3C8CA

Crystal structure of mcp_n and cache domains of methyl-accepting chemotaxis protein from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
240
structure length
240
Chain Sequence
SLRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIENNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mcp_N and cache N-terminal domains of methyl-accepting chemotaxis protein from Vibrio cholerae.
rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Structural genomics, unknown function
molecule keywords Methyl-accepting chemotaxis protein
total genus 79
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3c8cA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3c8cA02
1ODVA 2PR5A 4HJ4A 4GCZA 1LSVA 1OJ5A 1T1AA 1OJGA 4HJ6A 3LIAA 3EWKA 4MN6A 3H82A 2P7JA 1TS8A 4K08A 3RTYA 1T19A 4BBTA 2EA9A 3PYPA 2PR6A 5HWWA 3LICA 4M4XA 1V9ZA 1BYWA 3B33A 4JGOA 4LPZA 4WN5A 2R78A 1UWPX 5J7EA 3LI9A 3NOPC 4GS9A 2D02A 4L9FA 2PDRA 2V9AA 3CAXA 2VV6A 5I5LA 5HDDA 1OTAA 3H7WB 4DJ2A 2WKPA 4GW9A 4HP9A 4NXFA 4HH2A 3CLOA 3RH8B 3UMEA 4B9OA 3EEHA 5IS1A 4EEPA 4NXGA 3LIDA 4KUOA 2V1AA 2YKFA 3NJAA 2VV7A 1UGUA 3MFXA 3MQQA 3H7WA 2WKRA 4HY8A 3MXQA 4I3AA 5EFWA 4BBVA 1D06A 5DKLA 1DP8A 2VEAA 2QHKA 3FG8A 3UMDA 2YKHA 4LLOB 3UE6A 4HIAA 2JN7A 4MN5A 4EERA 3MR0A 4LRXC 2D01A 3A0SA 4F3LB 2PYRA 4BBUA 1JNUA 4YWZA 1XJ6A 5TBMA 3F1PB 3UB7A 2V1BA 2WKQA 1XJ4A 5DJTA 5HDCA 3E4PA 2PHYA 2V0WA 2KDKA 3FC7A 1F98A 4LRYC 4EESA 5J4EA 2Z6CA 1OT9A 2QJ7A 2L1MA 4I39A 1GSVA 3GDIA 4R6LA 2ZBBA 5J3WA 3OLOA 4DJ3A 4EQ1A 4HOIA 1OTDA 2QWSA 4HJ3A 3G6OA 2K7SA 3CWFA 3IS2B 4I5SA 5DKKA 5F68A 3K3CA 4HH3A 4LRZE 5KIZA 3LIFA 4I38A 1Y28A 3A0VA 1OTEA 5HD5A 2CMNA 1LSXA 5F69A 4GS9B 2J80A 4I3IA 3VE3A 3H82B 3F1OA 1S67L 5HWVA 3D72A 1UWNX 4JGQA 2GJ3A 3LIEA 4L9EA 4NXBA 4WF0A 4E04A 4KUKA 3HJIA 1T1BA 1D7EA 4HQAA 4RQ9A 1GSWA 1KOUA 4PKYA 1NWZA 4R70A 2PD8A 3UB8A 5AVFA 1OTIA 2HV1A 3F1OB 2W0NA 1P0ZA 4WL9A 1OT6A 4EXOA 1WA9A 1GSXA 4H6JA 1T18A 2Z6DA 4R3AA 1DP9A 3VOLA 3NOTC 3P7NA 4EETB 1TS7A 2B02A 3E4QA 3LYXA 3BY8A 3LIBA 1N9LA 2M1CA 3LUQA 3ICYA 5IU1A 3ZQ5A 1LL8A 1F9IA 1T1CA 2A24B 2W27A 4JGPA 4R38A 1LSWA 3E4OA 2A24A 4H6JB 4WUJA 5F6AA 5AVEA 5G4ZA 4HHDA 2PD7A 3T50A 3VE4A 3IBRA 2QJ5A 1TS0A 2VV8A 2I9VA 2QKPA 2L0WA 3LI8A 1S4RA 3K3DA 4NXEA 3UB9A 3MJQA 4WLAA 4EEUA 5HDSA 1G28A 3NOUC 2ZOIA 4JGRA 3IS2A 4PKYG 1MZUA 1S4SA 1XFQA 3F1NB 3MQOA 2KX6A 3F1PA 5HWTA 1LT0A 3F1NA 4EW7A 3BWLA 5A8BA 4F3LA 3GECA 4XT2A 3UB6A 4XT2B 1V9YA 2OOLA 4HNBA 4I3JA 2ZOHA 3C8CA 1TS6A 1N9OA 3PHYA 2V0UA 3NHQA 5TBMB 5F5YA 3HJKA 1S66L 1XJ2A 2L4RA 2H28A 1N9NA 1EW0A 1DP6A 1S1YA 2OWHA 1OTBA 1XFNA 3C2WA 4HI4A 4GHIB 4L9GA 3ULFA 1VB6A 2PYPA 2VLGA 3A0RA 4GHIA 4HP4A 4KQDA 3SW1A 3KX0X 2OWJA 5HD3A 1S1ZA 1P97A 1DRMA 1X0OA 3BY9A 5DJUA 5HZHA 2JHEA 2BASA 5G4YA 3H9WA 1XJ3A 2INWA 5HSQA
chains in the Genus database with same CATH superfamily
1E3UD 2PR5A 1PI5A 3VV4A 2WGVA 4UQIM 4O7DA 2WGWA 2Z2MB 5F82A 4OQGA 1L2SA 4P6ZM 5EVIC 1LL5A 1YSPA 2JCHA 1MKMA 2V9AA 3CAXA 4EBLA 1YLJA 4KQRA 3LIDA 3FZCA 1H8MA 3NECA 3T4OA 2YKHA 3PBSA 4PPRA 1XJ6A 3MS6A 5DJTA 3VFFA 1PW8A 1F98A 3LR5A 1OT9A 3Q1FA 3ZG0A 1KDWA 2V2FF 3VP4A 3S1YA 4KQOA 5HD5A 5L8MA 3VP0A 5F69A 3VE3A 1S67L 4WF0A 5FEFA 1CI9A 1NYYA 1T1BA 3V3RA 4ID4A 4RA7A 5HPIA 1BLCA 3BFGA 1ESUA 2P74A 3LUQA 4MLLA 1A0KA 1KE0A 3LR3A 3E4OA 4P87A 4YNRA 3IXGA 5L09A 1GCEA 2P04A 3UB9A 3LEQA 3MKEA 3ZGAB 1S6RA 2O0YA 2WADA 2R9XA 2Q0OA 4MBKA 5F1GA 3SOIA 3P98A 1YAXA 1IYPA 3PAEA 5FI2A 5A93A 2VLGA 3A0RA 2J8YA 1N4OA 1SKOA 1X0OA 1YT4A 3HCYA 2HDRA 3H82A 1T19A 3KO6A 3VP3A 3LICA 4ZAMA 3B33A 3LGOA 3NC8A 4JF5A 5E43A 2EXAA 1HLUP 2QYBA 4U0TA 1MBLA 5HDDA 1SKFA 4X56A 2JBFA 4GW9A 1L0GA 1SDNA 3MFXA 2X71A 3H7WA 1ERMA 5EOEA 4Q0JA 2HP9A 4LV3A 5FQIA 1HVBA 3ISGA 3QP2A 3GSGA 2V1BA 1FR1A 1IELA 4I39A 5J3WA 3OLOA 4OOMA 2JKRI 3CWFA 2J3TD 2G7UA 2XRNA 5JYPA 4G3WA 1W8YA 3HUMA 4EBPA 1CQAA 1L0EA 2O9BA 2Z6DA 3QP1A 3IF6C 4JGPA 3O86A 4OP5A 3VP1A 4DN0A 3ITAA 4ZJ2A 2Y91A 1LL9A 2HJ9C 5DF7A 2VGLS 2KOIA 1KVMA 3B3XA 1TS6A 3BFDA 2L4RA 3VOLA 2Y79A 3D9YA 3HL9A 1VETA 4BQMA 2PYPA 3IWQA 3MZEA 2C5WB 5FAPA 4HJ4A 1YQSA 4GCZA 3R7WB 2P7JA 4BL3A 2EA9A 2XD1A 2PR6A 2HGVA 5FI7A 2K2NA 3NOPC 1K6SA 4E3MA 4E3IA 4DE1A 4DJ2A 4JXWA 3IX8A 5GLAA 1H3QA 2J3WA 1J9MA 3NJAA 4K0WA 2WKEA 4LFUA 4JXSA 4E3JA 3A3EA 4U3TA 4OPRA 4LLOB 3UE6A 3S7OA 2XSSA 3A0SA 1JNUA 1K25A 4DDYA 1H8ZA 2XQZA 5TBMA 4DXCA 3EOIA 3HLDA 4X1MA 3OBFA 3K3CA 5CEDA 1Y28A 5GLCA 2Z2LB 4GS9B 2J80A 2A2LA 2HZ5A 1I5QA 3LEZA 3N6IA 4PKYA 4UA9A 3EQUA 4ARZA 1GHMA 3B47A 1SCWA 3NOTC 5A90A 4PM5A 3BM6A 2W3HA 3BLSA 3LIBA 3IBJA 5FQ9A 3NDGA 3UPPA 3IBRA 1I2SA 3MZFA 2VK3A 3FV7A 1YLWA 1EI5A 1W79A 1PI4A 2KX6A 4JKTA 4F3LA 1YM1A 4HBTA 1L0DA 4WBGA 3HJKA 4ETXA 4GHIA 1PYYA 1S1ZA 1P97A 5DF9A 3IH8A 2EX9A 4PM9A 4KG5A 4ZJ3A 3LIAA 4M4XA 4FH4A 3M6BA 3LI9A 4L9FA 5A91A 3EQVA 4HP9A 3EEHA 2WK0A 5DVAA 3LY4A 1UGUA 3MQQA 4CQHA 4MEZA 4MDZA 5L10A 1VHMA 1IOUA 1DP8A 5IT5A 4FH2A 4HBUA 2JN7A 2WGIA 1IYSA 5BOHA 3ZG7B 2XK1A 3N7WA 4S2PA 4E3KA 1U60A 5E2EA 4I5SA 4HJ3A 5EV0A 2ZC7A 4D60A 4ME4A 3PR6A 2ZQDA 4JF6A 3A0VA 1XGJA 1YPRA 1Z6FA 2Y2NA 4BWIA 1RCJA 3H82B 2NUTC 3N8LA 5E2GA 3NCKA 4E6WA 1ES3A 2Y55A 3T1SA 3GTCA 3SH8A 4OQIA 1ZKJA 1GSXA 4ZRRA 1HTZA 1TS7A 3LYXA 1GHIA 2PBYA 2A24B 1VEUB 3ZG8B 3FPVA 3PBNA 3PBRA 4QHCA 5FQMA 2H5SA 1S4RA 3RJUA 1NXYA 4X68A 5EVEA 4GNUA 2FFYA 1MZUA 4UQIS 5HAPA 1PIOA 4P6ZS 4GD6A 2ZOHA 4FUWA 4ESPA 4E3OA 1LI0A 2ZM8A 5IS1A 3C2WA 4QY5A 2VKSA 3SS5A 4IEDA 4KZBA 1E4DA 1JTDA 3GVBA 1BULA 1GA9A 1PZPA 1TVFA 1TDGA 1P9RA 3RTYA 3UN7A 5E2FA 5HWWA 2CC1A 2WKIA 3NI9A 3T4TA 4R4SA 1IYQA 3MF0A 4OLDA 4NXFA 1H8YA 3V50A 5D3OA 2K31A 1YLZA 2V20A 1D06A 1FQGA 2ZC6B 5DTSA 4O0PA 4Y0OA 4MN5A 5CXWA 5HAIA 3E2LA 4BD0A 1I2WA 5CRFA 5FA7A 1XJ4A 1EWZA 2PHYA 3FC7A 4EBNA 3GR2A 3KYQA 3LR4A 3G6OA 2K7SA 3IS2B 4FD8A 2ZQAA 3PBTA 4I38A 4OOYA 4Y3IA 3IX3A 2B95A 5GLBA 2XDMA 1UWNX 5HPFA 5HX9A 3IXDA 3WRZA 4R70A 2PD8A 4X53A 3D4FA 2W0NA 2B18A 1QMEA 3JVVA 1HZOA 4BENA 1S0WA 5F6AA 3UE1A 2PT7A 4GN2A 5M18A 3K3DA 3ZG5A 1PWCA 5FQKA 3NOUC 3T50A 1XKZA 4EUVA 2IA2A 2XGNA 4XT2A 4XT2B 3JPUA 3HLWA 4CJNA 5DFXA 1N9NA 5F1FA 1XFNA 4XUZA 4S2MA 3BFEA 3Q07A 1FSYA 3BY9A 2C6WB 1BZAA 3LY3A 5EVLA 3MSHA 5CGXA 1G68A 3ZG9B 1KGGA 1UWPX 2NUPC 2D02A 2J9OA 4GJ4A 4N9LA 3T12B 2WZXA 2ZJ9A 3WS4A 4KUOA 2ZLYA 3WS0A 2XA7S 1MXOA 2IWDA 4WEKA 4F3LB 5FATA 4EERA 2HJEA 3BJNA 1PRQA 2ZMAA 5J4EA 1K0KA 2P08A 3O5YA 3SS4A 1PWGA 4OOLA 4JXGA 1DJAA 1KGFA 1LSXA 2CMNA 4UEYA 4G3KA 3CZDA 4RVAA 4JGQA 4NXBA 2DCFA 2I72A 4WL9A 4EXOA 4EETB 1ERQA 1NLYA 3U4LP 4L0LA 3QP4A 4N9KA 1PZOA 5IU1A 5HL6A 1TDLA 2BTFP 1MWUA 2JKRM 1W7FA 1RGYA 2PD7A 4D2OA 2L0WA 1DY6A 3CHWP 1F2KA 4K91A 3WRTA 5J8XA 3UY6A 4IJGA 1BLPA 3W2ZA 1SKOB 2V0UA 2OV5A 1RP5A 4EW7A 1ZG4A 3ULFA 1VB6A 3DTKA 1VETB 4MCWA 5HD3A 2BASA 1CI8A 2INWA 4MN6A 1E3UA 2H0YA 1SDEA 3O3VA 1V9ZA 4Q0HA 4Y13A 2R9WA 4FTXA 3MQ0A 3IQAA 3H7WB 3U2AA 3UMEA 5KZHA 2Y2MA 3C7UA 2ZD8A 2W3DA 3GQZA 3QP5A 3P09A 3BFFA 3VSKA 4BBVA 4LV2A 4OKPA 3UMDA 3HLGA 2G2WA 1F5MA 2J9PA 3KSGA 2EX6A 3M2KA 5FAQA 3TSGA 1ES4A 1CK3A 1P9WA 5HARA 3QP8A 1NJ4A 4GDNA 2M7UA 1OTEA 4LENA 1K54C 3F1OA 2EX8A 2HDUA 1D7EA 2HV1A 3G35A 2HDQA 3MZDA 3JYIA 4OP8A 5CGSA 4WN5A 4Y5FA 4WUJA 4H6JB 2VZWA 2JC7A 4FCFA 3RXXA 2VV8A 3PXPA 3TW8A 3GRJA 1K54A 3LI8A 1MWTA 1NRJA 3F1NB 4LV0A 3Q7VA 3M6HA 3KYEA 2ZM0A 3DWKA 3A3FA 4E6XA 1XJ2A 1Y4OA 1SZVA 4U0XA 2OLUA 4S2NA 5EVIB 1KGEA 4S2KA 5CTMA 1LSVA 5AQAA 4MBFA 1ZC2A 4YOFA 4UA6A 4BBTA 3PYPA 1RGZA 4JPMA 4Y15A 1ES2A 4UAAA 4HH2A 5TFQA 1Y54A 1GA0A 1SHVA 2KLIA 4Y0TA 2VGJA 3W4PA 1VM1A 5A92A 5LBRA 2BG1A 1ZG6A 1XP4A 4OONA 4HIAA 4LRXC 3OCLA 4WZ4A 2PYRA 3UB7A 1L0FA 4KZ7A 4R4RA 4O01A 2QJ7A 1FIKA 5TR7A 2OAQ1 4DE0A 1NZUA 4KENB 2ZMFA 3HLEA 4DXBA 2Q9MA 3KSFA 4KQQA 4B4ZA 3RFBA 4Y17A 3IHAA 4CLCD 2GNXA 3L7HA 2M1CA 3ICYA 3BYDA 1LL8A 1T1CA 4G3VA 1VQQA 1N9BA 2A24A 2JKGA 5GHXA 4WEJA 2QKPA 5I94A 1K56A 2FFFB 5FI6A 1BT5A 1LHYA 1IEMA 5CHMA 3FKVA 4HNBA 3PHYA 3QNBA 3NHQA 3L9KA 1XX2A 1O7EA 5IHVA 2WAFA 1JWVA 3C4PA 3NBLA 3AGDA 2P9VB 4QD4A 4JGOA 3HBRA 2M7VA 1ACFA 1NLZA 2HP6A 3S7PA 1XPBA 2DMWA 2EFXA 3OPLA 3C38A 4OPYA 2DNSA 2B5RA 5CTNA 1K4FA 3V39A 2D01A 1IYOA 3ZHHA 1ONGA 4LCMA 4ZTKA 3UPOA 2ZBBA 3GV9A 3N4IA 4HH3A 1WYCA 4OQ0A 5KSCA 3FWLA 4ETZA 5HWVA 5FDHA 4L9EA 3HJIA 1TF1A 1STZA 2V1ZA 1P0ZA 1BSGA 4BD1A 2ZMVA 3EGDC 4ZDXA 2W1TB 3P7NA 4PHTA 4JBFA 1N9LA 3ZQ5A 1BLSA 2WGWB 3W8KA 3VE4A 3E98A 2LB5A 3RXWA 4O8GA 1PNEA 1FCOA 4X55A 5HDSA 3NY4A 3HUNA 2ZOIA 3DAVA 3GECA 5FASA 1V9YA 4I3JA 2Y2QA 4KG2A 4GKUA 2Y2OA 4CLCC 4KZ4A 1CEGA 3UB5P 5CEBA 3QP6A 2JHEA 2RCXA 2EWWA 1K55C 3OPPA 5E2HA 3CITA 4UA7A 3VFHA 4ARZB 4MMNA 3SH9A 5FQJA 1BYWA 3O87A 5DF8A 1WYBA 3I7JA 3DBAA 3RH8B 5CHJA 2X01A 2XH9A 3LO7A 1MPLA 4RX3A 3BFCA 1NYMA 4HESA 2OLVA 4IVKA 1MC0A 4YWZA 3NULA 1XA1A 4GD8A 1W63M 3C30A 1K56D 4LRYC 2QZ6A 4KZ9A 1GSVA 4DE3A 1FR6A 5KIZA 1Q2PA 2HPBA 4EWFA 3CMZA 4EUZA 3LIEA 3ZCZA 3IT9A 4B93A 3UDXA 3E2KA 4H8RA 1HD8A 3NDEA 5AVFA 3AGEA 3TE8A 4DE2A 1K6RA 3Q81A 2Y8HA 1M6KA 1OPXA 1OMEA 5G4ZA 2JKTM 4BMWA 3ZVWA 1IFQA 2G2UA 2Y59A 4P6BA 4NXEA 2HF6A 5F83A 3IWIA 4WLAA 4NK3A 2Y2LA 4FOFA 5KMWA 2PU4A 3MBZA 2XEPA 5AQ7A 5CX7A 3D3OA 3SZTA 4OVDA 2PU2A 3FYZA 3FKWA 2XD5A 4CPKA 4KZAA 5G4YA 1ODVA 5G18A 1OJ5A 4R3JA 4XUXA 2W3GA 4LCLA 3DTMA 1TS8A 5EM1A 1K57A 4R23A 1XGIA 1YMSA 5FSRA 5I5LA 3UNWA 3G34A 3HLFA 4YINA 5FQQA 4P0MA 4I3AA 4PM8A 3T4SA 4F94A 2Q9NA 1FILA 2ZC5B 2OSUA 3N8RA 3W4QA 1DJBA 5DFYA 1Z09A 5FAOA 2WZZA 3T1RA 3JVUA 4MN7A 1BUEA 2P9VA 1CJFA 2WKHA 4N1XA 3ZYTA 3MKFA 3UE0A 4E3NA 2AVXA 3SS3A 5EM0A 1OT6A 1JVJA 4R3AA 4WYYA 1DP9A 4NEED 3E4QA 5K5BA 1LLBA 1TEMA 3T4JA 4K0XA 4QB8A 5AVEA 4HHDA 2W3EA 3G32A 1TS0A 3BW6A 1G6AA 1YLPA 3DWZA 4EEUA 4KZ6A 3ITBA 3F1NA 2XF3A 1MKIA 1J3WA 4S2IA 1S66L 5GHZA 1W8QA 4M3KA 3MXSA 2OWJA 3G4PA 2IWCA 3FPWA 4CLCE 4EV4A 3EGXC 3EWKA 4R0QA 3PBQA 5L07A 1VEUA 1MY8A 3MMHA 3TRCA 4LPZA 2R78A 3KSIA 1JTGA 4GS9A 3E0YA 2E8IA 2PRFA 2EFUA 3CLOA 3WS5A 4B9OA 3DTEA 5EECA 2V1AA 2ZL1A 4ZJ1A 3OC2A 3MXQA 3CUEC 1FSWA 3CI6A 3HVFA 3CUEA 4QWOA 4JXVA 4XXRA 3PAGA 3T4QA 4WZ5A 3BEBA 2JKFA 3E4PA 2KDKA 4E3LA 3BECA 2L1MA 2WYXA 4HOIA 5FL3A 2QWSA 2LB9A 3Q7VB 3NIAA 3Q82A 1ESIA 4NKPA 4GLQA 4KUKA 3IF6B 4KG6A 3IF6A 4OLGA 2H0TA 2VGLM 4KZ3A 5EVIA 5HAQA 2UV0E 1WA9A 4H6JA 1T18A 3VOZA 1IKIA 5EVID 2ZM2A 3HLBA 2QPNA 3LR0A 4NG2A 2W1RA 3WWXA 4C75A 5HSQA 2Y2JA 1LT0A 3BWLA 3UB6A 3UDIA 3V5MA 4B4XA 4GZBA 5TBMB 3LCEA 5F5YA 2ZQ7A 1DP6A 4HI4A 2JKTI 1PFLA 4HP4A 1K55A 3VOYA 5EUAA 1JWZA 2Y2HA 4IVIA 5HWTA 3WS1A 4HEFA 3ZVTA 5L2FA 3DTIA 4BJPA 2J3TC 4S2OA 3SH7A 4IHQA 1BLHA 2J7VA 3TOIA 3EEAA 2PDRA 2VV6A 2WKPA 3OPRA 4AFIA 3UO9A 4WMCA 2XR0A 3KYZA 3QNCA 4HY8A 5DKLA 1MWRA 3BRMA 1NRFA 3TG9A 2ZC3B 1WE4A 3CJMA 3Q7ZA 4BBUA 3BQAA 3PBOA 3IH9A 3C7VA 2Z6CA 4EQ1A 4R6LA 2VJWA 3GDIA 2WUQA 5CGWA 1H0MA 3VP2A 3LIFA 2EWVA 4P85A 5JYOA 4DF6A 3S4XA 5EE8A 5FDSA 1TD5A 3D72A 3S7NA 3BLMA 4N92A 1KE4A 4HQAA 1IKGA 4N1HA 4S2LA 3UB8A 4QU3A 1OTIA 5AJGA 2GZAA 4CLCA 1H5XA 1K4EA 2GDNA 1FCMA 2W1TA 1L3LA 2E8JA 1QMFA 4PM7A 3GMWA 3MFDA 2RL3A 3MJQA 3A3IA 1G28A 4B88A 4JGRA 4DDSA 1PW1A 3ZNYA 2ACGA 3C8CA 3G31A 5DJUA 5AQBA 4KQDA 5EPHA 1NY0A 4R1GA 4WMCD 1YLTA 1DRMA 5M19A 2Y2PA 3S22A 3AGFA 4HJ6A 4K08A 4OPZA 2FH5A 5HL1A 2QMIA 1Q2QA 4R3BA 1C3BA 4Y2FA 1KVLA 2PBDP 4YFMA 4NXGA 3G30A 4EU0A 1LI9A 4GDBA 1ZTUA 2VEAA 2MJ6A 5AQ9A 1MWSA 4II7A 3IHBA 1JWPA 2JE5A 3T1QB 1YKDA 3F1PB 2Y2IA 5DTTA 4KZ8A 5HFOA 4JLFA 4IBXA 4IUKA 5GHYA 3P01A 4MBHA 3R4KA 3W4OA 2GJ3A 3A3DA 2UWXA 2H10A 1NWZA 4Q8IA 3F1OB 3QHYA 5KSHA 2B02A 3C4OA 5C5KA 3HREA 4DKIA 3WS2A 1F9IA 5CERA 4BLMA 2Y2GA 3HUOA 2QJ5A 1BTLA 3CPTB 3UE3A 1AXBA 3CPTA 3K2NA 3N8SA 5GLDA 3LFVA 4PMAA 4PKYG 1S4SA 3MQOA 5A8BA 2VGKA 3IXBA 4GB7A 3T4KA 3OPHA 4RYEA 4LRZE 2VX8A 2H28A 3V67A 3ZFZA 3PTEA 1G6OA 5HZHA 1ALQA 4EQIA 2ZQ9A 4NETA 4S2NC 3R7WA 4IBRA 1T1AA 4OQHA 4Y0UA 4Z1WA 1CEFA 4QJGA 3G2ZA 1OTAA 4Q0IA 2EX2A 4MNRA 2ZQCA 4EEPA 3T1XA 2YKFA 4LGWA 2VV7A 5EFWA 5GL9A 2WKRA 5TGFA 2QHKA 4FSFA 1XA7A 3FG8A 1XXMA 2DRWA 3MR0A 3T4LA 2WKQA 4Y7PA 2V0WA 5U47A 2O99A 2XFSA 4S2JA 3S7QA 4KZ5A 5CECA 1ZHHB 3IWOA 4DMZA 1DJCA 4PAUA 3OCNA 4I3IA 3TJZC 5TJJA 3ZNTA 3OOVA 2EXBA 1CF0A 4RQ9A 1GSWA 1KDSA 4OH0A 5HW3A 4C3QA 1O07A 3V3SA 3BY8A 2BLSA 2Y4AA 4WM9A 2ZQ8A 4R38A 1W63Q 3VSLA 1E25A 2FZ0A 4ZBEA 5DTKA 2GX5A 1XFQA 1YMXA 5EOOA 3ZDJA 4WZ5C 1ES5A 2OOLA 1YSQA 4GOGA 3IF5A 1M40A 2OWHA 2V8FA 1EW0A 1FOFA 1OTBA 2XROA 4OPQA 4GHIB 4C6YA 4JF4A 3SW1A 3H9WA 5MC7A 3KSHA 4QPRA 3O88A 1OJGA 4LV1A 3A3JA 4CLCB 2XA7M 4UHUA 3HLCA 1NZOA 2ZC4B 3MXRA 2A3UA 3UDFA 1ONHA 3CG5A 5CHUA 1KE3A 4DRTA 4Z9QA 1W5DA 2PAVP 3B42A 4BL2A 1FCNA 5FEGA 1EROA 3BQ8A 4WELA 5HDCA 2HP5A 4EESA 2VA0A 1YLYA 4DJ3A 5J7EA 1OTDA 5DKKA 2WAEA 5F68A 2O9AA 3G2YA 2A49A 4QY6A 2Y2KA 3DW0A 1AWIA 4IUHA 4X6TA 4E04A 4PM6A 1K57C 1KOUA 3OZHA 4RX2A 1PWDA 4X1LA 3UPNA 3VMAA 3IXHA 3IX4A 2XLNA 2O9CA 2OAP1 2W27A 1G5UA 1LSWA 1D1JA 3M2JA 2IWBA 2I9VA 1GHPA 2W3FA 2V8CA 3IS2A 3F1PA 2HDSA 1K38A 2ZL1B 5M1AA 4X69A 2X02A 1N9OA 1S1YA 4L9GA 4X25A 3KX0X 4A5RA 2XFTA 1XJ3A 3C5AA
chains in the Genus database with same CATH topology
2PR5A 1P9RA 3RTYA 3VV4A 4BJPA 4UQIM 2J3TC 5HWWA 4JGOA 4P6ZM 3T4TA 3MF0A 4IHQA 1YSPA 3EEAA 2PDRA 1MKMA 2V9AA 2VV6A 3CAXA 2M7VA 2WKPA 4NXFA 4AFIA 1NLZA 3LIDA 3S7PA 2DMWA 2K31A 3KYZA 4HY8A 1D06A 1H8MA 5DKLA 3C38A 4O0PA 3T4OA 2YKHA 3PBSA 4MN5A 2D01A 4BBUA 1XJ6A 3BQAA 3PBOA 1XJ4A 5DJTA 2PHYA 3FC7A 1F98A 3LR5A 2Z6CA 1OT9A 4EQ1A 4R6LA 2VJWA 3GDIA 2ZBBA 3KYQA 3LR4A 3G6OA 2K7SA 3IS2B 4HH3A 4KQOA 3LIFA 3PBTA 4I38A 4Y3IA 5HD5A 5L8MA 5F69A 2EWVA 3VE3A 1S67L 4ETZA 5HWVA 1TD5A 1UWNX 3D72A 4L9EA 4WF0A 3S7NA 5HPFA 3HJIA 1T1BA 4HQAA 1TF1A 3UB8A 4R70A 1STZA 2PD8A 1OTIA 5AJGA 2GZAA 4CLCA 2W0NA 1P0ZA 2B18A 3JVVA 5HPIA 2ZMVA 3EGDC 2W1TB 3P7NA 2W1TA 4PHTA 3ZQ5A 1N9LA 3LUQA 3LR3A 3E4OA 5F6AA 4YNRA 2PT7A 3VE4A 3E98A 2LB5A 2P04A 4O8GA 3K3DA 3UB9A 3MJQA 5HDSA 1G28A 3NOUC 2O0YA 2ZOIA 4JGRA 3T50A 4EUVA 2IA2A 3GECA 4XT2A 4XT2B 1V9YA 4I3JA 3C8CA 5DJUA 5DFXA 1N9NA 1XFNA 1YAXA 4CLCC 2VLGA 3A0RA 4KQDA 1X0OA 1DRMA 3BY9A 2JHEA 3HCYA 2EWWA 4HJ6A 3CITA 3H82A 4K08A 1T19A 3KO6A 4ARZB 2FH5A 4MMNA 3LICA 3B33A 1BYWA 1UWPX 2NUPC 2D02A 2QYBA 5HDDA 4GJ4A 4Y2FA 4GW9A 3DBAA 3RH8B 4NXGA 4KUOA 4EU0A 3MFXA 3H7WA 4Q0JA 1ZTUA 2VEAA 2MJ6A 4II7A 2XA7S 4WEKA 4F3LB 4EERA 1MC0A 2HJEA 4YWZA 1YKDA 3F1PB 3BJNA 2V1BA 1W63M 3C30A 4IUKA 4LRYC 5J4EA 2P08A 3O5YA 4I39A 1GSVA 5J3WA 3OLOA 4OOMA 2JKRI 3CWFA 2J3TD 4OOLA 5KIZA 2G7UA 3P01A 3R4KA 1LSXA 2CMNA 2XRNA 4UEYA 4G3KA 4G3WA 4JGQA 2GJ3A 3LIEA 4NXBA 4B93A 1NWZA 5AVFA 3TE8A 3F1OB 2O9BA 4WL9A 4EXOA 5KSHA 2Y8HA 4EETB 2Z6DA 2B02A 1NLYA 5C5KA 4L0LA 5IU1A 5HL6A 1OPXA 1F9IA 4JGPA 2JKRM 5G4ZA 2JKTM 2PD7A 4BMWA 1IFQA 2QJ5A 2L0WA 4NXEA 2HF6A 3UE3A 3K2NA 4DN0A 4WLAA 3LFVA 4FOFA 4PKYG 1S4SA 3MQOA 2HJ9C 5A8BA 2VGLS 2KOIA 4IJGA 5CX7A 3W2ZA 3D3OA 1TS6A 3T4KA 2V0UA 4LRZE 2VX8A 2L4RA 2H28A 3VOLA 2Y79A 3V67A 4EW7A 3ULFA 1VB6A 2PYPA 1G6OA 4MCWA 5HD3A 5HZHA 2BASA 5G4YA 2INWA 3R7WA 1ODVA 4HJ4A 4GCZA 3R7WB 1OJ5A 1T1AA 2W3GA 4MN6A 2P7JA 1TS8A 2EA9A 2PR6A 2HGVA 4Z1WA 1V9ZA 2K2NA 4Q0HA 3NOPC 5I5LA 3MQ0A 1OTAA 3H7WB 4DJ2A 4Q0IA 3U2AA 3UMEA 1H3QA 2J3WA 4EEPA 2YKFA 3NJAA 2VV7A 4I3AA 5EFWA 2WKRA 4BBVA 2W3DA 3T4SA 2QHKA 4FSFA 3FG8A 3UMDA 4LLOB 3UE6A 1F5MA 3S7OA 3MR0A 3KSGA 2XSSA 3A0SA 1JNUA 5DFYA 5TBMA 3T4LA 2WKQA 2V0WA 3EOIA 2O99A 1P9WA 3S7QA 3JVUA 4MN7A 3OBFA 1ZHHB 4DMZA 3K3CA 1Y28A 2M7UA 1OTEA 4PAUA 3OCNA 4GS9B 2J80A 4I3IA 3F1OA 3TJZC 2A2LA 5TJJA 3OOVA 4RQ9A 1D7EA 1GSWA 4PKYA 3ZYTA 2HV1A 3EQUA 1OT6A 4ARZA 3B47A 4R3AA 1DP9A 3NOTC 4NEED 3E4QA 3BY8A 5K5BA 3LIBA 2W3HA 4WN5A 3IBJA 4R38A 3T4JA 4Y5FA 4WUJA 4H6JB 5AVEA 1W63Q 2VZWA 4HHDA 2W3EA 3IBRA 2FZ0A 1TS0A 2VV8A 3BW6A 3PXPA 3TW8A 3LI8A 1NRJA 4EEUA 2GX5A 1XFQA 3F1NB 2KX6A 3F1NA 4F3LA 2OOLA 1YSQA 3HJKA 1S66L 1XJ2A 2OWHA 1EW0A 1OTBA 4ETXA 2XROA 4GHIB 4GHIA 3SW1A 2OWJA 1S1ZA 1P97A 5DF9A 3H9WA 5MC7A 3FPWA 3KSHA 4CLCE 4QPRA 1LSVA 1OJGA 3EGXC 3LIAA 3EWKA 4YOFA 3PBQA 4CLCB 2XA7M 4BBTA 3PYPA 3MMHA 4M4XA 3TRCA 4LPZA 2R78A 3KSIA 3LI9A 4GS9A 3E0YA 4L9FA 3EQVA 4HP9A 4HH2A 3CLOA 4B9OA 3EEHA 2KLIA 2V1AA 3OC2A 1UGUA 3MQQA 5LBRA 4CQHA 3B42A 3MXQA 4MDZA 1VHMA 1IOUA 1DP8A 3CUEC 5IT5A 3CI6A 2JN7A 4HIAA 3CUEA 3OCLA 4LRXC 2PYRA 3BQ8A 3T4QA 4WELA 3UB7A 5HDCA 3E4PA 2KDKA 4EESA 4O01A 2VA0A 2QJ7A 2L1MA 4DJ3A 2OAQ1 5J7EA 4HOIA 1OTDA 2QWSA 4HJ3A 4I5SA 5DKKA 5FL3A 5F68A 2O9AA 4ME4A 2LB9A 3PR6A 3A0VA 2ZMFA 4BWIA 3H82B 2NUTC 4IUHA 4E04A 3KSFA 4GLQA 4KUKA 4NKPA 3RFBA 1KOUA 4CLCD 2VGLM 2GNXA 1WA9A 1GSXA 4H6JA 1T18A 4ZRRA 1TS7A 3LYXA 2M1CA 3ICYA 2O9CA 2OAP1 1LL8A 1T1CA 2A24B 2W27A 4G3VA 1LSWA 2A24A 3FPVA 3PBNA 4WEJA 3PBRA 2I9VA 2QKPA 1S4RA 2W3FA 3LR0A 3IS2A 2W1RA 1MZUA 5HSQA 3F1PA 1LT0A 3BWLA 4UQIS 3UB6A 4HNBA 4P6ZS 2ZOHA 3PHYA 1N9OA 3NHQA 5TBMB 5F5YA 5IS1A 1DP6A 1S1YA 3C2WA 4L9GA 4HI4A 2JKTI 4HP4A 3KX0X 2VKSA 1XJ3A 5HWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODV A;  2PR5 A;  4HJ4 A;  4GCZ A;  1LSV A;  1OJ5 A;  1T1A A;  1OJG A;  4HJ6 A;  3LIA A;  3EWK A;  4MN6 A;  3H82 A;  2P7J A;  1TS8 A;  4K08 A;  3RTY A;  1T19 A;  4BBT A;  2EA9 A;  3PYP A;  2PR6 A;  5HWW A;  3LIC A;  4M4X A;  1V9Z A;  1BYW A;  3B33 A;  4JGO A;  4LPZ A;  4WN5 A;  2R78 A;  1UWP X;  5J7E A;  3LI9 A;  3NOP C;  4GS9 A;  2D02 A;  4L9F A;  2PDR A;  2V9A A;  3CAX A;  2VV6 A;  5I5L A;  5HDD A;  1OTA A;  3H7W B;  4DJ2 A;  2WKP A;  4GW9 A;  4HP9 A;  4NXF A;  4HH2 A;  3CLO A;  3RH8 B;  3UME A;  4B9O A;  3EEH A;  5IS1 A;  4EEP A;  4NXG A;  3LID A;  4KUO A;  2V1A A;  2YKF A;  3NJA A;  2VV7 A;  1UGU A;  3MFX A;  3MQQ A;  3H7W A;  2WKR A;  4HY8 A;  3MXQ A;  4I3A A;  5EFW A;  4BBV A;  1D06 A;  5DKL A;  1DP8 A;  2VEA A;  2QHK A;  3FG8 A;  3UMD A;  2YKH A;  4LLO B;  3UE6 A;  4HIA A;  2JN7 A;  4MN5 A;  4EER A;  3MR0 A;  4LRX C;  2D01 A;  3A0S A;  4F3L B;  2PYR A;  4BBU A;  1JNU A;  4YWZ A;  1XJ6 A;  5TBM A;  3F1P B;  3UB7 A;  2V1B A;  2WKQ A;  1XJ4 A;  5DJT A;  5HDC A;  3E4P A;  2PHY A;  2V0W A;  2KDK A;  3FC7 A;  1F98 A;  4LRY C;  4EES A;  5J4E A;  2Z6C A;  1OT9 A;  2QJ7 A;  2L1M A;  4I39 A;  1GSV A;  3GDI A;  4R6L A;  2ZBB A;  5J3W A;  3OLO A;  4DJ3 A;  4EQ1 A;  4HOI A;  1OTD A;  2QWS A;  4HJ3 A;  3G6O A;  2K7S A;  3CWF A;  3IS2 B;  4I5S A;  5DKK A;  5F68 A;  3K3C A;  4HH3 A;  4LRZ E;  5KIZ A;  3LIF A;  4I38 A;  1Y28 A;  3A0V A;  1OTE A;  5HD5 A;  2CMN A;  1LSX A;  5F69 A;  4GS9 B;  2J80 A;  4I3I A;  3VE3 A;  3H82 B;  3F1O A;  1S67 L;  5HWV A;  3D72 A;  1UWN X;  4JGQ A;  2GJ3 A;  3LIE A;  4L9E A;  4NXB A;  4WF0 A;  4E04 A;  4KUK A;  3HJI A;  1T1B A;  1D7E A;  4HQA A;  4RQ9 A;  1GSW A;  1KOU A;  4PKY A;  1NWZ A;  4R70 A;  2PD8 A;  3UB8 A;  5AVF A;  1OTI A;  2HV1 A;  3F1O B;  2W0N A;  1P0Z A;  4WL9 A;  1OT6 A;  4EXO A;  1WA9 A;  1GSX A;  4H6J A;  1T18 A;  2Z6D A;  4R3A A;  1DP9 A;  3VOL A;  3NOT C;  3P7N A;  4EET B;  1TS7 A;  2B02 A;  3E4Q A;  3LYX A;  3BY8 A;  3LIB A;  1N9L A;  2M1C A;  3LUQ A;  3ICY A;  5IU1 A;  3ZQ5 A;  1LL8 A;  1F9I A;  1T1C A;  2A24 B;  2W27 A;  4JGP A;  4R38 A;  1LSW A;  3E4O A;  2A24 A;  4H6J B;  4WUJ A;  5F6A A;  5AVE A;  5G4Z A;  4HHD A;  2PD7 A;  3T50 A;  3VE4 A;  3IBR A;  2QJ5 A;  1TS0 A;  2VV8 A;  2I9V A;  2QKP A;  2L0W A;  3LI8 A;  1S4R A;  3K3D A;  4NXE A;  3UB9 A;  3MJQ A;  4WLA A;  4EEU A;  5HDS A;  1G28 A;  3NOU C;  2ZOI A;  4JGR A;  3IS2 A;  4PKY G;  1MZU A;  1S4S A;  1XFQ A;  3F1N B;  3MQO A;  2KX6 A;  3F1P A;  5HWT A;  1LT0 A;  3F1N A;  4EW7 A;  3BWL A;  5A8B A;  4F3L A;  3GEC A;  4XT2 A;  3UB6 A;  4XT2 B;  1V9Y A;  2OOL A;  4HNB A;  4I3J A;  2ZOH A;  3C8C A;  1TS6 A;  1N9O A;  3PHY A;  2V0U A;  3NHQ A;  5TBM B;  5F5Y A;  3HJK A;  1S66 L;  1XJ2 A;  2L4R A;  2H28 A;  1N9N A;  1EW0 A;  1DP6 A;  1S1Y A;  2OWH A;  1OTB A;  1XFN A;  3C2W A;  4HI4 A;  4GHI B;  4L9G A;  3ULF A;  1VB6 A;  2PYP A;  2VLG A;  3A0R A;  4GHI A;  4HP4 A;  4KQD A;  3SW1 A;  3KX0 X;  2OWJ A;  5HD3 A;  1S1Z A;  1P97 A;  1DRM A;  1X0O A;  3BY9 A;  5DJU A;  5HZH A;  2JHE A;  2BAS A;  5G4Y A;  3H9W A;  1XJ3 A;  2INW A;  5HSQ A; 
#chains in the Genus database with same CATH topology
 1E3U D;  2PR5 A;  1PI5 A;  3VV4 A;  2WGV A;  4UQI M;  4O7D A;  2WGW A;  2Z2M B;  5F82 A;  4OQG A;  1L2S A;  4P6Z M;  5EVI C;  1LL5 A;  1YSP A;  2JCH A;  1MKM A;  2V9A A;  3CAX A;  4EBL A;  1YLJ A;  4KQR A;  3LID A;  3FZC A;  1H8M A;  3NEC A;  3T4O A;  2YKH A;  3PBS A;  4PPR A;  1XJ6 A;  3MS6 A;  5DJT A;  3VFF A;  1PW8 A;  1F98 A;  3LR5 A;  1OT9 A;  3Q1F A;  3ZG0 A;  1KDW A;  2V2F F;  3VP4 A;  3S1Y A;  4KQO A;  5HD5 A;  5L8M A;  3VP0 A;  5F69 A;  3VE3 A;  1S67 L;  4WF0 A;  5FEF A;  1CI9 A;  1NYY A;  1T1B A;  3V3R A;  4ID4 A;  4RA7 A;  5HPI A;  1BLC A;  3BFG A;  1ESU A;  2P74 A;  3LUQ A;  4MLL A;  1A0K A;  1KE0 A;  3LR3 A;  3E4O A;  4P87 A;  4YNR A;  3IXG A;  5L09 A;  1GCE A;  2P04 A;  3UB9 A;  3LEQ A;  3MKE A;  3ZGA B;  1S6R A;  2O0Y A;  2WAD A;  2R9X A;  2Q0O A;  4MBK A;  5F1G A;  3SOI A;  3P98 A;  1YAX A;  1IYP A;  3PAE A;  5FI2 A;  5A93 A;  2VLG A;  3A0R A;  2J8Y A;  1N4O A;  1SKO A;  1X0O A;  1YT4 A;  3HCY A;  2HDR A;  3H82 A;  1T19 A;  3KO6 A;  3VP3 A;  3LIC A;  4ZAM A;  3B33 A;  3LGO A;  3NC8 A;  4JF5 A;  5E43 A;  2EXA A;  1HLU P;  2QYB A;  4U0T A;  1MBL A;  5HDD A;  1SKF A;  4X56 A;  2JBF A;  4GW9 A;  1L0G A;  1SDN A;  3MFX A;  2X71 A;  3H7W A;  1ERM A;  5EOE A;  4Q0J A;  2HP9 A;  4LV3 A;  5FQI A;  1HVB A;  3ISG A;  3QP2 A;  3GSG A;  2V1B A;  1FR1 A;  1IEL A;  4I39 A;  5J3W A;  3OLO A;  4OOM A;  2JKR I;  3CWF A;  2J3T D;  2G7U A;  2XRN A;  5JYP A;  4G3W A;  1W8Y A;  3HUM A;  4EBP A;  1CQA A;  1L0E A;  2O9B A;  2Z6D A;  3QP1 A;  3IF6 C;  4JGP A;  3O86 A;  4OP5 A;  3VP1 A;  4DN0 A;  3ITA A;  4ZJ2 A;  2Y91 A;  1LL9 A;  2HJ9 C;  5DF7 A;  2VGL S;  2KOI A;  1KVM A;  3B3X A;  1TS6 A;  3BFD A;  2L4R A;  3VOL A;  2Y79 A;  3D9Y A;  3HL9 A;  1VET A;  4BQM A;  2PYP A;  3IWQ A;  3MZE A;  2C5W B;  5FAP A;  4HJ4 A;  1YQS A;  4GCZ A;  3R7W B;  2P7J A;  4BL3 A;  2EA9 A;  2XD1 A;  2PR6 A;  2HGV A;  5FI7 A;  2K2N A;  3NOP C;  1K6S A;  4E3M A;  4E3I A;  4DE1 A;  4DJ2 A;  4JXW A;  3IX8 A;  5GLA A;  1H3Q A;  2J3W A;  1J9M A;  3NJA A;  4K0W A;  2WKE A;  4LFU A;  4JXS A;  4E3J A;  3A3E A;  4U3T A;  4OPR A;  4LLO B;  3UE6 A;  3S7O A;  2XSS A;  3A0S A;  1JNU A;  1K25 A;  4DDY A;  1H8Z A;  2XQZ A;  5TBM A;  4DXC A;  3EOI A;  3HLD A;  4X1M A;  3OBF A;  3K3C A;  5CED A;  1Y28 A;  5GLC A;  2Z2L B;  4GS9 B;  2J80 A;  2A2L A;  2HZ5 A;  1I5Q A;  3LEZ A;  3N6I A;  4PKY A;  4UA9 A;  3EQU A;  4ARZ A;  1GHM A;  3B47 A;  1SCW A;  3NOT C;  5A90 A;  4PM5 A;  3BM6 A;  2W3H A;  3BLS A;  3LIB A;  3IBJ A;  5FQ9 A;  3NDG A;  3UPP A;  3IBR A;  1I2S A;  3MZF A;  2VK3 A;  3FV7 A;  1YLW A;  1EI5 A;  1W79 A;  1PI4 A;  2KX6 A;  4JKT A;  4F3L A;  1YM1 A;  4HBT A;  1L0D A;  4WBG A;  3HJK A;  4ETX A;  4GHI A;  1PYY A;  1S1Z A;  1P97 A;  5DF9 A;  3IH8 A;  2EX9 A;  4PM9 A;  4KG5 A;  4ZJ3 A;  3LIA A;  4M4X A;  4FH4 A;  3M6B A;  3LI9 A;  4L9F A;  5A91 A;  3EQV A;  4HP9 A;  3EEH A;  2WK0 A;  5DVA A;  3LY4 A;  1UGU A;  3MQQ A;  4CQH A;  4MEZ A;  4MDZ A;  5L10 A;  1VHM A;  1IOU A;  1DP8 A;  5IT5 A;  4FH2 A;  4HBU A;  2JN7 A;  2WGI A;  1IYS A;  5BOH A;  3ZG7 B;  2XK1 A;  3N7W A;  4S2P A;  4E3K A;  1U60 A;  5E2E A;  4I5S A;  4HJ3 A;  5EV0 A;  2ZC7 A;  4D60 A;  4ME4 A;  3PR6 A;  2ZQD A;  4JF6 A;  3A0V A;  1XGJ A;  1YPR A;  1Z6F A;  2Y2N A;  4BWI A;  1RCJ A;  3H82 B;  2NUT C;  3N8L A;  5E2G A;  3NCK A;  4E6W A;  1ES3 A;  2Y55 A;  3T1S A;  3GTC A;  3SH8 A;  4OQI A;  1ZKJ A;  1GSX A;  4ZRR A;  1HTZ A;  1TS7 A;  3LYX A;  1GHI A;  2PBY A;  2A24 B;  1VEU B;  3ZG8 B;  3FPV A;  3PBN A;  3PBR A;  4QHC A;  5FQM A;  2H5S A;  1S4R A;  3RJU A;  1NXY A;  4X68 A;  5EVE A;  4GNU A;  2FFY A;  1MZU A;  4UQI S;  5HAP A;  1PIO A;  4P6Z S;  4GD6 A;  2ZOH A;  4FUW A;  4ESP A;  4E3O A;  1LI0 A;  2ZM8 A;  5IS1 A;  3C2W A;  4QY5 A;  2VKS A;  3SS5 A;  4IED A;  4KZB A;  1E4D A;  1JTD A;  3GVB A;  1BUL A;  1GA9 A;  1PZP A;  1TVF A;  1TDG A;  1P9R A;  3RTY A;  3UN7 A;  5E2F A;  5HWW A;  2CC1 A;  2WKI A;  3NI9 A;  3T4T A;  4R4S A;  1IYQ A;  3MF0 A;  4OLD A;  4NXF A;  1H8Y A;  3V50 A;  5D3O A;  2K31 A;  1YLZ A;  2V20 A;  1D06 A;  1FQG A;  2ZC6 B;  5DTS A;  4O0P A;  4Y0O A;  4MN5 A;  5CXW A;  5HAI A;  3E2L A;  4BD0 A;  1I2W A;  5CRF A;  5FA7 A;  1XJ4 A;  1EWZ A;  2PHY A;  3FC7 A;  4EBN A;  3GR2 A;  3KYQ A;  3LR4 A;  3G6O A;  2K7S A;  3IS2 B;  4FD8 A;  2ZQA A;  3PBT A;  4I38 A;  4OOY A;  4Y3I A;  3IX3 A;  2B95 A;  5GLB A;  2XDM A;  1UWN X;  5HPF A;  5HX9 A;  3IXD A;  3WRZ A;  4R70 A;  2PD8 A;  4X53 A;  3D4F A;  2W0N A;  2B18 A;  1QME A;  3JVV A;  1HZO A;  4BEN A;  1S0W A;  5F6A A;  3UE1 A;  2PT7 A;  4GN2 A;  5M18 A;  3K3D A;  3ZG5 A;  1PWC A;  5FQK A;  3NOU C;  3T50 A;  1XKZ A;  4EUV A;  2IA2 A;  2XGN A;  4XT2 A;  4XT2 B;  3JPU A;  3HLW A;  4CJN A;  5DFX A;  1N9N A;  5F1F A;  1XFN A;  4XUZ A;  4S2M A;  3BFE A;  3Q07 A;  1FSY A;  3BY9 A;  2C6W B;  1BZA A;  3LY3 A;  5EVL A;  3MSH A;  5CGX A;  1G68 A;  3ZG9 B;  1KGG A;  1UWP X;  2NUP C;  2D02 A;  2J9O A;  4GJ4 A;  4N9L A;  3T12 B;  2WZX A;  2ZJ9 A;  3WS4 A;  4KUO A;  2ZLY A;  3WS0 A;  2XA7 S;  1MXO A;  2IWD A;  4WEK A;  4F3L B;  5FAT A;  4EER A;  2HJE A;  3BJN A;  1PRQ A;  2ZMA A;  5J4E A;  1K0K A;  2P08 A;  3O5Y A;  3SS4 A;  1PWG A;  4OOL A;  4JXG A;  1DJA A;  1KGF A;  1LSX A;  2CMN A;  4UEY A;  4G3K A;  3CZD A;  4RVA A;  4JGQ A;  4NXB A;  2DCF A;  2I72 A;  4WL9 A;  4EXO A;  4EET B;  1ERQ A;  1NLY A;  3U4L P;  4L0L A;  3QP4 A;  4N9K A;  1PZO A;  5IU1 A;  5HL6 A;  1TDL A;  2BTF P;  1MWU A;  2JKR M;  1W7F A;  1RGY A;  2PD7 A;  4D2O A;  2L0W A;  1DY6 A;  3CHW P;  1F2K A;  4K91 A;  3WRT A;  5J8X A;  3UY6 A;  4IJG A;  1BLP A;  3W2Z A;  1SKO B;  2V0U A;  2OV5 A;  1RP5 A;  4EW7 A;  1ZG4 A;  3ULF A;  1VB6 A;  3DTK A;  1VET B;  4MCW A;  5HD3 A;  2BAS A;  1CI8 A;  2INW A;  4MN6 A;  1E3U A;  2H0Y A;  1SDE A;  3O3V A;  1V9Z A;  4Q0H A;  4Y13 A;  2R9W A;  4FTX A;  3MQ0 A;  3IQA A;  3H7W B;  3U2A A;  3UME A;  5KZH A;  2Y2M A;  3C7U A;  2ZD8 A;  2W3D A;  3GQZ A;  3QP5 A;  3P09 A;  3BFF A;  3VSK A;  4BBV A;  4LV2 A;  4OKP A;  3UMD A;  3HLG A;  2G2W A;  1F5M A;  2J9P A;  3KSG A;  2EX6 A;  3M2K A;  5FAQ A;  3TSG A;  1ES4 A;  1CK3 A;  1P9W A;  5HAR A;  3QP8 A;  1NJ4 A;  4GDN A;  2M7U A;  1OTE A;  4LEN A;  1K54 C;  3F1O A;  2EX8 A;  2HDU A;  1D7E A;  2HV1 A;  3G35 A;  2HDQ A;  3MZD A;  3JYI A;  4OP8 A;  5CGS A;  4WN5 A;  4Y5F A;  4WUJ A;  4H6J B;  2VZW A;  2JC7 A;  4FCF A;  3RXX A;  2VV8 A;  3PXP A;  3TW8 A;  3GRJ A;  1K54 A;  3LI8 A;  1MWT A;  1NRJ A;  3F1N B;  4LV0 A;  3Q7V A;  3M6H A;  3KYE A;  2ZM0 A;  3DWK A;  3A3F A;  4E6X A;  1XJ2 A;  1Y4O A;  1SZV A;  4U0X A;  2OLU A;  4S2N A;  5EVI B;  1KGE A;  4S2K A;  5CTM A;  1LSV A;  5AQA A;  4MBF A;  1ZC2 A;  4YOF A;  4UA6 A;  4BBT A;  3PYP A;  1RGZ A;  4JPM A;  4Y15 A;  1ES2 A;  4UAA A;  4HH2 A;  5TFQ A;  1Y54 A;  1GA0 A;  1SHV A;  2KLI A;  4Y0T A;  2VGJ A;  3W4P A;  1VM1 A;  5A92 A;  5LBR A;  2BG1 A;  1ZG6 A;  1XP4 A;  4OON A;  4HIA A;  4LRX C;  3OCL A;  4WZ4 A;  2PYR A;  3UB7 A;  1L0F A;  4KZ7 A;  4R4R A;  4O01 A;  2QJ7 A;  1FIK A;  5TR7 A;  2OAQ 1;  4DE0 A;  1NZU A;  4KEN B;  2ZMF A;  3HLE A;  4DXB A;  2Q9M A;  3KSF A;  4KQQ A;  4B4Z A;  3RFB A;  4Y17 A;  3IHA A;  4CLC D;  2GNX A;  3L7H A;  2M1C A;  3ICY A;  3BYD A;  1LL8 A;  1T1C A;  4G3V A;  1VQQ A;  1N9B A;  2A24 A;  2JKG A;  5GHX A;  4WEJ A;  2QKP A;  5I94 A;  1K56 A;  2FFF B;  5FI6 A;  1BT5 A;  1LHY A;  1IEM A;  5CHM A;  3FKV A;  4HNB A;  3PHY A;  3QNB A;  3NHQ A;  3L9K A;  1XX2 A;  1O7E A;  5IHV A;  2WAF A;  1JWV A;  3C4P A;  3NBL A;  3AGD A;  2P9V B;  4QD4 A;  4JGO A;  3HBR A;  2M7V A;  1ACF A;  1NLZ A;  2HP6 A;  3S7P A;  1XPB A;  2DMW A;  2EFX A;  3OPL A;  3C38 A;  4OPY A;  2DNS A;  2B5R A;  5CTN A;  1K4F A;  3V39 A;  2D01 A;  1IYO A;  3ZHH A;  1ONG A;  4LCM A;  4ZTK A;  3UPO A;  2ZBB A;  3GV9 A;  3N4I A;  4HH3 A;  1WYC A;  4OQ0 A;  5KSC A;  3FWL A;  4ETZ A;  5HWV A;  5FDH A;  4L9E A;  3HJI A;  1TF1 A;  1STZ A;  2V1Z A;  1P0Z A;  1BSG A;  4BD1 A;  2ZMV A;  3EGD C;  4ZDX A;  2W1T B;  3P7N A;  4PHT A;  4JBF A;  1N9L A;  3ZQ5 A;  1BLS A;  2WGW B;  3W8K A;  3VE4 A;  3E98 A;  2LB5 A;  3RXW A;  4O8G A;  1PNE A;  1FCO A;  4X55 A;  5HDS A;  3NY4 A;  3HUN A;  2ZOI A;  3DAV A;  3GEC A;  5FAS A;  1V9Y A;  4I3J A;  2Y2Q A;  4KG2 A;  4GKU A;  2Y2O A;  4CLC C;  4KZ4 A;  1CEG A;  3UB5 P;  5CEB A;  3QP6 A;  2JHE A;  2RCX A;  2EWW A;  1K55 C;  3OPP A;  5E2H A;  3CIT A;  4UA7 A;  3VFH A;  4ARZ B;  4MMN A;  3SH9 A;  5FQJ A;  1BYW A;  3O87 A;  5DF8 A;  1WYB A;  3I7J A;  3DBA A;  3RH8 B;  5CHJ A;  2X01 A;  2XH9 A;  3LO7 A;  1MPL A;  4RX3 A;  3BFC A;  1NYM A;  4HES A;  2OLV A;  4IVK A;  1MC0 A;  4YWZ A;  3NUL A;  1XA1 A;  4GD8 A;  1W63 M;  3C30 A;  1K56 D;  4LRY C;  2QZ6 A;  4KZ9 A;  1GSV A;  4DE3 A;  1FR6 A;  5KIZ A;  1Q2P A;  2HPB A;  4EWF A;  3CMZ A;  4EUZ A;  3LIE A;  3ZCZ A;  3IT9 A;  4B93 A;  3UDX A;  3E2K A;  4H8R A;  1HD8 A;  3NDE A;  5AVF A;  3AGE A;  3TE8 A;  4DE2 A;  1K6R A;  3Q81 A;  2Y8H A;  1M6K A;  1OPX A;  1OME A;  5G4Z A;  2JKT M;  4BMW A;  3ZVW A;  1IFQ A;  2G2U A;  2Y59 A;  4P6B A;  4NXE A;  2HF6 A;  5F83 A;  3IWI A;  4WLA A;  4NK3 A;  2Y2L A;  4FOF A;  5KMW A;  2PU4 A;  3MBZ A;  2XEP A;  5AQ7 A;  5CX7 A;  3D3O A;  3SZT A;  4OVD A;  2PU2 A;  3FYZ A;  3FKW A;  2XD5 A;  4CPK A;  4KZA A;  5G4Y A;  1ODV A;  5G18 A;  1OJ5 A;  4R3J A;  4XUX A;  2W3G A;  4LCL A;  3DTM A;  1TS8 A;  5EM1 A;  1K57 A;  4R23 A;  1XGI A;  1YMS A;  5FSR A;  5I5L A;  3UNW A;  3G34 A;  3HLF A;  4YIN A;  5FQQ A;  4P0M A;  4I3A A;  4PM8 A;  3T4S A;  4F94 A;  2Q9N A;  1FIL A;  2ZC5 B;  2OSU A;  3N8R A;  3W4Q A;  1DJB A;  5DFY A;  1Z09 A;  5FAO A;  2WZZ A;  3T1R A;  3JVU A;  4MN7 A;  1BUE A;  2P9V A;  1CJF A;  2WKH A;  4N1X A;  3ZYT A;  3MKF A;  3UE0 A;  4E3N A;  2AVX A;  3SS3 A;  5EM0 A;  1OT6 A;  1JVJ A;  4R3A A;  4WYY A;  1DP9 A;  4NEE D;  3E4Q A;  5K5B A;  1LLB A;  1TEM A;  3T4J A;  4K0X A;  4QB8 A;  5AVE A;  4HHD A;  2W3E A;  3G32 A;  1TS0 A;  3BW6 A;  1G6A A;  1YLP A;  3DWZ A;  4EEU A;  4KZ6 A;  3ITB A;  3F1N A;  2XF3 A;  1MKI A;  1J3W A;  4S2I A;  1S66 L;  5GHZ A;  1W8Q A;  4M3K A;  3MXS A;  2OWJ A;  3G4P A;  2IWC A;  3FPW A;  4CLC E;  4EV4 A;  3EGX C;  3EWK A;  4R0Q A;  3PBQ A;  5L07 A;  1VEU A;  1MY8 A;  3MMH A;  3TRC A;  4LPZ A;  2R78 A;  3KSI A;  1JTG A;  4GS9 A;  3E0Y A;  2E8I A;  2PRF A;  2EFU A;  3CLO A;  3WS5 A;  4B9O A;  3DTE A;  5EEC A;  2V1A A;  2ZL1 A;  4ZJ1 A;  3OC2 A;  3MXQ A;  3CUE C;  1FSW A;  3CI6 A;  3HVF A;  3CUE A;  4QWO A;  4JXV A;  4XXR A;  3PAG A;  3T4Q A;  4WZ5 A;  3BEB A;  2JKF A;  3E4P A;  2KDK A;  4E3L A;  3BEC A;  2L1M A;  2WYX A;  4HOI A;  5FL3 A;  2QWS A;  2LB9 A;  3Q7V B;  3NIA A;  3Q82 A;  1ESI A;  4NKP A;  4GLQ A;  4KUK A;  3IF6 B;  4KG6 A;  3IF6 A;  4OLG A;  2H0T A;  2VGL M;  4KZ3 A;  5EVI A;  5HAQ A;  2UV0 E;  1WA9 A;  4H6J A;  1T18 A;  3VOZ A;  1IKI A;  5EVI D;  2ZM2 A;  3HLB A;  2QPN A;  3LR0 A;  4NG2 A;  2W1R A;  3WWX A;  4C75 A;  5HSQ A;  2Y2J A;  1LT0 A;  3BWL A;  3UB6 A;  3UDI A;  3V5M A;  4B4X A;  4GZB A;  5TBM B;  3LCE A;  5F5Y A;  2ZQ7 A;  1DP6 A;  4HI4 A;  2JKT I;  1PFL A;  4HP4 A;  1K55 A;  3VOY A;  5EUA A;  1JWZ A;  2Y2H A;  4IVI A;  5HWT A;  3WS1 A;  4HEF A;  3ZVT A;  5L2F A;  3DTI A;  4BJP A;  2J3T C;  4S2O A;  3SH7 A;  4IHQ A;  1BLH A;  2J7V A;  3TOI A;  3EEA A;  2PDR A;  2VV6 A;  2WKP A;  3OPR A;  4AFI A;  3UO9 A;  4WMC A;  2XR0 A;  3KYZ A;  3QNC A;  4HY8 A;  5DKL A;  1MWR A;  3BRM A;  1NRF A;  3TG9 A;  2ZC3 B;  1WE4 A;  3CJM A;  3Q7Z A;  4BBU A;  3BQA A;  3PBO A;  3IH9 A;  3C7V A;  2Z6C A;  4EQ1 A;  4R6L A;  2VJW A;  3GDI A;  2WUQ A;  5CGW A;  1H0M A;  3VP2 A;  3LIF A;  2EWV A;  4P85 A;  5JYO A;  4DF6 A;  3S4X A;  5EE8 A;  5FDS A;  1TD5 A;  3D72 A;  3S7N A;  3BLM A;  4N92 A;  1KE4 A;  4HQA A;  1IKG A;  4N1H A;  4S2L A;  3UB8 A;  4QU3 A;  1OTI A;  5AJG A;  2GZA A;  4CLC A;  1H5X A;  1K4E A;  2GDN A;  1FCM A;  2W1T A;  1L3L A;  2E8J A;  1QMF A;  4PM7 A;  3GMW A;  3MFD A;  2RL3 A;  3MJQ A;  3A3I A;  1G28 A;  4B88 A;  4JGR A;  4DDS A;  1PW1 A;  3ZNY A;  2ACG A;  3C8C A;  3G31 A;  5DJU A;  5AQB A;  4KQD A;  5EPH A;  1NY0 A;  4R1G A;  4WMC D;  1YLT A;  1DRM A;  5M19 A;  2Y2P A;  3S22 A;  3AGF A;  4HJ6 A;  4K08 A;  4OPZ A;  2FH5 A;  5HL1 A;  2QMI A;  1Q2Q A;  4R3B A;  1C3B A;  4Y2F A;  1KVL A;  2PBD P;  4YFM A;  4NXG A;  3G30 A;  4EU0 A;  1LI9 A;  4GDB A;  1ZTU A;  2VEA A;  2MJ6 A;  5AQ9 A;  1MWS A;  4II7 A;  3IHB A;  1JWP A;  2JE5 A;  3T1Q B;  1YKD A;  3F1P B;  2Y2I A;  5DTT A;  4KZ8 A;  5HFO A;  4JLF A;  4IBX A;  4IUK A;  5GHY A;  3P01 A;  4MBH A;  3R4K A;  3W4O A;  2GJ3 A;  3A3D A;  2UWX A;  2H10 A;  1NWZ A;  4Q8I A;  3F1O B;  3QHY A;  5KSH A;  2B02 A;  3C4O A;  5C5K A;  3HRE A;  4DKI A;  3WS2 A;  1F9I A;  5CER A;  4BLM A;  2Y2G A;  3HUO A;  2QJ5 A;  1BTL A;  3CPT B;  3UE3 A;  1AXB A;  3CPT A;  3K2N A;  3N8S A;  5GLD A;  3LFV A;  4PMA A;  4PKY G;  1S4S A;  3MQO A;  5A8B A;  2VGK A;  3IXB A;  4GB7 A;  3T4K A;  3OPH A;  4RYE A;  4LRZ E;  2VX8 A;  2H28 A;  3V67 A;  3ZFZ A;  3PTE A;  1G6O A;  5HZH A;  1ALQ A;  4EQI A;  2ZQ9 A;  4NET A;  4S2N C;  3R7W A;  4IBR A;  1T1A A;  4OQH A;  4Y0U A;  4Z1W A;  1CEF A;  4QJG A;  3G2Z A;  1OTA A;  4Q0I A;  2EX2 A;  4MNR A;  2ZQC A;  4EEP A;  3T1X A;  2YKF A;  4LGW A;  2VV7 A;  5EFW A;  5GL9 A;  2WKR A;  5TGF A;  2QHK A;  4FSF A;  1XA7 A;  3FG8 A;  1XXM A;  2DRW A;  3MR0 A;  3T4L A;  2WKQ A;  4Y7P A;  2V0W A;  5U47 A;  2O99 A;  2XFS A;  4S2J A;  3S7Q A;  4KZ5 A;  5CEC A;  1ZHH B;  3IWO A;  4DMZ A;  1DJC A;  4PAU A;  3OCN A;  4I3I A;  3TJZ C;  5TJJ A;  3ZNT A;  3OOV A;  2EXB A;  1CF0 A;  4RQ9 A;  1GSW A;  1KDS A;  4OH0 A;  5HW3 A;  4C3Q A;  1O07 A;  3V3S A;  3BY8 A;  2BLS A;  2Y4A A;  4WM9 A;  2ZQ8 A;  4R38 A;  1W63 Q;  3VSL A;  1E25 A;  2FZ0 A;  4ZBE A;  5DTK A;  2GX5 A;  1XFQ A;  1YMX A;  5EOO A;  3ZDJ A;  4WZ5 C;  1ES5 A;  2OOL A;  1YSQ A;  4GOG A;  3IF5 A;  1M40 A;  2OWH A;  2V8F A;  1EW0 A;  1FOF A;  1OTB A;  2XRO A;  4OPQ A;  4GHI B;  4C6Y A;  4JF4 A;  3SW1 A;  3H9W A;  5MC7 A;  3KSH A;  4QPR A;  3O88 A;  1OJG A;  4LV1 A;  3A3J A;  4CLC B;  2XA7 M;  4UHU A;  3HLC A;  1NZO A;  2ZC4 B;  3MXR A;  2A3U A;  3UDF A;  1ONH A;  3CG5 A;  5CHU A;  1KE3 A;  4DRT A;  4Z9Q A;  1W5D A;  2PAV P;  3B42 A;  4BL2 A;  1FCN A;  5FEG A;  1ERO A;  3BQ8 A;  4WEL A;  5HDC A;  2HP5 A;  4EES A;  2VA0 A;  1YLY A;  4DJ3 A;  5J7E A;  1OTD A;  5DKK A;  2WAE A;  5F68 A;  2O9A A;  3G2Y A;  2A49 A;  4QY6 A;  2Y2K A;  3DW0 A;  1AWI A;  4IUH A;  4X6T A;  4E04 A;  4PM6 A;  1K57 C;  1KOU A;  3OZH A;  4RX2 A;  1PWD A;  4X1L A;  3UPN A;  3VMA A;  3IXH A;  3IX4 A;  2XLN A;  2O9C A;  2OAP 1;  2W27 A;  1G5U A;  1LSW A;  1D1J A;  3M2J A;  2IWB A;  2I9V A;  1GHP A;  2W3F A;  2V8C A;  3IS2 A;  3F1P A;  2HDS A;  1K38 A;  2ZL1 B;  5M1A A;  4X69 A;  2X02 A;  1N9O A;  1S1Y A;  4L9G A;  4X25 A;  3KX0 X;  4A5R A;  2XFT A;  1XJ3 A;  3C5A A; 
#chains in the Genus database with same CATH homology
 2PR5 A;  1P9R A;  3RTY A;  3VV4 A;  4BJP A;  4UQI M;  2J3T C;  5HWW A;  4JGO A;  4P6Z M;  3T4T A;  3MF0 A;  4IHQ A;  1YSP A;  3EEA A;  2PDR A;  1MKM A;  2V9A A;  2VV6 A;  3CAX A;  2M7V A;  2WKP A;  4NXF A;  4AFI A;  1NLZ A;  3LID A;  3S7P A;  2DMW A;  2K31 A;  3KYZ A;  4HY8 A;  1D06 A;  1H8M A;  5DKL A;  3C38 A;  4O0P A;  3T4O A;  2YKH A;  3PBS A;  4MN5 A;  2D01 A;  4BBU A;  1XJ6 A;  3BQA A;  3PBO A;  1XJ4 A;  5DJT A;  2PHY A;  3FC7 A;  1F98 A;  3LR5 A;  2Z6C A;  1OT9 A;  4EQ1 A;  4R6L A;  2VJW A;  3GDI A;  2ZBB A;  3KYQ A;  3LR4 A;  3G6O A;  2K7S A;  3IS2 B;  4HH3 A;  4KQO A;  3LIF A;  3PBT A;  4I38 A;  4Y3I A;  5HD5 A;  5L8M A;  5F69 A;  2EWV A;  3VE3 A;  1S67 L;  4ETZ A;  5HWV A;  1TD5 A;  1UWN X;  3D72 A;  4L9E A;  4WF0 A;  3S7N A;  5HPF A;  3HJI A;  1T1B A;  4HQA A;  1TF1 A;  3UB8 A;  4R70 A;  1STZ A;  2PD8 A;  1OTI A;  5AJG A;  2GZA A;  4CLC A;  2W0N A;  1P0Z A;  2B18 A;  3JVV A;  5HPI A;  2ZMV A;  3EGD C;  2W1T B;  3P7N A;  2W1T A;  4PHT A;  3ZQ5 A;  1N9L A;  3LUQ A;  3LR3 A;  3E4O A;  5F6A A;  4YNR A;  2PT7 A;  3VE4 A;  3E98 A;  2LB5 A;  2P04 A;  4O8G A;  3K3D A;  3UB9 A;  3MJQ A;  5HDS A;  1G28 A;  3NOU C;  2O0Y A;  2ZOI A;  4JGR A;  3T50 A;  4EUV A;  2IA2 A;  3GEC A;  4XT2 A;  4XT2 B;  1V9Y A;  4I3J A;  3C8C A;  5DJU A;  5DFX A;  1N9N A;  1XFN A;  1YAX A;  4CLC C;  2VLG A;  3A0R A;  4KQD A;  1X0O A;  1DRM A;  3BY9 A;  2JHE A;  3HCY A;  2EWW A;  4HJ6 A;  3CIT A;  3H82 A;  4K08 A;  1T19 A;  3KO6 A;  4ARZ B;  2FH5 A;  4MMN A;  3LIC A;  3B33 A;  1BYW A;  1UWP X;  2NUP C;  2D02 A;  2QYB A;  5HDD A;  4GJ4 A;  4Y2F A;  4GW9 A;  3DBA A;  3RH8 B;  4NXG A;  4KUO A;  4EU0 A;  3MFX A;  3H7W A;  4Q0J A;  1ZTU A;  2VEA A;  2MJ6 A;  4II7 A;  2XA7 S;  4WEK A;  4F3L B;  4EER A;  1MC0 A;  2HJE A;  4YWZ A;  1YKD A;  3F1P B;  3BJN A;  2V1B A;  1W63 M;  3C30 A;  4IUK A;  4LRY C;  5J4E A;  2P08 A;  3O5Y A;  4I39 A;  1GSV A;  5J3W A;  3OLO A;  4OOM A;  2JKR I;  3CWF A;  2J3T D;  4OOL A;  5KIZ A;  2G7U A;  3P01 A;  3R4K A;  1LSX A;  2CMN A;  2XRN A;  4UEY A;  4G3K A;  4G3W A;  4JGQ A;  2GJ3 A;  3LIE A;  4NXB A;  4B93 A;  1NWZ A;  5AVF A;  3TE8 A;  3F1O B;  2O9B A;  4WL9 A;  4EXO A;  5KSH A;  2Y8H A;  4EET B;  2Z6D A;  2B02 A;  1NLY A;  5C5K A;  4L0L A;  5IU1 A;  5HL6 A;  1OPX A;  1F9I A;  4JGP A;  2JKR M;  5G4Z A;  2JKT M;  2PD7 A;  4BMW A;  1IFQ A;  2QJ5 A;  2L0W A;  4NXE A;  2HF6 A;  3UE3 A;  3K2N A;  4DN0 A;  4WLA A;  3LFV A;  4FOF A;  4PKY G;  1S4S A;  3MQO A;  2HJ9 C;  5A8B A;  2VGL S;  2KOI A;  4IJG A;  5CX7 A;  3W2Z A;  3D3O A;  1TS6 A;  3T4K A;  2V0U A;  4LRZ E;  2VX8 A;  2L4R A;  2H28 A;  3VOL A;  2Y79 A;  3V67 A;  4EW7 A;  3ULF A;  1VB6 A;  2PYP A;  1G6O A;  4MCW A;  5HD3 A;  5HZH A;  2BAS A;  5G4Y A;  2INW A;  3R7W A;  1ODV A;  4HJ4 A;  4GCZ A;  3R7W B;  1OJ5 A;  1T1A A;  2W3G A;  4MN6 A;  2P7J A;  1TS8 A;  2EA9 A;  2PR6 A;  2HGV A;  4Z1W A;  1V9Z A;  2K2N A;  4Q0H A;  3NOP C;  5I5L A;  3MQ0 A;  1OTA A;  3H7W B;  4DJ2 A;  4Q0I A;  3U2A A;  3UME A;  1H3Q A;  2J3W A;  4EEP A;  2YKF A;  3NJA A;  2VV7 A;  4I3A A;  5EFW A;  2WKR A;  4BBV A;  2W3D A;  3T4S A;  2QHK A;  4FSF A;  3FG8 A;  3UMD A;  4LLO B;  3UE6 A;  1F5M A;  3S7O A;  3MR0 A;  3KSG A;  2XSS A;  3A0S A;  1JNU A;  5DFY A;  5TBM A;  3T4L A;  2WKQ A;  2V0W A;  3EOI A;  2O99 A;  1P9W A;  3S7Q A;  3JVU A;  4MN7 A;  3OBF A;  1ZHH B;  4DMZ A;  3K3C A;  1Y28 A;  2M7U A;  1OTE A;  4PAU A;  3OCN A;  4GS9 B;  2J80 A;  4I3I A;  3F1O A;  3TJZ C;  2A2L A;  5TJJ A;  3OOV A;  4RQ9 A;  1D7E A;  1GSW A;  4PKY A;  3ZYT A;  2HV1 A;  3EQU A;  1OT6 A;  4ARZ A;  3B47 A;  4R3A A;  1DP9 A;  3NOT C;  4NEE D;  3E4Q A;  3BY8 A;  5K5B A;  3LIB A;  2W3H A;  4WN5 A;  3IBJ A;  4R38 A;  3T4J A;  4Y5F A;  4WUJ A;  4H6J B;  5AVE A;  1W63 Q;  2VZW A;  4HHD A;  2W3E A;  3IBR A;  2FZ0 A;  1TS0 A;  2VV8 A;  3BW6 A;  3PXP A;  3TW8 A;  3LI8 A;  1NRJ A;  4EEU A;  2GX5 A;  1XFQ A;  3F1N B;  2KX6 A;  3F1N A;  4F3L A;  2OOL A;  1YSQ A;  3HJK A;  1S66 L;  1XJ2 A;  2OWH A;  1EW0 A;  1OTB A;  4ETX A;  2XRO A;  4GHI B;  4GHI A;  3SW1 A;  2OWJ A;  1S1Z A;  1P97 A;  5DF9 A;  3H9W A;  5MC7 A;  3FPW A;  3KSH A;  4CLC E;  4QPR A;  1LSV A;  1OJG A;  3EGX C;  3LIA A;  3EWK A;  4YOF A;  3PBQ A;  4CLC B;  2XA7 M;  4BBT A;  3PYP A;  3MMH A;  4M4X A;  3TRC A;  4LPZ A;  2R78 A;  3KSI A;  3LI9 A;  4GS9 A;  3E0Y A;  4L9F A;  3EQV A;  4HP9 A;  4HH2 A;  3CLO A;  4B9O A;  3EEH A;  2KLI A;  2V1A A;  3OC2 A;  1UGU A;  3MQQ A;  5LBR A;  4CQH A;  3B42 A;  3MXQ A;  4MDZ A;  1VHM A;  1IOU A;  1DP8 A;  3CUE C;  5IT5 A;  3CI6 A;  2JN7 A;  4HIA A;  3CUE A;  3OCL A;  4LRX C;  2PYR A;  3BQ8 A;  3T4Q A;  4WEL A;  3UB7 A;  5HDC A;  3E4P A;  2KDK A;  4EES A;  4O01 A;  2VA0 A;  2QJ7 A;  2L1M A;  4DJ3 A;  2OAQ 1;  5J7E A;  4HOI A;  1OTD A;  2QWS A;  4HJ3 A;  4I5S A;  5DKK A;  5FL3 A;  5F68 A;  2O9A A;  4ME4 A;  2LB9 A;  3PR6 A;  3A0V A;  2ZMF A;  4BWI A;  3H82 B;  2NUT C;  4IUH A;  4E04 A;  3KSF A;  4GLQ A;  4KUK A;  4NKP A;  3RFB A;  1KOU A;  4CLC D;  2VGL M;  2GNX A;  1WA9 A;  1GSX A;  4H6J A;  1T18 A;  4ZRR A;  1TS7 A;  3LYX A;  2M1C A;  3ICY A;  2O9C A;  2OAP 1;  1LL8 A;  1T1C A;  2A24 B;  2W27 A;  4G3V A;  1LSW A;  2A24 A;  3FPV A;  3PBN A;  4WEJ A;  3PBR A;  2I9V A;  2QKP A;  1S4R A;  2W3F A;  3LR0 A;  3IS2 A;  2W1R A;  1MZU A;  5HSQ A;  3F1P A;  1LT0 A;  3BWL A;  4UQI S;  3UB6 A;  4HNB A;  4P6Z S;  2ZOH A;  3PHY A;  1N9O A;  3NHQ A;  5TBM B;  5F5Y A;  5IS1 A;  1DP6 A;  1S1Y A;  3C2W A;  4L9G A;  4HI4 A;  2JKT I;  4HP4 A;  3KX0 X;  2VKS A;  1XJ3 A;  5HWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...