3C7HA

Crystal structure of glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase from bacillus subtilis in complex with axos-4-0.5.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
487
structure length
487
Chain Sequence
ATSTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVNWTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDPIGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVVGSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAFFGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNLNPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKIEVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endo-1,4-beta-xylanase
publication title Structural analysis of a glycoside hydrolase family 43 arabinoxylan arabinofuranohydrolase in complex with xylotetraose reveals a different binding mechanism compared with other members of the same family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 134
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c7hA01
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3c7hA02
5A8DA 3SEPA 4QX1A 3F2ZA 3I3DA 3WQBA 1YRZA 1BHGA 2W46A 2VZOA 1W0NA 1JU4A 2WAAA 4OMCA 3MV11 1UY3A 5FKBA 4LKSA 5C71A 5C0PA 5LCWL 2QQMA 4KC7A 2E26A 1UY4A 1UYYA 2W47A 2VMCA 1GOGA 3VD5A 3WEZA 3LEMA 1O59A 3QC2A 3JXSA 2B4KA 3LEIA 1NX9A 4JKLA 1UV4A 4QDQA 4FFIA 4GZ9A 2Y6JA 4ET7A 3VD9A 2WZEA 3CZUA 4CVUA 1DP0A 2EXKA 4M4RA 3D5YA 3VSZA 4A3ZA 5DPNA 3I2JA 4QX0A 1NUKA 5G04L 3ZXKA 1GOFA 3IAQA 3LV4A 5JXGA 4AK7A 4O8PA 2WO1A 3BGAA 4RYDA 5JXHA 2WYSA 4AK6A 4BK4A 5J1XA 1VKDA 2J1EA 1H6YA 3P6BA 3VDBA 2ZEWA 1W9TA 3QEDA 2AEYA 2RVAA 4UI9L 3OBAA 4CUAA 5FUIA 2W94A 4MO3M 1Y9GA 4XZUG 3VT2A 2EIEA 4O8NA 1OF3A 1DYOA 4PT6A 3WNLA 4DEQA 3K4DA 4MADA 4QDRA 5HPOA 2ZEYA 2E33A 5IHRA 1W18A 1K12A 3T2PA 3I2KA 1UX7A 2QQKA 5C70A 4D47A 4UDIA 2J22A 3IB3A 3UGGA 3VSRA 2BBAA 1J83A 1JZ7A 3EYPA 2W1QA 3UETA 3WF1A 3ABZA 3KSTA 4FI9A 2Y6GA 3LFIA 3OM6A 4ONZA 3WSOA 4XUTA 2V4VA 4W4ZA 1H6XA 5B4XA 4TXWA 3R4ZA 2X8FA 3K4AA 3WPUA 3WMZA 2J7MA 3E1F1 3LDRA 2VDTA 3WN1A 5ANNA 1R64A 3LE0A 2XONA 4Z2AA 4UAPA 1D7PM 5CYYA 2RJ2A 4W8JA 4O8OA 4RN5A 1MPXA 1JHJA 3SEEA 5IFPA 4E8CA 5JXJA 3T08A 3FN9A 5JMOA 3D61A 2J1RA 2R7EB 2YC4A 3GXUA 5JOXA 2WQ8A 5FMBA 4BK5A 3QEEA 2W1WA 2ORXA 3ZXLA 1PT2A 2VL4A 3OG2A 1GUIA 2C9KA 2WN3A 3MUZ1 1RYYA 4A42A 4N1IA 3DYPA 4A45A 1UXZA 1GMMA 1O8PA 4JX0A 3VSFA 2WABA 4P08A 2JD9A 4N4BA 2OXBA 5FK8A 1GYEB 2C26A 3CKHA 3LQCA 5IFTA 2YFRA 5A7VB 3CDZB 1OYGA 3VDAA 4CU6A 4XUOA 1JYXA 4KMIA 3VSSA 2VCBA 3WPYA 4XVHA 2VCCA 2KD7A 2VJXA 3MV01 4XUQA 5HXMA 3DYOA 1US2A 4MGSA 4M4PA 1JI6A 2EICA 1F4AA 3WNNA 2HLEA 2EXJA 3NJXA 3EB7A 3NQHA 4KC8A 4XURA 4ZZ8A 1J84A 3U37A 1WL7A 4KCBA 3I97A 2V72A 2VZRA 2WAOA 5FIXA 2VMDA 3AC0A 1UYXA 4P5YA 1JZ8A 3LIGA 2J1SA 2W87A 2ZXQA 1UYPA 2X09A 2CDOA 5B6TA 3MBWA 2QQUA 3OGVA 3K1UA 4U6DA 2YG0A 3HJRA 1Y4WA 3PUHA 2W91A 4ARXA 3KF3A 3ETPA 2YC2A 3UGFA 3CMGA 1UXXX 4ZXEA 2VZUA 3WPZA 5GLMA 2B4WA 3BYKA 5FK7A 3OEAA 3T2QA 2L9LA 3A21A 3WMYA 3ACIA 3LF7A 4QX3A 3HN3A 1ULOA 2HYXA 5AYDA 2JKXA 5G05L 2QQJA 3KF5A 4ZY9A 2Z4FA 4DXSA 1US3A 3UGHA 1W9WA 3VD7A 3T09A 4NOVA 5LA1A 3C7EA 2QBXA 4AAXA 4P02B 3R67A 3IAPA 3HNMA 4HG6B 3MUY1 5JOWA 3CIHA 1WCQA 3VDCA 2DCKA 1F4HA 2DDUA 2Y64A 2YFZA 3T0AA 4OZOA 1SDDB 4AK5A 5F7UA 1UY2A 1OD3A 3K77A 5EIYB 2W95A 1EUUA 4QPWA 2Y6LA 3I2HA 1YIFA 3WNMA 3PIGA 3K4ZA 3C7HA 3C7FA 3NRUA 3LPFA 1K3IA 2Y6HA 5AYCA 3IIIA 3BYNA 2ADEA 4A6OA 5FKCA 4DXTA 3BYLA 4IUGA 3HNBM 1YQ2A 1UMIA 1L7RA 3I2GA 4OMDA 1JYWA 5EJZB 5IJRA 2YFTA 4DUWA 3OEBA 4FFGA 4ARYA 3MO4A 2E32A 4A41A 1PMJX 2XOMA 2EIDA 4PF1A 3SC7X 2VZTA 2B9VA 3NNGA 3LIHA 2BGOA 3DECA 1EUTA 1K42A 1P8JA 1JZ5A 2W3JA 4UDJA 3OM7A 3LEGA 1ULPA 2QQIA 1XNAA 2VOTA 4BJ0A 3W5MA 1HN1A 4W50A 3D5ZA 3WAUA 3OGRA 2EIBA 3RWKX 4DEVA 2WZ8A 5B6SA 2Y8KA 1CZVA 1JYNA 3D60A 4JKKA 3ZXJA 3I3BA 3U75A 3VT1A 4A44A 2J1AA 1GU3A 3HOBA 2VCAA 4TTGA 2J1TA 4YPJA 3WF4A 2VTFA 4LPLA 3BYJA 1IQDC 4LQRA 3HNYM 5JOYA 4ZZ5A 4KI5M 3GM8A 4MOAA 3SKJE 3CU9A 1XNTA 2J1VA 5DMYA 1GYDB 3WNOA 3HPNA 1W99A 1KGYA 2V5DA 2ID4A 3ECQA 3WNPA 2JDAA 4U6BA 2VC9A 5FMDA 1WKYA 5A7VA 2VR4A 4MGQA 5A8CA 3QEFA 4QX2A 1OH4A 4KMQA 3UNPA 4PVIA 3K46A 5JXIA 4OYUA 3ACFA 3C7OA 4OUEA 2WN2A 3OM4A 2QQVA 2EXIA 3HEIA 2X8SA 4UDGA 4QAWA 2EXHA 5DN2A 1DLCA 2VZPA 2LW8A 5GLPA 1GNYA 4UDKE 3C7GA 4BDVB 4COTA 2WUHA 2DCJA 3U14A 3BN6A 2VZQA 3FHAA 3WASA 2QQOA 1I5PA 3ZM8A 4DXRA 1TG7A 1OF4A 5FMCA 4LHSA 1JZ6A 1UWWA 1PX4A 2VZSA 4N2RA 2X10A 3CQOA 2XQRA 4QB2A 3A7QA 2VMFA 3SKVA 4QB1A 3WPVA 5GLOA 3I3EA 2ZEZA 5LA2A 1GYHA 1K45A 3ACHA 5I0DA 5EJ1B 3T2OA 5A1AA 1GOHA 3GDBA 5GLKA 3AKGA 2JE8A 3P2NA 4GWIA 4JHZA 4XUNA 3WN0A 4QB6A 4GWJA 1W8NA 3VD4A 4JKMA 3AKFA 1LNSA 2ZEXA 1PMHX 4KWUA 5GLLA 3WATA 4FFHA 1Y7BA 2J1UA 3PUIA 4AG4A 4CUCA 4A4AA 5IYYA 5JR2A 1CIYA 3OM2A 3OB8A 1CX1A 1JZ3A 2X05A 2VQUA 1OT5A 2WO2A 2VMEA 4D0QA 3P1IA 2LS6A 1SG3A 1UMHA 3FHQA 4XUPA 3A22A 2WDBA 4DUVA 3WF2A 2BGPA 3I2FA 2W5FA 5C7GA 2VO5A 1T2XA 2VZ3A 2X8TA 3LDKA 1SHWB 5FLWA 2VQTA 5JOZA 3DYMA 1XPWA 3THDA 1XC6A 2VZVA 1UZ0A 2W1SA 2VZ1A 5GLNA 4UDKA 1KEXA 3WNKA 1O8SA 4E8DA 3QZ4A 4P00B 3ACGA 3CZJA 3T0DA 3T0BA 3FL7A 2YB7A 1UY1A 3PIJA 2WO3A 3C8XA 1GQPA 1ST8A 3J7HA 4PQQA 5JUVA 3R4YA 1NKGA 1JU3A 3LEKA 3GGLA 2E31A 1W9SA 4CU7A 3WF3A 4N2ZA 3A23A 4PVAA 3WN2A 3K75B 1JZ2A 2AEZA 2VM9A 3OM5A 4L0PA 2XQXA 1TVGA 2ORZA 3IDAA 1CZSA 3VD3A 1Y9MA 3OGSA 5AY9A 3NJVA 3THCA 2WBKA 5LA0A 4MLGA 4CU9A 2RV9A 2OKXA 1YI7A 5GLQA 1L7QA 5CZKA 4QQSA 2ADDA 4UOJA 3TAWA 1JYVA 3W5NA 4KCAA 2W1UA 4EQVA 2AC1A 1UYZA 2YFUA 2C4XA 2PQSA 3VT0A 3D3AA 2QQNA 4BXSV 2Y6KA 5AYEA 4D8MA 2YFSA 1JZ4A 1NAEA 3AKHA 5B4NA 1W2TA 3UESA 3C2UA 1W8OA 2QQWA 2BZDA 4CU8A 2W92A 4CUBA 1UY0A 1PX3A 5DQ0A 3I2IA 4DUXA 5GLRA 1CZTA 2CDPA 3AKIA 2XHNA 2BERA 2QQLA 2W9XA 4QDSA 3LPGA 3WF0A 4FFFA
chains in the Genus database with same CATH superfamily
4JAAA 5H9RA 3GJBA 3J7NA 3O1TA 1TQ5A 3PDQA 1J3RA 2NP0A 1AYM1 2ZAHA 3MV11 4AYUA 1RIRA 4LKSA 4IEVA 4AHZA 3USSA 3Q8FA 3WP3A 5A6QA 2XUMA 4JZRA 2E26A 2XKPA 3O1OA 5ABJC 2ZOEB 2RMU3 1POQA 2HEWF 3VD5A 5A6ZA 2YU2A 3MIHA 3LEMA 3POEA 4XAEA 3JXSA 3QC2A 1RUF1 4PJYA 4FPGA 4CDXC 1NX9A 4I01A 4XQDA 2YPDA 4FQZA 4O61A 4QDQA 4Y22B 1G9DA 4QPYA 4XHXA 3VD9A 3LCPA 5JSPA 5EP9A 4K1ZA 4CTEA 3J8F2 4A3ZA 3AKRA 2GP5A 1BCXA 4BQWA 1QJY3 3CLPA 4R9CA 2SLIA 2WO1A 4YG0A 4Q4X2 2ZX2A 3ZN4A 5JXHA 1O4ZA 4BK4A 4AK6A 1X9TA 2HH9A 3CBNA 3LA2A 2WFF3 4AI3A 1N1SA 2J1EA 3P6BA 3VDBA 1ZZ7A 4MGTA 3AX4A 4HONA 1VBA1 3QEDA 5DZEA 3OGJA 4XZPA 3AYDA 5JPNB 4UI9L 2HKXA 1S0CA 5FUIA 2BWCA 3TN92 1TME1 1Y9GA 1OUXA 2W94A 4XZUG 4AXOA 2CWMA 2EIEA 2AUYA 2JG9B 3B02A 1OF3A 2DU0A 5FZAA 5IT6A 3IDBB 1S0IA 2VH9A 1DGLA 4MH0E 4BQ4A 2ZEYA 3O0WA 1WLWA 2E33A 5IVCA 5A32A 3DKWA 2PHRA 3N9LA 3I2KA 3T2PA 1UX7A 4QKFA 2CWSA 5BUVA 3PTYA 4QPGA 4UDIA 2JKBA 1O6UA 2FBEA 1W0OA 2J22A 3KV9A 1LESA 3M2MA 5F5AA 4AVVA 4PDWA 2W1QA 1EYBA 3UETA 3ZFEA 4FTSA 3ABZA 3KSTA 1SLIA 1UL9A 3OM6A 2ZGPA 4ONZA 2BVVA 4M3CE 2D97A 1C3HA 3B00A 2GH8A 2A70A 2BFUS 3ITQA 4OCTA 3O1MA 4QKNA 1PMIA 3OSDA 4BM8A 5I0SA 3WMZA 4WM7C 5FPXA 3E1F1 4JVAA 5A7QA 3WG2A 1LU2A 1LOCA 4E27A 1J3PA 1MS5A 1IOAA 4N43A 3ZFGA 3KV4A 3T2TA 3WG4A 4Z2AA 5FJKA 3ZN6A 4O8OA 2IXCA 2YYOA 1SQ4A 5DUUA 5ISLA 4LT5A 3GXUA 2WA4A 3NNMA 1U0AA 1BJQA 3SH3A 3WVJA 4OI0A 5C4WB 1R081 2HWB3 1IPKA 5T50A 4XJZA 4Y20A 2O8QA 4NRMA 3ZIWA 5C8WA 1E5RA 4QPIB 1PIV1 1O5LA 1R1A3 3ZXLA 3TBDA 4A3XA 2GZWA 3ZKUA 1CJPA 3WCRA 4B1LA 4EYUA 1CAUA 1RUI2 3FBYA 4UF0B 4XBQA 1RUH2 2ZHMA 2WN3A 1HRI1 3QLQA 3MUZ1 1UOJA 2B42B 3H1YA 5DABA 2RJKA 2OW4A 3LA3A 1GMMA 1O8PA 1ZVFA 5D2AA 4P08A 5KC6A 3FJSA 3H8OA 5BV6A 3O1PA 1TNRA 1V6OA 2C26A 1GYEB 2EAKA 2IVJA 3W58A 3WDWA 3CKHA 1NXD1 2WZR3 1OQEA 4CDUB 2BDRA 1OYGA 5FY7A 4I09A 5DUWA 3VBOA 2HWF2 2WC2A 3PL0A 1D4M3 2VCBA 3N35A 3BVCA 5I8TA 1ENRA 2VCCA 2VJXA 3MV01 1W9FA 3GZTB 1W8FA 3PLQA 3BTZA 3VBUB 3W9AA 2JWPA 4QGMA 3W21A 3V0BB 3NQHA 1D2SA 2WS93 1HX6A 1VBC1 4HOOA 4R4ZA 4UW6A 1DGRA 5K7PA 4KCBA 5GZCA 5KHJA 2VZRA 2RS31 4JTNA 5HCBA 4IE6A 5T5OA 3OGGA 3S7EA 2BV4A 1ZRFA 1CPMA 2JDNA 2VMDA 3AB0A 1UYXA 3AC0A 3NMBA 4P5YA 4Q4Y1 3WG1A 1HKDA 2J1SA 2ZXQA 4HKWA 3R4UA 4JRLA 1LB2A 2E63A 5K0UB 1AR61 1QQP3 1DQ0A 1DZTA 2NMNA 2YG0A 1AYM2 2GDFA 3FUQA 3HJRA 4FPFA 3SCFA 5JAXA 2W91A 4ARXA 4BQYA 2XVLA 4S2FA 2WFPA 3LZZA 3CMGA 2ZX3A 5EQUA 1PZ7A 2HWD1 5A3TA 2CU5A 4KGQA 4Q4V3 3HQRA 1Z78A 2R6QA 2B9UA 5FYZA 5FZ4A 1G9AA 1XRUA 1NCQC 2DU1A 3ACIA 3J9SA 3LF7A 2HYXA 1LKNA 1SBEA 1ULOA 1H4GA 2GNDA 1QOTA 1EPWA 2BU9A 4EN6B 4P9YA 1AR93 4XE9A 3WHUA 2QQJA 4KU8A 2JIJA 1V0AA 1URXA 4ZY9A 5FPUA 1GZWA 3VDDA 3FLTA 5LK7B 1N1VA 1PGL1 4AGRA 1NY72 1V70A 3ELNA 4ZS3A 2E9QA 2IFWA 1DF0A 3RG0A 3FBMA 5LA1A 2FDKA 3C7EA 4Y33A 2QBXA 3IKWA 4LHNA 3FUOA 5T52A 4IE4A 4L97A 3PUSA 5F32A 4A6SA 3R67A 2VOKA 3NL1A 3MUY1 5ABJB 3CIHA 1WCQA 5J96B 5JOWA 1Q8OA 2PHUA 1WZXA 2DDUA 5FYTA 1GFF2 1TMF2 2AREA 2MPFA 3T0AA 1HQNA 3MIBA 2WZR2 4IEWA 4CDXB 5L36A 1SDDB 2DTYA 5T54A 3VZMA 4AQTA 4AK5A 1ASJ3 1PVC3 2XGXA 4GKXA 4GWNA 4LA2A 4V2WA 1WBLA 5E88A 5FYHA 4ASLA 3IMNA 3VZNA 3K77A 4JHTA 1W90A 3ALQA 4L9BA 4ZKTB 1W2OA 3OTFA 3T4VA 2DUOA 1EUUA 3PIGA 2Y6LA 1YFXA 3RZHA 1PO13 3K4ZA 3C7FA 2UWAA 3LPFA 5FDBA 5JZGA 1K3IA 2D3SA 4PIZA 1T6BX 1JOJA 1LEMA 3IIIA 2OS2A 3QD6A 4R9DA 1QF3A 2XL7A 4AI9A 4PIYA 3I2GA 4DB5A 1JYWA 5EJZB 1H2LA 4AVAA 2X5IA 4DUWA 3EQEA 2GMMA 2XG3A 4R4XA 3DUIA 1DQ4A 3OF1A 4LITA 4V2VA 1W05A 2D5HA 3OEBA 3MLLA 1OQDA 2E32A 2XOMA 1GZTA 1G9CA 3KGZA 2LROA 1QIQA 1QDCA 4PF1A 4PF5A 1OA4A 5F5CA 2R043 2W2IA 3B7MA 3SH4A 5FZOA 2RM22 1CPNA 5L19A 4FSJA 4R9BA 1PM4A 1IG3A 1YEWA 5GM0A 5EYXA 3ZN5A 1EUTA 3PTRB 1K42A 3I59A 1APNA 1OFSA 2XMLA 3RMYA 2OQ7A 2QDRA 1TL2A 4Q4W1 3JBG1 1AR92 5T5PA 3I3QA 1XJAA 4QX7A 1HN1A 5FPVA 3D5ZA 3WAUA 4O7XA 1G9FA 4Q1RA 1RL3A 3VGIA 1R082 2GN3A 2VOWA 4DO0A 1ND3A 1QKQA 1AYN1 1XXNA 1YWKA 1WMXA 1NG0A 3OD0A 4DEVA 2R1DA 2VMIA 4XF1A 1CZVA 4DNYA 1HRI2 3VT1A 4YG3A 1GANA 5BNNA 1ONAA 3HN1A 3HOBA 4TTGA 4C0HA 2XB6C 4WM7B 3W59A 4LPLA 4CCKA 1VAMA 5A7SA 4LQRA 4GAZA 4OVEA 1LOGA 5CB7A 4AI1A 3BI3A 1VRBA 2UY9A 1CR7A 3KT1A 1H8TA 2Z69A 3AL5A 2A6WA 3JU9A 1PGW2 3TB0A 3R4SA 3A4UA 5I0UA 3HPNA 1A34A 3LSEA 1XE8A 2GU9A 4U2AA 3AKQA 1HXS3 1J58A 2JDAA 2GP3A 4U6BA 5L73A 5FYYA 3J7LA 4PI2A 2FD8A 2G9FA 3HD8B 2Y38A 5A7VA 3WW2A 2XUEA 3IWZA 1VBC2 3JQWA 5L9RA 1H2MA 3KCYA 3AZZA 2RS32 3POFA 1OH4A 3B3QE 3UNPA 1ZBA2 4PVIA 2A75A 3K46A 3R0RA 4KG8A 2QFEA 2FZ2A 3C7OA 4XTPA 4LE3A 4B3NA 5A70A 4QGLA 2WN2A 4XDOA 2JXAA 3TAYA 2QE3A 3ENRA 4QX5A 2EXIA 2ZMKA 3ZSLA 4IEXA 2PQQA 4NN0A 3F95A 1U5YA 2X8SA 3NW4A 2Y6FA 5FFOC 3M3EA 2ILMA 1K5MA 4MXWB 2LRPA 4B7EA 2R042 4GMP1 1WLCA 2EA7A 4AEDC 1BBT1 1M4WA 1XSQA 3M3CA 3D5OA 4C91A 3VBRC 1N3QA 4RR3C 2PFWA 2XVKA 2VZQA 5DDJ3 5FQ0B 5J48A 2WNVC 4HZFA 3BUCA 2BPA2 3FFZA 1VBD1 4FPHA 4EN8B 4L99A 3D0SA 4COYA 3AVSA 1F5FA 5JCTA 2ZAAA 1GR3A 1V00A 1JZ6A 3RMXA 1LOFC 3CQOA 3WDUA 3SITA 2XQRA 2HEVF 5CFDC 1WLDA 1POV3 1PGL2 5I8YA 4DY5A 5C2MA 4Z1VA 3RPQA 1EAH1 2IFRA 1UAIA 1R1ZA 1WMEA 4L92A 1XNCA 2ZEZA 4JCKA 2JG8A 1YCIA 3RVHA 5I0DA 2LUWA 3GJAA 5EJ1B 1RITA 1JODA 3M4FA 4BQ2A 2CAVA 2VUJA 3WOGA 1RUOA 4B7KA 2D3PA 4AF9A 3GDBA 3AKGA 1NCQB 4GWIA 4JHZA 4XUNA 4JGYC 3WN0A 4RGKA 4QB6A 4GWJA 3N3HA 4LBLA 2IC1A 4KWUA 1MS4A 4FFHA 3D8CA 1YUDA 2VULA 4RS5C 3AYAA 5EFUA 4AG4A 2XBO3 2HYKA 5JR2A 1CIYA 2D6MA 2D43A 4LNVA 3UT0A 4DRRA 1CX1A 2VW0A 5EXOA 1UW8A 4LR4A 1YC61 4HLTA 4YRDA 3AKTA 1OT5A 1MZFA 1QJEA 2VMEA 4RD7A 4AOCA 4A7ZA 4D0QA 5AC93 5FAXA 2LS6A 4S2HA 1V6KA 4DIQA 4XHBA 1DGRN 1HQLA 3BTXA 4DUVA 1HB3A 1HQWA 2RR11 4NIAA 3OY8A 2XJRA 1F9KA 3H1MA 4N7IA 4C90A 2JEMA 1RMU1 2A6XA 5FO7B 1ZM1A 3ES1A 1SHWB 1ZRCA 1X50A 3S30A 1PHMA 2VMHA 1XC6A 1UZ0A 2W1SA 2PHDA 4BA6A 5GLNA 2I07B 1UOGA 3WNKA 1XNKA 3KM5A 3GZUC 3BU0A 4HVQA 4AQ2A 5B2GB 4DS0A 3GF6A 1W06A 5DXDA 4XPVA 1QJX3 2YB7A 2WQ4A 2W0XA 4WVVA 2ARBA 4NRQA 1ST8A 3ZFFC 4PQQA 5JUVA 1NKGA 1C5HA 2RHPA 3LEKA 3POIA 4LIVA 1ZZBA 1IS4A 2FDGA 4YLZA 1O7FA 1L3JA 4BLJA 1AYN2 4N2ZA 4O9EA 4SBVA 4YW3A 4PVAA 5FZBA 1FNYA 3OBTA 4YGBA 2ZACA 3ZOIA 4Y4YA 3K75B 3RZMA 4YGCA 3WW3A 1T6GC 4QQPA 4YVWA 2V09A 4MZUA 1AUYA 3IDCB 4C1WA 4D94A 3IDAA 3LWCA 5IW0A 3VD3A 2R0HA 1Y9MA 4IE7A 4MX3A 3W20A 5F2WA 5ANQA 3OJBA 3SH5A 2HBUA 3ZXAC 1RJ7A 4CXWA 5FPBA 3HBKA 5LA0A 1W8HA 3WT3A 2RV9A 2OKXA 1YI7A 4YWAA 1RXGA 2WNUA 2VY0A 4GULA 5CZKA 4Z07A 1CESA 1E5IA 1GP5A 2MHFA 4KG0A 4UOJA 2OPKA 4JDMA 2AR6A 4MSVA 1LULA 1AL23 4HL0A 4NVPA 2W52A 3TAWA 4LBQB 3NNLA 4EQVA 2AC1A 3MGUA 1W6MB 4GMP0 3POWA 3Q8EA 2QZ2A 4K1YA 5I0TA 1SMVA 3D6EA 3G7DA 4D8MA 3ZSKA 2YFSA 4OI1A 1RVF1 4XIOA 3UESA 3JD73 1PO23 1SBFA 3C2UA 1W8OA 4JTOA 4UFHA 1NOVA 2W92A 1YQ5A 4HK8A 5DAPA 2Y60A 1G9BA 3WCSA 3P3NA 1Q56A 1JOPA 1QMJA 4H2AA 5CIRA 3H0OA 2BNOA 4M3CB 5GKAC 3I2IA 5I91A 1WD3A 5JSRA 1CAVA 1NQDA 1TE1B 2Z79A 2XHNA 3AKIA 1CAWB 2DVDA 4YVSA 3GALA 5BNOA 3VN4A 4GJZA 1IPSA 3MIDA 4BQ1A 5A8DA 4QX1A 1V6JA 5BNPC 2SBAA 1WLTA 3WQBA 2W46A 1GZCA 4J1XA 4CDWC 1OKQA 4BMEA 1JU4A 2WAAA 4NHXA 4RQPC 1DLLA 2CL2A 1GBGA 4OMCA 1VBD2 4YGEA 4DQAA 2ZJCA 1OHFA 1AVBA 3ZPOA 2PHXA 3ZO0B 4Y3OA 2QQMA 3NWKA 3WP4A 3SCGA 1OXCA 1UYYA 4OHZA 5FP8A 1GOGA 3UKNA 3WEZA 4FBFA 4AFCA 2QUOA 1EAH2 4C1XA 3EMRA 1DYKA 5F9TA 3WXPA 3VZKA 4D6QA 3GYDA 2FCVA 2QKDA 5FP4A 2TUNA 3MPPG 4AEDB 3SQOA 1QXRA 3C3VA 3V56A 4GZ9A 3SISA 1GV9A 2IUWA 4B4QA 2Y6JA 4BLIA 2N7GA 3KQ4B 4Q0UA 3VBRB 1DG6A 2TNFA 2WZEA 4RR3B 1W8ZA 4DXZA 3NVCA 2WNVB 2NLRA 1DP0A 3HVDA 5BY5A 2EXKA 2D98A 3MIGA 4LMFA 3KGLA 5K9YA 5L7OA 1D0GA 1ZZ6A 3WDXA 2ZGUA 1YQCA 4QX0A 5FWJA 3ZXKA 1NE4A 1F35A 5FP3A 4EWEA 5JXGA 2ENRA 3URFA 4O8PA 4LA3A 2B8MA 5DUXA 4GH4C 5H9SA 4IV1C 5CFDB 4HSJA 3VBHC 4HXCA 2P6CA 2DURA 1RUE1 4GB33 4UBGA 3PUQA 2XWJB 5IATA 5JPMB 5HI0A 2ZEWA 2XJTA 2YGLA 4XOGA 1LEDA 1YI9A 3TN91 2RVAA 4HBNA 3HT1A 1U5ZA 4IGPA 5SV5A 1OPOA 4CEWC 2XR4A 3MW4A 2RR12 1OLQA 3NJYA 3CO2A 4CYDA 4O8NA 1JTZX 5FZDA 3WNLA 4BH9A 4JGYB 1PVXA 4FOQA 5GJ6A 3POYA 4QQLA 4QDRA 4MADA 4XFCA 4DEQA 5EYYA 1QJU1 3ME2A 1MVEA 3ZDSA 2RDSA 2HWE1 4RS5B 5D8AC 4YW2A 1F2NA 1VBE3 3VSRA 2P17A 3O12A 1NA1A 1J83A 1GP4A 2JG9A 4Z8BA 4MGZE 2RS53 1FV3A 2I74A 3AZWA 1B35C 4FI9A 2ZZJA 4AI0A 3BYLA 3DPRA 1X8MA 2BOIA 1LJ7A 1NCRA 2V4VA 3NAPC 2PAKA 5KXEA 1H6XA 2G19A 2RMU1 4BIFA 3K4AA 4Y1YA 3RQ0A 3RJRA 1SLCA 4RGGA 2J7MA 4WM8A 3LDRA 5F3CA 2VDTA 3KCCA 4E9KA 3I54A 3POGA 5ANNA 3LE0A 1H0BA 3ES4A 3PURA 1D7PM 2RJ2A 1DZQA 1Q43A 4LIUA 2XH6A 4E8CA 1I5ZA 4IETA 4P9JA 4S2GA 2J1RA 5JOXA 4WZFA 5C3QA 3VBFA 4N53A 1YHFA 1ALYA 1X82A 4UFMA 1HRV3 1RUH1 2ORXA 4NIDA 2VL4A 3ZFFB 3KT4A 2LTNA 2VW2A 2YU1A 4O65A 5IVFA 4AZZA 3PMSA 4A45A 3ZMNA 5CG9A 4TWTA 4MGIE 3MLKA 3ST7A 2WFF1 3V64A 5GLZA 1OBNA 3UYJA 3MYXA 3ZYBA 1QXPA 2OZJA 2D6NA 4NHLA 2JICA 4UF0A 1NLSA 5FY4A 4EV0A 3TRSB 1WD4A 3UK9A 1S1AA 1IG0A 3CDZB 2ET1A 1RVF2 2HEYF 4LBJA 1C5IA 2D7FA 4XTMA 2JE7A 4XUOA 1J1TA 2Q4SA 2YROA 3FFQA 4IESA 1KXGA 4LLOA 2AYHA 2DV9A 4MGSA 3HT2A 1F4AA 5C9AA 2ZX1A 2P1BA 2XJSA 3NJXA 4K20A 5FP9A 3BIWE 2YMZA 3U37A 4QGNA 4BYYA 1WL7A 4P9LA 2C9AA 3I97A 4INDA 3P3PA 5FZ3A 1F15A 4HPKA 4CCEA 5TSWA 2JDMA 2BEOA 1FI2A 1UYPA 1BXHA 1Q5OA 2JB4A 2JX9A 1NLRA 1YFYA 5B6TA 3K1UA 1Q8SA 2FMDA 1CWPA 4U6DA 1VALA 3I7DA 2K9ZA 3PVNA 1GLHA 3PUHA 3Q8AA 4XJ8A 4NO4A 3KF3A 2YC2A 5T55A 3UGFA 3V0AA 4ZXEA 2ARAA 5J7MA 4HVOA 3WPZA 3ZPYA 2ZA9A 4IV3A 1O3QA 2B4WA 2YY1A 1GYKA 1RJ8A 1VMJA 1AF9A 2WIIB 2AGSA 4EZ4A 3AVRA 4B1MA 2RDNA 1N3PA 2FZ1A 4P9WA 2L9LA 2PAMA 3A21A 1W6OB 5CKQA 3T2QA 4B4PA 3B01A 2HWB1 5AYDA 2FCUA 1XOYA 5I0RA 1OI6A 1RC6A 2JKXA 5G05L 1HRV2 4M0NA 2OT7A 5H9QA 2VVDA 1VJ2A 2Y34A 1NY71 5BNPB 4LKFA 4CDWB 4RHV3 4XF4A 2Z4FA 4DXSA 1TNFA 1J3QA 2LALA 4RQPB 2VOVA 4YSFA 4QKDA 1UCXA 4BQ5A 5JDBA 2XLFA 5LRRA 4AHWA 4MLOA 1UOFA 1RUC3 2VU9A 4AAXA 2V4AA 4XFBA 5IVVA 4Q2FA 2DTWA 1QGLA 4Q0PA 1STMA 1WW5A 3ZR6A 1TMF1 3FLPA 4AHYA 2VTXA 3GBWA 3VDCA 2R072 3OUHA 4QPGC 3WQ7A 1RUE2 2WWJA 2WZR1 3KHCA 1HLCA 3QH7A 2VXJA 3WP6A 1SLLA 4HKOA 4OZOA 4PDWC 5T5JA 3VL8A 3ZFEC 1UY2A 3ZVXA 1SLTA 4Q26A 5C8CA 1COV3 4XXPA 1XYNA 1OD3A 5E16A 5EIYB 4IXLA 2WS91 3RNSA 5JWPA 1CIWA 3DEMA 2NM1A 3BB6A 3NRUA 1XSRA 2Y6HA 4SLIA 1QJU2 1OA3A 3BYNA 2HWE2 5DG2A 5GZFA 3ZFGC 4N43C 4K21A 2VNVA 4GH4B 2O1QA 2X29A 3HNBM 4IV1B 3VBHB 4Q29A 2O0OA 1QU0A 2W39A 1C4RA 4MVTA 4OI2A 3L2HA 2A71A 2JENA 1SPPA 4CP9B 3GZEA 3N9OA 3ZXEA 1MQTC 4FP3A 4P14A 1H1AA 5JI7A 1LOBA 4A41A 4CEWB 2VVEA 4CEYC 2EIDA 2RMU2 2JDUA 1S0DA 2RM21 1W9YA 1RUG3 3RWNA 1W3XA 2BNNA 2VZTA 2BGOA 4EN9B 4WVMB 1MS0A 2Q8CA 3LOBA 5AVPA 1AR91 5D8AB 2TBVA 2BQPA 3M70A 4YG6A 3ROUA 4CPBA 5EPAA 2VOTA 2P5BA 3RFRA 5KHIA 4YGDA 4BE3A 3Q8CA 2ARCA 1B35B 4EWDA 4XCBA 1WWYA 5FYIA 1V6IA 1XB9A 4GKYA 5GLWA 4Y1UA 3NAPB 3MW2A 2WZ8A 4AAPA 3VBOC 4CPBD 2Y8KA 4JC1A 1QJY2 1S55A 4OLLA 1JYNA 1BK0A 2G1MA 2LM3A 4FTEA 5F3IA 2DCZA 4A44A 1GU3A 4HFSA 2VCAA 2WFF2 4YPJA 1KFXL 1W04A 3M1HA 3BYJA 5JOYA 1JHNA 2G4IA 1NLQA 1PNGA 1W6PB 4XBLA 1UZWA 3GM8A 4MOAA 1ASJ1 1PGW1 1PVC1 1XNTA 1ZA4A 1DQ6A 4EN7B 1W99A 2YHJA 3DCQA 1KGYA 1XE0A 4FP2A 4I3PA 1G86A 1PO11 1F31A 3WNPA 1RTVA 3O1SA 1V9U3 4JQTA 4QD2A 3VBSA 3VKLA 3H50A 3NV2A 4JV4A 4OHWA 5CA6A 3WDTA 3J7MA 2ATFA 3QEFA 5A8CA 5FBJA 1ZBA1 1LGCA 2WSVA 2YDEA 4KWKA 3CL1A 4FPCA 2CNAA 1C8NA 4KMQA 2NPIA 3U4SA 4OYUA 2XJQA 4UW5A 4JGZC 4LO4B 4G9SB 5A3OA 2D6OX 3B69A 4TYSA 1VBA3 2P3KA 4IEYA 2QQVA 1S0GA 2KA3A 2JIGA 1OA2A 4KBZA 1TME3 3HEIA 3H7YA 2R041 3VV1A 3VDDC 4QXCA 4QAWA 1DLCA 2PTMA 2XLAA 3AZXA 3IPVA 1REDA 2VZPA 1I9RA 1WCKA 2LW8A 4NHYA 4AFBA 3C7GA 3RI8A 4BDVB 3THTA 5IVEA 2PLV3 4COTA 1KQRA 2BVBA 2DCJA 2WUHA 5L9BA 3H8UA 1OOPA 2WL1A 1I5PA 2HWB2 3ZM8A 5JIUA 1MZ5A 1OF4A 5DAWA 5A3MA 1R1A2 4LHSA 1O91A 3TEZA 3E5QA 2VVFA 2X10A 4CE8A 4IEOA 3TNPB 4NAMA 4E4HA 5CBLA 3A7QA 3EXUA 4Z82A 2VMFA 1LGNA 2V73A 4Y1VA 3SKVA 4QB1A 4AFAA 1HJFA 3WPVA 4BPZA 5CNAA 2H6BA 3RZLA 2RJLA 1DFQA 4YW4A 4NIGA 4FAHA 4D7YA 1GYHA 1C8M3 1KS4A 2ZGTA 2ET7A 4MHRA 5JZGC 1ZZCA 4QXHA 2CSGA 3T2OA 4BXFA 5A1AA 1LAJA 1VR3A 3AKSA 2MEV3 2B7YA 2HBTA 3PU3A 1NE6A 1GOHA 4KNCA 5GLKA 4E2SA 1UX6A 5FXXA 3T1LA 1HXS1 3WINE 1W8NA 1LNSA 2ZEXA 1D4M2 5GLLA 5FXVA 4AFMA 4W65A 2X5IC 3VZJA 1I1EA 2VGDA 5IWFA 3AKPA 4YFWA 1TZOA 1V9U2 3SCHA 4HKLA 3OB8A 1MS3A 2WS92 4XQ4A 3N7LA 1W0PA 1NCQA 1JZ3A 1OQ1A 4NRPA 3P1IA 3MIEA 4WVWA 1UMHA 3H3LA 5A32B 5C3PA 3A22A 2WDBA 2ZABA 4LTAA 2AH2A 4QPGB 1QQP2 5CU1A 3I2FA 2W5FA 4A2UA 2VO5A 1WGPA 2X8TA 5GALA 2ERFA 2GNBA 3M3QA 4ATEA 4F7ZA 5KXBA 4PDWB 3EO6A 3PJQA 1AHSA 3ZFEB 3MDPA 3WDVA 2Q8OA 3DYMA 2ZS6B 2DWRA 1ND3C 4HSLA 1SDWA 1ODNA 2VZ1A 5A1FA 4Q4V2 2XXZA 4IW3A 4Y5SA 5EHDA 2R49A 1DBNA 3LGRA 3ACGA 1RUNA 1FX5A 1UN1A 3TEXA 4LBOA 5A7OA 3T0BA 3FLRA 1UY1A 4CCJA 3PIJA 5KHGA 2WO3A 3ZFGB 4N43B 3J7HA 3KD4A 2PHTA 3ZN6B 4FO9A 4UW4A 1AR63 2E31A 1H8TC 2WWUA 1XYPA 3D82A 3GGLA 4CU7A 3OPZA 5CFCA 4AEJA 4XQWA 5FO8B 1PZ8A 2R0FA 3KT7A 5JSOA 1MQTB 1BEV3 2DUPA 4QM9A 2VBPA 4ISQA 4Y20B 3WN2A 1YYNA 2HWD3 1C8M2 1CAUB 2VM9A 1GSLA 4CEYB 3PHMA 5FOBB 4LULA 4RSUA 4E2QA 4I3GA 1CZSA 3OYWA 2A3XA 3B5LB 3OGSA 2OQ6A 4Q0SA 5GZEA 5FZ6A 5A6YA 1JBCA 1REFA 1CAXA 3APBA 5IK8A 1ASJ2 1CVNA 1PVC2 5FR3A 4Y1XA 4CU9A 1H2KA 4MGYE 2XBO1 4N8MA 4ZPIA 5GLQA 1ULCA 2ZHLA 2XDVA 4BWOA 1NQJA 1PO12 3RZZA 2XJPA 1SLAA 1WW7A 2PHWA 5FLHA 3VHNA 1OLMA 4AI2A 5AC91 3N7JA 1AR83 3EBRA 3VBOB 1K5MC 4NR1A 3VT0A 4BXSV 3RS6A 5AYEA 1FV2A 4QHOA 4D7SA 3M8LA 1JZ4A 3AKHA 1W2TA 3AMQA 5ACA3 5CKNA 3O7OA 3QBQA 4YNIA 5KWRA 2PA7A 4TZDA 2D3RA 5LATA 2Q1MA 2GC1A 1SFNA 4IE5A 1UY0A 1PX3A 4OHVA 1VAKA 4DFSA 4R52A 4CDUC 4FPOB 4Y4RA 4XJUA 2BP6A 4XCAA 5DQ0A 5APAA 2BBVA 2C24A 1WMFA 4CCCA 4DUXA 1ENXA 4R8HA 2P34A 1CZTA 1S0FA 1LHUA 5A6XA 1YQ6A 1IKPA 2BERA 2QTWB 4YZ1A 4XEZA 1OC1A 2VQ0A 3HIFA 3LPGA 1QJX1 3ZKYA 5FZ1A 3S7IA 4LBNA 2JG8C 3F2ZA 1IZ3A 1ND2A 1RUD3 3I3DA 4Y5Z0 5J37A 1YFUA 2VZOA 1W0NA 3MW3A 4D6SA 1UPSA 1W3VA 2KM2A 5FZCA 5C71A 3CJIA 4JGZB 4NWWA 5LCWL 3OOXA 1SEFA 4KC7A 2J42A 3J26N 5J3UA 4AHXA 4PCRA 1UY4A 2A3YA 5AFEA 5HV4A 5JLVA 3TOJA 3VUOA 5M0TA 3O1VA 1GZWB 3VDDB 2B4KA 3OBRA 4NE9A 4YZ3A 2GALA 2JDZA 2A6VA 3FMGA 1WCSA 3AP9A 3N9PA 4FFIA 5JI9A 2DCYA 5FYMA 1W6NA 1FXZA 5F3GA 5DAVA 3VZOA 1NXMA 3CNAA 3CZUA 3D5YA 4M4RA 1HXS2 3DXUA 3AP5A 1OURA 5FY8A 3I2JA 3MI8A 4TN7A 1AL21 4AEDA 1GOFA 4Y26A 1JYIA 1N47A 2QDNA 4A7YA 5FYVA 1S2EA 2Y33A 3LAGA 1AR82 3BU7A 5A7WA 2A6YA 2E7AA 5LBFA 3M3OA 4YYOA 4EROA 1VKDA 3AXEA 1RUJ3 3JD71 1PO21 2A7AA 4GQ7A 2R1BA 4BU2A 3EJKA 5JZGB 1OPMA 2I45A 5ACA2 1W6QA 5EJ3A 2BJSA 2FMYA 4X8NA 1Q8PA 5FWEA 4B4RA 1ZREA 1GNZA 5K8SA 2VNGA 4CCMA 4YM3A 3VT2A 4U36A 2Q5TA 5H9PA 5HCFA 2WA3A 3BOWA 5A7PA 3VHPA 1IGOA 1SZBA 4PT6A 4G3YC 3K4DA 5HPOA 1ZRIA 4E4ZA 4QMAA 5IHRA 1W18A 1K12A 3VKMA 5IK5A 2X5IB 4FQ4A 4I30A 2QQKA 3PVEA 5C70A 3AL6A 2F17A 4FPYA 3UGGA 4JDOA 4YW7A 1JZ7A 3DXTA 4I0BA 5DDJ2 4JGYA 3VB9A 4D6RA 4K3UA 4IEZA 5FCCA 4COUA 3LA7A 4YVWC 3WLUA 4YARA 3WP5A 4YW6A 3AK0A 4WBBA 5A3LA 5FZOB 3WSOA 1PK6A 5E1RA 3P5BA 4W4ZA 3DN7A 2JB8A 5B4XA 4TXWA 3RZKA 3I59B 3R4ZA 2R063 1HV1A 1FPN3 2Y0OA 2RS13 5A33A 3BODA 1WA4A 2WNUC 1R64A 5F6KA 2VW1A 5IVYA 2XONA 4W8JA 1ND3B 5CKMA 2Q0AA 3L2YA 3O1UA 1XNDA 3SEEA 1VBB3 5IFPA 3MPBA 2FCTA 3BPSA 3FZ3A 2R7EB 2YC4A 4QQOA 1I6XA 3USUA 2WQ8A 3FC0A 4GIQA 4CA9A 1BVP1 1DGWA 3MF9A 4EZHA 4AL9A 4IERA 1FOD3 1YJKA 3OG2A 4LOTA 1LENA 1MS1A 1RYYA 2XBO2 4QKBA 4A42A 4CP0A 3KV6A 4E4SA 3H7JA 1H8TB 4PQ9A 5KXCA 1UXZA 3ZIXA 5K4LA 3RJ2X 4GB31 5HV0A 5DZFA 1AZDA 2JDPA 1O3SA 1VP6A 2FQPA 2DUQA 5AC92 2JD9A 2OXBA 5FK8A 2ZPXA 4LLFA 4N90A 4YVSC 4XETA 1E5SA 5BNOC 3AMMA 3E6CC 3LQCA 4WV8A 5A7VB 4KBBA 4CRQA 1FMD3 3JCIA 5FV3A 4META 4OHYA 4KMIA 3ZX7A 2A1XA 3WPYA 2V5YA 3Q8BA 4CDQA 1O4YA 2GMPA 1CN1A 2KD7A 2QVSB 4XVHA 1WW6A 4P9GA 5HXMA 4M4PA 3WNNA 2HLEA 3EB7A 4QQ2A 4KC8A 2XJUA 1J84A 2PAEA 4UFIA 5FZIA 3LDBA 1IHMA 2RS51 2WAOA 2CGPA 1VE0A 3B9IA 1W8WA 2P2KA 1SLBA 2PHFA 2VBBA 1FYUA 1G6NA 1QJX2 2W87A 1K5MB 1VRH3 2X09A 1RB8G 1XU2A 2CDOA 3MBWA 1LODA 3DL3A 5C5UA 1IQAA 3HWJA 2NQYA 4X6QB 4DZGA 3ETPA 1RMU3 1MZ6A 3ILRA 4OUMA 2HWC3 4G4FA 5EWSA 1UXXX 2ZGKA 1Z7S3 1AX0A 5L7OC 5GLMA 4J25A 4ZU7A 3BYKA 5T5LA 3IBMA 2DVAA 1A8DA 3N7MA 4Q0VA 3I3MA 5C3OA 3JQXA 3S0MA 1VBB2 3WMYA 4QX3A 2ZGQA 1DGWX 1HRV1 3UKTA 1QHDA 1OUSA 1G7YA 1VMFA 1MR5A 2GNMA 2JG8B 1ZRRA 1H9PA 1OFNA 2IXHA 1WA6X 2VNOA 1W9WA 5GLUA 3VD7A 3BIEA 5E6HA 3T09A 3GBGA 2PMWB 2ZMLA 4NOVA 3K3OA 4Y22A 4KGGA 1H1IA 1H4HA 1R093 1AL22 4AR2A 4CCNA 1XU1A 1AXKA 4E2GA 4QU1A 3IAPA 2R071 5FXWA 4HG6B 1BKZA 4KQ7A 2DCKA 2OZ6A 1F4HA 4IQPA 3PVBB 5FZKA 5FZFA 1NA1C 2D40A 2OPWA 2OIIA 1PO22 2YBPA 3JD72 4JQRA 4Z2WA 2ZGNA 4FOVA 5C5TA 4LO8A 3DPRC 2Y26A 1NCRC 3AZYA 2W95A 1IS3A 2ZTNA 4K8RB 1C1FA 3U07A 2IVIB 1DYPA 5F6LB 3PJYA 3T3YA 5F1RA 3OY8B 3HMYA 3WD5A 4CXYA 1Y3TA 2WKKA 4XC9A 5AYCA 3NNJA 4WM8C 2EIGA 2BTVC 3S6PA 4A6OA 4QXBA 4DXTA 4IUGA 3I49A 2JECA 3R6SA 1MS9A 2DVBA 1UMIA 5E89A 1L7RA 1VRH2 2C5DA 1W28A 1LU1A 1ENQA 5HBAA 5FRAA 2E7TA 2NMOA 1DCSA 3VBFC 3KVBA 1LOAA 4M0HA 1EV13 4N53C 1LGBA 4LUKA 4FFGA 2VUDA 1QH6A 2IXJA 1XYOA 1GQHA 1ZBE3 2Z5WA 3IZOA 4UW3A 4ARYA 5KC5A 1PMJX 4ZU4A 4ZU5A 1Z7S2 5LBBA 3SC7X 3ZXGA 2A3WA 2B9VA 1VIWB 3LIHA 2K0GA 4M3CF 2WZPP 3S57A 1SCRA 3DECA 1H1MA 1JZ5A 1NZIA 1A6CA 3OM7A 1DZRA 4W6XA 1F5JA 4M01A 5ERLA 2ZGOA 4CCOA 4BJ0A 4UFJA 5KHHA 4RHV1 1RXFA 4W50A 3THPA 4AVTA 4EE2A 5D1IA 3TNQA 2WQZC 4YVWB 1QJY1 1RUC1 1ULEA 2IZWA 2E51A 1AR73 3N9QA 5F2SA 4JKKA 5DG1A 3I3BA 2BNMA 3N7KA 1R092 1UIJA 3Q9OA 1G8WA 4OI4A 5C4WA 3U75A 2J1AA 5C9AC 4QPIA 2RE9A 4GB32 1PM7A 2WNUB 1B09A 1RGSA 1W39A 2GMEA 1RINA 2QQPA 1RHI3 4F3JA 1OVPA 4KI5M 1H2NA 2B5HA 2FDIA 2VTXJ 1S2KA 2C6SA 2D5FA 4H14A 3V65A 1UQXA 4AFDA 4ZHNA 2VD7A 3GNEA 4YZ4A 5LW9A 1C57A 2AENA 2V5DA 2ZGSA 1PGSA 3ECQA 2K2SA 1QDOA 3J8F3 3LD8A 1IS5A 4BZ4A 1UOBA 2H0BA 1TEIA 5FMDA 5LY2A 3ZYFA 2BWAA 2ZHKA 5FPZA 4Q4X3 1WKYA 4CDUA 2JJ6A 2VR4A 1VBE2 4MGQA 3DV8A 3KB5A 1ZX5A 4IV3C 4UFLA 2RG4A 2PXJA 2RS52 5FYBA 4QX2A 3RZGA 1GQGA 1LHVA 2OUJA 4XFAA 4IDZA 3NV4A 1VLNA 5JXIA 3VBUA 1CAVB 2P3IA 4FXGB 4MHUA 1OSGA 1YJLA 3IIAA 4H7LA 3V0BA 4XIKA 4YVSB 3TN93 1DQ2A 5BNOB 1GZ9A 3OM4A 2UWBA 3RGBA 1NZCA 4D69A 5LA9A 2JDYA 3H9AA 1LHOA 5IVBA 2VE1A 1QNWA 3LB9A 5K0UA 2BYVE 4AQ6A 4EWAA 1J59A 5GLPA 4K9SA 4NROA 3KS7A 2WT1A 2WNEA 2EVXA 5F8PA 5FUNA 1EPZA 5FZ0A 3T4HB 4YM1A 1MEC3 2VUAA 3FHAA 2QQOA 3M7AA 1LR5A 1R1A1 4DXRA 3N9NA 3BPZA 5FMCA 1UWWA 2VZSA 1ZZ8A 1GNHA 4IEQA 5C8CC 1UKRA 1HW5A 3H8RA 1AR72 2BOJA 3M3IA 1ZYBA 4GJYA 1O3TA 2GC0A 2DBNA 4LXLA 5IK7A 3RI9A 3I3EA 4NWVA 2ZGLA 1A78A 1VMHA 1WMDA 4D7TA 1NT0A 3K51A 5L7OB 4L11A 1PNFA 1HIXA 1WBFA 2JE9A 1RHI2 5JVVA 4LJHA 5J98B 5LEKA 2VUCA 5F3EA 4XMIA 1UO9A 4LO7A 4O9GA 3E5UA 1QWRA 3JB8A 3INAA 1D4M1 1OKOA 2F4PA 1XE7A 2QZ3A 5AFBA 1ZZ9A 3AKFA 3H8XA 1PMHX 1V9U1 5ABJA 2WT0A 1RUI3 4YZ5A 3KVAA 1RUH3 3K48A 3VKFC 2WNOA 4A4AA 2IWGB 4BISA 4NPMA 3NO8A 3OM2A 4CP1A 3WY6A 1AL0G 1JOBA 1GWKA 4CDXA 4DINB 2GC2A 2Q1ZB 5FBZA 2X05A 2VQUA 1OLME 4QHZA 2G9GA 3HAGA 1JH5A 1SG3A 3H3UA 2E7QA 1EP0A 4PLMA 5FLIA 4FPLA 1QQP1 2K46A 4NJ4A 1AX1A 3POSA 2G9ZA 2BGPA 1Q8QA 4E4DX 5C7GA 3GZAA 3LDKA 1NA1B 2HWF3 5A80A 4DMIA 3R4DB 4LEJA 2DF7A 5CADA 5FLWA 1HB1A 5JOZA 4NAOA 1XPWA 4Q4V1 2XKOA 3DPRB 5C3RA 5I93A 1NCRB 4FCAA 1QJFA 5FYUA 4UDKA 2PLV1 1KEXA 3NKTA 1UZYA 2R32A 3WUDA 1HDKA 5LBCA 3ILFA 4FOWA 4LUMA 3CZJA 1MEC2 3FL7A 3AYCA 5CAZA 4WM8B 4NHKA 5A7NA 4MUVA 1LRHA 3R4YA 3AJZA 1JU3A 4BQXA 4RHV2 2XL9A 4JRAA 1X33A 1AYM3 1GICA 1W9SA 1A8MA 2XVGA 4RFT0 2MNGA 4ZS2A 2X53S 3VBFB 2GNTA 3A23A 4N53B 1YO8A 1RUC2 4OZXA 3CF6E 1C8M1 3LOIA 3A0KA 3D4KA 1UU5A 1SACA 2AEZA 2MEV1 4YM2A 5EV7A 1GWMA 3OM5A 3VBSC 1FATA 2Q1FA 5LASA 3ETQA 1YLLA 1U5XA 3CU7A 1RUF3 3MHZA 4IEUA 1MQTA 5FZ9A 4RGAA 5AY9A 3NJVA 3ZSEA 4CUGA 4KH9A 1COV2 1S4CA 4MLGA 5FY1A 2E53A 4NPLA 4WM7A 4XW3A 5FZEA 5BXXA 4CEYA 3B93A 4HANA 1L7QA 4N9IA 5FYCA 2ADDA 1JW6A 1HB2A 1ZA7A 3VHRA 4ISRA 1VAVA 2UYBA 4W6YA 1OVSA 1KRIA 2W1UA 2YV8A 3VKNA 2VCMA 2YFUA 4AWDA 4ONUA 4UT5A 3NJZA 2QQNA 5FPAA 5FJHA 5C9AB 1TMF3 3OCPA 4XBNA 2D6LX 2GN7A 3EHKA 5EZWA 4BB3A 3AJYA 4URAA 3FHIB 4GA9A 3BCWA 2OVUA 1OOPC 2QQWA 4R9AA 3ZYPA 3AP6A 3CEWA 2C0ZA 1OD5A 4AI8A 3OPTA 4HMZA 4HN1A 4HPKB 4OULA 1UU4A 2OYZA 2VNRA 1SFPA 1F8VA 4XYXA 1Q8VA 1RUG2 4Y24A 4HVRA 4UWDA 1AJKA 1Z0HA 3I8TA 4CZSA 3OPWA 4CSWA 4RL7A 4FFFA 3WF0A 2YGMA 2C1FA 2UU8A 2Q8EA 1EY2A 3SEPA 3V0AB 2PN5A 1YRZA 3NNFA 1BHGA 1ZNPA 2QNKA 5FY5A 1QEXA 1DHKB 4IV3B 2CGNA 4TLGA 3VL9A 4MXWA 3ZYGA 5IVJA 1CQ9A 1UY3A 5FKBA 2IXLA 3D0JA 3AP7A 3H1WA 4AE2A 3OBZA 5C0PA 3RYKA 1BEV1 4Q8LA 3I2OA 1JXNA 1UIKA 3BTYA 5SV8A 5FQ0A 2W47A 3NV1A 3SNMA 2VMCA 4GD4A 4HETA 3KMHA 1S2BA 1CJDA 4K40A 3U1XA 3VZLA 4AVCA 1O59A 1GKBA 2RM23 2R30A 3SHRA 3U10A 4NIHA 3LEIA 2Z42A 1JMUB 3BTAA 4JGZA 2F6BA 4JKLA 1RUF2 1UV4A 2D6KA 3WQ0A 3U4XA 4TSVA 4ET7A 4YZ2A 4BCUA 4CXXA 1UKGA 4CVUA 4RA0A 1R083 4ATFA 4Y5TA 3VSZA 1PIV3 2PHLA 2ZGRA 5DPNA 1AJOA 4UYBA 1VB4A 1NUKA 5G04L 3IAQA 5FZ7A 1AR81 4XILA 5LB6A 3LV4A 1HRI3 2WRAA 5C8CB 4AK7A 2ZKLA 3BGAA 4YW5A 4RYDA 4COVA 3O0XA 2WYSA 3RYPA 5J1XA 4HK9A 3GHMA 1W2NA 1MACA 1UNBA 2JDKA 4PLOA 1H6YA 4IEPA 5T3NA 2DYCA 1FAYA 3JUUA 4AEMA 3AZVA 5ACA1 1W9TA 4ITCA 3DF0A 2AEYA 3SLIA 4ES8A 5A3NA 2ZBJA 3QOPA 3OBAA 1VBA2 4X6RB 4CUAA 2D44A 4MO3M 3RZJA 2FDJA 4BIOA 2D6PA 1DYOA 1TME2 1NYWA 4X8PA 5CG8A 4XFGA 3ON7A 2VECA 1HJGA 1SPPB 3LKJA 2OX0A 5CFCC 4D47A 3T30A 3IB3A 1VBC3 5DDJ1 1RUD1 2BBAA 2PLV2 3E97A 4NOTA 2WR9A 3AM2A 3EYPA 3WNXA 5BNNC 2RS33 3H42B 3BOPA 4NMIA 3WF1A 4ASKA 2WJSA 1ZBA3 4Y1ZA 2DFBA 2Y6GA 3LFIA 3O5SA 4NHMA 2CHHA 4Q4Y3 4Z92B 3ZSMA 5FMOL 2P3JA 2OUHA 4XFIA 4XUTA 2YBSA 1MVQA 4QT6A 4LKEA 5GZGA 1POV1 4FPJA 4K6BA 5KBFA 2WYFA 2P6HA 2B45X 2XPJA 2XWBB 1D2QA 4BHPA 2X8FA 3WPUA 2VOXA 3AMHA 4QX8A 3WN1A 2A73B 3U0ZA 1X7NA 1Y9QA 3DKQA 1BYHA 4FXKB 4J6GA 4UAPA 5CYYA 1ZRDA 4CCLA 4RN5A 4OUSA 1MPXA 5JIAA 4NIIA 1N3OA 1JHJA 1IS6A 5FUPA 5JXJA 2YUEA 3RDIA 1JS9A 3ASIA 3FN9A 2MEV2 3T08A 5BNQA 5JMOA 3D61A 2UWCA 4LK6A 5J36A 1WCUA 5FMBA 2VQAA 2ZGMA 1KDMA 1DQ5A 1KD7A 4NUBA 4BK5A 3QEEA 2ARXA 4FPKA 2W1WA 4XJ9A 1PT2A 1AXYA 1C1LA 1GUIA 1PIV2 4LO5B 2C9KA 4PLNA 2CY6A 4N1IA 1YXWA 3DYPA 4AGGA 2YZ4A 3CHXA 1JUIA 4GALA 5E8AA 3VSFA 3ORJA 4JX0A 2WABA 1RUJ1 1D4VB 2PYTA 3AFKA 4N4BA 5DUVA 3KHBA 1ACCA 4F83A 2JD4A 1OLRA 5FXZA 2I2SA 4PBOA 2FHRA 5IFTA 3FX3A 3VBSB 2YFRA 1ND2C 4H3WA 3VDAA 2ETEA 3ZYHA 4ES9A 4CU6A 4LBQA 5FO9B 2GAUA 1JYXA 3VSSA 2UYAA 1W6MA 4XUQA 5LRSA 3JB4C 3R05A 3DYOA 1US2A 3ILNA 4MGKE 1BMV1 1JI6A 2EICA 3CJIC 2EXJA 3HR9A 3PMEA 5KXDA 2ZKNA 4XURA 5FZLA 4ZZ8A 4LBQD 4XAAA 2OA2A 2V72A 4QQHA 1E57A 5FIXA 5F37A 4LHLA 1I3HA 1JZ8A 3GCWA 3LIGA 3G6JB 3UJOA 1W03A 4XMAA 4AK3A 3IPVB 4Q4Y2 4M3CA 4A7KA 4YFZA 2QQUA 2UY8A 2ZZQA 3OGVA 5GLTA 3DGTA 3AFGA 5D21A 4YW1A 1CAWA 2R061 2W08A 2ZMNA 4C8DA 1Y4WA 1FPN1 1AR62 1W2AX 1DDLA 5FZHA 3WZ1A 2RS11 4DOUA 1OOPB 2GC3A 1KJRA 2ES3A 1KFUL 1A3KA 4LOSA 1BEV2 4PI0A 3SMHA 2VXRA 2VZUA 2EF6A 4DRVA 5FK7A 1V6NA 3OEAA 1VBB1 2HWD2 5KHKA 1VPHA 4BOWA 4JDNA 4MYEA 4Q5OA 5C33A 3K2OA 2WLQA 4LK7A 1O3RA 5LZ6A 1BVVA 3HN3A 5A3UA 1JYTA 4M00A 2YBKA 3HBZA 5FY9A 5FZ8A 1FOD1 2CGOA 2H0VA 1PZ9A 1S0EA 2CV6A 5FTTC 4Q4W3 3JBG3 1ULDA 3KF5A 3E6DA 2VBDA 3AMPA 3U78A 4AGVA 1US3A 3UGHA 1HN0A 5GZDA 2ZCWA 3ZR5A 1AYN3 2DBIA 1KS5A 3LFMA 2A6ZA 1X8EA 3MFCA 1Q3EA 4P02B 3WW4A 3VBRA 4RR3A 1KDKA 3HNMA 3UJQA 3OUJA 2WNVA 4TLFA 2BW8A 3IT8A 2P37A 5JR7B 1OH3A 2Y64A 2YFZA 5KR7A 1J1LA 1FMD1 5JMCA 1LOFA 3KSCA 5IK4A 5F7UA 2XHKA 4I0WB 3O0VA 4LBMA 2VAUA 5IUQA 5CFDA 3RRDA 3ZYIB 2RDRA 3O1RA 5BPXA 4QM8A 1QOSA 5FPLA 1X36A 4LE4A 1XNBA 5A3PA 1PK6C 3KLSA 2CTVA 1YIFA 4QPWA 3I2HA 1POV0 3WG3A 3WNMA 3C7HA 1UF2C 1UZZA 2Q30A 4KU7A 5FP7A 1MZEA 1WUVA 2YXSA 3NSTA 4DY3A 4UXAA 3AP4A 5A3WA 2ADEA 3MICA 5FKCA 4NPRA 1E5HA 1VRH1 3ZYJB 4AVBA 1YQ2A 1JUHA 1RUD2 4PBPA 1DU3D 2QCSB 4OMDA 1UZVA 5IJRA 3WX5A 2YFTA 3TEWA 1LECA 1H8VA 1W2UA 3BYWA 1BK1A 3L9JT 4RS5A 5FMOS 1JYCA 4LKDA 2HWC1 2H6CA 3WW1A 2O8OA 3K3NA 3MO4A 4I02A 1Z7S1 3QACA 4P9IA 4IGQA 3HQUA 2EALA 1CGPA 1SFYA 1HB4A 5FZGA 4CP2A 3N36A 2KR2A 3NNGA 2XJVA 3IN9A 2BRTA 2Z2SB 4GMP3 1GWLA 3WR0A 5CFCB 1P8JA 4LO6B 1YFWA 3WDYA 2W3JA 4UDJA 1BBT3 4QU2A 3LEGA 1ULPA 2QQIA 1XNAA 1ODMA 1YIPA 4BMBA 3W5MA 5BNNB 4COWA 4Q4W2 3JBG2 2WT2A 3OGRA 3U11A 4XFHA 1VBD3 4H55A 3ZDVA 2EIBA 1VB2A 1H9WA 4FOYA 4XF3A 3RWKX 4XJWA 2ZX4A 3VKOA 1R091 3OYWB 5B6SA 4XDQA 4KL1A 3D60A 4CDQC 3ZXJA 1S0BA 1CAXB 1CD3G 4N7UA 3WUCA 4Q0QA 4YM0A 2WWSA 3TYJA 1EAH3 4WVZA 5LY1A 2J1TA 3WF4A 4B29A 2VTFA 1C28A 4MXVA 3JZVA 1RUJ2 1IQDC 4GXLA 2ZHNA 1LOEA 2W68A 3HNYM 4URTA 3UL2A 3X29B 3ZFFA 4ZZ5A 3CU9A 3SKJE 1DQ1A 5C6CA 1YNAA 2A5ZA 1LTEA 2J1VA 5DMYA 1GYDB 5A1LA 3WNOA 1X9PA 4XF0A 2CAUA 3CJXA 1LCLA 2ID4A 2BGCA 2DFCA 3VHOA 3AXDA 5HCHA 1QY4A 4P9XA 4LORA 2O14A 1WW4A 3KQRA 3OD4A 2VC9A 1VBE1 1BMV2 4FVVA 1IPJA 4FPEA 1LHWA 4COZA 3ZMOA 4UFKA 5L9VA 2WO7A 2FDHA 5LBEA 4MV2A 3I4IA 3E6BA 3KZ4C 1ULFA 4XJAA 3POBA 1IKQA 3FE5A 5I8SA 5C3SA 3SXWA 3ACFA 1EV11 4OUEA 4K7JA 5FYSA 4Q8KA 1ZBE1 5FREA 1UMZA 4K8FA 4B8EA 1CX4A 2RR13 4HT1T 4L2NA 3VLBB 3B94A 2P4EA 4QWNA 1KJLA 1U12A 2R062 3TEYA 1ND2B 4N9HA 1FPN2 3QCWA 2RS12 4ZONA 4UDGA 2EXHA 5DN2A 5DAQA 2B46X 1FT9A 5BYNA 5LWBA 1GNYA 4PIXA 4UDKE 3CJIB 5DAXA 3KWVA 1LHNA 3FWEA 1QOOA 3U14A 1BBT2 1WCDJ 2JDHA 3BN6A 5IAXA 3WASA 3T1MA 1ULGA 1TG7A 2D93A 3AYEA 1FOD2 2NZ9A 1PX4A 4N2RA 3RYRA 4ASMB 1QNYA 2AZ5A 1AR71 2RDQA 3ZYRA 4CDQB 4I2OA 3NKGA 1W6OA 4QB2A 1SBDA 1HV0A 1Y43B 1BQPA 1W6NB 2EAAA 2TEPA 2YC0A 3GCXA 4HN0A 5AVAA 1YQ8A 2Q8DA 3ZSJA 5GLOA 1N1YA 4Q27A 4RFRB 4D3WA 5LA2A 1K45A 3ACHA 1RHI1 5BNPA 3KV5A 4CDWA 4BQ3A 3UV9A 4RQPA 3POJA 1QXJA 1BZWA 4XFFA 3WQ1A 2JG9C 2JE8A 3P2NA 5HXVA 5A7WB 5IAVA 1FMD2 5CEHA 3J8F1 3VD4A 4JKMA 4XABA 3A0NA 3BKZA 1QJZA 3WATA 5F5IA 4EJRA 1Y7BA 4ORFA 1FNZA 2J1UA 3PNAA 3PUIA 4CUCA 4Q4X1 2AACA 3MFAA 2IXIA 2NYYA 5IYYA 1W6QB 4FT8A 3GBFA 3WV6A 4XDPA 1O5UA 4J1WA 1MS8A 2WO2A 3MIFA 3IM0A 4P5HA 3FHQA 4XUPA 2CYFA 2ZX0A 1V6LA 3S5QA 4EN0A 3O14A 4GWMA 4LHKA 3MZHA 3WF2A 1RVF3 3H3ZA 4WZCA 5CVRA 1T2XA 2VZ3A 5FLJA 2UURA 3TWIA 3PU8A 4OQ9A 1RMU2 1REEA 4GH4A 2HWC2 4IV1A 2VQTA 3PUAA 3VBHA 1L7LA 3THDA 4AW7A 4FAGA 1SCSA 1GP6A 2VZVA 2VG9A 4V1PA 1PK6B 3ZLIA 4CP9A 1O8SA 4E8DA 3QZ4A 5DZGA 4P00B 5C4WC 4DPNA 1MEC1 3OUIA 2F4LA 2QJVA 3T0DA 4QPIC 4QHBA 5A33B 4CEWA 4I0AA 4CCDA 2R16A 3PVOA 3ACLA 3C8XA 1GQPA 2WSUA 3MF6A 5F5QA 1XQNA 3N4MA 1OMIA 2BFUL 4IE0A 4IL7A 4AQSA 2Y0IA 4WVMA 4FTBA 1U5IA 4F8AA 2DVFA 4IGOA 5FY0A 3WF3A 5D8AA 3USUB 3AMNA 4OFGA 4S2DA 1O4TA 5CISA 2GSYA 3BALA 2X8KA 1JZ2A 3E5XA 1AXZA 2HJIA 1B35A 1D0HA 1BLZA 1V6MA 3HQXA 4OHXA 4L0PA 1UD1A 2XLGA 1UPIA 4KWLA 2XQXA 1TVGA 3QH6A 5FZMA 2ORZA 4AEKA 1H30A 3NAPA 3N9MA 1COV1 2B39A 3IDEA 4Q1PA 2WLPA 3KCXA 4L8QA 3THCA 1RUI1 2IXKA 2WBKA 5J09A 5HCAA 1CONA 3J4UH 3VBUC 2FDFA 4KWJA 2VPVA 4QXKA 3ZXDA 1W8UA 4MG2A 2VMGA 3RSJA 5FOJB 4QQSA 1W6PA 1M06G 2E6VA 3MEPA 1JYVA 3W5NA 4LBKA 4KCAA 1XBFA 2KXLA 1QH7A 3MLJA 1K5JA 1UYZA 3NV3A 3LSDA 4XACA 2C4XA 3B9CA 2PQSA 4ZXKA 5K0UC 3S5AA 3D3AA 5F39A 2R073 2P3YA 2Y6KA 1RUE3 2BUKA 2YPJA 3IMMA 3UKVA 1NAEA 5B4NA 4C0BA 3I2DA 2HWF1 2DCTA 3ATGA 4UBHA 5GLVA 1KITA 2BZDA 3WHTA 2PELA 1EV12 1DIWA 2DVGA 2NN8A 4CU8A 4CUBA 1N1TA 1ENSA 1S0JA 4AVSA 1ZBE2 4H7MA 1UU6A 1RUG1 2GH2A 5LEJA 4XF9A 4PHZA 5LK5A 5GLRA 2CDPA 3GHNA 3ZXFA 1JN2P 1W8TA 1AX2A 2W9XA 2QQLA 1QJU3 2WINB 4OQ8A 4QDSA 4W6WA 2HWE3 4XXAA
chains in the Genus database with same CATH topology
5A8DA 3SEPA 4QX1A 3F2ZA 3I3DA 3WQBA 1YRZA 1BHGA 2W46A 2VZOA 1W0NA 1JU4A 2WAAA 4OMCA 3MV11 1UY3A 5FKBA 4LKSA 5C71A 5C0PA 5LCWL 2QQMA 4KC7A 2E26A 1UY4A 1UYYA 2W47A 2VMCA 1GOGA 3VD5A 3WEZA 3LEMA 1O59A 3QC2A 3JXSA 2B4KA 3LEIA 1NX9A 4JKLA 1UV4A 4QDQA 4FFIA 4GZ9A 2Y6JA 4ET7A 3VD9A 2WZEA 3CZUA 4CVUA 1DP0A 2EXKA 4M4RA 3D5YA 3VSZA 4A3ZA 5DPNA 3I2JA 4QX0A 1NUKA 5G04L 3ZXKA 1GOFA 3IAQA 3LV4A 5JXGA 4AK7A 4O8PA 2WO1A 3BGAA 4RYDA 5JXHA 2WYSA 4AK6A 4BK4A 5J1XA 1VKDA 2J1EA 1H6YA 3P6BA 3VDBA 2ZEWA 1W9TA 3QEDA 2AEYA 2RVAA 4UI9L 3OBAA 4CUAA 5FUIA 2W94A 4MO3M 1Y9GA 4XZUG 3VT2A 2EIEA 4O8NA 1OF3A 1DYOA 4PT6A 3WNLA 4DEQA 3K4DA 4MADA 4QDRA 5HPOA 2ZEYA 2E33A 5IHRA 1W18A 1K12A 3T2PA 3I2KA 1UX7A 2QQKA 5C70A 4D47A 4UDIA 2J22A 3IB3A 3UGGA 3VSRA 2BBAA 1J83A 1JZ7A 3EYPA 2W1QA 3UETA 3WF1A 3ABZA 3KSTA 4FI9A 2Y6GA 3LFIA 3OM6A 4ONZA 3WSOA 4XUTA 2V4VA 4W4ZA 1H6XA 5B4XA 4TXWA 3R4ZA 2X8FA 3K4AA 3WPUA 3WMZA 2J7MA 3E1F1 3LDRA 2VDTA 3WN1A 5ANNA 1R64A 3LE0A 2XONA 4Z2AA 4UAPA 1D7PM 5CYYA 2RJ2A 4W8JA 4O8OA 4RN5A 1MPXA 1JHJA 3SEEA 5IFPA 4E8CA 5JXJA 3T08A 3FN9A 5JMOA 3D61A 2J1RA 2R7EB 2YC4A 3GXUA 5JOXA 2WQ8A 5FMBA 4BK5A 3QEEA 2W1WA 2ORXA 3ZXLA 1PT2A 2VL4A 3OG2A 1GUIA 2C9KA 2WN3A 3MUZ1 1RYYA 4A42A 4N1IA 3DYPA 4A45A 1UXZA 1GMMA 1O8PA 4JX0A 3VSFA 2WABA 4P08A 2JD9A 4N4BA 2OXBA 5FK8A 1GYEB 2C26A 3CKHA 3LQCA 5IFTA 2YFRA 5A7VB 3CDZB 1OYGA 3VDAA 4CU6A 4XUOA 1JYXA 4KMIA 3VSSA 2VCBA 3WPYA 4XVHA 2VCCA 2KD7A 2VJXA 3MV01 4XUQA 5HXMA 3DYOA 1US2A 4MGSA 4M4PA 1JI6A 2EICA 1F4AA 3WNNA 2HLEA 2EXJA 3NJXA 3EB7A 3NQHA 4KC8A 4XURA 4ZZ8A 1J84A 3U37A 1WL7A 4KCBA 3I97A 2V72A 2VZRA 2WAOA 5FIXA 2VMDA 3AC0A 1UYXA 4P5YA 1JZ8A 3LIGA 2J1SA 2W87A 2ZXQA 1UYPA 2X09A 2CDOA 5B6TA 3MBWA 2QQUA 3OGVA 3K1UA 4U6DA 2YG0A 3HJRA 1Y4WA 3PUHA 2W91A 4ARXA 3KF3A 3ETPA 2YC2A 3UGFA 3CMGA 1UXXX 4ZXEA 2VZUA 3WPZA 5GLMA 2B4WA 3BYKA 5FK7A 3OEAA 3T2QA 2L9LA 3A21A 3WMYA 3ACIA 3LF7A 4QX3A 3HN3A 1ULOA 2HYXA 5AYDA 2JKXA 5G05L 2QQJA 3KF5A 4ZY9A 2Z4FA 4DXSA 1US3A 3UGHA 1W9WA 3VD7A 3T09A 4NOVA 5LA1A 3C7EA 2QBXA 4AAXA 4P02B 3R67A 3IAPA 3HNMA 4HG6B 3MUY1 5JOWA 3CIHA 1WCQA 3VDCA 2DCKA 1F4HA 2DDUA 2Y64A 2YFZA 3T0AA 4OZOA 1SDDB 4AK5A 5F7UA 1UY2A 1OD3A 3K77A 5EIYB 2W95A 1EUUA 4QPWA 2Y6LA 3I2HA 1YIFA 3WNMA 3PIGA 3K4ZA 3C7HA 3C7FA 3NRUA 3LPFA 1K3IA 2Y6HA 5AYCA 3IIIA 3BYNA 2ADEA 4A6OA 5FKCA 4DXTA 3BYLA 4IUGA 3HNBM 1YQ2A 1UMIA 1L7RA 3I2GA 4OMDA 1JYWA 5EJZB 5IJRA 2YFTA 4DUWA 3OEBA 4FFGA 4ARYA 3MO4A 2E32A 4A41A 1PMJX 2XOMA 2EIDA 4PF1A 3SC7X 2VZTA 2B9VA 3NNGA 3LIHA 2BGOA 3DECA 1EUTA 1K42A 1P8JA 1JZ5A 2W3JA 4UDJA 3OM7A 3LEGA 1ULPA 2QQIA 1XNAA 2VOTA 4BJ0A 3W5MA 1HN1A 4W50A 3D5ZA 3WAUA 3OGRA 2EIBA 3RWKX 4DEVA 2WZ8A 5B6SA 2Y8KA 1CZVA 1JYNA 3D60A 4JKKA 3ZXJA 3I3BA 3U75A 3VT1A 4A44A 2J1AA 1GU3A 3HOBA 2VCAA 4TTGA 2J1TA 4YPJA 3WF4A 2VTFA 4LPLA 3BYJA 1IQDC 4LQRA 3HNYM 5JOYA 4ZZ5A 4KI5M 3GM8A 4MOAA 3SKJE 3CU9A 1XNTA 2J1VA 5DMYA 1GYDB 3WNOA 3HPNA 1W99A 1KGYA 2V5DA 2ID4A 3ECQA 3WNPA 2JDAA 4U6BA 2VC9A 5FMDA 1WKYA 5A7VA 2VR4A 4MGQA 5A8CA 3QEFA 4QX2A 1OH4A 4KMQA 3UNPA 4PVIA 3K46A 5JXIA 4OYUA 3ACFA 3C7OA 4OUEA 2WN2A 3OM4A 2QQVA 2EXIA 3HEIA 2X8SA 4UDGA 4QAWA 2EXHA 5DN2A 1DLCA 2VZPA 2LW8A 5GLPA 1GNYA 4UDKE 3C7GA 4BDVB 4COTA 2WUHA 2DCJA 3U14A 3BN6A 2VZQA 3FHAA 3WASA 2QQOA 1I5PA 3ZM8A 4DXRA 1TG7A 1OF4A 5FMCA 4LHSA 1JZ6A 1UWWA 1PX4A 2VZSA 4N2RA 2X10A 3CQOA 2XQRA 4QB2A 3A7QA 2VMFA 3SKVA 4QB1A 3WPVA 5GLOA 3I3EA 2ZEZA 5LA2A 1GYHA 1K45A 3ACHA 5I0DA 5EJ1B 3T2OA 5A1AA 1GOHA 3GDBA 5GLKA 3AKGA 2JE8A 3P2NA 4GWIA 4JHZA 4XUNA 3WN0A 4QB6A 4GWJA 1W8NA 3VD4A 4JKMA 3AKFA 1LNSA 2ZEXA 1PMHX 4KWUA 5GLLA 3WATA 4FFHA 1Y7BA 2J1UA 3PUIA 4AG4A 4CUCA 4A4AA 5IYYA 5JR2A 1CIYA 3OM2A 3OB8A 1CX1A 1JZ3A 2X05A 2VQUA 1OT5A 2WO2A 2VMEA 4D0QA 3P1IA 2LS6A 1SG3A 1UMHA 3FHQA 4XUPA 3A22A 2WDBA 4DUVA 3WF2A 2BGPA 3I2FA 2W5FA 5C7GA 2VO5A 1T2XA 2VZ3A 2X8TA 3LDKA 1SHWB 5FLWA 2VQTA 5JOZA 3DYMA 1XPWA 3THDA 1XC6A 2VZVA 1UZ0A 2W1SA 2VZ1A 5GLNA 4UDKA 1KEXA 3WNKA 1O8SA 4E8DA 3QZ4A 4P00B 3ACGA 3CZJA 3T0DA 3T0BA 3FL7A 2YB7A 1UY1A 3PIJA 2WO3A 3C8XA 1GQPA 1ST8A 3J7HA 4PQQA 5JUVA 3R4YA 1NKGA 1JU3A 3LEKA 3GGLA 2E31A 1W9SA 4CU7A 3WF3A 4N2ZA 3A23A 4PVAA 3WN2A 3K75B 1JZ2A 2AEZA 2VM9A 3OM5A 4L0PA 2XQXA 1TVGA 2ORZA 3IDAA 1CZSA 3VD3A 1Y9MA 3OGSA 5AY9A 3NJVA 3THCA 2WBKA 5LA0A 4MLGA 4CU9A 2RV9A 2OKXA 1YI7A 5GLQA 1L7QA 5CZKA 4QQSA 2ADDA 4UOJA 3TAWA 1JYVA 3W5NA 4KCAA 2W1UA 4EQVA 2AC1A 1UYZA 2YFUA 2C4XA 2PQSA 3VT0A 3D3AA 2QQNA 4BXSV 2Y6KA 5AYEA 4D8MA 2YFSA 1JZ4A 1NAEA 3AKHA 5B4NA 1W2TA 3UESA 3C2UA 1W8OA 2QQWA 2BZDA 4CU8A 2W92A 4CUBA 1UY0A 1PX3A 5DQ0A 3I2IA 4DUXA 5GLRA 1CZTA 2CDPA 3AKIA 2XHNA 2BERA 2QQLA 2W9XA 4QDSA 3LPGA 3WF0A 4FFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A8D A;  3SEP A;  4QX1 A;  3F2Z A;  3I3D A;  3WQB A;  1YRZ A;  1BHG A;  2W46 A;  2VZO A;  1W0N A;  1JU4 A;  2WAA A;  4OMC A;  3MV1 1;  1UY3 A;  5FKB A;  4LKS A;  5C71 A;  5C0P A;  5LCW L;  2QQM A;  4KC7 A;  2E26 A;  1UY4 A;  1UYY A;  2W47 A;  2VMC A;  1GOG A;  3VD5 A;  3WEZ A;  3LEM A;  1O59 A;  3QC2 A;  3JXS A;  2B4K A;  3LEI A;  1NX9 A;  4JKL A;  1UV4 A;  4QDQ A;  4FFI A;  4GZ9 A;  2Y6J A;  4ET7 A;  3VD9 A;  2WZE A;  3CZU A;  4CVU A;  1DP0 A;  2EXK A;  4M4R A;  3D5Y A;  3VSZ A;  4A3Z A;  5DPN A;  3I2J A;  4QX0 A;  1NUK A;  5G04 L;  3ZXK A;  1GOF A;  3IAQ A;  3LV4 A;  5JXG A;  4AK7 A;  4O8P A;  2WO1 A;  3BGA A;  4RYD A;  5JXH A;  2WYS A;  4AK6 A;  4BK4 A;  5J1X A;  1VKD A;  2J1E A;  1H6Y A;  3P6B A;  3VDB A;  2ZEW A;  1W9T A;  3QED A;  2AEY A;  2RVA A;  4UI9 L;  3OBA A;  4CUA A;  5FUI A;  2W94 A;  4MO3 M;  1Y9G A;  4XZU G;  3VT2 A;  2EIE A;  4O8N A;  1OF3 A;  1DYO A;  4PT6 A;  3WNL A;  4DEQ A;  3K4D A;  4MAD A;  4QDR A;  5HPO A;  2ZEY A;  2E33 A;  5IHR A;  1W18 A;  1K12 A;  3T2P A;  3I2K A;  1UX7 A;  2QQK A;  5C70 A;  4D47 A;  4UDI A;  2J22 A;  3IB3 A;  3UGG A;  3VSR A;  2BBA A;  1J83 A;  1JZ7 A;  3EYP A;  2W1Q A;  3UET A;  3WF1 A;  3ABZ A;  3KST A;  4FI9 A;  2Y6G A;  3LFI A;  3OM6 A;  4ONZ A;  3WSO A;  4XUT A;  2V4V A;  4W4Z A;  1H6X A;  5B4X A;  4TXW A;  3R4Z A;  2X8F A;  3K4A A;  3WPU A;  3WMZ A;  2J7M A;  3E1F 1;  3LDR A;  2VDT A;  3WN1 A;  5ANN A;  1R64 A;  3LE0 A;  2XON A;  4Z2A A;  4UAP A;  1D7P M;  5CYY A;  2RJ2 A;  4W8J A;  4O8O A;  4RN5 A;  1MPX A;  1JHJ A;  3SEE A;  5IFP A;  4E8C A;  5JXJ A;  3T08 A;  3FN9 A;  5JMO A;  3D61 A;  2J1R A;  2R7E B;  2YC4 A;  3GXU A;  5JOX A;  2WQ8 A;  5FMB A;  4BK5 A;  3QEE A;  2W1W A;  2ORX A;  3ZXL A;  1PT2 A;  2VL4 A;  3OG2 A;  1GUI A;  2C9K A;  2WN3 A;  3MUZ 1;  1RYY A;  4A42 A;  4N1I A;  3DYP A;  4A45 A;  1UXZ A;  1GMM A;  1O8P A;  4JX0 A;  3VSF A;  2WAB A;  4P08 A;  2JD9 A;  4N4B A;  2OXB A;  5FK8 A;  1GYE B;  2C26 A;  3CKH A;  3LQC A;  5IFT A;  2YFR A;  5A7V B;  3CDZ B;  1OYG A;  3VDA A;  4CU6 A;  4XUO A;  1JYX A;  4KMI A;  3VSS A;  2VCB A;  3WPY A;  4XVH A;  2VCC A;  2KD7 A;  2VJX A;  3MV0 1;  4XUQ A;  5HXM A;  3DYO A;  1US2 A;  4MGS A;  4M4P A;  1JI6 A;  2EIC A;  1F4A A;  3WNN A;  2HLE A;  2EXJ A;  3NJX A;  3EB7 A;  3NQH A;  4KC8 A;  4XUR A;  4ZZ8 A;  1J84 A;  3U37 A;  1WL7 A;  4KCB A;  3I97 A;  2V72 A;  2VZR A;  2WAO A;  5FIX A;  2VMD A;  3AC0 A;  1UYX A;  4P5Y A;  1JZ8 A;  3LIG A;  2J1S A;  2W87 A;  2ZXQ A;  1UYP A;  2X09 A;  2CDO A;  5B6T A;  3MBW A;  2QQU A;  3OGV A;  3K1U A;  4U6D A;  2YG0 A;  3HJR A;  1Y4W A;  3PUH A;  2W91 A;  4ARX A;  3KF3 A;  3ETP A;  2YC2 A;  3UGF A;  3CMG A;  1UXX X;  4ZXE A;  2VZU A;  3WPZ A;  5GLM A;  2B4W A;  3BYK A;  5FK7 A;  3OEA A;  3T2Q A;  2L9L A;  3A21 A;  3WMY A;  3ACI A;  3LF7 A;  4QX3 A;  3HN3 A;  1ULO A;  2HYX A;  5AYD A;  2JKX A;  5G05 L;  2QQJ A;  3KF5 A;  4ZY9 A;  2Z4F A;  4DXS A;  1US3 A;  3UGH A;  1W9W A;  3VD7 A;  3T09 A;  4NOV A;  5LA1 A;  3C7E A;  2QBX A;  4AAX A;  4P02 B;  3R67 A;  3IAP A;  3HNM A;  4HG6 B;  3MUY 1;  5JOW A;  3CIH A;  1WCQ A;  3VDC A;  2DCK A;  1F4H A;  2DDU A;  2Y64 A;  2YFZ A;  3T0A A;  4OZO A;  1SDD B;  4AK5 A;  5F7U A;  1UY2 A;  1OD3 A;  3K77 A;  5EIY B;  2W95 A;  1EUU A;  4QPW A;  2Y6L A;  3I2H A;  1YIF A;  3WNM A;  3PIG A;  3K4Z A;  3C7H A;  3C7F A;  3NRU A;  3LPF A;  1K3I A;  2Y6H A;  5AYC A;  3III A;  3BYN A;  2ADE A;  4A6O A;  5FKC A;  4DXT A;  3BYL A;  4IUG A;  3HNB M;  1YQ2 A;  1UMI A;  1L7R A;  3I2G A;  4OMD A;  1JYW A;  5EJZ B;  5IJR A;  2YFT A;  4DUW A;  3OEB A;  4FFG A;  4ARY A;  3MO4 A;  2E32 A;  4A41 A;  1PMJ X;  2XOM A;  2EID A;  4PF1 A;  3SC7 X;  2VZT A;  2B9V A;  3NNG A;  3LIH A;  2BGO A;  3DEC A;  1EUT A;  1K42 A;  1P8J A;  1JZ5 A;  2W3J A;  4UDJ A;  3OM7 A;  3LEG A;  1ULP A;  2QQI A;  1XNA A;  2VOT A;  4BJ0 A;  3W5M A;  1HN1 A;  4W50 A;  3D5Z A;  3WAU A;  3OGR A;  2EIB A;  3RWK X;  4DEV A;  2WZ8 A;  5B6S A;  2Y8K A;  1CZV A;  1JYN A;  3D60 A;  4JKK A;  3ZXJ A;  3I3B A;  3U75 A;  3VT1 A;  4A44 A;  2J1A A;  1GU3 A;  3HOB A;  2VCA A;  4TTG A;  2J1T A;  4YPJ A;  3WF4 A;  2VTF A;  4LPL A;  3BYJ A;  1IQD C;  4LQR A;  3HNY M;  5JOY A;  4ZZ5 A;  4KI5 M;  3GM8 A;  4MOA A;  3SKJ E;  3CU9 A;  1XNT A;  2J1V A;  5DMY A;  1GYD B;  3WNO A;  3HPN A;  1W99 A;  1KGY A;  2V5D A;  2ID4 A;  3ECQ A;  3WNP A;  2JDA A;  4U6B A;  2VC9 A;  5FMD A;  1WKY A;  5A7V A;  2VR4 A;  4MGQ A;  5A8C A;  3QEF A;  4QX2 A;  1OH4 A;  4KMQ A;  3UNP A;  4PVI A;  3K46 A;  5JXI A;  4OYU A;  3ACF A;  3C7O A;  4OUE A;  2WN2 A;  3OM4 A;  2QQV A;  2EXI A;  3HEI A;  2X8S A;  4UDG A;  4QAW A;  2EXH A;  5DN2 A;  1DLC A;  2VZP A;  2LW8 A;  5GLP A;  1GNY A;  4UDK E;  3C7G A;  4BDV B;  4COT A;  2WUH A;  2DCJ A;  3U14 A;  3BN6 A;  2VZQ A;  3FHA A;  3WAS A;  2QQO A;  1I5P A;  3ZM8 A;  4DXR A;  1TG7 A;  1OF4 A;  5FMC A;  4LHS A;  1JZ6 A;  1UWW A;  1PX4 A;  2VZS A;  4N2R A;  2X10 A;  3CQO A;  2XQR A;  4QB2 A;  3A7Q A;  2VMF A;  3SKV A;  4QB1 A;  3WPV A;  5GLO A;  3I3E A;  2ZEZ A;  5LA2 A;  1GYH A;  1K45 A;  3ACH A;  5I0D A;  5EJ1 B;  3T2O A;  5A1A A;  1GOH A;  3GDB A;  5GLK A;  3AKG A;  2JE8 A;  3P2N A;  4GWI A;  4JHZ A;  4XUN A;  3WN0 A;  4QB6 A;  4GWJ A;  1W8N A;  3VD4 A;  4JKM A;  3AKF A;  1LNS A;  2ZEX A;  1PMH X;  4KWU A;  5GLL A;  3WAT A;  4FFH A;  1Y7B A;  2J1U A;  3PUI A;  4AG4 A;  4CUC A;  4A4A A;  5IYY A;  5JR2 A;  1CIY A;  3OM2 A;  3OB8 A;  1CX1 A;  1JZ3 A;  2X05 A;  2VQU A;  1OT5 A;  2WO2 A;  2VME A;  4D0Q A;  3P1I A;  2LS6 A;  1SG3 A;  1UMH A;  3FHQ A;  4XUP A;  3A22 A;  2WDB A;  4DUV A;  3WF2 A;  2BGP A;  3I2F A;  2W5F A;  5C7G A;  2VO5 A;  1T2X A;  2VZ3 A;  2X8T A;  3LDK A;  1SHW B;  5FLW A;  2VQT A;  5JOZ A;  3DYM A;  1XPW A;  3THD A;  1XC6 A;  2VZV A;  1UZ0 A;  2W1S A;  2VZ1 A;  5GLN A;  4UDK A;  1KEX A;  3WNK A;  1O8S A;  4E8D A;  3QZ4 A;  4P00 B;  3ACG A;  3CZJ A;  3T0D A;  3T0B A;  3FL7 A;  2YB7 A;  1UY1 A;  3PIJ A;  2WO3 A;  3C8X A;  1GQP A;  1ST8 A;  3J7H A;  4PQQ A;  5JUV A;  3R4Y A;  1NKG A;  1JU3 A;  3LEK A;  3GGL A;  2E31 A;  1W9S A;  4CU7 A;  3WF3 A;  4N2Z A;  3A23 A;  4PVA A;  3WN2 A;  3K75 B;  1JZ2 A;  2AEZ A;  2VM9 A;  3OM5 A;  4L0P A;  2XQX A;  1TVG A;  2ORZ A;  3IDA A;  1CZS A;  3VD3 A;  1Y9M A;  3OGS A;  5AY9 A;  3NJV A;  3THC A;  2WBK A;  5LA0 A;  4MLG A;  4CU9 A;  2RV9 A;  2OKX A;  1YI7 A;  5GLQ A;  1L7Q A;  5CZK A;  4QQS A;  2ADD A;  4UOJ A;  3TAW A;  1JYV A;  3W5N A;  4KCA A;  2W1U A;  4EQV A;  2AC1 A;  1UYZ A;  2YFU A;  2C4X A;  2PQS A;  3VT0 A;  3D3A A;  2QQN A;  4BXS V;  2Y6K A;  5AYE A;  4D8M A;  2YFS A;  1JZ4 A;  1NAE A;  3AKH A;  5B4N A;  1W2T A;  3UES A;  3C2U A;  1W8O A;  2QQW A;  2BZD A;  4CU8 A;  2W92 A;  4CUB A;  1UY0 A;  1PX3 A;  5DQ0 A;  3I2I A;  4DUX A;  5GLR A;  1CZT A;  2CDP A;  3AKI A;  2XHN A;  2BER A;  2QQL A;  2W9X A;  4QDS A;  3LPG A;  3WF0 A;  4FFF A; 
#chains in the Genus database with same CATH topology
 4JAA A;  5H9R A;  3GJB A;  3J7N A;  3O1T A;  1TQ5 A;  3PDQ A;  1J3R A;  2NP0 A;  1AYM 1;  2ZAH A;  3MV1 1;  4AYU A;  1RIR A;  4LKS A;  4IEV A;  4AHZ A;  3USS A;  3Q8F A;  3WP3 A;  5A6Q A;  2XUM A;  4JZR A;  2E26 A;  2XKP A;  3O1O A;  5ABJ C;  2ZOE B;  2RMU 3;  1POQ A;  2HEW F;  3VD5 A;  5A6Z A;  2YU2 A;  3MIH A;  3LEM A;  3POE A;  4XAE A;  3JXS A;  3QC2 A;  1RUF 1;  4PJY A;  4FPG A;  4CDX C;  1NX9 A;  4I01 A;  4XQD A;  2YPD A;  4FQZ A;  4O61 A;  4QDQ A;  4Y22 B;  1G9D A;  4QPY A;  4XHX A;  3VD9 A;  3LCP A;  5JSP A;  5EP9 A;  4K1Z A;  4CTE A;  3J8F 2;  4A3Z A;  3AKR A;  2GP5 A;  1BCX A;  4BQW A;  1QJY 3;  3CLP A;  4R9C A;  2SLI A;  2WO1 A;  4YG0 A;  4Q4X 2;  2ZX2 A;  3ZN4 A;  5JXH A;  1O4Z A;  4BK4 A;  4AK6 A;  1X9T A;  2HH9 A;  3CBN A;  3LA2 A;  2WFF 3;  4AI3 A;  1N1S A;  2J1E A;  3P6B A;  3VDB A;  1ZZ7 A;  4MGT A;  3AX4 A;  4HON A;  1VBA 1;  3QED A;  5DZE A;  3OGJ A;  4XZP A;  3AYD A;  5JPN B;  4UI9 L;  2HKX A;  1S0C A;  5FUI A;  2BWC A;  3TN9 2;  1TME 1;  1Y9G A;  1OUX A;  2W94 A;  4XZU G;  4AXO A;  2CWM A;  2EIE A;  2AUY A;  2JG9 B;  3B02 A;  1OF3 A;  2DU0 A;  5FZA A;  5IT6 A;  3IDB B;  1S0I A;  2VH9 A;  1DGL A;  4MH0 E;  4BQ4 A;  2ZEY A;  3O0W A;  1WLW A;  2E33 A;  5IVC A;  5A32 A;  3DKW A;  2PHR A;  3N9L A;  3I2K A;  3T2P A;  1UX7 A;  4QKF A;  2CWS A;  5BUV A;  3PTY A;  4QPG A;  4UDI A;  2JKB A;  1O6U A;  2FBE A;  1W0O A;  2J22 A;  3KV9 A;  1LES A;  3M2M A;  5F5A A;  4AVV A;  4PDW A;  2W1Q A;  1EYB A;  3UET A;  3ZFE A;  4FTS A;  3ABZ A;  3KST A;  1SLI A;  1UL9 A;  3OM6 A;  2ZGP A;  4ONZ A;  2BVV A;  4M3C E;  2D97 A;  1C3H A;  3B00 A;  2GH8 A;  2A70 A;  2BFU S;  3ITQ A;  4OCT A;  3O1M A;  4QKN A;  1PMI A;  3OSD A;  4BM8 A;  5I0S A;  3WMZ A;  4WM7 C;  5FPX A;  3E1F 1;  4JVA A;  5A7Q A;  3WG2 A;  1LU2 A;  1LOC A;  4E27 A;  1J3P A;  1MS5 A;  1IOA A;  4N43 A;  3ZFG A;  3KV4 A;  3T2T A;  3WG4 A;  4Z2A A;  5FJK A;  3ZN6 A;  4O8O A;  2IXC A;  2YYO A;  1SQ4 A;  5DUU A;  5ISL A;  4LT5 A;  3GXU A;  2WA4 A;  3NNM A;  1U0A A;  1BJQ A;  3SH3 A;  3WVJ A;  4OI0 A;  5C4W B;  1R08 1;  2HWB 3;  1IPK A;  5T50 A;  4XJZ A;  4Y20 A;  2O8Q A;  4NRM A;  3ZIW A;  5C8W A;  1E5R A;  4QPI B;  1PIV 1;  1O5L A;  1R1A 3;  3ZXL A;  3TBD A;  4A3X A;  2GZW A;  3ZKU A;  1CJP A;  3WCR A;  4B1L A;  4EYU A;  1CAU A;  1RUI 2;  3FBY A;  4UF0 B;  4XBQ A;  1RUH 2;  2ZHM A;  2WN3 A;  1HRI 1;  3QLQ A;  3MUZ 1;  1UOJ A;  2B42 B;  3H1Y A;  5DAB A;  2RJK A;  2OW4 A;  3LA3 A;  1GMM A;  1O8P A;  1ZVF A;  5D2A A;  4P08 A;  5KC6 A;  3FJS A;  3H8O A;  5BV6 A;  3O1P A;  1TNR A;  1V6O A;  2C26 A;  1GYE B;  2EAK A;  2IVJ A;  3W58 A;  3WDW A;  3CKH A;  1NXD 1;  2WZR 3;  1OQE A;  4CDU B;  2BDR A;  1OYG A;  5FY7 A;  4I09 A;  5DUW A;  3VBO A;  2HWF 2;  2WC2 A;  3PL0 A;  1D4M 3;  2VCB A;  3N35 A;  3BVC A;  5I8T A;  1ENR A;  2VCC A;  2VJX A;  3MV0 1;  1W9F A;  3GZT B;  1W8F A;  3PLQ A;  3BTZ A;  3VBU B;  3W9A A;  2JWP A;  4QGM A;  3W21 A;  3V0B B;  3NQH A;  1D2S A;  2WS9 3;  1HX6 A;  1VBC 1;  4HOO A;  4R4Z A;  4UW6 A;  1DGR A;  5K7P A;  4KCB A;  5GZC A;  5KHJ A;  2VZR A;  2RS3 1;  4JTN A;  5HCB A;  4IE6 A;  5T5O A;  3OGG A;  3S7E A;  2BV4 A;  1ZRF A;  1CPM A;  2JDN A;  2VMD A;  3AB0 A;  1UYX A;  3AC0 A;  3NMB A;  4P5Y A;  4Q4Y 1;  3WG1 A;  1HKD A;  2J1S A;  2ZXQ A;  4HKW A;  3R4U A;  4JRL A;  1LB2 A;  2E63 A;  5K0U B;  1AR6 1;  1QQP 3;  1DQ0 A;  1DZT A;  2NMN A;  2YG0 A;  1AYM 2;  2GDF A;  3FUQ A;  3HJR A;  4FPF A;  3SCF A;  5JAX A;  2W91 A;  4ARX A;  4BQY A;  2XVL A;  4S2F A;  2WFP A;  3LZZ A;  3CMG A;  2ZX3 A;  5EQU A;  1PZ7 A;  2HWD 1;  5A3T A;  2CU5 A;  4KGQ A;  4Q4V 3;  3HQR A;  1Z78 A;  2R6Q A;  2B9U A;  5FYZ A;  5FZ4 A;  1G9A A;  1XRU A;  1NCQ C;  2DU1 A;  3ACI A;  3J9S A;  3LF7 A;  2HYX A;  1LKN A;  1SBE A;  1ULO A;  1H4G A;  2GND A;  1QOT A;  1EPW A;  2BU9 A;  4EN6 B;  4P9Y A;  1AR9 3;  4XE9 A;  3WHU A;  2QQJ A;  4KU8 A;  2JIJ A;  1V0A A;  1URX A;  4ZY9 A;  5FPU A;  1GZW A;  3VDD A;  3FLT A;  5LK7 B;  1N1V A;  1PGL 1;  4AGR A;  1NY7 2;  1V70 A;  3ELN A;  4ZS3 A;  2E9Q A;  2IFW A;  1DF0 A;  3RG0 A;  3FBM A;  5LA1 A;  2FDK A;  3C7E A;  4Y33 A;  2QBX A;  3IKW A;  4LHN A;  3FUO A;  5T52 A;  4IE4 A;  4L97 A;  3PUS A;  5F32 A;  4A6S A;  3R67 A;  2VOK A;  3NL1 A;  3MUY 1;  5ABJ B;  3CIH A;  1WCQ A;  5J96 B;  5JOW A;  1Q8O A;  2PHU A;  1WZX A;  2DDU A;  5FYT A;  1GFF 2;  1TMF 2;  2ARE A;  2MPF A;  3T0A A;  1HQN A;  3MIB A;  2WZR 2;  4IEW A;  4CDX B;  5L36 A;  1SDD B;  2DTY A;  5T54 A;  3VZM A;  4AQT A;  4AK5 A;  1ASJ 3;  1PVC 3;  2XGX A;  4GKX A;  4GWN A;  4LA2 A;  4V2W A;  1WBL A;  5E88 A;  5FYH A;  4ASL A;  3IMN A;  3VZN A;  3K77 A;  4JHT A;  1W90 A;  3ALQ A;  4L9B A;  4ZKT B;  1W2O A;  3OTF A;  3T4V A;  2DUO A;  1EUU A;  3PIG A;  2Y6L A;  1YFX A;  3RZH A;  1PO1 3;  3K4Z A;  3C7F A;  2UWA A;  3LPF A;  5FDB A;  5JZG A;  1K3I A;  2D3S A;  4PIZ A;  1T6B X;  1JOJ A;  1LEM A;  3III A;  2OS2 A;  3QD6 A;  4R9D A;  1QF3 A;  2XL7 A;  4AI9 A;  4PIY A;  3I2G A;  4DB5 A;  1JYW A;  5EJZ B;  1H2L A;  4AVA A;  2X5I A;  4DUW A;  3EQE A;  2GMM A;  2XG3 A;  4R4X A;  3DUI A;  1DQ4 A;  3OF1 A;  4LIT A;  4V2V A;  1W05 A;  2D5H A;  3OEB A;  3MLL A;  1OQD A;  2E32 A;  2XOM A;  1GZT A;  1G9C A;  3KGZ A;  2LRO A;  1QIQ A;  1QDC A;  4PF1 A;  4PF5 A;  1OA4 A;  5F5C A;  2R04 3;  2W2I A;  3B7M A;  3SH4 A;  5FZO A;  2RM2 2;  1CPN A;  5L19 A;  4FSJ A;  4R9B A;  1PM4 A;  1IG3 A;  1YEW A;  5GM0 A;  5EYX A;  3ZN5 A;  1EUT A;  3PTR B;  1K42 A;  3I59 A;  1APN A;  1OFS A;  2XML A;  3RMY A;  2OQ7 A;  2QDR A;  1TL2 A;  4Q4W 1;  3JBG 1;  1AR9 2;  5T5P A;  3I3Q A;  1XJA A;  4QX7 A;  1HN1 A;  5FPV A;  3D5Z A;  3WAU A;  4O7X A;  1G9F A;  4Q1R A;  1RL3 A;  3VGI A;  1R08 2;  2GN3 A;  2VOW A;  4DO0 A;  1ND3 A;  1QKQ A;  1AYN 1;  1XXN A;  1YWK A;  1WMX A;  1NG0 A;  3OD0 A;  4DEV A;  2R1D A;  2VMI A;  4XF1 A;  1CZV A;  4DNY A;  1HRI 2;  3VT1 A;  4YG3 A;  1GAN A;  5BNN A;  1ONA A;  3HN1 A;  3HOB A;  4TTG A;  4C0H A;  2XB6 C;  4WM7 B;  3W59 A;  4LPL A;  4CCK A;  1VAM A;  5A7S A;  4LQR A;  4GAZ A;  4OVE A;  1LOG A;  5CB7 A;  4AI1 A;  3BI3 A;  1VRB A;  2UY9 A;  1CR7 A;  3KT1 A;  1H8T A;  2Z69 A;  3AL5 A;  2A6W A;  3JU9 A;  1PGW 2;  3TB0 A;  3R4S A;  3A4U A;  5I0U A;  3HPN A;  1A34 A;  3LSE A;  1XE8 A;  2GU9 A;  4U2A A;  3AKQ A;  1HXS 3;  1J58 A;  2JDA A;  2GP3 A;  4U6B A;  5L73 A;  5FYY A;  3J7L A;  4PI2 A;  2FD8 A;  2G9F A;  3HD8 B;  2Y38 A;  5A7V A;  3WW2 A;  2XUE A;  3IWZ A;  1VBC 2;  3JQW A;  5L9R A;  1H2M A;  3KCY A;  3AZZ A;  2RS3 2;  3POF A;  1OH4 A;  3B3Q E;  3UNP A;  1ZBA 2;  4PVI A;  2A75 A;  3K46 A;  3R0R A;  4KG8 A;  2QFE A;  2FZ2 A;  3C7O A;  4XTP A;  4LE3 A;  4B3N A;  5A70 A;  4QGL A;  2WN2 A;  4XDO A;  2JXA A;  3TAY A;  2QE3 A;  3ENR A;  4QX5 A;  2EXI A;  2ZMK A;  3ZSL A;  4IEX A;  2PQQ A;  4NN0 A;  3F95 A;  1U5Y A;  2X8S A;  3NW4 A;  2Y6F A;  5FFO C;  3M3E A;  2ILM A;  1K5M A;  4MXW B;  2LRP A;  4B7E A;  2R04 2;  4GMP 1;  1WLC A;  2EA7 A;  4AED C;  1BBT 1;  1M4W A;  1XSQ A;  3M3C A;  3D5O A;  4C91 A;  3VBR C;  1N3Q A;  4RR3 C;  2PFW A;  2XVK A;  2VZQ A;  5DDJ 3;  5FQ0 B;  5J48 A;  2WNV C;  4HZF A;  3BUC A;  2BPA 2;  3FFZ A;  1VBD 1;  4FPH A;  4EN8 B;  4L99 A;  3D0S A;  4COY A;  3AVS A;  1F5F A;  5JCT A;  2ZAA A;  1GR3 A;  1V00 A;  1JZ6 A;  3RMX A;  1LOF C;  3CQO A;  3WDU A;  3SIT A;  2XQR A;  2HEV F;  5CFD C;  1WLD A;  1POV 3;  1PGL 2;  5I8Y A;  4DY5 A;  5C2M A;  4Z1V A;  3RPQ A;  1EAH 1;  2IFR A;  1UAI A;  1R1Z A;  1WME A;  4L92 A;  1XNC A;  2ZEZ A;  4JCK A;  2JG8 A;  1YCI A;  3RVH A;  5I0D A;  2LUW A;  3GJA A;  5EJ1 B;  1RIT A;  1JOD A;  3M4F A;  4BQ2 A;  2CAV A;  2VUJ A;  3WOG A;  1RUO A;  4B7K A;  2D3P A;  4AF9 A;  3GDB A;  3AKG A;  1NCQ B;  4GWI A;  4JHZ A;  4XUN A;  4JGY C;  3WN0 A;  4RGK A;  4QB6 A;  4GWJ A;  3N3H A;  4LBL A;  2IC1 A;  4KWU A;  1MS4 A;  4FFH A;  3D8C A;  1YUD A;  2VUL A;  4RS5 C;  3AYA A;  5EFU A;  4AG4 A;  2XBO 3;  2HYK A;  5JR2 A;  1CIY A;  2D6M A;  2D43 A;  4LNV A;  3UT0 A;  4DRR A;  1CX1 A;  2VW0 A;  5EXO A;  1UW8 A;  4LR4 A;  1YC6 1;  4HLT A;  4YRD A;  3AKT A;  1OT5 A;  1MZF A;  1QJE A;  2VME A;  4RD7 A;  4AOC A;  4A7Z A;  4D0Q A;  5AC9 3;  5FAX A;  2LS6 A;  4S2H A;  1V6K A;  4DIQ A;  4XHB A;  1DGR N;  1HQL A;  3BTX A;  4DUV A;  1HB3 A;  1HQW A;  2RR1 1;  4NIA A;  3OY8 A;  2XJR A;  1F9K A;  3H1M A;  4N7I A;  4C90 A;  2JEM A;  1RMU 1;  2A6X A;  5FO7 B;  1ZM1 A;  3ES1 A;  1SHW B;  1ZRC A;  1X50 A;  3S30 A;  1PHM A;  2VMH A;  1XC6 A;  1UZ0 A;  2W1S A;  2PHD A;  4BA6 A;  5GLN A;  2I07 B;  1UOG A;  3WNK A;  1XNK A;  3KM5 A;  3GZU C;  3BU0 A;  4HVQ A;  4AQ2 A;  5B2G B;  4DS0 A;  3GF6 A;  1W06 A;  5DXD A;  4XPV A;  1QJX 3;  2YB7 A;  2WQ4 A;  2W0X A;  4WVV A;  2ARB A;  4NRQ A;  1ST8 A;  3ZFF C;  4PQQ A;  5JUV A;  1NKG A;  1C5H A;  2RHP A;  3LEK A;  3POI A;  4LIV A;  1ZZB A;  1IS4 A;  2FDG A;  4YLZ A;  1O7F A;  1L3J A;  4BLJ A;  1AYN 2;  4N2Z A;  4O9E A;  4SBV A;  4YW3 A;  4PVA A;  5FZB A;  1FNY A;  3OBT A;  4YGB A;  2ZAC A;  3ZOI A;  4Y4Y A;  3K75 B;  3RZM A;  4YGC A;  3WW3 A;  1T6G C;  4QQP A;  4YVW A;  2V09 A;  4MZU A;  1AUY A;  3IDC B;  4C1W A;  4D94 A;  3IDA A;  3LWC A;  5IW0 A;  3VD3 A;  2R0H A;  1Y9M A;  4IE7 A;  4MX3 A;  3W20 A;  5F2W A;  5ANQ A;  3OJB A;  3SH5 A;  2HBU A;  3ZXA C;  1RJ7 A;  4CXW A;  5FPB A;  3HBK A;  5LA0 A;  1W8H A;  3WT3 A;  2RV9 A;  2OKX A;  1YI7 A;  4YWA A;  1RXG A;  2WNU A;  2VY0 A;  4GUL A;  5CZK A;  4Z07 A;  1CES A;  1E5I A;  1GP5 A;  2MHF A;  4KG0 A;  4UOJ A;  2OPK A;  4JDM A;  2AR6 A;  4MSV A;  1LUL A;  1AL2 3;  4HL0 A;  4NVP A;  2W52 A;  3TAW A;  4LBQ B;  3NNL A;  4EQV A;  2AC1 A;  3MGU A;  1W6M B;  4GMP 0;  3POW A;  3Q8E A;  2QZ2 A;  4K1Y A;  5I0T A;  1SMV A;  3D6E A;  3G7D A;  4D8M A;  3ZSK A;  2YFS A;  4OI1 A;  1RVF 1;  4XIO A;  3UES A;  3JD7 3;  1PO2 3;  1SBF A;  3C2U A;  1W8O A;  4JTO A;  4UFH A;  1NOV A;  2W92 A;  1YQ5 A;  4HK8 A;  5DAP A;  2Y60 A;  1G9B A;  3WCS A;  3P3N A;  1Q56 A;  1JOP A;  1QMJ A;  4H2A A;  5CIR A;  3H0O A;  2BNO A;  4M3C B;  5GKA C;  3I2I A;  5I91 A;  1WD3 A;  5JSR A;  1CAV A;  1NQD A;  1TE1 B;  2Z79 A;  2XHN A;  3AKI A;  1CAW B;  2DVD A;  4YVS A;  3GAL A;  5BNO A;  3VN4 A;  4GJZ A;  1IPS A;  3MID A;  4BQ1 A;  5A8D A;  4QX1 A;  1V6J A;  5BNP C;  2SBA A;  1WLT A;  3WQB A;  2W46 A;  1GZC A;  4J1X A;  4CDW C;  1OKQ A;  4BME A;  1JU4 A;  2WAA A;  4NHX A;  4RQP C;  1DLL A;  2CL2 A;  1GBG A;  4OMC A;  1VBD 2;  4YGE A;  4DQA A;  2ZJC A;  1OHF A;  1AVB A;  3ZPO A;  2PHX A;  3ZO0 B;  4Y3O A;  2QQM A;  3NWK A;  3WP4 A;  3SCG A;  1OXC A;  1UYY A;  4OHZ A;  5FP8 A;  1GOG A;  3UKN A;  3WEZ A;  4FBF A;  4AFC A;  2QUO A;  1EAH 2;  4C1X A;  3EMR A;  1DYK A;  5F9T A;  3WXP A;  3VZK A;  4D6Q A;  3GYD A;  2FCV A;  2QKD A;  5FP4 A;  2TUN A;  3MPP G;  4AED B;  3SQO A;  1QXR A;  3C3V A;  3V56 A;  4GZ9 A;  3SIS A;  1GV9 A;  2IUW A;  4B4Q A;  2Y6J A;  4BLI A;  2N7G A;  3KQ4 B;  4Q0U A;  3VBR B;  1DG6 A;  2TNF A;  2WZE A;  4RR3 B;  1W8Z A;  4DXZ A;  3NVC A;  2WNV B;  2NLR A;  1DP0 A;  3HVD A;  5BY5 A;  2EXK A;  2D98 A;  3MIG A;  4LMF A;  3KGL A;  5K9Y A;  5L7O A;  1D0G A;  1ZZ6 A;  3WDX A;  2ZGU A;  1YQC A;  4QX0 A;  5FWJ A;  3ZXK A;  1NE4 A;  1F35 A;  5FP3 A;  4EWE A;  5JXG A;  2ENR A;  3URF A;  4O8P A;  4LA3 A;  2B8M A;  5DUX A;  4GH4 C;  5H9S A;  4IV1 C;  5CFD B;  4HSJ A;  3VBH C;  4HXC A;  2P6C A;  2DUR A;  1RUE 1;  4GB3 3;  4UBG A;  3PUQ A;  2XWJ B;  5IAT A;  5JPM B;  5HI0 A;  2ZEW A;  2XJT A;  2YGL A;  4XOG A;  1LED A;  1YI9 A;  3TN9 1;  2RVA A;  4HBN A;  3HT1 A;  1U5Z A;  4IGP A;  5SV5 A;  1OPO A;  4CEW C;  2XR4 A;  3MW4 A;  2RR1 2;  1OLQ A;  3NJY A;  3CO2 A;  4CYD A;  4O8N A;  1JTZ X;  5FZD A;  3WNL A;  4BH9 A;  4JGY B;  1PVX A;  4FOQ A;  5GJ6 A;  3POY A;  4QQL A;  4QDR A;  4MAD A;  4XFC A;  4DEQ A;  5EYY A;  1QJU 1;  3ME2 A;  1MVE A;  3ZDS A;  2RDS A;  2HWE 1;  4RS5 B;  5D8A C;  4YW2 A;  1F2N A;  1VBE 3;  3VSR A;  2P17 A;  3O12 A;  1NA1 A;  1J83 A;  1GP4 A;  2JG9 A;  4Z8B A;  4MGZ E;  2RS5 3;  1FV3 A;  2I74 A;  3AZW A;  1B35 C;  4FI9 A;  2ZZJ A;  4AI0 A;  3BYL A;  3DPR A;  1X8M A;  2BOI A;  1LJ7 A;  1NCR A;  2V4V A;  3NAP C;  2PAK A;  5KXE A;  1H6X A;  2G19 A;  2RMU 1;  4BIF A;  3K4A A;  4Y1Y A;  3RQ0 A;  3RJR A;  1SLC A;  4RGG A;  2J7M A;  4WM8 A;  3LDR A;  5F3C A;  2VDT A;  3KCC A;  4E9K A;  3I54 A;  3POG A;  5ANN A;  3LE0 A;  1H0B A;  3ES4 A;  3PUR A;  1D7P M;  2RJ2 A;  1DZQ A;  1Q43 A;  4LIU A;  2XH6 A;  4E8C A;  1I5Z A;  4IET A;  4P9J A;  4S2G A;  2J1R A;  5JOX A;  4WZF A;  5C3Q A;  3VBF A;  4N53 A;  1YHF A;  1ALY A;  1X82 A;  4UFM A;  1HRV 3;  1RUH 1;  2ORX A;  4NID A;  2VL4 A;  3ZFF B;  3KT4 A;  2LTN A;  2VW2 A;  2YU1 A;  4O65 A;  5IVF A;  4AZZ A;  3PMS A;  4A45 A;  3ZMN A;  5CG9 A;  4TWT A;  4MGI E;  3MLK A;  3ST7 A;  2WFF 1;  3V64 A;  5GLZ A;  1OBN A;  3UYJ A;  3MYX A;  3ZYB A;  1QXP A;  2OZJ A;  2D6N A;  4NHL A;  2JIC A;  4UF0 A;  1NLS A;  5FY4 A;  4EV0 A;  3TRS B;  1WD4 A;  3UK9 A;  1S1A A;  1IG0 A;  3CDZ B;  2ET1 A;  1RVF 2;  2HEY F;  4LBJ A;  1C5I A;  2D7F A;  4XTM A;  2JE7 A;  4XUO A;  1J1T A;  2Q4S A;  2YRO A;  3FFQ A;  4IES A;  1KXG A;  4LLO A;  2AYH A;  2DV9 A;  4MGS A;  3HT2 A;  1F4A A;  5C9A A;  2ZX1 A;  2P1B A;  2XJS A;  3NJX A;  4K20 A;  5FP9 A;  3BIW E;  2YMZ A;  3U37 A;  4QGN A;  4BYY A;  1WL7 A;  4P9L A;  2C9A A;  3I97 A;  4IND A;  3P3P A;  5FZ3 A;  1F15 A;  4HPK A;  4CCE A;  5TSW A;  2JDM A;  2BEO A;  1FI2 A;  1UYP A;  1BXH A;  1Q5O A;  2JB4 A;  2JX9 A;  1NLR A;  1YFY A;  5B6T A;  3K1U A;  1Q8S A;  2FMD A;  1CWP A;  4U6D A;  1VAL A;  3I7D A;  2K9Z A;  3PVN A;  1GLH A;  3PUH A;  3Q8A A;  4XJ8 A;  4NO4 A;  3KF3 A;  2YC2 A;  5T55 A;  3UGF A;  3V0A A;  4ZXE A;  2ARA A;  5J7M A;  4HVO A;  3WPZ A;  3ZPY A;  2ZA9 A;  4IV3 A;  1O3Q A;  2B4W A;  2YY1 A;  1GYK A;  1RJ8 A;  1VMJ A;  1AF9 A;  2WII B;  2AGS A;  4EZ4 A;  3AVR A;  4B1M A;  2RDN A;  1N3P A;  2FZ1 A;  4P9W A;  2L9L A;  2PAM A;  3A21 A;  1W6O B;  5CKQ A;  3T2Q A;  4B4P A;  3B01 A;  2HWB 1;  5AYD A;  2FCU A;  1XOY A;  5I0R A;  1OI6 A;  1RC6 A;  2JKX A;  5G05 L;  1HRV 2;  4M0N A;  2OT7 A;  5H9Q A;  2VVD A;  1VJ2 A;  2Y34 A;  1NY7 1;  5BNP B;  4LKF A;  4CDW B;  4RHV 3;  4XF4 A;  2Z4F A;  4DXS A;  1TNF A;  1J3Q A;  2LAL A;  4RQP B;  2VOV A;  4YSF A;  4QKD A;  1UCX A;  4BQ5 A;  5JDB A;  2XLF A;  5LRR A;  4AHW A;  4MLO A;  1UOF A;  1RUC 3;  2VU9 A;  4AAX A;  2V4A A;  4XFB A;  5IVV A;  4Q2F A;  2DTW A;  1QGL A;  4Q0P A;  1STM A;  1WW5 A;  3ZR6 A;  1TMF 1;  3FLP A;  4AHY A;  2VTX A;  3GBW A;  3VDC A;  2R07 2;  3OUH A;  4QPG C;  3WQ7 A;  1RUE 2;  2WWJ A;  2WZR 1;  3KHC A;  1HLC A;  3QH7 A;  2VXJ A;  3WP6 A;  1SLL A;  4HKO A;  4OZO A;  4PDW C;  5T5J A;  3VL8 A;  3ZFE C;  1UY2 A;  3ZVX A;  1SLT A;  4Q26 A;  5C8C A;  1COV 3;  4XXP A;  1XYN A;  1OD3 A;  5E16 A;  5EIY B;  4IXL A;  2WS9 1;  3RNS A;  5JWP A;  1CIW A;  3DEM A;  2NM1 A;  3BB6 A;  3NRU A;  1XSR A;  2Y6H A;  4SLI A;  1QJU 2;  1OA3 A;  3BYN A;  2HWE 2;  5DG2 A;  5GZF A;  3ZFG C;  4N43 C;  4K21 A;  2VNV A;  4GH4 B;  2O1Q A;  2X29 A;  3HNB M;  4IV1 B;  3VBH B;  4Q29 A;  2O0O A;  1QU0 A;  2W39 A;  1C4R A;  4MVT A;  4OI2 A;  3L2H A;  2A71 A;  2JEN A;  1SPP A;  4CP9 B;  3GZE A;  3N9O A;  3ZXE A;  1MQT C;  4FP3 A;  4P14 A;  1H1A A;  5JI7 A;  1LOB A;  4A41 A;  4CEW B;  2VVE A;  4CEY C;  2EID A;  2RMU 2;  2JDU A;  1S0D A;  2RM2 1;  1W9Y A;  1RUG 3;  3RWN A;  1W3X A;  2BNN A;  2VZT A;  2BGO A;  4EN9 B;  4WVM B;  1MS0 A;  2Q8C A;  3LOB A;  5AVP A;  1AR9 1;  5D8A B;  2TBV A;  2BQP A;  3M70 A;  4YG6 A;  3ROU A;  4CPB A;  5EPA A;  2VOT A;  2P5B A;  3RFR A;  5KHI A;  4YGD A;  4BE3 A;  3Q8C A;  2ARC A;  1B35 B;  4EWD A;  4XCB A;  1WWY A;  5FYI A;  1V6I A;  1XB9 A;  4GKY A;  5GLW A;  4Y1U A;  3NAP B;  3MW2 A;  2WZ8 A;  4AAP A;  3VBO C;  4CPB D;  2Y8K A;  4JC1 A;  1QJY 2;  1S55 A;  4OLL A;  1JYN A;  1BK0 A;  2G1M A;  2LM3 A;  4FTE A;  5F3I A;  2DCZ A;  4A44 A;  1GU3 A;  4HFS A;  2VCA A;  2WFF 2;  4YPJ A;  1KFX L;  1W04 A;  3M1H A;  3BYJ A;  5JOY A;  1JHN A;  2G4I A;  1NLQ A;  1PNG A;  1W6P B;  4XBL A;  1UZW A;  3GM8 A;  4MOA A;  1ASJ 1;  1PGW 1;  1PVC 1;  1XNT A;  1ZA4 A;  1DQ6 A;  4EN7 B;  1W99 A;  2YHJ A;  3DCQ A;  1KGY A;  1XE0 A;  4FP2 A;  4I3P A;  1G86 A;  1PO1 1;  1F31 A;  3WNP A;  1RTV A;  3O1S A;  1V9U 3;  4JQT A;  4QD2 A;  3VBS A;  3VKL A;  3H50 A;  3NV2 A;  4JV4 A;  4OHW A;  5CA6 A;  3WDT A;  3J7M A;  2ATF A;  3QEF A;  5A8C A;  5FBJ A;  1ZBA 1;  1LGC A;  2WSV A;  2YDE A;  4KWK A;  3CL1 A;  4FPC A;  2CNA A;  1C8N A;  4KMQ A;  2NPI A;  3U4S A;  4OYU A;  2XJQ A;  4UW5 A;  4JGZ C;  4LO4 B;  4G9S B;  5A3O A;  2D6O X;  3B69 A;  4TYS A;  1VBA 3;  2P3K A;  4IEY A;  2QQV A;  1S0G A;  2KA3 A;  2JIG A;  1OA2 A;  4KBZ A;  1TME 3;  3HEI A;  3H7Y A;  2R04 1;  3VV1 A;  3VDD C;  4QXC A;  4QAW A;  1DLC A;  2PTM A;  2XLA A;  3AZX A;  3IPV A;  1RED A;  2VZP A;  1I9R A;  1WCK A;  2LW8 A;  4NHY A;  4AFB A;  3C7G A;  3RI8 A;  4BDV B;  3THT A;  5IVE A;  2PLV 3;  4COT A;  1KQR A;  2BVB A;  2DCJ A;  2WUH A;  5L9B A;  3H8U A;  1OOP A;  2WL1 A;  1I5P A;  2HWB 2;  3ZM8 A;  5JIU A;  1MZ5 A;  1OF4 A;  5DAW A;  5A3M A;  1R1A 2;  4LHS A;  1O91 A;  3TEZ A;  3E5Q A;  2VVF A;  2X10 A;  4CE8 A;  4IEO A;  3TNP B;  4NAM A;  4E4H A;  5CBL A;  3A7Q A;  3EXU A;  4Z82 A;  2VMF A;  1LGN A;  2V73 A;  4Y1V A;  3SKV A;  4QB1 A;  4AFA A;  1HJF A;  3WPV A;  4BPZ A;  5CNA A;  2H6B A;  3RZL A;  2RJL A;  1DFQ A;  4YW4 A;  4NIG A;  4FAH A;  4D7Y A;  1GYH A;  1C8M 3;  1KS4 A;  2ZGT A;  2ET7 A;  4MHR A;  5JZG C;  1ZZC A;  4QXH A;  2CSG A;  3T2O A;  4BXF A;  5A1A A;  1LAJ A;  1VR3 A;  3AKS A;  2MEV 3;  2B7Y A;  2HBT A;  3PU3 A;  1NE6 A;  1GOH A;  4KNC A;  5GLK A;  4E2S A;  1UX6 A;  5FXX A;  3T1L A;  1HXS 1;  3WIN E;  1W8N A;  1LNS A;  2ZEX A;  1D4M 2;  5GLL A;  5FXV A;  4AFM A;  4W65 A;  2X5I C;  3VZJ A;  1I1E A;  2VGD A;  5IWF A;  3AKP A;  4YFW A;  1TZO A;  1V9U 2;  3SCH A;  4HKL A;  3OB8 A;  1MS3 A;  2WS9 2;  4XQ4 A;  3N7L A;  1W0P A;  1NCQ A;  1JZ3 A;  1OQ1 A;  4NRP A;  3P1I A;  3MIE A;  4WVW A;  1UMH A;  3H3L A;  5A32 B;  5C3P A;  3A22 A;  2WDB A;  2ZAB A;  4LTA A;  2AH2 A;  4QPG B;  1QQP 2;  5CU1 A;  3I2F A;  2W5F A;  4A2U A;  2VO5 A;  1WGP A;  2X8T A;  5GAL A;  2ERF A;  2GNB A;  3M3Q A;  4ATE A;  4F7Z A;  5KXB A;  4PDW B;  3EO6 A;  3PJQ A;  1AHS A;  3ZFE B;  3MDP A;  3WDV A;  2Q8O A;  3DYM A;  2ZS6 B;  2DWR A;  1ND3 C;  4HSL A;  1SDW A;  1ODN A;  2VZ1 A;  5A1F A;  4Q4V 2;  2XXZ A;  4IW3 A;  4Y5S A;  5EHD A;  2R49 A;  1DBN A;  3LGR A;  3ACG A;  1RUN A;  1FX5 A;  1UN1 A;  3TEX A;  4LBO A;  5A7O A;  3T0B A;  3FLR A;  1UY1 A;  4CCJ A;  3PIJ A;  5KHG A;  2WO3 A;  3ZFG B;  4N43 B;  3J7H A;  3KD4 A;  2PHT A;  3ZN6 B;  4FO9 A;  4UW4 A;  1AR6 3;  2E31 A;  1H8T C;  2WWU A;  1XYP A;  3D82 A;  3GGL A;  4CU7 A;  3OPZ A;  5CFC A;  4AEJ A;  4XQW A;  5FO8 B;  1PZ8 A;  2R0F A;  3KT7 A;  5JSO A;  1MQT B;  1BEV 3;  2DUP A;  4QM9 A;  2VBP A;  4ISQ A;  4Y20 B;  3WN2 A;  1YYN A;  2HWD 3;  1C8M 2;  1CAU B;  2VM9 A;  1GSL A;  4CEY B;  3PHM A;  5FOB B;  4LUL A;  4RSU A;  4E2Q A;  4I3G A;  1CZS A;  3OYW A;  2A3X A;  3B5L B;  3OGS A;  2OQ6 A;  4Q0S A;  5GZE A;  5FZ6 A;  5A6Y A;  1JBC A;  1REF A;  1CAX A;  3APB A;  5IK8 A;  1ASJ 2;  1CVN A;  1PVC 2;  5FR3 A;  4Y1X A;  4CU9 A;  1H2K A;  4MGY E;  2XBO 1;  4N8M A;  4ZPI A;  5GLQ A;  1ULC A;  2ZHL A;  2XDV A;  4BWO A;  1NQJ A;  1PO1 2;  3RZZ A;  2XJP A;  1SLA A;  1WW7 A;  2PHW A;  5FLH A;  3VHN A;  1OLM A;  4AI2 A;  5AC9 1;  3N7J A;  1AR8 3;  3EBR A;  3VBO B;  1K5M C;  4NR1 A;  3VT0 A;  4BXS V;  3RS6 A;  5AYE A;  1FV2 A;  4QHO A;  4D7S A;  3M8L A;  1JZ4 A;  3AKH A;  1W2T A;  3AMQ A;  5ACA 3;  5CKN A;  3O7O A;  3QBQ A;  4YNI A;  5KWR A;  2PA7 A;  4TZD A;  2D3R A;  5LAT A;  2Q1M A;  2GC1 A;  1SFN A;  4IE5 A;  1UY0 A;  1PX3 A;  4OHV A;  1VAK A;  4DFS A;  4R52 A;  4CDU C;  4FPO B;  4Y4R A;  4XJU A;  2BP6 A;  4XCA A;  5DQ0 A;  5APA A;  2BBV A;  2C24 A;  1WMF A;  4CCC A;  4DUX A;  1ENX A;  4R8H A;  2P34 A;  1CZT A;  1S0F A;  1LHU A;  5A6X A;  1YQ6 A;  1IKP A;  2BER A;  2QTW B;  4YZ1 A;  4XEZ A;  1OC1 A;  2VQ0 A;  3HIF A;  3LPG A;  1QJX 1;  3ZKY A;  5FZ1 A;  3S7I A;  4LBN A;  2JG8 C;  3F2Z A;  1IZ3 A;  1ND2 A;  1RUD 3;  3I3D A;  4Y5Z 0;  5J37 A;  1YFU A;  2VZO A;  1W0N A;  3MW3 A;  4D6S A;  1UPS A;  1W3V A;  2KM2 A;  5FZC A;  5C71 A;  3CJI A;  4JGZ B;  4NWW A;  5LCW L;  3OOX A;  1SEF A;  4KC7 A;  2J42 A;  3J26 N;  5J3U A;  4AHX A;  4PCR A;  1UY4 A;  2A3Y A;  5AFE A;  5HV4 A;  5JLV A;  3TOJ A;  3VUO A;  5M0T A;  3O1V A;  1GZW B;  3VDD B;  2B4K A;  3OBR A;  4NE9 A;  4YZ3 A;  2GAL A;  2JDZ A;  2A6V A;  3FMG A;  1WCS A;  3AP9 A;  3N9P A;  4FFI A;  5JI9 A;  2DCY A;  5FYM A;  1W6N A;  1FXZ A;  5F3G A;  5DAV A;  3VZO A;  1NXM A;  3CNA A;  3CZU A;  3D5Y A;  4M4R A;  1HXS 2;  3DXU A;  3AP5 A;  1OUR A;  5FY8 A;  3I2J A;  3MI8 A;  4TN7 A;  1AL2 1;  4AED A;  1GOF A;  4Y26 A;  1JYI A;  1N47 A;  2QDN A;  4A7Y A;  5FYV A;  1S2E A;  2Y33 A;  3LAG A;  1AR8 2;  3BU7 A;  5A7W A;  2A6Y A;  2E7A A;  5LBF A;  3M3O A;  4YYO A;  4ERO A;  1VKD A;  3AXE A;  1RUJ 3;  3JD7 1;  1PO2 1;  2A7A A;  4GQ7 A;  2R1B A;  4BU2 A;  3EJK A;  5JZG B;  1OPM A;  2I45 A;  5ACA 2;  1W6Q A;  5EJ3 A;  2BJS A;  2FMY A;  4X8N A;  1Q8P A;  5FWE A;  4B4R A;  1ZRE A;  1GNZ A;  5K8S A;  2VNG A;  4CCM A;  4YM3 A;  3VT2 A;  4U36 A;  2Q5T A;  5H9P A;  5HCF A;  2WA3 A;  3BOW A;  5A7P A;  3VHP A;  1IGO A;  1SZB A;  4PT6 A;  4G3Y C;  3K4D A;  5HPO A;  1ZRI A;  4E4Z A;  4QMA A;  5IHR A;  1W18 A;  1K12 A;  3VKM A;  5IK5 A;  2X5I B;  4FQ4 A;  4I30 A;  2QQK A;  3PVE A;  5C70 A;  3AL6 A;  2F17 A;  4FPY A;  3UGG A;  4JDO A;  4YW7 A;  1JZ7 A;  3DXT A;  4I0B A;  5DDJ 2;  4JGY A;  3VB9 A;  4D6R A;  4K3U A;  4IEZ A;  5FCC A;  4COU A;  3LA7 A;  4YVW C;  3WLU A;  4YAR A;  3WP5 A;  4YW6 A;  3AK0 A;  4WBB A;  5A3L A;  5FZO B;  3WSO A;  1PK6 A;  5E1R A;  3P5B A;  4W4Z A;  3DN7 A;  2JB8 A;  5B4X A;  4TXW A;  3RZK A;  3I59 B;  3R4Z A;  2R06 3;  1HV1 A;  1FPN 3;  2Y0O A;  2RS1 3;  5A33 A;  3BOD A;  1WA4 A;  2WNU C;  1R64 A;  5F6K A;  2VW1 A;  5IVY A;  2XON A;  4W8J A;  1ND3 B;  5CKM A;  2Q0A A;  3L2Y A;  3O1U A;  1XND A;  3SEE A;  1VBB 3;  5IFP A;  3MPB A;  2FCT A;  3BPS A;  3FZ3 A;  2R7E B;  2YC4 A;  4QQO A;  1I6X A;  3USU A;  2WQ8 A;  3FC0 A;  4GIQ A;  4CA9 A;  1BVP 1;  1DGW A;  3MF9 A;  4EZH A;  4AL9 A;  4IER A;  1FOD 3;  1YJK A;  3OG2 A;  4LOT A;  1LEN A;  1MS1 A;  1RYY A;  2XBO 2;  4QKB A;  4A42 A;  4CP0 A;  3KV6 A;  4E4S A;  3H7J A;  1H8T B;  4PQ9 A;  5KXC A;  1UXZ A;  3ZIX A;  5K4L A;  3RJ2 X;  4GB3 1;  5HV0 A;  5DZF A;  1AZD A;  2JDP A;  1O3S A;  1VP6 A;  2FQP A;  2DUQ A;  5AC9 2;  2JD9 A;  2OXB A;  5FK8 A;  2ZPX A;  4LLF A;  4N90 A;  4YVS C;  4XET A;  1E5S A;  5BNO C;  3AMM A;  3E6C C;  3LQC A;  4WV8 A;  5A7V B;  4KBB A;  4CRQ A;  1FMD 3;  3JCI A;  5FV3 A;  4MET A;  4OHY A;  4KMI A;  3ZX7 A;  2A1X A;  3WPY A;  2V5Y A;  3Q8B A;  4CDQ A;  1O4Y A;  2GMP A;  1CN1 A;  2KD7 A;  2QVS B;  4XVH A;  1WW6 A;  4P9G A;  5HXM A;  4M4P A;  3WNN A;  2HLE A;  3EB7 A;  4QQ2 A;  4KC8 A;  2XJU A;  1J84 A;  2PAE A;  4UFI A;  5FZI A;  3LDB A;  1IHM A;  2RS5 1;  2WAO A;  2CGP A;  1VE0 A;  3B9I A;  1W8W A;  2P2K A;  1SLB A;  2PHF A;  2VBB A;  1FYU A;  1G6N A;  1QJX 2;  2W87 A;  1K5M B;  1VRH 3;  2X09 A;  1RB8 G;  1XU2 A;  2CDO A;  3MBW A;  1LOD A;  3DL3 A;  5C5U A;  1IQA A;  3HWJ A;  2NQY A;  4X6Q B;  4DZG A;  3ETP A;  1RMU 3;  1MZ6 A;  3ILR A;  4OUM A;  2HWC 3;  4G4F A;  5EWS A;  1UXX X;  2ZGK A;  1Z7S 3;  1AX0 A;  5L7O C;  5GLM A;  4J25 A;  4ZU7 A;  3BYK A;  5T5L A;  3IBM A;  2DVA A;  1A8D A;  3N7M A;  4Q0V A;  3I3M A;  5C3O A;  3JQX A;  3S0M A;  1VBB 2;  3WMY A;  4QX3 A;  2ZGQ A;  1DGW X;  1HRV 1;  3UKT A;  1QHD A;  1OUS A;  1G7Y A;  1VMF A;  1MR5 A;  2GNM A;  2JG8 B;  1ZRR A;  1H9P A;  1OFN A;  2IXH A;  1WA6 X;  2VNO A;  1W9W A;  5GLU A;  3VD7 A;  3BIE A;  5E6H A;  3T09 A;  3GBG A;  2PMW B;  2ZML A;  4NOV A;  3K3O A;  4Y22 A;  4KGG A;  1H1I A;  1H4H A;  1R09 3;  1AL2 2;  4AR2 A;  4CCN A;  1XU1 A;  1AXK A;  4E2G A;  4QU1 A;  3IAP A;  2R07 1;  5FXW A;  4HG6 B;  1BKZ A;  4KQ7 A;  2DCK A;  2OZ6 A;  1F4H A;  4IQP A;  3PVB B;  5FZK A;  5FZF A;  1NA1 C;  2D40 A;  2OPW A;  2OII A;  1PO2 2;  2YBP A;  3JD7 2;  4JQR A;  4Z2W A;  2ZGN A;  4FOV A;  5C5T A;  4LO8 A;  3DPR C;  2Y26 A;  1NCR C;  3AZY A;  2W95 A;  1IS3 A;  2ZTN A;  4K8R B;  1C1F A;  3U07 A;  2IVI B;  1DYP A;  5F6L B;  3PJY A;  3T3Y A;  5F1R A;  3OY8 B;  3HMY A;  3WD5 A;  4CXY A;  1Y3T A;  2WKK A;  4XC9 A;  5AYC A;  3NNJ A;  4WM8 C;  2EIG A;  2BTV C;  3S6P A;  4A6O A;  4QXB A;  4DXT A;  4IUG A;  3I49 A;  2JEC A;  3R6S A;  1MS9 A;  2DVB A;  1UMI A;  5E89 A;  1L7R A;  1VRH 2;  2C5D A;  1W28 A;  1LU1 A;  1ENQ A;  5HBA A;  5FRA A;  2E7T A;  2NMO A;  1DCS A;  3VBF C;  3KVB A;  1LOA A;  4M0H A;  1EV1 3;  4N53 C;  1LGB A;  4LUK A;  4FFG A;  2VUD A;  1QH6 A;  2IXJ A;  1XYO A;  1GQH A;  1ZBE 3;  2Z5W A;  3IZO A;  4UW3 A;  4ARY A;  5KC5 A;  1PMJ X;  4ZU4 A;  4ZU5 A;  1Z7S 2;  5LBB A;  3SC7 X;  3ZXG A;  2A3W A;  2B9V A;  1VIW B;  3LIH A;  2K0G A;  4M3C F;  2WZP P;  3S57 A;  1SCR A;  3DEC A;  1H1M A;  1JZ5 A;  1NZI A;  1A6C A;  3OM7 A;  1DZR A;  4W6X A;  1F5J A;  4M01 A;  5ERL A;  2ZGO A;  4CCO A;  4BJ0 A;  4UFJ A;  5KHH A;  4RHV 1;  1RXF A;  4W50 A;  3THP A;  4AVT A;  4EE2 A;  5D1I A;  3TNQ A;  2WQZ C;  4YVW B;  1QJY 1;  1RUC 1;  1ULE A;  2IZW A;  2E51 A;  1AR7 3;  3N9Q A;  5F2S A;  4JKK A;  5DG1 A;  3I3B A;  2BNM A;  3N7K A;  1R09 2;  1UIJ A;  3Q9O A;  1G8W A;  4OI4 A;  5C4W A;  3U75 A;  2J1A A;  5C9A C;  4QPI A;  2RE9 A;  4GB3 2;  1PM7 A;  2WNU B;  1B09 A;  1RGS A;  1W39 A;  2GME A;  1RIN A;  2QQP A;  1RHI 3;  4F3J A;  1OVP A;  4KI5 M;  1H2N A;  2B5H A;  2FDI A;  2VTX J;  1S2K A;  2C6S A;  2D5F A;  4H14 A;  3V65 A;  1UQX A;  4AFD A;  4ZHN A;  2VD7 A;  3GNE A;  4YZ4 A;  5LW9 A;  1C57 A;  2AEN A;  2V5D A;  2ZGS A;  1PGS A;  3ECQ A;  2K2S A;  1QDO A;  3J8F 3;  3LD8 A;  1IS5 A;  4BZ4 A;  1UOB A;  2H0B A;  1TEI A;  5FMD A;  5LY2 A;  3ZYF A;  2BWA A;  2ZHK A;  5FPZ A;  4Q4X 3;  1WKY A;  4CDU A;  2JJ6 A;  2VR4 A;  1VBE 2;  4MGQ A;  3DV8 A;  3KB5 A;  1ZX5 A;  4IV3 C;  4UFL A;  2RG4 A;  2PXJ A;  2RS5 2;  5FYB A;  4QX2 A;  3RZG A;  1GQG A;  1LHV A;  2OUJ A;  4XFA A;  4IDZ A;  3NV4 A;  1VLN A;  5JXI A;  3VBU A;  1CAV B;  2P3I A;  4FXG B;  4MHU A;  1OSG A;  1YJL A;  3IIA A;  4H7L A;  3V0B A;  4XIK A;  4YVS B;  3TN9 3;  1DQ2 A;  5BNO B;  1GZ9 A;  3OM4 A;  2UWB A;  3RGB A;  1NZC A;  4D69 A;  5LA9 A;  2JDY A;  3H9A A;  1LHO A;  5IVB A;  2VE1 A;  1QNW A;  3LB9 A;  5K0U A;  2BYV E;  4AQ6 A;  4EWA A;  1J59 A;  5GLP A;  4K9S A;  4NRO A;  3KS7 A;  2WT1 A;  2WNE A;  2EVX A;  5F8P A;  5FUN A;  1EPZ A;  5FZ0 A;  3T4H B;  4YM1 A;  1MEC 3;  2VUA A;  3FHA A;  2QQO A;  3M7A A;  1LR5 A;  1R1A 1;  4DXR A;  3N9N A;  3BPZ A;  5FMC A;  1UWW A;  2VZS A;  1ZZ8 A;  1GNH A;  4IEQ A;  5C8C C;  1UKR A;  1HW5 A;  3H8R A;  1AR7 2;  2BOJ A;  3M3I A;  1ZYB A;  4GJY A;  1O3T A;  2GC0 A;  2DBN A;  4LXL A;  5IK7 A;  3RI9 A;  3I3E A;  4NWV A;  2ZGL A;  1A78 A;  1VMH A;  1WMD A;  4D7T A;  1NT0 A;  3K51 A;  5L7O B;  4L11 A;  1PNF A;  1HIX A;  1WBF A;  2JE9 A;  1RHI 2;  5JVV A;  4LJH A;  5J98 B;  5LEK A;  2VUC A;  5F3E A;  4XMI A;  1UO9 A;  4LO7 A;  4O9G A;  3E5U A;  1QWR A;  3JB8 A;  3INA A;  1D4M 1;  1OKO A;  2F4P A;  1XE7 A;  2QZ3 A;  5AFB A;  1ZZ9 A;  3AKF A;  3H8X A;  1PMH X;  1V9U 1;  5ABJ A;  2WT0 A;  1RUI 3;  4YZ5 A;  3KVA A;  1RUH 3;  3K48 A;  3VKF C;  2WNO A;  4A4A A;  2IWG B;  4BIS A;  4NPM A;  3NO8 A;  3OM2 A;  4CP1 A;  3WY6 A;  1AL0 G;  1JOB A;  1GWK A;  4CDX A;  4DIN B;  2GC2 A;  2Q1Z B;  5FBZ A;  2X05 A;  2VQU A;  1OLM E;  4QHZ A;  2G9G A;  3HAG A;  1JH5 A;  1SG3 A;  3H3U A;  2E7Q A;  1EP0 A;  4PLM A;  5FLI A;  4FPL A;  1QQP 1;  2K46 A;  4NJ4 A;  1AX1 A;  3POS A;  2G9Z A;  2BGP A;  1Q8Q A;  4E4D X;  5C7G A;  3GZA A;  3LDK A;  1NA1 B;  2HWF 3;  5A80 A;  4DMI A;  3R4D B;  4LEJ A;  2DF7 A;  5CAD A;  5FLW A;  1HB1 A;  5JOZ A;  4NAO A;  1XPW A;  4Q4V 1;  2XKO A;  3DPR B;  5C3R A;  5I93 A;  1NCR B;  4FCA A;  1QJF A;  5FYU A;  4UDK A;  2PLV 1;  1KEX A;  3NKT A;  1UZY A;  2R32 A;  3WUD A;  1HDK A;  5LBC A;  3ILF A;  4FOW A;  4LUM A;  3CZJ A;  1MEC 2;  3FL7 A;  3AYC A;  5CAZ A;  4WM8 B;  4NHK A;  5A7N A;  4MUV A;  1LRH A;  3R4Y A;  3AJZ A;  1JU3 A;  4BQX A;  4RHV 2;  2XL9 A;  4JRA A;  1X33 A;  1AYM 3;  1GIC A;  1W9S A;  1A8M A;  2XVG A;  4RFT 0;  2MNG A;  4ZS2 A;  2X53 S;  3VBF B;  2GNT A;  3A23 A;  4N53 B;  1YO8 A;  1RUC 2;  4OZX A;  3CF6 E;  1C8M 1;  3LOI A;  3A0K A;  3D4K A;  1UU5 A;  1SAC A;  2AEZ A;  2MEV 1;  4YM2 A;  5EV7 A;  1GWM A;  3OM5 A;  3VBS C;  1FAT A;  2Q1F A;  5LAS A;  3ETQ A;  1YLL A;  1U5X A;  3CU7 A;  1RUF 3;  3MHZ A;  4IEU A;  1MQT A;  5FZ9 A;  4RGA A;  5AY9 A;  3NJV A;  3ZSE A;  4CUG A;  4KH9 A;  1COV 2;  1S4C A;  4MLG A;  5FY1 A;  2E53 A;  4NPL A;  4WM7 A;  4XW3 A;  5FZE A;  5BXX A;  4CEY A;  3B93 A;  4HAN A;  1L7Q A;  4N9I A;  5FYC A;  2ADD A;  1JW6 A;  1HB2 A;  1ZA7 A;  3VHR A;  4ISR A;  1VAV A;  2UYB A;  4W6Y A;  1OVS A;  1KRI A;  2W1U A;  2YV8 A;  3VKN A;  2VCM A;  2YFU A;  4AWD A;  4ONU A;  4UT5 A;  3NJZ A;  2QQN A;  5FPA A;  5FJH A;  5C9A B;  1TMF 3;  3OCP A;  4XBN A;  2D6L X;  2GN7 A;  3EHK A;  5EZW A;  4BB3 A;  3AJY A;  4URA A;  3FHI B;  4GA9 A;  3BCW A;  2OVU A;  1OOP C;  2QQW A;  4R9A A;  3ZYP A;  3AP6 A;  3CEW A;  2C0Z A;  1OD5 A;  4AI8 A;  3OPT A;  4HMZ A;  4HN1 A;  4HPK B;  4OUL A;  1UU4 A;  2OYZ A;  2VNR A;  1SFP A;  1F8V A;  4XYX A;  1Q8V A;  1RUG 2;  4Y24 A;  4HVR A;  4UWD A;  1AJK A;  1Z0H A;  3I8T A;  4CZS A;  3OPW A;  4CSW A;  4RL7 A;  4FFF A;  3WF0 A;  2YGM A;  2C1F A;  2UU8 A;  2Q8E A;  1EY2 A;  3SEP A;  3V0A B;  2PN5 A;  1YRZ A;  3NNF A;  1BHG A;  1ZNP A;  2QNK A;  5FY5 A;  1QEX A;  1DHK B;  4IV3 B;  2CGN A;  4TLG A;  3VL9 A;  4MXW A;  3ZYG A;  5IVJ A;  1CQ9 A;  1UY3 A;  5FKB A;  2IXL A;  3D0J A;  3AP7 A;  3H1W A;  4AE2 A;  3OBZ A;  5C0P A;  3RYK A;  1BEV 1;  4Q8L A;  3I2O A;  1JXN A;  1UIK A;  3BTY A;  5SV8 A;  5FQ0 A;  2W47 A;  3NV1 A;  3SNM A;  2VMC A;  4GD4 A;  4HET A;  3KMH A;  1S2B A;  1CJD A;  4K40 A;  3U1X A;  3VZL A;  4AVC A;  1O59 A;  1GKB A;  2RM2 3;  2R30 A;  3SHR A;  3U10 A;  4NIH A;  3LEI A;  2Z42 A;  1JMU B;  3BTA A;  4JGZ A;  2F6B A;  4JKL A;  1RUF 2;  1UV4 A;  2D6K A;  3WQ0 A;  3U4X A;  4TSV A;  4ET7 A;  4YZ2 A;  4BCU A;  4CXX A;  1UKG A;  4CVU A;  4RA0 A;  1R08 3;  4ATF A;  4Y5T A;  3VSZ A;  1PIV 3;  2PHL A;  2ZGR A;  5DPN A;  1AJO A;  4UYB A;  1VB4 A;  1NUK A;  5G04 L;  3IAQ A;  5FZ7 A;  1AR8 1;  4XIL A;  5LB6 A;  3LV4 A;  1HRI 3;  2WRA A;  5C8C B;  4AK7 A;  2ZKL A;  3BGA A;  4YW5 A;  4RYD A;  4COV A;  3O0X A;  2WYS A;  3RYP A;  5J1X A;  4HK9 A;  3GHM A;  1W2N A;  1MAC A;  1UNB A;  2JDK A;  4PLO A;  1H6Y A;  4IEP A;  5T3N A;  2DYC A;  1FAY A;  3JUU A;  4AEM A;  3AZV A;  5ACA 1;  1W9T A;  4ITC A;  3DF0 A;  2AEY A;  3SLI A;  4ES8 A;  5A3N A;  2ZBJ A;  3QOP A;  3OBA A;  1VBA 2;  4X6R B;  4CUA A;  2D44 A;  4MO3 M;  3RZJ A;  2FDJ A;  4BIO A;  2D6P A;  1DYO A;  1TME 2;  1NYW A;  4X8P A;  5CG8 A;  4XFG A;  3ON7 A;  2VEC A;  1HJG A;  1SPP B;  3LKJ A;  2OX0 A;  5CFC C;  4D47 A;  3T30 A;  3IB3 A;  1VBC 3;  5DDJ 1;  1RUD 1;  2BBA A;  2PLV 2;  3E97 A;  4NOT A;  2WR9 A;  3AM2 A;  3EYP A;  3WNX A;  5BNN C;  2RS3 3;  3H42 B;  3BOP A;  4NMI A;  3WF1 A;  4ASK A;  2WJS A;  1ZBA 3;  4Y1Z A;  2DFB A;  2Y6G A;  3LFI A;  3O5S A;  4NHM A;  2CHH A;  4Q4Y 3;  4Z92 B;  3ZSM A;  5FMO L;  2P3J A;  2OUH A;  4XFI A;  4XUT A;  2YBS A;  1MVQ A;  4QT6 A;  4LKE A;  5GZG A;  1POV 1;  4FPJ A;  4K6B A;  5KBF A;  2WYF A;  2P6H A;  2B45 X;  2XPJ A;  2XWB B;  1D2Q A;  4BHP A;  2X8F A;  3WPU A;  2VOX A;  3AMH A;  4QX8 A;  3WN1 A;  2A73 B;  3U0Z A;  1X7N A;  1Y9Q A;  3DKQ A;  1BYH A;  4FXK B;  4J6G A;  4UAP A;  5CYY A;  1ZRD A;  4CCL A;  4RN5 A;  4OUS A;  1MPX A;  5JIA A;  4NII A;  1N3O A;  1JHJ A;  1IS6 A;  5FUP A;  5JXJ A;  2YUE A;  3RDI A;  1JS9 A;  3ASI A;  3FN9 A;  2MEV 2;  3T08 A;  5BNQ A;  5JMO A;  3D61 A;  2UWC A;  4LK6 A;  5J36 A;  1WCU A;  5FMB A;  2VQA A;  2ZGM A;  1KDM A;  1DQ5 A;  1KD7 A;  4NUB A;  4BK5 A;  3QEE A;  2ARX A;  4FPK A;  2W1W A;  4XJ9 A;  1PT2 A;  1AXY A;  1C1L A;  1GUI A;  1PIV 2;  4LO5 B;  2C9K A;  4PLN A;  2CY6 A;  4N1I A;  1YXW A;  3DYP A;  4AGG A;  2YZ4 A;  3CHX A;  1JUI A;  4GAL A;  5E8A A;  3VSF A;  3ORJ A;  4JX0 A;  2WAB A;  1RUJ 1;  1D4V B;  2PYT A;  3AFK A;  4N4B A;  5DUV A;  3KHB A;  1ACC A;  4F83 A;  2JD4 A;  1OLR A;  5FXZ A;  2I2S A;  4PBO A;  2FHR A;  5IFT A;  3FX3 A;  3VBS B;  2YFR A;  1ND2 C;  4H3W A;  3VDA A;  2ETE A;  3ZYH A;  4ES9 A;  4CU6 A;  4LBQ A;  5FO9 B;  2GAU A;  1JYX A;  3VSS A;  2UYA A;  1W6M A;  4XUQ A;  5LRS A;  3JB4 C;  3R05 A;  3DYO A;  1US2 A;  3ILN A;  4MGK E;  1BMV 1;  1JI6 A;  2EIC A;  3CJI C;  2EXJ A;  3HR9 A;  3PME A;  5KXD A;  2ZKN A;  4XUR A;  5FZL A;  4ZZ8 A;  4LBQ D;  4XAA A;  2OA2 A;  2V72 A;  4QQH A;  1E57 A;  5FIX A;  5F37 A;  4LHL A;  1I3H A;  1JZ8 A;  3GCW A;  3LIG A;  3G6J B;  3UJO A;  1W03 A;  4XMA A;  4AK3 A;  3IPV B;  4Q4Y 2;  4M3C A;  4A7K A;  4YFZ A;  2QQU A;  2UY8 A;  2ZZQ A;  3OGV A;  5GLT A;  3DGT A;  3AFG A;  5D21 A;  4YW1 A;  1CAW A;  2R06 1;  2W08 A;  2ZMN A;  4C8D A;  1Y4W A;  1FPN 1;  1AR6 2;  1W2A X;  1DDL A;  5FZH A;  3WZ1 A;  2RS1 1;  4DOU A;  1OOP B;  2GC3 A;  1KJR A;  2ES3 A;  1KFU L;  1A3K A;  4LOS A;  1BEV 2;  4PI0 A;  3SMH A;  2VXR A;  2VZU A;  2EF6 A;  4DRV A;  5FK7 A;  1V6N A;  3OEA A;  1VBB 1;  2HWD 2;  5KHK A;  1VPH A;  4BOW A;  4JDN A;  4MYE A;  4Q5O A;  5C33 A;  3K2O A;  2WLQ A;  4LK7 A;  1O3R A;  5LZ6 A;  1BVV A;  3HN3 A;  5A3U A;  1JYT A;  4M00 A;  2YBK A;  3HBZ A;  5FY9 A;  5FZ8 A;  1FOD 1;  2CGO A;  2H0V A;  1PZ9 A;  1S0E A;  2CV6 A;  5FTT C;  4Q4W 3;  3JBG 3;  1ULD A;  3KF5 A;  3E6D A;  2VBD A;  3AMP A;  3U78 A;  4AGV A;  1US3 A;  3UGH A;  1HN0 A;  5GZD A;  2ZCW A;  3ZR5 A;  1AYN 3;  2DBI A;  1KS5 A;  3LFM A;  2A6Z A;  1X8E A;  3MFC A;  1Q3E A;  4P02 B;  3WW4 A;  3VBR A;  4RR3 A;  1KDK A;  3HNM A;  3UJQ A;  3OUJ A;  2WNV A;  4TLF A;  2BW8 A;  3IT8 A;  2P37 A;  5JR7 B;  1OH3 A;  2Y64 A;  2YFZ A;  5KR7 A;  1J1L A;  1FMD 1;  5JMC A;  1LOF A;  3KSC A;  5IK4 A;  5F7U A;  2XHK A;  4I0W B;  3O0V A;  4LBM A;  2VAU A;  5IUQ A;  5CFD A;  3RRD A;  3ZYI B;  2RDR A;  3O1R A;  5BPX A;  4QM8 A;  1QOS A;  5FPL A;  1X36 A;  4LE4 A;  1XNB A;  5A3P A;  1PK6 C;  3KLS A;  2CTV A;  1YIF A;  4QPW A;  3I2H A;  1POV 0;  3WG3 A;  3WNM A;  3C7H A;  1UF2 C;  1UZZ A;  2Q30 A;  4KU7 A;  5FP7 A;  1MZE A;  1WUV A;  2YXS A;  3NST A;  4DY3 A;  4UXA A;  3AP4 A;  5A3W A;  2ADE A;  3MIC A;  5FKC A;  4NPR A;  1E5H A;  1VRH 1;  3ZYJ B;  4AVB A;  1YQ2 A;  1JUH A;  1RUD 2;  4PBP A;  1DU3 D;  2QCS B;  4OMD A;  1UZV A;  5IJR A;  3WX5 A;  2YFT A;  3TEW A;  1LEC A;  1H8V A;  1W2U A;  3BYW A;  1BK1 A;  3L9J T;  4RS5 A;  5FMO S;  1JYC A;  4LKD A;  2HWC 1;  2H6C A;  3WW1 A;  2O8O A;  3K3N A;  3MO4 A;  4I02 A;  1Z7S 1;  3QAC A;  4P9I A;  4IGQ A;  3HQU A;  2EAL A;  1CGP A;  1SFY A;  1HB4 A;  5FZG A;  4CP2 A;  3N36 A;  2KR2 A;  3NNG A;  2XJV A;  3IN9 A;  2BRT A;  2Z2S B;  4GMP 3;  1GWL A;  3WR0 A;  5CFC B;  1P8J A;  4LO6 B;  1YFW A;  3WDY A;  2W3J A;  4UDJ A;  1BBT 3;  4QU2 A;  3LEG A;  1ULP A;  2QQI A;  1XNA A;  1ODM A;  1YIP A;  4BMB A;  3W5M A;  5BNN B;  4COW A;  4Q4W 2;  3JBG 2;  2WT2 A;  3OGR A;  3U11 A;  4XFH A;  1VBD 3;  4H55 A;  3ZDV A;  2EIB A;  1VB2 A;  1H9W A;  4FOY A;  4XF3 A;  3RWK X;  4XJW A;  2ZX4 A;  3VKO A;  1R09 1;  3OYW B;  5B6S A;  4XDQ A;  4KL1 A;  3D60 A;  4CDQ C;  3ZXJ A;  1S0B A;  1CAX B;  1CD3 G;  4N7U A;  3WUC A;  4Q0Q A;  4YM0 A;  2WWS A;  3TYJ A;  1EAH 3;  4WVZ A;  5LY1 A;  2J1T A;  3WF4 A;  4B29 A;  2VTF A;  1C28 A;  4MXV A;  3JZV A;  1RUJ 2;  1IQD C;  4GXL A;  2ZHN A;  1LOE A;  2W68 A;  3HNY M;  4URT A;  3UL2 A;  3X29 B;  3ZFF A;  4ZZ5 A;  3CU9 A;  3SKJ E;  1DQ1 A;  5C6C A;  1YNA A;  2A5Z A;  1LTE A;  2J1V A;  5DMY A;  1GYD B;  5A1L A;  3WNO A;  1X9P A;  4XF0 A;  2CAU A;  3CJX A;  1LCL A;  2ID4 A;  2BGC A;  2DFC A;  3VHO A;  3AXD A;  5HCH A;  1QY4 A;  4P9X A;  4LOR A;  2O14 A;  1WW4 A;  3KQR A;  3OD4 A;  2VC9 A;  1VBE 1;  1BMV 2;  4FVV A;  1IPJ A;  4FPE A;  1LHW A;  4COZ A;  3ZMO A;  4UFK A;  5L9V A;  2WO7 A;  2FDH A;  5LBE A;  4MV2 A;  3I4I A;  3E6B A;  3KZ4 C;  1ULF A;  4XJA A;  3POB A;  1IKQ A;  3FE5 A;  5I8S A;  5C3S A;  3SXW A;  3ACF A;  1EV1 1;  4OUE A;  4K7J A;  5FYS A;  4Q8K A;  1ZBE 1;  5FRE A;  1UMZ A;  4K8F A;  4B8E A;  1CX4 A;  2RR1 3;  4HT1 T;  4L2N A;  3VLB B;  3B94 A;  2P4E A;  4QWN A;  1KJL A;  1U12 A;  2R06 2;  3TEY A;  1ND2 B;  4N9H A;  1FPN 2;  3QCW A;  2RS1 2;  4ZON A;  4UDG A;  2EXH A;  5DN2 A;  5DAQ A;  2B46 X;  1FT9 A;  5BYN A;  5LWB A;  1GNY A;  4PIX A;  4UDK E;  3CJI B;  5DAX A;  3KWV A;  1LHN A;  3FWE A;  1QOO A;  3U14 A;  1BBT 2;  1WCD J;  2JDH A;  3BN6 A;  5IAX A;  3WAS A;  3T1M A;  1ULG A;  1TG7 A;  2D93 A;  3AYE A;  1FOD 2;  2NZ9 A;  1PX4 A;  4N2R A;  3RYR A;  4ASM B;  1QNY A;  2AZ5 A;  1AR7 1;  2RDQ A;  3ZYR A;  4CDQ B;  4I2O A;  3NKG A;  1W6O A;  4QB2 A;  1SBD A;  1HV0 A;  1Y43 B;  1BQP A;  1W6N B;  2EAA A;  2TEP A;  2YC0 A;  3GCX A;  4HN0 A;  5AVA A;  1YQ8 A;  2Q8D A;  3ZSJ A;  5GLO A;  1N1Y A;  4Q27 A;  4RFR B;  4D3W A;  5LA2 A;  1K45 A;  3ACH A;  1RHI 1;  5BNP A;  3KV5 A;  4CDW A;  4BQ3 A;  3UV9 A;  4RQP A;  3POJ A;  1QXJ A;  1BZW A;  4XFF A;  3WQ1 A;  2JG9 C;  2JE8 A;  3P2N A;  5HXV A;  5A7W B;  5IAV A;  1FMD 2;  5CEH A;  3J8F 1;  3VD4 A;  4JKM A;  4XAB A;  3A0N A;  3BKZ A;  1QJZ A;  3WAT A;  5F5I A;  4EJR A;  1Y7B A;  4ORF A;  1FNZ A;  2J1U A;  3PNA A;  3PUI A;  4CUC A;  4Q4X 1;  2AAC A;  3MFA A;  2IXI A;  2NYY A;  5IYY A;  1W6Q B;  4FT8 A;  3GBF A;  3WV6 A;  4XDP A;  1O5U A;  4J1W A;  1MS8 A;  2WO2 A;  3MIF A;  3IM0 A;  4P5H A;  3FHQ A;  4XUP A;  2CYF A;  2ZX0 A;  1V6L A;  3S5Q A;  4EN0 A;  3O14 A;  4GWM A;  4LHK A;  3MZH A;  3WF2 A;  1RVF 3;  3H3Z A;  4WZC A;  5CVR A;  1T2X A;  2VZ3 A;  5FLJ A;  2UUR A;  3TWI A;  3PU8 A;  4OQ9 A;  1RMU 2;  1REE A;  4GH4 A;  2HWC 2;  4IV1 A;  2VQT A;  3PUA A;  3VBH A;  1L7L A;  3THD A;  4AW7 A;  4FAG A;  1SCS A;  1GP6 A;  2VZV A;  2VG9 A;  4V1P A;  1PK6 B;  3ZLI A;  4CP9 A;  1O8S A;  4E8D A;  3QZ4 A;  5DZG A;  4P00 B;  5C4W C;  4DPN A;  1MEC 1;  3OUI A;  2F4L A;  2QJV A;  3T0D A;  4QPI C;  4QHB A;  5A33 B;  4CEW A;  4I0A A;  4CCD A;  2R16 A;  3PVO A;  3ACL A;  3C8X A;  1GQP A;  2WSU A;  3MF6 A;  5F5Q A;  1XQN A;  3N4M A;  1OMI A;  2BFU L;  4IE0 A;  4IL7 A;  4AQS A;  2Y0I A;  4WVM A;  4FTB A;  1U5I A;  4F8A A;  2DVF A;  4IGO A;  5FY0 A;  3WF3 A;  5D8A A;  3USU B;  3AMN A;  4OFG A;  4S2D A;  1O4T A;  5CIS A;  2GSY A;  3BAL A;  2X8K A;  1JZ2 A;  3E5X A;  1AXZ A;  2HJI A;  1B35 A;  1D0H A;  1BLZ A;  1V6M A;  3HQX A;  4OHX A;  4L0P A;  1UD1 A;  2XLG A;  1UPI A;  4KWL A;  2XQX A;  1TVG A;  3QH6 A;  5FZM A;  2ORZ A;  4AEK A;  1H30 A;  3NAP A;  3N9M A;  1COV 1;  2B39 A;  3IDE A;  4Q1P A;  2WLP A;  3KCX A;  4L8Q A;  3THC A;  1RUI 1;  2IXK A;  2WBK A;  5J09 A;  5HCA A;  1CON A;  3J4U H;  3VBU C;  2FDF A;  4KWJ A;  2VPV A;  4QXK A;  3ZXD A;  1W8U A;  4MG2 A;  2VMG A;  3RSJ A;  5FOJ B;  4QQS A;  1W6P A;  1M06 G;  2E6V A;  3MEP A;  1JYV A;  3W5N A;  4LBK A;  4KCA A;  1XBF A;  2KXL A;  1QH7 A;  3MLJ A;  1K5J A;  1UYZ A;  3NV3 A;  3LSD A;  4XAC A;  2C4X A;  3B9C A;  2PQS A;  4ZXK A;  5K0U C;  3S5A A;  3D3A A;  5F39 A;  2R07 3;  2P3Y A;  2Y6K A;  1RUE 3;  2BUK A;  2YPJ A;  3IMM A;  3UKV A;  1NAE A;  5B4N A;  4C0B A;  3I2D A;  2HWF 1;  2DCT A;  3ATG A;  4UBH A;  5GLV A;  1KIT A;  2BZD A;  3WHT A;  2PEL A;  1EV1 2;  1DIW A;  2DVG A;  2NN8 A;  4CU8 A;  4CUB A;  1N1T A;  1ENS A;  1S0J A;  4AVS A;  1ZBE 2;  4H7M A;  1UU6 A;  1RUG 1;  2GH2 A;  5LEJ A;  4XF9 A;  4PHZ A;  5LK5 A;  5GLR A;  2CDP A;  3GHN A;  3ZXF A;  1JN2 P;  1W8T A;  1AX2 A;  2W9X A;  2QQL A;  1QJU 3;  2WIN B;  4OQ8 A;  4QDS A;  4W6W A;  2HWE 3;  4XXA A; 
#chains in the Genus database with same CATH homology
 5A8D A;  3SEP A;  4QX1 A;  3F2Z A;  3I3D A;  3WQB A;  1YRZ A;  1BHG A;  2W46 A;  2VZO A;  1W0N A;  1JU4 A;  2WAA A;  4OMC A;  3MV1 1;  1UY3 A;  5FKB A;  4LKS A;  5C71 A;  5C0P A;  5LCW L;  2QQM A;  4KC7 A;  2E26 A;  1UY4 A;  1UYY A;  2W47 A;  2VMC A;  1GOG A;  3VD5 A;  3WEZ A;  3LEM A;  1O59 A;  3QC2 A;  3JXS A;  2B4K A;  3LEI A;  1NX9 A;  4JKL A;  1UV4 A;  4QDQ A;  4FFI A;  4GZ9 A;  2Y6J A;  4ET7 A;  3VD9 A;  2WZE A;  3CZU A;  4CVU A;  1DP0 A;  2EXK A;  4M4R A;  3D5Y A;  3VSZ A;  4A3Z A;  5DPN A;  3I2J A;  4QX0 A;  1NUK A;  5G04 L;  3ZXK A;  1GOF A;  3IAQ A;  3LV4 A;  5JXG A;  4AK7 A;  4O8P A;  2WO1 A;  3BGA A;  4RYD A;  5JXH A;  2WYS A;  4AK6 A;  4BK4 A;  5J1X A;  1VKD A;  2J1E A;  1H6Y A;  3P6B A;  3VDB A;  2ZEW A;  1W9T A;  3QED A;  2AEY A;  2RVA A;  4UI9 L;  3OBA A;  4CUA A;  5FUI A;  2W94 A;  4MO3 M;  1Y9G A;  4XZU G;  3VT2 A;  2EIE A;  4O8N A;  1OF3 A;  1DYO A;  4PT6 A;  3WNL A;  4DEQ A;  3K4D A;  4MAD A;  4QDR A;  5HPO A;  2ZEY A;  2E33 A;  5IHR A;  1W18 A;  1K12 A;  3T2P A;  3I2K A;  1UX7 A;  2QQK A;  5C70 A;  4D47 A;  4UDI A;  2J22 A;  3IB3 A;  3UGG A;  3VSR A;  2BBA A;  1J83 A;  1JZ7 A;  3EYP A;  2W1Q A;  3UET A;  3WF1 A;  3ABZ A;  3KST A;  4FI9 A;  2Y6G A;  3LFI A;  3OM6 A;  4ONZ A;  3WSO A;  4XUT A;  2V4V A;  4W4Z A;  1H6X A;  5B4X A;  4TXW A;  3R4Z A;  2X8F A;  3K4A A;  3WPU A;  3WMZ A;  2J7M A;  3E1F 1;  3LDR A;  2VDT A;  3WN1 A;  5ANN A;  1R64 A;  3LE0 A;  2XON A;  4Z2A A;  4UAP A;  1D7P M;  5CYY A;  2RJ2 A;  4W8J A;  4O8O A;  4RN5 A;  1MPX A;  1JHJ A;  3SEE A;  5IFP A;  4E8C A;  5JXJ A;  3T08 A;  3FN9 A;  5JMO A;  3D61 A;  2J1R A;  2R7E B;  2YC4 A;  3GXU A;  5JOX A;  2WQ8 A;  5FMB A;  4BK5 A;  3QEE A;  2W1W A;  2ORX A;  3ZXL A;  1PT2 A;  2VL4 A;  3OG2 A;  1GUI A;  2C9K A;  2WN3 A;  3MUZ 1;  1RYY A;  4A42 A;  4N1I A;  3DYP A;  4A45 A;  1UXZ A;  1GMM A;  1O8P A;  4JX0 A;  3VSF A;  2WAB A;  4P08 A;  2JD9 A;  4N4B A;  2OXB A;  5FK8 A;  1GYE B;  2C26 A;  3CKH A;  3LQC A;  5IFT A;  2YFR A;  5A7V B;  3CDZ B;  1OYG A;  3VDA A;  4CU6 A;  4XUO A;  1JYX A;  4KMI A;  3VSS A;  2VCB A;  3WPY A;  4XVH A;  2VCC A;  2KD7 A;  2VJX A;  3MV0 1;  4XUQ A;  5HXM A;  3DYO A;  1US2 A;  4MGS A;  4M4P A;  1JI6 A;  2EIC A;  1F4A A;  3WNN A;  2HLE A;  2EXJ A;  3NJX A;  3EB7 A;  3NQH A;  4KC8 A;  4XUR A;  4ZZ8 A;  1J84 A;  3U37 A;  1WL7 A;  4KCB A;  3I97 A;  2V72 A;  2VZR A;  2WAO A;  5FIX A;  2VMD A;  3AC0 A;  1UYX A;  4P5Y A;  1JZ8 A;  3LIG A;  2J1S A;  2W87 A;  2ZXQ A;  1UYP A;  2X09 A;  2CDO A;  5B6T A;  3MBW A;  2QQU A;  3OGV A;  3K1U A;  4U6D A;  2YG0 A;  3HJR A;  1Y4W A;  3PUH A;  2W91 A;  4ARX A;  3KF3 A;  3ETP A;  2YC2 A;  3UGF A;  3CMG A;  1UXX X;  4ZXE A;  2VZU A;  3WPZ A;  5GLM A;  2B4W A;  3BYK A;  5FK7 A;  3OEA A;  3T2Q A;  2L9L A;  3A21 A;  3WMY A;  3ACI A;  3LF7 A;  4QX3 A;  3HN3 A;  1ULO A;  2HYX A;  5AYD A;  2JKX A;  5G05 L;  2QQJ A;  3KF5 A;  4ZY9 A;  2Z4F A;  4DXS A;  1US3 A;  3UGH A;  1W9W A;  3VD7 A;  3T09 A;  4NOV A;  5LA1 A;  3C7E A;  2QBX A;  4AAX A;  4P02 B;  3R67 A;  3IAP A;  3HNM A;  4HG6 B;  3MUY 1;  5JOW A;  3CIH A;  1WCQ A;  3VDC A;  2DCK A;  1F4H A;  2DDU A;  2Y64 A;  2YFZ A;  3T0A A;  4OZO A;  1SDD B;  4AK5 A;  5F7U A;  1UY2 A;  1OD3 A;  3K77 A;  5EIY B;  2W95 A;  1EUU A;  4QPW A;  2Y6L A;  3I2H A;  1YIF A;  3WNM A;  3PIG A;  3K4Z A;  3C7H A;  3C7F A;  3NRU A;  3LPF A;  1K3I A;  2Y6H A;  5AYC A;  3III A;  3BYN A;  2ADE A;  4A6O A;  5FKC A;  4DXT A;  3BYL A;  4IUG A;  3HNB M;  1YQ2 A;  1UMI A;  1L7R A;  3I2G A;  4OMD A;  1JYW A;  5EJZ B;  5IJR A;  2YFT A;  4DUW A;  3OEB A;  4FFG A;  4ARY A;  3MO4 A;  2E32 A;  4A41 A;  1PMJ X;  2XOM A;  2EID A;  4PF1 A;  3SC7 X;  2VZT A;  2B9V A;  3NNG A;  3LIH A;  2BGO A;  3DEC A;  1EUT A;  1K42 A;  1P8J A;  1JZ5 A;  2W3J A;  4UDJ A;  3OM7 A;  3LEG A;  1ULP A;  2QQI A;  1XNA A;  2VOT A;  4BJ0 A;  3W5M A;  1HN1 A;  4W50 A;  3D5Z A;  3WAU A;  3OGR A;  2EIB A;  3RWK X;  4DEV A;  2WZ8 A;  5B6S A;  2Y8K A;  1CZV A;  1JYN A;  3D60 A;  4JKK A;  3ZXJ A;  3I3B A;  3U75 A;  3VT1 A;  4A44 A;  2J1A A;  1GU3 A;  3HOB A;  2VCA A;  4TTG A;  2J1T A;  4YPJ A;  3WF4 A;  2VTF A;  4LPL A;  3BYJ A;  1IQD C;  4LQR A;  3HNY M;  5JOY A;  4ZZ5 A;  4KI5 M;  3GM8 A;  4MOA A;  3SKJ E;  3CU9 A;  1XNT A;  2J1V A;  5DMY A;  1GYD B;  3WNO A;  3HPN A;  1W99 A;  1KGY A;  2V5D A;  2ID4 A;  3ECQ A;  3WNP A;  2JDA A;  4U6B A;  2VC9 A;  5FMD A;  1WKY A;  5A7V A;  2VR4 A;  4MGQ A;  5A8C A;  3QEF A;  4QX2 A;  1OH4 A;  4KMQ A;  3UNP A;  4PVI A;  3K46 A;  5JXI A;  4OYU A;  3ACF A;  3C7O A;  4OUE A;  2WN2 A;  3OM4 A;  2QQV A;  2EXI A;  3HEI A;  2X8S A;  4UDG A;  4QAW A;  2EXH A;  5DN2 A;  1DLC A;  2VZP A;  2LW8 A;  5GLP A;  1GNY A;  4UDK E;  3C7G A;  4BDV B;  4COT A;  2WUH A;  2DCJ A;  3U14 A;  3BN6 A;  2VZQ A;  3FHA A;  3WAS A;  2QQO A;  1I5P A;  3ZM8 A;  4DXR A;  1TG7 A;  1OF4 A;  5FMC A;  4LHS A;  1JZ6 A;  1UWW A;  1PX4 A;  2VZS A;  4N2R A;  2X10 A;  3CQO A;  2XQR A;  4QB2 A;  3A7Q A;  2VMF A;  3SKV A;  4QB1 A;  3WPV A;  5GLO A;  3I3E A;  2ZEZ A;  5LA2 A;  1GYH A;  1K45 A;  3ACH A;  5I0D A;  5EJ1 B;  3T2O A;  5A1A A;  1GOH A;  3GDB A;  5GLK A;  3AKG A;  2JE8 A;  3P2N A;  4GWI A;  4JHZ A;  4XUN A;  3WN0 A;  4QB6 A;  4GWJ A;  1W8N A;  3VD4 A;  4JKM A;  3AKF A;  1LNS A;  2ZEX A;  1PMH X;  4KWU A;  5GLL A;  3WAT A;  4FFH A;  1Y7B A;  2J1U A;  3PUI A;  4AG4 A;  4CUC A;  4A4A A;  5IYY A;  5JR2 A;  1CIY A;  3OM2 A;  3OB8 A;  1CX1 A;  1JZ3 A;  2X05 A;  2VQU A;  1OT5 A;  2WO2 A;  2VME A;  4D0Q A;  3P1I A;  2LS6 A;  1SG3 A;  1UMH A;  3FHQ A;  4XUP A;  3A22 A;  2WDB A;  4DUV A;  3WF2 A;  2BGP A;  3I2F A;  2W5F A;  5C7G A;  2VO5 A;  1T2X A;  2VZ3 A;  2X8T A;  3LDK A;  1SHW B;  5FLW A;  2VQT A;  5JOZ A;  3DYM A;  1XPW A;  3THD A;  1XC6 A;  2VZV A;  1UZ0 A;  2W1S A;  2VZ1 A;  5GLN A;  4UDK A;  1KEX A;  3WNK A;  1O8S A;  4E8D A;  3QZ4 A;  4P00 B;  3ACG A;  3CZJ A;  3T0D A;  3T0B A;  3FL7 A;  2YB7 A;  1UY1 A;  3PIJ A;  2WO3 A;  3C8X A;  1GQP A;  1ST8 A;  3J7H A;  4PQQ A;  5JUV A;  3R4Y A;  1NKG A;  1JU3 A;  3LEK A;  3GGL A;  2E31 A;  1W9S A;  4CU7 A;  3WF3 A;  4N2Z A;  3A23 A;  4PVA A;  3WN2 A;  3K75 B;  1JZ2 A;  2AEZ A;  2VM9 A;  3OM5 A;  4L0P A;  2XQX A;  1TVG A;  2ORZ A;  3IDA A;  1CZS A;  3VD3 A;  1Y9M A;  3OGS A;  5AY9 A;  3NJV A;  3THC A;  2WBK A;  5LA0 A;  4MLG A;  4CU9 A;  2RV9 A;  2OKX A;  1YI7 A;  5GLQ A;  1L7Q A;  5CZK A;  4QQS A;  2ADD A;  4UOJ A;  3TAW A;  1JYV A;  3W5N A;  4KCA A;  2W1U A;  4EQV A;  2AC1 A;  1UYZ A;  2YFU A;  2C4X A;  2PQS A;  3VT0 A;  3D3A A;  2QQN A;  4BXS V;  2Y6K A;  5AYE A;  4D8M A;  2YFS A;  1JZ4 A;  1NAE A;  3AKH A;  5B4N A;  1W2T A;  3UES A;  3C2U A;  1W8O A;  2QQW A;  2BZD A;  4CU8 A;  2W92 A;  4CUB A;  1UY0 A;  1PX3 A;  5DQ0 A;  3I2I A;  4DUX A;  5GLR A;  1CZT A;  2CDP A;  3AKI A;  2XHN A;  2BER A;  2QQL A;  2W9X A;  4QDS A;  3LPG A;  3WF0 A;  4FFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...