;  4DUV A;  1DLC A;  4QQS A;  3WF2 A;  2J1E A;  2Y8K A;  3MO4 A;  3OGV A;  3THC A;  4CU8 A;  4UOJ A;  4N1I A;  3EB7 A;  1JZ4 A;  5FLW A;  1CZS A;  3WF4 A;  5DMY A;  3VT0 A;  2EID A;  3FN9 A;  1GOH A;  1SDD B;  2CDP A;  2OXB A;  3WSO A;  1JYW A;  3ACH A;  5FK8 A;  4N2Z A;  1JZ6 A;  2WQ8 A;  3BYL A;  3D61 A;  2BGO A;  3ZXL A;  4FFG A;  5J1X A;  2Y6H A;  2EIE A;  1XPW A;  2QQI A;  4LQR A;  4FFI A;  4A41 A;  3VDB A;  2DCJ A;  1GNY A;  3WF1 A;  3AC0 A;  2WO1 A;  4ET7 A;  1WCQ A;  3PIG A;  4PVI A;  3I3D A;  3LPF A;  3MV1 1;  1OF3 A;  3I3E A;  4JHZ A;  4OMD A;  3UES A;  3ACF A;  4LKS A;  3ZM8 A;  4LPL A;  2ADD A;  2VCC A;  2LS6 A;  3E1F 1;  2VZ1 A;  3QZ4 A;  2Y6J A;  5IHR A;  1KGY A;  2YB7 A;  2XQX A;  1Y7B A;  2E32 A;  2YC4 A;  3GGL A;  5A1A A;  2JD9 A;  2YFS A;  3UGF A;  3T0B A;  5C70 A;  1W99 A;  3A21 A;  3ABZ A;  2ADE A;  2J1T A;  3F2Z A;  2J1V A;  3WAT A;  3TAW A;  2PQS A;  4CU9 A;  4KC8 A;  1O59 A;  5FMC A;  5B6T A;  5JXG A;  3SEP A;  2LW8 A;  3WNO A;  2VMC A;  2BGP A;  3HJR A;  2YFZ A;  3VT1 A;  2X10 A;  2X8T A;  3BYN A;  5JXI A;  3I97 A;  4AK6 A;  3IDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...