3C7VB

Structural insight into the kinetics and delta-cp of interactions between tem-1 beta-lactamase and blip
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
165
Chain Sequence
AGVMTGAKFTQIQFGMTRQQVLDIAGAENCETGGSFGDSIHCRGHAAGDYAAYATFGFTSAAADAKVDSKSQEKLLAPSAPTLTLAKFNQVTVGMTRAQVLATVGQGSCTTWSEYYPAYPSTAGVTLSLSCFDVDGYSSTGFYRGSAHLWFTDGVLQGKRQWDLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural insight into the kinetics and DeltaCp of interactions between TEM-1 beta-lactamase and beta-lactamase inhibitory protein (BLIP)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07467 BLIP Beta-lactamase inhibitor (BLIP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3c7vB01
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 3c7vB02
5EKQE 3C7UB 1XXMC 3C4OB 1S0WC 2G2WB 3GMUB 3N4IB 2PXGA 2KXXA 5D0OE 2G2UB 3D4EA 4DM5A 3C7VB 1JTGB 2B5RC 5AYWE 3E2LC 2KM7A 3C4PB 5D0QE 3E2KC 2YH9A
chains in the Genus database with same CATH superfamily
5EKQE 3C7UB 4HSIA 1XXMC 3NWFA 3C4OB 1S0WC 2G2WB 3GMUB 3N4IB 2PXGA 2KXXA 3FVCA 5D0OE 2G2UB 3D4EA 4DM5A 3C7VB 1JTGB 2B5RC 3NWDA 5AYWE 3E2LC 3NW8A 3NWAA 4L1RA 2GUMA 2KM7A 3C4PB 5D0QE 3E2KC 2YH9A
chains in the Genus database with same CATH topology
5EKQE 3C7UB 4HSIA 1XXMC 3NWFA 3C4OB 1S0WC 2G2WB 3GMUB 3N4IB 2PXGA 2KXXA 3FVCA 5D0OE 2G2UB 3D4EA 4DM5A 3C7VB 1JTGB 2B5RC 3NWDA 5AYWE 3E2LC 3NW8A 3NWAA 4L1RA 2GUMA 2KM7A 3C4PB 5D0QE 3E2KC 2YH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKQ E;  3C7U B;  1XXM C;  3C4O B;  1S0W C;  2G2W B;  3GMU B;  3N4I B;  2PXG A;  2KXX A;  5D0O E;  2G2U B;  3D4E A;  4DM5 A;  3C7V B;  1JTG B;  2B5R C;  5AYW E;  3E2L C;  2KM7 A;  3C4P B;  5D0Q E;  3E2K C;  2YH9 A; 
#chains in the Genus database with same CATH topology
 5EKQ E;  3C7U B;  4HSI A;  1XXM C;  3NWF A;  3C4O B;  1S0W C;  2G2W B;  3GMU B;  3N4I B;  2PXG A;  2KXX A;  3FVC A;  5D0O E;  2G2U B;  3D4E A;  4DM5 A;  3C7V B;  1JTG B;  2B5R C;  3NWD A;  5AYW E;  3E2L C;  3NW8 A;  3NWA A;  4L1R A;  2GUM A;  2KM7 A;  3C4P B;  5D0Q E;  3E2K C;  2YH9 A; 
#chains in the Genus database with same CATH homology
 5EKQ E;  3C7U B;  4HSI A;  1XXM C;  3NWF A;  3C4O B;  1S0W C;  2G2W B;  3GMU B;  3N4I B;  2PXG A;  2KXX A;  3FVC A;  5D0O E;  2G2U B;  3D4E A;  4DM5 A;  3C7V B;  1JTG B;  2B5R C;  3NWD A;  5AYW E;  3E2L C;  3NW8 A;  3NWA A;  4L1R A;  2GUM A;  2KM7 A;  3C4P B;  5D0Q E;  3E2K C;  2YH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...