3C7HA

Crystal structure of glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with axos-4-0.5.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
487
structure length
487
Chain Sequence
b'ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endo-1,4-beta-xylanase
publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 134
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7hA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7hA02
2E31A 4MOAA 2C26A 3LIHA 3WAUA 4PT6A 2EIBA 2W46A 4UDKE 2V4VA 3NJVA 3QEFA 1F4AA 3MO4A 1EUUA 3K46A 4LQRA 1JYNA 2VMDA 2Y6LA 5C7GA 3C7OA 2VO5A 4DXRA 3WMYA 5FK8A 3WF0A 5A8CA 4KCAA 3P1IA 1DP0A 4M4PA 3D5YA 3NRUA 4UDKA 1UZ0A 4AG4A 4ET7A 2EXIA 2VZ1A 3D60A 3C7GA 2BBAA 3HPNA 1GQPA 5IHRA 1SHWB 4MGQA 2VZSA 2RVAA 2JKXA 4CUBA 3KF5A 1OF3A 4DXSA 3T2QA 2VCAA 5JXIA 4QDRA 1JYWA 3OGSA 3AKHA 4PVIA 1NUKA 5A1AA 2DCJA 2VZUA 5CYYA 3K4DA 3AKFA 3VSFA 2QQJA 2WBKA 1JZ7A 5GLLA 4AAXA 5CZKA 2VZTA 3OG2A 5B6TA 1ULOA 2VR4A 4P02B 4DEVA 3LPFA 4CU7A 3LDKA 3EB7A 2YC4A 3P6BA 4UDIA 5AY9A 1JI6A 4MLGA 5GLKA 3P2NA 3OGVA 1TVGA 3ECQA 4AK7A 4XZUG 2WQ8A 4L0PA 4QAWA 5FKBA 1PX4A 1W0NA 2CDPA 3OB8A 1H6XA 3I2GA 3PUIA 1XNAA 1UY0A 2VC9A 5DPNA 3UESA 3QZ4A 4JKLA 3UNPA 2W87A 3WPVA 3LV4A 1Y9GA 3WQBA 2YFRA 1UY3A 2KD7A 4XUOA 2YC2A 4E8CA 2W1QA 4AK6A 2AEYA 4XUPA 3ZXJA 1MPXA 2R7EB 2J1AA 1F4HA 2B4WA 5C70A 1UYXA 5FMBA 2W1SA 4KC7A 2EIEA 4DUVA 3WATA 2WO1A 1JYVA 2VOTA 5JOYA 1BHGA 2XOMA 2Y8KA 2JE8A 2L9LA 5JOZA 1GOFA 3I3BA 2ADEA 3VT0A 2XQXA 2WO2A 4QDSA 2WYSA 2QQKA 2WDBA 2VZVA 4CUCA 5A7VB 5AYDA 4UDGA 1YQ2A 5AYEA 2W1WA 4QDQA 4BK5A 3BGAA 4QX2A 4XUQA 4JHZA 3ETPA 3BYLA 1UWWA 4RYDA 4ARYA 4DXTA 4JX0A 4W4ZA 4A42A 2CDOA 3C7HA 3J7HA 4OYUA 3WNPA 3T2PA 2HYXA 2VZPA 4D8MA 1W9TA 2EIDA 1CZSA 2JDAA 3FHQA 4D47A 5F7UA 3IB3A 1UY2A 3R67A 5FUIA 2VZ3A 5GLNA 5GLRA 2AEZA 1JYXA 3VSRA 5IJRA 3WPZA 1UMHA 5IFTA 2VQUA 5LA1A 1PMJX 5B4XA 3LPGA 1GYHA 3DYPA 3QEDA 4QB1A 3GXUA 3R4YA 5LA0A 3LEKA 5HXMA 3WEZA 3VD3A 3A22A 3WSOA 4BDVB 4NOVA 3VD7A 1I5PA 2HLEA 2VMFA 1O59A 3MUZ1 4FFFA 3IAPA 4YPJA 1UYPA 3LFIA 3I2JA 4ONZA 5J1XA 3MBWA 2RV9A 3KF3A 3WF2A 2Y6KA 2J1TA 3K77A 5JUVA 3GGLA 2QQVA 5GLQA 2XHNA 1JZ2A 2ZEYA 2ORXA 3FN9A 3SKVA 2ZEWA 2X05A 1GMMA 2VCBA 4LPLA 2J1UA 4AK5A 3WN1A 4RN5A 1US3A 2OKXA 4N2RA 1UMIA 3ACGA 3W5NA 4N1IA 4OMDA 5DMYA 1JZ3A 4QQSA 3KSTA 2RJ2A 2ORZA 3OEAA 4BXSV 1CZTA 1W2TA 3CU9A 4FFGA 3LQCA 3WN2A 4KMQA 5JXHA 3DECA 3R4ZA 3AKGA 3W5MA 3D3AA 1PMHX 2XONA 2Y6HA 3HOBA 2ZEZA 2W3JA 1K42A 3CIHA 1GNYA 1YRZA 5EJZB 1CX1A 1VKDA 4O8PA 5A7VA 2EXJA 5EIYB 3UGHA 3VT2A 3WPUA 4MADA 3A7QA 2LS6A 1W9SA 5GLPA 2W92A 3WNLA 1SDDB 4KWUA 4LKSA 5HPOA 3I3EA 5A8DA 2JD9A 3ACIA 3HNBM 1XPWA 3VD5A 2LW8A 5LA2A 1P8JA 3OBAA 4UDJA 5JOWA 3WNMA 3WF1A 1UYZA 1SG3A 4QX0A 1W8NA 1Y4WA 3LEGA 2BERA 3U75A 5FMDA 2QBXA 2VMCA 1T2XA 3ZM8A 2ZXQA 3VD9A 3T2OA 3BYJA 1H6YA 3LIGA 3PIJA 2EXHA 1JZ8A 1GYDB 3HJRA 1O8PA 3LE0A 3T09A 3ACFA 5FK7A 1JZ6A 4M4RA 4N4BA 4BK4A 2VDTA 2Z4FA 1W18A 5IYYA 2WUHA 1OD3A 4FI9A 4A44A 4QX3A 1Y7BA 2VQTA 2WO3A 3OM7A 3T0AA 4COTA 2WABA 2X09A 1WL7A 3UGGA 1W8OA 3BYKA 1US2A 5JXJA 4KCBA 3T08A 1XC6A 3C2UA 1UX7A 3WN0A 3VSSA 1J84A 4CU8A 3A23A 1CZVA 2X8SA 2J1VA 5AYCA 3HNMA 2BGOA 1OYGA 2ZEXA 3WNNA 1UY1A 1O8SA 2VZRA 3VSZA 2Y64A 2WAOA 3BYNA 2EXKA 2E33A 3I2IA 2VZQA 3JXSA 2W47A 2B9VA 4UOJA 3QEEA 3PUHA 3VDBA 1GOGA 3CZUA 1UV4A 5B6SA 1PX3A 3SEEA 2QQMA 5JR2A 4OZOA 4FFIA 2J1SA 1NX9A 4KI5M 3THCA 1Y9MA 4N2ZA 3WPYA 2VMEA 2C9KA 2X8TA 3NQHA 3WMZA 5JOXA 2VZOA 2W5FA 2DCKA 3IIIA 2BGPA 3EYPA 4A41A 4ZZ8A 2EICA 3K1UA 3VT1A 2VL4A 3CZJA 4DUXA 1YIFA 4QPWA 2ADDA 3D5ZA 3MUY1 5JMOA 5FLWA 3ZXLA 3MV01 2BZDA 3A21A 3TAWA 3ABZA 2PQSA 2QQUA 4LHSA 3VDAA 3WASA 5C71A 1EUTA 3OEBA 4XVHA 3ZXKA 4GWIA 3LEMA 4CU6A 5I0DA 4A6OA 4MO3M 3WF4A 1LNSA 3UETA 4DEQA 1OH4A 1JZ4A 3K75B 1GUIA 3AC0A 2V72A 1D7PM 4KC8A 4O8NA 3BN6A 4JKKA 2YFSA 1KGYA 2J1RA 3C8XA 4UI9L 5LCWL 3IDAA 4Z2AA 4IUGA 4A4AA 1L7QA 4ZXEA 3U14A 1NAEA 1WKYA 5JXGA 3D61A 2Y6JA 1TG7A 3UGFA 1WCQA 2W91A 3LEIA 3PIGA 4XUNA 2XQRA 1R64A 3MV11 5G05L 1JHJA 4ZZ5A 3NNGA 4GZ9A 4MGSA 4W50A 4EQVA 4CUAA 1K45A 3DYMA 3E1F1 3SKJE 4PVAA 2X8FA 2J22A 2B4KA 2AC1A 4JKMA 3GDBA 2WN3A 3K4AA 3HEIA 4XUTA 2QQNA 1YI7A 2W1UA 3FHAA 4KMIA 4BJ0A 3LDRA 3RWKX 4OUEA 1OT5A 4PQQA 1DYOA 2VTFA 2ID4A 4ARXA 1GYEB 4CVUA 3T0BA 2WAAA 1JU3A 2E26A 3I3DA 3OGRA 1CIYA 1L7RA 2WZ8A 4P08A 3OM5A 3CDZB 3VDCA 4XURA 2V5DA 3ACHA 4A45A 3DYOA 1DLCA 4GWJA 5IFPA 3CQOA 2DDUA 2VCCA 5GLMA 3U37A 3SEPA 2VM9A 3I97A 1PT2A 2VJXA 5FMCA 2YG0A 2J7MA 4HG6B 4TTGA 1NKGA 4P00B 4CU9A 4FFHA 3CMGA 3WNKA 2W95A 5DQ0A 5G04L 1W9WA 1K12A 3I2FA 1XNTA 5FKCA 3VD4A 2QQLA 1K3IA 1ULPA 3CKHA 4QB2A 2QQIA 1UXXX 3WNOA 4E8DA 2WN2A 1UXZA 1IQDC 1HN1A 2E32A 5EJ1B 3IAQA 1RYYA 2QQOA 4ZY9A 4D0QA 5GLOA 4U6BA 3SC7X 3I2HA 2W94A 3NJXA 1JU4A 2YB7A 4UAPA 1KEXA 2C4XA 2YFUA 3QC2A 1JZ5A 3I2KA 3LF7A 4P5YA 4W8JA 2Y6GA 3C7EA 2YFZA 4DUWA 3T0DA 2W9XA 3GM8A 2YFTA 2WZEA 1UYYA 3C7FA 4TXWA 3OM4A 1OF4A 3AKIA 3OM2A 1UY4A 4PF1A 4O8OA 2J1EA 3WF3A 5ANNA 3HNYM 3THDA 5DN2A 3FL7A 4U6DA 4QX1A 4QB6A 3OM6A 1GOHA 3K4ZA 4A3ZA 4OMCA 5FIXA 2OXBA 5B4NA 1J83A 2X10A 2QQWA 1GU3A 3F2ZA 1ST8A 5C0PA 1W99A 3HN3A
chains in the Genus database with same CATH superfamily
1LESA 1QJEA 2LROA 4MOAA 1GP6A 4HBNA 3OPZA 5C9AC 3B02A 2ZGUA 1BEV1 1OOPA 3NJVA 4IEVA 1O5UA 5FUNA 2BBVA 3DPRB 4GH4B 1WMXA 4X8NA 2QZ2A 5F5AA 4LQRA 3AL5A 5AFBA 1FMD3 2Y6LA 2VOWA 4QXCA 3TWIA 3VZLA 3C7OA 1ND3B 1LHNA 2YXSA 5LEKA 1UMZA 2HWD1 1CAWB 1VBD2 3RWNA 4LNVA 1DP0A 3WR0A 4QPIA 5A70A 2XUMA 1QJU1 3NRUA 4LLFA 4UDKA 3AKTA 1QEXA 4PDWA 2CGNA 1YCIA 2VZ1A 4MGZE 1A34A 1NQJA 4ZONA 5JR7B 1GQPA 5IHRA 5FZ8A 2P34A 1I9RA 2JKXA 4JV4A 1VR3A 4Q4Y1 2D97A 1RITA 3M3EA 3POYA 5DXDA 1RUJ3 4HK9A 4CP1A 4AEJA 1ZBA1 2D44A 1QIQA 3UV9A 3LB9A 5DAQA 4AI0A 1BVP1 1O4ZA 2Z69A 1FOD3 2GC2A 2HWB2 4XJ9A 3AKFA 3VSFA 2QQJA 1JZ7A 5GLLA 2D7FA 3GBWA 3L9JT 2VY0A 5T50A 3OG2A 3VBUB 1RUOA 1GZWA 5EV7A 3MPBA 5JI7A 3FBMA 2ZGQA 3O5SA 1VBB3 4MH0E 3VBHC 1D4M1 2A6YA 2D6LX 4RSUA 1S0JA 4NHYA 4ATFA 4QQLA 4NIIA 3ECQA 3H7JA 3ATGA 3MW3A 1DQ4A 4M3CE 4Q27A 2IZWA 3BPZA 4Q0PA 1ZRRA 4QAWA 1PX4A 5FKBA 2RG4A 3BB6A 4AXOA 4L9BA 2CDPA 5FY1A 1MS4A 4AVBA 5C5TA 4F8AA 4IEOA 1SLBA 2X8KA 4N7UA 1REEA 1XJAA 4ATEA 2BWAA 2D3SA 3B7MA 4IGQA 1GSLA 3UKTA 5FYCA 4TN7A 3A4UA 4L92A 4QQOA 3UESA 1W6OA 3QZ4A 4JKLA 2JKBA 2A7AA 1OD5A 3LV4A 1ASJ2 4YZ4A 4UFKA 3WQBA 4IW3A 4MXVA 2DTWA 4XF1A 2E51A 4XUOA 1DGWX 3WT3A 2Y60A 4CTEA 4AK6A 4Q4W2 1K5MA 4C90A 3ZXJA 1Q8PA 2WINB 2J1AA 5C70A 1BMV2 2CTVA 2CAUA 2PHUA 4DUVA 3WATA 3U11A 4IEZA 1PO12 1AR71 1JYVA 5JOYA 1OHFA 5FPUA 2EF6A 2VE1A 2YMZA 3ZSEA 2Y8KA 3FX3A 3AX4A 5EP9A 2L9LA 1Z0HA 3VDDB 1SLLA 4LKFA 3U10A 1GOFA 4L2NA 4FAHA 3DPRA 4URAA 1R1ZA 3UT0A 4A7YA 1BJQA 2ADEA 1RL3A 2XQXA 1BK1A 2WO2A 3PMEA 2QJVA 3Q8BA 3WW3A 2RM21 2ETEA 2WDBA 2VZVA 3CO2A 5JSOA 3RZLA 1MQTB 3AYDA 2OPKA 4YM0A 2WSVA 5AYDA 2Y34A 5AYEA 2W1WA 1CAWA 4QGNA 3BGAA 1HDKA 1WCUA 5D2AA 5C8CC 3IWZA 4IE7A 4XUQA 4YG0A 4OHZA 2GNDA 1NCRB 3J7NA 4AFDA 4CDWB 4B1MA 4LO6B 4DXTA 5HV0A 4P9JA 3ZMNA 2R041 3LDBA 2AZ5A 1JXNA 4OQ8A 2HYXA 3R4DB 4EYUA 5ERLA 4B29A 1W9TA 3ES1A 1Z7S2 2OZJA 4QX5A 1VBD3 4D47A 4M3CB 3MPPG 3PU3A 1AYM1 3RYKA 4B4QA 4N9IA 4DPNA 4N53C 1W39A 3WPZA 2JDNA 2OS2A 3PVNA 5IFTA 2DWRA 3H7YA 4RS5A 2RDRA 1GYHA 4XFFA 3VHRA 4MGKE 3L2HA 5JLVA 4KGQA 1DGLA 1APNA 4QKNA 4LBQD 5KXDA 4UWDA 1ZZBA 2R071 5GJ6A 1OI6A 3H8XA 4GMP0 4LE3A 4KBZA 3VHOA 2DCYA 5BNPA 3PVBB 3WP6A 5LASA 3LOIA 4NOVA 1VP6A 4FPKA 4U2AA 4XC9A 3D0SA 3T3YA 2HWB3 1QJX2 5A6ZA 1H1IA 2UWBA 3Q8EA 3MDPA 4FFFA 4MLOA 1LOFA 3IAPA 4YVWC 2PLV3 1S0BA 2VNGA 3N9MA 4DFSA 5C33A 4UBHA 5DABA 2NM1A 4Q29A 1QKQA 3OPTA 4M01A 1N3OA 5KXBA 3EJKA 3GGLA 4G9SB 2QQVA 5GLQA 2Z5WA 3O0WA 3KV5A 3FN9A 3MEPA 1Q8QA 3HBZA 3SKVA 2GU9A 2RJLA 3HQRA 3I7DA 2X05A 5C4WC 2VCBA 1WCKA 1RVF1 1UPIA 3OSDA 3R05A 2J1UA 4XACA 1H8TB 4YZ5A 1OURA 5J7MA 4EWAA 4AK5A 4I02A 3BI3A 3OUIA 4NUBA 1UMIA 1AR91 2A3WA 3KGZA 5AC93 4K3UA 5DMYA 4R9AA 2HWF3 3V0BA 4BQ5A 2TEPA 5FYIA 2RJ2A 2XH6A 4I0BA 2DBNA 2XJQA 1OH3A 2HWC3 5CG9A 2NP0A 2QKDA 4K40A 3ST7A 2A75A 1CZTA 3SXWA 4BXSV 5C8WA 2JG8C 4CCKA 3WP3A 3WN2A 2J42A 4YWAA 3U0ZA 4JGZC 5JXHA 2P2KA 3R4ZA 1O5LA 1RHI2 1CAUA 1H9PA 1X9PA 3MW4A 1TNRA 1B35C 2B7YA 5FYZA 2ZEZA 3KT4A 2W3JA 3CL1A 1RIRA 4QD2A 1DGRN 1OVPA 3AP9A 1HQNA 3AKRA 1GNYA 4IESA 1JOBA 1YUDA 3MGUA 1MEC1 4Y5SA 1ZRCA 1CX1A 4O8PA 1W2UA 2EXJA 4BQXA 5EIYB 4CCLA 3WPUA 4MADA 5GKAC 5C3OA 1JUIA 3A7QA 2LS6A 2WWSA 1BEV2 5FLIA 5I0TA 1UKGA 2XVKA 5L9BA 2W92A 1SDDB 1FV3A 4N43A 4AF9A 5DAWA 1IPSA 2FQPA 4KWUA 4R9CA 4BOWA 2VOXA 1OKOA 3PTRB 3UJQA 1YNAA 5FREA 4IEPA 1RUC3 1J3PA 5FPXA 3VL8A 1VAKA 3ACIA 3HNBM 1XPWA 3I4IA 4QXBA 2LW8A 2LUWA 3RG0A 2HWD2 3OBAA 4V1PA 4Q8KA 4FT8A 1Q8VA 4XABA 2D6KA 2HWE1 3WNMA 1HRI1 3AYAA 5LB6A 4SLIA 1ULEA 3QD6A 1UKRA 4HKOA 2BERA 5GLTA 3ZYBA 4LK6A 2PQQA 2XJSA 5LBCA 1ZZCA 2CV6A 3S7IA 2H6BA 1Z7S3 1KDKA 1OOPC 1H30A 2RS51 3O0VA 3KHBA 5IUQA 5JMCA 4CP9B 4Q4Y2 4C0BA 3JB8A 3IPVB 5J3UA 1H6YA 3LIGA 5DZGA 3BYJA 2EXHA 2G19A 4YRDA 3HJRA 4AQ2A 3ACFA 1FATA 3ALQA 5FUPA 5FZFA 4BK4A 4DO0A 2R49A 4FI9A 4A44A 3AKQA 5FZGA 1JYTA 2PFWA 1WL7A 2ILMA 3UGGA 5FOBB 3D8CA 4QPIC 5JXJA 1BZWA 4YGCA 1DBNA 1JHNA 1UX7A 3KMHA 5BNQA 1L7LA 5J48A 4PDWC 1PVC2 3MIGA 3VSSA 1D4M2 1NQDA 1OLQA 4Q2FA 1HJGA 5L9RA 5C9AB 2BGOA 4G3YC 1MR5A 1OYGA 4NRMA 5FYMA 1U5XA 1IOAA 4OHVA 1RUH3 2F4PA 3UJOA 3WINE 5D1IA 1OVSA 3TAYA 5A33A 1WLCA 3JXSA 4E2GA 2OQ6A 1VMJA 1W6MA 2F4LA 2WS91 2B9VA 2XL7A 5ABJA 5HBAA 3VDBA 3SHRA 4DMIA 1NYWA 1U5ZA 1FNYA 1SCRA 4OQ9A 2MEV3 4WVVA 3NAPB 5JR2A 2K9ZA 1BBT1 3THCA 3SQOA 5DDJ3 3H3UA 5A3MA 1O3SA 2VMEA 5A6QA 5CIRA 1WCSA 2C9KA 2FZ2A 1EP0A 1HV1A 4UF0B 1QJFA 4YW3A 1UQXA 5K4LA 4B3NA 5JOXA 3IIIA 2Y38A 2BGPA 4IEWA 2XBO3 1CJPA 2AACA 4Q26A 3ZFFC 4MVTA 4AHZA 3I2OA 2VL4A 1OSGA 1CWPA 4XW3A 2YHJA 1PGW2 2UYBA 3SCGA 1QXRA 3HQUA 1AR72 2WA3A 3MUY1 3D5ZA 4AGRA 2RS33 2JDHA 3MV01 4TYSA 1E5SA 1RHI3 1RXGA 1QJY3 3A21A 4H7MA 4LHSA 4RGGA 4DIQA 1RUD3 2WZR1 2OX0A 1IHMA 4HANA 5CNAA 5HCAA 1UO9A 4NIHA 5A6XA 1OLRA 4LBJA 2QFEA 3ZO0B 2RM22 3H42B 4NRQA 5FJKA 4IQPA 2ZX0A 1YXWA 3WF4A 1J3QA 4YZ2A 2ZPXA 1XU2A 2D5FA 5GLVA 1CESA 4DEQA 1K5MC 3VL9A 1SLCA 1LJ7A 3I59A 1LOCA 4V2VA 5FXVA 1GUIA 3VBHB 3AC0A 1FT9A 2RJKA 3MIDA 4WM8A 2AENA 4ZKTB 2JEMA 1MS9A 4YGBA 1KGYA 2R1DA 3C8XA 1O3RA 1BCXA 1A8DA 4UI9L 2VQAA 2ZHLA 4OVEA 5F5QA 3V56A 4CDXB 5BNNB 1SCSA 1ZRDA 4IUGA 1W8UA 4ZXEA 3LOBA 1RTVA 2ZKNA 2HWD3 4MXWB 2JDUA 3DPRC 4NOTA 2CU5A 1AYM2 1GP4A 5JIAA 1F2NA 4LUMA 5FZ1A 3LEIA 3PIGA 1A3KA 2K46A 2W2IA 3N7JA 2UURA 2XQRA 4GALA 1YJLA 4XUNA 1WD4A 5FY0A 4AWDA 5G05L 4CEYA 5BY5A 5A3WA 4HPKB 4CXYA 1DZQA 4QM8A 2TNFA 1VBA3 3DEMA 4EQVA 2R072 4MX3A 1V0AA 3RFRA 4QM9A 4JZRA 5IVBA 2D43A 4JKMA 5KHHA 5FZ3A 5FPBA 1SLTA 1SLIA 2ET7A 5LA9A 3VZJA 4FTBA 4FPYA 3WDTA 2Q0AA 4XUTA 4HK8A 2V5YA 4QX8A 2CY6A 3B00A 2C6SA 3FHAA 4P9WA 4BJ0A 5D8AA 2FDIA 3RWKX 3OY8B 2WLPA 1DYKA 5FP8A 1OT5A 4PQQA 5E16A 3JD71 3PHMA 4UT5A 1PVC3 4XCBA 2E26A 3OGRA 1IG0A 3NKGA 1ZVFA 4RS5C 4JRLA 2ARBA 1FYUA 3O1VA 1REFA 2DFBA 3E5QA 4QHOA 3VDCA 2VMGA 3NAPA 3O12A 1LCLA 5DUVA 4Q0VA 5F1RA 2E63A 1JS9A 1AYN3 1A8MA 5FZIA 2DDUA 2VCCA 5BNPC 4HONA 1AR92 1WBFA 3U37A 2BGCA 4XJAA 1OPMA 3IZOA 4V2WA 5CKMA 1RMU2 5FZ4A 4XAEA 1OPOA 5KHIA 1AX1A 1GQHA 2BOIA 3K48A 5KXEA 3TB0A 2D3PA 2P5BA 1NCQB 1LOFC 3RYPA 2HEYF 1G7YA 1TME3 4LITA 1FNZA 5FMOL 1KD7A 5IT6A 3VKOA 4YGEA 2VVFA 3OBRA 3NW4A 3POWA 4P00B 5FZLA 2A3XA 5CU1A 2Q1FA 3EXUA 1ULFA 2JDPA 3PDQA 1WW7A 2W95A 3HAGA 4Y24A 1W9WA 2WSUA 1K12A 2H6CA 2I07B 2NMOA 1YFUA 1H0BA 2JECA 4TWTA 4QB2A 4FAGA 3J8F1 4BH9A 1G9BA 3FZ3A 2QUOA 4E8DA 3O1TA 1XU1A 1CJDA 1HN1A 4D0QA 2QQOA 2PAKA 2VQ0A 3O0XA 5JZGA 5LK5A 4GXLA 2W94A 2ZX1A 2Z2SB 2C4XA 2YFUA 1I3HA 5L7OB 3I2KA 2A6XA 5EXOA 1PZ8A 1PNGA 4NPMA 2GDFA 4AAPA 1WW6A 4LE4A 4HZFA 4W8JA 5I93A 2RM23 2Y6GA 4YVWB 1CGPA 3GHNA 5H9RA 1F5FA 2VOKA 4CDXA 3AKPA 4DUWA 5BNNA 1LAJA 2W9XA 1WMFA 4AI1A 5FO8B 1UYYA 3PL0A 3PVOA 3WVJA 2PELA 1OF4A 2MPFA 3AKIA 3OM2A 1PM7A 2Q1MA 4EN6B 2MNGA 3AZYA 4O8OA 5KHKA 3AZWA 2A6ZA 3WX5A 3GJAA 1HRI2 3FMGA 5C4WB 4QB6A 3J9SA 4D3WA 3KSCA 4YZ1A 1G9DA 1ZRIA 1HLCA 1UD1A 1M06G 1JTZX 2XJUA 1S0FA 2LRPA 1G9FA 2RS52 4COWA 4S2DA 4BM8A 1GU3A 4CP2A 1RGSA 4N43C 4LORA 4Z07A 3Q8AA 3POFA 1RUF3 2E31A 3LIHA 2C26A 3S5QA 3USUB 4P9IA 4Z2WA 4UDKE 3WCRA 3E6BA 5GZGA 2FCVA 2V4VA 2DV9A 4JGZB 3E5UA 4GKYA 3QEFA 2WNOA 1F4AA 2HEWF 4RFT0 4BU2A 1KS4A 3UYJA 2VBDA 2EVXA 4MV2A 3FWEA 3JBG1 3QLQA 1JYNA 2DVGA 3BTAA 3RJRA 4XFCA 4LO4B 3UL2A 4NAOA 5C7GA 3BU0A 2YUEA 3OD0A 2VO5A 4Q0SA 3WMYA 5FK8A 2BJSA 5KC6A 2EAAA 2XG3A 4L97A 4KCAA 1M4WA 3NSTA 4E4DX 3D5YA 1U5IA 4CXXA 4IETA 3BPSA 4BQ3A 3D5OA 3DCQA 4AG4A 2EXIA 4BZ4A 1BLZA 1ND2B 2RE9A 2DVDA 4XQDA 3GCWA 1RUG3 5FFOC 4XFAA 5FLHA 4OI1A 2VCMA 1HRV1 2WS92 4KGGA 4CCEA 3HPNA 5HV4A 2X29A 3VV1A 2Y33A 3KVAA 4QQ2A 2RVAA 2WNUA 4NVPA 3THTA 2ES3A 4A2UA 1ZZ8A 1NCQA 3E5XA 3PUSA 5E6HA 1W8FA 2GSYA 1BBT2 3AKHA 3CEWA 4HN0A 2R30A 1NUKA 3RDIA 1E5RA 5CYYA 4LOSA 2D6MA 2GMEA 3K4DA 1TZOA 1RMU3 1UF2C 5LA1A 4AAXA 1AR61 1VAMA 1S1AA 1OOPB 4L11A 3LAGA 3UKNA 4BPZA 1VBC1 5B6TA 2R0FA 4P02B 5HI0A 2YDEA 4CU7A 1W6PA 1VBE1 3P6BA 1H2KA 4Z8BA 3O1MA 5ABJC 2XUEA 4UDIA 1JI6A 1X8EA 2N7GA 3RZKA 5GLKA 2QTWB 3P2NA 3AVRA 4BE3A 2AREA 3KT1A 4AK7A 4OHYA 4R52A 4L0PA 1H8VA 2WZR2 1OXCA 1W8ZA 2PYTA 4FOWA 2SBAA 3WP5A 5A80A 1KJLA 2BOJA 5KC5A 3ZYFA 1YEWA 4O9GA 3T2TA 3TEXA 3WASA 3D4KA 1HB2A 1H6XA 2X5IA 3I2GA 1XNAA 4QPIB 3SH3A 4COYA 3I49A 4GKXA 4FQ4A 1SLAA 4TLGA 1HQWA 2NMNA 1GQGA 4AVSA 2HH9A 1H2MA 2R6QA 2WFF3 2W87A 3UNPA 2O0OA 5EQUA 1Y9GA 1O91A 3BALA 4EWEA 2FDKA 2YFRA 1UY3A 3ELNA 3PNAA 4IV1B 2W1QA 2GZWA 2VNOA 2IVJA 4LKDA 2R7EB 5KHGA 1XE8A 4KC7A 2YYOA 1KITA 3LWCA 5BXXA 4DOUA 5CADA 5APAA 3USUA 5K0UA 4ZPIA 1VLNA 5IK7A 2JE8A 4BLJA 1GZWB 3M3QA 5B2GB 1J1LA 1EAH3 4AFMA 4WZCA 5FZBA 5FZ7A 3ZIXA 4Y1VA 1HQLA 4QDSA 4HXCA 3WG4A 3SITA 4WM8C 1QOTA 2QQKA 4UFHA 4AEKA 2VXJA 1R083 4XETA 3VGIA 4GB33 5DG2A 4E2SA 1W03A 3ZYHA 1ZZ9A 2P6HA 4BCUA 1NLQA 4UDGA 2C1FA 1AL21 1PO23 3CJIB 1PIV1 3AFKA 2GMMA 3KCYA 3MICA 2ZTNA 4P9LA 4BK5A 1KRIA 1V6IA 4GJYA 4RYDA 3OBZA 1ACCA 4LA3A 4QQPA 2YC0A 1ND2A 4JX0A 2CNAA 2WR9A 3JD72 5GLZA 2CDOA 3C7HA 5FTTC 3WNPA 5KWRA 2VZPA 4ZS3A 2EIDA 2GNTA 4CEYC 4DY3A 1YFYA 2VNVA 4XQWA 1XNKA 1ZZ7A 4FPHA 5LY2A 2I45A 3CU7A 3O1UA 1XOYA 1K5MB 4EWDA 1REDA 5EJ3A 2ZGRA 3VZNA 4AQ6A 5GLNA 5GLRA 1JYXA 2PMWB 1HXS2 1V6JA 4AZZA 2VQUA 1CPNA 2WNVA 1PMJX 4HSLA 1MVQA 3QEDA 5K7PA 3S30A 1AJOA 2GMPA 4UFJA 4I30A 4QB1A 3QCWA 1STMA 1ZNPA 1NE4A 2WFPA 2VTXA 1DLLA 3GXUA 4Q0QA 5D8AC 4CEWB 5DUXA 4F83A 1QJZA 1WZXA 4TLFA 1ENRA 3ZFEA 2FCUA 2ZS6B 2D6PA 4NPRA 5F2WA 3VD7A 4BDVB 4MZUA 1ZM1A 1W04A 3PUAA 4HL0A 4A6SA 1O59A 3RZGA 2WO7A 4HSJA 4FTSA 4KWLA 2MHFA 3NAPC 4CDUB 4ONZA 2OW4A 3VBOB 1MZ6A 4QHBA 3B9CA 2CWSA 3S6PA 3KF3A 1VMHA 5JUVA 1IZ3A 5L36A 1V70A 5A7PA 4MGTA 2ORXA 2P6CA 2ZEWA 3EO6A 3BTZA 1A6CA 1GMMA 5CBLA 4XXPA 4FP2A 1JUHA 2VULA 4FOYA 1W06A 4RN5A 1GWKA 1BKZA 3WG1A 4IV1A 5TSWA 4AGVA 4XZPA 4OMDA 4DZGA 3DV8A 3KGLA 4QQSA 3KSTA 4XBNA 4OCTA 1W2NA 1GZCA 3P3NA 3SMHA 1POQA 4RS5B 1VALA 1PM4A 2RMU3 1DIWA 4TSVA 5FO9B 3CU9A 1HV0A 4KMQA 1NXMA 2CGOA 4LTAA 3ZSLA 3D3AA 5JZGC 3KHCA 5BNPB 2XONA 3PJQA 1FXZA 1K42A 3QACA 3CIHA 5F9TA 1QF3A 1TMF1 2JENA 4L99A 3MIHA 1YRZA 4UW5A 1OQEA 5A6YA 2ZGKA 1PZ9A 3H3ZA 3UGHA 3VHPA 1BVVA 4CDXC 5A3UA 5BNNC 1COV3 4CPBD 4Z1VA 1W9SA 3CJIA 3PLQA 4K6BA 4W6XA 4OHWA 4HMZA 2DBIA 3JBG2 1Q5OA 1DZTA 2DUPA 3I3EA 2ZAAA 2P3JA 2P4EA 5FXXA 5A8DA 4KL1A 3WQ7A 2NQYA 2VH9A 3BOWA 3ZOIA 5KXCA 3A0NA 2DUQA 4FP3A 4UDJA 1GP5A 2FMDA 3HIFA 5FP3A 3N4MA 4E4HA 4META 2VVDA 3V0BB 1UYZA 1SG3A 2W39A 3O1RA 3H8UA 2W68A 3LEGA 3JD73 4FPFA 2DTYA 1HRV2 1F9KA 5FMDA 4QHZA 4RHV3 5FYUA 3ILNA 5IVFA 3NV2A 1HJFA 2QBXA 5I0UA 1T2XA 2E7AA 1C5HA 1IG3A 2R063 3AZVA 3N7LA 2ZXQA 3ZM8A 3T2OA 4OI0A 3KV4A 4CEWA 1SPPA 1CAUB 1ULDA 2QVSB 3TNQA 4PQ9A 1W0OA 1QH6A 1JZ8A 4NRPA 1DF0A 3GBGA 1PMIA 3T09A 3L2YA 3ZYIB 1HXS3 2B9UA 1GR3A 4M4RA 4N4BA 4AOCA 3KWVA 1UU4A 4MGIE 5IYYA 1VRH1 5EZWA 3ZN4A 1Y7BA 3OM7A 4I01A 1KS5A 2WABA 4Q4V1 2FDGA 1AR62 3GZEA 3VN4A 1MS0A 4CDUA 3BYKA 1KQRA 3VBOA 1OMIA 1VBC2 2ZZJA 5T5OA 1QXPA 3C2UA 4DQAA 4N43B 3WN0A 1V6NA 3KV9A 1VBE2 3P5BA 4CU8A 2ZGLA 4RQPA 4Y4RA 1O4TA 3MFCA 4CA9A 2BW8A 5AYCA 4GWNA 1ZBE1 5FXZA 3DKQA 4CCCA 1O8SA 2Y64A 2EXKA 1NCQC 2BP6A 2E7TA 2E33A 3DKWA 3EMRA 4XOGA 3I2IA 5FPZA 1NY71 3B69A 5EHDA 3VZOA 3M1HA 4GQ7A 3SLIA 1DQ5A 1OFNA 3RYRA 1W2OA 2EA7A 3PUHA 4Y1YA 4W65A 3QEEA 5FJHA 2Q8EA 1ONAA 1UV4A 3ZN6A 5GLOA 3KCCA 5FP9A 2FDJA 4AEMA 1AXYA 3CF6E 2XMLA 2QQMA 2R0HA 1ULCA 4MSVA 3V0AB 1UOGA 1NX9A 2J1SA 3APBA 3ZYPA 1R1A1 2RS11 4LBQA 5E88A 3M3CA 2YPJA 4OI2A 4N2ZA 3OOXA 1QH7A 2W08A 3NV1A 4PF5A 2VPVA 4FXKB 2G9FA 2X8TA 3NQHA 1N3PA 4IGPA 4QPYA 5FZEA 2PHDA 4A41A 4GMP1 4K7JA 5FZMA 5I0RA 4UW3A 1C1FA 2UY9A 3CZJA 5L7OC 1YIFA 4RR3A 4LO7A 3R6SA 4CCJA 3H8OA 5FLWA 2XKPA 2V73A 1PHMA 2X5IC 2PQSA 4XIKA 5I8YA 4H2AA 1AX2A 4FSJA 4J6GA 3ROUA 5C71A 4WM7B 1QHDA 4XVHA 3ZXKA 3LEMA 4S2GA 4E4SA 2RHPA 2DURA 3ZSJA 5I0DA 1ODMA 3M7AA 4R4ZA 5KHJA 2JB8A 4M3CF 1GKBA 5F39A 1JMUB 1LNSA 3ON7A 1G6NA 2WL1A 1OH4A 2HYKA 1AJKA 1AL22 5A33B 5ABJB 1PIV2 1W6MB 3E97A 4ASMB 1CONA 2OVUA 5F3GA 1D7PM 1WGPA 2JXAA 4LXLA 5K8SA 4Y4YA 5A3NA 4XHBA 2VECA 3IDAA 1HB1A 1ASJ3 1LGBA 2Q30A 4WVMA 4ES9A 1WKYA 1JYIA 1R091 1WMEA 3AB0A 3I8TA 4Q4W3 3O7OA 3I3MA 1VPHA 1D0GA 1YYNA 1AXZA 1XE7A 5D21A 3UGFA 3UK9A 3WW1A 1LULA 3VLBB 3A0KA 5A3LA 1R64A 3HR9A 1GYKA 1PO13 5JDBA 4COVA 4ZZ5A 4WV8A 2VW0A 4BHPA 4NO4A 4GZ9A 4MGSA 4BQ2A 1UW8A 3DYMA 1QQP1 3TN91 4AFAA 1C8M1 3BODA 3HVDA 4K21A 2AC1A 2YROA 4YZ3A 3NJYA 1ND2C 4Y22A 4CRQA 2WN3A 5GZEA 1OA4A 3HEIA 3FLTA 3Q9OA 1YI7A 2BPA2 1QDCA 3RGBA 4KMIA 5IVJA 4BYYA 1OLME 2RR11 1G86A 2IXJA 3DXUA 2AYHA 3WOGA 5FZDA 1VBC3 3I59B 4IV3A 1D2QA 2VGDA 3BCWA 4NHMA 1JU3A 2R16A 4WM8B 2YU2A 2WNVC 4FPEA 1JN2P 1QJU2 3O1PA 3AYCA 4Q8LA 2IFRA 3CDZB 5FXWA 4QX7A 3OUJA 3ACHA 3V0AA 3DYOA 4GWJA 4PCRA 4FVVA 2D6OX 5CG8A 2K0GA 3ZFEC 3RZMA 4HLTA 5GLMA 1CIWA 1YQ8A 1ZBA2 5IK5A 2NYYA 2A5ZA 1YFWA 4S2HA 3URFA 4K20A 4CEYB 1YO8A 5FMCA 3WDUA 2A73B 2JIJA 5FZKA 5FOJB 1RUE1 1NE6A 1HN0A 4YYOA 1UL9A 3OCPA 4FFHA 4R4XA 2GC1A 3MHZA 4XTMA 5FP7A 2NLRA 5G04L 1DCSA 3INAA 3N9OA 2BVBA 3I2FA 1F15A 1VRBA 1XNTA 5JSRA 5LBBA 4WM7A 1FPN1 4PBOA 2QQLA 3K2OA 5A7QA 3VD4A 4XQ4A 1O3TA 1QJX3 1TMF2 1XYOA 3WNOA 1UXZA 1IQDC 3KM5A 1KFUL 3NNLA 4OUMA 3IAQA 4XEZA 5D8AB 2XLAA 4ZY9A 1V9U1 2A1XA 3I3QA 3TYJA 5FZ9A 4U6BA 4IV1C 3BVCA 5SV5A 5ACA1 3FFZA 3NJXA 2YB7A 2LM3A 1KEXA 1AXKA 4YM3A 2QZ3A 2IFWA 1SMVA 3T30A 1ZRFA 4P5YA 3WW4A 2VUDA 2AR6A 5HXVA 1O3QA 1LODA 1T6BX 5EYYA 5FWJA 3C7FA 4TXWA 3OM4A 4XDQA 2JIGA 4Z92B 5T52A 2WRAA 1KDMA 1UY4A 4ISRA 4XTPA 2J1EA 4UW4A 4B1LA 5LWBA 4UW6A 3ZVXA 2WZPP 3THDA 5DN2A 1UOBA 2E6VA 3FL7A 5H9QA 2JE9A 3K4ZA 4A3ZA 5FZAA 1H1MA 2OXBA 1UIKA 5FZHA 3MF6A 1BK0A 3BKZA 5B4NA 1J83A 3CJIC 1W6NA 2HJIA 4PI0A 3BUCA 5C0PA 1YQ6A 3KT7A 4JVAA 2D98A 5F3CA 1W8HA 1ZZ6A 2Q1ZB 2EIBA 2W46A 4PT6A 4UFIA 3R4UA 3WG2A 3KS7A 1LEDA 3ZPYA 2JICA 3V65A 1GWMA 1FMD1 4D7SA 3VBFA 4A7KA 2RDNA 5JZGB 3K46A 3GBFA 1OFSA 1BEV3 4AFCA 4KG8A 3HMYA 2VAUA 5J96B 1AHSA 5FY4A 1GICA 1NXD1 1RJ8A 2F17A 3KLSA 4DINB 3IDCB 4WBBA 4DXRA 3WCSA 4AQTA 5IW0A 3MIFA 4UXAA 3WF0A 3U78A 2R042 3P1IA 4H3WA 3PTYA 4QPGB 1ZBE2 2WQZC 4COUA 5J09A 1UOJA 2BFUL 5IVCA 5IK8A 3KB5A 3NV4A 4NJ4A 4XDOA 5E8AA 4CEWC 3WDYA 1NA1A 1XXNA 3PMSA 1I6XA 2Q8CA 3VKMA 1NY72 1C5IA 1YQCA 2BVVA 3POSA 1Y9QA 3B93A 2BBAA 4AVVA 1RUJ1 5T55A 1QJU3 1SHWB 1VJ2A 2GNMA 3Q8CA 2GN7A 4CSWA 4BA6A 3LA3A 3KF5A 5GZFA 2VUCA 4CUBA 2GC3A 3T2QA 1FOD1 2VCAA 1SFNA 4LKEA 5JXIA 1JYWA 5AFEA 3AP4A 3AXDA 5F3IA 4CDUC 1R1A2 2RS12 3H1MA 1URXA 5E1RA 3VBOC 2YGLA 4Q4Y3 2CHHA 2Y0IA 4MHUA 5A1AA 4AI8A 4KU8A 5FYHA 1S0EA 2VZUA 1ZBA3 5L19A 2ENRA 2DUOA 2BNMA 3P3PA 1WW4A 1EPWA 4QGLA 3H3LA 1VBB1 1JODA 3AFGA 3FJSA 3M70A 4H7LA 3S5AA 4O7XA 2GAUA 5EWSA 1FAYA 3NVCA 5J37A 3EB7A 2YC4A 4I0AA 4EN0A 5AY9A 4MLGA 1H4GA 1VB4A 4WVZA 1WLTA 1TE1B 3OGVA 4E4ZA 1EV11 4XZUG 1ENQA 3LZZA 1D4M3 1YC61 1W0NA 2YBPA 4AYUA 2G4IA 4D69A 3OB8A 2F6BA 4A7ZA 1CAXB 3LCPA 3PUIA 1RVF2 5FYSA 2ZMNA 1IQAA 1FX5A 3Q8FA 4AHYA 3ZYRA 4Y1ZA 4JRAA 5EPAA 1AUYA 5IVYA 2WNUB 1XRUA 3ILRA 1XNCA 2KD7A 2PHWA 2OUHA 2YC2A 2ZAHA 4GWMA 4RR3C 3MIEA 5FY9A 1QXJA 3WDVA 4E8CA 4NHKA 2AEYA 2ZX2A 2VBBA 4XUPA 4BMEA 1MPXA 4B7KA 2B4WA 1F4HA 4GULA 2FDFA 1AVBA 4UFMA 5LBEA 2XJRA 4NR1A 5FMBA 2W1SA 4Q1RA 4K9SA 2PHTA 2Q5TA 3W9AA 3OD4A 1GNHA 2VOTA 3WV6A 3BIEA 3NMBA 3NV3A 1DG6A 4QKFA 1LR5A 4LR4A 3B5LB 3MI8A 5JOZA 1AR73 1MEC2 1Q3EA 1W6PB 4KH9A 3WY6A 2XB6C 5CB7A 3VT0A 5CEHA 4YFZA 2WYSA 3TN92 5FAXA 3KD4A 1C8M2 3RZJA 3N7KA 2ET1A 3OJBA 3GZTB 3OYWA 4IEQA 3JZVA 3M4FA 1MZ5A 3SH5A 5J98B 5FYTA 1PK6B 4QDQA 2ZA9A 4MYEA 4QX2A 4QPGA 2X5IB 4YARA 3D60A 2BU9A 4RD7A 3ETPA 5FLJA 3IN9A 4GIQA 3N9NA 3TOJA 4K8RB 4XJUA 4ARYA 4AVAA 4W4ZA 5GLUA 4A42A 4OYUA 3VB9A 4EZHA 2HWE2 1CZSA 4AI9A 1I1EA 3H0OA 2XDVA 4QXKA 3PJYA 2LTNA 2XJTA 2R043 3HN1A 4HN1A 1Q56A 4UBGA 5FYVA 4BLIA 1HX6A 1T6GC 4C0HA 5JAXA 5JPNB 1UY2A 4IEUA 3C3VA 2VZ3A 1N1YA 3VSRA 2AEZA 5CKNA 5IJRA 1OKQA 1W8TA 1TQ5A 2A3YA 2I74A 2PHLA 1ULGA 4Y1UA 1AYM3 3LPGA 4LMFA 5B4XA 1WA4A 3PUQA 2CSGA 4IGOA 1F8VA 5K0UB 5FQ0B 4QU1A 1BQPA 3GNEA 5BUVA 5HXMA 4PJYA 1GWLA 2HWB1 2QE3A 3VD3A 1RUE2 4G4FA 1PGL1 5HCHA 4IV3C 3WSOA 4BWOA 1WLDA 2R073 2PLV1 1I5PA 1LENA 2BV4A 2HLEA 2ZMKA 4LIUA 1ZREA 5T5LA 4YW2A 3VBRA 2ZBJA 5JSPA 2QNKA 4P9GA 4YPJA 3ZN5A 1FPN2 2D6NA 1VAVA 1KXGA 5J1XA 3MBWA 1CAXA 1E5IA 2RV9A 4H14A 4S2FA 1G9CA 2Y6KA 2J1TA 3IDBB 4FTEA 4N8MA 4ITCA 2D5HA 3DGTA 4SBVA 5ACA2 4ORFA 2PA7A 2ZEYA 4YSFA 5BV6A 4QU2A 3T4VA 1LU2A 3PVEA 5AC91 5LW9A 2DVAA 2HWF1 2EALA 4CDQA 3LKJA 1WD3A 1US3A 1RJ7A 1PZ7A 2OKXA 4FCAA 5JVVA 2HWC1 1RVF3 5HCFA 4C91A 1JZ3A 4Q5OA 4I2OA 4LK7A 1DHKB 5CFCA 1X33A 2WNVB 1AR93 3ACLA 4Q0UA 3OEAA 1O6UA 4M0HA 4WM7C 1W2TA 3VKFC 1D0HA 3U4SA 1GZTA 4AR2A 3G7DA 1HB3A 5C8CA 2XJPA 4HETA 3AMMA 5JWPA 1X36A 2ZGTA 3DECA 1IGOA 3N3HA 4AK3A 3AKGA 1PMHX 4FXGB 4N7IA 4U36A 3ZFEB 2Y6HA 2IXHA 3HOBA 2YBKA 2WT2A 4XMAA 4AHXA 5F2SA 1UZZA 5C2MA 3ZPOA 3H9AA 4BIFA 1DYPA 1C28A 1CVNA 4J1WA 5EJZB 5GM0A 2FDHA 3K51A 1VKDA 3VT2A 4LT5A 4WVWA 1IS4A 1QU0A 4CCDA 3EHKA 1PK6A 5A7WA 5GLPA 1EPZA 1MEC3 3AMPA 1N3QA 1RUC1 1V00A 1DU3D 1FMD2 5LEJA 5F3EA 3TN93 3ORJA 2A6WA 1LHVA 5HPOA 4LBMA 1MACA 2IWGB 2JD9A 4EZ4A 4BQWA 3RRDA 4XFGA 5LA2A 3ILFA 5C6CA 1POV1 5IWFA 1ALYA 5JOWA 4AI2A 3LSEA 5A7NA 1VIWB 3SISA 2ZGPA 3AM2A 1Z7S1 4LOTA 2PN5A 3WF1A 1W8NA 1Y4WA 3MLJA 4LA2A 3WD5A 3HWJA 4FPJA 3U75A 5FWEA 2ZGMA 1IPJA 2HWE3 1RUJ2 1C4RA 1HRI3 3RVHA 2VMCA 4D6SA 4QMAA 1W3VA 3VD9A 3N9LA 4XBLA 5FQ0A 1VMFA 4P14A 3VBFC 4NIDA 1FOD2 4YG3A 4YW5A 1GYDB 2VBPA 1YHFA 1O8PA 2RS53 3LE0A 3BYWA 3CJXA 2GC0A 1OQ1A 4HKLA 3ZKYA 1UN1A 4YW4A 4ASKA 3VBSB 4PLNA 4QX3A 2LALA 2WO3A 2XKOA 4P9XA 4O9EA 4COTA 2X09A 4IDZA 1W8OA 4FQZA 4XF0A 1VBB2 5FPVA 4AVCA 3T08A 4F3JA 3WLUA 1NA1C 4DY5A 1AX0A 3D82A 3ZXGA 1RUH1 1YLLA 3WP4A 3BIWE 3A23A 1LHOA 2JDKA 1CZVA 2QQPA 2J1VA 5BNOA 1QDOA 3HNMA 2X8SA 1S0IA 2ZEXA 4PLMA 2BEOA 3WNNA 4LHLA 1PGSA 1UY1A 1EV12 4EN7B 1AR81 3G6JB 1XSRA 1LHUA 1CAVB 2VZQA 4AVTA 2MEV1 2W47A 5GLWA 4XJ8A 4IE4A 4QQHA 4XF4A 5DDJ1 3CZUA 4QGMA 3ETQA 3QH7A 1HW5A 2WS93 3CNAA 4E9KA 2DVFA 2JJ6A 2AUYA 3SEEA 3WHTA 2Z42A 3AMHA 4OZOA 4KI5M 3MZHA 3ME2A 1C1LA 5A32B 1RUI1 3QBQA 2ARAA 2XBO1 2AH2A 2YPDA 5A1FA 2CL2A 1SPPB 1H2LA 3GHMA 1BBT3 1YWKA 3WMZA 1E57A 1UPSA 2DCKA 2W5FA 2VZOA 1LOBA 2EAKA 3CHXA 3EYPA 3JQXA 3OGGA 2VTXJ 1MS3A 4ZZ8A 5L73A 1IKPA 2OZ6A 2RS31 2VMIA 2BUKA 2VMHA 3OGJA 4UFLA 2W0XA 4XYXA 1RHI1 2OIIA 5FMOS 1QJY1 4BIOA 1QGLA 2D93A 4QPWA 1J1TA 3KVBA 3CBNA 1RUD1 2VW2A 3IIAA 5I0SA 1GBGA 2BZDA 1RINA 3E6CC 3ABZA 1LECA 3J8F2 3W58A 3TAWA 4OHXA 4RQPB 1EUTA 3OEBA 1U5YA 4LLOA 1XE0A 4CU6A 3AZZA 3HBKA 4MO3M 2WZR3 1DZRA 1W9YA 1MS8A 3UETA 5M0TA 2JD4A 1W3XA 2PHRA 3TEZA 1GFF2 2V72A 5FR3A 4KC8A 3BN6A 4JKKA 4DB5A 3DXTA 3HT2A 2YFSA 1S2KA 1NG0A 2JG9A 1L3JA 3ZN6B 4JGYB 3T1MA 5LCWL 3FHIB 4I09A 3S0MA 4Z2AA 4A4AA 1L7QA 2XWBB 3U14A 1MZFA 4LBQB 4LULA 4YM2A 1DQ2A 1BYHA 4KWJA 3D61A 2Y6JA 3ZFGB 4NAMA 3VKLA 2CWMA 1MZEA 3ZYGA 1NZCA 3W20A 2W91A 1VBA1 1XB9A 2ZCWA 4PHZA 4MGYE 3MV11 4LHNA 1SFYA 3VBSA 1H2NA 2YY1A 4RR3B 1JHJA 4YFWA 4YVSA 4EN9B 4ZHNA 4BQ1A 4CPBA 2VVEA 4W50A 5DZEA 4QPGC 3KQRA 1SZBA 5KR7A 1K45A 4PVAA 3E1F1 3RI9A 3ZXFA 4O61A 3ZDVA 4HVRA 1YFXA 2J22A 1AZDA 2B4KA 3OBTA 2X8FA 3WZ1A 5IVEA 4IERA 1PGL2 1YQ5A 3GDBA 1G9AA 3K4AA 2PLV2 4I3GA 3MYXA 4CXWA 1ODNA 3FC0A 4JDOA 5EFUA 2PTMA 1PVXA 1PVC1 2BTVC 1SACA 3LDRA 3AKSA 4OUEA 1DYOA 3ENRA 2VTFA 1CAVA 2ZGNA 3AMNA 3ZFFA 4ARXA 3IDEA 3T0BA 3I3DA 1GANA 1W6QA 1X50A 1RB8G 4P08A 3AP6A 4NE9A 1AYN1 2GALA 3AP5A 4YW7A 4XURA 1EV13 3QH6A 2PHXA 3DN7A 4FOVA 2V5DA 4H55A 4ZXKA 4A45A 5FBJA 4YG6A 4WVMB 4AEDB 1DLCA 5AC92 5IFPA 2HWF2 5K9YA 5L9VA 3CQOA 5A32A 4LBLA 3B01A 3KCXA 3IMMA 4JQRA 2HWC2 1TME1 3I97A 4JHTA 1RUNA 4I3PA 2Q8DA 1ZA4A 2VJXA 3OTFA 4LBKA 3VBRC 2WIIB 4HG6B 1O7FA 4DRRA 4TTGA 4D6QA 1A78A 4E2QA 3CMGA 3WNKA 1RC6A 1SFPA 1PGW1 2HEVF 2GP3A 3HT1A 5JCTA 4Y22B 4EE2A 1RXFA 4XIOA 5FKCA 5ANQA 2ATFA 2DVBA 3JCIA 4GD4A 1ULPA 3AL6A 3CKHA 2QQIA 4Q4X1 4RA0A 3RMYA 3I2DA 2WN2A 1C3HA 2E32A 2WNUC 2XJVA 4OLLA 4CDQC 2CGPA 3FLPA 3ZXAC 1AL0G 2ZHNA 4GH4A 3SC7X 1WA6X 5LY1A 3J8F3 4UAPA 4PIXA 4IV3B 4RGAA 2GH8A 4W6WA 4WZFA 3H8RA 4Z82A 2P1BA 5CFCC 1RUC2 3OUHA 1JZ5A 1ND3A 3LF7A 4IEXA 4P5HA 4JGYA 2YFZA 5AVAA 4AQSA 2VOVA 3S57A 4IXLA 3NNMA 3T0DA 2I2SA 2WZEA 3M8LA 3AJZA 1DQ6A 1GV9A 2ZX3A 3ZFGA 3RZHA 3F95A 4PF1A 1G8WA 2WKKA 4HT1T 1GNZA 4CZSA 3D0JA 2HBUA 3LA2A 4U6DA 1GOHA 4PIZA 5FIXA 5CISA 4OI4A 4LO5B 2A6VA 2XLFA 5DAXA 5LRSA 1KFXL 4AHWA 5FY8A 1RUF1 4D7YA 1UU6A 1UZWA 1PK6C 2ARXA 3IT8A 3J26N 3RI8A 3W59A 4NIGA 2Y26A 1BXHA 1ST8A 5FBZA 1N1SA 5LZ6A 2UU8A 1UOFA 1JBCA 4LO8A 1W0PA 1JOJA 3WAUA 5CFDB 2Y0OA 5F5IA 2E53A 3AXEA 3AVSA 3N36A 3TEYA 4EROA 5F8PA 1X8MA 3VBUA 4XMIA 1LTEA 1XSQA 1OA2A 3MO4A 5H9PA 1EUUA 4F7ZA 4BQ4A 4GJZA 1K5JA 2VMDA 2BRTA 1IPKA 3N9PA 4PBPA 1JH5A 5FY7A 3JBG3 2B42B 2KA3A 2P17A 1RUH2 2XLGA 3FUQA 3JU9A 5A8CA 3NO8A 1XQNA 1RUG1 1UZYA 4M4PA 2EIGA 4CE8A 4AEDA 5K0UC 1F31A 1AR82 1ZYBA 2DU0A 1UZ0A 4D94A 1ZX5A 5FPAA 4Y1XA 5A3PA 2E7QA 1VB2A 2E9QA 2MEV2 3C7GA 2PAEA 5F6KA 2O8QA 4D6RA 5T5PA 3B9IA 4MGQA 2VZSA 5DDJ2 4IE6A 5KBFA 2WJSA 2HKXA 3ES4A 4XFIA 1Q43A 5FV3A 1OF3A 1HRV3 1UZVA 3RJ2X 4ES8A 4DXSA 5GALA 5FZ0A 4QDRA 3OGSA 5FZ6A 2WLQA 1LOAA 4UYBA 1RMU1 3RNSA 2OPWA 3EQEA 1RUI2 5I91A 4D7TA 5A3TA 2XBO2 1W6NB 4PVIA 2ZX4A 2TUNA 2PAMA 1N1VA 2DCJA 2B5HA 5CVRA 5EYXA 1MS1A 5FP4A 3IBMA 5BNOC 2WBKA 3POJA 2JDMA 2HBTA 2ZGOA 3GALA 2RS32 5CZKA 3R0RA 2Y6FA 2VZTA 1QJY2 1ULOA 5C5UA 2VR4A 3VDDA 1JW6A 4PIYA 4JTNA 2C0ZA 3LPFA 4HOOA 2VNRA 3LDKA 3VBFB 1AR63 1RUD2 4FO9A 5FYYA 4DS0A 2ZMLA 4JQTA 1WMDA 1TVGA 2QDRA 4INDA 4R9BA 1MQTA 1VBE3 2WQ8A 4NWVA 2G9ZA 1V6LA 2XXZA 1U12A 4FPCA 2B45X 1LEMA 3RSJA 3KZ4C 2UY8A 2IXLA 3FUOA 3GYDA 2DU1A 2YBSA 3VHNA 4XBQA 4CYDA 5FY5A 2WFF1 1WCDJ 1SDWA 3AK0A 3JB4C 5FZCA 1NCRA 1UY0A 3MIBA 2VC9A 2D40A 1QWRA 1NA1B 2R1BA 4CDWA 1NT0A 2ZKLA 3U4XA 5DPNA 4XPVA 1H1AA 2RDSA 5A7OA 3WPVA 4HVOA 2OA2A 2DYCA 1Q8SA 5A7SA 4KWKA 3W21A 2NN8A 2FBEA 4M3CA 4NN0A 1EYBA 1LRHA 3USSA 3GJBA 3K3OA 1POV3 1UYXA 2OT7A 4Y5Z0 1W8WA 2EIEA 2P3IA 2XVGA 4BXFA 2A70A 2WO1A 1VE0A 3RPQA 1BHGA 1EAH1 1I5ZA 2IC1A 3J4UH 1VBA2 4IL7A 2XOMA 4LIVA 5CFDA 1W90A 2TBVA 3ZLIA 3VUOA 1B09A 2ZABA 2ZHMA 1DFQA 2B46X 1R081 4XDPA 1S0CA 1CD3G 2SLIA 4GB31 3I3BA 1QOSA 4AI3A 1XBFA 1PO21 3BTXA 2JG9C 4CUCA 5A7VB 4Q1PA 4J1XA 4OFGA 1YQ2A 4ISQA 3M3IA 2NPIA 2BWCA 3LGRA 1S0GA 4JHZA 3X29B 3BYLA 1D2SA 1UWWA 2GN3A 3R4SA 4HVQA 1AL23 1PIV3 3FBYA 4AW7A 1CX4A 3J7HA 3BTYA 3T2PA 4D8MA 2JDAA 1H8TA 3FHQA 3EBRA 2IUWA 2JDYA 4P9YA 3VBSC 2VD7A 1AYN2 4YVSC 2C5DA 3NNFA 5F7UA 3IB3A 3R67A 5FUIA 1AR83 2G1MA 3I54A 4NPLA 5AVPA 1XNDA 1UMHA 2BQPA 2R32A 2WWUA 1F35A 3DYPA 4NHXA 2B39A 1IS3A 4KG0A 4LHKA 4RL7A 1TME2 5FPLA 4JCKA 3HD8B 3R4YA 1HIXA 5LA0A 1QMJA 1VRH2 3LEKA 3WEZA 1W28A 5A3OA 3A22A 1LGCA 1RUI3 4Q4V2 2DCTA 4YW1A 1CN1A 1J3RA 5T3NA 4TZDA 2VMFA 3TRSB 5SV8A 2UYAA 1U0AA 3MUZ1 1CR7A 4COZA 3OYWB 2VUJA 2XL9A 3VZKA 1UYPA 3LFIA 5ISLA 3I2JA 1V6OA 3RMXA 4Q4X2 4YW6A 3RS6A 3WF2A 3K77A 2C24A 3H1WA 1DDLA 1DGRA 2WQ4A 2XHNA 3RZZA 1JZ2A 2XR4A 2WYFA 4N90A 1SBFA 5LBFA 4LPLA 1OUXA 2DFCA 3WG3A 3TBDA 3KV6A 3WN1A 4ASLA 4N2RA 3O1SA 3ACGA 3H1YA 3W5NA 4N1IA 5JI9A 1UX6A 4K1YA 3S7EA 2BNOA 2RMU1 2WWJA 2C9AA 4C1WA 1WW5A 3SCFA 4BQYA 5IK4A 1W9FA 2BDRA 4C8DA 3ZX7A 4EJRA 2ORZA 1Y3TA 2IXCA 2X53S 4RQPC 1CQ9A 4ZU4A 5LATA 1W2AX 4FFGA 3WXPA 4XHXA 3LQCA 4GAZA 1IS6A 1XYPA 3IM0A 1SEFA 4FOQA 4XILA 4CUGA 4CP9A 3JUUA 3IPVA 2Q4SA 4GH4C 4IE0A 3W5MA 4MG2A 2H0VA 4QT6A 1X7NA 3WQ0A 1RUF2 5FYBA 3CLPA 2WT0A 1COV1 1ND3C 3LA7A 3MW2A 1S2EA 4IE5A 1OUSA 3LFMA 3VBRB 1J59A 5A7VA 4AE2A 4JGYC 1N47A 1LHWA 4M0NA 1TMF3 3ZSKA 2IVIB 3KQ4B 4CCMA 1YJKA 1OA3A 4LEJA 3WNLA 2BYVE 2ERFA 1OBNA 3ZFGC 2YZ4A 4MUVA 2BNNA 1UU5A 4LKSA 4DNYA 3ZSMA 1MVEA 1TL2A 5C9AA 2FZ1A 4Y26A 4AGGA 2FMYA 5T54A 3VD5A 4CDQB 1P8JA 1SBDA 3PURA 4W6YA 5LK7B 2IXIA 3DUIA 1RUG2 2H0BA 2FD8A 3N9QA 4EV0A 4RHV1 3VZMA 5CFCB 1QY4A 4QX0A 2R061 3AJYA 1R092 5DAPA 2FHRA 2KXLA 5FCCA 2WA4A 5C8CB 3NJZA 1HXS1 4LJHA 3VBUC 5HCBA 1Z78A 2KM2A 3PIJA 4XFBA 2B8MA 2YGMA 4UF0A 4LUKA 4YM1A 1OLMA 3ASIA 5FK7A 4PI2A 1JZ6A 4YGDA 2Q8OA 2WC2A 2YU1A 4KQ7A 5CA6A 2VDTA 2Z4FA 1W18A 1QQP2 4XJZA 2WUHA 2Z79A 4NIAA 1NZIA 1OD3A 4IEYA 4QWNA 2P3YA 2VQTA 1LOEA 3T0AA 3ZMOA 2UWAA 4N53B 3HQXA 5IAVA 1VRH3 1NOVA 1JOPA 1QNYA 1US2A 5A7WB 4AEDC 4CP0A 1X9TA 2V4AA 2QDNA 3BOPA 1XC6A 4KCBA 4Q4V3 1J84A 2RR12 3IKWA 3THPA 1S0DA 4K1ZA 1VBD1 2OQ7A 3POGA 2VZRA 4KBBA 4AL9A 2WAOA 3QOPA 3SCHA 4YLZA 4BISA 3BYNA 3VSZA 4Q4X3 4JDMA 3VBHA 1ZBE3 4B7EA 4UOJA 3U07A 3N35A 2WFF2 4FPLA 1YI9A 1UAIA 2WT1A 3FE5A 1GOGA 4JDNA 1OC1A 3TNPB 1UCXA 4NHLA 1PX3A 2OUJA 5B6SA 4K8FA 4FFIA 1C8NA 5DUWA 4XJWA 2GP5A 4E27A 1Y9MA 4LBNA 1N1TA 3DF0A 3WHUA 1V6MA 3WPYA 4NWWA 4MXWA 5IATA 3VDDC 1OQDA 3ITQA 1UIJA 2JDZA 3J7LA 1R1A3 1HB4A 2RS13 4OUSA 4Y5TA 3OPWA 1E5HA 3K1UA 2EICA 4R8HA 3VT1A 2YV8A 1MQTC 5GZDA 4CCOA 4DUXA 2K2SA 4HPKA 2ADDA 2ZOEB 5DZFA 4JTOA 1DQ0A 3POIA 1D4VB 2ZJCA 4GMP3 1EAH2 1W05A 5JMOA 1LKNA 3VKNA 1TNFA 5F5CA 2O8OA 3B94A 3D6EA 4AFBA 1NCRC 2QQUA 3FLRA 2RDQA 4OZXA 3VDAA 4B8EA 1H4HA 5T5JA 5DG1A 1C57A 4B4PA 1R082 1V9U2 4CDWC 4GB32 3WNXA 1LU1A 1S4CA 1ZA7A 2IXKA 4ZU5A 2JG8B 4M00A 4GWIA 1SQ4A 3T1LA 1F5JA 3U1XA 5BNOB 4A6OA 1PO22 5F37A 1IS5A 1SBEA 2XVLA 2G9GA 2ZHKA 4A3XA 2JE7A 5FZOB 2W52A 4HFSA 1YIPA 5JIUA 3DL3A 1QNWA 3OY8A 5F32A 5C3SA 1B35B 5JPMB 3ZKUA 1S2BA 5IVVA 4DEVA 1JZ4A 1HKDA 2GNBA 1DQ1A 2XWJB 3K75B 1ASJ1 2ARCA 4O8NA 2J1RA 3B3QE 3E6DA 2PHFA 2KR2A 3AMQA 1J58A 1UNBA 1DGWA 1Y43B 4ONUA 4Q4W1 4Y20B 2VXRA 2UWCA 5CAZA 5CFDC 2XGXA 4XXAA 3UKVA 1NAEA 3GF6A 4DXZA 1AF9A 3FFQA 3SH4A 1BMV1 4KNCA 3J7MA 5JXGA 5A1LA 2JB4A 3NWKA 1TG7A 2CAVA 2P37A 4L8QA 1WWYA 1PO11 1XYNA 1WCQA 1KJRA 1TEIA 1R093 1WUVA 5BPXA 3LD8A 4X8PA 5FRAA 5I8TA 4PLOA 4QXHA 3MF9A 4R9DA 2GH2A 3ZR5A 4BMBA 2JWPA 3NNGA 3JQWA 4ZU7A 3H50A 3POBA 2D3RA 4N53A 1MS5A 4CUAA 5LRRA 3SKJE 2AGSA 2VU9A 1V6KA 3MFAA 4J25A 5DUUA 4OULA 4URTA 4JC1A 3BU7A 2NZ9A 1NLSA 4B4RA 1QQP3 1JYCA 2VW1A 2QQNA 1C8M3 5C3PA 1FI2A 2W1UA 2OYZA 1H8TC 1QOOA 2FCTA 4XAAA 3MLLA 2O1QA 2CYFA 1CPMA 5BYNA 4XF3A 3ZDSA 5E89A 1Q8OA 2QCSB 2ID4A 3NL1A 1FV2A 2ZACA 4CVUA 2WNEA 1GYEB 5L7OA 2WAAA 1LB2A 2RR13 4ET7A 1EY2A 5C3QA 4KU7A 4NROA 1CIYA 2JG9B 3K3NA 4I0WB 1L7RA 2WZ8A 3IMNA 3OM5A 4YVWA 3ZYJB 3V64A 2BFUS 1GZ9A 4LBOA 1GLHA 2VG9A 3O14A 2V09A 4HKWA 4FPOB 2ZGSA 2XHKA 3M3OA 4PDWB 1ENSA 4QKDA 3POEA 1POV0 3SEPA 5CKQA 3PU8A 1X82A 2RMU2 2VM9A 3GZAA 2O14A 5H9SA 3LSDA 3M2MA 5C4WA 2XPJA 4XFHA 4FPGA 1PT2A 3OF1A 5FO7B 2ZZQA 5I8SA 2YG0A 2J7MA 4YVSB 3ZR6A 1NKGA 3RQ0A 5J36A 5F6LB 4CU9A 3AZXA 3ZIWA 1WBLA 1QJX1 1RUE3 5DQ0A 2VUAA 2PXJA 3N7MA 4RGKA 2JG8A 1K3IA 1IKQA 1COV2 1UXXX 4JGZA 3ZXEA 3ZXLA 5EJ1B 1RYYA 4XF9A 5FZOA 1FPN3 4CCNA 3I2HA 2DF7A 3ZXDA 3WUDA 1B35A 1JU4A 1LGNA 4QKBA 3ZFFB 3QC2A 3GZUC 4GA9A 3T4HB 1S55A 5DAVA 1V9U3 1W6QB 5ACA3 3AP7A 3NNJA 4O65A 4EN8B 3WDWA 3C7EA 4Y20A 1WLWA 2JX9A 3GCXA 4RFRB 4X6RB 3GM8A 5GZCA 2YFTA 5C3RA 1LOGA 3AYEA 3NKTA 3WW2A 4C1XA 5FDBA 3TEWA 3SNMA 1W6OB 4JAAA 3WQ1A 1XNBA 4ZS2A 3WDXA 4DRVA 3WF3A 3O1OA 5ANNA 3HNYM 4RHV2 1NLRA 2R062 2P3KA 3MLKA 1H9WA 4QX1A 4X6QB 3OM6A 4OMCA 1PNFA 4Y33A 4NMIA 5IAXA 1ENXA 4BB3A 4FBFA 4N9HA 4XE9A 2X10A 2DCZA 3WUCA 4YNIA 1O4YA 2A71A 2QQWA 4XCAA 4Y3OA 3F2ZA 4MHRA 1W99A 3HN3A
chains in the Genus database with same CATH topology
2E31A 4MOAA 2C26A 3LIHA 3WAUA 4PT6A 2EIBA 2W46A 4UDKE 2V4VA 3NJVA 3QEFA 1F4AA 3MO4A 1EUUA 3K46A 4LQRA 1JYNA 2VMDA 2Y6LA 5C7GA 3C7OA 2VO5A 4DXRA 3WMYA 5FK8A 3WF0A 5A8CA 4KCAA 3P1IA 1DP0A 4M4PA 3D5YA 3NRUA 4UDKA 1UZ0A 4AG4A 4ET7A 2EXIA 2VZ1A 3D60A 3C7GA 2BBAA 3HPNA 1GQPA 5IHRA 1SHWB 4MGQA 2VZSA 2RVAA 2JKXA 4CUBA 3KF5A 1OF3A 4DXSA 3T2QA 2VCAA 5JXIA 4QDRA 1JYWA 3OGSA 3AKHA 4PVIA 1NUKA 5A1AA 2DCJA 2VZUA 5CYYA 3K4DA 3AKFA 3VSFA 2QQJA 2WBKA 1JZ7A 5GLLA 4AAXA 5CZKA 2VZTA 3OG2A 5B6TA 1ULOA 2VR4A 4P02B 4DEVA 3LPFA 4CU7A 3LDKA 3EB7A 2YC4A 3P6BA 4UDIA 5AY9A 1JI6A 4MLGA 5GLKA 3P2NA 3OGVA 1TVGA 3ECQA 4AK7A 4XZUG 2WQ8A 4L0PA 4QAWA 5FKBA 1PX4A 1W0NA 2CDPA 3OB8A 1H6XA 3I2GA 3PUIA 1XNAA 1UY0A 2VC9A 5DPNA 3UESA 3QZ4A 4JKLA 3UNPA 2W87A 3WPVA 3LV4A 1Y9GA 3WQBA 2YFRA 1UY3A 2KD7A 4XUOA 2YC2A 4E8CA 2W1QA 4AK6A 2AEYA 4XUPA 3ZXJA 1MPXA 2R7EB 2J1AA 1F4HA 2B4WA 5C70A 1UYXA 5FMBA 2W1SA 4KC7A 2EIEA 4DUVA 3WATA 2WO1A 1JYVA 2VOTA 5JOYA 1BHGA 2XOMA 2Y8KA 2JE8A 2L9LA 5JOZA 1GOFA 3I3BA 2ADEA 3VT0A 2XQXA 2WO2A 4QDSA 2WYSA 2QQKA 2WDBA 2VZVA 4CUCA 5A7VB 5AYDA 4UDGA 1YQ2A 5AYEA 2W1WA 4QDQA 4BK5A 3BGAA 4QX2A 4XUQA 4JHZA 3ETPA 3BYLA 1UWWA 4RYDA 4ARYA 4DXTA 4JX0A 4W4ZA 4A42A 2CDOA 3C7HA 3J7HA 4OYUA 3WNPA 3T2PA 2HYXA 2VZPA 4D8MA 1W9TA 2EIDA 1CZSA 2JDAA 3FHQA 4D47A 5F7UA 3IB3A 1UY2A 3R67A 5FUIA 2VZ3A 5GLNA 5GLRA 2AEZA 1JYXA 3VSRA 5IJRA 3WPZA 1UMHA 5IFTA 2VQUA 5LA1A 1PMJX 5B4XA 3LPGA 1GYHA 3DYPA 3QEDA 4QB1A 3GXUA 3R4YA 5LA0A 3LEKA 5HXMA 3WEZA 3VD3A 3A22A 3WSOA 4BDVB 4NOVA 3VD7A 1I5PA 2HLEA 2VMFA 1O59A 3MUZ1 4FFFA 3IAPA 4YPJA 1UYPA 3LFIA 3I2JA 4ONZA 5J1XA 3MBWA 2RV9A 3KF3A 3WF2A 2Y6KA 2J1TA 3K77A 5JUVA 3GGLA 2QQVA 5GLQA 2XHNA 1JZ2A 2ZEYA 2ORXA 3FN9A 3SKVA 2ZEWA 2X05A 1GMMA 2VCBA 4LPLA 2J1UA 4AK5A 3WN1A 4RN5A 1US3A 2OKXA 4N2RA 1UMIA 3ACGA 3W5NA 4N1IA 4OMDA 5DMYA 1JZ3A 4QQSA 3KSTA 2RJ2A 2ORZA 3OEAA 4BXSV 1CZTA 1W2TA 3CU9A 4FFGA 3LQCA 3WN2A 4KMQA 5JXHA 3DECA 3R4ZA 3AKGA 3W5MA 3D3AA 1PMHX 2XONA 2Y6HA 3HOBA 2ZEZA 2W3JA 1K42A 3CIHA 1GNYA 1YRZA 5EJZB 1CX1A 1VKDA 4O8PA 5A7VA 2EXJA 5EIYB 3UGHA 3VT2A 3WPUA 4MADA 3A7QA 2LS6A 1W9SA 5GLPA 2W92A 3WNLA 1SDDB 4KWUA 4LKSA 5HPOA 3I3EA 5A8DA 2JD9A 3ACIA 3HNBM 1XPWA 3VD5A 2LW8A 5LA2A 1P8JA 3OBAA 4UDJA 5JOWA 3WNMA 3WF1A 1UYZA 1SG3A 4QX0A 1W8NA 1Y4WA 3LEGA 2BERA 3U75A 5FMDA 2QBXA 2VMCA 1T2XA 3ZM8A 2ZXQA 3VD9A 3T2OA 3BYJA 1H6YA 3LIGA 3PIJA 2EXHA 1JZ8A 1GYDB 3HJRA 1O8PA 3LE0A 3T09A 3ACFA 5FK7A 1JZ6A 4M4RA 4N4BA 4BK4A 2VDTA 2Z4FA 1W18A 5IYYA 2WUHA 1OD3A 4FI9A 4A44A 4QX3A 1Y7BA 2VQTA 2WO3A 3OM7A 3T0AA 4COTA 2WABA 2X09A 1WL7A 3UGGA 1W8OA 3BYKA 1US2A 5JXJA 4KCBA 3T08A 1XC6A 3C2UA 1UX7A 3WN0A 3VSSA 1J84A 4CU8A 3A23A 1CZVA 2X8SA 2J1VA 5AYCA 3HNMA 2BGOA 1OYGA 2ZEXA 3WNNA 1UY1A 1O8SA 2VZRA 3VSZA 2Y64A 2WAOA 3BYNA 2EXKA 2E33A 3I2IA 2VZQA 3JXSA 2W47A 2B9VA 4UOJA 3QEEA 3PUHA 3VDBA 1GOGA 3CZUA 1UV4A 5B6SA 1PX3A 3SEEA 2QQMA 5JR2A 4OZOA 4FFIA 2J1SA 1NX9A 4KI5M 3THCA 1Y9MA 4N2ZA 3WPYA 2VMEA 2C9KA 2X8TA 3NQHA 3WMZA 5JOXA 2VZOA 2W5FA 2DCKA 3IIIA 2BGPA 3EYPA 4A41A 4ZZ8A 2EICA 3K1UA 3VT1A 2VL4A 3CZJA 4DUXA 1YIFA 4QPWA 2ADDA 3D5ZA 3MUY1 5JMOA 5FLWA 3ZXLA 3MV01 2BZDA 3A21A 3TAWA 3ABZA 2PQSA 2QQUA 4LHSA 3VDAA 3WASA 5C71A 1EUTA 3OEBA 4XVHA 3ZXKA 4GWIA 3LEMA 4CU6A 5I0DA 4A6OA 4MO3M 3WF4A 1LNSA 3UETA 4DEQA 1OH4A 1JZ4A 3K75B 1GUIA 3AC0A 2V72A 1D7PM 4KC8A 4O8NA 3BN6A 4JKKA 2YFSA 1KGYA 2J1RA 3C8XA 4UI9L 5LCWL 3IDAA 4Z2AA 4IUGA 4A4AA 1L7QA 4ZXEA 3U14A 1NAEA 1WKYA 5JXGA 3D61A 2Y6JA 1TG7A 3UGFA 1WCQA 2W91A 3LEIA 3PIGA 4XUNA 2XQRA 1R64A 3MV11 5G05L 1JHJA 4ZZ5A 3NNGA 4GZ9A 4MGSA 4W50A 4EQVA 4CUAA 1K45A 3DYMA 3E1F1 3SKJE 4PVAA 2X8FA 2J22A 2B4KA 2AC1A 4JKMA 3GDBA 2WN3A 3K4AA 3HEIA 4XUTA 2QQNA 1YI7A 2W1UA 3FHAA 4KMIA 4BJ0A 3LDRA 3RWKX 4OUEA 1OT5A 4PQQA 1DYOA 2VTFA 2ID4A 4ARXA 1GYEB 4CVUA 3T0BA 2WAAA 1JU3A 2E26A 3I3DA 3OGRA 1CIYA 1L7RA 2WZ8A 4P08A 3OM5A 3CDZB 3VDCA 4XURA 2V5DA 3ACHA 4A45A 3DYOA 1DLCA 4GWJA 5IFPA 3CQOA 2DDUA 2VCCA 5GLMA 3U37A 3SEPA 2VM9A 3I97A 1PT2A 2VJXA 5FMCA 2YG0A 2J7MA 4HG6B 4TTGA 1NKGA 4P00B 4CU9A 4FFHA 3CMGA 3WNKA 2W95A 5DQ0A 5G04L 1W9WA 1K12A 3I2FA 1XNTA 5FKCA 3VD4A 2QQLA 1K3IA 1ULPA 3CKHA 4QB2A 2QQIA 1UXXX 3WNOA 4E8DA 2WN2A 1UXZA 1IQDC 1HN1A 2E32A 5EJ1B 3IAQA 1RYYA 2QQOA 4ZY9A 4D0QA 5GLOA 4U6BA 3SC7X 3I2HA 2W94A 3NJXA 1JU4A 2YB7A 4UAPA 1KEXA 2C4XA 2YFUA 3QC2A 1JZ5A 3I2KA 3LF7A 4P5YA 4W8JA 2Y6GA 3C7EA 2YFZA 4DUWA 3T0DA 2W9XA 3GM8A 2YFTA 2WZEA 1UYYA 3C7FA 4TXWA 3OM4A 1OF4A 3AKIA 3OM2A 1UY4A 4PF1A 4O8OA 2J1EA 3WF3A 5ANNA 3HNYM 3THDA 5DN2A 3FL7A 4U6DA 4QX1A 4QB6A 3OM6A 1GOHA 3K4ZA 4A3ZA 4OMCA 5FIXA 2OXBA 5B4NA 1J83A 2X10A 2QQWA 1GU3A 3F2ZA 1ST8A 5C0PA 1W99A 3HN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E31 A;  4MOA A;  2C26 A;  3LIH A;  3WAU A;  4PT6 A;  2EIB A;  2W46 A;  4UDK E;  2V4V A;  3NJV A;  3QEF A;  1F4A A;  3MO4 A;  1EUU A;  3K46 A;  4LQR A;  1JYN A;  2VMD A;  2Y6L A;  5C7G A;  3C7O A;  2VO5 A;  4DXR A;  3WMY A;  5FK8 A;  3WF0 A;  5A8C A;  4KCA A;  3P1I A;  1DP0 A;  4M4P A;  3D5Y A;  3NRU A;  4UDK A;  1UZ0 A;  4AG4 A;  4ET7 A;  2EXI A;  2VZ1 A;  3D60 A;  3C7G A;  2BBA A;  3HPN A;  1GQP A;  5IHR A;  1SHW B;  4MGQ A;  2VZS A;  2RVA A;  2JKX A;  4CUB A;  3KF5 A;  1OF3 A;  4DXS A;  3T2Q A;  2VCA A;  5JXI A;  4QDR A;  1JYW A;  3OGS A;  3AKH A;  4PVI A;  1NUK A;  5A1A A;  2DCJ A;  2VZU A;  5CYY A;  3K4D A;  3AKF A;  3VSF A;  2QQJ A;  2WBK A;  1JZ7 A;  5GLL A;  4AAX A;  5CZK A;  2VZT A;  3OG2 A;  5B6T A;  1ULO A;  2VR4 A;  4P02 B;  4DEV A;  3LPF A;  4CU7 A;  3LDK A;  3EB7 A;  2YC4 A;  3P6B A;  4UDI A;  5AY9 A;  1JI6 A;  4MLG A;  5GLK A;  3P2N A;  3OGV A;  1TVG A;  3ECQ A;  4AK7 A;  4XZU G;  2WQ8 A;  4L0P A;  4QAW A;  5FKB A;  1PX4 A;  1W0N A;  2CDP A;  3OB8 A;  1H6X A;  3I2G A;  3PUI A;  1XNA A;  1UY0 A;  2VC9 A;  5DPN A;  3UES A;  3QZ4 A;  4JKL A;  3UNP A;  2W87 A;  3WPV A;  3LV4 A;  1Y9G A;  3WQB A;  2YFR A;  1UY3 A;  2KD7 A;  4XUO A;  2YC2 A;  4E8C A;  2W1Q A;  4AK6 A;  2AEY A;  4XUP A;  3ZXJ A;  1MPX A;  2R7E B;  2J1A A;  1F4H A;  2B4W A;  5C70 A;  1UYX A;  5FMB A;  2W1S A;  4KC7 A;  2EIE A;  4DUV A;  3WAT A;  2WO1 A;  1JYV A;  2VOT A;  5JOY A;  1BHG A;  2XOM A;  2Y8K A;  2JE8 A;  2L9L A;  5JOZ A;  1GOF A;  3I3B A;  2ADE A;  3VT0 A;  2XQX A;  2WO2 A;  4QDS A;  2WYS A;  2QQK A;  2WDB A;  2VZV A;  4CUC A;  5A7V B;  5AYD A;  4UDG A;  1YQ2 A;  5AYE A;  2W1W A;  4QDQ A;  4BK5 A;  3BGA A;  4QX2 A;  4XUQ A;  4JHZ A;  3ETP A;  3BYL A;  1UWW A;  4RYD A;  4ARY A;  4DXT A;  4JX0 A;  4W4Z A;  4A42 A;  2CDO A;  3C7H A;  3J7H A;  4OYU A;  3WNP A;  3T2P A;  2HYX A;  2VZP A;  4D8M A;  1W9T A;  2EID A;  1CZS A;  2JDA A;  3FHQ A;  4D47 A;  5F7U A;  3IB3 A;  1UY2 A;  3R67 A;  5FUI A;  2VZ3 A;  5GLN A;  5GLR A;  2AEZ A;  1JYX A;  3VSR A;  5IJR A;  3WPZ A;  1UMH A;  5IFT A;  2VQU A;  5LA1 A;  1PMJ X;  5B4X A;  3LPG A;  1GYH A;  3DYP A;  3QED A;  4QB1 A;  3GXU A;  3R4Y A;  5LA0 A;  3LEK A;  5HXM A;  3WEZ A;  3VD3 A;  3A22 A;  3WSO A;  4BDV B;  4NOV A;  3VD7 A;  1I5P A;  2HLE A;  2VMF A;  1O59 A;  3MUZ 1;  4FFF A;  3IAP A;  4YPJ A;  1UYP A;  3LFI A;  3I2J A;  4ONZ A;  5J1X A;  3MBW A;  2RV9 A;  3KF3 A;  3WF2 A;  2Y6K A;  2J1T A;  3K77 A;  5JUV A;  3GGL A;  2QQV A;  5GLQ A;  2XHN A;  1JZ2 A;  2ZEY A;  2ORX A;  3FN9 A;  3SKV A;  2ZEW A;  2X05 A;  1GMM A;  2VCB A;  4LPL A;  2J1U A;  4AK5 A;  3WN1 A;  4RN5 A;  1US3 A;  2OKX A;  4N2R A;  1UMI A;  3ACG A;  3W5N A;  4N1I A;  4OMD A;  5DMY A;  1JZ3 A;  4QQS A;  3KST A;  2RJ2 A;  2ORZ A;  3OEA A;  4BXS V;  1CZT A;  1W2T A;  3CU9 A;  4FFG A;  3LQC A;  3WN2 A;  4KMQ A;  5JXH A;  3DEC A;  3R4Z A;  3AKG A;  3W5M A;  3D3A A;  1PMH X;  2XON A;  2Y6H A;  3HOB A;  2ZEZ A;  2W3J A;  1K42 A;  3CIH A;  1GNY A;  1YRZ A;  5EJZ B;  1CX1 A;  1VKD A;  4O8P A;  5A7V A;  2EXJ A;  5EIY B;  3UGH A;  3VT2 A;  3WPU A;  4MAD A;  3A7Q A;  2LS6 A;  1W9S A;  5GLP A;  2W92 A;  3WNL A;  1SDD B;  4KWU A;  4LKS A;  5HPO A;  3I3E A;  5A8D A;  2JD9 A;  3ACI A;  3HNB M;  1XPW A;  3VD5 A;  2LW8 A;  5LA2 A;  1P8J A;  3OBA A;  4UDJ A;  5JOW A;  3WNM A;  3WF1 A;  1UYZ A;  1SG3 A;  4QX0 A;  1W8N A;  1Y4W A;  3LEG A;  2BER A;  3U75 A;  5FMD A;  2QBX A;  2VMC A;  1T2X A;  3ZM8 A;  2ZXQ A;  3VD9 A;  3T2O A;  3BYJ A;  1H6Y A;  3LIG A;  3PIJ A;  2EXH A;  1JZ8 A;  1GYD B;  3HJR A;  1O8P A;  3LE0 A;  3T09 A;  3ACF A;  5FK7 A;  1JZ6 A;  4M4R A;  4N4B A;  4BK4 A;  2VDT A;  2Z4F A;  1W18 A;  5IYY A;  2WUH A;  1OD3 A;  4FI9 A;  4A44 A;  4QX3 A;  1Y7B A;  2VQT A;  2WO3 A;  3OM7 A;  3T0A A;  4COT A;  2WAB A;  2X09 A;  1WL7 A;  3UGG A;  1W8O A;  3BYK A;  1US2 A;  5JXJ A;  4KCB A;  3T08 A;  1XC6 A;  3C2U A;  1UX7 A;  3WN0 A;  3VSS A;  1J84 A;  4CU8 A;  3A23 A;  1CZV A;  2X8S A;  2J1V A;  5AYC A;  3HNM A;  2BGO A;  1OYG A;  2ZEX A;  3WNN A;  1UY1 A;  1O8S A;  2VZR A;  3VSZ A;  2Y64 A;  2WAO A;  3BYN A;  2EXK A;  2E33 A;  3I2I A;  2VZQ A;  3JXS A;  2W47 A;  2B9V A;  4UOJ A;  3QEE A;  3PUH A;  3VDB A;  1GOG A;  3CZU A;  1UV4 A;  5B6S A;  1PX3 A;  3SEE A;  2QQM A;  5JR2 A;  4OZO A;  4FFI A;  2J1S A;  1NX9 A;  4KI5 M;  3THC A;  1Y9M A;  4N2Z A;  3WPY A;  2VME A;  2C9K A;  2X8T A;  3NQH A;  3WMZ A;  5JOX A;  2VZO A;  2W5F A;  2DCK A;  3III A;  2BGP A;  3EYP A;  4A41 A;  4ZZ8 A;  2EIC A;  3K1U A;  3VT1 A;  2VL4 A;  3CZJ A;  4DUX A;  1YIF A;  4QPW A;  2ADD A;  3D5Z A;  3MUY 1;  5JMO A;  5FLW A;  3ZXL A;  3MV0 1;  2BZD A;  3A21 A;  3TAW A;  3ABZ A;  2PQS A;  2QQU A;  4LHS A;  3VDA A;  3WAS A;  5C71 A;  1EUT A;  3OEB A;  4XVH A;  3ZXK A;  4GWI A;  3LEM A;  4CU6 A;  5I0D A;  4A6O A;  4MO3 M;  3WF4 A;  1LNS A;  3UET A;  4DEQ A;  1OH4 A;  1JZ4 A;  3K75 B;  1GUI A;  3AC0 A;  2V72 A;  1D7P M;  4KC8 A;  4O8N A;  3BN6 A;  4JKK A;  2YFS A;  1KGY A;  2J1R A;  3C8X A;  4UI9 L;  5LCW L;  3IDA A;  4Z2A A;  4IUG A;  4A4A A;  1L7Q A;  4ZXE A;  3U14 A;  1NAE A;  1WKY A;  5JXG A;  3D61 A;  2Y6J A;  1TG7 A;  3UGF A;  1WCQ A;  2W91 A;  3LEI A;  3PIG A;  4XUN A;  2XQR A;  1R64 A;  3MV1 1;  5G05 L;  1JHJ A;  4ZZ5 A;  3NNG A;  4GZ9 A;  4MGS A;  4W50 A;  4EQV A;  4CUA A;  1K45 A;  3DYM A;  3E1F 1;  3SKJ E;  4PVA A;  2X8F A;  2J22 A;  2B4K A;  2AC1 A;  4JKM A;  3GDB A;  2WN3 A;  3K4A A;  3HEI A;  4XUT A;  2QQN A;  1YI7 A;  2W1U A;  3FHA A;  4KMI A;  4BJ0 A;  3LDR A;  3RWK X;  4OUE A;  1OT5 A;  4PQQ A;  1DYO A;  2VTF A;  2ID4 A;  4ARX A;  1GYE B;  4CVU A;  3T0B A;  2WAA A;  1JU3 A;  2E26 A;  3I3D A;  3OGR A;  1CIY A;  1L7R A;  2WZ8 A;  4P08 A;  3OM5 A;  3CDZ B;  3VDC A;  4XUR A;  2V5D A;  3ACH A;  4A45 A;  3DYO A;  1DLC A;  4GWJ A;  5IFP A;  3CQO A;  2DDU A;  2VCC A;  5GLM A;  3U37 A;  3SEP A;  2VM9 A;  3I97 A;  1PT2 A;  2VJX A;  5FMC A;  2YG0 A;  2J7M A;  4HG6 B;  4TTG A;  1NKG A;  4P00 B;  4CU9 A;  4FFH A;  3CMG A;  3WNK A;  2W95 A;  5DQ0 A;  5G04 L;  1W9W A;  1K12 A;  3I2F A;  1XNT A;  5FKC A;  3VD4 A;  2QQL A;  1K3I A;  1ULP A;  3CKH A;  4QB2 A;  2QQI A;  1UXX X;  3WNO A;  4E8D A;  2WN2 A;  1UXZ A;  1IQD C;  1HN1 A;  2E32 A;  5EJ1 B;  3IAQ A;  1RYY A;  2QQO A;  4ZY9 A;  4D0Q A;  5GLO A;  4U6B A;  3SC7 X;  3I2H A;  2W94 A;  3NJX A;  1JU4 A;  2YB7 A;  4UAP A;  1KEX A;  2C4X A;  2YFU A;  3QC2 A;  1JZ5 A;  3I2K A;  3LF7 A;  4P5Y A;  4W8J A;  2Y6G A;  3C7E A;  2YFZ A;  4DUW A;  3T0D A;  2W9X A;  3GM8 A;  2YFT A;  2WZE A;  1UYY A;  3C7F A;  4TXW A;  3OM4 A;  1OF4 A;  3AKI A;  3OM2 A;  1UY4 A;  4PF1 A;  4O8O A;  2J1E A;  3WF3 A;  5ANN A;  3HNY M;  3THD A;  5DN2 A;  3FL7 A;  4U6D A;  4QX1 A;  4QB6 A;  3OM6 A;  1GOH A;  3K4Z A;  4A3Z A;  4OMC A;  5FIX A;  2OXB A;  5B4N A;  1J83 A;  2X10 A;  2QQW A;  1GU3 A;  3F2Z A;  1ST8 A;  5C0P A;  1W99 A;  3HN3 A; 
#chains in the Genus database with same CATH topology
 1LES A;  1QJE A;  2LRO A;  4MOA A;  1GP6 A;  4HBN A;  3OPZ A;  5C9A C;  3B02 A;  2ZGU A;  1BEV 1;  1OOP A;  3NJV A;  4IEV A;  1O5U A;  5FUN A;  2BBV A;  3DPR B;  4GH4 B;  1WMX A;  4X8N A;  2QZ2 A;  5F5A A;  4LQR A;  3AL5 A;  5AFB A;  1FMD 3;  2Y6L A;  2VOW A;  4QXC A;  3TWI A;  3VZL A;  3C7O A;  1ND3 B;  1LHN A;  2YXS A;  5LEK A;  1UMZ A;  2HWD 1;  1CAW B;  1VBD 2;  3RWN A;  4LNV A;  1DP0 A;  3WR0 A;  4QPI A;  5A70 A;  2XUM A;  1QJU 1;  3NRU A;  4LLF A;  4UDK A;  3AKT A;  1QEX A;  4PDW A;  2CGN A;  1YCI A;  2VZ1 A;  4MGZ E;  1A34 A;  1NQJ A;  4ZON A;  5JR7 B;  1GQP A;  5IHR A;  5FZ8 A;  2P34 A;  1I9R A;  2JKX A;  4JV4 A;  1VR3 A;  4Q4Y 1;  2D97 A;  1RIT A;  3M3E A;  3POY A;  5DXD A;  1RUJ 3;  4HK9 A;  4CP1 A;  4AEJ A;  1ZBA 1;  2D44 A;  1QIQ A;  3UV9 A;  3LB9 A;  5DAQ A;  4AI0 A;  1BVP 1;  1O4Z A;  2Z69 A;  1FOD 3;  2GC2 A;  2HWB 2;  4XJ9 A;  3AKF A;  3VSF A;  2QQJ A;  1JZ7 A;  5GLL A;  2D7F A;  3GBW A;  3L9J T;  2VY0 A;  5T50 A;  3OG2 A;  3VBU B;  1RUO A;  1GZW A;  5EV7 A;  3MPB A;  5JI7 A;  3FBM A;  2ZGQ A;  3O5S A;  1VBB 3;  4MH0 E;  3VBH C;  1D4M 1;  2A6Y A;  2D6L X;  4RSU A;  1S0J A;  4NHY A;  4ATF A;  4QQL A;  4NII A;  3ECQ A;  3H7J A;  3ATG A;  3MW3 A;  1DQ4 A;  4M3C E;  4Q27 A;  2IZW A;  3BPZ A;  4Q0P A;  1ZRR A;  4QAW A;  1PX4 A;  5FKB A;  2RG4 A;  3BB6 A;  4AXO A;  4L9B A;  2CDP A;  5FY1 A;  1MS4 A;  4AVB A;  5C5T A;  4F8A A;  4IEO A;  1SLB A;  2X8K A;  4N7U A;  1REE A;  1XJA A;  4ATE A;  2BWA A;  2D3S A;  3B7M A;  4IGQ A;  1GSL A;  3UKT A;  5FYC A;  4TN7 A;  3A4U A;  4L92 A;  4QQO A;  3UES A;  1W6O A;  3QZ4 A;  4JKL A;  2JKB A;  2A7A A;  1OD5 A;  3LV4 A;  1ASJ 2;  4YZ4 A;  4UFK A;  3WQB A;  4IW3 A;  4MXV A;  2DTW A;  4XF1 A;  2E51 A;  4XUO A;  1DGW X;  3WT3 A;  2Y60 A;  4CTE A;  4AK6 A;  4Q4W 2;  1K5M A;  4C90 A;  3ZXJ A;  1Q8P A;  2WIN B;  2J1A A;  5C70 A;  1BMV 2;  2CTV A;  2CAU A;  2PHU A;  4DUV A;  3WAT A;  3U11 A;  4IEZ A;  1PO1 2;  1AR7 1;  1JYV A;  5JOY A;  1OHF A;  5FPU A;  2EF6 A;  2VE1 A;  2YMZ A;  3ZSE A;  2Y8K A;  3FX3 A;  3AX4 A;  5EP9 A;  2L9L A;  1Z0H A;  3VDD B;  1SLL A;  4LKF A;  3U10 A;  1GOF A;  4L2N A;  4FAH A;  3DPR A;  4URA A;  1R1Z A;  3UT0 A;  4A7Y A;  1BJQ A;  2ADE A;  1RL3 A;  2XQX A;  1BK1 A;  2WO2 A;  3PME A;  2QJV A;  3Q8B A;  3WW3 A;  2RM2 1;  2ETE A;  2WDB A;  2VZV A;  3CO2 A;  5JSO A;  3RZL A;  1MQT B;  3AYD A;  2OPK A;  4YM0 A;  2WSV A;  5AYD A;  2Y34 A;  5AYE A;  2W1W A;  1CAW A;  4QGN A;  3BGA A;  1HDK A;  1WCU A;  5D2A A;  5C8C C;  3IWZ A;  4IE7 A;  4XUQ A;  4YG0 A;  4OHZ A;  2GND A;  1NCR B;  3J7N A;  4AFD A;  4CDW B;  4B1M A;  4LO6 B;  4DXT A;  5HV0 A;  4P9J A;  3ZMN A;  2R04 1;  3LDB A;  2AZ5 A;  1JXN A;  4OQ8 A;  2HYX A;  3R4D B;  4EYU A;  5ERL A;  4B29 A;  1W9T A;  3ES1 A;  1Z7S 2;  2OZJ A;  4QX5 A;  1VBD 3;  4D47 A;  4M3C B;  3MPP G;  3PU3 A;  1AYM 1;  3RYK A;  4B4Q A;  4N9I A;  4DPN A;  4N53 C;  1W39 A;  3WPZ A;  2JDN A;  2OS2 A;  3PVN A;  5IFT A;  2DWR A;  3H7Y A;  4RS5 A;  2RDR A;  1GYH A;  4XFF A;  3VHR A;  4MGK E;  3L2H A;  5JLV A;  4KGQ A;  1DGL A;  1APN A;  4QKN A;  4LBQ D;  5KXD A;  4UWD A;  1ZZB A;  2R07 1;  5GJ6 A;  1OI6 A;  3H8X A;  4GMP 0;  4LE3 A;  4KBZ A;  3VHO A;  2DCY A;  5BNP A;  3PVB B;  3WP6 A;  5LAS A;  3LOI A;  4NOV A;  1VP6 A;  4FPK A;  4U2A A;  4XC9 A;  3D0S A;  3T3Y A;  2HWB 3;  1QJX 2;  5A6Z A;  1H1I A;  2UWB A;  3Q8E A;  3MDP A;  4FFF A;  4MLO A;  1LOF A;  3IAP A;  4YVW C;  2PLV 3;  1S0B A;  2VNG A;  3N9M A;  4DFS A;  5C33 A;  4UBH A;  5DAB A;  2NM1 A;  4Q29 A;  1QKQ A;  3OPT A;  4M01 A;  1N3O A;  5KXB A;  3EJK A;  3GGL A;  4G9S B;  2QQV A;  5GLQ A;  2Z5W A;  3O0W A;  3KV5 A;  3FN9 A;  3MEP A;  1Q8Q A;  3HBZ A;  3SKV A;  2GU9 A;  2RJL A;  3HQR A;  3I7D A;  2X05 A;  5C4W C;  2VCB A;  1WCK A;  1RVF 1;  1UPI A;  3OSD A;  3R05 A;  2J1U A;  4XAC A;  1H8T B;  4YZ5 A;  1OUR A;  5J7M A;  4EWA A;  4AK5 A;  4I02 A;  3BI3 A;  3OUI A;  4NUB A;  1UMI A;  1AR9 1;  2A3W A;  3KGZ A;  5AC9 3;  4K3U A;  5DMY A;  4R9A A;  2HWF 3;  3V0B A;  4BQ5 A;  2TEP A;  5FYI A;  2RJ2 A;  2XH6 A;  4I0B A;  2DBN A;  2XJQ A;  1OH3 A;  2HWC 3;  5CG9 A;  2NP0 A;  2QKD A;  4K40 A;  3ST7 A;  2A75 A;  1CZT A;  3SXW A;  4BXS V;  5C8W A;  2JG8 C;  4CCK A;  3WP3 A;  3WN2 A;  2J42 A;  4YWA A;  3U0Z A;  4JGZ C;  5JXH A;  2P2K A;  3R4Z A;  1O5L A;  1RHI 2;  1CAU A;  1H9P A;  1X9P A;  3MW4 A;  1TNR A;  1B35 C;  2B7Y A;  5FYZ A;  2ZEZ A;  3KT4 A;  2W3J A;  3CL1 A;  1RIR A;  4QD2 A;  1DGR N;  1OVP A;  3AP9 A;  1HQN A;  3AKR A;  1GNY A;  4IES A;  1JOB A;  1YUD A;  3MGU A;  1MEC 1;  4Y5S A;  1ZRC A;  1CX1 A;  4O8P A;  1W2U A;  2EXJ A;  4BQX A;  5EIY B;  4CCL A;  3WPU A;  4MAD A;  5GKA C;  5C3O A;  1JUI A;  3A7Q A;  2LS6 A;  2WWS A;  1BEV 2;  5FLI A;  5I0T A;  1UKG A;  2XVK A;  5L9B A;  2W92 A;  1SDD B;  1FV3 A;  4N43 A;  4AF9 A;  5DAW A;  1IPS A;  2FQP A;  4KWU A;  4R9C A;  4BOW A;  2VOX A;  1OKO A;  3PTR B;  3UJQ A;  1YNA A;  5FRE A;  4IEP A;  1RUC 3;  1J3P A;  5FPX A;  3VL8 A;  1VAK A;  3ACI A;  3HNB M;  1XPW A;  3I4I A;  4QXB A;  2LW8 A;  2LUW A;  3RG0 A;  2HWD 2;  3OBA A;  4V1P A;  4Q8K A;  4FT8 A;  1Q8V A;  4XAB A;  2D6K A;  2HWE 1;  3WNM A;  1HRI 1;  3AYA A;  5LB6 A;  4SLI A;  1ULE A;  3QD6 A;  1UKR A;  4HKO A;  2BER A;  5GLT A;  3ZYB A;  4LK6 A;  2PQQ A;  2XJS A;  5LBC A;  1ZZC A;  2CV6 A;  3S7I A;  2H6B A;  1Z7S 3;  1KDK A;  1OOP C;  1H30 A;  2RS5 1;  3O0V A;  3KHB A;  5IUQ A;  5JMC A;  4CP9 B;  4Q4Y 2;  4C0B A;  3JB8 A;  3IPV B;  5J3U A;  1H6Y A;  3LIG A;  5DZG A;  3BYJ A;  2EXH A;  2G19 A;  4YRD A;  3HJR A;  4AQ2 A;  3ACF A;  1FAT A;  3ALQ A;  5FUP A;  5FZF A;  4BK4 A;  4DO0 A;  2R49 A;  4FI9 A;  4A44 A;  3AKQ A;  5FZG A;  1JYT A;  2PFW A;  1WL7 A;  2ILM A;  3UGG A;  5FOB B;  3D8C A;  4QPI C;  5JXJ A;  1BZW A;  4YGC A;  1DBN A;  1JHN A;  1UX7 A;  3KMH A;  5BNQ A;  1L7L A;  5J48 A;  4PDW C;  1PVC 2;  3MIG A;  3VSS A;  1D4M 2;  1NQD A;  1OLQ A;  4Q2F A;  1HJG A;  5L9R A;  5C9A B;  2BGO A;  4G3Y C;  1MR5 A;  1OYG A;  4NRM A;  5FYM A;  1U5X A;  1IOA A;  4OHV A;  1RUH 3;  2F4P A;  3UJO A;  3WIN E;  5D1I A;  1OVS A;  3TAY A;  5A33 A;  1WLC A;  3JXS A;  4E2G A;  2OQ6 A;  1VMJ A;  1W6M A;  2F4L A;  2WS9 1;  2B9V A;  2XL7 A;  5ABJ A;  5HBA A;  3VDB A;  3SHR A;  4DMI A;  1NYW A;  1U5Z A;  1FNY A;  1SCR A;  4OQ9 A;  2MEV 3;  4WVV A;  3NAP B;  5JR2 A;  2K9Z A;  1BBT 1;  3THC A;  3SQO A;  5DDJ 3;  3H3U A;  5A3M A;  1O3S A;  2VME A;  5A6Q A;  5CIR A;  1WCS A;  2C9K A;  2FZ2 A;  1EP0 A;  1HV1 A;  4UF0 B;  1QJF A;  4YW3 A;  1UQX A;  5K4L A;  4B3N A;  5JOX A;  3III A;  2Y38 A;  2BGP A;  4IEW A;  2XBO 3;  1CJP A;  2AAC A;  4Q26 A;  3ZFF C;  4MVT A;  4AHZ A;  3I2O A;  2VL4 A;  1OSG A;  1CWP A;  4XW3 A;  2YHJ A;  1PGW 2;  2UYB A;  3SCG A;  1QXR A;  3HQU A;  1AR7 2;  2WA3 A;  3MUY 1;  3D5Z A;  4AGR A;  2RS3 3;  2JDH A;  3MV0 1;  4TYS A;  1E5S A;  1RHI 3;  1RXG A;  1QJY 3;  3A21 A;  4H7M A;  4LHS A;  4RGG A;  4DIQ A;  1RUD 3;  2WZR 1;  2OX0 A;  1IHM A;  4HAN A;  5CNA A;  5HCA A;  1UO9 A;  4NIH A;  5A6X A;  1OLR A;  4LBJ A;  2QFE A;  3ZO0 B;  2RM2 2;  3H42 B;  4NRQ A;  5FJK A;  4IQP A;  2ZX0 A;  1YXW A;  3WF4 A;  1J3Q A;  4YZ2 A;  2ZPX A;  1XU2 A;  2D5F A;  5GLV A;  1CES A;  4DEQ A;  1K5M C;  3VL9 A;  1SLC A;  1LJ7 A;  3I59 A;  1LOC A;  4V2V A;  5FXV A;  1GUI A;  3VBH B;  3AC0 A;  1FT9 A;  2RJK A;  3MID A;  4WM8 A;  2AEN A;  4ZKT B;  2JEM A;  1MS9 A;  4YGB A;  1KGY A;  2R1D A;  3C8X A;  1O3R A;  1BCX A;  1A8D A;  4UI9 L;  2VQA A;  2ZHL A;  4OVE A;  5F5Q A;  3V56 A;  4CDX B;  5BNN B;  1SCS A;  1ZRD A;  4IUG A;  1W8U A;  4ZXE A;  3LOB A;  1RTV A;  2ZKN A;  2HWD 3;  4MXW B;  2JDU A;  3DPR C;  4NOT A;  2CU5 A;  1AYM 2;  1GP4 A;  5JIA A;  1F2N A;  4LUM A;  5FZ1 A;  3LEI A;  3PIG A;  1A3K A;  2K46 A;  2W2I A;  3N7J A;  2UUR A;  2XQR A;  4GAL A;  1YJL A;  4XUN A;  1WD4 A;  5FY0 A;  4AWD A;  5G05 L;  4CEY A;  5BY5 A;  5A3W A;  4HPK B;  4CXY A;  1DZQ A;  4QM8 A;  2TNF A;  1VBA 3;  3DEM A;  4EQV A;  2R07 2;  4MX3 A;  1V0A A;  3RFR A;  4QM9 A;  4JZR A;  5IVB A;  2D43 A;  4JKM A;  5KHH A;  5FZ3 A;  5FPB A;  1SLT A;  1SLI A;  2ET7 A;  5LA9 A;  3VZJ A;  4FTB A;  4FPY A;  3WDT A;  2Q0A A;  4XUT A;  4HK8 A;  2V5Y A;  4QX8 A;  2CY6 A;  3B00 A;  2C6S A;  3FHA A;  4P9W A;  4BJ0 A;  5D8A A;  2FDI A;  3RWK X;  3OY8 B;  2WLP A;  1DYK A;  5FP8 A;  1OT5 A;  4PQQ A;  5E16 A;  3JD7 1;  3PHM A;  4UT5 A;  1PVC 3;  4XCB A;  2E26 A;  3OGR A;  1IG0 A;  3NKG A;  1ZVF A;  4RS5 C;  4JRL A;  2ARB A;  1FYU A;  3O1V A;  1REF A;  2DFB A;  3E5Q A;  4QHO A;  3VDC A;  2VMG A;  3NAP A;  3O12 A;  1LCL A;  5DUV A;  4Q0V A;  5F1R A;  2E63 A;  1JS9 A;  1AYN 3;  1A8M A;  5FZI A;  2DDU A;  2VCC A;  5BNP C;  4HON A;  1AR9 2;  1WBF A;  3U37 A;  2BGC A;  4XJA A;  1OPM A;  3IZO A;  4V2W A;  5CKM A;  1RMU 2;  5FZ4 A;  4XAE A;  1OPO A;  5KHI A;  1AX1 A;  1GQH A;  2BOI A;  3K48 A;  5KXE A;  3TB0 A;  2D3P A;  2P5B A;  1NCQ B;  1LOF C;  3RYP A;  2HEY F;  1G7Y A;  1TME 3;  4LIT A;  1FNZ A;  5FMO L;  1KD7 A;  5IT6 A;  3VKO A;  4YGE A;  2VVF A;  3OBR A;  3NW4 A;  3POW A;  4P00 B;  5FZL A;  2A3X A;  5CU1 A;  2Q1F A;  3EXU A;  1ULF A;  2JDP A;  3PDQ A;  1WW7 A;  2W95 A;  3HAG A;  4Y24 A;  1W9W A;  2WSU A;  1K12 A;  2H6C A;  2I07 B;  2NMO A;  1YFU A;  1H0B A;  2JEC A;  4TWT A;  4QB2 A;  4FAG A;  3J8F 1;  4BH9 A;  1G9B A;  3FZ3 A;  2QUO A;  4E8D A;  3O1T A;  1XU1 A;  1CJD A;  1HN1 A;  4D0Q A;  2QQO A;  2PAK A;  2VQ0 A;  3O0X A;  5JZG A;  5LK5 A;  4GXL A;  2W94 A;  2ZX1 A;  2Z2S B;  2C4X A;  2YFU A;  1I3H A;  5L7O B;  3I2K A;  2A6X A;  5EXO A;  1PZ8 A;  1PNG A;  4NPM A;  2GDF A;  4AAP A;  1WW6 A;  4LE4 A;  4HZF A;  4W8J A;  5I93 A;  2RM2 3;  2Y6G A;  4YVW B;  1CGP A;  3GHN A;  5H9R A;  1F5F A;  2VOK A;  4CDX A;  3AKP A;  4DUW A;  5BNN A;  1LAJ A;  2W9X A;  1WMF A;  4AI1 A;  5FO8 B;  1UYY A;  3PL0 A;  3PVO A;  3WVJ A;  2PEL A;  1OF4 A;  2MPF A;  3AKI A;  3OM2 A;  1PM7 A;  2Q1M A;  4EN6 B;  2MNG A;  3AZY A;  4O8O A;  5KHK A;  3AZW A;  2A6Z A;  3WX5 A;  3GJA A;  1HRI 2;  3FMG A;  5C4W B;  4QB6 A;  3J9S A;  4D3W A;  3KSC A;  4YZ1 A;  1G9D A;  1ZRI A;  1HLC A;  1UD1 A;  1M06 G;  1JTZ X;  2XJU A;  1S0F A;  2LRP A;  1G9F A;  2RS5 2;  4COW A;  4S2D A;  4BM8 A;  1GU3 A;  4CP2 A;  1RGS A;  4N43 C;  4LOR A;  4Z07 A;  3Q8A A;  3POF A;  1RUF 3;  2E31 A;  3LIH A;  2C26 A;  3S5Q A;  3USU B;  4P9I A;  4Z2W A;  4UDK E;  3WCR A;  3E6B A;  5GZG A;  2FCV A;  2V4V A;  2DV9 A;  4JGZ B;  3E5U A;  4GKY A;  3QEF A;  2WNO A;  1F4A A;  2HEW F;  4RFT 0;  4BU2 A;  1KS4 A;  3UYJ A;  2VBD A;  2EVX A;  4MV2 A;  3FWE A;  3JBG 1;  3QLQ A;  1JYN A;  2DVG A;  3BTA A;  3RJR A;  4XFC A;  4LO4 B;  3UL2 A;  4NAO A;  5C7G A;  3BU0 A;  2YUE A;  3OD0 A;  2VO5 A;  4Q0S A;  3WMY A;  5FK8 A;  2BJS A;  5KC6 A;  2EAA A;  2XG3 A;  4L97 A;  4KCA A;  1M4W A;  3NST A;  4E4D X;  3D5Y A;  1U5I A;  4CXX A;  4IET A;  3BPS A;  4BQ3 A;  3D5O A;  3DCQ A;  4AG4 A;  2EXI A;  4BZ4 A;  1BLZ A;  1ND2 B;  2RE9 A;  2DVD A;  4XQD A;  3GCW A;  1RUG 3;  5FFO C;  4XFA A;  5FLH A;  4OI1 A;  2VCM A;  1HRV 1;  2WS9 2;  4KGG A;  4CCE A;  3HPN A;  5HV4 A;  2X29 A;  3VV1 A;  2Y33 A;  3KVA A;  4QQ2 A;  2RVA A;  2WNU A;  4NVP A;  3THT A;  2ES3 A;  4A2U A;  1ZZ8 A;  1NCQ A;  3E5X A;  3PUS A;  5E6H A;  1W8F A;  2GSY A;  1BBT 2;  3AKH A;  3CEW A;  4HN0 A;  2R30 A;  1NUK A;  3RDI A;  1E5R A;  5CYY A;  4LOS A;  2D6M A;  2GME A;  3K4D A;  1TZO A;  1RMU 3;  1UF2 C;  5LA1 A;  4AAX A;  1AR6 1;  1VAM A;  1S1A A;  1OOP B;  4L11 A;  3LAG A;  3UKN A;  4BPZ A;  1VBC 1;  5B6T A;  2R0F A;  4P02 B;  5HI0 A;  2YDE A;  4CU7 A;  1W6P A;  1VBE 1;  3P6B A;  1H2K A;  4Z8B A;  3O1M A;  5ABJ C;  2XUE A;  4UDI A;  1JI6 A;  1X8E A;  2N7G A;  3RZK A;  5GLK A;  2QTW B;  3P2N A;  3AVR A;  4BE3 A;  2ARE A;  3KT1 A;  4AK7 A;  4OHY A;  4R52 A;  4L0P A;  1H8V A;  2WZR 2;  1OXC A;  1W8Z A;  2PYT A;  4FOW A;  2SBA A;  3WP5 A;  5A80 A;  1KJL A;  2BOJ A;  5KC5 A;  3ZYF A;  1YEW A;  4O9G A;  3T2T A;  3TEX A;  3WAS A;  3D4K A;  1HB2 A;  1H6X A;  2X5I A;  3I2G A;  1XNA A;  4QPI B;  3SH3 A;  4COY A;  3I49 A;  4GKX A;  4FQ4 A;  1SLA A;  4TLG A;  1HQW A;  2NMN A;  1GQG A;  4AVS A;  2HH9 A;  1H2M A;  2R6Q A;  2WFF 3;  2W87 A;  3UNP A;  2O0O A;  5EQU A;  1Y9G A;  1O91 A;  3BAL A;  4EWE A;  2FDK A;  2YFR A;  1UY3 A;  3ELN A;  3PNA A;  4IV1 B;  2W1Q A;  2GZW A;  2VNO A;  2IVJ A;  4LKD A;  2R7E B;  5KHG A;  1XE8 A;  4KC7 A;  2YYO A;  1KIT A;  3LWC A;  5BXX A;  4DOU A;  5CAD A;  5APA A;  3USU A;  5K0U A;  4ZPI A;  1VLN A;  5IK7 A;  2JE8 A;  4BLJ A;  1GZW B;  3M3Q A;  5B2G B;  1J1L A;  1EAH 3;  4AFM A;  4WZC A;  5FZB A;  5FZ7 A;  3ZIX A;  4Y1V A;  1HQL A;  4QDS A;  4HXC A;  3WG4 A;  3SIT A;  4WM8 C;  1QOT A;  2QQK A;  4UFH A;  4AEK A;  2VXJ A;  1R08 3;  4XET A;  3VGI A;  4GB3 3;  5DG2 A;  4E2S A;  1W03 A;  3ZYH A;  1ZZ9 A;  2P6H A;  4BCU A;  1NLQ A;  4UDG A;  2C1F A;  1AL2 1;  1PO2 3;  3CJI B;  1PIV 1;  3AFK A;  2GMM A;  3KCY A;  3MIC A;  2ZTN A;  4P9L A;  4BK5 A;  1KRI A;  1V6I A;  4GJY A;  4RYD A;  3OBZ A;  1ACC A;  4LA3 A;  4QQP A;  2YC0 A;  1ND2 A;  4JX0 A;  2CNA A;  2WR9 A;  3JD7 2;  5GLZ A;  2CDO A;  3C7H A;  5FTT C;  3WNP A;  5KWR A;  2VZP A;  4ZS3 A;  2EID A;  2GNT A;  4CEY C;  4DY3 A;  1YFY A;  2VNV A;  4XQW A;  1XNK A;  1ZZ7 A;  4FPH A;  5LY2 A;  2I45 A;  3CU7 A;  3O1U A;  1XOY A;  1K5M B;  4EWD A;  1RED A;  5EJ3 A;  2ZGR A;  3VZN A;  4AQ6 A;  5GLN A;  5GLR A;  1JYX A;  2PMW B;  1HXS 2;  1V6J A;  4AZZ A;  2VQU A;  1CPN A;  2WNV A;  1PMJ X;  4HSL A;  1MVQ A;  3QED A;  5K7P A;  3S30 A;  1AJO A;  2GMP A;  4UFJ A;  4I30 A;  4QB1 A;  3QCW A;  1STM A;  1ZNP A;  1NE4 A;  2WFP A;  2VTX A;  1DLL A;  3GXU A;  4Q0Q A;  5D8A C;  4CEW B;  5DUX A;  4F83 A;  1QJZ A;  1WZX A;  4TLF A;  1ENR A;  3ZFE A;  2FCU A;  2ZS6 B;  2D6P A;  4NPR A;  5F2W A;  3VD7 A;  4BDV B;  4MZU A;  1ZM1 A;  1W04 A;  3PUA A;  4HL0 A;  4A6S A;  1O59 A;  3RZG A;  2WO7 A;  4HSJ A;  4FTS A;  4KWL A;  2MHF A;  3NAP C;  4CDU B;  4ONZ A;  2OW4 A;  3VBO B;  1MZ6 A;  4QHB A;  3B9C A;  2CWS A;  3S6P A;  3KF3 A;  1VMH A;  5JUV A;  1IZ3 A;  5L36 A;  1V70 A;  5A7P A;  4MGT A;  2ORX A;  2P6C A;  2ZEW A;  3EO6 A;  3BTZ A;  1A6C A;  1GMM A;  5CBL A;  4XXP A;  4FP2 A;  1JUH A;  2VUL A;  4FOY A;  1W06 A;  4RN5 A;  1GWK A;  1BKZ A;  3WG1 A;  4IV1 A;  5TSW A;  4AGV A;  4XZP A;  4OMD A;  4DZG A;  3DV8 A;  3KGL A;  4QQS A;  3KST A;  4XBN A;  4OCT A;  1W2N A;  1GZC A;  3P3N A;  3SMH A;  1POQ A;  4RS5 B;  1VAL A;  1PM4 A;  2RMU 3;  1DIW A;  4TSV A;  5FO9 B;  3CU9 A;  1HV0 A;  4KMQ A;  1NXM A;  2CGO A;  4LTA A;  3ZSL A;  3D3A A;  5JZG C;  3KHC A;  5BNP B;  2XON A;  3PJQ A;  1FXZ A;  1K42 A;  3QAC A;  3CIH A;  5F9T A;  1QF3 A;  1TMF 1;  2JEN A;  4L99 A;  3MIH A;  1YRZ A;  4UW5 A;  1OQE A;  5A6Y A;  2ZGK A;  1PZ9 A;  3H3Z A;  3UGH A;  3VHP A;  1BVV A;  4CDX C;  5A3U A;  5BNN C;  1COV 3;  4CPB D;  4Z1V A;  1W9S A;  3CJI A;  3PLQ A;  4K6B A;  4W6X A;  4OHW A;  4HMZ A;  2DBI A;  3JBG 2;  1Q5O A;  1DZT A;  2DUP A;  3I3E A;  2ZAA A;  2P3J A;  2P4E A;  5FXX A;  5A8D A;  4KL1 A;  3WQ7 A;  2NQY A;  2VH9 A;  3BOW A;  3ZOI A;  5KXC A;  3A0N A;  2DUQ A;  4FP3 A;  4UDJ A;  1GP5 A;  2FMD A;  3HIF A;  5FP3 A;  3N4M A;  4E4H A;  4MET A;  2VVD A;  3V0B B;  1UYZ A;  1SG3 A;  2W39 A;  3O1R A;  3H8U A;  2W68 A;  3LEG A;  3JD7 3;  4FPF A;  2DTY A;  1HRV 2;  1F9K A;  5FMD A;  4QHZ A;  4RHV 3;  5FYU A;  3ILN A;  5IVF A;  3NV2 A;  1HJF A;  2QBX A;  5I0U A;  1T2X A;  2E7A A;  1C5H A;  1IG3 A;  2R06 3;  3AZV A;  3N7L A;  2ZXQ A;  3ZM8 A;  3T2O A;  4OI0 A;  3KV4 A;  4CEW A;  1SPP A;  1CAU B;  1ULD A;  2QVS B;  3TNQ A;  4PQ9 A;  1W0O A;  1QH6 A;  1JZ8 A;  4NRP A;  1DF0 A;  3GBG A;  1PMI A;  3T09 A;  3L2Y A;  3ZYI B;  1HXS 3;  2B9U A;  1GR3 A;  4M4R A;  4N4B A;  4AOC A;  3KWV A;  1UU4 A;  4MGI E;  5IYY A;  1VRH 1;  5EZW A;  3ZN4 A;  1Y7B A;  3OM7 A;  4I01 A;  1KS5 A;  2WAB A;  4Q4V 1;  2FDG A;  1AR6 2;  3GZE A;  3VN4 A;  1MS0 A;  4CDU A;  3BYK A;  1KQR A;  3VBO A;  1OMI A;  1VBC 2;  2ZZJ A;  5T5O A;  1QXP A;  3C2U A;  4DQA A;  4N43 B;  3WN0 A;  1V6N A;  3KV9 A;  1VBE 2;  3P5B A;  4CU8 A;  2ZGL A;  4RQP A;  4Y4R A;  1O4T A;  3MFC A;  4CA9 A;  2BW8 A;  5AYC A;  4GWN A;  1ZBE 1;  5FXZ A;  3DKQ A;  4CCC A;  1O8S A;  2Y64 A;  2EXK A;  1NCQ C;  2BP6 A;  2E7T A;  2E33 A;  3DKW A;  3EMR A;  4XOG A;  3I2I A;  5FPZ A;  1NY7 1;  3B69 A;  5EHD A;  3VZO A;  3M1H A;  4GQ7 A;  3SLI A;  1DQ5 A;  1OFN A;  3RYR A;  1W2O A;  2EA7 A;  3PUH A;  4Y1Y A;  4W65 A;  3QEE A;  5FJH A;  2Q8E A;  1ONA A;  1UV4 A;  3ZN6 A;  5GLO A;  3KCC A;  5FP9 A;  2FDJ A;  4AEM A;  1AXY A;  3CF6 E;  2XML A;  2QQM A;  2R0H A;  1ULC A;  4MSV A;  3V0A B;  1UOG A;  1NX9 A;  2J1S A;  3APB A;  3ZYP A;  1R1A 1;  2RS1 1;  4LBQ A;  5E88 A;  3M3C A;  2YPJ A;  4OI2 A;  4N2Z A;  3OOX A;  1QH7 A;  2W08 A;  3NV1 A;  4PF5 A;  2VPV A;  4FXK B;  2G9F A;  2X8T A;  3NQH A;  1N3P A;  4IGP A;  4QPY A;  5FZE A;  2PHD A;  4A41 A;  4GMP 1;  4K7J A;  5FZM A;  5I0R A;  4UW3 A;  1C1F A;  2UY9 A;  3CZJ A;  5L7O C;  1YIF A;  4RR3 A;  4LO7 A;  3R6S A;  4CCJ A;  3H8O A;  5FLW A;  2XKP A;  2V73 A;  1PHM A;  2X5I C;  2PQS A;  4XIK A;  5I8Y A;  4H2A A;  1AX2 A;  4FSJ A;  4J6G A;  3ROU A;  5C71 A;  4WM7 B;  1QHD A;  4XVH A;  3ZXK A;  3LEM A;  4S2G A;  4E4S A;  2RHP A;  2DUR A;  3ZSJ A;  5I0D A;  1ODM A;  3M7A A;  4R4Z A;  5KHJ A;  2JB8 A;  4M3C F;  1GKB A;  5F39 A;  1JMU B;  1LNS A;  3ON7 A;  1G6N A;  2WL1 A;  1OH4 A;  2HYK A;  1AJK A;  1AL2 2;  5A33 B;  5ABJ B;  1PIV 2;  1W6M B;  3E97 A;  4ASM B;  1CON A;  2OVU A;  5F3G A;  1D7P M;  1WGP A;  2JXA A;  4LXL A;  5K8S A;  4Y4Y A;  5A3N A;  4XHB A;  2VEC A;  3IDA A;  1HB1 A;  1ASJ 3;  1LGB A;  2Q30 A;  4WVM A;  4ES9 A;  1WKY A;  1JYI A;  1R09 1;  1WME A;  3AB0 A;  3I8T A;  4Q4W 3;  3O7O A;  3I3M A;  1VPH A;  1D0G A;  1YYN A;  1AXZ A;  1XE7 A;  5D21 A;  3UGF A;  3UK9 A;  3WW1 A;  1LUL A;  3VLB B;  3A0K A;  5A3L A;  1R64 A;  3HR9 A;  1GYK A;  1PO1 3;  5JDB A;  4COV A;  4ZZ5 A;  4WV8 A;  2VW0 A;  4BHP A;  4NO4 A;  4GZ9 A;  4MGS A;  4BQ2 A;  1UW8 A;  3DYM A;  1QQP 1;  3TN9 1;  4AFA A;  1C8M 1;  3BOD A;  3HVD A;  4K21 A;  2AC1 A;  2YRO A;  4YZ3 A;  3NJY A;  1ND2 C;  4Y22 A;  4CRQ A;  2WN3 A;  5GZE A;  1OA4 A;  3HEI A;  3FLT A;  3Q9O A;  1YI7 A;  2BPA 2;  1QDC A;  3RGB A;  4KMI A;  5IVJ A;  4BYY A;  1OLM E;  2RR1 1;  1G86 A;  2IXJ A;  3DXU A;  2AYH A;  3WOG A;  5FZD A;  1VBC 3;  3I59 B;  4IV3 A;  1D2Q A;  2VGD A;  3BCW A;  4NHM A;  1JU3 A;  2R16 A;  4WM8 B;  2YU2 A;  2WNV C;  4FPE A;  1JN2 P;  1QJU 2;  3O1P A;  3AYC A;  4Q8L A;  2IFR A;  3CDZ B;  5FXW A;  4QX7 A;  3OUJ A;  3ACH A;  3V0A A;  3DYO A;  4GWJ A;  4PCR A;  4FVV A;  2D6O X;  5CG8 A;  2K0G A;  3ZFE C;  3RZM A;  4HLT A;  5GLM A;  1CIW A;  1YQ8 A;  1ZBA 2;  5IK5 A;  2NYY A;  2A5Z A;  1YFW A;  4S2H A;  3URF A;  4K20 A;  4CEY B;  1YO8 A;  5FMC A;  3WDU A;  2A73 B;  2JIJ A;  5FZK A;  5FOJ B;  1RUE 1;  1NE6 A;  1HN0 A;  4YYO A;  1UL9 A;  3OCP A;  4FFH A;  4R4X A;  2GC1 A;  3MHZ A;  4XTM A;  5FP7 A;  2NLR A;  5G04 L;  1DCS A;  3INA A;  3N9O A;  2BVB A;  3I2F A;  1F15 A;  1VRB A;  1XNT A;  5JSR A;  5LBB A;  4WM7 A;  1FPN 1;  4PBO A;  2QQL A;  3K2O A;  5A7Q A;  3VD4 A;  4XQ4 A;  1O3T A;  1QJX 3;  1TMF 2;  1XYO A;  3WNO A;  1UXZ A;  1IQD C;  3KM5 A;  1KFU L;  3NNL A;  4OUM A;  3IAQ A;  4XEZ A;  5D8A B;  2XLA A;  4ZY9 A;  1V9U 1;  2A1X A;  3I3Q A;  3TYJ A;  5FZ9 A;  4U6B A;  4IV1 C;  3BVC A;  5SV5 A;  5ACA 1;  3FFZ A;  3NJX A;  2YB7 A;  2LM3 A;  1KEX A;  1AXK A;  4YM3 A;  2QZ3 A;  2IFW A;  1SMV A;  3T30 A;  1ZRF A;  4P5Y A;  3WW4 A;  2VUD A;  2AR6 A;  5HXV A;  1O3Q A;  1LOD A;  1T6B X;  5EYY A;  5FWJ A;  3C7F A;  4TXW A;  3OM4 A;  4XDQ A;  2JIG A;  4Z92 B;  5T52 A;  2WRA A;  1KDM A;  1UY4 A;  4ISR A;  4XTP A;  2J1E A;  4UW4 A;  4B1L A;  5LWB A;  4UW6 A;  3ZVX A;  2WZP P;  3THD A;  5DN2 A;  1UOB A;  2E6V A;  3FL7 A;  5H9Q A;  2JE9 A;  3K4Z A;  4A3Z A;  5FZA A;  1H1M A;  2OXB A;  1UIK A;  5FZH A;  3MF6 A;  1BK0 A;  3BKZ A;  5B4N A;  1J83 A;  3CJI C;  1W6N A;  2HJI A;  4PI0 A;  3BUC A;  5C0P A;  1YQ6 A;  3KT7 A;  4JVA A;  2D98 A;  5F3C A;  1W8H A;  1ZZ6 A;  2Q1Z B;  2EIB A;  2W46 A;  4PT6 A;  4UFI A;  3R4U A;  3WG2 A;  3KS7 A;  1LED A;  3ZPY A;  2JIC A;  3V65 A;  1GWM A;  1FMD 1;  4D7S A;  3VBF A;  4A7K A;  2RDN A;  5JZG B;  3K46 A;  3GBF A;  1OFS A;  1BEV 3;  4AFC A;  4KG8 A;  3HMY A;  2VAU A;  5J96 B;  1AHS A;  5FY4 A;  1GIC A;  1NXD 1;  1RJ8 A;  2F17 A;  3KLS A;  4DIN B;  3IDC B;  4WBB A;  4DXR A;  3WCS A;  4AQT A;  5IW0 A;  3MIF A;  4UXA A;  3WF0 A;  3U78 A;  2R04 2;  3P1I A;  4H3W A;  3PTY A;  4QPG B;  1ZBE 2;  2WQZ C;  4COU A;  5J09 A;  1UOJ A;  2BFU L;  5IVC A;  5IK8 A;  3KB5 A;  3NV4 A;  4NJ4 A;  4XDO A;  5E8A A;  4CEW C;  3WDY A;  1NA1 A;  1XXN A;  3PMS A;  1I6X A;  2Q8C A;  3VKM A;  1NY7 2;  1C5I A;  1YQC A;  2BVV A;  3POS A;  1Y9Q A;  3B93 A;  2BBA A;  4AVV A;  1RUJ 1;  5T55 A;  1QJU 3;  1SHW B;  1VJ2 A;  2GNM A;  3Q8C A;  2GN7 A;  4CSW A;  4BA6 A;  3LA3 A;  3KF5 A;  5GZF A;  2VUC A;  4CUB A;  2GC3 A;  3T2Q A;  1FOD 1;  2VCA A;  1SFN A;  4LKE A;  5JXI A;  1JYW A;  5AFE A;  3AP4 A;  3AXD A;  5F3I A;  4CDU C;  1R1A 2;  2RS1 2;  3H1M A;  1URX A;  5E1R A;  3VBO C;  2YGL A;  4Q4Y 3;  2CHH A;  2Y0I A;  4MHU A;  5A1A A;  4AI8 A;  4KU8 A;  5FYH A;  1S0E A;  2VZU A;  1ZBA 3;  5L19 A;  2ENR A;  2DUO A;  2BNM A;  3P3P A;  1WW4 A;  1EPW A;  4QGL A;  3H3L A;  1VBB 1;  1JOD A;  3AFG A;  3FJS A;  3M70 A;  4H7L A;  3S5A A;  4O7X A;  2GAU A;  5EWS A;  1FAY A;  3NVC A;  5J37 A;  3EB7 A;  2YC4 A;  4I0A A;  4EN0 A;  5AY9 A;  4MLG A;  1H4G A;  1VB4 A;  4WVZ A;  1WLT A;  1TE1 B;  3OGV A;  4E4Z A;  1EV1 1;  4XZU G;  1ENQ A;  3LZZ A;  1D4M 3;  1YC6 1;  1W0N A;  2YBP A;  4AYU A;  2G4I A;  4D69 A;  3OB8 A;  2F6B A;  4A7Z A;  1CAX B;  3LCP A;  3PUI A;  1RVF 2;  5FYS A;  2ZMN A;  1IQA A;  1FX5 A;  3Q8F A;  4AHY A;  3ZYR A;  4Y1Z A;  4JRA A;  5EPA A;  1AUY A;  5IVY A;  2WNU B;  1XRU A;  3ILR A;  1XNC A;  2KD7 A;  2PHW A;  2OUH A;  2YC2 A;  2ZAH A;  4GWM A;  4RR3 C;  3MIE A;  5FY9 A;  1QXJ A;  3WDV A;  4E8C A;  4NHK A;  2AEY A;  2ZX2 A;  2VBB A;  4XUP A;  4BME A;  1MPX A;  4B7K A;  2B4W A;  1F4H A;  4GUL A;  2FDF A;  1AVB A;  4UFM A;  5LBE A;  2XJR A;  4NR1 A;  5FMB A;  2W1S A;  4Q1R A;  4K9S A;  2PHT A;  2Q5T A;  3W9A A;  3OD4 A;  1GNH A;  2VOT A;  3WV6 A;  3BIE A;  3NMB A;  3NV3 A;  1DG6 A;  4QKF A;  1LR5 A;  4LR4 A;  3B5L B;  3MI8 A;  5JOZ A;  1AR7 3;  1MEC 2;  1Q3E A;  1W6P B;  4KH9 A;  3WY6 A;  2XB6 C;  5CB7 A;  3VT0 A;  5CEH A;  4YFZ A;  2WYS A;  3TN9 2;  5FAX A;  3KD4 A;  1C8M 2;  3RZJ A;  3N7K A;  2ET1 A;  3OJB A;  3GZT B;  3OYW A;  4IEQ A;  3JZV A;  3M4F A;  1MZ5 A;  3SH5 A;  5J98 B;  5FYT A;  1PK6 B;  4QDQ A;  2ZA9 A;  4MYE A;  4QX2 A;  4QPG A;  2X5I B;  4YAR A;  3D60 A;  2BU9 A;  4RD7 A;  3ETP A;  5FLJ A;  3IN9 A;  4GIQ A;  3N9N A;  3TOJ A;  4K8R B;  4XJU A;  4ARY A;  4AVA A;  4W4Z A;  5GLU A;  4A42 A;  4OYU A;  3VB9 A;  4EZH A;  2HWE 2;  1CZS A;  4AI9 A;  1I1E A;  3H0O A;  2XDV A;  4QXK A;  3PJY A;  2LTN A;  2XJT A;  2R04 3;  3HN1 A;  4HN1 A;  1Q56 A;  4UBG A;  5FYV A;  4BLI A;  1HX6 A;  1T6G C;  4C0H A;  5JAX A;  5JPN B;  1UY2 A;  4IEU A;  3C3V A;  2VZ3 A;  1N1Y A;  3VSR A;  2AEZ A;  5CKN A;  5IJR A;  1OKQ A;  1W8T A;  1TQ5 A;  2A3Y A;  2I74 A;  2PHL A;  1ULG A;  4Y1U A;  1AYM 3;  3LPG A;  4LMF A;  5B4X A;  1WA4 A;  3PUQ A;  2CSG A;  4IGO A;  1F8V A;  5K0U B;  5FQ0 B;  4QU1 A;  1BQP A;  3GNE A;  5BUV A;  5HXM A;  4PJY A;  1GWL A;  2HWB 1;  2QE3 A;  3VD3 A;  1RUE 2;  4G4F A;  1PGL 1;  5HCH A;  4IV3 C;  3WSO A;  4BWO A;  1WLD A;  2R07 3;  2PLV 1;  1I5P A;  1LEN A;  2BV4 A;  2HLE A;  2ZMK A;  4LIU A;  1ZRE A;  5T5L A;  4YW2 A;  3VBR A;  2ZBJ A;  5JSP A;  2QNK A;  4P9G A;  4YPJ A;  3ZN5 A;  1FPN 2;  2D6N A;  1VAV A;  1KXG A;  5J1X A;  3MBW A;  1CAX A;  1E5I A;  2RV9 A;  4H14 A;  4S2F A;  1G9C A;  2Y6K A;  2J1T A;  3IDB B;  4FTE A;  4N8M A;  4ITC A;  2D5H A;  3DGT A;  4SBV A;  5ACA 2;  4ORF A;  2PA7 A;  2ZEY A;  4YSF A;  5BV6 A;  4QU2 A;  3T4V A;  1LU2 A;  3PVE A;  5AC9 1;  5LW9 A;  2DVA A;  2HWF 1;  2EAL A;  4CDQ A;  3LKJ A;  1WD3 A;  1US3 A;  1RJ7 A;  1PZ7 A;  2OKX A;  4FCA A;  5JVV A;  2HWC 1;  1RVF 3;  5HCF A;  4C91 A;  1JZ3 A;  4Q5O A;  4I2O A;  4LK7 A;  1DHK B;  5CFC A;  1X33 A;  2WNV B;  1AR9 3;  3ACL A;  4Q0U A;  3OEA A;  1O6U A;  4M0H A;  4WM7 C;  1W2T A;  3VKF C;  1D0H A;  3U4S A;  1GZT A;  4AR2 A;  3G7D A;  1HB3 A;  5C8C A;  2XJP A;  4HET A;  3AMM A;  5JWP A;  1X36 A;  2ZGT A;  3DEC A;  1IGO A;  3N3H A;  4AK3 A;  3AKG A;  1PMH X;  4FXG B;  4N7I A;  4U36 A;  3ZFE B;  2Y6H A;  2IXH A;  3HOB A;  2YBK A;  2WT2 A;  4XMA A;  4AHX A;  5F2S A;  1UZZ A;  5C2M A;  3ZPO A;  3H9A A;  4BIF A;  1DYP A;  1C28 A;  1CVN A;  4J1W A;  5EJZ B;  5GM0 A;  2FDH A;  3K51 A;  1VKD A;  3VT2 A;  4LT5 A;  4WVW A;  1IS4 A;  1QU0 A;  4CCD A;  3EHK A;  1PK6 A;  5A7W A;  5GLP A;  1EPZ A;  1MEC 3;  3AMP A;  1N3Q A;  1RUC 1;  1V00 A;  1DU3 D;  1FMD 2;  5LEJ A;  5F3E A;  3TN9 3;  3ORJ A;  2A6W A;  1LHV A;  5HPO A;  4LBM A;  1MAC A;  2IWG B;  2JD9 A;  4EZ4 A;  4BQW A;  3RRD A;  4XFG A;  5LA2 A;  3ILF A;  5C6C A;  1POV 1;  5IWF A;  1ALY A;  5JOW A;  4AI2 A;  3LSE A;  5A7N A;  1VIW B;  3SIS A;  2ZGP A;  3AM2 A;  1Z7S 1;  4LOT A;  2PN5 A;  3WF1 A;  1W8N A;  1Y4W A;  3MLJ A;  4LA2 A;  3WD5 A;  3HWJ A;  4FPJ A;  3U75 A;  5FWE A;  2ZGM A;  1IPJ A;  2HWE 3;  1RUJ 2;  1C4R A;  1HRI 3;  3RVH A;  2VMC A;  4D6S A;  4QMA A;  1W3V A;  3VD9 A;  3N9L A;  4XBL A;  5FQ0 A;  1VMF A;  4P14 A;  3VBF C;  4NID A;  1FOD 2;  4YG3 A;  4YW5 A;  1GYD B;  2VBP A;  1YHF A;  1O8P A;  2RS5 3;  3LE0 A;  3BYW A;  3CJX A;  2GC0 A;  1OQ1 A;  4HKL A;  3ZKY A;  1UN1 A;  4YW4 A;  4ASK A;  3VBS B;  4PLN A;  4QX3 A;  2LAL A;  2WO3 A;  2XKO A;  4P9X A;  4O9E A;  4COT A;  2X09 A;  4IDZ A;  1W8O A;  4FQZ A;  4XF0 A;  1VBB 2;  5FPV A;  4AVC A;  3T08 A;  4F3J A;  3WLU A;  1NA1 C;  4DY5 A;  1AX0 A;  3D82 A;  3ZXG A;  1RUH 1;  1YLL A;  3WP4 A;  3BIW E;  3A23 A;  1LHO A;  2JDK A;  1CZV A;  2QQP A;  2J1V A;  5BNO A;  1QDO A;  3HNM A;  2X8S A;  1S0I A;  2ZEX A;  4PLM A;  2BEO A;  3WNN A;  4LHL A;  1PGS A;  1UY1 A;  1EV1 2;  4EN7 B;  1AR8 1;  3G6J B;  1XSR A;  1LHU A;  1CAV B;  2VZQ A;  4AVT A;  2MEV 1;  2W47 A;  5GLW A;  4XJ8 A;  4IE4 A;  4QQH A;  4XF4 A;  5DDJ 1;  3CZU A;  4QGM A;  3ETQ A;  3QH7 A;  1HW5 A;  2WS9 3;  3CNA A;  4E9K A;  2DVF A;  2JJ6 A;  2AUY A;  3SEE A;  3WHT A;  2Z42 A;  3AMH A;  4OZO A;  4KI5 M;  3MZH A;  3ME2 A;  1C1L A;  5A32 B;  1RUI 1;  3QBQ A;  2ARA A;  2XBO 1;  2AH2 A;  2YPD A;  5A1F A;  2CL2 A;  1SPP B;  1H2L A;  3GHM A;  1BBT 3;  1YWK A;  3WMZ A;  1E57 A;  1UPS A;  2DCK A;  2W5F A;  2VZO A;  1LOB A;  2EAK A;  3CHX A;  3EYP A;  3JQX A;  3OGG A;  2VTX J;  1MS3 A;  4ZZ8 A;  5L73 A;  1IKP A;  2OZ6 A;  2RS3 1;  2VMI A;  2BUK A;  2VMH A;  3OGJ A;  4UFL A;  2W0X A;  4XYX A;  1RHI 1;  2OII A;  5FMO S;  1QJY 1;  4BIO A;  1QGL A;  2D93 A;  4QPW A;  1J1T A;  3KVB A;  3CBN A;  1RUD 1;  2VW2 A;  3IIA A;  5I0S A;  1GBG A;  2BZD A;  1RIN A;  3E6C C;  3ABZ A;  1LEC A;  3J8F 2;  3W58 A;  3TAW A;  4OHX A;  4RQP B;  1EUT A;  3OEB A;  1U5Y A;  4LLO A;  1XE0 A;  4CU6 A;  3AZZ A;  3HBK A;  4MO3 M;  2WZR 3;  1DZR A;  1W9Y A;  1MS8 A;  3UET A;  5M0T A;  2JD4 A;  1W3X A;  2PHR A;  3TEZ A;  1GFF 2;  2V72 A;  5FR3 A;  4KC8 A;  3BN6 A;  4JKK A;  4DB5 A;  3DXT A;  3HT2 A;  2YFS A;  1S2K A;  1NG0 A;  2JG9 A;  1L3J A;  3ZN6 B;  4JGY B;  3T1M A;  5LCW L;  3FHI B;  4I09 A;  3S0M A;  4Z2A A;  4A4A A;  1L7Q A;  2XWB B;  3U14 A;  1MZF A;  4LBQ B;  4LUL A;  4YM2 A;  1DQ2 A;  1BYH A;  4KWJ A;  3D61 A;  2Y6J A;  3ZFG B;  4NAM A;  3VKL A;  2CWM A;  1MZE A;  3ZYG A;  1NZC A;  3W20 A;  2W91 A;  1VBA 1;  1XB9 A;  2ZCW A;  4PHZ A;  4MGY E;  3MV1 1;  4LHN A;  1SFY A;  3VBS A;  1H2N A;  2YY1 A;  4RR3 B;  1JHJ A;  4YFW A;  4YVS A;  4EN9 B;  4ZHN A;  4BQ1 A;  4CPB A;  2VVE A;  4W50 A;  5DZE A;  4QPG C;  3KQR A;  1SZB A;  5KR7 A;  1K45 A;  4PVA A;  3E1F 1;  3RI9 A;  3ZXF A;  4O61 A;  3ZDV A;  4HVR A;  1YFX A;  2J22 A;  1AZD A;  2B4K A;  3OBT A;  2X8F A;  3WZ1 A;  5IVE A;  4IER A;  1PGL 2;  1YQ5 A;  3GDB A;  1G9A A;  3K4A A;  2PLV 2;  4I3G A;  3MYX A;  4CXW A;  1ODN A;  3FC0 A;  4JDO A;  5EFU A;  2PTM A;  1PVX A;  1PVC 1;  2BTV C;  1SAC A;  3LDR A;  3AKS A;  4OUE A;  1DYO A;  3ENR A;  2VTF A;  1CAV A;  2ZGN A;  3AMN A;  3ZFF A;  4ARX A;  3IDE A;  3T0B A;  3I3D A;  1GAN A;  1W6Q A;  1X50 A;  1RB8 G;  4P08 A;  3AP6 A;  4NE9 A;  1AYN 1;  2GAL A;  3AP5 A;  4YW7 A;  4XUR A;  1EV1 3;  3QH6 A;  2PHX A;  3DN7 A;  4FOV A;  2V5D A;  4H55 A;  4ZXK A;  4A45 A;  5FBJ A;  4YG6 A;  4WVM B;  4AED B;  1DLC A;  5AC9 2;  5IFP A;  2HWF 2;  5K9Y A;  5L9V A;  3CQO A;  5A32 A;  4LBL A;  3B01 A;  3KCX A;  3IMM A;  4JQR A;  2HWC 2;  1TME 1;  3I97 A;  4JHT A;  1RUN A;  4I3P A;  2Q8D A;  1ZA4 A;  2VJX A;  3OTF A;  4LBK A;  3VBR C;  2WII B;  4HG6 B;  1O7F A;  4DRR A;  4TTG A;  4D6Q A;  1A78 A;  4E2Q A;  3CMG A;  3WNK A;  1RC6 A;  1SFP A;  1PGW 1;  2HEV F;  2GP3 A;  3HT1 A;  5JCT A;  4Y22 B;  4EE2 A;  1RXF A;  4XIO A;  5FKC A;  5ANQ A;  2ATF A;  2DVB A;  3JCI A;  4GD4 A;  1ULP A;  3AL6 A;  3CKH A;  2QQI A;  4Q4X 1;  4RA0 A;  3RMY A;  3I2D A;  2WN2 A;  1C3H A;  2E32 A;  2WNU C;  2XJV A;  4OLL A;  4CDQ C;  2CGP A;  3FLP A;  3ZXA C;  1AL0 G;  2ZHN A;  4GH4 A;  3SC7 X;  1WA6 X;  5LY1 A;  3J8F 3;  4UAP A;  4PIX A;  4IV3 B;  4RGA A;  2GH8 A;  4W6W A;  4WZF A;  3H8R A;  4Z82 A;  2P1B A;  5CFC C;  1RUC 2;  3OUH A;  1JZ5 A;  1ND3 A;  3LF7 A;  4IEX A;  4P5H A;  4JGY A;  2YFZ A;  5AVA A;  4AQS A;  2VOV A;  3S57 A;  4IXL A;  3NNM A;  3T0D A;  2I2S A;  2WZE A;  3M8L A;  3AJZ A;  1DQ6 A;  1GV9 A;  2ZX3 A;  3ZFG A;  3RZH A;  3F95 A;  4PF1 A;  1G8W A;  2WKK A;  4HT1 T;  1GNZ A;  4CZS A;  3D0J A;  2HBU A;  3LA2 A;  4U6D A;  1GOH A;  4PIZ A;  5FIX A;  5CIS A;  4OI4 A;  4LO5 B;  2A6V A;  2XLF A;  5DAX A;  5LRS A;  1KFX L;  4AHW A;  5FY8 A;  1RUF 1;  4D7Y A;  1UU6 A;  1UZW A;  1PK6 C;  2ARX A;  3IT8 A;  3J26 N;  3RI8 A;  3W59 A;  4NIG A;  2Y26 A;  1BXH A;  1ST8 A;  5FBZ A;  1N1S A;  5LZ6 A;  2UU8 A;  1UOF A;  1JBC A;  4LO8 A;  1W0P A;  1JOJ A;  3WAU A;  5CFD B;  2Y0O A;  5F5I A;  2E53 A;  3AXE A;  3AVS A;  3N36 A;  3TEY A;  4ERO A;  5F8P A;  1X8M A;  3VBU A;  4XMI A;  1LTE A;  1XSQ A;  1OA2 A;  3MO4 A;  5H9P A;  1EUU A;  4F7Z A;  4BQ4 A;  4GJZ A;  1K5J A;  2VMD A;  2BRT A;  1IPK A;  3N9P A;  4PBP A;  1JH5 A;  5FY7 A;  3JBG 3;  2B42 B;  2KA3 A;  2P17 A;  1RUH 2;  2XLG A;  3FUQ A;  3JU9 A;  5A8C A;  3NO8 A;  1XQN A;  1RUG 1;  1UZY A;  4M4P A;  2EIG A;  4CE8 A;  4AED A;  5K0U C;  1F31 A;  1AR8 2;  1ZYB A;  2DU0 A;  1UZ0 A;  4D94 A;  1ZX5 A;  5FPA A;  4Y1X A;  5A3P A;  2E7Q A;  1VB2 A;  2E9Q A;  2MEV 2;  3C7G A;  2PAE A;  5F6K A;  2O8Q A;  4D6R A;  5T5P A;  3B9I A;  4MGQ A;  2VZS A;  5DDJ 2;  4IE6 A;  5KBF A;  2WJS A;  2HKX A;  3ES4 A;  4XFI A;  1Q43 A;  5FV3 A;  1OF3 A;  1HRV 3;  1UZV A;  3RJ2 X;  4ES8 A;  4DXS A;  5GAL A;  5FZ0 A;  4QDR A;  3OGS A;  5FZ6 A;  2WLQ A;  1LOA A;  4UYB A;  1RMU 1;  3RNS A;  2OPW A;  3EQE A;  1RUI 2;  5I91 A;  4D7T A;  5A3T A;  2XBO 2;  1W6N B;  4PVI A;  2ZX4 A;  2TUN A;  2PAM A;  1N1V A;  2DCJ A;  2B5H A;  5CVR A;  5EYX A;  1MS1 A;  5FP4 A;  3IBM A;  5BNO C;  2WBK A;  3POJ A;  2JDM A;  2HBT A;  2ZGO A;  3GAL A;  2RS3 2;  5CZK A;  3R0R A;  2Y6F A;  2VZT A;  1QJY 2;  1ULO A;  5C5U A;  2VR4 A;  3VDD A;  1JW6 A;  4PIY A;  4JTN A;  2C0Z A;  3LPF A;  4HOO A;  2VNR A;  3LDK A;  3VBF B;  1AR6 3;  1RUD 2;  4FO9 A;  5FYY A;  4DS0 A;  2ZML A;  4JQT A;  1WMD A;  1TVG A;  2QDR A;  4IND A;  4R9B A;  1MQT A;  1VBE 3;  2WQ8 A;  4NWV A;  2G9Z A;  1V6L A;  2XXZ A;  1U12 A;  4FPC A;  2B45 X;  1LEM A;  3RSJ A;  3KZ4 C;  2UY8 A;  2IXL A;  3FUO A;  3GYD A;  2DU1 A;  2YBS A;  3VHN A;  4XBQ A;  4CYD A;  5FY5 A;  2WFF 1;  1WCD J;  1SDW A;  3AK0 A;  3JB4 C;  5FZC A;  1NCR A;  1UY0 A;  3MIB A;  2VC9 A;  2D40 A;  1QWR A;  1NA1 B;  2R1B A;  4CDW A;  1NT0 A;  2ZKL A;  3U4X A;  5DPN A;  4XPV A;  1H1A A;  2RDS A;  5A7O A;  3WPV A;  4HVO A;  2OA2 A;  2DYC A;  1Q8S A;  5A7S A;  4KWK A;  3W21 A;  2NN8 A;  2FBE A;  4M3C A;  4NN0 A;  1EYB A;  1LRH A;  3USS A;  3GJB A;  3K3O A;  1POV 3;  1UYX A;  2OT7 A;  4Y5Z 0;  1W8W A;  2EIE A;  2P3I A;  2XVG A;  4BXF A;  2A70 A;  2WO1 A;  1VE0 A;  3RPQ A;  1BHG A;  1EAH 1;  1I5Z A;  2IC1 A;  3J4U H;  1VBA 2;  4IL7 A;  2XOM A;  4LIV A;  5CFD A;  1W90 A;  2TBV A;  3ZLI A;  3VUO A;  1B09 A;  2ZAB A;  2ZHM A;  1DFQ A;  2B46 X;  1R08 1;  4XDP A;  1S0C A;  1CD3 G;  2SLI A;  4GB3 1;  3I3B A;  1QOS A;  4AI3 A;  1XBF A;  1PO2 1;  3BTX A;  2JG9 C;  4CUC A;  5A7V B;  4Q1P A;  4J1X A;  4OFG A;  1YQ2 A;  4ISQ A;  3M3I A;  2NPI A;  2BWC A;  3LGR A;  1S0G A;  4JHZ A;  3X29 B;  3BYL A;  1D2S A;  1UWW A;  2GN3 A;  3R4S A;  4HVQ A;  1AL2 3;  1PIV 3;  3FBY A;  4AW7 A;  1CX4 A;  3J7H A;  3BTY A;  3T2P A;  4D8M A;  2JDA A;  1H8T A;  3FHQ A;  3EBR A;  2IUW A;  2JDY A;  4P9Y A;  3VBS C;  2VD7 A;  1AYN 2;  4YVS C;  2C5D A;  3NNF A;  5F7U A;  3IB3 A;  3R67 A;  5FUI A;  1AR8 3;  2G1M A;  3I54 A;  4NPL A;  5AVP A;  1XND A;  1UMH A;  2BQP A;  2R32 A;  2WWU A;  1F35 A;  3DYP A;  4NHX A;  2B39 A;  1IS3 A;  4KG0 A;  4LHK A;  4RL7 A;  1TME 2;  5FPL A;  4JCK A;  3HD8 B;  3R4Y A;  1HIX A;  5LA0 A;  1QMJ A;  1VRH 2;  3LEK A;  3WEZ A;  1W28 A;  5A3O A;  3A22 A;  1LGC A;  1RUI 3;  4Q4V 2;  2DCT A;  4YW1 A;  1CN1 A;  1J3R A;  5T3N A;  4TZD A;  2VMF A;  3TRS B;  5SV8 A;  2UYA A;  1U0A A;  3MUZ 1;  1CR7 A;  4COZ A;  3OYW B;  2VUJ A;  2XL9 A;  3VZK A;  1UYP A;  3LFI A;  5ISL A;  3I2J A;  1V6O A;  3RMX A;  4Q4X 2;  4YW6 A;  3RS6 A;  3WF2 A;  3K77 A;  2C24 A;  3H1W A;  1DDL A;  1DGR A;  2WQ4 A;  2XHN A;  3RZZ A;  1JZ2 A;  2XR4 A;  2WYF A;  4N90 A;  1SBF A;  5LBF A;  4LPL A;  1OUX A;  2DFC A;  3WG3 A;  3TBD A;  3KV6 A;  3WN1 A;  4ASL A;  4N2R A;  3O1S A;  3ACG A;  3H1Y A;  3W5N A;  4N1I A;  5JI9 A;  1UX6 A;  4K1Y A;  3S7E A;  2BNO A;  2RMU 1;  2WWJ A;  2C9A A;  4C1W A;  1WW5 A;  3SCF A;  4BQY A;  5IK4 A;  1W9F A;  2BDR A;  4C8D A;  3ZX7 A;  4EJR A;  2ORZ A;  1Y3T A;  2IXC A;  2X53 S;  4RQP C;  1CQ9 A;  4ZU4 A;  5LAT A;  1W2A X;  4FFG A;  3WXP A;  4XHX A;  3LQC A;  4GAZ A;  1IS6 A;  1XYP A;  3IM0 A;  1SEF A;  4FOQ A;  4XIL A;  4CUG A;  4CP9 A;  3JUU A;  3IPV A;  2Q4S A;  4GH4 C;  4IE0 A;  3W5M A;  4MG2 A;  2H0V A;  4QT6 A;  1X7N A;  3WQ0 A;  1RUF 2;  5FYB A;  3CLP A;  2WT0 A;  1COV 1;  1ND3 C;  3LA7 A;  3MW2 A;  1S2E A;  4IE5 A;  1OUS A;  3LFM A;  3VBR B;  1J59 A;  5A7V A;  4AE2 A;  4JGY C;  1N47 A;  1LHW A;  4M0N A;  1TMF 3;  3ZSK A;  2IVI B;  3KQ4 B;  4CCM A;  1YJK A;  1OA3 A;  4LEJ A;  3WNL A;  2BYV E;  2ERF A;  1OBN A;  3ZFG C;  2YZ4 A;  4MUV A;  2BNN A;  1UU5 A;  4LKS A;  4DNY A;  3ZSM A;  1MVE A;  1TL2 A;  5C9A A;  2FZ1 A;  4Y26 A;  4AGG A;  2FMY A;  5T54 A;  3VD5 A;  4CDQ B;  1P8J A;  1SBD A;  3PUR A;  4W6Y A;  5LK7 B;  2IXI A;  3DUI A;  1RUG 2;  2H0B A;  2FD8 A;  3N9Q A;  4EV0 A;  4RHV 1;  3VZM A;  5CFC B;  1QY4 A;  4QX0 A;  2R06 1;  3AJY A;  1R09 2;  5DAP A;  2FHR A;  2KXL A;  5FCC A;  2WA4 A;  5C8C B;  3NJZ A;  1HXS 1;  4LJH A;  3VBU C;  5HCB A;  1Z78 A;  2KM2 A;  3PIJ A;  4XFB A;  2B8M A;  2YGM A;  4UF0 A;  4LUK A;  4YM1 A;  1OLM A;  3ASI A;  5FK7 A;  4PI2 A;  1JZ6 A;  4YGD A;  2Q8O A;  2WC2 A;  2YU1 A;  4KQ7 A;  5CA6 A;  2VDT A;  2Z4F A;  1W18 A;  1QQP 2;  4XJZ A;  2WUH A;  2Z79 A;  4NIA A;  1NZI A;  1OD3 A;  4IEY A;  4QWN A;  2P3Y A;  2VQT A;  1LOE A;  3T0A A;  3ZMO A;  2UWA A;  4N53 B;  3HQX A;  5IAV A;  1VRH 3;  1NOV A;  1JOP A;  1QNY A;  1US2 A;  5A7W B;  4AED C;  4CP0 A;  1X9T A;  2V4A A;  2QDN A;  3BOP A;  1XC6 A;  4KCB A;  4Q4V 3;  1J84 A;  2RR1 2;  3IKW A;  3THP A;  1S0D A;  4K1Z A;  1VBD 1;  2OQ7 A;  3POG A;  2VZR A;  4KBB A;  4AL9 A;  2WAO A;  3QOP A;  3SCH A;  4YLZ A;  4BIS A;  3BYN A;  3VSZ A;  4Q4X 3;  4JDM A;  3VBH A;  1ZBE 3;  4B7E A;  4UOJ A;  3U07 A;  3N35 A;  2WFF 2;  4FPL A;  1YI9 A;  1UAI A;  2WT1 A;  3FE5 A;  1GOG A;  4JDN A;  1OC1 A;  3TNP B;  1UCX A;  4NHL A;  1PX3 A;  2OUJ A;  5B6S A;  4K8F A;  4FFI A;  1C8N A;  5DUW A;  4XJW A;  2GP5 A;  4E27 A;  1Y9M A;  4LBN A;  1N1T A;  3DF0 A;  3WHU A;  1V6M A;  3WPY A;  4NWW A;  4MXW A;  5IAT A;  3VDD C;  1OQD A;  3ITQ A;  1UIJ A;  2JDZ A;  3J7L A;  1R1A 3;  1HB4 A;  2RS1 3;  4OUS A;  4Y5T A;  3OPW A;  1E5H A;  3K1U A;  2EIC A;  4R8H A;  3VT1 A;  2YV8 A;  1MQT C;  5GZD A;  4CCO A;  4DUX A;  2K2S A;  4HPK A;  2ADD A;  2ZOE B;  5DZF A;  4JTO A;  1DQ0 A;  3POI A;  1D4V B;  2ZJC A;  4GMP 3;  1EAH 2;  1W05 A;  5JMO A;  1LKN A;  3VKN A;  1TNF A;  5F5C A;  2O8O A;  3B94 A;  3D6E A;  4AFB A;  1NCR C;  2QQU A;  3FLR A;  2RDQ A;  4OZX A;  3VDA A;  4B8E A;  1H4H A;  5T5J A;  5DG1 A;  1C57 A;  4B4P A;  1R08 2;  1V9U 2;  4CDW C;  4GB3 2;  3WNX A;  1LU1 A;  1S4C A;  1ZA7 A;  2IXK A;  4ZU5 A;  2JG8 B;  4M00 A;  4GWI A;  1SQ4 A;  3T1L A;  1F5J A;  3U1X A;  5BNO B;  4A6O A;  1PO2 2;  5F37 A;  1IS5 A;  1SBE A;  2XVL A;  2G9G A;  2ZHK A;  4A3X A;  2JE7 A;  5FZO B;  2W52 A;  4HFS A;  1YIP A;  5JIU A;  3DL3 A;  1QNW A;  3OY8 A;  5F32 A;  5C3S A;  1B35 B;  5JPM B;  3ZKU A;  1S2B A;  5IVV A;  4DEV A;  1JZ4 A;  1HKD A;  2GNB A;  1DQ1 A;  2XWJ B;  3K75 B;  1ASJ 1;  2ARC A;  4O8N A;  2J1R A;  3B3Q E;  3E6D A;  2PHF A;  2KR2 A;  3AMQ A;  1J58 A;  1UNB A;  1DGW A;  1Y43 B;  4ONU A;  4Q4W 1;  4Y20 B;  2VXR A;  2UWC A;  5CAZ A;  5CFD C;  2XGX A;  4XXA A;  3UKV A;  1NAE A;  3GF6 A;  4DXZ A;  1AF9 A;  3FFQ A;  3SH4 A;  1BMV 1;  4KNC A;  3J7M A;  5JXG A;  5A1L A;  2JB4 A;  3NWK A;  1TG7 A;  2CAV A;  2P37 A;  4L8Q A;  1WWY A;  1PO1 1;  1XYN A;  1WCQ A;  1KJR A;  1TEI A;  1R09 3;  1WUV A;  5BPX A;  3LD8 A;  4X8P A;  5FRA A;  5I8T A;  4PLO A;  4QXH A;  3MF9 A;  4R9D A;  2GH2 A;  3ZR5 A;  4BMB A;  2JWP A;  3NNG A;  3JQW A;  4ZU7 A;  3H50 A;  3POB A;  2D3R A;  4N53 A;  1MS5 A;  4CUA A;  5LRR A;  3SKJ E;  2AGS A;  2VU9 A;  1V6K A;  3MFA A;  4J25 A;  5DUU A;  4OUL A;  4URT A;  4JC1 A;  3BU7 A;  2NZ9 A;  1NLS A;  4B4R A;  1QQP 3;  1JYC A;  2VW1 A;  2QQN A;  1C8M 3;  5C3P A;  1FI2 A;  2W1U A;  2OYZ A;  1H8T C;  1QOO A;  2FCT A;  4XAA A;  3MLL A;  2O1Q A;  2CYF A;  1CPM A;  5BYN A;  4XF3 A;  3ZDS A;  5E89 A;  1Q8O A;  2QCS B;  2ID4 A;  3NL1 A;  1FV2 A;  2ZAC A;  4CVU A;  2WNE A;  1GYE B;  5L7O A;  2WAA A;  1LB2 A;  2RR1 3;  4ET7 A;  1EY2 A;  5C3Q A;  4KU7 A;  4NRO A;  1CIY A;  2JG9 B;  3K3N A;  4I0W B;  1L7R A;  2WZ8 A;  3IMN A;  3OM5 A;  4YVW A;  3ZYJ B;  3V64 A;  2BFU S;  1GZ9 A;  4LBO A;  1GLH A;  2VG9 A;  3O14 A;  2V09 A;  4HKW A;  4FPO B;  2ZGS A;  2XHK A;  3M3O A;  4PDW B;  1ENS A;  4QKD A;  3POE A;  1POV 0;  3SEP A;  5CKQ A;  3PU8 A;  1X82 A;  2RMU 2;  2VM9 A;  3GZA A;  2O14 A;  5H9S A;  3LSD A;  3M2M A;  5C4W A;  2XPJ A;  4XFH A;  4FPG A;  1PT2 A;  3OF1 A;  5FO7 B;  2ZZQ A;  5I8S A;  2YG0 A;  2J7M A;  4YVS B;  3ZR6 A;  1NKG A;  3RQ0 A;  5J36 A;  5F6L B;  4CU9 A;  3AZX A;  3ZIW A;  1WBL A;  1QJX 1;  1RUE 3;  5DQ0 A;  2VUA A;  2PXJ A;  3N7M A;  4RGK A;  2JG8 A;  1K3I A;  1IKQ A;  1COV 2;  1UXX X;  4JGZ A;  3ZXE A;  3ZXL A;  5EJ1 B;  1RYY A;  4XF9 A;  5FZO A;  1FPN 3;  4CCN A;  3I2H A;  2DF7 A;  3ZXD A;  3WUD A;  1B35 A;  1JU4 A;  1LGN A;  4QKB A;  3ZFF B;  3QC2 A;  3GZU C;  4GA9 A;  3T4H B;  1S55 A;  5DAV A;  1V9U 3;  1W6Q B;  5ACA 3;  3AP7 A;  3NNJ A;  4O65 A;  4EN8 B;  3WDW A;  3C7E A;  4Y20 A;  1WLW A;  2JX9 A;  3GCX A;  4RFR B;  4X6R B;  3GM8 A;  5GZC A;  2YFT A;  5C3R A;  1LOG A;  3AYE A;  3NKT A;  3WW2 A;  4C1X A;  5FDB A;  3TEW A;  3SNM A;  1W6O B;  4JAA A;  3WQ1 A;  1XNB A;  4ZS2 A;  3WDX A;  4DRV A;  3WF3 A;  3O1O A;  5ANN A;  3HNY M;  4RHV 2;  1NLR A;  2R06 2;  2P3K A;  3MLK A;  1H9W A;  4QX1 A;  4X6Q B;  3OM6 A;  4OMC A;  1PNF A;  4Y33 A;  4NMI A;  5IAX A;  1ENX A;  4BB3 A;  4FBF A;  4N9H A;  4XE9 A;  2X10 A;  2DCZ A;  3WUC A;  4YNI A;  1O4Y A;  2A71 A;  2QQW A;  4XCA A;  4Y3O A;  3F2Z A;  4MHR A;  1W99 A;  3HN3 A; 
#chains in the Genus database with same CATH homology
 2E31 A;  4MOA A;  2C26 A;  3LIH A;  3WAU A;  4PT6 A;  2EIB A;  2W46 A;  4UDK E;  2V4V A;  3NJV A;  3QEF A;  1F4A A;  3MO4 A;  1EUU A;  3K46 A;  4LQR A;  1JYN A;  2VMD A;  2Y6L A;  5C7G A;  3C7O A;  2VO5 A;  4DXR A;  3WMY A;  5FK8 A;  3WF0 A;  5A8C A;  4KCA A;  3P1I A;  1DP0 A;  4M4P A;  3D5Y A;  3NRU A;  4UDK A;  1UZ0 A;  4AG4 A;  4ET7 A;  2EXI A;  2VZ1 A;  3D60 A;  3C7G A;  2BBA A;  3HPN A;  1GQP A;  5IHR A;  1SHW B;  4MGQ A;  2VZS A;  2RVA A;  2JKX A;  4CUB A;  3KF5 A;  1OF3 A;  4DXS A;  3T2Q A;  2VCA A;  5JXI A;  4QDR A;  1JYW A;  3OGS A;  3AKH A;  4PVI A;  1NUK A;  5A1A A;  2DCJ A;  2VZU A;  5CYY A;  3K4D A;  3AKF A;  3VSF A;  2QQJ A;  2WBK A;  1JZ7 A;  5GLL A;  4AAX A;  5CZK A;  2VZT A;  3OG2 A;  5B6T A;  1ULO A;  2VR4 A;  4P02 B;  4DEV A;  3LPF A;  4CU7 A;  3LDK A;  3EB7 A;  2YC4 A;  3P6B A;  4UDI A;  5AY9 A;  1JI6 A;  4MLG A;  5GLK A;  3P2N A;  3OGV A;  1TVG A;  3ECQ A;  4AK7 A;  4XZU G;  2WQ8 A;  4L0P A;  4QAW A;  5FKB A;  1PX4 A;  1W0N A;  2CDP A;  3OB8 A;  1H6X A;  3I2G A;  3PUI A;  1XNA A;  1UY0 A;  2VC9 A;  5DPN A;  3UES A;  3QZ4 A;  4JKL A;  3UNP A;  2W87 A;  3WPV A;  3LV4 A;  1Y9G A;  3WQB A;  2YFR A;  1UY3 A;  2KD7 A;  4XUO A;  2YC2 A;  4E8C A;  2W1Q A;  4AK6 A;  2AEY A;  4XUP A;  3ZXJ A;  1MPX A;  2R7E B;  2J1A A;  1F4H A;  2B4W A;  5C70 A;  1UYX A;  5FMB A;  2W1S A;  4KC7 A;  2EIE A;  4DUV A;  3WAT A;  2WO1 A;  1JYV A;  2VOT A;  5JOY A;  1BHG A;  2XOM A;  2Y8K A;  2JE8 A;  2L9L A;  5JOZ A;  1GOF A;  3I3B A;  2ADE A;  3VT0 A;  2XQX A;  2WO2 A;  4QDS A;  2WYS A;  2QQK A;  2WDB A;  2VZV A;  4CUC A;  5A7V B;  5AYD A;  4UDG A;  1YQ2 A;  5AYE A;  2W1W A;  4QDQ A;  4BK5 A;  3BGA A;  4QX2 A;  4XUQ A;  4JHZ A;  3ETP A;  3BYL A;  1UWW A;  4RYD A;  4ARY A;  4DXT A;  4JX0 A;  4W4Z A;  4A42 A;  2CDO A;  3C7H A;  3J7H A;  4OYU A;  3WNP A;  3T2P A;  2HYX A;  2VZP A;  4D8M A;  1W9T A;  2EID A;  1CZS A;  2JDA A;  3FHQ A;  4D47 A;  5F7U A;  3IB3 A;  1UY2 A;  3R67 A;  5FUI A;  2VZ3 A;  5GLN A;  5GLR A;  2AEZ A;  1JYX A;  3VSR A;  5IJR A;  3WPZ A;  1UMH A;  5IFT A;  2VQU A;  5LA1 A;  1PMJ X;  5B4X A;  3LPG A;  1GYH A;  3DYP A;  3QED A;  4QB1 A;  3GXU A;  3R4Y A;  5LA0 A;  3LEK A;  5HXM A;  3WEZ A;  3VD3 A;  3A22 A;  3WSO A;  4BDV B;  4NOV A;  3VD7 A;  1I5P A;  2HLE A;  2VMF A;  1O59 A;  3MUZ 1;  4FFF A;  3IAP A;  4YPJ A;  1UYP A;  3LFI A;  3I2J A;  4ONZ A;  5J1X A;  3MBW A;  2RV9 A;  3KF3 A;  3WF2 A;  2Y6K A;  2J1T A;  3K77 A;  5JUV A;  3GGL A;  2QQV A;  5GLQ A;  2XHN A;  1JZ2 A;  2ZEY A;  2ORX A;  3FN9 A;  3SKV A;  2ZEW A;  2X05 A;  1GMM A;  2VCB A;  4LPL A;  2J1U A;  4AK5 A;  3WN1 A;  4RN5 A;  1US3 A;  2OKX A;  4N2R A;  1UMI A;  3ACG A;  3W5N A;  4N1I A;  4OMD A;  5DMY A;  1JZ3 A;  4QQS A;  3KST A;  2RJ2 A;  2ORZ A;  3OEA A;  4BXS V;  1CZT A;  1W2T A;  3CU9 A;  4FFG A;  3LQC A;  3WN2 A;  4KMQ A;  5JXH A;  3DEC A;  3R4Z A;  3AKG A;  3W5M A;  3D3A A;  1PMH X;  2XON A;  2Y6H A;  3HOB A;  2ZEZ A;  2W3J A;  1K42 A;  3CIH A;  1GNY A;  1YRZ A;  5EJZ B;  1CX1 A;  1VKD A;  4O8P A;  5A7V A;  2EXJ A;  5EIY B;  3UGH A;  3VT2 A;  3WPU A;  4MAD A;  3A7Q A;  2LS6 A;  1W9S A;  5GLP A;  2W92 A;  3WNL A;  1SDD B;  4KWU A;  4LKS A;  5HPO A;  3I3E A;  5A8D A;  2JD9 A;  3ACI A;  3HNB M;  1XPW A;  3VD5 A;  2LW8 A;  5LA2 A;  1P8J A;  3OBA A;  4UDJ A;  5JOW A;  3WNM A;  3WF1 A;  1UYZ A;  1SG3 A;  4QX0 A;  1W8N A;  1Y4W A;  3LEG A;  2BER A;  3U75 A;  5FMD A;  2QBX A;  2VMC A;  1T2X A;  3ZM8 A;  2ZXQ A;  3VD9 A;  3T2O A;  3BYJ A;  1H6Y A;  3LIG A;  3PIJ A;  2EXH A;  1JZ8 A;  1GYD B;  3HJR A;  1O8P A;  3LE0 A;  3T09 A;  3ACF A;  5FK7 A;  1JZ6 A;  4M4R A;  4N4B A;  4BK4 A;  2VDT A;  2Z4F A;  1W18 A;  5IYY A;  2WUH A;  1OD3 A;  4FI9 A;  4A44 A;  4QX3 A;  1Y7B A;  2VQT A;  2WO3 A;  3OM7 A;  3T0A A;  4COT A;  2WAB A;  2X09 A;  1WL7 A;  3UGG A;  1W8O A;  3BYK A;  1US2 A;  5JXJ A;  4KCB A;  3T08 A;  1XC6 A;  3C2U A;  1UX7 A;  3WN0 A;  3VSS A;  1J84 A;  4CU8 A;  3A23 A;  1CZV A;  2X8S A;  2J1V A;  5AYC A;  3HNM A;  2BGO A;  1OYG A;  2ZEX A;  3WNN A;  1UY1 A;  1O8S A;  2VZR A;  3VSZ A;  2Y64 A;  2WAO A;  3BYN A;  2EXK A;  2E33 A;  3I2I A;  2VZQ A;  3JXS A;  2W47 A;  2B9V A;  4UOJ A;  3QEE A;  3PUH A;  3VDB A;  1GOG A;  3CZU A;  1UV4 A;  5B6S A;  1PX3 A;  3SEE A;  2QQM A;  5JR2 A;  4OZO A;  4FFI A;  2J1S A;  1NX9 A;  4KI5 M;  3THC A;  1Y9M A;  4N2Z A;  3WPY A;  2VME A;  2C9K A;  2X8T A;  3NQH A;  3WMZ A;  5JOX A;  2VZO A;  2W5F A;  2DCK A;  3III A;  2BGP A;  3EYP A;  4A41 A;  4ZZ8 A;  2EIC A;  3K1U A;  3VT1 A;  2VL4 A;  3CZJ A;  4DUX A;  1YIF A;  4QPW A;  2ADD A;  3D5Z A;  3MUY 1;  5JMO A;  5FLW A;  3ZXL A;  3MV0 1;  2BZD A;  3A21 A;  3TAW A;  3ABZ A;  2PQS A;  2QQU A;  4LHS A;  3VDA A;  3WAS A;  5C71 A;  1EUT A;  3OEB A;  4XVH A;  3ZXK A;  4GWI A;  3LEM A;  4CU6 A;  5I0D A;  4A6O A;  4MO3 M;  3WF4 A;  1LNS A;  3UET A;  4DEQ A;  1OH4 A;  1JZ4 A;  3K75 B;  1GUI A;  3AC0 A;  2V72 A;  1D7P M;  4KC8 A;  4O8N A;  3BN6 A;  4JKK A;  2YFS A;  1KGY A;  2J1R A;  3C8X A;  4UI9 L;  5LCW L;  3IDA A;  4Z2A A;  4IUG A;  4A4A A;  1L7Q A;  4ZXE A;  3U14 A;  1NAE A;  1WKY A;  5JXG A;  3D61 A;  2Y6J A;  1TG7 A;  3UGF A;  1WCQ A;  2W91 A;  3LEI A;  3PIG A;  4XUN A;  2XQR A;  1R64 A;  3MV1 1;  5G05 L;  1JHJ A;  4ZZ5 A;  3NNG A;  4GZ9 A;  4MGS A;  4W50 A;  4EQV A;  4CUA A;  1K45 A;  3DYM A;  3E1F 1;  3SKJ E;  4PVA A;  2X8F A;  2J22 A;  2B4K A;  2AC1 A;  4JKM A;  3GDB A;  2WN3 A;  3K4A A;  3HEI A;  4XUT A;  2QQN A;  1YI7 A;  2W1U A;  3FHA A;  4KMI A;  4BJ0 A;  3LDR A;  3RWK X;  4OUE A;  1OT5 A;  4PQQ A;  1DYO A;  2VTF A;  2ID4 A;  4ARX A;  1GYE B;  4CVU A;  3T0B A;  2WAA A;  1JU3 A;  2E26 A;  3I3D A;  3OGR A;  1CIY A;  1L7R A;  2WZ8 A;  4P08 A;  3OM5 A;  3CDZ B;  3VDC A;  4XUR A;  2V5D A;  3ACH A;  4A45 A;  3DYO A;  1DLC A;  4GWJ A;  5IFP A;  3CQO A;  2DDU A;  2VCC A;  5GLM A;  3U37 A;  3SEP A;  2VM9 A;  3I97 A;  1PT2 A;  2VJX A;  5FMC A;  2YG0 A;  2J7M A;  4HG6 B;  4TTG A;  1NKG A;  4P00 B;  4CU9 A;  4FFH A;  3CMG A;  3WNK A;  2W95 A;  5DQ0 A;  5G04 L;  1W9W A;  1K12 A;  3I2F A;  1XNT A;  5FKC A;  3VD4 A;  2QQL A;  1K3I A;  1ULP A;  3CKH A;  4QB2 A;  2QQI A;  1UXX X;  3WNO A;  4E8D A;  2WN2 A;  1UXZ A;  1IQD C;  1HN1 A;  2E32 A;  5EJ1 B;  3IAQ A;  1RYY A;  2QQO A;  4ZY9 A;  4D0Q A;  5GLO A;  4U6B A;  3SC7 X;  3I2H A;  2W94 A;  3NJX A;  1JU4 A;  2YB7 A;  4UAP A;  1KEX A;  2C4X A;  2YFU A;  3QC2 A;  1JZ5 A;  3I2K A;  3LF7 A;  4P5Y A;  4W8J A;  2Y6G A;  3C7E A;  2YFZ A;  4DUW A;  3T0D A;  2W9X A;  3GM8 A;  2YFT A;  2WZE A;  1UYY A;  3C7F A;  4TXW A;  3OM4 A;  1OF4 A;  3AKI A;  3OM2 A;  1UY4 A;  4PF1 A;  4O8O A;  2J1E A;  3WF3 A;  5ANN A;  3HNY M;  3THD A;  5DN2 A;  3FL7 A;  4U6D A;  4QX1 A;  4QB6 A;  3OM6 A;  1GOH A;  3K4Z A;  4A3Z A;  4OMC A;  5FIX A;  2OXB A;  5B4N A;  1J83 A;  2X10 A;  2QQW A;  1GU3 A;  3F2Z A;  1ST8 A;  5C0P A;  1W99 A;  3HN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...