3C8CA

Crystal structure of mcp_n and cache domains of methyl-accepting chemotaxis protein from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
240
structure length
240
Chain Sequence
SLRSMVSDSVDEIVDGVSKTTAEVINGRKSIAQYATSLIENNPEPDNVRTIISQPLIKNTFLLVGFGLEKDGSNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYADSASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESKINVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYAALDELRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
publication title Crystal structure of Mcp_N and cache N-terminal domains of methyl-accepting chemotaxis protein from Vibrio cholerae.
rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Structural genomics, unknown function
total genus 79
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3c8cA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3c8cA02
2EA9A 2PD7A 4I5SA 4KUOA 4I38A 5DJTA 2K7SA 2M1CA 2OWJA 3K3DA 1LT0A 1S4SA 5HDCA 3CAXA 1F9IA 1TS8A 4L9GA 3MJQA 2PR6A 3H7WB 4JGOA 2W27A 3LIBA 4XT2B 3HJIA 4XT2A 2P7JA 2VV8A 4K08A 3CWFA 3B33A 3UB8A 2BASA 5J4EA 4LRXC 2ZBBA 1XJ2A 4KQDA 5DKKA 5HWTA 1T1BA 1TS0A 3T50A 5AVEA 1D06A 3NOTC 1OT9A 3VOLA 1S1YA 4HP4A 4DJ2A 3NOUC 5HSQA 1XFQA 3NOPC 3K3CA 2W0NA 4GS9B 1WA9A 2QWSA 3VE4A 4GS9A 4NXBA 5J7EA 1MZUA 4LLOB 3VE3A 5KIZA 4HJ6A 1TS7A 3HJKA 2H28A 3NHQA 1V9YA 2A24B 5F68A 2V0WA 1XFNA 1OJGA 4WLAA 3UMEA 4L9EA 2A24A 3H82B 4EXOA 1XJ6A 3LI9A 3H82A 2OWHA 5G4ZA 4EERA 3A0VA 4JGQA 4EQ1A 2GJ3A 2WKPA 1N9NA 3D72A 3F1NB 5F69A 1LSWA 2KX6A 3F1NA 2L4RA 3P7NA 1T18A 4LPZA 2PYPA 2JHEA 3LICA 3KX0X 2VEAA 3G6OA 4NXGA 2R78A 5F5YA 3E4OA 4L9FA 4JGRA 1OTAA 2J80A 3IS2B 1P97A 3H9WA 1GSXA 1NWZA 3IS2A 4PKYA 1LSVA 1D7EA 2QKPA 3A0RA 4HIAA 3EEHA 3LIDA 2PDRA 3LUQA 3SW1A 3ULFA 4M4XA 4JGPA 4NXFA 2WKRA 1ODVA 4YWZA 2WKQA 1P0ZA 2B02A 4R3AA 4WF0A 2KDKA 2PR5A 2I9VA 1OTIA 2ZOHA 5F6AA 4PKYG 4WN5A 1UGUA 1DP6A 4MN6A 1TS6A 1T1CA 3UB9A 4BBTA 4R38A 2QHKA 1T1AA 4EEUA 1OTBA 3E4PA 4MN5A 5TBMB 4HQAA 3ZQ5A 5TBMA 1S4RA 4E04A 3BY8A 4LRYC 4KUKA 5HD3A 4I39A 4GW9A 3A0SA 3BWLA 4WL9A 2V9AA 3PHYA 3UB6A 3MXQA 2HV1A 4WUJA 1KOUA 3IBRA 1T19A 3FG8A 1OJ5A 4HJ3A 1S67L 4I3IA 3EWKA 3LYXA 3MQOA 3FC7A 1GSWA 1LL8A 1JNUA 2ZOIA 1Y28A 2D01A 4HOIA 3GECA 4GCZA 4LRZE 1DP8A 1S1ZA 3BY9A 4HY8A 1OT6A 2VLGA 3UMDA 4HP9A 1OTDA 2VV7A 5HD5A 4HNBA 3PYPA 2L1MA 1EW0A 1LSXA 3MR0A 5G4YA 3C8CA 5I5LA 2PHYA 3H7WA 4GHIB 5HWVA 4HH2A 4GHIA 5HDDA 5HDSA 4BBUA 1N9LA 2CMNA 3F1PB 2YKHA 4HH3A 3LIEA 3F1PA 1OTEA 4HHDA 1BYWA 4R6LA 2OOLA 1N9OA 4F3LB 3MFXA 1XJ3A 4F3LA 4RQ9A 2Z6DA 5IU1A 1V9ZA 3ICYA 4I3AA 2L0WA 2Z6CA 2V1AA 1UWPX 5HZHA 5DJUA 3E4QA 4B9OA 4EESA 3CLOA 4EW7A 5J3WA 4EETB 4BBVA 2JN7A 1X0OA 3LIFA 4H6JB 1G28A 5HWWA 4H6JA 2INWA 5DKLA 3NJAA 3UE6A 2VV6A 4HI4A 1DP9A 2V1BA 4NXEA 1UWNX 3RTYA 2PYRA 3GDIA 3UB7A 2YKFA 4EEPA 2PD8A 4I3JA 1S66L 5IS1A 2QJ7A 3OLOA 3F1OB 4DJ3A 2QJ5A 3RH8B 3F1OA 1DRMA 1VB6A 2V0UA 1F98A 4R70A 3MQQA 3LIAA 5A8BA 5EFWA 3C2WA 1GSVA 2D02A 4HJ4A 1XJ4A 3LI8A 5AVFA
chains in the Genus database with same CATH superfamily
4QHCA 3K3DA 1N9BA 1S4SA 4OVDA 1IYOA 1C3BA 3H7WB 2ZL1A 2J8YA 5J8XA 4JXSA 5FDSA 3SS4A 3HJIA 2WZXA 4MBHA 1K25A 4XT2A 5TFQA 1TD5A 4ESPA 3CWFA 3UB8A 3CHWP 5DVAA 4UQIS 1HVBA 1BTLA 5J4EA 1SHVA 2XR0A 3PTEA 3G32A 1XJ2A 3VP0A 1ZKJA 1NYMA 5GLAA 3DBAA 4GD8A 1TS0A 2XH9A 3T50A 3HUNA 2J3WA 4OOLA 4E6XA 4OPYA 3IHBA 3IX4A 4G3KA 3NOTC 2PAVP 1OT9A 2FZ0A 5CHMA 3E2KA 3ITAA 2OAQ1 1F5MA 1ZC2A 3TSGA 4XUXA 1SCWA 1PRQA 3OPLA 4JXWA 2W0NA 1WA9A 5GLCA 4GOGA 2GDNA 4GS9A 5J7EA 4LLOB 4CLCC 4B4XA 2X02A 2XD1A 5JYOA 4EBNA 4B88A 1PW8A 3MXSA 4QPRA 1EROA 1RGZA 4FD8A 1OJGA 5HPFA 1K56D 3NDGA 3LEQA 3ZVTA 2AVXA 3OPRA 3LI9A 3UN7A 4KQOA 4EERA 5CTNA 4BQMA 1VM1A 4JGQA 4EQ1A 3ZNTA 3OOVA 3UPOA 5A92A 3NDEA 5DTKA 4GD6A 5F69A 2OSUA 2WK0A 1PIOA 3V50A 3P7NA 4S2MA 3TE8A 1MXOA 2Y2IA 3KX0X 3FKWA 1ERMA 3IXHA 4NXGA 3QP5A 5L10A 5GLDA 4LCMA 4E3JA 4L9FA 3IS2B 1P97A 4P6ZM 3JPUA 4UEYA 3HVFA 3H9WA 3VP3A 3DWKA 1K54A 4OKPA 3EEHA 2PDRA 3LR4A 4EQIA 3BFDA 4Y2FA 1YSPA 3Q07A 4JGPA 4NXFA 4XUZA 2VK3A 4YWZA 3QHYA 3NY4A 3O3VA 4N1XA 3S7NA 2B02A 5DF7A 4E3IA 3IXGA 1YQSA 2IWDA 2FH5A 5EM1A 2PR5A 5EOOA 1L0GA 1MWTA 1ESIA 3QP8A 5F6AA 2ZC6B 1UGUA 3ZFZA 4MN6A 2Z2MB 3SH9A 4KQQA 1RP5A 3DW0A 4R38A 3VP4A 3BFGA 3ZG5A 3ZG0A 5EVLA 1YSQA 1T1AA 4JF5A 4S2PA 3U2AA 4QJGA 4EEUA 4X1MA 5JYPA 4MCWA 4N9LA 2WZZA 3M2KA 5TBMB 2E8JA 3ZQ5A 4X6TA 4X68A 3S4XA 2Y4AA 4ZJ3A 1STZA 1MWSA 4P6BA 1S4RA 3T1SA 4E04A 2O9BA 3IF6C 3BY8A 3GV9A 4OQIA 3QP2A 3LEZA 4C75A 4C6YA 5HD3A 5KSCA 2ZQDA 2BLSA 2JKFA 4Y0TA 1ERQA 3LFVA 5FAQA 1GCEA 4BLMA 4WUJA 1KOUA 5M19A 3IBRA 2ZMAA 1FOFA 2JKRI 2JKRM 3A3FA 4C3QA 2J9OA 2W3HA 3O5YA 3WS5A 3HUMA 3B3XA 4Q0JA 4II7A 4OQ0A 3MQOA 3PBRA 2JE5A 1JNUA 1BLHA 2W1RA 4DRTA 2D01A 2H0YA 2P9VA 4HOIA 5IT5A 4LRZE 1WYBA 4HY8A 1MBLA 1OT6A 3W4QA 3UMDA 5FSRA 1H8MA 2Y2GA 2XDMA 3UDIA 4PM5A 4IBXA 5HAQA 3MR0A 5CERA 4KG6A 3C30A 5G4YA 4CLCD 1KE0A 3C8CA 2J3TD 2XF3A 3N8SA 5EM0A 3H7WA 3C4PA 4GHIB 4R3BA 4ETXA 4LCLA 2OAP1 4IHQA 1YLPA 5HDDA 4X25A 5EVIA 4YFMA 4ETZA 4OP5A 5HFOA 1CF0A 3DTKA 1K57A 1MPLA 4XXRA 3FZCA 4UHUA 1BYWA 1CI8A 5HL1A 4R6LA 3PXPA 2B95A 4OOMA 3QNBA 5TJJA 3ZG8B 4GNUA 2EX6A 1XJ3A 3NCKA 1LL9A 2Z6DA 1XX2A 4X55A 5IU1A 3QNCA 2K31A 3V39A 3ICYA 4I3AA 3O86A 2Z6CA 2V1AA 3TOIA 1UWPX 3E4QA 3MXRA 4HBUA 4RX3A 1DJBA 3S1YA 2WYXA 2HJEA 4Y5FA 3TRCA 4R4RA 3LIFA 2DCFA 4PPRA 4H6JB 1G28A 3NC8A 5HWWA 4S2NC 3NJAA 4R0QA 5F1GA 4IJGA 3QP6A 1VEUB 3UE6A 3JVVA 2V1BA 4Q0HA 2Z2LB 2YKFA 4UA9A 3SS3A 3M6BA 1GHPA 4JF4A 5IS1A 2M7VA 4R3JA 4GLQA 2K2NA 3R7WA 4QD4A 5U47A 3F1OA 1F98A 3LIAA 3D4FA 2ZM0A 4UA6A 5EFWA 1BUEA 1WYCA 3C2WA 1GSVA 2D02A 4GB7A 4Q0IA 2PT7A 2EA9A 5CHUA 1ONGA 2VX8A 4WZ5C 4I5SA 3UE1A 5KZHA 2OWJA 5EVID 2XEPA 4DMZA 1KGEA 3MZEA 3MZDA 4ZBEA 5IHVA 3WWXA 3N8RA 3QP4A 5A90A 4X53A 3GR2A 2Y2NA 2W27A 2M7UA 1IKIA 2VJWA 1YKDA 2P7JA 5DFYA 3FKVA 1JTGA 2W1TB 3OC2A 4KZAA 4QWOA 4LRXC 1GHMA 3TJZC 1XA7A 2RL3A 1SZVA 4KQDA 2JBFA 2P08A 3HL9A 3UB5P 4BL2A 3ZVWA 2HF6A 2V2FF 2BTFP 4CLCB 2WGWA 4GZBA 1JWPA 1LI0A 2VKSA 2XRNA 5E43A 5EE8A 3ZG7B 3E0YA 2XK1A 1W63M 5KMWA 1LHYA 1XFQA 3IH9A 3K3CA 5CX7A 2QWSA 3EQUA 3O87A 4NXBA 3MF0A 3WS2A 4U3TA 3CPTB 1KDWA 4HJ6A 2R9XA 3CMZA 5CHJA 3VOYA 3DAVA 3IF5A 3V3RA 1CK3A 2A24B 5F68A 1XFNA 4O01A 4WLAA 3UDFA 4P6ZS 3H82A 4OPRA 2XA7M 4ME4A 5G4ZA 5DTSA 1H3QA 2IWCA 3KYZA 4P85A 2OV5A 1NZUA 2GJ3A 3HBRA 3E2LA 3D72A 4MBKA 2MJ6A 2Q9MA 5CECA 3T1XA 1W63Q 3P98A 2HPBA 3F1NA 1S6RA 4B4ZA 2VZWA 4FUWA 3OCNA 3G2ZA 2R78A 3B42A 3E4OA 4FCFA 2J7VA 4Z9QA 2J80A 5K5BA 2ZJ9A 1TVFA 2KOIA 1IELA 3OCLA 5CRFA 2QKPA 3A0RA 3LIDA 3HLEA 3M2JA 4E3LA 3ULFA 1DY6A 4M4XA 3MSHA 4HBTA 2Y2OA 2V20A 2WKRA 2WKQA 5FQIA 5FDHA 3GRJA 2WAFA 1K6SA 3IH8A 2HP9A 5EOEA 4RA7A 5HL6A 1OTIA 2O99A 4OQHA 1FIKA 3MS6A 3WS1A 1BLCA 4ZTKA 5EVEA 4FH2A 1HZOA 4FH4A 1TS6A 3UB9A 4L0LA 1Z09A 4JKTA 2VGJA 3MZFA 2EFUA 5FA7A 2WUQA 3P09A 2B18A 3IF6B 1YLJA 1NY0A 3T12B 2J3TC 3R4KA 4MN5A 4HQAA 2JKGA 4EU0A 5CGSA 2WKEA 1FR6A 4DE3A 4WEJA 2E8IA 5M18A 4GDBA 1W79A 3BWLA 2LB9A 3PHYA 3UB6A 3QP1A 1P9WA 4MBFA 3CUEA 4S2OA 3FYZA 2JKTI 2JKTM 4Y7PA 4RYEA 4X1LA 4KZ5A 4KG5A 4LV3A 5FL3A 1SKFA 4I3IA 4BD1A 3EWKA 3IBJA 3HLCA 1K0KA 1GSWA 4DE2A 3DTIA 4E3NA 2ZOIA 1HLUP 4WYYA 3VV4A 3GECA 5F82A 3BY9A 3VMAA 1H8ZA 3LO7A 2C6WB 1GA0A 1YLWA 4LGWA 1OTDA 2Y8HA 4Y0OA 1L3LA 5HD5A 2ZM2A 3Q81A 4UA7A 3PYPA 2L1MA 1G68A 3Q7VA 2XROA 3G31A 4CLCE 2ZQ7A 4N1HA 4BENA 3G30A 3AGFA 2PHYA 3KSHA 1ALQA 5L07A 5HARA 1XA1A 4ARZA 5TGFA 1MWRA 3G4PA 2KLIA 3UY6A 1YMSA 2W1TA 3F1PB 2YKHA 4GN2A 5FATA 3L7HA 4HH3A 3LIEA 1OTEA 4HHDA 4OPZA 2HZ5A 3T4TA 1NRFA 4MEZA 3S7OA 5EVIC 1LI9A 3N7WA 1NLZA 2I72A 4F3LB 2Y55A 4JXGA 3MFXA 3TG9A 5L09A 3U4LP 4WELA 2A49A 2X71A 5TR7A 1NZOA 1PYYA 4G3VA 2ZC4B 5DJUA 3IT9A 1NLYA 1OPXA 3RJUA 2G7UA 1E3UA 3V5MA 4ZJ1A 4EETB 4BBVA 1P9RA 5GHXA 3BYDA 1I5QA 1S0WA 5EV0A 3Q82A 1W8QA 2INWA 2ZQAA 4S2JA 1IKGA 3IHAA 1PW1A 4NXEA 2PYRA 1KE3A 1EWZA 4KZ3A 1E4DA 1KDSA 1SKOA 4ZRRA 1G6OA 1BLPA 3GMWA 3SZTA 3OPPA 1IYSA 4FTXA 2V0UA 3BQAA 1KGGA 1IEMA 2P74A 4KQRA 3PBNA 1U60A 3MMHA 3LR3A 1ZG6A 5E2EA 3BW6A 3C4OA 2HJ9C 2H10A 3Q7ZA 4HJ4A 1XJ4A 2EXBA 1NRJA 2WGIA 3D3OA 4FOFA 4A5RA 5DJTA 1BSGA 3SH7A 2DMWA 1FCOA 1LT0A 4EBPA 1XP4A 5HDCA 1F9IA 2ZL1B 1ES2A 5FI6A 4HESA 5G18A 1L2SA 3FWLA 3CZDA 4XT2B 3MFDA 1G5UA 1G6AA 2VV8A 4K08A 1XKZA 3B33A 2BASA 4K0WA 3BJNA 1PNEA 5EUAA 4E3KA 1XPBA 2ZBBA 3VOZA 1MKIA 4RX2A 1JVJA 5DKKA 5HWTA 4R4SA 1BT5A 2Y91A 3IWQA 3VP2A 5AVEA 1D06A 2OLVA 4EBLA 4WMCA 5FI7A 1KVMA 2R9WA 2XA7S 1E3UD 1N4OA 3MQ0A 3VOLA 5A93A 4HP4A 4B93A 4OPQA 4Z1WA 2ZM8A 4JPMA 4K91A 4QY6A 3BLSA 3NOUC 3NOPC 4GS9B 4DXBA 1ES5A 1MZUA 3VE3A 1K55C 2WKIA 3IF6A 4CJNA 1TS7A 3HJKA 2H28A 5AQ7A 3UO9A 4YINA 5I94A 3UMEA 5BOHA 4P87A 1YLTA 1XJ6A 2OWHA 1FILA 1FSYA 1M6KA 3A0VA 4E3MA 2O0YA 2PBDP 3NBLA 1NJ4A 2PU4A 4IUKA 4OLGA 1N9NA 2VGLM 4F94A 1NYYA 3G34A 4ZJ2A 5E2GA 5MC7A 4Y3IA 1LSWA 3HLFA 5HAPA 2KX6A 3T4QA 2L4RA 2OLUA 2XQZA 3IX8A 1T18A 4M3KA 4LPZA 2PYPA 3GSGA 1F2KA 3LICA 3C5AA 2HDRA 3LY4A 4ZAMA 4JGRA 1YAXA 3ZYTA 4D2OA 1OTAA 2RCXA 1GSXA 3IS2A 1HTZA 1MY8A 3LY3A 5FI2A 3C7UA 3N4IA 1ZTUA 3CITA 2EXAA 3LUQA 2QZ6A 3SW1A 2BG1A 3N8LA 5CGXA 5HX9A 3B47A 4WMCD 4NEED 4YOFA 2V8CA 1CI9A 2A2LA 1PZOA 3G35A 1ODVA 3ZCZA 5GHYA 1P0ZA 3EEAA 1PFLA 3CI6A 4KZ4A 2V1ZA 3KYEA 4WF0A 3HLWA 2KDKA 3T1QB 5HW3A 2I9VA 1CJFA 4PKYG 4IEDA 4WN5A 2HDQA 3ZG9B 5DF8A 3LR5A 1QMFA 1T1CA 1NXYA 4BBTA 3LGOA 4PM8A 3S22A 3UNWA 2QHKA 4K0XA 4CPKA 5AQ9A 2W3DA 3BLMA 3I7JA 5FEGA 5FEFA 1EI5A 1OTBA 4QB8A 5FASA 5TBMA 4JLFA 3E98A 3PAEA 4S2NA 3S7PA 2O9AA 4KUKA 1XXMA 4P0MA 5AQAA 5FQQA 4PAUA 3A0SA 1TDGA 1O7EA 1O07A 3MXQA 3HLBA 2HP6A 3BRMA 2W3EA 1T19A 3FG8A 1OJ5A 3FV7A 2H5SA 1PWCA 3FC7A 4D60A 1WE4A 5FQ9A 1LL8A 3CUEC 3EGXC 4YNRA 1Q2PA 4DN0A 3PAGA 1FSWA 4GCZA 5CGWA 3ZHHA 1S1ZA 3P01A 2VLGA 1K4FA 5AQBA 1PI5A 2ZQCA 4U0TA 3PBTA 4HNBA 3A3DA 1EW0A 3W2ZA 1LSXA 4BMWA 1K54C 5I5LA 4JBFA 4OOYA 5CTMA 1VETB 1E25A 5HWVA 2Y2PA 4GHIA 5EVIB 2EWWA 3RFBA 3PR6A 3V3SA 3NIAA 4LV1A 5HPIA 4MLLA 1N9LA 1FCNA 2CMNA 3HLGA 3AGDA 1AWIA 5EECA 1TDLA 3ZDJA 1YLZA 3A3IA 1PZPA 2OOLA 4GJ4A 1N9OA 1OMEA 1GA9A 1PWGA 2VGKA 2ZMVA 5FQKA 1J9MA 1XGJA 2ZC3B 4RQ9A 1ZHHB 1H8YA 1V9ZA 2PBYA 3JYIA 2L0WA 2JC7A 4WZ4A 3EOIA 4OH0A 2XGNA 3FPVA 3UE3A 5HZHA 3W4OA 4WM9A 4B9OA 3CLOA 4NG2A 1MKMA 4EW7A 2JN7A 2DNSA 4G3WA 4O8GA 1DJAA 3BQ8A 4RVAA 2FFYA 4H6JA 1BZAA 5DKLA 3UDXA 1CEFA 2VV6A 3G2YA 1HD8A 3RTYA 2NUPC 1VEUA 3T4SA 2UWXA 3KSIA 1L0DA 4EEPA 4I3JA 1S66L 2GNXA 2ZC5B 2PU2A 1CEGA 4LENA 2B5RA 2QJ7A 3DWZA 3R7WB 2H0TA 1Q2QA 3OLOA 3F1OB 4MN7A 3SH8A 2HDSA 3RH8B 1KGFA 1DRMA 5D3OA 4R70A 3MQQA 3RXXA 4N92A 1BULA 4PM9A 4OQGA 1FCMA 1JWZA 5GL9A 3JVUA 3GTCA 5F1FA 4ZDXA 4IBRA 4E6WA 2PD7A 2JCHA 4KUOA 2XFTA 4I38A 2K7SA 2M1CA 3BECA 3CAXA 3ZGAB 1TS8A 4BL3A 4L9GA 3MJQA 2PR6A 3EGDC 3IWOA 2FFFB 1VQQA 4JGOA 2O9CA 2XSSA 1JTDA 3LIBA 5FQMA 1Z6FA 4O0PA 4KZ8A 2VA0A 3T4LA 3VSKA 2ZC7A 1SDEA 4PM7A 4DKIA 1D1JA 4JXVA 1Y54A 3OZHA 5E2HA 2DRWA 1T1BA 4S2IA 3PBSA 2J9PA 1TEMA 2QMIA 2WGWB 5AJGA 3WRTA 4CLCA 1S1YA 3HREA 1K57C 3BFFA 4WEKA 2G2WA 2VGLS 4DJ2A 2XD5A 4DE1A 1L0FA 3GQZA 5HSQA 3HUOA 3IXBA 1IOUA 5FAPA 2EWVA 2Y59A 4X56A 4BD0A 4E3OA 4IVKA 1I2SA 3VE4A 2W3FA 3HCYA 3VFFA 5KIZA 3LR0A 2ZMFA 4UQIM 3CPTA 3ISGA 3NHQA 1V9YA 2QPNA 2V0WA 5EPHA 3IX3A 4L9EA 2A24A 3H82B 4EXOA 4LFUA 4EUZA 2C5WB 5A91A 2XFSA 1L0EA 2EFXA 3GVBA 4NETA 1ONHA 1YT4A 3TW8A 4PMAA 2WKPA 3PBOA 4R23A 1FQGA 3F1NB 2GX5A 2V8FA 3W8KA 2ZQ8A 1Y4OA 4R1GA 3C7VA 2JHEA 4Y17A 3MKFA 1W5DA 4X69A 2Y2MA 2WGVA 2VEAA 3S7QA 3G6OA 3NI9A 5F5YA 4DF6A 2Y79A 1XGIA 3OPHA 3WS4A 3HLDA 3UE0A 3M6HA 1NWZA 4PKYA 3D9YA 4QU3A 1LSVA 2A3UA 1H0MA 3KO6A 5DFXA 1D7EA 4HIAA 3BEBA 5KSHA 4GKUA 3VFHA 4KG2A 4DXCA 3ITBA 1PWDA 1RCJA 4KZ6A 1VHMA 1M40A 4MNRA 4WBGA 3K2NA 3KYQA 4DDSA 1ESUA 4R3AA 3W4PA 4U0XA 5CEDA 4HEFA 5GHZA 1J3WA 1YLYA 1VETA 1TF1A 4S2KA 4PM6A 5L8MA 2ZOHA 3RXWA 4O7DA 5L2FA 2ZQ9A 3IWIA 1DP6A 4MDZA 3FPWA 4Q8IA 1IFQA 4FSFA 2G2UA 2Y2KA 3CJMA 4LV0A 3DTEA 2XLNA 4DE0A 1IYPA 3E4PA 2W3GA 5CXWA 4AFIA 4UAAA 3LCEA 3BFEA 3OBFA 1FR1A 4BJPA 1LLBA 5HAIA 1AXBA 3WS0A 4LRYC 3VP1A 3NULA 3MBZA 5LBRA 4NKPA 1PI4A 2Q9NA 3UPPA 3DTMA 3PBQA 5F83A 4I39A 4S2LA 4GW9A 3SOIA 4WL9A 1KVLA 2V9AA 3IXDA 2HV1A 2PRFA 3ZNYA 2WAEA 2Y2QA 5GLBA 1SDNA 1ZG4A 3T4KA 4HJ3A 1S67L 3N6IA 4GDNA 4PHTA 4IUHA 3LYXA 4QY5A 4EV4A 4KZ9A 1Y28A 3NECA 1W7FA 2X01A 1DP8A 4KENB 5E2FA 3T4JA 4H8RA 3L9KA 4HP9A 3UPNA 2QYBA 3Q7VB 2UV0E 1ACFA 2VV7A 1QMEA 2IWBA 2CC1A 1K4EA 2WKHA 5C5KA 3MKEA 3EQVA 4Y13A 3O88A 1A0KA 4KZ7A 3BFCA 4ARZB 4N9KA 4HH2A 1IYQA 4IVIA 1H5XA 3SS5A 5HDSA 3V67A 4BBUA 1YPRA 2GZAA 4BWIA 2P04A 2LB5A 1YMXA 3Q1FA 3F1PA 4ID4A 2EX8A 2HGVA 2Y2JA 1GHIA 2ZLYA 1JWVA 2HDUA 3A3EA 3BM6A 3WRZA 4OP8A 1DJCA 4F3LA 1LL5A 1K55A 1ES3A 2Y2HA 2IA2A 3VSLA 2EX9A 2EX2A 4CQHA 4KZBA 1YM1A 5FQJA 4EUVA 3KSFA 1RGYA 5DTTA 4OONA 4EESA 3AGEA 3CG5A 1K38A 5J3WA 1KE4A 5FAOA 1X0OA 4DDYA 3T4OA 4JF6A 1I2WA 1MWUA 2ACGA 1ES4A 4LV2A 3T1RA 2Q0OA 4HI4A 1DP9A 1UWNX 1SKOB 2Y2LA 3GDIA 3UB7A 3C38A 2NUTC 4MMNA 2PD8A 1MC0A 1CQAA 1BLSA 1W8YA 2WADA 3IQAA 4DJ3A 4Y0UA 2QJ5A 4WZ5A 1K56A 1VB6A 4EWFA 5DF9A 4NK3A 2ZD8A 5A8BA 2P9VB 3KSGA 4OLDA 5M1AA 3A3JA 1K6RA 5CEBA 3LI8A 2HP5A 4Y15A 5AVFA
chains in the Genus database with same CATH topology
3D3OA 2EA9A 2PD7A 4FOFA 2VX8A 4I5SA 4KUOA 4I38A 5DJTA 2K7SA 2M1CA 2OWJA 3K3DA 2DMWA 4DMZA 1LT0A 1S4SA 5HDCA 3CAXA 1F9IA 1TS8A 4L9GA 3MJQA 2PR6A 3EGDC 3H7WB 4JGOA 2W27A 2M7UA 2O9CA 2XSSA 3LIBA 4XT2B 3HJIA 4O0PA 2VJWA 1YKDA 4XT2A 2P7JA 1TD5A 5DFYA 2VA0A 3T4LA 2VV8A 4K08A 3CWFA 3B33A 3UB8A 2BASA 2W1TB 3OC2A 3BJNA 4UQIS 5J4EA 4LRXC 2ZBBA 3TJZC 1XJ2A 4KQDA 5DKKA 5HWTA 1T1BA 3PBSA 3DBAA 2P08A 1TS0A 3T50A 5AVEA 1D06A 2J3WA 4OOLA 2HF6A 2XA7S 5AJGA 4G3KA 4CLCB 3NOTC 1OT9A 3VOLA 3MQ0A 2FZ0A 4CLCA 1S1YA 4HP4A 4B93A 4Z1WA 2XRNA 2VKSA 4WEKA 3E0YA 2VGLS 4DJ2A 2OAQ1 1F5MA 1W63M 3NOUC 5HSQA 1XFQA 3NOPC 1IOUA 3K3CA 2EWVA 2W0NA 4GS9B 1WA9A 5CX7A 2QWSA 3VE4A 4GS9A 3EQUA 4NXBA 5J7EA 1MZUA 3MF0A 4LLOB 3VE3A 4CLCC 2W3FA 3HCYA 5KIZA 4HJ6A 3LR0A 2ZMFA 4UQIM 1TS7A 3HJKA 2H28A 3NHQA 1V9YA 4QPRA 2A24B 5F68A 2V0WA 1XFNA 4O01A 1OJGA 4WLAA 5HPFA 3UMEA 4L9EA 2A24A 4P6ZS 3H82B 4EXOA 1XJ6A 3LI9A 3H82A 2OWHA 2XA7M 4KQOA 4ME4A 5G4ZA 4EERA 3A0VA 4JGQA 1H3QA 2O0YA 4EQ1A 3KYZA 2GJ3A 4IUKA 3TW8A 3OOVA 2WKPA 1N9NA 2VGLM 3D72A 3PBOA 2MJ6A 3F1NB 5F69A 4Y3IA 2GX5A 5MC7A 1LSWA 1W63Q 2KX6A 3F1NA 3T4QA 2L4RA 3P7NA 1T18A 3TE8A 4LPZA 2VZWA 2PYPA 3OCNA 2JHEA 3LICA 3KX0X 2VEAA 3S7QA 3G6OA 4NXGA 2R78A 5F5YA 3B42A 3E4OA 4L9FA 2Y79A 1YAXA 4JGRA 3ZYTA 1OTAA 2J80A 3IS2B 5K5BA 1P97A 4P6ZM 4UEYA 3H9WA 1GSXA 1NWZA 3IS2A 4PKYA 2KOIA 1LSVA 3OCLA 1ZTUA 3KO6A 5DFXA 3CITA 1D7EA 2QKPA 3A0RA 4HIAA 5KSHA 3EEHA 3LIDA 2PDRA 3LUQA 3SW1A 3LR4A 3B47A 3ULFA 4Y2FA 1YSPA 4M4XA 4JGPA 1VHMA 4NEED 4YOFA 4NXFA 2WKRA 2A2LA 3K2NA 1ODVA 4YWZA 2WKQA 3S7NA 1P0ZA 2B02A 3EEAA 3KYQA 3CI6A 4R3AA 4WF0A 2FH5A 2KDKA 2PR5A 1TF1A 5HL6A 2I9VA 5L8MA 1OTIA 2ZOHA 5F6AA 4PKYG 2O99A 4WN5A 1UGUA 1DP6A 4MDZA 3FPWA 4MN6A 3LR5A 1TS6A 1T1CA 1IFQA 3UB9A 4L0LA 4FSFA 4BBTA 4R38A 2QHKA 1YSQA 1T1AA 2W3DA 3U2AA 2B18A 4EEUA 2J3TC 1OTBA 4MCWA 3R4KA 3E4PA 2W3GA 4MN5A 5TBMB 4HQAA 3ZQ5A 4AFIA 5TBMA 3E98A 3OBFA 4BJPA 4EU0A 1STZA 1S4RA 4E04A 3S7PA 2O9BA 3BY8A 4LRYC 2O9AA 4KUKA 4WEJA 5LBRA 4NKPA 5HD3A 3PBQA 4I39A 4GW9A 4PAUA 3A0SA 3BWLA 2LB9A 3LFVA 4WL9A 2V9AA 3PHYA 3UB6A 3MXQA 2HV1A 4WUJA 1KOUA 1P9WA 3CUEA 3IBRA 2W3EA 1T19A 2JKRI 3FG8A 2JKRM 1OJ5A 3T4KA 2JKTI 2W3HA 2JKTM 3O5YA 4HJ3A 5FL3A 1S67L 4I3IA 4Q0JA 4PHTA 4IUHA 4II7A 3EWKA 3LYXA 3MQOA 3IBJA 3FC7A 3PBRA 1GSWA 1LL8A 3CUEC 1JNUA 3EGXC 4YNRA 2ZOIA 1Y28A 4DN0A 2W1RA 2D01A 4HOIA 3VV4A 3GECA 4GCZA 4LRZE 5IT5A 1DP8A 1S1ZA 3BY9A 4HY8A 3P01A 1OT6A 2VLGA 3UMDA 3T4JA 4HP9A 1H8MA 2QYBA 1OTDA 2Y8HA 2VV7A 3PBTA 5HD5A 4HNBA 3PYPA 2L1MA 1EW0A 3W2ZA 2XROA 1LSXA 4CLCE 3MR0A 4BMWA 3C30A 5C5KA 5G4YA 4CLCD 3C8CA 2J3TD 3EQVA 2PHYA 5I5LA 3KSHA 3H7WA 4GHIB 4ETXA 2OAP1 4ARZB 5HWVA 4HH2A 4GHIA 4IHQA 3RFBA 2EWWA 3PR6A 5HDDA 4ARZA 5HDSA 3V67A 4BBUA 4ETZA 2KLIA 5HPIA 1N9LA 2CMNA 2GZAA 4BWIA 2P04A 2W1TA 3F1PB 2YKHA 2LB5A 4HH3A 3LIEA 3F1PA 1OTEA 2HGVA 4HHDA 1BYWA 3T4TA 3S7OA 4R6LA 3PXPA 2OOLA 4GJ4A 4OOMA 1N9OA 1NLZA 4F3LB 5TJJA 2ZMVA 3MFXA 1XJ3A 4F3LA 4RQ9A 1ZHHB 2Z6DA 4WELA 2IA2A 5IU1A 2K31A 1V9ZA 3ICYA 4I3AA 4CQHA 2L0WA 2Z6CA 2V1AA 3EOIA 4G3VA 3FPVA 1UWPX 3UE3A 5HZHA 5DJUA 4EUVA 3KSFA 3E4QA 1NLYA 4B9OA 1OPXA 2G7UA 4EESA 3CLOA 2HJEA 1MKMA 4Y5FA 4EW7A 5J3WA 4EETB 4BBVA 1P9RA 2JN7A 3TRCA 1X0OA 4G3WA 4O8GA 3LIFA 3T4OA 3BQ8A 4H6JB 1G28A 5HWWA 4H6JA 2INWA 5DKLA 3NJAA 4IJGA 3UE6A 3JVVA 2VV6A 4HI4A 1DP9A 2V1BA 4NXEA 1UWNX 2NUPC 3RTYA 4Q0HA 3T4SA 2PYRA 3GDIA 3UB7A 3KSIA 3C38A 2YKFA 2NUTC 4MMNA 4EEPA 2PD8A 4I3JA 1MC0A 1S66L 1G6OA 4ZRRA 2GNXA 5IS1A 2M7VA 4GLQA 2QJ7A 3R7WB 3OLOA 3F1OB 4MN7A 2K2NA 4DJ3A 2QJ5A 3R7WA 3RH8B 3F1OA 1DRMA 1VB6A 5DF9A 2V0UA 3BQAA 1F98A 4R70A 3MQQA 3LIAA 5A8BA 3KSGA 3PBNA 5EFWA 3MMHA 3LR3A 3C2WA 3BW6A 3JVUA 2HJ9C 1GSVA 2D02A 4HJ4A 1XJ4A 3LI8A 1NRJA 5AVFA 4Q0IA 2PT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA9 A;  2PD7 A;  4I5S A;  4KUO A;  4I38 A;  5DJT A;  2K7S A;  2M1C A;  2OWJ A;  3K3D A;  1LT0 A;  1S4S A;  5HDC A;  3CAX A;  1F9I A;  1TS8 A;  4L9G A;  3MJQ A;  2PR6 A;  3H7W B;  4JGO A;  2W27 A;  3LIB A;  4XT2 B;  3HJI A;  4XT2 A;  2P7J A;  2VV8 A;  4K08 A;  3CWF A;  3B33 A;  3UB8 A;  2BAS A;  5J4E A;  4LRX C;  2ZBB A;  1XJ2 A;  4KQD A;  5DKK A;  5HWT A;  1T1B A;  1TS0 A;  3T50 A;  5AVE A;  1D06 A;  3NOT C;  1OT9 A;  3VOL A;  1S1Y A;  4HP4 A;  4DJ2 A;  3NOU C;  5HSQ A;  1XFQ A;  3NOP C;  3K3C A;  2W0N A;  4GS9 B;  1WA9 A;  2QWS A;  3VE4 A;  4GS9 A;  4NXB A;  5J7E A;  1MZU A;  4LLO B;  3VE3 A;  5KIZ A;  4HJ6 A;  1TS7 A;  3HJK A;  2H28 A;  3NHQ A;  1V9Y A;  2A24 B;  5F68 A;  2V0W A;  1XFN A;  1OJG A;  4WLA A;  3UME A;  4L9E A;  2A24 A;  3H82 B;  4EXO A;  1XJ6 A;  3LI9 A;  3H82 A;  2OWH A;  5G4Z A;  4EER A;  3A0V A;  4JGQ A;  4EQ1 A;  2GJ3 A;  2WKP A;  1N9N A;  3D72 A;  3F1N B;  5F69 A;  1LSW A;  2KX6 A;  3F1N A;  2L4R A;  3P7N A;  1T18 A;  4LPZ A;  2PYP A;  2JHE A;  3LIC A;  3KX0 X;  2VEA A;  3G6O A;  4NXG A;  2R78 A;  5F5Y A;  3E4O A;  4L9F A;  4JGR A;  1OTA A;  2J80 A;  3IS2 B;  1P97 A;  3H9W A;  1GSX A;  1NWZ A;  3IS2 A;  4PKY A;  1LSV A;  1D7E A;  2QKP A;  3A0R A;  4HIA A;  3EEH A;  3LID A;  2PDR A;  3LUQ A;  3SW1 A;  3ULF A;  4M4X A;  4JGP A;  4NXF A;  2WKR A;  1ODV A;  4YWZ A;  2WKQ A;  1P0Z A;  2B02 A;  4R3A A;  4WF0 A;  2KDK A;  2PR5 A;  2I9V A;  1OTI A;  2ZOH A;  5F6A A;  4PKY G;  4WN5 A;  1UGU A;  1DP6 A;  4MN6 A;  1TS6 A;  1T1C A;  3UB9 A;  4BBT A;  4R38 A;  2QHK A;  1T1A A;  4EEU A;  1OTB A;  3E4P A;  4MN5 A;  5TBM B;  4HQA A;  3ZQ5 A;  5TBM A;  1S4R A;  4E04 A;  3BY8 A;  4LRY C;  4KUK A;  5HD3 A;  4I39 A;  4GW9 A;  3A0S A;  3BWL A;  4WL9 A;  2V9A A;  3PHY A;  3UB6 A;  3MXQ A;  2HV1 A;  4WUJ A;  1KOU A;  3IBR A;  1T19 A;  3FG8 A;  1OJ5 A;  4HJ3 A;  1S67 L;  4I3I A;  3EWK A;  3LYX A;  3MQO A;  3FC7 A;  1GSW A;  1LL8 A;  1JNU A;  2ZOI A;  1Y28 A;  2D01 A;  4HOI A;  3GEC A;  4GCZ A;  4LRZ E;  1DP8 A;  1S1Z A;  3BY9 A;  4HY8 A;  1OT6 A;  2VLG A;  3UMD A;  4HP9 A;  1OTD A;  2VV7 A;  5HD5 A;  4HNB A;  3PYP A;  2L1M A;  1EW0 A;  1LSX A;  3MR0 A;  5G4Y A;  3C8C A;  5I5L A;  2PHY A;  3H7W A;  4GHI B;  5HWV A;  4HH2 A;  4GHI A;  5HDD A;  5HDS A;  4BBU A;  1N9L A;  2CMN A;  3F1P B;  2YKH A;  4HH3 A;  3LIE A;  3F1P A;  1OTE A;  4HHD A;  1BYW A;  4R6L A;  2OOL A;  1N9O A;  4F3L B;  3MFX A;  1XJ3 A;  4F3L A;  4RQ9 A;  2Z6D A;  5IU1 A;  1V9Z A;  3ICY A;  4I3A A;  2L0W A;  2Z6C A;  2V1A A;  1UWP X;  5HZH A;  5DJU A;  3E4Q A;  4B9O A;  4EES A;  3CLO A;  4EW7 A;  5J3W A;  4EET B;  4BBV A;  2JN7 A;  1X0O A;  3LIF A;  4H6J B;  1G28 A;  5HWW A;  4H6J A;  2INW A;  5DKL A;  3NJA A;  3UE6 A;  2VV6 A;  4HI4 A;  1DP9 A;  2V1B A;  4NXE A;  1UWN X;  3RTY A;  2PYR A;  3GDI A;  3UB7 A;  2YKF A;  4EEP A;  2PD8 A;  4I3J A;  1S66 L;  5IS1 A;  2QJ7 A;  3OLO A;  3F1O B;  4DJ3 A;  2QJ5 A;  3RH8 B;  3F1O A;  1DRM A;  1VB6 A;  2V0U A;  1F98 A;  4R70 A;  3MQQ A;  3LIA A;  5A8B A;  5EFW A;  3C2W A;  1GSV A;  2D02 A;  4HJ4 A;  1XJ4 A;  3LI8 A;  5AVF A; 
#chains in the Genus database with same CATH topology
 4QHC A;  3K3D A;  1N9B A;  1S4S A;  4OVD A;  1IYO A;  1C3B A;  3H7W B;  2ZL1 A;  2J8Y A;  5J8X A;  4JXS A;  5FDS A;  3SS4 A;  3HJI A;  2WZX A;  4MBH A;  1K25 A;  4XT2 A;  5TFQ A;  1TD5 A;  4ESP A;  3CWF A;  3UB8 A;  3CHW P;  5DVA A;  4UQI S;  1HVB A;  1BTL A;  5J4E A;  1SHV A;  2XR0 A;  3PTE A;  3G32 A;  1XJ2 A;  3VP0 A;  1ZKJ A;  1NYM A;  5GLA A;  3DBA A;  4GD8 A;  1TS0 A;  2XH9 A;  3T50 A;  3HUN A;  2J3W A;  4OOL A;  4E6X A;  4OPY A;  3IHB A;  3IX4 A;  4G3K A;  3NOT C;  2PAV P;  1OT9 A;  2FZ0 A;  5CHM A;  3E2K A;  3ITA A;  2OAQ 1;  1F5M A;  1ZC2 A;  3TSG A;  4XUX A;  1SCW A;  1PRQ A;  3OPL A;  4JXW A;  2W0N A;  1WA9 A;  5GLC A;  4GOG A;  2GDN A;  4GS9 A;  5J7E A;  4LLO B;  4CLC C;  4B4X A;  2X02 A;  2XD1 A;  5JYO A;  4EBN A;  4B88 A;  1PW8 A;  3MXS A;  4QPR A;  1ERO A;  1RGZ A;  4FD8 A;  1OJG A;  5HPF A;  1K56 D;  3NDG A;  3LEQ A;  3ZVT A;  2AVX A;  3OPR A;  3LI9 A;  3UN7 A;  4KQO A;  4EER A;  5CTN A;  4BQM A;  1VM1 A;  4JGQ A;  4EQ1 A;  3ZNT A;  3OOV A;  3UPO A;  5A92 A;  3NDE A;  5DTK A;  4GD6 A;  5F69 A;  2OSU A;  2WK0 A;  1PIO A;  3V50 A;  3P7N A;  4S2M A;  3TE8 A;  1MXO A;  2Y2I A;  3KX0 X;  3FKW A;  1ERM A;  3IXH A;  4NXG A;  3QP5 A;  5L10 A;  5GLD A;  4LCM A;  4E3J A;  4L9F A;  3IS2 B;  1P97 A;  4P6Z M;  3JPU A;  4UEY A;  3HVF A;  3H9W A;  3VP3 A;  3DWK A;  1K54 A;  4OKP A;  3EEH A;  2PDR A;  3LR4 A;  4EQI A;  3BFD A;  4Y2F A;  1YSP A;  3Q07 A;  4JGP A;  4NXF A;  4XUZ A;  2VK3 A;  4YWZ A;  3QHY A;  3NY4 A;  3O3V A;  4N1X A;  3S7N A;  2B02 A;  5DF7 A;  4E3I A;  3IXG A;  1YQS A;  2IWD A;  2FH5 A;  5EM1 A;  2PR5 A;  5EOO A;  1L0G A;  1MWT A;  1ESI A;  3QP8 A;  5F6A A;  2ZC6 B;  1UGU A;  3ZFZ A;  4MN6 A;  2Z2M B;  3SH9 A;  4KQQ A;  1RP5 A;  3DW0 A;  4R38 A;  3VP4 A;  3BFG A;  3ZG5 A;  3ZG0 A;  5EVL A;  1YSQ A;  1T1A A;  4JF5 A;  4S2P A;  3U2A A;  4QJG A;  4EEU A;  4X1M A;  5JYP A;  4MCW A;  4N9L A;  2WZZ A;  3M2K A;  5TBM B;  2E8J A;  3ZQ5 A;  4X6T A;  4X68 A;  3S4X A;  2Y4A A;  4ZJ3 A;  1STZ A;  1MWS A;  4P6B A;  1S4R A;  3T1S A;  4E04 A;  2O9B A;  3IF6 C;  3BY8 A;  3GV9 A;  4OQI A;  3QP2 A;  3LEZ A;  4C75 A;  4C6Y A;  5HD3 A;  5KSC A;  2ZQD A;  2BLS A;  2JKF A;  4Y0T A;  1ERQ A;  3LFV A;  5FAQ A;  1GCE A;  4BLM A;  4WUJ A;  1KOU A;  5M19 A;  3IBR A;  2ZMA A;  1FOF A;  2JKR I;  2JKR M;  3A3F A;  4C3Q A;  2J9O A;  2W3H A;  3O5Y A;  3WS5 A;  3HUM A;  3B3X A;  4Q0J A;  4II7 A;  4OQ0 A;  3MQO A;  3PBR A;  2JE5 A;  1JNU A;  1BLH A;  2W1R A;  4DRT A;  2D01 A;  2H0Y A;  2P9V A;  4HOI A;  5IT5 A;  4LRZ E;  1WYB A;  4HY8 A;  1MBL A;  1OT6 A;  3W4Q A;  3UMD A;  5FSR A;  1H8M A;  2Y2G A;  2XDM A;  3UDI A;  4PM5 A;  4IBX A;  5HAQ A;  3MR0 A;  5CER A;  4KG6 A;  3C30 A;  5G4Y A;  4CLC D;  1KE0 A;  3C8C A;  2J3T D;  2XF3 A;  3N8S A;  5EM0 A;  3H7W A;  3C4P A;  4GHI B;  4R3B A;  4ETX A;  4LCL A;  2OAP 1;  4IHQ A;  1YLP A;  5HDD A;  4X25 A;  5EVI A;  4YFM A;  4ETZ A;  4OP5 A;  5HFO A;  1CF0 A;  3DTK A;  1K57 A;  1MPL A;  4XXR A;  3FZC A;  4UHU A;  1BYW A;  1CI8 A;  5HL1 A;  4R6L A;  3PXP A;  2B95 A;  4OOM A;  3QNB A;  5TJJ A;  3ZG8 B;  4GNU A;  2EX6 A;  1XJ3 A;  3NCK A;  1LL9 A;  2Z6D A;  1XX2 A;  4X55 A;  5IU1 A;  3QNC A;  2K31 A;  3V39 A;  3ICY A;  4I3A A;  3O86 A;  2Z6C A;  2V1A A;  3TOI A;  1UWP X;  3E4Q A;  3MXR A;  4HBU A;  4RX3 A;  1DJB A;  3S1Y A;  2WYX A;  2HJE A;  4Y5F A;  3TRC A;  4R4R A;  3LIF A;  2DCF A;  4PPR A;  4H6J B;  1G28 A;  3NC8 A;  5HWW A;  4S2N C;  3NJA A;  4R0Q A;  5F1G A;  4IJG A;  3QP6 A;  1VEU B;  3UE6 A;  3JVV A;  2V1B A;  4Q0H A;  2Z2L B;  2YKF A;  4UA9 A;  3SS3 A;  3M6B A;  1GHP A;  4JF4 A;  5IS1 A;  2M7V A;  4R3J A;  4GLQ A;  2K2N A;  3R7W A;  4QD4 A;  5U47 A;  3F1O A;  1F98 A;  3LIA A;  3D4F A;  2ZM0 A;  4UA6 A;  5EFW A;  1BUE A;  1WYC A;  3C2W A;  1GSV A;  2D02 A;  4GB7 A;  4Q0I A;  2PT7 A;  2EA9 A;  5CHU A;  1ONG A;  2VX8 A;  4WZ5 C;  4I5S A;  3UE1 A;  5KZH A;  2OWJ A;  5EVI D;  2XEP A;  4DMZ A;  1KGE A;  3MZE A;  3MZD A;  4ZBE A;  5IHV A;  3WWX A;  3N8R A;  3QP4 A;  5A90 A;  4X53 A;  3GR2 A;  2Y2N A;  2W27 A;  2M7U A;  1IKI A;  2VJW A;  1YKD A;  2P7J A;  5DFY A;  3FKV A;  1JTG A;  2W1T B;  3OC2 A;  4KZA A;  4QWO A;  4LRX C;  1GHM A;  3TJZ C;  1XA7 A;  2RL3 A;  1SZV A;  4KQD A;  2JBF A;  2P08 A;  3HL9 A;  3UB5 P;  4BL2 A;  3ZVW A;  2HF6 A;  2V2F F;  2BTF P;  4CLC B;  2WGW A;  4GZB A;  1JWP A;  1LI0 A;  2VKS A;  2XRN A;  5E43 A;  5EE8 A;  3ZG7 B;  3E0Y A;  2XK1 A;  1W63 M;  5KMW A;  1LHY A;  1XFQ A;  3IH9 A;  3K3C A;  5CX7 A;  2QWS A;  3EQU A;  3O87 A;  4NXB A;  3MF0 A;  3WS2 A;  4U3T A;  3CPT B;  1KDW A;  4HJ6 A;  2R9X A;  3CMZ A;  5CHJ A;  3VOY A;  3DAV A;  3IF5 A;  3V3R A;  1CK3 A;  2A24 B;  5F68 A;  1XFN A;  4O01 A;  4WLA A;  3UDF A;  4P6Z S;  3H82 A;  4OPR A;  2XA7 M;  4ME4 A;  5G4Z A;  5DTS A;  1H3Q A;  2IWC A;  3KYZ A;  4P85 A;  2OV5 A;  1NZU A;  2GJ3 A;  3HBR A;  3E2L A;  3D72 A;  4MBK A;  2MJ6 A;  2Q9M A;  5CEC A;  3T1X A;  1W63 Q;  3P98 A;  2HPB A;  3F1N A;  1S6R A;  4B4Z A;  2VZW A;  4FUW A;  3OCN A;  3G2Z A;  2R78 A;  3B42 A;  3E4O A;  4FCF A;  2J7V A;  4Z9Q A;  2J80 A;  5K5B A;  2ZJ9 A;  1TVF A;  2KOI A;  1IEL A;  3OCL A;  5CRF A;  2QKP A;  3A0R A;  3LID A;  3HLE A;  3M2J A;  4E3L A;  3ULF A;  1DY6 A;  4M4X A;  3MSH A;  4HBT A;  2Y2O A;  2V20 A;  2WKR A;  2WKQ A;  5FQI A;  5FDH A;  3GRJ A;  2WAF A;  1K6S A;  3IH8 A;  2HP9 A;  5EOE A;  4RA7 A;  5HL6 A;  1OTI A;  2O99 A;  4OQH A;  1FIK A;  3MS6 A;  3WS1 A;  1BLC A;  4ZTK A;  5EVE A;  4FH2 A;  1HZO A;  4FH4 A;  1TS6 A;  3UB9 A;  4L0L A;  1Z09 A;  4JKT A;  2VGJ A;  3MZF A;  2EFU A;  5FA7 A;  2WUQ A;  3P09 A;  2B18 A;  3IF6 B;  1YLJ A;  1NY0 A;  3T12 B;  2J3T C;  3R4K A;  4MN5 A;  4HQA A;  2JKG A;  4EU0 A;  5CGS A;  2WKE A;  1FR6 A;  4DE3 A;  4WEJ A;  2E8I A;  5M18 A;  4GDB A;  1W79 A;  3BWL A;  2LB9 A;  3PHY A;  3UB6 A;  3QP1 A;  1P9W A;  4MBF A;  3CUE A;  4S2O A;  3FYZ A;  2JKT I;  2JKT M;  4Y7P A;  4RYE A;  4X1L A;  4KZ5 A;  4KG5 A;  4LV3 A;  5FL3 A;  1SKF A;  4I3I A;  4BD1 A;  3EWK A;  3IBJ A;  3HLC A;  1K0K A;  1GSW A;  4DE2 A;  3DTI A;  4E3N A;  2ZOI A;  1HLU P;  4WYY A;  3VV4 A;  3GEC A;  5F82 A;  3BY9 A;  3VMA A;  1H8Z A;  3LO7 A;  2C6W B;  1GA0 A;  1YLW A;  4LGW A;  1OTD A;  2Y8H A;  4Y0O A;  1L3L A;  5HD5 A;  2ZM2 A;  3Q81 A;  4UA7 A;  3PYP A;  2L1M A;  1G68 A;  3Q7V A;  2XRO A;  3G31 A;  4CLC E;  2ZQ7 A;  4N1H A;  4BEN A;  3G30 A;  3AGF A;  2PHY A;  3KSH A;  1ALQ A;  5L07 A;  5HAR A;  1XA1 A;  4ARZ A;  5TGF A;  1MWR A;  3G4P A;  2KLI A;  3UY6 A;  1YMS A;  2W1T A;  3F1P B;  2YKH A;  4GN2 A;  5FAT A;  3L7H A;  4HH3 A;  3LIE A;  1OTE A;  4HHD A;  4OPZ A;  2HZ5 A;  3T4T A;  1NRF A;  4MEZ A;  3S7O A;  5EVI C;  1LI9 A;  3N7W A;  1NLZ A;  2I72 A;  4F3L B;  2Y55 A;  4JXG A;  3MFX A;  3TG9 A;  5L09 A;  3U4L P;  4WEL A;  2A49 A;  2X71 A;  5TR7 A;  1NZO A;  1PYY A;  4G3V A;  2ZC4 B;  5DJU A;  3IT9 A;  1NLY A;  1OPX A;  3RJU A;  2G7U A;  1E3U A;  3V5M A;  4ZJ1 A;  4EET B;  4BBV A;  1P9R A;  5GHX A;  3BYD A;  1I5Q A;  1S0W A;  5EV0 A;  3Q82 A;  1W8Q A;  2INW A;  2ZQA A;  4S2J A;  1IKG A;  3IHA A;  1PW1 A;  4NXE A;  2PYR A;  1KE3 A;  1EWZ A;  4KZ3 A;  1E4D A;  1KDS A;  1SKO A;  4ZRR A;  1G6O A;  1BLP A;  3GMW A;  3SZT A;  3OPP A;  1IYS A;  4FTX A;  2V0U A;  3BQA A;  1KGG A;  1IEM A;  2P74 A;  4KQR A;  3PBN A;  1U60 A;  3MMH A;  3LR3 A;  1ZG6 A;  5E2E A;  3BW6 A;  3C4O A;  2HJ9 C;  2H10 A;  3Q7Z A;  4HJ4 A;  1XJ4 A;  2EXB A;  1NRJ A;  2WGI A;  3D3O A;  4FOF A;  4A5R A;  5DJT A;  1BSG A;  3SH7 A;  2DMW A;  1FCO A;  1LT0 A;  4EBP A;  1XP4 A;  5HDC A;  1F9I A;  2ZL1 B;  1ES2 A;  5FI6 A;  4HES A;  5G18 A;  1L2S A;  3FWL A;  3CZD A;  4XT2 B;  3MFD A;  1G5U A;  1G6A A;  2VV8 A;  4K08 A;  1XKZ A;  3B33 A;  2BAS A;  4K0W A;  3BJN A;  1PNE A;  5EUA A;  4E3K A;  1XPB A;  2ZBB A;  3VOZ A;  1MKI A;  4RX2 A;  1JVJ A;  5DKK A;  5HWT A;  4R4S A;  1BT5 A;  2Y91 A;  3IWQ A;  3VP2 A;  5AVE A;  1D06 A;  2OLV A;  4EBL A;  4WMC A;  5FI7 A;  1KVM A;  2R9W A;  2XA7 S;  1E3U D;  1N4O A;  3MQ0 A;  3VOL A;  5A93 A;  4HP4 A;  4B93 A;  4OPQ A;  4Z1W A;  2ZM8 A;  4JPM A;  4K91 A;  4QY6 A;  3BLS A;  3NOU C;  3NOP C;  4GS9 B;  4DXB A;  1ES5 A;  1MZU A;  3VE3 A;  1K55 C;  2WKI A;  3IF6 A;  4CJN A;  1TS7 A;  3HJK A;  2H28 A;  5AQ7 A;  3UO9 A;  4YIN A;  5I94 A;  3UME A;  5BOH A;  4P87 A;  1YLT A;  1XJ6 A;  2OWH A;  1FIL A;  1FSY A;  1M6K A;  3A0V A;  4E3M A;  2O0Y A;  2PBD P;  3NBL A;  1NJ4 A;  2PU4 A;  4IUK A;  4OLG A;  1N9N A;  2VGL M;  4F94 A;  1NYY A;  3G34 A;  4ZJ2 A;  5E2G A;  5MC7 A;  4Y3I A;  1LSW A;  3HLF A;  5HAP A;  2KX6 A;  3T4Q A;  2L4R A;  2OLU A;  2XQZ A;  3IX8 A;  1T18 A;  4M3K A;  4LPZ A;  2PYP A;  3GSG A;  1F2K A;  3LIC A;  3C5A A;  2HDR A;  3LY4 A;  4ZAM A;  4JGR A;  1YAX A;  3ZYT A;  4D2O A;  1OTA A;  2RCX A;  1GSX A;  3IS2 A;  1HTZ A;  1MY8 A;  3LY3 A;  5FI2 A;  3C7U A;  3N4I A;  1ZTU A;  3CIT A;  2EXA A;  3LUQ A;  2QZ6 A;  3SW1 A;  2BG1 A;  3N8L A;  5CGX A;  5HX9 A;  3B47 A;  4WMC D;  4NEE D;  4YOF A;  2V8C A;  1CI9 A;  2A2L A;  1PZO A;  3G35 A;  1ODV A;  3ZCZ A;  5GHY A;  1P0Z A;  3EEA A;  1PFL A;  3CI6 A;  4KZ4 A;  2V1Z A;  3KYE A;  4WF0 A;  3HLW A;  2KDK A;  3T1Q B;  5HW3 A;  2I9V A;  1CJF A;  4PKY G;  4IED A;  4WN5 A;  2HDQ A;  3ZG9 B;  5DF8 A;  3LR5 A;  1QMF A;  1T1C A;  1NXY A;  4BBT A;  3LGO A;  4PM8 A;  3S22 A;  3UNW A;  2QHK A;  4K0X A;  4CPK A;  5AQ9 A;  2W3D A;  3BLM A;  3I7J A;  5FEG A;  5FEF A;  1EI5 A;  1OTB A;  4QB8 A;  5FAS A;  5TBM A;  4JLF A;  3E98 A;  3PAE A;  4S2N A;  3S7P A;  2O9A A;  4KUK A;  1XXM A;  4P0M A;  5AQA A;  5FQQ A;  4PAU A;  3A0S A;  1TDG A;  1O7E A;  1O07 A;  3MXQ A;  3HLB A;  2HP6 A;  3BRM A;  2W3E A;  1T19 A;  3FG8 A;  1OJ5 A;  3FV7 A;  2H5S A;  1PWC A;  3FC7 A;  4D60 A;  1WE4 A;  5FQ9 A;  1LL8 A;  3CUE C;  3EGX C;  4YNR A;  1Q2P A;  4DN0 A;  3PAG A;  1FSW A;  4GCZ A;  5CGW A;  3ZHH A;  1S1Z A;  3P01 A;  2VLG A;  1K4F A;  5AQB A;  1PI5 A;  2ZQC A;  4U0T A;  3PBT A;  4HNB A;  3A3D A;  1EW0 A;  3W2Z A;  1LSX A;  4BMW A;  1K54 C;  5I5L A;  4JBF A;  4OOY A;  5CTM A;  1VET B;  1E25 A;  5HWV A;  2Y2P A;  4GHI A;  5EVI B;  2EWW A;  3RFB A;  3PR6 A;  3V3S A;  3NIA A;  4LV1 A;  5HPI A;  4MLL A;  1N9L A;  1FCN A;  2CMN A;  3HLG A;  3AGD A;  1AWI A;  5EEC A;  1TDL A;  3ZDJ A;  1YLZ A;  3A3I A;  1PZP A;  2OOL A;  4GJ4 A;  1N9O A;  1OME A;  1GA9 A;  1PWG A;  2VGK A;  2ZMV A;  5FQK A;  1J9M A;  1XGJ A;  2ZC3 B;  4RQ9 A;  1ZHH B;  1H8Y A;  1V9Z A;  2PBY A;  3JYI A;  2L0W A;  2JC7 A;  4WZ4 A;  3EOI A;  4OH0 A;  2XGN A;  3FPV A;  3UE3 A;  5HZH A;  3W4O A;  4WM9 A;  4B9O A;  3CLO A;  4NG2 A;  1MKM A;  4EW7 A;  2JN7 A;  2DNS A;  4G3W A;  4O8G A;  1DJA A;  3BQ8 A;  4RVA A;  2FFY A;  4H6J A;  1BZA A;  5DKL A;  3UDX A;  1CEF A;  2VV6 A;  3G2Y A;  1HD8 A;  3RTY A;  2NUP C;  1VEU A;  3T4S A;  2UWX A;  3KSI A;  1L0D A;  4EEP A;  4I3J A;  1S66 L;  2GNX A;  2ZC5 B;  2PU2 A;  1CEG A;  4LEN A;  2B5R A;  2QJ7 A;  3DWZ A;  3R7W B;  2H0T A;  1Q2Q A;  3OLO A;  3F1O B;  4MN7 A;  3SH8 A;  2HDS A;  3RH8 B;  1KGF A;  1DRM A;  5D3O A;  4R70 A;  3MQQ A;  3RXX A;  4N92 A;  1BUL A;  4PM9 A;  4OQG A;  1FCM A;  1JWZ A;  5GL9 A;  3JVU A;  3GTC A;  5F1F A;  4ZDX A;  4IBR A;  4E6W A;  2PD7 A;  2JCH A;  4KUO A;  2XFT A;  4I38 A;  2K7S A;  2M1C A;  3BEC A;  3CAX A;  3ZGA B;  1TS8 A;  4BL3 A;  4L9G A;  3MJQ A;  2PR6 A;  3EGD C;  3IWO A;  2FFF B;  1VQQ A;  4JGO A;  2O9C A;  2XSS A;  1JTD A;  3LIB A;  5FQM A;  1Z6F A;  4O0P A;  4KZ8 A;  2VA0 A;  3T4L A;  3VSK A;  2ZC7 A;  1SDE A;  4PM7 A;  4DKI A;  1D1J A;  4JXV A;  1Y54 A;  3OZH A;  5E2H A;  2DRW A;  1T1B A;  4S2I A;  3PBS A;  2J9P A;  1TEM A;  2QMI A;  2WGW B;  5AJG A;  3WRT A;  4CLC A;  1S1Y A;  3HRE A;  1K57 C;  3BFF A;  4WEK A;  2G2W A;  2VGL S;  4DJ2 A;  2XD5 A;  4DE1 A;  1L0F A;  3GQZ A;  5HSQ A;  3HUO A;  3IXB A;  1IOU A;  5FAP A;  2EWV A;  2Y59 A;  4X56 A;  4BD0 A;  4E3O A;  4IVK A;  1I2S A;  3VE4 A;  2W3F A;  3HCY A;  3VFF A;  5KIZ A;  3LR0 A;  2ZMF A;  4UQI M;  3CPT A;  3ISG A;  3NHQ A;  1V9Y A;  2QPN A;  2V0W A;  5EPH A;  3IX3 A;  4L9E A;  2A24 A;  3H82 B;  4EXO A;  4LFU A;  4EUZ A;  2C5W B;  5A91 A;  2XFS A;  1L0E A;  2EFX A;  3GVB A;  4NET A;  1ONH A;  1YT4 A;  3TW8 A;  4PMA A;  2WKP A;  3PBO A;  4R23 A;  1FQG A;  3F1N B;  2GX5 A;  2V8F A;  3W8K A;  2ZQ8 A;  1Y4O A;  4R1G A;  3C7V A;  2JHE A;  4Y17 A;  3MKF A;  1W5D A;  4X69 A;  2Y2M A;  2WGV A;  2VEA A;  3S7Q A;  3G6O A;  3NI9 A;  5F5Y A;  4DF6 A;  2Y79 A;  1XGI A;  3OPH A;  3WS4 A;  3HLD A;  3UE0 A;  3M6H A;  1NWZ A;  4PKY A;  3D9Y A;  4QU3 A;  1LSV A;  2A3U A;  1H0M A;  3KO6 A;  5DFX A;  1D7E A;  4HIA A;  3BEB A;  5KSH A;  4GKU A;  3VFH A;  4KG2 A;  4DXC A;  3ITB A;  1PWD A;  1RCJ A;  4KZ6 A;  1VHM A;  1M40 A;  4MNR A;  4WBG A;  3K2N A;  3KYQ A;  4DDS A;  1ESU A;  4R3A A;  3W4P A;  4U0X A;  5CED A;  4HEF A;  5GHZ A;  1J3W A;  1YLY A;  1VET A;  1TF1 A;  4S2K A;  4PM6 A;  5L8M A;  2ZOH A;  3RXW A;  4O7D A;  5L2F A;  2ZQ9 A;  3IWI A;  1DP6 A;  4MDZ A;  3FPW A;  4Q8I A;  1IFQ A;  4FSF A;  2G2U A;  2Y2K A;  3CJM A;  4LV0 A;  3DTE A;  2XLN A;  4DE0 A;  1IYP A;  3E4P A;  2W3G A;  5CXW A;  4AFI A;  4UAA A;  3LCE A;  3BFE A;  3OBF A;  1FR1 A;  4BJP A;  1LLB A;  5HAI A;  1AXB A;  3WS0 A;  4LRY C;  3VP1 A;  3NUL A;  3MBZ A;  5LBR A;  4NKP A;  1PI4 A;  2Q9N A;  3UPP A;  3DTM A;  3PBQ A;  5F83 A;  4I39 A;  4S2L A;  4GW9 A;  3SOI A;  4WL9 A;  1KVL A;  2V9A A;  3IXD A;  2HV1 A;  2PRF A;  3ZNY A;  2WAE A;  2Y2Q A;  5GLB A;  1SDN A;  1ZG4 A;  3T4K A;  4HJ3 A;  1S67 L;  3N6I A;  4GDN A;  4PHT A;  4IUH A;  3LYX A;  4QY5 A;  4EV4 A;  4KZ9 A;  1Y28 A;  3NEC A;  1W7F A;  2X01 A;  1DP8 A;  4KEN B;  5E2F A;  3T4J A;  4H8R A;  3L9K A;  4HP9 A;  3UPN A;  2QYB A;  3Q7V B;  2UV0 E;  1ACF A;  2VV7 A;  1QME A;  2IWB A;  2CC1 A;  1K4E A;  2WKH A;  5C5K A;  3MKE A;  3EQV A;  4Y13 A;  3O88 A;  1A0K A;  4KZ7 A;  3BFC A;  4ARZ B;  4N9K A;  4HH2 A;  1IYQ A;  4IVI A;  1H5X A;  3SS5 A;  5HDS A;  3V67 A;  4BBU A;  1YPR A;  2GZA A;  4BWI A;  2P04 A;  2LB5 A;  1YMX A;  3Q1F A;  3F1P A;  4ID4 A;  2EX8 A;  2HGV A;  2Y2J A;  1GHI A;  2ZLY A;  1JWV A;  2HDU A;  3A3E A;  3BM6 A;  3WRZ A;  4OP8 A;  1DJC A;  4F3L A;  1LL5 A;  1K55 A;  1ES3 A;  2Y2H A;  2IA2 A;  3VSL A;  2EX9 A;  2EX2 A;  4CQH A;  4KZB A;  1YM1 A;  5FQJ A;  4EUV A;  3KSF A;  1RGY A;  5DTT A;  4OON A;  4EES A;  3AGE A;  3CG5 A;  1K38 A;  5J3W A;  1KE4 A;  5FAO A;  1X0O A;  4DDY A;  3T4O A;  4JF6 A;  1I2W A;  1MWU A;  2ACG A;  1ES4 A;  4LV2 A;  3T1R A;  2Q0O A;  4HI4 A;  1DP9 A;  1UWN X;  1SKO B;  2Y2L A;  3GDI A;  3UB7 A;  3C38 A;  2NUT C;  4MMN A;  2PD8 A;  1MC0 A;  1CQA A;  1BLS A;  1W8Y A;  2WAD A;  3IQA A;  4DJ3 A;  4Y0U A;  2QJ5 A;  4WZ5 A;  1K56 A;  1VB6 A;  4EWF A;  5DF9 A;  4NK3 A;  2ZD8 A;  5A8B A;  2P9V B;  3KSG A;  4OLD A;  5M1A A;  3A3J A;  1K6R A;  5CEB A;  3LI8 A;  2HP5 A;  4Y15 A;  5AVF A; 
#chains in the Genus database with same CATH homology
 3D3O A;  2EA9 A;  2PD7 A;  4FOF A;  2VX8 A;  4I5S A;  4KUO A;  4I38 A;  5DJT A;  2K7S A;  2M1C A;  2OWJ A;  3K3D A;  2DMW A;  4DMZ A;  1LT0 A;  1S4S A;  5HDC A;  3CAX A;  1F9I A;  1TS8 A;  4L9G A;  3MJQ A;  2PR6 A;  3EGD C;  3H7W B;  4JGO A;  2W27 A;  2M7U A;  2O9C A;  2XSS A;  3LIB A;  4XT2 B;  3HJI A;  4O0P A;  2VJW A;  1YKD A;  4XT2 A;  2P7J A;  1TD5 A;  5DFY A;  2VA0 A;  3T4L A;  2VV8 A;  4K08 A;  3CWF A;  3B33 A;  3UB8 A;  2BAS A;  2W1T B;  3OC2 A;  3BJN A;  4UQI S;  5J4E A;  4LRX C;  2ZBB A;  3TJZ C;  1XJ2 A;  4KQD A;  5DKK A;  5HWT A;  1T1B A;  3PBS A;  3DBA A;  2P08 A;  1TS0 A;  3T50 A;  5AVE A;  1D06 A;  2J3W A;  4OOL A;  2HF6 A;  2XA7 S;  5AJG A;  4G3K A;  4CLC B;  3NOT C;  1OT9 A;  3VOL A;  3MQ0 A;  2FZ0 A;  4CLC A;  1S1Y A;  4HP4 A;  4B93 A;  4Z1W A;  2XRN A;  2VKS A;  4WEK A;  3E0Y A;  2VGL S;  4DJ2 A;  2OAQ 1;  1F5M A;  1W63 M;  3NOU C;  5HSQ A;  1XFQ A;  3NOP C;  1IOU A;  3K3C A;  2EWV A;  2W0N A;  4GS9 B;  1WA9 A;  5CX7 A;  2QWS A;  3VE4 A;  4GS9 A;  3EQU A;  4NXB A;  5J7E A;  1MZU A;  3MF0 A;  4LLO B;  3VE3 A;  4CLC C;  2W3F A;  3HCY A;  5KIZ A;  4HJ6 A;  3LR0 A;  2ZMF A;  4UQI M;  1TS7 A;  3HJK A;  2H28 A;  3NHQ A;  1V9Y A;  4QPR A;  2A24 B;  5F68 A;  2V0W A;  1XFN A;  4O01 A;  1OJG A;  4WLA A;  5HPF A;  3UME A;  4L9E A;  2A24 A;  4P6Z S;  3H82 B;  4EXO A;  1XJ6 A;  3LI9 A;  3H82 A;  2OWH A;  2XA7 M;  4KQO A;  4ME4 A;  5G4Z A;  4EER A;  3A0V A;  4JGQ A;  1H3Q A;  2O0Y A;  4EQ1 A;  3KYZ A;  2GJ3 A;  4IUK A;  3TW8 A;  3OOV A;  2WKP A;  1N9N A;  2VGL M;  3D72 A;  3PBO A;  2MJ6 A;  3F1N B;  5F69 A;  4Y3I A;  2GX5 A;  5MC7 A;  1LSW A;  1W63 Q;  2KX6 A;  3F1N A;  3T4Q A;  2L4R A;  3P7N A;  1T18 A;  3TE8 A;  4LPZ A;  2VZW A;  2PYP A;  3OCN A;  2JHE A;  3LIC A;  3KX0 X;  2VEA A;  3S7Q A;  3G6O A;  4NXG A;  2R78 A;  5F5Y A;  3B42 A;  3E4O A;  4L9F A;  2Y79 A;  1YAX A;  4JGR A;  3ZYT A;  1OTA A;  2J80 A;  3IS2 B;  5K5B A;  1P97 A;  4P6Z M;  4UEY A;  3H9W A;  1GSX A;  1NWZ A;  3IS2 A;  4PKY A;  2KOI A;  1LSV A;  3OCL A;  1ZTU A;  3KO6 A;  5DFX A;  3CIT A;  1D7E A;  2QKP A;  3A0R A;  4HIA A;  5KSH A;  3EEH A;  3LID A;  2PDR A;  3LUQ A;  3SW1 A;  3LR4 A;  3B47 A;  3ULF A;  4Y2F A;  1YSP A;  4M4X A;  4JGP A;  1VHM A;  4NEE D;  4YOF A;  4NXF A;  2WKR A;  2A2L A;  3K2N A;  1ODV A;  4YWZ A;  2WKQ A;  3S7N A;  1P0Z A;  2B02 A;  3EEA A;  3KYQ A;  3CI6 A;  4R3A A;  4WF0 A;  2FH5 A;  2KDK A;  2PR5 A;  1TF1 A;  5HL6 A;  2I9V A;  5L8M A;  1OTI A;  2ZOH A;  5F6A A;  4PKY G;  2O99 A;  4WN5 A;  1UGU A;  1DP6 A;  4MDZ A;  3FPW A;  4MN6 A;  3LR5 A;  1TS6 A;  1T1C A;  1IFQ A;  3UB9 A;  4L0L A;  4FSF A;  4BBT A;  4R38 A;  2QHK A;  1YSQ A;  1T1A A;  2W3D A;  3U2A A;  2B18 A;  4EEU A;  2J3T C;  1OTB A;  4MCW A;  3R4K A;  3E4P A;  2W3G A;  4MN5 A;  5TBM B;  4HQA A;  3ZQ5 A;  4AFI A;  5TBM A;  3E98 A;  3OBF A;  4BJP A;  4EU0 A;  1STZ A;  1S4R A;  4E04 A;  3S7P A;  2O9B A;  3BY8 A;  4LRY C;  2O9A A;  4KUK A;  4WEJ A;  5LBR A;  4NKP A;  5HD3 A;  3PBQ A;  4I39 A;  4GW9 A;  4PAU A;  3A0S A;  3BWL A;  2LB9 A;  3LFV A;  4WL9 A;  2V9A A;  3PHY A;  3UB6 A;  3MXQ A;  2HV1 A;  4WUJ A;  1KOU A;  1P9W A;  3CUE A;  3IBR A;  2W3E A;  1T19 A;  2JKR I;  3FG8 A;  2JKR M;  1OJ5 A;  3T4K A;  2JKT I;  2W3H A;  2JKT M;  3O5Y A;  4HJ3 A;  5FL3 A;  1S67 L;  4I3I A;  4Q0J A;  4PHT A;  4IUH A;  4II7 A;  3EWK A;  3LYX A;  3MQO A;  3IBJ A;  3FC7 A;  3PBR A;  1GSW A;  1LL8 A;  3CUE C;  1JNU A;  3EGX C;  4YNR A;  2ZOI A;  1Y28 A;  4DN0 A;  2W1R A;  2D01 A;  4HOI A;  3VV4 A;  3GEC A;  4GCZ A;  4LRZ E;  5IT5 A;  1DP8 A;  1S1Z A;  3BY9 A;  4HY8 A;  3P01 A;  1OT6 A;  2VLG A;  3UMD A;  3T4J A;  4HP9 A;  1H8M A;  2QYB A;  1OTD A;  2Y8H A;  2VV7 A;  3PBT A;  5HD5 A;  4HNB A;  3PYP A;  2L1M A;  1EW0 A;  3W2Z A;  2XRO A;  1LSX A;  4CLC E;  3MR0 A;  4BMW A;  3C30 A;  5C5K A;  5G4Y A;  4CLC D;  3C8C A;  2J3T D;  3EQV A;  2PHY A;  5I5L A;  3KSH A;  3H7W A;  4GHI B;  4ETX A;  2OAP 1;  4ARZ B;  5HWV A;  4HH2 A;  4GHI A;  4IHQ A;  3RFB A;  2EWW A;  3PR6 A;  5HDD A;  4ARZ A;  5HDS A;  3V67 A;  4BBU A;  4ETZ A;  2KLI A;  5HPI A;  1N9L A;  2CMN A;  2GZA A;  4BWI A;  2P04 A;  2W1T A;  3F1P B;  2YKH A;  2LB5 A;  4HH3 A;  3LIE A;  3F1P A;  1OTE A;  2HGV A;  4HHD A;  1BYW A;  3T4T A;  3S7O A;  4R6L A;  3PXP A;  2OOL A;  4GJ4 A;  4OOM A;  1N9O A;  1NLZ A;  4F3L B;  5TJJ A;  2ZMV A;  3MFX A;  1XJ3 A;  4F3L A;  4RQ9 A;  1ZHH B;  2Z6D A;  4WEL A;  2IA2 A;  5IU1 A;  2K31 A;  1V9Z A;  3ICY A;  4I3A A;  4CQH A;  2L0W A;  2Z6C A;  2V1A A;  3EOI A;  4G3V A;  3FPV A;  1UWP X;  3UE3 A;  5HZH A;  5DJU A;  4EUV A;  3KSF A;  3E4Q A;  1NLY A;  4B9O A;  1OPX A;  2G7U A;  4EES A;  3CLO A;  2HJE A;  1MKM A;  4Y5F A;  4EW7 A;  5J3W A;  4EET B;  4BBV A;  1P9R A;  2JN7 A;  3TRC A;  1X0O A;  4G3W A;  4O8G A;  3LIF A;  3T4O A;  3BQ8 A;  4H6J B;  1G28 A;  5HWW A;  4H6J A;  2INW A;  5DKL A;  3NJA A;  4IJG A;  3UE6 A;  3JVV A;  2VV6 A;  4HI4 A;  1DP9 A;  2V1B A;  4NXE A;  1UWN X;  2NUP C;  3RTY A;  4Q0H A;  3T4S A;  2PYR A;  3GDI A;  3UB7 A;  3KSI A;  3C38 A;  2YKF A;  2NUT C;  4MMN A;  4EEP A;  2PD8 A;  4I3J A;  1MC0 A;  1S66 L;  1G6O A;  4ZRR A;  2GNX A;  5IS1 A;  2M7V A;  4GLQ A;  2QJ7 A;  3R7W B;  3OLO A;  3F1O B;  4MN7 A;  2K2N A;  4DJ3 A;  2QJ5 A;  3R7W A;  3RH8 B;  3F1O A;  1DRM A;  1VB6 A;  5DF9 A;  2V0U A;  3BQA A;  1F98 A;  4R70 A;  3MQQ A;  3LIA A;  5A8B A;  3KSG A;  3PBN A;  5EFW A;  3MMH A;  3LR3 A;  3C2W A;  3BW6 A;  3JVU A;  2HJ9 C;  1GSV A;  2D02 A;  4HJ4 A;  1XJ4 A;  3LI8 A;  1NRJ A;  5AVF A;  4Q0I A;  2PT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...