3C8CA

Crystal structure of mcp_n and cache domains of methyl-accepting chemotaxis protein from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
240
structure length
240
Chain Sequence
b'SLRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIENNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
publication title Crystal structure of Mcp_N and cache N-terminal domains of methyl-accepting chemotaxis protein from Vibrio cholerae.
rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Structural genomics, unknown function
total genus 79
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3c8cA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3c8cA02
2KDKA 2PYPA 5DJUA 3OLOA 3F1OA 3C2WA 3PYPA 3LUQA 4HJ6A 2JN7A 1OTIA 1P0ZA 4EETB 3LIEA 3MQOA 3FG8A 4HH3A 4HNBA 3NJAA 1UWNX 2HV1A 4LRXC 4HH2A 4NXBA 5AVFA 4WL9A 3UB6A 2PD7A 1DP8A 1GSWA 2ZOHA 3P7NA 3UMEA 3GECA 3E4OA 2V0UA 3BY9A 3UMDA 3MR0A 5HWWA 2D02A 5HWVA 2PYRA 2VV6A 3NOTC 3K3DA 3H82B 5EFWA 4NXFA 5F5YA 4HQAA 1DP6A 2JHEA 2B02A 1XFNA 4EW7A 4WN5A 2OOLA 3BWLA 1OTBA 5IS1A 3UB8A 1D06A 5G4YA 3ULFA 3F1NB 1VB6A 4RQ9A 2P7JA 1UWPX 5F6AA 1GSXA 3UB7A 5IU1A 1T1CA 5HDSA 3E4QA 2BASA 1S4SA 1F9IA 4I3IA 4JGOA 3RH8B 1OTEA 3MJQA 3LICA 2VV7A 1X0OA 3F1NA 1NWZA 2VV8A 1LL8A 5J4EA 3HJKA 4PKYG 4L9GA 3F1OB 4JGPA 3ZQ5A 4WLAA 1XJ3A 4M4XA 2ZBBA 3D72A 3A0VA 1S67L 4HOIA 4L9FA 4PKYA 3H7WB 2WKRA 3LI8A 2YKHA 1EW0A 1OT9A 5HZHA 4HIAA 3CLOA 1S4RA 4EESA 4YWZA 1TS6A 1TS0A 1T1AA 4R3AA 2I9VA 5F69A 3H7WA 5TBMA 3UB9A 1LT0A 4HJ3A 1WA9A 3H9WA 1N9LA 3LIDA 1S1YA 1KOUA 2GJ3A 1N9OA 4R70A 2QHKA 4E04A 5AVEA 5HDDA 1D7EA 1TS8A 3EEHA 3K3CA 2V1BA 3E4PA 3LI9A 5HSQA 3IBRA 2QJ5A 5HD3A 2R78A 3KX0X 1XFQA 3NOUC 3NHQA 1GSVA 4HY8A 1OTDA 2CMNA 1T1BA 2YKFA 3IS2A 3FC7A 4GW9A 4BBVA 5F68A 2OWHA 5J7EA 3VE3A 4GCZA 5HD5A 1XJ4A 4XT2A 1S1ZA 4KUOA 3LIBA 3CWFA 4DJ2A 3C8CA 5DKLA 3LIFA 3NOPC 4EEUA 3F1PB 4I39A 4K08A 4L9EA 4H6JB 4KUKA 1XJ6A 2WKQA 4HHDA 4NXEA 2D01A 3BY8A 4GS9A 2PR6A 4LRZE 1OJGA 3CAXA 4B9OA 3SW1A 3F1PA 4H6JA 4HP9A 2ZOIA 1T19A 4HI4A 3VE4A 4LRYC 4BBUA 4I3AA 2M1CA 2W0NA 2Z6CA 2QWSA 4EQ1A 5TBMB 4HP4A 4JGRA 1LSVA 4GHIA 1DRMA 1UGUA 1OT6A 2PD8A 4JGQA 3G6OA 4I38A 4KQDA 4EXOA 4EEPA 1LSXA 2INWA 4WUJA 2PR5A 2A24A 3MXQA 2V0WA 1MZUA 3MFXA 5I5LA 3GDIA 4BBTA 1OTAA 5G4ZA 5DJTA 4I3JA 1P97A 3A0RA 5HDCA 4NXGA 2L1MA 5KIZA 3IS2B 2L4RA 3T50A 2EA9A 2PHYA 1Y28A 4HJ4A 1JNUA 4EERA 1OJ5A 4I5SA 3PHYA 4XT2B 5J3WA 1TS7A 4WF0A 3LYXA 4MN5A 2H28A 3ICYA 1DP9A 3B33A 3A0SA 2L0WA 4MN6A 3UE6A 1S66L 3HJIA 4R6LA 1T18A 1ODVA 4GS9B 1N9NA 2Z6DA 4LLOB 5A8BA 4LPZA 3RTYA 2KX6A 1LSWA 1BYWA 2PDRA 1V9YA 2QKPA 1XJ2A 3MQQA 3H82A 3VOLA 1F98A 5DKKA 2VEAA 4GHIB 2QJ7A 1G28A 2K7SA 4F3LB 2J80A 2V9AA 4R38A 2OWJA 2WKPA 1V9ZA 4DJ3A 2VLGA 2A24B 3LIAA 5HWTA 2W27A 4F3LA 3EWKA 2V1AA
chains in the Genus database with same CATH superfamily
3IX4A 3W2ZA 3IF6A 3BFCA 3D4FA 1DJCA 3ITBA 1DY6A 4G3KA 4OQGA 1MPLA 5M18A 1P0ZA 3HUMA 3UE3A 1FR6A 1DJAA 1M6KA 1IYQA 3LIEA 3WWXA 4IHQA 4OQ0A 3N7WA 1XGIA 2M7VA 1WYBA 3LR0A 3MZEA 3FKWA 2XD1A 4BL3A 3V5MA 2OSUA 4HH2A 2ZM2A 2PD7A 1DP8A 1GSWA 4LV3A 2ZOHA 3UMEA 3N8SA 1KDWA 3P98A 1J3WA 4QD4A 3HL9A 2DNSA 2D02A 4RYEA 3IWQA 1K0KA 1YPRA 4DDYA 3NOTC 1NJ4A 4Q8IA 2WKEA 3K3DA 4S2NA 3H82B 5EFWA 4DMZA 5JYPA 1HZOA 4JXSA 3S7PA 2EWVA 4WN5A 1OTBA 3OZHA 4B4XA 4IVIA 4ZRRA 2HP5A 2XLNA 3VOYA 2XFSA 2H5SA 4DE2A 2JCHA 1NXYA 3T4TA 3FV7A 5HAQA 4S2NC 3M6BA 3TRCA 3P09A 3UPPA 1XX2A 2CC1A 3NIAA 3E0YA 1PW1A 5F83A 3C7VA 4I3IA 1PZOA 5CHMA 3RH8B 1OTEA 3UDIA 3HLDA 1MY8A 4OOMA 1HLUP 3FYZA 3Q82A 2XD5A 1YKDA 2RCXA 4E3IA 4JGPA 5DF9A 3ZQ5A 1G5UA 4IJGA 1XJ3A 4CLCC 2QPNA 1P9RA 4YNRA 2EX6A 2JKTM 3D9YA 5FQMA 2O99A 5FA7A 3MQ0A 4HOIA 4L9FA 2Y2HA 3MSHA 3FZCA 4ZJ2A 1CF0A 2EWWA 1OT9A 4OOYA 1S4RA 5EOOA 4DE3A 2WADA 1TS0A 4R4RA 5EPHA 1ZTUA 5F69A 5TBMA 4YINA 1YLTA 4HJ3A 1J9MA 3GSGA 1K57A 4ID4A 3MKEA 1WA9A 1ESUA 1PRQA 4MDZA 3T1XA 4LCMA 1IYOA 2Y2LA 1S1YA 1N9OA 1RGZA 2GJ3A 5CHUA 5AQ9A 4S2KA 4R4SA 3T4JA 4E04A 5AVEA 1F5MA 3EEHA 4IUHA 4BL2A 2EXBA 3K3CA 4DXCA 4K0XA 3SH7A 1VQQA 3LI9A 2ZM0A 3IBRA 5F82A 5EM1A 2QJ5A 3FKVA 2FFFB 3OOVA 3EEAA 4GN2A 1Y54A 2KLIA 1TDGA 5CXWA 4QB8A 4OQIA 5CTNA 3IS2A 1YT4A 2VGJA 5A90A 3V39A 5L07A 3BQ8A 4GCZA 4S2PA 1W79A 1S1ZA 2XH9A 3UPNA 1E4DA 2WZZA 3PBOA 3CWFA 4IEDA 3NOPC 5MC7A 1ERMA 4K08A 4L9EA 3T4OA 4QY5A 1NRJA 3UE1A 4HHDA 3OCNA 2BG1A 2D01A 5KZHA 4PM6A 3BY8A 5TJJA 2PR6A 4MMNA 5EECA 2P74A 3PBNA 2Q9MA 4B9OA 1M40A 2QYBA 1LHYA 1YSQA 4HI4A 2ZMVA 4EV4A 2Q9NA 2PU2A 5HPFA 3QP8A 4PM5A 1JTGA 3KYZA 5CERA 2QWSA 1RCJA 2XK1A 3WRZA 4EQ1A 3BECA 4HP4A 4JGRA 3MFDA 2ZC5B 1YMXA 2WAFA 1W8QA 4C75A 4E3MA 1KGEA 3T12B 1XA7A 1LLBA 1TF1A 1BT5A 1L2SA 4I38A 4KQDA 4EBPA 1YM1A 1MWUA 4EEPA 1LSXA 2XDMA 3HREA 3BEBA 4Y15A 4MLLA 3QP2A 4G3WA 4LV0A 3G4PA 4N1HA 2LB9A 3FPVA 4IBRA 4I3JA 1GHPA 2HDSA 5FQ9A 2Y55A 2XROA 4BWIA 2XQZA 4UA6A 2L1MA 3T50A 3MF0A 2EA9A 2W3DA 1YQSA 2XSSA 4HEFA 5EM0A 4PM8A 2OLUA 5A91A 3B3XA 4GDNA 2PBDP 5J3WA 4N92A 1TS7A 2WYXA 3A3IA 4ARZA 1MWTA 4PM9A 5EVIC 4KZAA 4JPMA 4ME4A 5A92A 1XGJA 3NCKA 1Z09A 1CJFA 4MEZA 4MN6A 3S7QA 1T18A 3E98A 5GL9A 1ES3A 4EQIA 3LEQA 4FCFA 4G3VA 4C3QA 3E2LA 1YAXA 5A8BA 3SS3A 3TJZC 1RGYA 2W1TB 1VETB 3O3VA 3LCEA 1ACFA 2KX6A 4WBGA 1LSWA 3C4PA 2NUPC 2PDRA 2RL3A 2Y59A 2VGLM 4LV2A 4EWFA 3MMHA 4Y13A 2A3UA 4MN7A 4WZ5C 5M19A 4M3KA 4RVAA 4OPZA 2XEPA 3O5YA 2W3GA 2QJ7A 3UDFA 1G28A 2EX2A 1ZG6A 4LGWA 2V9AA 2R9WA 4S2LA 1PI5A 4R38A 4R3BA 1Y4OA 2B18A 4DJ3A 3IQAA 4R23A 4WELA 3LIAA 5HWTA 2W27A 4B93A 1K6SA 2B95A 5KMWA 4YOFA 1NRFA 5AQBA 3NECA 2WZXA 1BLHA 4EU0A 2QMIA 5DJUA 1H0MA 3TOIA 3OLOA 4K0WA 2EXAA 3ISGA 2JE5A 2EFUA 3JYIA 2Y2MA 4QU3A 2OAP1 3ZVTA 1C3BA 3FG8A 3VOZA 4HBTA 2VGLS 4HNBA 1UWNX 1CI8A 2HV1A 1E3UA 3S7OA 4LRXC 5AVFA 4WL9A 3M6HA 3ZYTA 3B47A 2WGVA 2ZL1A 4E3LA 3P7NA 1VHMA 3WS5A 2J8YA 2V0UA 3UMDA 5HWWA 3VP0A 3ZG8B 5HWVA 4IBXA 4Y7PA 5DFXA 3CITA 4Y0UA 4GJ4A 4KQRA 2PT7A 4GDBA 3W8KA 1TDLA 4Y17A 2H0YA 5L8MA 1CEGA 2PRFA 1H5XA 2JHEA 2ZC3B 3BLSA 1STZA 4OP8A 3PAEA 4EW7A 5FQJA 3C4OA 4KQQA 3ZFZA 2OOLA 3G31A 3BWLA 3UB8A 1MXOA 2Y91A 1OPXA 2JC7A 3IXDA 4UA7A 5F6AA 1GSXA 1P9WA 3E4QA 1MC0A 1S4SA 1F9IA 2XA7S 3G32A 1L0DA 1EWZA 4KZ5A 2BLSA 1PNEA 2X01A 1FCNA 1IEMA 3N8LA 4PPRA 2VV8A 1LL8A 3I7JA 4XXRA 5FDSA 3HJKA 4PKYG 4DXBA 3F1OB 1ES4A 1YLZA 3QP4A 4L0LA 5E2EA 2O9BA 3D72A 1BLSA 4UA9A 2JKRI 1GHIA 1S67L 5HL6A 4HESA 4ZJ1A 2OV5A 5BOHA 2WKRA 5EVLA 1EW0A 1LL5A 5HZHA 5GHZA 1I2WA 5FQQA 4DDSA 1GA0A 2VJWA 1ZKJA 3V50A 4OQHA 1T1AA 3BLMA 4P0MA 3KSFA 4WYYA 1LI9A 3T1RA 4OVDA 3V67A 1SZVA 4GNUA 4S2JA 3MKFA 3CJMA 4WZ4A 3UB5P 3O86A 1D7EA 1YSPA 1IKGA 4DKIA 3E4PA 1KE3A 2UV0E 4KZ9A 4EBNA 4NKPA 5HSQA 3DTEA 4ESPA 2WAEA 2R78A 4X6TA 1BUEA 3CZDA 5HAIA 2V8CA 2CMNA 1H8YA 5IT5A 3FC7A 4X25A 3D3OA 1Z6FA 5F68A 2WKHA 2J3TD 3QHYA 3FPWA 2Q0OA 5HD5A 4XT2A 4KUOA 3VP4A 4LENA 4KG6A 5CTMA 3LIBA 4Y0TA 4DJ2A 3C8CA 2HGVA 3LIFA 5GLCA 4KUKA 1IKIA 3R7WB 4JXWA 2WKQA 4NXEA 4MBFA 4CLCA 4OPRA 2IWBA 4DE1A 4E6XA 3IHAA 4X68A 2GNXA 3VFHA 1ESIA 1OJGA 4QJGA 5CGXA 1CQAA 2HDUA 2W1RA 4H6JA 4HP9A 1T19A 5FAOA 5FEGA 4ZTKA 5GLBA 3WS1A 3BFEA 4O8GA 4Q0HA 4C6YA 2M1CA 3BFGA 2GZAA 1K54C 1SKOA 4ETXA 1O07A 1GA9A 4GD8A 4IVKA 4FD8A 4FUWA 4PAUA 4JGQA 3NDGA 3Q7VB 1AWIA 1F2KA 4EUVA 5DFYA 3W4QA 2A24A 2V0WA 3HLWA 3RJUA 2DRWA 3MFXA 4BBTA 3BM6A 1OTAA 2BTFP 3ZCZA 4BLMA 5G4ZA 5C5KA 5HPIA 1FQGA 2WGWB 4CLCE 5G18A 3CPTB 4NXGA 1TD5A 3KO6A 2PHYA 4ZAMA 2XF3A 4RX3A 4EERA 4I5SA 5IHVA 4WEJA 3PHYA 5EVEA 1PW8A 5DF7A 1KGFA 4WF0A 3VV4A 3FWLA 2H28A 4MN5A 2V8FA 3LGOA 4E3NA 5HFOA 4JF4A 3B33A 3AGEA 1XPBA 3TSGA 2L0WA 3OBFA 2HJEA 1S66L 4R6LA 5TFQA 3M2KA 3OCLA 3CG5A 3VMAA 1ODVA 4UAAA 3A3JA 4WMCA 4GS9B 4Q0IA 1NLZA 1N4OA 2Z6DA 1TEMA 4CQHA 4NEED 4LLOB 1VEUB 3EQUA 2JBFA 5CEBA 1LL9A 3ZNTA 1V9YA 1PWCA 3C7UA 3TW8A 3DBAA 4Z9QA 1Q2QA 1GHMA 4BD0A 3H82A 3VOLA 4Z1WA 5E2FA 2VEAA 4GHIB 1FIKA 2MJ6A 2I72A 3NULA 1KVLA 3CMZA 1PWGA 1NY0A 3OPRA 5FI7A 5CECA 2X71A 4PHTA 4RX2A 3WRTA 1EI5A 1MWSA 5M1AA 4F3LA 3EWKA 3BFDA 4R1GA 4X69A 2AVXA 2V1AA 3HLBA 4JBFA 4OLDA 1G6AA 1K4FA 1FR1A 4OONA 5DTSA 5KSCA 1MKIA 1H8ZA 5TR7A 3MXRA 4BMWA 3UO9A 2HZ5A 3T4QA 3PYPA 4QPRA 1OTIA 1NYYA 2ZL1B 5EVIA 4ETZA 3KSGA 4HH3A 1KDSA 3IX3A 3GMWA 3A3FA 3NJAA 1YMSA 5GHXA 1L0FA 4R0QA 3UB6A 3C5AA 1Q2PA 3GECA 3E4OA 2Z2LB 3IHBA 3MR0A 3N6IA 2JKFA 2WUQA 2ZC6B 5FSRA 3OPPA 2V1ZA 4GZBA 2P9VB 3SH8A 4WZ5A 1QMEA 5AJGA 4H8RA 2ZD8A 5F5YA 1CI9A 2XRNA 4HQAA 2HJ9C 5F1FA 1IELA 2HP6A 5IS1A 1NZUA 3OPHA 3K2NA 4NK3A 1FSWA 5G4YA 3MZFA 3ULFA 2J7VA 3C38A 1UWPX 5FATA 5IU1A 1S0WA 2PBYA 1JWVA 2VZWA 4ZDXA 1YLYA 2DMWA 4X1MA 4Y3IA 3LICA 1JVJA 1I2SA 1XXMA 2VV7A 3F1NA 1NWZA 3IF6B 4BD1A 3AGFA 3R4KA 1ES2A 3A3EA 1BTLA 4L9GA 4E3JA 2WGIA 2XFTA 5FASA 3L7HA 4LFUA 1DJBA 4M4XA 2ZBBA 4B88A 3A0VA 3L9KA 5GLAA 4PKYA 1BZAA 2V2FF 1KGGA 2QZ6A 3IH8A 1JTDA 4MBHA 3LI8A 4KZ3A 1IYSA 1CK3A 3AGDA 3MS6A 3T4LA 5E43A 5AQAA 4YWZA 3Q1FA 5E2HA 3QP6A 2I9VA 5FQIA 3H7WA 3HUNA 1BLPA 3NBLA 1W8YA 3H9WA 4XUZA 1N9LA 1TVFA 1KOUA 2KOIA 4R70A 1BSGA 2Y2KA 2QHKA 3SH9A 2EX8A 5HDDA 3LR4A 1TS8A 1I5QA 4CPKA 1SDEA 3RXXA 2V1BA 1FCMA 4BJPA 2HDQA 1ERQA 2VX8A 3S4XA 1XFQA 2VA0A 1E25A 1OTDA 3PBQA 1T1BA 2YKFA 3CUEC 2W3EA 5DTKA 3DTKA 3IXHA 3A3DA 1K4EA 4ZJ3A 2OLVA 4U0TA 4BBVA 1ES5A 1K56D 1ONHA 2OWHA 5FEFA 5J7EA 5DVAA 1XJ4A 3IBJA 4CLCB 1IFQA 2IA2A 3G34A 2M7UA 3VP2A 4KZ4A 1G68A 4EUZA 2ZQ9A 5FAPA 4AFIA 4I39A 4H6JB 1PZPA 2ZLYA 3PBRA 1S6RA 3LY4A 4B4ZA 4JXGA 3U4LP 3LFVA 3MXSA 4Q0JA 4NETA 4X1LA 5GHYA 2K31A 3BFFA 2Y79A 3JVUA 3CAXA 3EGXC 3GTCA 3SW1A 4BENA 3F1PA 3WS2A 1SKOB 3MZDA 2W1TA 1VETA 2ZOIA 1G6OA 5F1GA 1YLWA 3IWOA 5U47A 4I3AA 2W0NA 1O7EA 2O9CA 4PMAA 4LCLA 1NZOA 5TBMB 3DTMA 2XGNA 1DRMA 3JVVA 1XP4A 1UGUA 4D2OA 3LO7A 4R3JA 3WS4A 1H3QA 1PWDA 3W4OA 3BRMA 1FILA 3ZG9B 1SKFA 3VSLA 4KZ7A 5J8XA 5FQKA 3KSIA 3NI9A 3MXQA 5EE8A 4JXVA 5JYOA 2C6WB 2O9AA 3GDIA 4GKUA 1WYCA 5DJTA 1P97A 3E2KA 2JKRM 3A0RA 1MBLA 2C5WB 4K91A 5KIZA 3IS2B 2L4RA 1SCWA 1Y28A 4HJ4A 1JNUA 3SOIA 3UE0A 5GLDA 3IF6C 1XKZA 1OJ5A 3QNBA 2ZQDA 1QMFA 4P85A 2P04A 1LI0A 4FH2A 1DP9A 2V20A 4S2MA 1IYPA 4X56A 5LBRA 4O7DA 5K5BA 3N8RA 3ITAA 3UE6A 4GLQA 1JWZA 4RA7A 2NUTC 1PI4A 4U0XA 3HLFA 4N9KA 2Z2MB 3W4PA 3IX8A 4KZBA 2Y2JA 4OOLA 4CLCD 1BYWA 4OPYA 1D1JA 2QKPA 5KSHA 3PXPA 2JKTI 3B42A 1K54A 3MQQA 3Q81A 4GOGA 2GX5A 4JF6A 5CEDA 2VKSA 3BYDA 2E8JA 5L10A 2J9PA 4X53A 2X02A 5EOEA 2J3TC 3S22A 4FSFA 4QY6A 2K7SA 4PM7A 4F3LB 4GB7A 4Y5FA 4YFMA 2J80A 3OC2A 1U60A 2A49A 1N9BA 2Y2NA 3ZHHA 2ZQ8A 1EROA 1KE0A 5HARA 4X55A 3VFFA 2ZM8A 3RXWA 3DWZA 3KYQA 5A93A 5EVIB 2KDKA 4N9LA 3IXBA 2PYPA 1IOUA 1ALQA 3ZDJA 3LEZA 3LY3A 1KE4A 3GRJA 4OPQA 3F1OA 3C2WA 3LUQA 2O0YA 3VP3A 4HJ6A 2JN7A 1BLCA 4O0PA 1ZHHB 4KZ6A 4EETB 2FH5A 4ARZB 3G30A 3ZG5A 3MQOA 3TG9A 5D3OA 4FTXA 2ZQAA 5FAQA 3GVBA 3PBTA 4O01A 4OH0A 4JF5A 3HLGA 3S1YA 3JPUA 4NXBA 3Q7ZA 3UY6A 3LR5A 3G2ZA 3O88A 1YLJA 3BY9A 2Y2PA 1AXBA 4KQOA 4N1XA 5AQ7A 2ZQCA 4D60A 5L09A 1K57C 2PYRA 1XA1A 2VV6A 3U2AA 3VSKA 4WMCD 4P6ZM 4NXFA 3QNCA 3IXGA 1DP6A 3GR2A 2B02A 1XFNA 3ZG0A 4FOFA 1CEFA 3V3SA 2FZ0A 3V3RA 2HP9A 3PBSA 1D06A 1SDNA 1BULA 2W3FA 4UQIM 3HUOA 4EBLA 1HVBA 3F1NB 1VB6A 4RQ9A 2P7JA 3M2JA 2H0TA 2ZMFA 3UB7A 5L2FA 1T1CA 5HDSA 3QP1A 2BASA 2WKIA 3EOIA 2FFYA 4JGOA 3MJQA 5CHJA 5DF8A 1X0OA 1MWRA 5J4EA 3R7WA 2DCFA 1W63M 4WLAA 4OP5A 2PAVP 3MBZA 4DRTA 2Y2QA 3EGDC 4IUKA 1KVMA 2ZQ7A 1W5DA 3H7WB 3KYEA 4P6ZS 2YKHA 1FCOA 4HIAA 1ZC2A 3CLOA 1SHVA 4EESA 4KG2A 2HPBA 3UN7A 1TS6A 5EVID 4MNRA 4R3AA 1OMEA 3DAVA 1FSYA 1L0GA 2Y2GA 4JLFA 3IF5A 3UB9A 1LT0A 2VK3A 3HLEA 4UQIS 3LIDA 2P08A 1ONGA 2J3WA 3BW6A 3Q7VA 3CI6A 4CJNA 3OPLA 2G7UA 1PIOA 3SS4A 1K55A 3NC8A 4XUXA 5HD3A 1YLPA 5HX9A 3UPOA 4ZBEA 3KX0X 3NOUC 3RFBA 3T1QB 3NHQA 3BQAA 3DTIA 1GSVA 5E2GA 5HL1A 2WGWA 4HY8A 3CPTA 2Y2OA 5HW3A 4DN0A 4E3OA 4GW9A 4FH4A 2G2UA 3VE3A 1K55C 5CRFA 2ZMAA 2R9XA 2ACGA 2B5RA 5CGWA 3BJNA 5FI6A 5DKLA 4EEUA 3G35A 3F1PB 1WE4A 5FL3A 3TE8A 3ZGAB 2J9OA 1XJ6A 4QWOA 2EX9A 5EUAA 4A5RA 3PAGA 4GS9A 1K38A 4LRZE 3LR3A 3GV9A 4KENB 1VEUA 3ZVWA 1VM1A 4F94A 3VE4A 2LB5A 3VP1A 4LRYC 3ZNYA 3T4KA 4BBUA 3NY4A 2ZJ9A 3Q07A 3ZG7B 1JWPA 2IWDA 5I94A 2Z6CA 4MBKA 2PU4A 2W3HA 4WEKA 1LSVA 4GHIA 4QHCA 4P87A 1OT6A 2Y2IA 3O87A 3KSHA 2PD8A 4E3KA 2VGKA 5FI2A 2HDRA 3G6OA 4KZ8A 4EXOA 2UWXA 2JKGA 5EV0A 2INWA 4WUJA 2PR5A 3UDXA 2K2NA 4II7A 1GCEA 1MZUA 1E3UD 5I5LA 3T1SA 1HD8A 3CUEA 4JKTA 5FDHA 2Y4AA 3HVFA 5HDCA 1FOFA 3HCYA 4GD6A 2XA7M 2ZC7A 3GQZA 5DTTA 1HTZA 1L3LA 2A2LA 1A0KA 3CHWP 3G2YA 4XT2B 4Y2FA 1MKMA 3NDEA 1W63Q 3DWKA 2IWCA 3LYXA 1NYMA 1RP5A 4BQMA 1L0EA 3C30A 4S2IA 5CX7A 3ICYA 4WM9A 1PYYA 3A0SA 3EQVA 1W7FA 2WK0A 2OAQ1 4P6BA 4UEYA 3HJIA 3WS0A 2GDNA 1N9NA 3IWIA 4OLGA 2EFXA 5HAPA 3S7NA 1K56A 4LV1A 4LPZA 3QP5A 3RTYA 3N4IA 1K25A 1K6RA 2P9VA 4E6WA 3IH9A 1PFLA 2ZC4B 4NG2A 3PTEA 4S2OA 3T4SA 5TGFA 1XJ2A 1H8MA 1F98A 4OKPA 5CGSA 3HBRA 4DE0A 5DKKA 4UHUA 3UNWA 3DW0A 3IT9A 2HF6A 4DF6A 1ZG4A 4Y0OA 3SS5A 2G2WA 4HBUA 3SZTA 4KG5A 2OWJA 2WKPA 4MCWA 1V9ZA 3PR6A 2Y8HA 2VLGA 2A24B 2E8IA 3HLCA 4U3TA 1NLYA 3P01A 2H10A 2XR0A
chains in the Genus database with same CATH topology
3W2ZA 2KDKA 4EU0A 2PYPA 1IOUA 5DJUA 3OLOA 4BMWA 3F1OA 3T4QA 3C2WA 3PYPA 3LUQA 2O0YA 4G3KA 4QPRA 4HJ6A 2JN7A 1OTIA 1P0ZA 4O0PA 3UE3A 1ZHHB 2OAP1 4EETB 4ETZA 2FH5A 3LIEA 4ARZB 3KSGA 3MQOA 3FG8A 4HH3A 4IHQA 2M7VA 3LR0A 2VGLS 4HNBA 3NJAA 1UWNX 3PBTA 4O01A 2HV1A 3S7OA 4LRXC 4HH2A 4NXBA 5AVFA 4WL9A 3UB6A 2PD7A 1DP8A 3ZYTA 1GSWA 3B47A 2ZOHA 3LR5A 3P7NA 3UMEA 1VHMA 3GECA 3E4OA 2V0UA 3BY9A 3UMDA 4KQOA 3MR0A 5HWWA 2D02A 5HWVA 2PYRA 2VV6A 3U2AA 5DFXA 3CITA 3NOTC 4GJ4A 5AJGA 2PT7A 4P6ZM 3K3DA 3H82B 5EFWA 4NXFA 5F5YA 5L8MA 4DMZA 2XRNA 4HQAA 1DP6A 3S7PA 2HJ9C 2JHEA 2B02A 1STZA 1XFNA 2EWVA 4EW7A 4WN5A 4FOFA 2OOLA 2FZ0A 1OTBA 3BWLA 5IS1A 3UB8A 4ZRRA 1OPXA 3K2NA 3PBSA 1D06A 5G4YA 2W3FA 3ULFA 4UQIM 3F1NB 1VB6A 3C38A 4RQ9A 2P7JA 3T4TA 1UWPX 5F6AA 1GSXA 3TRCA 2ZMFA 3UB7A 5IU1A 1P9WA 1T1CA 5HDSA 2VZWA 3E4QA 2BASA 3E0YA 1MC0A 1S4SA 1F9IA 2DMWA 2XA7S 4I3IA 3EOIA 4JGOA 3RH8B 1OTEA 3MJQA 4Y3IA 3LICA 4OOMA 2VV7A 1X0OA 3F1NA 1NWZA 2VV8A 1LL8A 5J4EA 1YKDA 3R7WA 3R4KA 3HJKA 4PKYG 4L9GA 3F1OB 1W63M 4JGPA 5DF9A 3ZQ5A 4WLAA 4L0LA 4IJGA 1XJ3A 2O9BA 4CLCC 4M4XA 1P9RA 2ZBBA 3D72A 4YNRA 2JKTM 3EGDC 4IUKA 2JKRI 3A0VA 2O99A 1S67L 3MQ0A 5HL6A 4HOIA 4L9FA 4PKYA 3H7WB 2WKRA 4P6ZS 3LI8A 2YKHA 1EW0A 2EWWA 1OT9A 5HZHA 4HIAA 3CLOA 1S4RA 2VJWA 3T4LA 4EESA 4YWZA 1TS6A 1TS0A 1T1AA 4R3AA 1ZTUA 2I9VA 5F69A 3H7WA 3KSFA 5TBMA 3UB9A 1LT0A 4HJ3A 1WA9A 3V67A 3H9WA 4UQIS 1N9LA 3LIDA 4MDZA 1S1YA 2P08A 1KOUA 1N9OA 2GJ3A 2KOIA 4R70A 2QHKA 2J3WA 3BW6A 3CI6A 3T4JA 4E04A 5AVEA 5HDDA 1F5MA 2G7UA 3LR4A 1D7EA 1TS8A 3EEHA 4IUHA 1YSPA 3K3CA 2V1BA 3E4PA 3LI9A 5HSQA 4NKPA 4BJPA 3IBRA 2QJ5A 5HD3A 3OOVA 2R78A 2VX8A 3KX0X 1XFQA 3EEAA 3NOUC 2VA0A 3RFBA 3NHQA 2KLIA 3BQAA 1GSVA 4HY8A 1OTDA 2CMNA 5IT5A 3PBQA 1T1BA 2YKFA 3CUEC 2W3EA 3IS2A 4DN0A 3FC7A 4GW9A 3D3OA 4BBVA 5F68A 2J3TD 2OWHA 3FPWA 5J7EA 3BQ8A 4GCZA 5HD5A 3VE3A 1XJ4A 3IBJA 4CLCB 4XT2A 1S1ZA 1IFQA 4KUOA 2IA2A 3BJNA 2M7UA 3LIBA 3PBOA 3CWFA 4DJ2A 3C8CA 5DKLA 2HGVA 3LIFA 3NOPC 4EEUA 5MC7A 4AFIA 3F1PB 4I39A 4K08A 4L9EA 5FL3A 4H6JB 4KUKA 3TE8A 3PBRA 3R7WB 3T4OA 1NRJA 3LFVA 1XJ6A 2WKQA 4HHDA 4NXEA 3OCNA 4CLCA 2D01A 4Q0JA 2K31A 3BY8A 4GS9A 5TJJA 2PR6A 4LRZE 2GNXA 4MMNA 2Y79A 3PBNA 1OJGA 3LR3A 3JVUA 3CAXA 4B9OA 3EGXC 3SW1A 3F1PA 2QYBA 2W1RA 4H6JA 1YSQA 2W1TA 4HP9A 2ZOIA 1T19A 4HI4A 2ZMVA 1G6OA 3VE4A 2LB5A 4LRYC 3T4KA 4BBUA 5HPFA 4O8GA 4Q0HA 4I3AA 2M1CA 2W0NA 3KYZA 2Z6CA 2QWSA 2GZAA 2O9CA 4EQ1A 5TBMB 4ETXA 4HP4A 4JGRA 2W3HA 4WEKA 1LSVA 4GHIA 1DRMA 3JVVA 1UGUA 1OT6A 4PAUA 3KSHA 2PD8A 4JGQA 1H3QA 1TF1A 3G6OA 4I38A 4KQDA 4EXOA 4EUVA 4EEPA 5DFYA 1LSXA 2INWA 4WUJA 2PR5A 2A24A 3KSIA 3MXQA 2V0WA 2K2NA 4G3WA 4II7A 1MZUA 3MFXA 5I5LA 3GDIA 2O9AA 4BBTA 1OTAA 5G4ZA 2LB9A 3CUEA 5C5KA 3FPVA 5DJTA 5HPIA 4I3JA 1P97A 4CLCE 2XROA 2JKRM 4BWIA 3A0RA 5HDCA 4NXGA 2L1MA 5KIZA 3IS2B 1TD5A 2L4RA 3KO6A 3MF0A 2EA9A 2PHYA 3T50A 1Y28A 2W3DA 3HCYA 4HJ4A 2XSSA 1JNUA 2XA7M 4EERA 1OJ5A 2A2LA 4I5SA 4WEJA 3PHYA 4XT2B 4Y2FA 5J3WA 1MKMA 1TS7A 1W63Q 4WF0A 3VV4A 2P04A 3LYXA 4ARZA 2H28A 3C30A 4MN5A 5CX7A 3ICYA 1DP9A 3B33A 3A0SA 3EQVA 4ME4A 2L0WA 5LBRA 5K5BA 3OBFA 4MN6A 3S7QA 2OAQ1 4UEYA 2HJEA 1S66L 3HJIA 4GLQA 3OCLA 4R6LA 3UE6A 1T18A 1ODVA 3E98A 2NUTC 4GS9B 4Q0IA 1NLZA 1N9NA 4G3VA 2Z6DA 4CQHA 4NEED 4LLOB 1YAXA 5A8BA 3S7NA 3EQUA 3TJZC 2W1TB 4LPZA 3RTYA 2KX6A 4OOLA 4CLCD 1LSWA 1BYWA 2NUPC 2PDRA 1V9YA 2QKPA 5KSHA 2VGLM 3TW8A 3DBAA 3T4SA 3MMHA 3PXPA 1XJ2A 2JKTI 3B42A 3MQQA 4MN7A 3H82A 3VOLA 1H8MA 2GX5A 4Z1WA 1F98A 2VKSA 5DKKA 2VEAA 4GHIB 3O5YA 2W3GA 2QJ7A 2J3TC 4FSFA 2MJ6A 1G28A 2K7SA 4F3LB 4Y5FA 2HF6A 2J80A 3OC2A 2V9AA 4PHTA 4R38A 2OWJA 2WKPA 4MCWA 2B18A 1V9ZA 3PR6A 2Y8HA 4DJ3A 2VLGA 2A24B 4WELA 3LIAA 1NLYA 5HWTA 2W27A 4B93A 3P01A 4F3LA 4YOFA 3EWKA 3KYQA 2V1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDK A;  2PYP A;  5DJU A;  3OLO A;  3F1O A;  3C2W A;  3PYP A;  3LUQ A;  4HJ6 A;  2JN7 A;  1OTI A;  1P0Z A;  4EET B;  3LIE A;  3MQO A;  3FG8 A;  4HH3 A;  4HNB A;  3NJA A;  1UWN X;  2HV1 A;  4LRX C;  4HH2 A;  4NXB A;  5AVF A;  4WL9 A;  3UB6 A;  2PD7 A;  1DP8 A;  1GSW A;  2ZOH A;  3P7N A;  3UME A;  3GEC A;  3E4O A;  2V0U A;  3BY9 A;  3UMD A;  3MR0 A;  5HWW A;  2D02 A;  5HWV A;  2PYR A;  2VV6 A;  3NOT C;  3K3D A;  3H82 B;  5EFW A;  4NXF A;  5F5Y A;  4HQA A;  1DP6 A;  2JHE A;  2B02 A;  1XFN A;  4EW7 A;  4WN5 A;  2OOL A;  3BWL A;  1OTB A;  5IS1 A;  3UB8 A;  1D06 A;  5G4Y A;  3ULF A;  3F1N B;  1VB6 A;  4RQ9 A;  2P7J A;  1UWP X;  5F6A A;  1GSX A;  3UB7 A;  5IU1 A;  1T1C A;  5HDS A;  3E4Q A;  2BAS A;  1S4S A;  1F9I A;  4I3I A;  4JGO A;  3RH8 B;  1OTE A;  3MJQ A;  3LIC A;  2VV7 A;  1X0O A;  3F1N A;  1NWZ A;  2VV8 A;  1LL8 A;  5J4E A;  3HJK A;  4PKY G;  4L9G A;  3F1O B;  4JGP A;  3ZQ5 A;  4WLA A;  1XJ3 A;  4M4X A;  2ZBB A;  3D72 A;  3A0V A;  1S67 L;  4HOI A;  4L9F A;  4PKY A;  3H7W B;  2WKR A;  3LI8 A;  2YKH A;  1EW0 A;  1OT9 A;  5HZH A;  4HIA A;  3CLO A;  1S4R A;  4EES A;  4YWZ A;  1TS6 A;  1TS0 A;  1T1A A;  4R3A A;  2I9V A;  5F69 A;  3H7W A;  5TBM A;  3UB9 A;  1LT0 A;  4HJ3 A;  1WA9 A;  3H9W A;  1N9L A;  3LID A;  1S1Y A;  1KOU A;  2GJ3 A;  1N9O A;  4R70 A;  2QHK A;  4E04 A;  5AVE A;  5HDD A;  1D7E A;  1TS8 A;  3EEH A;  3K3C A;  2V1B A;  3E4P A;  3LI9 A;  5HSQ A;  3IBR A;  2QJ5 A;  5HD3 A;  2R78 A;  3KX0 X;  1XFQ A;  3NOU C;  3NHQ A;  1GSV A;  4HY8 A;  1OTD A;  2CMN A;  1T1B A;  2YKF A;  3IS2 A;  3FC7 A;  4GW9 A;  4BBV A;  5F68 A;  2OWH A;  5J7E A;  3VE3 A;  4GCZ A;  5HD5 A;  1XJ4 A;  4XT2 A;  1S1Z A;  4KUO A;  3LIB A;  3CWF A;  4DJ2 A;  3C8C A;  5DKL A;  3LIF A;  3NOP C;  4EEU A;  3F1P B;  4I39 A;  4K08 A;  4L9E A;  4H6J B;  4KUK A;  1XJ6 A;  2WKQ A;  4HHD A;  4NXE A;  2D01 A;  3BY8 A;  4GS9 A;  2PR6 A;  4LRZ E;  1OJG A;  3CAX A;  4B9O A;  3SW1 A;  3F1P A;  4H6J A;  4HP9 A;  2ZOI A;  1T19 A;  4HI4 A;  3VE4 A;  4LRY C;  4BBU A;  4I3A A;  2M1C A;  2W0N A;  2Z6C A;  2QWS A;  4EQ1 A;  5TBM B;  4HP4 A;  4JGR A;  1LSV A;  4GHI A;  1DRM A;  1UGU A;  1OT6 A;  2PD8 A;  4JGQ A;  3G6O A;  4I38 A;  4KQD A;  4EXO A;  4EEP A;  1LSX A;  2INW A;  4WUJ A;  2PR5 A;  2A24 A;  3MXQ A;  2V0W A;  1MZU A;  3MFX A;  5I5L A;  3GDI A;  4BBT A;  1OTA A;  5G4Z A;  5DJT A;  4I3J A;  1P97 A;  3A0R A;  5HDC A;  4NXG A;  2L1M A;  5KIZ A;  3IS2 B;  2L4R A;  3T50 A;  2EA9 A;  2PHY A;  1Y28 A;  4HJ4 A;  1JNU A;  4EER A;  1OJ5 A;  4I5S A;  3PHY A;  4XT2 B;  5J3W A;  1TS7 A;  4WF0 A;  3LYX A;  4MN5 A;  2H28 A;  3ICY A;  1DP9 A;  3B33 A;  3A0S A;  2L0W A;  4MN6 A;  3UE6 A;  1S66 L;  3HJI A;  4R6L A;  1T18 A;  1ODV A;  4GS9 B;  1N9N A;  2Z6D A;  4LLO B;  5A8B A;  4LPZ A;  3RTY A;  2KX6 A;  1LSW A;  1BYW A;  2PDR A;  1V9Y A;  2QKP A;  1XJ2 A;  3MQQ A;  3H82 A;  3VOL A;  1F98 A;  5DKK A;  2VEA A;  4GHI B;  2QJ7 A;  1G28 A;  2K7S A;  4F3L B;  2J80 A;  2V9A A;  4R38 A;  2OWJ A;  2WKP A;  1V9Z A;  4DJ3 A;  2VLG A;  2A24 B;  3LIA A;  5HWT A;  2W27 A;  4F3L A;  3EWK A;  2V1A A; 
#chains in the Genus database with same CATH topology
 3IX4 A;  3W2Z A;  3IF6 A;  3BFC A;  3D4F A;  1DJC A;  3ITB A;  1DY6 A;  4G3K A;  4OQG A;  1MPL A;  5M18 A;  1P0Z A;  3HUM A;  3UE3 A;  1FR6 A;  1DJA A;  1M6K A;  1IYQ A;  3LIE A;  3WWX A;  4IHQ A;  4OQ0 A;  3N7W A;  1XGI A;  2M7V A;  1WYB A;  3LR0 A;  3MZE A;  3FKW A;  2XD1 A;  4BL3 A;  3V5M A;  2OSU A;  4HH2 A;  2ZM2 A;  2PD7 A;  1DP8 A;  1GSW A;  4LV3 A;  2ZOH A;  3UME A;  3N8S A;  1KDW A;  3P98 A;  1J3W A;  4QD4 A;  3HL9 A;  2DNS A;  2D02 A;  4RYE A;  3IWQ A;  1K0K A;  1YPR A;  4DDY A;  3NOT C;  1NJ4 A;  4Q8I A;  2WKE A;  3K3D A;  4S2N A;  3H82 B;  5EFW A;  4DMZ A;  5JYP A;  1HZO A;  4JXS A;  3S7P A;  2EWV A;  4WN5 A;  1OTB A;  3OZH A;  4B4X A;  4IVI A;  4ZRR A;  2HP5 A;  2XLN A;  3VOY A;  2XFS A;  2H5S A;  4DE2 A;  2JCH A;  1NXY A;  3T4T A;  3FV7 A;  5HAQ A;  4S2N C;  3M6B A;  3TRC A;  3P09 A;  3UPP A;  1XX2 A;  2CC1 A;  3NIA A;  3E0Y A;  1PW1 A;  5F83 A;  3C7V A;  4I3I A;  1PZO A;  5CHM A;  3RH8 B;  1OTE A;  3UDI A;  3HLD A;  1MY8 A;  4OOM A;  1HLU P;  3FYZ A;  3Q82 A;  2XD5 A;  1YKD A;  2RCX A;  4E3I A;  4JGP A;  5DF9 A;  3ZQ5 A;  1G5U A;  4IJG A;  1XJ3 A;  4CLC C;  2QPN A;  1P9R A;  4YNR A;  2EX6 A;  2JKT M;  3D9Y A;  5FQM A;  2O99 A;  5FA7 A;  3MQ0 A;  4HOI A;  4L9F A;  2Y2H A;  3MSH A;  3FZC A;  4ZJ2 A;  1CF0 A;  2EWW A;  1OT9 A;  4OOY A;  1S4R A;  5EOO A;  4DE3 A;  2WAD A;  1TS0 A;  4R4R A;  5EPH A;  1ZTU A;  5F69 A;  5TBM A;  4YIN A;  1YLT A;  4HJ3 A;  1J9M A;  3GSG A;  1K57 A;  4ID4 A;  3MKE A;  1WA9 A;  1ESU A;  1PRQ A;  4MDZ A;  3T1X A;  4LCM A;  1IYO A;  2Y2L A;  1S1Y A;  1N9O A;  1RGZ A;  2GJ3 A;  5CHU A;  5AQ9 A;  4S2K A;  4R4S A;  3T4J A;  4E04 A;  5AVE A;  1F5M A;  3EEH A;  4IUH A;  4BL2 A;  2EXB A;  3K3C A;  4DXC A;  4K0X A;  3SH7 A;  1VQQ A;  3LI9 A;  2ZM0 A;  3IBR A;  5F82 A;  5EM1 A;  2QJ5 A;  3FKV A;  2FFF B;  3OOV A;  3EEA A;  4GN2 A;  1Y54 A;  2KLI A;  1TDG A;  5CXW A;  4QB8 A;  4OQI A;  5CTN A;  3IS2 A;  1YT4 A;  2VGJ A;  5A90 A;  3V39 A;  5L07 A;  3BQ8 A;  4GCZ A;  4S2P A;  1W79 A;  1S1Z A;  2XH9 A;  3UPN A;  1E4D A;  2WZZ A;  3PBO A;  3CWF A;  4IED A;  3NOP C;  5MC7 A;  1ERM A;  4K08 A;  4L9E A;  3T4O A;  4QY5 A;  1NRJ A;  3UE1 A;  4HHD A;  3OCN A;  2BG1 A;  2D01 A;  5KZH A;  4PM6 A;  3BY8 A;  5TJJ A;  2PR6 A;  4MMN A;  5EEC A;  2P74 A;  3PBN A;  2Q9M A;  4B9O A;  1M40 A;  2QYB A;  1LHY A;  1YSQ A;  4HI4 A;  2ZMV A;  4EV4 A;  2Q9N A;  2PU2 A;  5HPF A;  3QP8 A;  4PM5 A;  1JTG A;  3KYZ A;  5CER A;  2QWS A;  1RCJ A;  2XK1 A;  3WRZ A;  4EQ1 A;  3BEC A;  4HP4 A;  4JGR A;  3MFD A;  2ZC5 B;  1YMX A;  2WAF A;  1W8Q A;  4C75 A;  4E3M A;  1KGE A;  3T12 B;  1XA7 A;  1LLB A;  1TF1 A;  1BT5 A;  1L2S A;  4I38 A;  4KQD A;  4EBP A;  1YM1 A;  1MWU A;  4EEP A;  1LSX A;  2XDM A;  3HRE A;  3BEB A;  4Y15 A;  4MLL A;  3QP2 A;  4G3W A;  4LV0 A;  3G4P A;  4N1H A;  2LB9 A;  3FPV A;  4IBR A;  4I3J A;  1GHP A;  2HDS A;  5FQ9 A;  2Y55 A;  2XRO A;  4BWI A;  2XQZ A;  4UA6 A;  2L1M A;  3T50 A;  3MF0 A;  2EA9 A;  2W3D A;  1YQS A;  2XSS A;  4HEF A;  5EM0 A;  4PM8 A;  2OLU A;  5A91 A;  3B3X A;  4GDN A;  2PBD P;  5J3W A;  4N92 A;  1TS7 A;  2WYX A;  3A3I A;  4ARZ A;  1MWT A;  4PM9 A;  5EVI C;  4KZA A;  4JPM A;  4ME4 A;  5A92 A;  1XGJ A;  3NCK A;  1Z09 A;  1CJF A;  4MEZ A;  4MN6 A;  3S7Q A;  1T18 A;  3E98 A;  5GL9 A;  1ES3 A;  4EQI A;  3LEQ A;  4FCF A;  4G3V A;  4C3Q A;  3E2L A;  1YAX A;  5A8B A;  3SS3 A;  3TJZ C;  1RGY A;  2W1T B;  1VET B;  3O3V A;  3LCE A;  1ACF A;  2KX6 A;  4WBG A;  1LSW A;  3C4P A;  2NUP C;  2PDR A;  2RL3 A;  2Y59 A;  2VGL M;  4LV2 A;  4EWF A;  3MMH A;  4Y13 A;  2A3U A;  4MN7 A;  4WZ5 C;  5M19 A;  4M3K A;  4RVA A;  4OPZ A;  2XEP A;  3O5Y A;  2W3G A;  2QJ7 A;  3UDF A;  1G28 A;  2EX2 A;  1ZG6 A;  4LGW A;  2V9A A;  2R9W A;  4S2L A;  1PI5 A;  4R38 A;  4R3B A;  1Y4O A;  2B18 A;  4DJ3 A;  3IQA A;  4R23 A;  4WEL A;  3LIA A;  5HWT A;  2W27 A;  4B93 A;  1K6S A;  2B95 A;  5KMW A;  4YOF A;  1NRF A;  5AQB A;  3NEC A;  2WZX A;  1BLH A;  4EU0 A;  2QMI A;  5DJU A;  1H0M A;  3TOI A;  3OLO A;  4K0W A;  2EXA A;  3ISG A;  2JE5 A;  2EFU A;  3JYI A;  2Y2M A;  4QU3 A;  2OAP 1;  3ZVT A;  1C3B A;  3FG8 A;  3VOZ A;  4HBT A;  2VGL S;  4HNB A;  1UWN X;  1CI8 A;  2HV1 A;  1E3U A;  3S7O A;  4LRX C;  5AVF A;  4WL9 A;  3M6H A;  3ZYT A;  3B47 A;  2WGV A;  2ZL1 A;  4E3L A;  3P7N A;  1VHM A;  3WS5 A;  2J8Y A;  2V0U A;  3UMD A;  5HWW A;  3VP0 A;  3ZG8 B;  5HWV A;  4IBX A;  4Y7P A;  5DFX A;  3CIT A;  4Y0U A;  4GJ4 A;  4KQR A;  2PT7 A;  4GDB A;  3W8K A;  1TDL A;  4Y17 A;  2H0Y A;  5L8M A;  1CEG A;  2PRF A;  1H5X A;  2JHE A;  2ZC3 B;  3BLS A;  1STZ A;  4OP8 A;  3PAE A;  4EW7 A;  5FQJ A;  3C4O A;  4KQQ A;  3ZFZ A;  2OOL A;  3G31 A;  3BWL A;  3UB8 A;  1MXO A;  2Y91 A;  1OPX A;  2JC7 A;  3IXD A;  4UA7 A;  5F6A A;  1GSX A;  1P9W A;  3E4Q A;  1MC0 A;  1S4S A;  1F9I A;  2XA7 S;  3G32 A;  1L0D A;  1EWZ A;  4KZ5 A;  2BLS A;  1PNE A;  2X01 A;  1FCN A;  1IEM A;  3N8L A;  4PPR A;  2VV8 A;  1LL8 A;  3I7J A;  4XXR A;  5FDS A;  3HJK A;  4PKY G;  4DXB A;  3F1O B;  1ES4 A;  1YLZ A;  3QP4 A;  4L0L A;  5E2E A;  2O9B A;  3D72 A;  1BLS A;  4UA9 A;  2JKR I;  1GHI A;  1S67 L;  5HL6 A;  4HES A;  4ZJ1 A;  2OV5 A;  5BOH A;  2WKR A;  5EVL A;  1EW0 A;  1LL5 A;  5HZH A;  5GHZ A;  1I2W A;  5FQQ A;  4DDS A;  1GA0 A;  2VJW A;  1ZKJ A;  3V50 A;  4OQH A;  1T1A A;  3BLM A;  4P0M A;  3KSF A;  4WYY A;  1LI9 A;  3T1R A;  4OVD A;  3V67 A;  1SZV A;  4GNU A;  4S2J A;  3MKF A;  3CJM A;  4WZ4 A;  3UB5 P;  3O86 A;  1D7E A;  1YSP A;  1IKG A;  4DKI A;  3E4P A;  1KE3 A;  2UV0 E;  4KZ9 A;  4EBN A;  4NKP A;  5HSQ A;  3DTE A;  4ESP A;  2WAE A;  2R78 A;  4X6T A;  1BUE A;  3CZD A;  5HAI A;  2V8C A;  2CMN A;  1H8Y A;  5IT5 A;  3FC7 A;  4X25 A;  3D3O A;  1Z6F A;  5F68 A;  2WKH A;  2J3T D;  3QHY A;  3FPW A;  2Q0O A;  5HD5 A;  4XT2 A;  4KUO A;  3VP4 A;  4LEN A;  4KG6 A;  5CTM A;  3LIB A;  4Y0T A;  4DJ2 A;  3C8C A;  2HGV A;  3LIF A;  5GLC A;  4KUK A;  1IKI A;  3R7W B;  4JXW A;  2WKQ A;  4NXE A;  4MBF A;  4CLC A;  4OPR A;  2IWB A;  4DE1 A;  4E6X A;  3IHA A;  4X68 A;  2GNX A;  3VFH A;  1ESI A;  1OJG A;  4QJG A;  5CGX A;  1CQA A;  2HDU A;  2W1R A;  4H6J A;  4HP9 A;  1T19 A;  5FAO A;  5FEG A;  4ZTK A;  5GLB A;  3WS1 A;  3BFE A;  4O8G A;  4Q0H A;  4C6Y A;  2M1C A;  3BFG A;  2GZA A;  1K54 C;  1SKO A;  4ETX A;  1O07 A;  1GA9 A;  4GD8 A;  4IVK A;  4FD8 A;  4FUW A;  4PAU A;  4JGQ A;  3NDG A;  3Q7V B;  1AWI A;  1F2K A;  4EUV A;  5DFY A;  3W4Q A;  2A24 A;  2V0W A;  3HLW A;  3RJU A;  2DRW A;  3MFX A;  4BBT A;  3BM6 A;  1OTA A;  2BTF P;  3ZCZ A;  4BLM A;  5G4Z A;  5C5K A;  5HPI A;  1FQG A;  2WGW B;  4CLC E;  5G18 A;  3CPT B;  4NXG A;  1TD5 A;  3KO6 A;  2PHY A;  4ZAM A;  2XF3 A;  4RX3 A;  4EER A;  4I5S A;  5IHV A;  4WEJ A;  3PHY A;  5EVE A;  1PW8 A;  5DF7 A;  1KGF A;  4WF0 A;  3VV4 A;  3FWL A;  2H28 A;  4MN5 A;  2V8F A;  3LGO A;  4E3N A;  5HFO A;  4JF4 A;  3B33 A;  3AGE A;  1XPB A;  3TSG A;  2L0W A;  3OBF A;  2HJE A;  1S66 L;  4R6L A;  5TFQ A;  3M2K A;  3OCL A;  3CG5 A;  3VMA A;  1ODV A;  4UAA A;  3A3J A;  4WMC A;  4GS9 B;  4Q0I A;  1NLZ A;  1N4O A;  2Z6D A;  1TEM A;  4CQH A;  4NEE D;  4LLO B;  1VEU B;  3EQU A;  2JBF A;  5CEB A;  1LL9 A;  3ZNT A;  1V9Y A;  1PWC A;  3C7U A;  3TW8 A;  3DBA A;  4Z9Q A;  1Q2Q A;  1GHM A;  4BD0 A;  3H82 A;  3VOL A;  4Z1W A;  5E2F A;  2VEA A;  4GHI B;  1FIK A;  2MJ6 A;  2I72 A;  3NUL A;  1KVL A;  3CMZ A;  1PWG A;  1NY0 A;  3OPR A;  5FI7 A;  5CEC A;  2X71 A;  4PHT A;  4RX2 A;  3WRT A;  1EI5 A;  1MWS A;  5M1A A;  4F3L A;  3EWK A;  3BFD A;  4R1G A;  4X69 A;  2AVX A;  2V1A A;  3HLB A;  4JBF A;  4OLD A;  1G6A A;  1K4F A;  1FR1 A;  4OON A;  5DTS A;  5KSC A;  1MKI A;  1H8Z A;  5TR7 A;  3MXR A;  4BMW A;  3UO9 A;  2HZ5 A;  3T4Q A;  3PYP A;  4QPR A;  1OTI A;  1NYY A;  2ZL1 B;  5EVI A;  4ETZ A;  3KSG A;  4HH3 A;  1KDS A;  3IX3 A;  3GMW A;  3A3F A;  3NJA A;  1YMS A;  5GHX A;  1L0F A;  4R0Q A;  3UB6 A;  3C5A A;  1Q2P A;  3GEC A;  3E4O A;  2Z2L B;  3IHB A;  3MR0 A;  3N6I A;  2JKF A;  2WUQ A;  2ZC6 B;  5FSR A;  3OPP A;  2V1Z A;  4GZB A;  2P9V B;  3SH8 A;  4WZ5 A;  1QME A;  5AJG A;  4H8R A;  2ZD8 A;  5F5Y A;  1CI9 A;  2XRN A;  4HQA A;  2HJ9 C;  5F1F A;  1IEL A;  2HP6 A;  5IS1 A;  1NZU A;  3OPH A;  3K2N A;  4NK3 A;  1FSW A;  5G4Y A;  3MZF A;  3ULF A;  2J7V A;  3C38 A;  1UWP X;  5FAT A;  5IU1 A;  1S0W A;  2PBY A;  1JWV A;  2VZW A;  4ZDX A;  1YLY A;  2DMW A;  4X1M A;  4Y3I A;  3LIC A;  1JVJ A;  1I2S A;  1XXM A;  2VV7 A;  3F1N A;  1NWZ A;  3IF6 B;  4BD1 A;  3AGF A;  3R4K A;  1ES2 A;  3A3E A;  1BTL A;  4L9G A;  4E3J A;  2WGI A;  2XFT A;  5FAS A;  3L7H A;  4LFU A;  1DJB A;  4M4X A;  2ZBB A;  4B88 A;  3A0V A;  3L9K A;  5GLA A;  4PKY A;  1BZA A;  2V2F F;  1KGG A;  2QZ6 A;  3IH8 A;  1JTD A;  4MBH A;  3LI8 A;  4KZ3 A;  1IYS A;  1CK3 A;  3AGD A;  3MS6 A;  3T4L A;  5E43 A;  5AQA A;  4YWZ A;  3Q1F A;  5E2H A;  3QP6 A;  2I9V A;  5FQI A;  3H7W A;  3HUN A;  1BLP A;  3NBL A;  1W8Y A;  3H9W A;  4XUZ A;  1N9L A;  1TVF A;  1KOU A;  2KOI A;  4R70 A;  1BSG A;  2Y2K A;  2QHK A;  3SH9 A;  2EX8 A;  5HDD A;  3LR4 A;  1TS8 A;  1I5Q A;  4CPK A;  1SDE A;  3RXX A;  2V1B A;  1FCM A;  4BJP A;  2HDQ A;  1ERQ A;  2VX8 A;  3S4X A;  1XFQ A;  2VA0 A;  1E25 A;  1OTD A;  3PBQ A;  1T1B A;  2YKF A;  3CUE C;  2W3E A;  5DTK A;  3DTK A;  3IXH A;  3A3D A;  1K4E A;  4ZJ3 A;  2OLV A;  4U0T A;  4BBV A;  1ES5 A;  1K56 D;  1ONH A;  2OWH A;  5FEF A;  5J7E A;  5DVA A;  1XJ4 A;  3IBJ A;  4CLC B;  1IFQ A;  2IA2 A;  3G34 A;  2M7U A;  3VP2 A;  4KZ4 A;  1G68 A;  4EUZ A;  2ZQ9 A;  5FAP A;  4AFI A;  4I39 A;  4H6J B;  1PZP A;  2ZLY A;  3PBR A;  1S6R A;  3LY4 A;  4B4Z A;  4JXG A;  3U4L P;  3LFV A;  3MXS A;  4Q0J A;  4NET A;  4X1L A;  5GHY A;  2K31 A;  3BFF A;  2Y79 A;  3JVU A;  3CAX A;  3EGX C;  3GTC A;  3SW1 A;  4BEN A;  3F1P A;  3WS2 A;  1SKO B;  3MZD A;  2W1T A;  1VET A;  2ZOI A;  1G6O A;  5F1G A;  1YLW A;  3IWO A;  5U47 A;  4I3A A;  2W0N A;  1O7E A;  2O9C A;  4PMA A;  4LCL A;  1NZO A;  5TBM B;  3DTM A;  2XGN A;  1DRM A;  3JVV A;  1XP4 A;  1UGU A;  4D2O A;  3LO7 A;  4R3J A;  3WS4 A;  1H3Q A;  1PWD A;  3W4O A;  3BRM A;  1FIL A;  3ZG9 B;  1SKF A;  3VSL A;  4KZ7 A;  5J8X A;  5FQK A;  3KSI A;  3NI9 A;  3MXQ A;  5EE8 A;  4JXV A;  5JYO A;  2C6W B;  2O9A A;  3GDI A;  4GKU A;  1WYC A;  5DJT A;  1P97 A;  3E2K A;  2JKR M;  3A0R A;  1MBL A;  2C5W B;  4K91 A;  5KIZ A;  3IS2 B;  2L4R A;  1SCW A;  1Y28 A;  4HJ4 A;  1JNU A;  3SOI A;  3UE0 A;  5GLD A;  3IF6 C;  1XKZ A;  1OJ5 A;  3QNB A;  2ZQD A;  1QMF A;  4P85 A;  2P04 A;  1LI0 A;  4FH2 A;  1DP9 A;  2V20 A;  4S2M A;  1IYP A;  4X56 A;  5LBR A;  4O7D A;  5K5B A;  3N8R A;  3ITA A;  3UE6 A;  4GLQ A;  1JWZ A;  4RA7 A;  2NUT C;  1PI4 A;  4U0X A;  3HLF A;  4N9K A;  2Z2M B;  3W4P A;  3IX8 A;  4KZB A;  2Y2J A;  4OOL A;  4CLC D;  1BYW A;  4OPY A;  1D1J A;  2QKP A;  5KSH A;  3PXP A;  2JKT I;  3B42 A;  1K54 A;  3MQQ A;  3Q81 A;  4GOG A;  2GX5 A;  4JF6 A;  5CED A;  2VKS A;  3BYD A;  2E8J A;  5L10 A;  2J9P A;  4X53 A;  2X02 A;  5EOE A;  2J3T C;  3S22 A;  4FSF A;  4QY6 A;  2K7S A;  4PM7 A;  4F3L B;  4GB7 A;  4Y5F A;  4YFM A;  2J80 A;  3OC2 A;  1U60 A;  2A49 A;  1N9B A;  2Y2N A;  3ZHH A;  2ZQ8 A;  1ERO A;  1KE0 A;  5HAR A;  4X55 A;  3VFF A;  2ZM8 A;  3RXW A;  3DWZ A;  3KYQ A;  5A93 A;  5EVI B;  2KDK A;  4N9L A;  3IXB A;  2PYP A;  1IOU A;  1ALQ A;  3ZDJ A;  3LEZ A;  3LY3 A;  1KE4 A;  3GRJ A;  4OPQ A;  3F1O A;  3C2W A;  3LUQ A;  2O0Y A;  3VP3 A;  4HJ6 A;  2JN7 A;  1BLC A;  4O0P A;  1ZHH B;  4KZ6 A;  4EET B;  2FH5 A;  4ARZ B;  3G30 A;  3ZG5 A;  3MQO A;  3TG9 A;  5D3O A;  4FTX A;  2ZQA A;  5FAQ A;  3GVB A;  3PBT A;  4O01 A;  4OH0 A;  4JF5 A;  3HLG A;  3S1Y A;  3JPU A;  4NXB A;  3Q7Z A;  3UY6 A;  3LR5 A;  3G2Z A;  3O88 A;  1YLJ A;  3BY9 A;  2Y2P A;  1AXB A;  4KQO A;  4N1X A;  5AQ7 A;  2ZQC A;  4D60 A;  5L09 A;  1K57 C;  2PYR A;  1XA1 A;  2VV6 A;  3U2A A;  3VSK A;  4WMC D;  4P6Z M;  4NXF A;  3QNC A;  3IXG A;  1DP6 A;  3GR2 A;  2B02 A;  1XFN A;  3ZG0 A;  4FOF A;  1CEF A;  3V3S A;  2FZ0 A;  3V3R A;  2HP9 A;  3PBS A;  1D06 A;  1SDN A;  1BUL A;  2W3F A;  4UQI M;  3HUO A;  4EBL A;  1HVB A;  3F1N B;  1VB6 A;  4RQ9 A;  2P7J A;  3M2J A;  2H0T A;  2ZMF A;  3UB7 A;  5L2F A;  1T1C A;  5HDS A;  3QP1 A;  2BAS A;  2WKI A;  3EOI A;  2FFY A;  4JGO A;  3MJQ A;  5CHJ A;  5DF8 A;  1X0O A;  1MWR A;  5J4E A;  3R7W A;  2DCF A;  1W63 M;  4WLA A;  4OP5 A;  2PAV P;  3MBZ A;  4DRT A;  2Y2Q A;  3EGD C;  4IUK A;  1KVM A;  2ZQ7 A;  1W5D A;  3H7W B;  3KYE A;  4P6Z S;  2YKH A;  1FCO A;  4HIA A;  1ZC2 A;  3CLO A;  1SHV A;  4EES A;  4KG2 A;  2HPB A;  3UN7 A;  1TS6 A;  5EVI D;  4MNR A;  4R3A A;  1OME A;  3DAV A;  1FSY A;  1L0G A;  2Y2G A;  4JLF A;  3IF5 A;  3UB9 A;  1LT0 A;  2VK3 A;  3HLE A;  4UQI S;  3LID A;  2P08 A;  1ONG A;  2J3W A;  3BW6 A;  3Q7V A;  3CI6 A;  4CJN A;  3OPL A;  2G7U A;  1PIO A;  3SS4 A;  1K55 A;  3NC8 A;  4XUX A;  5HD3 A;  1YLP A;  5HX9 A;  3UPO A;  4ZBE A;  3KX0 X;  3NOU C;  3RFB A;  3T1Q B;  3NHQ A;  3BQA A;  3DTI A;  1GSV A;  5E2G A;  5HL1 A;  2WGW A;  4HY8 A;  3CPT A;  2Y2O A;  5HW3 A;  4DN0 A;  4E3O A;  4GW9 A;  4FH4 A;  2G2U A;  3VE3 A;  1K55 C;  5CRF A;  2ZMA A;  2R9X A;  2ACG A;  2B5R A;  5CGW A;  3BJN A;  5FI6 A;  5DKL A;  4EEU A;  3G35 A;  3F1P B;  1WE4 A;  5FL3 A;  3TE8 A;  3ZGA B;  2J9O A;  1XJ6 A;  4QWO A;  2EX9 A;  5EUA A;  4A5R A;  3PAG A;  4GS9 A;  1K38 A;  4LRZ E;  3LR3 A;  3GV9 A;  4KEN B;  1VEU A;  3ZVW A;  1VM1 A;  4F94 A;  3VE4 A;  2LB5 A;  3VP1 A;  4LRY C;  3ZNY A;  3T4K A;  4BBU A;  3NY4 A;  2ZJ9 A;  3Q07 A;  3ZG7 B;  1JWP A;  2IWD A;  5I94 A;  2Z6C A;  4MBK A;  2PU4 A;  2W3H A;  4WEK A;  1LSV A;  4GHI A;  4QHC A;  4P87 A;  1OT6 A;  2Y2I A;  3O87 A;  3KSH A;  2PD8 A;  4E3K A;  2VGK A;  5FI2 A;  2HDR A;  3G6O A;  4KZ8 A;  4EXO A;  2UWX A;  2JKG A;  5EV0 A;  2INW A;  4WUJ A;  2PR5 A;  3UDX A;  2K2N A;  4II7 A;  1GCE A;  1MZU A;  1E3U D;  5I5L A;  3T1S A;  1HD8 A;  3CUE A;  4JKT A;  5FDH A;  2Y4A A;  3HVF A;  5HDC A;  1FOF A;  3HCY A;  4GD6 A;  2XA7 M;  2ZC7 A;  3GQZ A;  5DTT A;  1HTZ A;  1L3L A;  2A2L A;  1A0K A;  3CHW P;  3G2Y A;  4XT2 B;  4Y2F A;  1MKM A;  3NDE A;  1W63 Q;  3DWK A;  2IWC A;  3LYX A;  1NYM A;  1RP5 A;  4BQM A;  1L0E A;  3C30 A;  4S2I A;  5CX7 A;  3ICY A;  4WM9 A;  1PYY A;  3A0S A;  3EQV A;  1W7F A;  2WK0 A;  2OAQ 1;  4P6B A;  4UEY A;  3HJI A;  3WS0 A;  2GDN A;  1N9N A;  3IWI A;  4OLG A;  2EFX A;  5HAP A;  3S7N A;  1K56 A;  4LV1 A;  4LPZ A;  3QP5 A;  3RTY A;  3N4I A;  1K25 A;  1K6R A;  2P9V A;  4E6W A;  3IH9 A;  1PFL A;  2ZC4 B;  4NG2 A;  3PTE A;  4S2O A;  3T4S A;  5TGF A;  1XJ2 A;  1H8M A;  1F98 A;  4OKP A;  5CGS A;  3HBR A;  4DE0 A;  5DKK A;  4UHU A;  3UNW A;  3DW0 A;  3IT9 A;  2HF6 A;  4DF6 A;  1ZG4 A;  4Y0O A;  3SS5 A;  2G2W A;  4HBU A;  3SZT A;  4KG5 A;  2OWJ A;  2WKP A;  4MCW A;  1V9Z A;  3PR6 A;  2Y8H A;  2VLG A;  2A24 B;  2E8I A;  3HLC A;  4U3T A;  1NLY A;  3P01 A;  2H10 A;  2XR0 A; 
#chains in the Genus database with same CATH homology
 3W2Z A;  2KDK A;  4EU0 A;  2PYP A;  1IOU A;  5DJU A;  3OLO A;  4BMW A;  3F1O A;  3T4Q A;  3C2W A;  3PYP A;  3LUQ A;  2O0Y A;  4G3K A;  4QPR A;  4HJ6 A;  2JN7 A;  1OTI A;  1P0Z A;  4O0P A;  3UE3 A;  1ZHH B;  2OAP 1;  4EET B;  4ETZ A;  2FH5 A;  3LIE A;  4ARZ B;  3KSG A;  3MQO A;  3FG8 A;  4HH3 A;  4IHQ A;  2M7V A;  3LR0 A;  2VGL S;  4HNB A;  3NJA A;  1UWN X;  3PBT A;  4O01 A;  2HV1 A;  3S7O A;  4LRX C;  4HH2 A;  4NXB A;  5AVF A;  4WL9 A;  3UB6 A;  2PD7 A;  1DP8 A;  3ZYT A;  1GSW A;  3B47 A;  2ZOH A;  3LR5 A;  3P7N A;  3UME A;  1VHM A;  3GEC A;  3E4O A;  2V0U A;  3BY9 A;  3UMD A;  4KQO A;  3MR0 A;  5HWW A;  2D02 A;  5HWV A;  2PYR A;  2VV6 A;  3U2A A;  5DFX A;  3CIT A;  3NOT C;  4GJ4 A;  5AJG A;  2PT7 A;  4P6Z M;  3K3D A;  3H82 B;  5EFW A;  4NXF A;  5F5Y A;  5L8M A;  4DMZ A;  2XRN A;  4HQA A;  1DP6 A;  3S7P A;  2HJ9 C;  2JHE A;  2B02 A;  1STZ A;  1XFN A;  2EWV A;  4EW7 A;  4WN5 A;  4FOF A;  2OOL A;  2FZ0 A;  1OTB A;  3BWL A;  5IS1 A;  3UB8 A;  4ZRR A;  1OPX A;  3K2N A;  3PBS A;  1D06 A;  5G4Y A;  2W3F A;  3ULF A;  4UQI M;  3F1N B;  1VB6 A;  3C38 A;  4RQ9 A;  2P7J A;  3T4T A;  1UWP X;  5F6A A;  1GSX A;  3TRC A;  2ZMF A;  3UB7 A;  5IU1 A;  1P9W A;  1T1C A;  5HDS A;  2VZW A;  3E4Q A;  2BAS A;  3E0Y A;  1MC0 A;  1S4S A;  1F9I A;  2DMW A;  2XA7 S;  4I3I A;  3EOI A;  4JGO A;  3RH8 B;  1OTE A;  3MJQ A;  4Y3I A;  3LIC A;  4OOM A;  2VV7 A;  1X0O A;  3F1N A;  1NWZ A;  2VV8 A;  1LL8 A;  5J4E A;  1YKD A;  3R7W A;  3R4K A;  3HJK A;  4PKY G;  4L9G A;  3F1O B;  1W63 M;  4JGP A;  5DF9 A;  3ZQ5 A;  4WLA A;  4L0L A;  4IJG A;  1XJ3 A;  2O9B A;  4CLC C;  4M4X A;  1P9R A;  2ZBB A;  3D72 A;  4YNR A;  2JKT M;  3EGD C;  4IUK A;  2JKR I;  3A0V A;  2O99 A;  1S67 L;  3MQ0 A;  5HL6 A;  4HOI A;  4L9F A;  4PKY A;  3H7W B;  2WKR A;  4P6Z S;  3LI8 A;  2YKH A;  1EW0 A;  2EWW A;  1OT9 A;  5HZH A;  4HIA A;  3CLO A;  1S4R A;  2VJW A;  3T4L A;  4EES A;  4YWZ A;  1TS6 A;  1TS0 A;  1T1A A;  4R3A A;  1ZTU A;  2I9V A;  5F69 A;  3H7W A;  3KSF A;  5TBM A;  3UB9 A;  1LT0 A;  4HJ3 A;  1WA9 A;  3V67 A;  3H9W A;  4UQI S;  1N9L A;  3LID A;  4MDZ A;  1S1Y A;  2P08 A;  1KOU A;  1N9O A;  2GJ3 A;  2KOI A;  4R70 A;  2QHK A;  2J3W A;  3BW6 A;  3CI6 A;  3T4J A;  4E04 A;  5AVE A;  5HDD A;  1F5M A;  2G7U A;  3LR4 A;  1D7E A;  1TS8 A;  3EEH A;  4IUH A;  1YSP A;  3K3C A;  2V1B A;  3E4P A;  3LI9 A;  5HSQ A;  4NKP A;  4BJP A;  3IBR A;  2QJ5 A;  5HD3 A;  3OOV A;  2R78 A;  2VX8 A;  3KX0 X;  1XFQ A;  3EEA A;  3NOU C;  2VA0 A;  3RFB A;  3NHQ A;  2KLI A;  3BQA A;  1GSV A;  4HY8 A;  1OTD A;  2CMN A;  5IT5 A;  3PBQ A;  1T1B A;  2YKF A;  3CUE C;  2W3E A;  3IS2 A;  4DN0 A;  3FC7 A;  4GW9 A;  3D3O A;  4BBV A;  5F68 A;  2J3T D;  2OWH A;  3FPW A;  5J7E A;  3BQ8 A;  4GCZ A;  5HD5 A;  3VE3 A;  1XJ4 A;  3IBJ A;  4CLC B;  4XT2 A;  1S1Z A;  1IFQ A;  4KUO A;  2IA2 A;  3BJN A;  2M7U A;  3LIB A;  3PBO A;  3CWF A;  4DJ2 A;  3C8C A;  5DKL A;  2HGV A;  3LIF A;  3NOP C;  4EEU A;  5MC7 A;  4AFI A;  3F1P B;  4I39 A;  4K08 A;  4L9E A;  5FL3 A;  4H6J B;  4KUK A;  3TE8 A;  3PBR A;  3R7W B;  3T4O A;  1NRJ A;  3LFV A;  1XJ6 A;  2WKQ A;  4HHD A;  4NXE A;  3OCN A;  4CLC A;  2D01 A;  4Q0J A;  2K31 A;  3BY8 A;  4GS9 A;  5TJJ A;  2PR6 A;  4LRZ E;  2GNX A;  4MMN A;  2Y79 A;  3PBN A;  1OJG A;  3LR3 A;  3JVU A;  3CAX A;  4B9O A;  3EGX C;  3SW1 A;  3F1P A;  2QYB A;  2W1R A;  4H6J A;  1YSQ A;  2W1T A;  4HP9 A;  2ZOI A;  1T19 A;  4HI4 A;  2ZMV A;  1G6O A;  3VE4 A;  2LB5 A;  4LRY C;  3T4K A;  4BBU A;  5HPF A;  4O8G A;  4Q0H A;  4I3A A;  2M1C A;  2W0N A;  3KYZ A;  2Z6C A;  2QWS A;  2GZA A;  2O9C A;  4EQ1 A;  5TBM B;  4ETX A;  4HP4 A;  4JGR A;  2W3H A;  4WEK A;  1LSV A;  4GHI A;  1DRM A;  3JVV A;  1UGU A;  1OT6 A;  4PAU A;  3KSH A;  2PD8 A;  4JGQ A;  1H3Q A;  1TF1 A;  3G6O A;  4I38 A;  4KQD A;  4EXO A;  4EUV A;  4EEP A;  5DFY A;  1LSX A;  2INW A;  4WUJ A;  2PR5 A;  2A24 A;  3KSI A;  3MXQ A;  2V0W A;  2K2N A;  4G3W A;  4II7 A;  1MZU A;  3MFX A;  5I5L A;  3GDI A;  2O9A A;  4BBT A;  1OTA A;  5G4Z A;  2LB9 A;  3CUE A;  5C5K A;  3FPV A;  5DJT A;  5HPI A;  4I3J A;  1P97 A;  4CLC E;  2XRO A;  2JKR M;  4BWI A;  3A0R A;  5HDC A;  4NXG A;  2L1M A;  5KIZ A;  3IS2 B;  1TD5 A;  2L4R A;  3KO6 A;  3MF0 A;  2EA9 A;  2PHY A;  3T50 A;  1Y28 A;  2W3D A;  3HCY A;  4HJ4 A;  2XSS A;  1JNU A;  2XA7 M;  4EER A;  1OJ5 A;  2A2L A;  4I5S A;  4WEJ A;  3PHY A;  4XT2 B;  4Y2F A;  5J3W A;  1MKM A;  1TS7 A;  1W63 Q;  4WF0 A;  3VV4 A;  2P04 A;  3LYX A;  4ARZ A;  2H28 A;  3C30 A;  4MN5 A;  5CX7 A;  3ICY A;  1DP9 A;  3B33 A;  3A0S A;  3EQV A;  4ME4 A;  2L0W A;  5LBR A;  5K5B A;  3OBF A;  4MN6 A;  3S7Q A;  2OAQ 1;  4UEY A;  2HJE A;  1S66 L;  3HJI A;  4GLQ A;  3OCL A;  4R6L A;  3UE6 A;  1T18 A;  1ODV A;  3E98 A;  2NUT C;  4GS9 B;  4Q0I A;  1NLZ A;  1N9N A;  4G3V A;  2Z6D A;  4CQH A;  4NEE D;  4LLO B;  1YAX A;  5A8B A;  3S7N A;  3EQU A;  3TJZ C;  2W1T B;  4LPZ A;  3RTY A;  2KX6 A;  4OOL A;  4CLC D;  1LSW A;  1BYW A;  2NUP C;  2PDR A;  1V9Y A;  2QKP A;  5KSH A;  2VGL M;  3TW8 A;  3DBA A;  3T4S A;  3MMH A;  3PXP A;  1XJ2 A;  2JKT I;  3B42 A;  3MQQ A;  4MN7 A;  3H82 A;  3VOL A;  1H8M A;  2GX5 A;  4Z1W A;  1F98 A;  2VKS A;  5DKK A;  2VEA A;  4GHI B;  3O5Y A;  2W3G A;  2QJ7 A;  2J3T C;  4FSF A;  2MJ6 A;  1G28 A;  2K7S A;  4F3L B;  4Y5F A;  2HF6 A;  2J80 A;  3OC2 A;  2V9A A;  4PHT A;  4R38 A;  2OWJ A;  2WKP A;  4MCW A;  2B18 A;  1V9Z A;  3PR6 A;  2Y8H A;  4DJ3 A;  2VLG A;  2A24 B;  4WEL A;  3LIA A;  1NLY A;  5HWT A;  2W27 A;  4B93 A;  3P01 A;  4F3L A;  4YOF A;  3EWK A;  3KYQ A;  2V1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...