3C8DA

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-glycine
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
392
structure length
378
Chain Sequence
VGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
molecule keywords Enterochelin esterase
total genus 116
structure length 378
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c8dA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c8dA02
1NCAL 5BRZE 4DYHA 1IQDA 1HQRB 5EIAA 1MFBH 3ZLVA 2BVQA 4R4FL 1A9EB 3EFFA 3WV0A 4CNIA 4NZDA 2VIRB 5IMOA 3P3YA 3LKQA 2PSJA 1A14L 3WIHL 4DCQA 1A7OL 3CSBA 5F1IA 3WYRA 3K2UL 3OX8A 5F96H 2BSTB 2OZ4H 4LGSB 3WFZA 1MHHB 1R0AH 4UNVA 3SE9H 5JAOA 1T21B 2DIBA 1H3PL 4HH9B 3DTXA 4DN3L 3SC2A 4PRPD 1FL5B 2X9WA 5I9QB 5HKAA 3D5EA 2N56A 5ALJA 1DBKH 5DLPA 4MCYB 3VFNA 4KJPD 5ENWB 2J3DA 3TV3H 4HWEH 1LK3H 3LB6C 3L5WB 5AOCA 4LVNB 3PIQB 4EDXB 1AD0A 2H26B 2VH5L 4HLJA 3CFCL 1CUHA 1QO3A 1FG9C 2PXYC 5DMYA 4QHKI 4PB9L 4FABH 4X4XA 3BD3A 3GMRA 4K55A 4DVBA 5C0FB 1LDSA 3S37L 4OAWB 1X3DA 2GTWA 2NXZC 2EE6A 3VGAB 5I16B 1R3KB 1VEMA 5GJTH 2I24N 2OJEB 3WXWL 3E0GA 1NGYB 4W4OA 4FQJL 2VDPH 5EG6C 1AURA 1ZT4A 1IEBA 4Q2ZB 4Z7VB 4HXEB 1OQXA 2HTKD 5DS8B 4YQXL 4ETWA 3CU7A 2VH5H 3MMEA 4WDIB 3R06A 1JGUH 4Z18A 4Z0BH 4KUZL 3EYSH 3TVMD 1WV7T 2PYEB 3U0TA 5ALDA 3K6KA 1FNEA 1D7FA 2NYYD 2AEPH 1MVUA 2PU7A 2Z92A 1KEMH 4L3WA 4U2FA 4X9HA 2XMGA 1KJ3H 2GY7B 1AD0B 1INDH 4XP5H 4HFUL 4QYOA 3HUJF 3QDGA 5T1MA 1G4HA 4PBXA 3O3DB 4PRPA 1IKFL 1JFQL 4P4RB 1MPAH 4R96B 4AENA 5D96B 1MQ8A 5KSBF 1R0AL 2F54E 1F58L 4BQCA 3ZMRA 3UJTL 5C0GA 4DUWA 4RMTA 2VQTA 3D2AA 4Y0GA 3UTSA 1AI1L 5TJWK 5D7JB 2RFXA 5FO7B 3QXWA 4XXDB 3SGEH 3ANTA 3NGBB 5T5NG 2IFGA 1BZ9B 1Y0LB 3L6FB 2VMFA 1UADC 4PJEA 4OCMC 5DJCB 4NNYA 2JEYA 4XRCA 2FB4L 3IJYB 3G5ZA 3CIQA 3DROA 2Z3ZA 4F7TA 5ILTL 3OG6B 4LSUH 1WBXB 2X70A 2WBJA 1MX1A 1G0XA 2RR3A 3QXDA 2CSPA 4HCRH 2OL3L 5FECA 1KG0A 4CN6A 5MHSE 4HPOH 4DCQB 5ALMA 4AMKH 5DI8B 4QWWC 3DIFB 5AYUL 3MXVL 2DBLH 5JD5A 1JV5B 3QUKA 1I9RL 4I0PC 4XAKD 4Y4FB 4UU9B 4X99A 4JY6A 1IC5H 3D3VA 4QCIA 5DTFA 5I30H 5IWLA 1DWOA 4WFJA 4YPJA 1FCCA 1KIRA 1DQMH 2EDHA 4Y16B 2O5ZL 3WUZA 2OCFD 4M5YH 1JGEA 1F4YH 1V7NL 1RFDH 3F7PC 4JO4H 1DLHA 5A16A 5T4FA 5AICA 5CP7A 4D9RD 1N8ZB 3KPSE 4YHLL 1CF8L 3ISWA 4UQ2A 3NTCH 2RHWA 3VXPB 4Z8FH 1SYSA 3D1MC 4L3CA 3WK4A 3LN5B 2MPAH 1GZPB 4X4XB 2HRQA 5J8OA 4QEKA 4W63A 4JANA 4JVWA 4WHTB 5BS0A 1HILA 3MUHL 1MREH 5DA4A 2ID5A 4KMLB 5C07A 3NIGF 2HVKA 1J8HB 4M6AA 1ZVSB 5F7DB 3SDCC 4UU9A 5ADOL 4XVTL 3Q2CA 3SDCB 4GG6A 4JFPA 3VFOA 4LPUA 4EB0A 5AM3A 1E6OL 5C8JA 2AXEA 3PXHA 3UBXG 5ALHA 4D9QE 4ONGL 4NJAH 1UGNA 2Y7QA 4U1LB 3QXTA 3DX8B 3CVHB 2XMDA 2ZJFA 4K8RC 2VDNL 3HE7B 1G0YR 2R0LH 4U7KA 1S8DA 2NY3C 2OJZH 3VD5A 3NGBC 1MJ7H 2IF7A 5TH2A 2ACEA 4UDTB 5CILH 3SDDC 5HGBB 5L7XH 4LGRB 3EYUL 2IBGA 3P0VL 2FJHA 3BP5A 2AKRA 1G9EA 5DUML 3SDDB 1ADQH 4WEBL 2DQGL 1QJ4A 7FABL 2YA2A 5DRZB 4JFOA 4Q58C 1QFWL 3VXMD 2CPCA 5SWSB 4G4GA 1ZT7B 2WQZA 1AQKL 2EEBA 5LLSA 3CJJA 4LFHG 4QLRA 3QEGL 4Z9KB 1FG2B 1NSNH 4KAJA 1U58B 3HFML 1FBIL 3FO2A 3EO1A 1FVCA 4K94C 4U1SB 5LG1A 3UP1A 3ES6B 1GOGA 3OAZK 1R5VA 4Z7UE 1S7WA 3RJDA 4WFFD 4L8SA 2VLRD 1IAOB 3DPBA 2HLFD 4HH8A 5C07D 3O8XC 5MENA 4PV9A 4RGOH 3V6OC 2Z31D 4NC0B 5DK3A 2VLKE 4X94A 1A4JB 4APQD 2EICA 3OG4B 4NQXA 3WSQH 3DRTA 1XIWB 1KJ2A 1FDLL 5IMLB 2CK0H 2C5FA 1UENA 2NZ9D 4WFFE 4PPTA 2JIXB 1MRCL 2ZJ6A 2C3VB 1ZT4B 2NNAA 1JWMB 1QRNE 3MRGB 3QIBD 4H35A 2HJLA 3NZHL 4L4TA 5IOPA 2JGJA 3HC0A 2W65B 2VABA 4JGJA 4PR5B 1NC2B 1T1YA 3WL5A 4QY8A 4W4OC 4RGYA 4HIIB 1P4BH 3EFDL 1R4ZA 4OTXL 5GISH 1WEJL 1G7JA 1BZ7B 1VJ5A 3WS3B 1QO7A 4GW5A 5FV2A 2UZXB 2P43B 3PWLB 4GW1A 2W59A 4JRXB 3VA6A 4U33A 1GPOH 3C9NA 3RPIB 2QSCL 1BN7A 5IJVA 3FB7B 3BXNA 1FL6B 4OLWH 5HJ3A 2ITDB 1LDPL 3SE8L 2YPVH 4NHCH 2WJ3A 2VAAA 1B90A 2VXQH 4AEIH 5F4ZA 5FUMA 1T0MA 1CGUA 2GSGB 1NCDL 1NCTA 3GRWL 2HYMA 4S1QL 3ULVL 5D7KE 1DX4A 3CC5B 5IJKC 3M3DA 4NC1E 5DHVH 1PVHA 5D7JC 3EO9H 1I8MB 2D5LA 5BQ7B 5GSVA 2Y5TA 4KJWC 2YK1L 2V5YA 4ZQKB 4X99B 2UWEB 3QUYC 1TVHA 1NL0H 1YNLL 3V4VH 3QDMD 3FLAA 5AM1A 2WIIA 4PTTA 1OT2A 2NY4D 5DI8A 4NKOA 4XPBL 4MDIA 3O4OC 4WDRA 5DD5H 3UTTB 2KQMA 1OAUL 4NNPL 5DEGB 3D39B 2ZSHA 1CL7H 3QIBA 4HKXA 1AGCA 1FZMA 5DQDH 5EWIL 1IUNA 3QM1A 1MH5B 4JFEB 2NY5L 3I6ZA 1CDCA 2Y23A 5HDQL 5C0AB 3CVHL 1FVDB 2YD2A 2WSLA 4OGXH 3ZKXC 1W72A 1QFWI 4TTGA 2F15A 4X7EC 3ARBB 3BRDA 2AJ8A 5CZKA 2ZPKH 5F9OL 5T3ZD 3KAAA 2ARWA 3UROR 1NGPH 2QHRH 3BGFB 5DD6A 2WG2A 3AILA 4BFEA 3VDAA 4E9LA 4PJIF 2G4LA 3VXMB 2L7UA 3EOBA 3HNTH 1CLZL 2WFZA 2WLSA 4PW0A 4KI1A 5HHVL 1XAUA 5TE6L 4ZG1A 2Y7QB 1OD7A 5C81A 3BPLC 1S5IL 2ZOKB 2QKIB 3BEVB 1G7MB 1RZJC 1C16A 3HI5H 1BROA 1D5XB 1P4LB 3QZUA 1Z5LA 4X7BA 4C4YA 3NFNA 5I0DA 4PJEF 4LVEA 3KSRA 3NCJL 4KK6D 2AJDA 2JJSA 3CXHK 5HZGA 5SX4I 1CFJA 1OARL 5IK3B 4X6FB 3RU8L 5H94A 1OSZB 3G6AB 2QSCH 2OBGA 4YPGA 1R5IB 1FNHA 4PRPE 4OFIA 4GS7B 3D69B 3BL8A 4PJCB 2I5YL 3O41B 5EZJA 4CDHA 2DJSA 3MRGA 4NUGH 2Y6SD 1F45A 2NY2D 3WNPA 2AQ1A 2BZDA 5D1ZB 4MQXC 4P3WA 1ZEAL 2PW2B 4LAQL 4XPFH 4MA7H 1MFCH 5AZ2H 4G8DA 1T0NA 2FWOA 5HGGS 4WCYL 3ZYJA 3P9WB 4UOW1 4GQ9H 1A47A 3MV7E 1JVKA 4DKEH 1QLRA 1XQYA 3ZI7A 4S1DC 4AM0A 1CL7I 1IAII 2IJ0C 2XFXA 3QXAA 5C9JA 2X1OA 4P9NA 1ZD2P 5K3FA 2EDJA 4I3SH 4NO0A 5B4MD 4PJ7E 3N0PB 1Z2KA 5F89B 5IEHA 1WCBA 3SDYL 5ALIA 4OCYL 1FSSA 1VZ2A 5E5MA 5E0QA 3N85L 3GFFA 4XCNB 4LNRA 4Y2TA 5BVJB 1KPVB 3WWOA 1I9IL 3MRIB 4HK3N 4APQB 4KZDH 1YEGL 3HNVL 5E8EB 2WIKA 2X4OA 1UA6H 3I84A 1HL7A 3HMXA 4ZAKB 4LPYA 4PSUA 1ZGLM 3LKNA 4K9EL 5FOQA 4C58B 3SQBA 2HJKA 1C5CL 3CZFA 4NZRH 2G75B 1UJ3A 4ZTOH 3O4GA 3MNVB 4I0CC 4PJBE 2EZ0C 5CJ5A 5D96C 3PI6A 3FHQA 5F3BB 2AK1L 3IUNA 5T3XL 5JW4Q 3IJYA 1BD2D 3H9ZA 3FRPA 3TH2T 3IDJB 1BU8A 1MFDH 3IFPA 4OQTA 5DEGA 1MCIA 2X9XA 4U6TA 4TNVF 5GHWL 5EPMA 1QIEA 1AO7A 4MXQC 3HSSA 1TMCB 1LGVA 5AWNL 4OB7A 3Q48A 3QFJE 1HYRC 2OM5A 5LIPA 4ZXBC 2NMSA 4LSRL 4M0EA 4QXTB 5E94B 1LDPH 5IMKB 2I78A 5J11C 5EIQA 1VOTA 4OLWL 5ALYA 3S96B 3ULUL 3QO1A 3ARDD 3S36H 1IC5L 4C4KT 1XZEA 4Z77A 1MY7A 3PHOA 1RULL 3O11B 3ALXA 3CUPB 3G9AB 3B5HA 4L4VE 4CL7A 2YEZB 2JGMA 4JLRA 1YEDA 4BCDA 2FECI 2F54A 3LCRA 1SM3H 1CFSB 4H0GA 1I1AB 2FEEL 4I13B 5DZNA 4PJAB 3KPNA 5ELIA 2D7TH 3KD2A 3QCTL 5CP7B 3WDJA 3RPKA 2HU8A 3EZJB 5EIVA 1I7UB 1BD2E 1HH6A 4OAWA 1NMCC 1MX9A 4Q9BA 1W0WA 1YY9D 3IRZA 1TAHA 2A74B 2A6JB 2P5WD 2X40A 4RISH 3C60A 4R3SA 1AR2A 1BVZA 4OB5H 3Q8WA 2MHAA 3NCYP 4YUEH 4BYHA 4Y16D 4JY4B 4HWUA 3DL7A 2DD8H 3KPRD 4JUIA 1D5MB 2D7TL 4UPDA 4NQED 1I85C 4G8EB 3R3WA 4XVCA 3BYTA 3NBNA 2YWYA 3VWKC 2BXYA 5CT8A 2ITCB 1T2QL 1YDPA 1I3RA 3HG1D 3TA3D 1AUOA 4GLRH 1KJ2L 3QDJB 2VN4A 5LAXB 4G43B 4AO7A 4AMYA 1U93A 4HHAB 1E4KC 1ERNA 2HL6A 4XB8A 4OUUA 3QG6A 3LSOB 2V7HA 2HDWA 4LSTH 3WN5C 5KOVC 3X14A 1A8JH 1HHGB 1YPZF 4ZUUB 3ARFA 5IG7B 3RUGF 2E27L 2V5RA 1N1MA 1IZ7A 4P4KA 5EUKA 2DQIL 3W05A 3H2WA 4PQEA 5E00A 5D2LF 2GW5A 1QA9A 3MLYH 3QUZD 3M17B 3MRRA 2VSDA 2P8MB 2OXGA 1LO0H 3KNBB 3TBTA 2F8OA 5MP6L 1L7TH 3B9KA 4RMRA 3VWJA 4UILL 4BC1A 1EBAA 1I8IA 2DLTA 5C08E 5EZIL 1CGSH 2BOCB 5FYKD 5E2VH 5F9AC 3WK5A 2AEPL 3UZEA 4F3FA 5EO0A 1E4XI 4OKVA 1IGJB 2VZVA 4U1GB 4X5XB 3C6LB 3P0YL 1AQLA 3UTPD 5JARA 2DM2A 5HHNB 1ZHKA 1UT6A 4Q9CA 3L7EA 1BQUA 4U1GC 5HVGB 2H2SC 4H0HB 4YIQB 4M61A 4BCBA 4JFPB 3VFOB 1NLDH 1G7LA 4HIHB 5I17B 3SJVE 1XZDA 1BEZA 3HZVA 2OXEA 4YASA 2ATPB 4K71B 1RZKH 4DMCA 4MNGE 1IGJA 3SGKA 1MY5A 3K1DA 2GJ6E 1WAAA 1INQA 3VA2C 4FABL 4PJCF 1XZCA 4BSWA 4F60A 1XGTB 4OCRH 1EO5A 1CUIA 4JZJC 2OL3B 1Q94A 5BXFB 4WU7A 4Y2QA 3LD8C 4XMKL 3C6LA 3F67A 4JH0A 2GT9B 1T21A 2K1MA 4XVJH 3AB0C 4CAGA 5K9JL 3QUMB 4RNRB 1Y6KR 4AIZA 4JNCA 3QDGD 1BFOB 3BPOC 4G6ML 3AREC 4YXLL 1S8OA 1C5BL 4NO2A 1QSED 2HMID 1I9JL 4KI5F 3F65A 4RPCA 4HQQH 5A3ID 2EXYD 1PEZA 3WD5H 1IGYB 3X11B 4N0YL 5F8QC 1MJJA 2I03A 1LQSR 2ZUQB 2MQ0A 4OZIF 1F3DH 4H7JA 2P5ED 4HS3A 4TYUA 3GFUA 3GHBH 4U1JA 2O61B 5ALOA 1JHTA 4E46A 1XGRA 1RIUL 1F3JA 4X7FC 3BGAA 4DSZA 4Y1AB 5LAXA 1JZ6A 1A1OB 3KPRB 3QHFH 2IAND 1E3QA 4PLOB 1CG9B 3GSRB 1B0GA 1U8PB 3E2HC 1BAFL 5LWYH 4MB3A 1T03H 3W5MA 3QCUL 1CQYA 2EYSB 4PB0L 1U36A 2DTSA 4LSRH 5EU6D 1FAIL 5FO9A 2AEQH 2YRZA 3MNWA 4PLJD 3MV8A 4HMEA 3LOWA 5I76A 4HUUB 1S7UB 5E9DE 1LBSA 4RRPA 4KGLA 4JFEA 4IDLA 3V4PL 2WQRA 1MCQA 4NWTL 1OT1A 4JFXB 1X5AA 1T22A 2VZOA 2A74A 3C6LD 3E3QC 4J3XA 5GGVH 4TRPL 3IETB 4LCWD 1RUAH 1U8NA 4ONHB 1A4KB 1EDQA 3TT1L 2EYSA 1OWWA 3QA3B 1NAKH 2BVPA 3TFKD 1UKBA 4AG4L 4D3CL 3WNMA 3TBYA 2AEQL 4BTLA 5FF6A 3WFDL 1CFTB 4HJJH 5I73B 5BS0D 2EH8L 4ZAKD 3W39A 1U8MB 5EBMA 3RZCA 2Z8SA 5I73C 4K3DL 1QFPA 4AO6A 4KK8D 1BHGA 2P5EA 2XMQA 4AIXA 1UM4H 4KPHL 4OM1L 5I1EL 3CCHA 1F4XL 2ATKB 4KEAA 3GO1H 1B6GA 1MHEA 2QKYA 1PG7X 1J0ZA 5K9OA 1KC5L 4CU7A 2B39A 4HUWB 3RWHA 3ARGC 4FMFA 2GJ6A 3P30H 2FHFA 1UZ8A 3ZT5A 3TF7C 4JN1H 5EUKB 1EX9A 3WDHA 4GRWB 4F9PA 2VXSH 4NPYB 4WU7B 1FJ2A 3FYUB 2P8PA 3ARXA 3WA7A 3DYIA 3I3DA 2FRGP 4LLQB 2FCBA 1FQ9C 4S0XA 1TZHA 5I1KL 3U4BH 4NKQB 1A3LH 1I1AC 2AQ2A 3TEJA 3I75B 2AV7A 5E56A 1NBZB 3O45A 4LPWA 3VE0A 1DDHB 4PJCE 4JJ5A 2D4FA 2OTWA 4KI5E 1EDDA 1AFVH 1DBJL 3NABL 4ZAKA 1KPUB 3O9WC 4W1PA 5BVPL 1U8KA 4I4CA 1N3NA 3WIHH 3GSNH 1TFHA 1S7TB 3T0ED 3VE0B 2V2WB 4PV8A 1RJYA 1UT9A 2ZNXA 5C0IB 2Z8WC 1ZGLP 1V8HA 3DQZA 2FIKB 3DVNB 2LV4A 3MBEC 4NRYA 4H7FA 1QLEL 4R4BA 5HYEA 3OOSA 2BFVH 3MUGB 4DSAA 2Q7YB 1H3TA 1BJ8A 3RL2B 3WL6A 5AKLA 2Z31A 3PWPB 5F7NC 2QBWA 3KPPB 3PUIA 1CK0L 3EYQC 1V3LA 3HZMB 1WJ3A 4JM2B 5I1KH 4XNXL 3IJSB 5HGHB 3DUUB 4FLFA 3U1TA 1R3HA 1RUQL 2R2BB 3DJ9A 1T0MB 4F37F 1T1WB 5FUZL 2B2XL 3WIFB 2W0PA 1PG7W 4X6DF 2BRRH 3WKEA 2WINA 2GJ6D 2XZAH 1E27B 5SWSA 3V0WH 2R23B 2XTJC 3AIMA 2GUOB 1CICD 1HEZA 4LLUB 3G5YB 3K8MA 2YZ1A 3I6MA 2AKRB 3CMOL 3FB5B 3QDMB 1GRWA 1Q72H 1KN4L 3GKWL 3L5XL 1Q94B 3WFHB 4Z77B 3PFCA 1JYNA 1LNSA 2GK2A 32C2B 1AGEB 1NC4D 1U8HA 3MJ9L 2CGRL 3SPVB 2EIEA 4XI5C 2LFGA 5JDSB 4P3CH 4MNQB 5EUOA 2O7RA 2RHTA 3SHSA 5F1OB 5JAUA 1VACA 3QDAA 3ZZ1A 5ADOH 4LSVH 1KPRA 4JDTL 5HI5D 3ZLTA 1H0DB 2C3VA 4S1SL 2HVKB 5J13B 4R97B 1EVUA 2EXYC 2HT4C 2VDOH 4MNQA 4AQDA 1NFIB 4J03A 4RFNB 5HF8A 3SPVA 2EE3A 3T0EA 3O6ML 3MNVA 1IT9L 3EOBB 1MCBA 5AD0A 5TF1L 1LO2L 3OKMA 1AGEA 2B1AL 4FQQB 5MEQA 4ZREA 1RJZA 4Y4KB 3C5WP 4P2CG 5GS1B 5K9JH 3W11C 4DKFL 3BKJL 4UBJA 3LZFH 1NBVL 5CGYC 4MA1C 1TJIH 1DQDL 4KYVA 4U2DA 3WZLA 4Y5VB 5B38A 4PJDA 5E2TL 2NR6D 3FLEA 2ZCKH 3HMXH 4JFDB 3BZFA 1S7VA 4O9HH 2QS9A 3E2HB 4YX9A 4P23B 3MBXH 3ZHLA 2EO9A 4FBLA 4GAFB 4E15A 1IUPA 2UWEA 4IHOB 3O4JA 1R9MA 4JFQB 3QPCA 2BMKB 4JFOB 5KBYA 3HG1E 4ODWB 4NP4L 2IMNA 4U1MA 3V0AC 5CIPH 2VQ6A 2V5MA 4HPYL 2FATH 4KU1A 1OAXL 4V2CB 2FWOB 5AK5A 3D9AH 3IFOB 3GSOA 3VXRD 4PGZA 5JZ7D 2XKNB 4P46D 4KVNH 5H35B 4JYMA 3AAZB 5IH7A 1RIHL 2BVEA 2WLYA 1SMOA 2NTFB 1CYGA 3KJ4C 5EFIB 2DQDL 4X7SL 5D72L 3P73A 4CMHB 1KB9K 4E42B 3CDYA 4NC2B 4P2OA 5GGRA 3P4MB 2BNRE 4ENEC 5KSBB 5CP3A 2Z8XA 3KYKH 5DR5L 3PGDA 4E41B 1A5FH 2H1PL 4AYFA 4OCZA 1F4WL 1LK2A 1TTFA 2A0LD 2ERJB 4M1CC 5E4YA 4U6VL 4DN4L 1ZSDA 3QUZC 3RWFA 5KVEL 4W6YB 2EXWD 2GAZA 3GK8L 3MRKA 1YPZA 5SV4A 3QWQB 3F98A 1IMJA 1SYVB 1OCWH 5M94B 1R88A 3QISA 4Z7UB 3TBWA 1A7BA 1ZHKB 1MF2L 2X4QB 4LCIL 3HE6C 4AQ1B 2VC2H 2E9WA 2VQUA 3WFCL 1HSAA 4NCDA 2IPTH 3HC3H 1BZ7A 4P2RB 3T52A 4G8CA 4ZNEA 2D7NA 4JZJA 3WKAA 2AXFA 4PJXF 4WTZA 4HC1H 2GBFA 1FVDA 4K5QA 5C3LD 2H7CA 2HA0A 4WIQA 1CUZA 1GQSA 4E14A 3CFBA 4L8CA 3W9EA 3QWOB 1JNLH 3ZDZE 1U8QA 5BOPA 4JZNB 1NCDH 3X13B 5JIIA 3RK4A 3VFSB 3ZHKA 4OIIH 1KTRL 4P9HL 2D4DA 2AJBA 4N8EA 4CCYA 1A7NL 4ZO6A 2Q0XA 5IF0B 4FQCL 4LQ1A 5IVIA 2BVOA 1OTSD 4Z7WB 3SKNB 2O5YH 2YASA 1PFCA 5D7LD 4G80B 4U4BA 3MRHA 5DHVB 3QNZA 3ES6A 4WJ5B 5DD0H 5E8PA 3VXRA 4QRRE 3QHZH 1I9EA 4D2NA 3UAJD 4WGVB 5EBWA 4Z8FL 1VERA 4L3EA 2QTEA 2PM8A 3JW8A 4WV1A 4MWSA 5JIPA 5FGBA 1IFHH 4FTVE 4HBQA 1AO7D 2OCGA 3MRLA 3N1FC 4JPWH 2V6HA 4JAMB 4PJGA 3IF1B 4PJ5D 2FJ0A 4LHQB 4N0FA 5AKEA 3O9VA 1A02N 3B8SA 3T77A 5GRVK 4HH9A 4PG9B 3BZFB 5ADPH 5EIHA 3D18A 3U0PB 5DFTA 1ORSB 3ROOB 2ARJB 1RY7B 1IQWL 3OXRA 1KTDA 3PF2A 3R0MA 3TN0D 2HRRA 1OAQH 1YUHA 5DD6B 1PYWA 5M95B 1E6JH 1FV1B 1N0XH 2AXGA 5ALFA 2AJVL 4PG2A 5BVJA 2EE9A 4JO3L 5AZEH 4MB4A 2NR6C 4GKNB 2HN7A 4X4MA 4Y2DB 4Q6YA 2QQLH 1ETZA 2XTJE 4OSUH 3W11D 1PEWA 4D9JA 3AS0A 3PWNB 3GMPA 3A0OA 1GGTA 3GUTB 4IOIB 1TITA 2F8VA 1JPSL 3HCVB 3MODH 2QADD 4L3CB 3WEXA 4OCLC 2AK4E 4GH7B 5J06A 5K9KA 2V2XB 4Y4FD 2PL5A 3S5LB 4YXHL 5ICXB 4UBDC 5CMAA 5IUSA 4N5UA 3VGGA 2HAZA 4I18A 3TYFA 4EXKA 3ZDZF 4XPGL 3UTZA 2O2GA 3HAEA 5FYJL 5IK3A 3BGMB 3FQWB 3OPZH 2HT2D 1AKNA 4LIQH 4P2RA 2XUOA 2E3VA 2F19H 5GGQL 1A1MB 2WUCL 4D9LL 1FZOA 1JTOA 1NEZG 3DDUA 4ZTPH 3DO3A 1FL5A 4U6VH 1SYVA 4J3OC 1K8DB 2ZUYA 3SDYH 4P08A 2NY6C 1MCOL 5MI0B 5I1IL 1G6RA 5IESH 2FZ3B 3RAJL 4EVNA 4S1DD 4QHLB 2BVTA 4UMGA 3H9HA 3RPIA 1KT2A 3VD9A 1GKLA 4DKEL 4BZZA 2QV2A 4PJXE 3I50H 3KPLA 4OKVB 1HIML 5H37H 4GQPH 4J3VA 2X70B 1AR1D 1NANI 4NQDE 4K3HA 4UINH 3UZQA 5D2NC 4HPYH 5EOCJ 1BX2A 5FB8A 2GCYA 4FQXB 2BERA 4LIQL 4GRMB 2PYED 5CXXA 3HE6D 1AE6L 4LARH 5DDHA 2DF3A 2VJXA 5JPMB 3O3DA 3G5XB 1TQBB 2X5XA 2VEOA 1QBML 2BC4A 2EECA 5EU6B 1YEGH 5CT5A 3T0EC 2BUCA 5JIBA 1IM9B 4GQ9L 3D9AL 4MJ4A 1OGAE 1TVHB 4KRPB 3SQOH 3WCYA 3X12B 2P8LA 5EU5B 3BHBB 3MLPA 1JT2A 4O08A 2HFJA 5T1MB 3DHMA 4M48H 5IQ9B 2WJ4A 5FGRA 1YAJA 4MLSA 4J3TA 1BFVH 1MAJA 3AM8C 3KYMB 3BWUC 3QQ4B 4LLAA 2VR5A 3I9GH 1JYWA 4Q3LA 2HFTA 1ZA6B 5C0ND 2R1WA 1Y18B 5HHOB 5HHMB 4BH7A 5D5MB 4V1DD 3OB0H 5D2NB 1T1XB 5DEFB 4IIQC 4JDZA 5D1QB 4LEOB 4WI3A 5T5FL 2I5YH 3OWEA 3U1SL 2DIAA 4BATA 1CGVA 1UM5L 3QZWB 1KTLA 2CDEA 1GGIH 5FA3B 5HGBA 4QRRB 1DTEA 3HRPA 3O6MH 5FHAH 5J89A 4FOMA 3P11H 4WUKL 4MXDA 4DGIH 3PHQB 2Y72A 4S1SH 2MKWA 1MJ7L 2DBJA 4MZ2A 1R50A 2BJMH 2F74B 4P2RE 4HWBA 5HDLA 5D7JD 4OT1L 3WJ2A 1IC4H 4NRXA 4G6AC 1A4KA 3CVHH 4B0PA 1A1MA 1CD8A 3S9DB 3KGRA 2HKHL 5TQ2H 3V1NA 2V9RA 2B1AH 2ZOLA 4KVCL 4Z7WF 3MV8E 1EMTH 2BY3A 1X5GA 2B4CC 2AXJA 5I76B 1GC1H 1PKQB 1X6NA 4P0DA 2PUHA 1WGOA 5C0CD 4GRLD 2FYYA 4FQXC 2Q3AA 3QWRA 3QYJA 1KCSH 2DKMA 4WO4B 3LKQB 3QIWD 5ISZD 4QDOA 2EKSA 3DKRA 3V5HB 3CFCH 5JHLH 4DNOA 1CZ8L 5LZ9A 2WUBH 3REVA 5K9QG 1QFUL 3FQRA 2PSDA 3OJMB 1BX2B 3GUUA 1CK0H 1EAPA 1EEUA 1MCWM 4H77A 3TA3A 2FJPA 3NIDE 1AFVL 4XXCC 1RZFH 3KPLB 1S7SB 4WW2F 3IDGA 3QIBC 4N5ED 1EEZB 1H3UA 1QKZH 2X4SB 4P2QB 1R3KA 2DOCA 1AXTH 4GMSL 3BZEB 3H9SE 4N0UB 1ZD3A 1OM3H 4Y19B 5DJ8A 4RNRA 4U1KA 3WUWB 4B0OA 2QQNL 3ULVH 5I19L 1DFBL 1CVRA 1WBXA 3EJYD 1RHHA 4XGZB 2V97A 4OZFA 3TYGL 5SYMA 1NBZA 3VG0H 5CP3H 2PXYA 2DQJL 2FX7L 3VXQA 4NWUL 1Z6JT 3STXA 2ED7A 4FQ2H 4YO0B 3QDGE 3B8YA 2HFEB 2FO4B 2R0WH 2WWMC 4PSDA 2OI9B 5DEZA 1A3RL 5I30L 3FFCA 5CSZA 2I60L 1TZGL 1XLUA 5IVZB 2NXYB 3GIVB 5TDPA 1CR9H 3OAUH 5TDOB 3OZ9L 1VXRA 1JF1B 3RIFF 2DFPA 4U6HA 1S5HA 1YA5A 3GMOB 4MSWA 3VCLA 1ODCA 2OQVA 5DJ8B 5D1XC 2B8OT 3D85B 1YEEL 4DW2L 2JIXA 3DRQB 4CFSA 2FH8A 1QKZL 1S7QB 5C70A 2GJZB 2VDLH 4MJ5A 2XB6A 1FO0L 1IKFH 4O58L 4GWLA 5L88H 4HAFA 3MJGX 4OLYH 4UBOA 4XP1H 2EH8H 2NY3D 1P1ZB 2FHCA 4FNGA 3V5DA 4O2EA 5EA0H 4PJFB 2HWZL 2J1KA 2X8BA 1QFHA 4MZ3A 1TJIL 3ZKSD 1JZ5A 3V6OA 4QOKD 2HN7B 4QRPB 2I07A 2QQKH 3B2UD 4I2XE 4NS4A 2R8SH 4Y2JA 4WUUD 3VFGL 3BRGC 5I1AA 1CE6A 1TJHL 2VWEC 2QSQA 4HK3J 1KCSL 1OWRM 1PSKH 1P4IL 4PRNA 5FK9B 4F15C 2XT0A 4RAHA 4MDJA 2DLFL 1D5IH 4J7RA 3VXSD 4TVKA 1PKQA 3BP6B 4MS8C 3WNNA 2X4NA 3SE4C 4AMZA 2FJHB 2VLJA 3BP5B 5GS1C 3H3KA 1CLYL 4XPTL 3SDXF 3C8HA 4XPHH 2HKHH 5TQ2L 3LHPH 3QJHA 3VXTA 1E6OH 1ORSA 4L8SC 4OLZH 2PO6C 4HWEL 3TV3L 43C9A 3AM8A 2ITCA 2A6IA 1U8PA 4WO4D 4FLMA 5K3AA 1O0VA 3N2ZB 4M5YL 5CD3B 4XVUC 4OD3L 4DGIL 5CBEB 5DNVA 4N8VA 1KCVH 4UIKH 2X4TA 3SGDI 1QRKA 3IFOA 5FK9A 4ODXB 3QXUA 4X6CF 2YMXL 1VE6A 3B9DA 1KTLB 1S9WA 3WS6C 3OV6A 4BDSA 3NCYS 4EVNB 1IZ8A 4P46B 4XVTH 3RGVD 3U36A 1XZBA 2RB8A 4NQEE 4G6FB 1TQCB 1ZV5A 5HD8C 5DQ9B 3H04A 4ZNEE 2HA1A 1J88A 3KPRE 2OK0L 5JW5A 4M9PA 3GSUB 3MR9B 1MFBL 4HZLB 3I6GA 5FM8A 1CBVH 4Y2DD 2BDNH 1BVKA 3MRQA 5GSRB 4WUUA 1TETH 1CT8A 4WFHD 1SM3L 5FYKH 1XLWA 1KV3A 4YC2B 4PS4L 4QTIL 3VFUA 3MV7A 4WI8A 5I1HH 3WLAA 4TSBL 5I19H 3DYOA 4JPVH 4DMKA 2NW3B 5SWZE 3U46A 3CGTA 4X80L 3BH8B 3FQNA 1H3WM 1NCCH 4Y19E 4F7PA 5GPRA 3CLEL 3VXSA 3BYYA 4TTDC 2XUKA 3CN9A 1T7XA 3UTSD 3SWWA 1A21A 5GGVY 5HGDB 3QQ3A 1G7LB 4P59L 4I0PB 1ZA3A 5E4TA 4PRAB 3BSZH 1B9ZA 4RRPG 3WS3A 5HPOA 5E6IC 4MA8H 2HMIC 3MV9A 4JRYD 5IW1A 25C8L 3AJAA 5E95B 4BH8B 2DQFA 3RWEA 3EIOA 3SGEI 2CR3A 4X5XA 5GRUH 5FP0A 1ZGLB 3DXAA 3ARGD 3NAAH 3TNNA 3PGDB 5A43C 4P99A 2F58H 4KQ4L 2IIVA 4XNYH 1WHTA 4X4YA 3HLAA 2AJZA 3E0XA 4C83B 1U95B 2YD7A 3CDFA 5I1DA 4JKLA 3QFJD 5EORH 4EI5C 3V6OE 1RWQA 2ADIB 5F70A 4Y5VC 3QFDA 3VFWB 3H18A 5IVXE 3ROOA 1N7ML 5I1JH 2BVQB 5AI9A 1UB6B 5GS3A 3GO1L 3O95A 5AI8A 4HIXL 4OZ4A 2DHCA 5GGTA 4X95A 3JV4A 2UUDH 1MN6A 4X8JA 5FEBA 1R3LB 2FEEI 2P42B 5CT6A 1A6VL 3SKMA 5ANME 3WKNA 2R8SL 2BMKA 4YDLB 5LP1A 2H2SD 5DWUH 3VXOB 3BRFA 4HGWB 1PKQE 3HTLX 1GGCL 4RAUA 1F13A 5JHDD 4AZ0A 2E6PA 4QDZA 5F44A 4XCCH 4FQQA 1IGFH 3PABA 5HPMA 4POUB 5IW3A 1T0PB 4I5BA 3MRHB 5DHVA 4OLYL 4X97A 3GI9L 5C09D 1AHWC 1JHLH 5DXWA 1YJDH 5T33L 1T6VN 5TDNA 1NCBH 1KTKE 1EMTL 3HS0A 3ZL4L 4O00A 1JGUL 5J0BA 1CQWA 2BY2A 3GSXB 1MOEA 1P7QB 2VLKA 3JTSA 3TO2A 4ELKA 3TPKA 1KJMB 3BKYL 5JOFA 5KSUA 4YDVB 3H0CA 5AI6A 5K5EA 1IBGL 3GMPB 5D5MF 1QSFE 4HIJA 1ADQA 1QNZH 1NEZB 2NLJB 2ZOKA 1WM1A 4LCYA 4HJGA 2GYVA 1XF2B 2YC1A 4JB9L 3L5WA 1F4AA 5D5ME 2Y06H 5KN5A 3P11L 4WUKH 1MPXA 1TENA 3LH2L 4L0CA 2ICWA 1JZ2A 4WFGD 5EIEA 1MCCA 3QEHA 5ID0B 4R4NC 2VXVH 5JPNB 4A6YL 1CU4L 1U42A 3IU3B 1C7JA 2BCKA 1YA4A 4CG2A 4XNMA 1PBYA 5IT2L 1N5YL 3RWFB 3U0PA 4K8RL 2V5SA 1AXTL 4GMSH 3O6FC 3DVGA 3DURB 4M43H 5EU3A 1YCDA 3OKDA 3S7GA 4I1NB 5CSGA 3NMEA 2Y5EA 1A64A 4MWTA 3BVNA 4N9GB 2D31B 4O2FB 3DJYA 3PP4H 4LXIA 1MLCB 2IH3A 1Q9WA 3VG0L 2HT3C 1K8IB 1KIQA 1Z9MA 1R24B 1DQJB 4HXFB 1OSPL 2VXTL 4X8XA 4TULL 5MEND 4Z0XB 4Y5XC 2GEEA 5EBGA 3PG2A 3TN0B 4YBQC 2X1QA 5I8EA 3SY0B 3HNSH 1QBMH 3C5VA 1MLCA 1S9KC 4YFLF 3ULUE 4ZFOA 4HX1B 5KVFH 3ZKMD 3SDAB 5D8JL 1G7QB 2LU4A 1C8PA 4QXGH 4RX4A 1RU9L 3P0GB 4Z0XA 2XUPA 4TSCH 1DE4B 1K8IA 5J4MA 4PJ8D 1CRLA 3EO9L 1M7XA 1T04A 4K2AA 5D3KA 3W0WD 1DUZB 1KIPB 4QF1A 4KC3B 5LXGL 1MAKA 4JPKH 3V5KA 1PV1A 1Q84A 1FL6A 5JHLL 2BVUA 3FOMA 5I1LB 2YOCA 5LGJB 2Q76B 1AD9B 4C56D 2N7BA 1SEBB 3A67L 5ALKA 2UV3A 3Q3GA 1E4WL 3ARDC 3A70A 4I3SL 4BK5A 3B9VA 1E8NA 1IZKA 5I71C 2HKFL 3FCXA 2VL4A 3C5JB 4D0BA 1IM3A 1U6AH 1CICB 3GB7A 4UT9H 4UV4L 1G66A 5I71B 3TBVA 4GDMA 4OZGE 1NBYB 5AAWA 3Q3GB 4LVHB 4OQ1A 1CFQA 1M71A 2DQEL 2Q76A 4GXVL 2Y9RT 3A2LA 3FAWA 3RVVD 4ZSOE 1REIA 4NRZB 2YD3A 2FJFB 3DNMA 3GIZH 4B6GA 3HZOA 1U8IA 4XTRD 3RWHB 1AY1L 1VGEH 1HBJA 2IBBA 5LBSH 4MJ6A 4YDVA 2OCLA 3KYNB 2AAVA 1EHLL 5KAQG 4KDWA 1X7QA 2VQ1A 3QDMA 3MODL 3ESVF 1X44A 1MCPL 3L3IA 3DMMC 5LYYA 4BE4A 3RKPA 3MLWL 1ZI9A 2FJGB 4U1NB 2VATA 3HNTL 1OARH 3U0VA 2JF0A 2QEJA 4OLUL 4HD9A 2H26A 4JEIA 3T2PA 1S7UA 5T4BA 5JXEC 3SX4A 3TBSA 3ESCA 4XBGB 4GAGL 4O2FA 2D03L 4JPWL 3SKMB 4EJ1C 5FGCB 1SC9A 2P1YA 1QONA 3SEPA 4RDQG 5F7FA 3BH9B 4ITVA 5D7SL 3BKYH 4EY7A 5TF0A 3T2OA 2X4NB 2R4SH 3GJEA 5AD0B 3IFNH 5HGAB 3DVNA 1WCYA 4YDLC 4LU5L 3ZYZA 3L3OA 5I8CB 1HXMA 2V96A 1TPXB 2DMKA 4PBWD 4IJ3C 3OC0A 3KXFB 4GLRI 4WTZG 3TVMB 5JZ9A 5CJXC 4OIIL 3VG9C 4IRJB 5CEZH 2J4WH 5IVKA 4GG6E 1XF2A 4LCYB 1H2WA 3EOAA 4CADB 3EAKA 3DI2B 5ITFA 5C09B 3BQUD 2BY0A 3S35X 4ZUWB 2OQJB 3ULUH 5BJTB 3IT8D 4RBPH 4CDGC 4JGUA 2OX5A 2X7LA 4WWKC 1JNJA 1AP2A 4P2OC 5GGRY 1ND0A 2EZ0D 1X2EA 2YRLA 1DN2A 1NKOA 3IS1X 4PJ7B 4YXHH 5HQ3A 2HJFA 2NX5D 3FO1B 1BBDH 4YAQB 4U1IB 2D0DA 1ZD5A 5DHYA 2NZIA 3RKSA 1NGXB 2FSEB 1K4CA 1RUMH 1I8KB 2WUFA 4HFWA 3M07A 3WK8A 4X9BA 5DD3L 4S0TD 3T4YB 5EZLA 2NY4C 3TPUB 3JWOC 3NACH 5HHNA 2W9EH 1YJDC 3MRNB 4ZOCA 3QXDB 1WWWX 2GAZB 3GSVB 4TVPE 1CFTA 3U7WH 5EHNA 2APBA 3KDMA 1U2HA 2IANB 4M9OA 2CEKA 4MNHA 4M61B 5HFNA 4PGDA 1G6RL 3TIDB 1H5BC 3JV6B 2W0KA 3BWAA 1LK2B 3I02B 3WYNA 3I1YA 2J6EL 4KRPD 4PS4H 5FV4A 3WSQL 3RUGA 1T2XA 3CDGB 4LKOA 2EC9T 4JFXA 1SMAA 4BZ2H 3CU1A 6FABL 5J6HB 3QDJE 4RQQB 3PL6D 3RWIB 4BRSA 2WHPB 2UUDK 2XACC 2YEZA 3KXPA 5IB4B 1JGLH 3MV9B 4JFDE 4UT6L 1L7AA 2RAUA 4RGNE 4JQVA 4FN0A 4LLQA 1EH9A 1BFVL 3H42L 2JB6B 2CLVB 2R4RL 5EB9A 5E2WL 4OTXH 4JDVB 4UFNA 5B3NA 1IC7H 1P0IA 2Q8BL 4LNVA 5TFSH 1H15B 2AJSH 1OAKH 1QIMA 5DYTA 2E7CA 3WQHA 2YUWA 3T0DA 2ZJSL 4GO6B 1U3HB 2UYLA 3STLB 4HS3B 5L7XL 5IBLD 2XG4A 1ODAA 1VGEL 4KH2A 4ZNCD 2Q3ZA 4OM1H 3CVIH 3M1BA 3DLQR 1K4DB 5FPPA 2D3VA 3OKOB 3EQ7A 3UJIH 2R29L 2HVJB 3KWJA 3OKEB 3FO9B 2F5BH 3STVA 4YBLC 2OMNA 4UZGA 3STZB 4GUPA 2R69H 5HFAA 1MCFA 4DNPA 1WF5A 4G42A 4FFZH 2MHAB 3WKCA 1RZ7L 5DMKA 8FABA 5DA0B 5GS2D 1WFOA 2HFEA 3GK8H 4F7CA 4P5KA 4P49A 1ZHLA 3VVLA 5T1KA 3QUYD 4KJQD 5DHYB 2GYWA 4QOKA 4JVPA 3ZDXF 4J3JA 2HT3D 3BQUC 3MRJA 1XZAA 1ADQL 3D25A 3K7UA 5BZDA 3T0AA 2NY5C 2ZSVA 2VLJE 3QG7L 2CK2A 2ZUTA 3LVEA 4KDTC 3TCXA 1FFCA 5HVFB 3MLZH 2ZKHH 3VGEA 3BPCB 3VXUB 4CN4A 1S9VA 1AKJB 4XMPH 5ICXA 2GUOA 1BLNB 2CJPA 1QIIA 4QRQB 5L2KD 4GKZB 3V0WL 2B4CL 1QIJA 2E8YA 5IW6A 2XI9A 4X80H 1NPUA 4S2SB 2DL9A 1HHKA 1V7MH 3QBTB 1I8IB 1USWA 2OP4L 4KMQA 1IGML 3DD5A 4U1MB 4IBLT 1UK9A 4QWWA 2A9ML 1BOGB 1CV2A 1TNMA 3ILPB 3NFNB 1T5WA 4MJID 3WL9B 1H2XA 4BSVB 3F6LA 5HVHC 3WWPA 2IG2H 3D5OF 1F6LL 1Q0YH 4L72A 4AK1A 3BISA 4ZUVB 5JXED 5C0BE 2G5PA 1H8OA 4X6CA 1KT2B 4XHQA 1FGNH 5DVMA 3H9HB 1XCQA 1RJZB 4PGCA 4G43A 4KAFA 5C6TH 3CLFL 3DETD 1EJ6A 3VFVB 1AQDB 3EBLA 4KQ3H 2OTWB 1G1CA 3BEWA 4WNQB 5T33H 5ALXA 3NN8A 1MJ8H 3FFCE 5J6GA 3AREB 3ZO0A 3ULVC 1UEYA 2EEDA 3MOBH 4XB7A 3CXDH 5HD8D 5I9QC 1OAYL 2CUMA 3O8XD 5C0EA 4FHZA 5C2UB 4TPRL 5E2TH 3D3VD 1RZKC 5HI3C 2P7TA 1LO5B 4P4RA 4AENB 3T3ME 1QNZL 3V7AG 1DQLH 4ODHH 1CGYA 4BKLA 1DBAH 4KRLB 5SWSE 1MIML 3RVVC 3ULUC 4CGTA 3H6JA 4LSUL 5BOZG 5F7LB 3UTTD 3AFLA 4XHJC 1JHLL 1XF5A 2BOBA 4N9OB 4N1HB 5FYJU 3S5LG 3U9PL 3DV6B 1L6XA 3FB5A 1UXWA 2BSSA 5I1CH 1OTTD 4J3WA 5LGHL 5GRYA 3H0TA 4YHKH 4QGYA 3SGJA 1F11B 4R7DA 1NMAL 2Z0BA 2DM3A 4KRNA 4PV7A 5I1GL 1EHNA 3T4UA 2D9QB 4NRZA 1I1FA 3NPSB 1P69B 4M5ZH 4Z95H 3VMOA 4JFEE 4KRXA 3FT2B 1KGCE 4A5SA 5I15H 2HA2A 1X4XA 1CLOL 4OCXH 1T03L 1Q72L 2QKIA 1LLFA 3FN3A 4M1DH 4PJFF 3WA6A 2CDGA 3IDYB 4TTDD 1XFPA 2ADFH 5A2IH 5J13C 1KENH 1D9KA 1F0PA 3FJTA 1THGA 1OAZH 4XC1H 4HWZA 4Q6IC 3OL2A 2JJVA 3SDXA 4YQXH 1UJTA 3O4HA 4Y1AE 1KIPA 2YWZA 3WXVH 1H3GA 3TWCL 3KPSB 4FXLA 5JO5B 1CIUA 1X6LA 5DGRA 3TM6A 1N6QH 1OTTC 2XA3A 4FXKB 4NQCD 3NWOA 1MCJA 1PY9A 1NC2D 4LYDA 2YPVL 4XBEH 5IV2A 1WT5A 4TGLA 3QUXD 1KEGL 3V4UL 3SY0A 3QIBB 4HKXB 1JYXA 4AN0A 3VFTA 2VLLB 5KANG 1E66A 2VDRH 5IFAH 4OFPA 1O6FA 3JV0A 1GPOL 3MRMA 2OSLB 2CLRA 1U65A 1PX3A 2B7DT 3LB6D 3GNMH 4G9FE 2XQBL 1CUVA 5E6IB 3FQTA 2YSSA 4P2QE 4XCNA 5TQ0H 4PREB 1V3JA 2APFA 4ZYKA 5DFWH 4Y2YA 4IHOA 1WCQA 2XZZA 3VFSA 2BNQE 4ZSOA 2X44D 1RD6A 2Z91B 4JEGB 4DZ8B 2ZKHL 3PGCA 1J1XH 1CT8B 3K2UH 4YK4C 5F96L 4OCNC 3O81A 3V9FA 4QRQA 1F42A 4N9GA 3N0TA 1FAKT 3HB3D 4YK4B 3SDDA 3MREA 4KJXA 2OL3H 2DMBA 3ARSA 2YD4A 3RX7A 3FQTB 3S98A 1PG7H 1GHFL 1LP9E 2EIDA 2P8SA 3D3NA 3UYRL 3FVTA 5AKKA 4QNPF 4M93B 4HLZG 5JW5B 1MRFH 1TK3A 4B41A 1JPST 5DRWB 3L1IA 3EUUA 2YUVA 2ZNWA 4KUCD 5D7LB 2R11A 2KBGA 1INQB 4WFED 3QZWG 3S4SG 4YPGB 3LIPA 3JZ7A 1J10A 4MAYA 1YYLL 3ESBA 2NCMA 1MNAA 1RHFA 2WBKA 2EDNA 5E08L 2QL1A 1FN4B 1JWMA 3R0NA 3C60C 4ODVL 1TJHH 3H7LA 1DT5A 3M83A 2FDBP 5ACZB 3F8SA 1YA8A 4UDUA 2AK1H 5IB5B 2YMXH 1NC2A 4TOYH 1WIUA 1NEZA 2NLJA 3B9EA 4EUPG 1HPLA 1TDQA 5EO1B 4OGAC 1BFTA 3B5EA 1OW0A 5EA0L 1P7KB 3S3SA 5F1SA 2WFLB 3Q6FB 2WMPA 5E6YA 5KJRH 5YASA 3BH9A 3HNVH 1T5XB 2FHBA 2ZJSH 3I6LD 1BPVA 3RA7L 3UJIL 3FCTB 1A8UA 1IVYA 1EK2A 5DUBA 1E27A 5C6WH 5MP6H 1A1OA 5FKAB 4X9IA 4JCMA 1YEEH 1VGKB 1SBBA 5DUPL 5EGNA 4HIXH 1FNGB 4ZPVA 4F2MB 1AGCB 4FZ8L 1LEGA 4JG1L 1N4XL 3OZ9H 2IQAB 1D5IL 5A7GA 4JAMA 5AK4A 1F5WA 1Q9LB 1BGXL 4R7NA 2WWMD 2WWKT 1NJ9B 4RDQF 4PGEA 2QMQA 3OKYA 1WIPA 1IMHC 4JO2L 5LWYL 1VADA 4N90E 5HK9A 5FIEA 3O0DA 4MAYD 4MD5A 1RV6X 2VDLL 3FKUS 2IH1A 3LY6A 5JDJA 3UJJH 5FO8B 5C86A 3UTSE 2CO7B 1A3QA 3ZLUA 3T08A 4XC3L 4G9DA 1RJYB 4W9RA 2V17H 5AJHA 1K6QL 2HWZH 5IBTH 1QOKA 2BX5A 1RFDL 4XPAL 3L3DB 3G6JB 3R3XA 2FBJH 1J1XL 1T3FA 2ICEA 4LHUD 1ZWIB 4X5LA 4ZD3H 3JWOL 4LL9A 2JCCB 4M0MA 4QT5B 3IDXL 4HRXA 3V6FA 4CMMA 1HHJA 1OAKL 1T2JA 3OHXA 3QPXL 4YWGH 1G1YA 5C6TL 1CD1B 1KB5L 1P2CB 4LCCC 1NAML 3HHRB 2J6EH 4FNMA 4Y2DC 4JANB 4JPVL 3BP7A 2PW1B 4R96A 3SE4A 3O4OB 4YC2C 3F7YB 2R1YB 4MQ7B 5B39B 4QO1A 1NGPL 4G42B 3JWDH 3V7MA 1AD9A 2ICWI 3E3QE 5IGXH 1JGVH 2XPGA 4TVPL 2CDFA 4LP4A 1CD1A 5D1XA 2DSNA 1HINL 3KS0J 3DGCR 5EZOH 1VB9A 3ZE0E 3MXWH 1KC5H 1NEUA 35C8H 5HY9A 4NJ9L 4WDQA 3MCG1 2NTFA 2VDQH 1T66D 4UHCA 4TNVK 4OD2B 3WE6B 2WNGA 4WW1B 3D2UD 4S1RL 3LEVH 1KG0B 2CXGA 3EYOA 3HN3A 3IDMB 3GMRB 4DTGH 3GMQB 1XQWA 4LPTA 5ITFB 1GPNA 4NN7C 2VLLA 4XCYB 5DVLA 3K4DA 3O4LA 1BN6A 3CN7A 3FMGL 3WLWD 1QSVA 3VGDA 2IH3B 2RAMA 5JNYB 4L8SB 5FHAL 3KYOA 1DBBH 1LBTA 1A9BB 1R5VB 4OZHB 5GHWH 1ZGCA 4LPXA 3DBXB 5HF6A 5EHQA 3IDJA 1F4WH 3QYCA 1OQOA 2ESVD 1EPFA 4FZEL 2DIJA 5D9SB 4A2LA 1GOHA 3BQUA 1CWVA 5HGAA 4GBXC 4QOKE 1AGBA 4RGND 3IFLL 5C0NC 2WUGA 5D6OA 2ZCLH 2QADC 4OFYA 3I02A 4PRPB 4EY6A 5DMKB 3DS8A 5JD6A 1QTYT 2P8PB 2VXUL 2ZCHH 4MA7L 2BUBA 1XCTB 1I7ZA 1XIWC 2R29H 1KCKA 2C4XA 3GSVA 1FNSL 3GBNH 3WHE1 5E5MB 3ZKNC 2XY2A 5C9KA 4PGBB 1HHHA 3F7RA 4I8DA 4MA1B 2G63A 5EFZA 1JHTB 3OR7A 4J8RB 4LSQL 5D1XD 4WWID 5C8JB 1JI2A 1CGTA 4PJGF 4NQVB 3T3PF 3QQ9D 3RVUC 2NY1C 4DMHA 5F3HB 1F2QA 5ETUB 3BKCL 3KPTA 3D7RA 1YPZE 4CIAA 2H41A 1IGCL 1C5BH 2W6CX 4G6FD 1B41A 5ESRA 1HKHA 3R06B 5A2FA 4O2EB 4DVBB 5C0FA 1TRHA 1UJ3C 5HQ3B 4MXVE 3UJJL 4OZGA 4M4RA 4WHYH 3S34H 2BSRA 2W92A 3VH8B 4LSSL 3PF9A 1SHMA 2C1PB 4BUHA 2OJEA 3WIBA 3QQ4A 1PAMA 2LAGB 1FFEA 4P9HC 5DJ0A 5EUOF 4ZUWA 2XT1B 4PFEA 2BVPB 3KJ4B 4LRNH 3OKKA 3LS2A 3FFCB 2Z5GA 5J3JA 3NCJH 4Y9SA 2OTUB 4G8FA 3WKMH 4B84A 1J11A 5BZDB 5IHLB 4JDTH 3WWEA 1K5NA 3HABA 1RZKL 3TYGH 1DL7H 2VJAA 2X9YA 1NAMB 2X1WL 5ALVA 2DYPB 1ZT7A 2Y07L 4M7KH 3WN5A 1A7QL 2UY7A 4JM2A 1ZLVH 1CLZH 4HF5L 1MHHA 4PJDB 1BVLA 3P4OB 5K59F 3U4AA 3HG1A 4X6DA 3RGVB 4OI7A 2Y2UA 1N6VA 1SY6L 3BWAB 1MAML 5CW2A 5FXMA 3KVQA 4U3XA 1V3MA 3ARBA 5DYWA 1GZ7A 3NN8B 2OJZL 3IDIB 1RMFH 1DLFH 1S8DB 1DSFL 4OLXL 3T4AB 4JM2C 3UCRA 4PGJA 3CMOH 4R0LA 4XTRC 2BSTA 4NM8H 5FYLD 5CT4A 1ED3A 2F5AH 4RFNC 3MACH 4WV1C 1JI1A 3G0GA 5FA4A 4LGPB 3SOBL 1P5VA 3RY6C 5KS9A 3B83A 5GRJH 2WIFA 3CXHJ 3UC0L 4EEEA 1JPSH 1RZJL 1I8LC 5DJ2B 1EO8L 3KJ6H 3QI9C 4GKSA 4Y2VA 1K3ZA 3L3KA 3C09C 3MCKA 5D8JH 1HDMB 1E0OB 3TNMB 4G8GD 1YECL 2MCG1 4F9PC 5E9DB 1C5CH 1XRPA 4DOHB 4N90D 1A2YB 1UYWH 3H1AA 2IALA 3KXFE 5IVOA 1Z3GL 2LQRA 5DVNA 2AQ3A 4LU5H 2CLZB 1PY4A 4A6YA 3D85D 3TJHC 3FSGA 3BGMA 4B7ZA 2V7HB 3FYUA 3CSPA 3QRGH 4JPKL 1OSPH 2VXTH 3GBSA 2EYTB 3MZTA 4JFYA 3ZTJG 4G8GB 4JFFE 1S7XB 2WUCH 3GJFH 1I1RA 3QDJA 4S1QH 1I7RB 3UBXB 3NCFB 4XP6H 2WHPA 4M8QB 1T89A 4PJ8C 2VERN 1TVBA 5IJKA 1IGCH 1KIRB 5MEOA 2YPLA 4YGVA 5EBMB 1QSFB 4E0RA 1MHCB 3PDOB 5CEZE 5J7CC 5I2IA 3C43A 5TQ0L 5ALNA 1FO0A 4FRWA 4HXBH 2IGFL 4LCUB 3B3IA 4GRWE 2E9IA 1UM5H 1GSMA 4K71C 1YB7A 2DHEA 5HHOE 4H0IA 1K2DA 3CFDA 5D71H 1W0YT 3LZFL 4KROB 1Y37A 4P4KC 3PDOA 2YR3A 4H25A 3S2ZA 1J5OH 4MA3A 1TVDA 1VLQA 4K3EL 5CRIA 3VGHA 4HXAL 4UI2A 4ZMAT 2H45A 4PR5A 3FBWA 3SKOB 3RIAF 1MFEL 1QACA 2LVEA 1VEPA 3AUKA 4F5ZA 2YUZA 2W0FB 3VMPA 1Y0LA 1O7SA 5F71A 1CIJA 3QPDA 5CH5A 1LPNA 3C08L 1QPPA 4HVTA 3MLWH 5I8OH 3QEQE 1XR8A 3DV4A 1Y18A 4A6YH 4U2ZA 3I75A 3X12A 4C56E 2UWEF 3PABB 3QH3B 4JKWA 3HYSA 1DVFC 1F3JB 5CINH 3MRPB 4PJHA 1JZ7A 2PVSA 2PSFA 4Y4KC 3HA0A 2JB5L 4L29A 1WVZA 3E4DA 2GJJA 3LEYL 3BIXA 4FQ1H 3JSSA 4I3GA 3F96A 1IGTA 3DV4B 4JDVA 3IJHB 5B8CB 2BY1A 1YDPB 1C7SA 2JE8A 2D9CA 1GGUA 2JGFA 2O5XL 5T5NF 3PL6A 4JHWH 4LVOC 1FLRL 2PBLA 3V1LA 2IEPA 2EDLA 2V5TA 1IGYA 4FQJH 4G8BA 2RQ8A 1RUQH 2XA8H 5EU4A 1U95A 4TQEL 3LRSB 3RTQA 2GCYB 1FJ1B 1S7QA 2DWDA 2MNUA 4R26H 2WBWB 4AEIL 4DGYH 1BFOA 4NIKB 1GIGL 3QIWB 3DSFH 5ISZB 1MWAA 3DMMA 1X5LA 1MF2H 3GMMB 2F53B 3WNLA 2OXHA 3D2CA 1DWQA 3QB7C 5F7WC 2VLME 1HXYA 5AM0A 5EU7E 3VGFA 1PDKA 1N2RB 3LIIA 1KCUL 4CW1A 3PFBA 5CSZB 5D1ZC 2VAJA 2OTUA 1CDBA 1LO5A 1UH3A 4UNTA 3H3BC 4F9LC 1LZKA 4KROC 2XG5A 4HS8L 2EDXA 1K5NB 1HWHB 4XNQB 3QXAB 4M43L 4WFGE 4X6CE 1NMBL 3VG9B 3GSWA 1MWAB 3DMMB 3O0RL 5FUCE 5I18L 1NCWL 1QBBA 4GRLA 1XCQB 2ECFA 5E24E 4J3UA 5FYLL 4N8SA 1KGCD 3JWNC 5IVHA 3EJZC 5EC2A 5EFIA 5DYOB 3O41A 5EZJB 1KF9B 1UXOA 1T7VA 2AV1A 5AOAA 5H35A 3MLRH 3UPAA 4JKPH 4O4YL 5ILTH 3L1OL 5FLKA 1YNTB 3MCKB 5C0RH 3RU8H 1NCAH 3TIEA 1IGIL 4JN1L 4BSVA 2OQJA 2VDKH 2QJWA 5GRWA 1XGPA 1YEKH 1SEQH 5E8DL 2QVBA 5AZEL 2XQIA 5HHMD 3QPQD 4ZUUA 4O9HL 4U1SA 4N0UE 4OQTH 3BDBA 4LSQH 4L4VA 1S5IH 4YZFE 1SCQA 3HEAA 1IZJA 1VGKA 4IRZL 4F37K 4OF8A 3LKPB 4Y2DA 3T3MF 2J8UB 3OKNB 1SFRA 5ALEA 3LN9A 4YHYB 1BEYL 2VZUA 4NSKB 3GJEB 4XMPL 5B38B 1JMYA 1BQLL 2VXUH 3RI5K 3QP3A 3VGAC 5F21B 4I77L 4K23H 1BQHB 1YASA 3I3BA 3G5ZB 2Z8VC 1MCLA 1L0XA 4PJ9B 1A6UH 3ALPA 3TO4B 1EX0A 3AUVA 5IVNA 5BV7B 1N6UA 4NSKA 1BZ9A 2FD6H 4LQFL 4H20H 5JNYA 1BS9A 3W2TA 4HT1H 4JQVC 5DD3H 3FFCD 3WS6A 3F7QA 3W9DA 1K63A 5DUPH 5J6HA 5DJDA 4UDUB 1GXEA 4L3EB 1C1EH 4FTVA 5ALBL 1LPMA 3WFEL 5IR1B 4QRTB 4K6KA 5INCB 3WK6A 3EIFA 2JKXA 1S3KL 1EXUB 2V7NA 4PJ8B 1TPXC 3VISA 1AXSA 3FT4B 5C0BD 2KZ1B 1FAIH 1S9XA 3C6LC 4Y8AA 5EBWB 1NL0L 4XP1L 4P9HH 3SDAD 2I07B 4JRYE 3N9GL 2VDNH 3QNZB 4U6YA 4LFHD 2Q86A 5A2LH 5GSVB 5HY9B 1XGQB 4P92A 5JOPD 2YN3A 5L8LB 1UZ6F 5C7XH 4RGMB 4OD2A 4XT1C 5GGTL 2ENYA 4F0JA 3O9WD 1XZIA 5L9DL 4OZGF 4POYA 4BVJA 5GZNC 3OURA 5KSAB 1MJUL 4FNLL 4YHOL 1U3HA 1CR6A 5IQ7L 4U6YB 3AC0A 3STYA 4JZJB 4ENED 3AIOA 2ZUWA 3ESAA 1WBZB 2I9TB 4YGAB 1PD6A 1WC7A 3GZKA 4XH2B 5HYJE 1XZKA 1HDMA 3MLRL 1SJHB 1CFQB 4BQ6A 1DT3A 4TUOA 1GHFH 3RY4A 5FYJE 1MLBB 5KZCD 3MLVL 2VLJD 4YHIB 4LEXH 3SO5A 1B2WL 1EGJA 2JCCA 1WFNA 1U93B 1XZMA 1WAAF 4OD1L 3IGAB 1W72B 1TETL 1FVEA 4PY8J 1TZGH 1FFDA 1P2CA 1XZ0B 3DXAB 4LMQI 1A7RL 5HVWA 2IG2L 5BW7A 5C0AA 5AIAA 5DF0A 1WAAE 4G9DB 3IRPX 1TJGH 5DC4B 1SVCP 4S11A 4FFYH 1N6QL 4NOBA 1I85A 4X9FA 2R0KL 4O02L 4YHIA 5AG9A 4EN3A 2FATL 1R9NA 1XZGA 3GSNL 4E42A 1TTUA 4MQMA 2B1HL 2OMBA 1J06A 4HS9A 1SJHA 3BO8A 1BVLB 1KCUH 4L1HA 4MYWB 2J4CA 1JJIA 4GMTL 1MEXL 4G4IA 4I18C 1EHLH 1MLBA 2H32A 1Q9WB 4QGTA 2VO5A 4U2CA 4Y4HC 1EA9C 5HHPA 5KVDL 1MVUB 5DJ6A 3DYVA 3FCTA 1H3XA 1NAKL 5E99L 4KTEH 3OAYH 4MB5A 1UG9A 5FYLE 3B6SA 4JO1L 5ITBL 2EH7L 1CD9B 1DU4A 1ZI8A 1DCLA 2LTQC 4FQIL 2AV1B 4MNQE 4PJCA 1WB4A 4PJ7A 4OLVH 1T20A 2H2PC 1G7HA 4K3DH 5GXBB 1MIEH 1BGXH 5JR1H 3WEXB 3FT4A 3P0VH 2WILA 4BDTA 1JTTA 3OJ2C 3MRBB 3U4EA 1Q8MA 4LLMB 1F4XH 1CGXA 1LPSA 2ZYRA 3R1GL 5ALRA 2QR0B 2IQ9H 4AZ3A 1A1NB 1P6AB 3L9RA 4ZXBB 4TOYL 1GGIL 2EDKA 4ONGH 1JJFA 2HG5A 2R2EA 1CICC 4LCUA 2CO6B 5I8OL 4JHAL 4X98A 1G7IA 1FN4A 5CEZL 4IRJA 2PR4H 3EYFA 3NCEB 1M71B 2X5PA 3MQIA 3QIWC 3D2UA 1ZWIA 4L3EE 1QTIA 4YGVB 4W81A 5DVKA 3WFHA 3GKWH 3L5XH 3LPWA 4L3AA 5I8CA 3L7FA 4OU4A 3HPLB 4PSCA 5ALWA 2QR0A 4LPCA 3KG5A 1ULVA 3D87B 1HK6A 4Y4HD 3QFJA 1FIEA 1KACB 1UJ3B 4U1KB 3WUWA 3MROB 4XPFL 3U6RA 2VE6A 3MPCA 3MRBA 3U4EB 3LKNB 3VWKD 1GPLA 2MQCA 3U1SH 1OCEA 3BZEA 2ZSWA 5JANA 2MJWA 4J0DA 5K3BA 3H42H 4ORGB 3WO3B 1IAOA 4YNYA 3MBED 1CG9A 1AGDB 4ESKA 3O4LD 4L3ED 2X4PA 1A9EA 3EFFB 4CNIB 5E8DH 4EI5B 4HXGA 3QUXB 4E41D 3FT3B 4KHXL 4OCRL 3MLUL 5E8NA 1ZXQA 2G5TA 2C26A 4FQ2L 1UCBL 3TT3H 4INZA 1YY9C 3K3QA 3WHXA 3DX6A 4HEPG 1QLEH 2ARJQ 3MJ7A 4NRYB 3ESDA 4U1NA 5KS9B 5I8PA 1H9VA 4XP6L 2GHWB 3L3IB 2ROQA 1RVFH 4E41E 5DK2A 3GELA 3VKFA 1Q9KA 4YHNA 1CUEA 3STWA 4L9DA 1HIMH 2DWEA 3E6HB 3QPQC 3X13A 3H2KA 5CEYA 5I1DB 1U8IB 1P84K 3I9GL 4B0MM 3DSFL 4Y2RA 1B4JL 1ITBB 1A3LL 5DYYA 5AWNH 3DURA 3JVGC 4LIQE 4ZDHA 2FBOJ 4P5TA 3ARZA 4GOSA 4MHHG 4G3YL 4J6RH 3TWCH 3CH1A 1DBML 3VWJD 1V7ML 1T4KB 2ATPA 2UVFA 1BCSA 2QTBA 1FGVH 1KCRL 4XNMB 2IBZX 4DQOL 1OAZL 3JV5A 4PJ9C 1M33A 3D6GA 1QZ1A 1JYVA 1U91A 3QI9D 2N7AA 4KK8C 4QRRA 3B3IB 2NW6A 2AXHA 5I1AB 1FYHB 2C3GA 5E2VL 3HE7D 4BAZA 1T83A 3KLSA 4V2IA 3PE6A 4ZV7A 3FRUA 1FNAA 1FNEB 5GGTH 5HF9A 3EDEA 5DURD 5HYJA 4X6UA 3KS0H 3MJ6A 5SX4H 1WT5C 4R7DB 4JM2D 1PKOA 5DS8A 4WUUB 4OT1H 2OG1A 1BIIA 3D3VB 3MRFA 4MNQD 2Q87A 4UTAH 1IEBB 3U7YL 4TUJB 2IPKA 3TP4A 4HZGA 3E8UH 2DS4A 3TBYB 4D0CB 2HRPH 3VI4E 4B80A 2FIRT 3MOBL 1ZOIA 5HK8A 5KWJA 2XZCH 1GC1L 4HJ0C 4OF3A 4ODWA 1XIWA 3RZCB 4C89A 1R5WA 4L8BB 4P4KB 4BZ1H 4PB9H 4NN7B 3DSNA 3RNKA 3BE1H 1S9WB 3D0KA 4PF1A 1OGTA 5GISL 4G8IA 5B21A 1IL1B 4ODXA 3H2JA 1AGFB 5KREA 1CDIA 4U6XB 3GSNA 1BREA 2XZQH 4PGCB 2J3QA 4AB1A 1E4KA 1TIBA 3L6FA 1JRHI 3R40A 1OGAD 5EU3B 5E4EB 1FG2A 3RWIA 3V1KA 4XXDA 2NY2C 2G60H 4M3JA 5IP4A 1GKKA 1O7VA 2DTML 2J8UF 5GJSH 1SQ2N 3O2DA 5EUOE 5F7YC 3KPOB 5TE7L 4WHYG 3RUGB 4OGYL 2J8UE 1AKJD 4DK6A 4QYOB 4KK6C 3IYLW 2QXUA 5CUSH 2CJUL 3KHQA 4GXNA 2GKIA 3EYFB 2B4CH 1EA5A 5IMMB 1RIVL 1AC5A 4M1GL 5ACMA 3JVGA 2GK0A 3A6BL 4KKCD 5LZ5A 4BH8A 4PJEE 2GTZB 3MCLL 1UFOA 3QUMA 4NWUH 1CDJA 1D5ZA 3X3FL 4PRAA 4LLWB 1IBGH 1XIWD 4EI6A 5IIEB 2NY1B 4HFWB 2M8XA 2PKYX 3Q6GH 5HGDA 3W2DL 1KJMA 5DLMH 1XZLA 2DI8A 4WGWB 4ZS7H 4KJQC 2XUGA 4LCWA 5C07B 4NO5A 1DZBA 3A6OA 1QTRA 4OI8A 1FPTH 4S2SA 1ZIXA 1YEDB 1OM3L 4NT6B 1DBBL 5BS0B 4OZGB 1JP5A 5A2JH 1NMBH 4OZFG 1I7RA 4BQ9A 2VLRA 2WINB 3NIFF 3MFFA 4O51B 1N64L 2NY0D 4U05A 4BYMA 3L3KB 2ZOLB 4YHOH 4LCWB 4ERSH 3T2NH 3WLBB 2G2RA 2CLZA 4A6YB 1TQBC 2JJTA 5ENWA 3B12A 1WICA 1YY8A 4OF5A 4U6HB 8FABB 2FX5A 4ZPTA 3LS4H 4PJIA 1KEZA 5E1HB 1KN2L 2LTQB 1WBYB 1R3IL 3WLWC 4H7DA 2J4FA 1GXSA 3PXJA 3OHXB 3IKCA 4X6YA 1JCKA 1PQZA 2X89D 2ADGB 3T1FA 2F53A 5A40E 1L0QA 1VENA 3IFPB 4CW1B 3BX7C 4I2XB 2EDQA 2QUAA 1U4NA 1U8KB 2BGRA 2FL5A 5KVEH 4MMZC 4EUPB 1ORVA 2HA4A 3O6LL 2VWEE 5JUEL 3TZVB 3QITA 3DUHA 2YRPA 4NFCA 5DO2C 1R3IH 5D1QC 3NCCB 2EDCA 1EAPB 2H1PH 4LPVA 1KELL 5JOEA 3C5SB 2I3DA 5F6IC 1ZVHA 3MACL 3C45A 4UBNA 4ZI5A 2HFKA 4RGNB 3F9CA 4HCRA 3B9AA 3IAGC 5AM4A 1DEEA 4R6UA 3QNYB 4M02A 4UT7H 4KMTH 1OLLA 5DMGC 4YHPA 5IG7A 4QDXA 1AGFA 1MAHA 3L5JA 2CDGB 2P49B 1IEAB 1KB5A 3QDGB 3B4NA 4N8DA 3VXUD 2XWJB 1HHKB 5C09E 5C8XA 5F8RC 4NO0B 4LXHA 3C2SA 3UYPA 3FB6A 2E6JA 4KRPC 5C2BH 1GAFH 1BEYH 1VPOL 4K2UH 3OB8A 2JIDA 3ARFB 3QUML 4Q74A 1M1SA 4Q34A 2DQYA 3PGFH 3H2IA 3VD3A 2CUHA 2C58A 3MCLH 4JZOA 4AL8L 2NXYD 4U2GA 4W70A 1U8OB 2Y06L 4Q9QH 1EIBA 4RZCB 1E8MA 3WZMA 3DUSB 5FOJA 2Z93B 3PWUA 4IIQB 2A77H 2Q8BH 4WWKA 4JY5L 2DQJH 5EOQH 1P5UA 4MVBC 2XRAL 4NZJA 4HK0B 2GJZA 3E6FA 4J0JA 1KLGA 4JQXC 2DM4A 2R1YA 4MQ7A 3D85A 5E03A 4H8WC 2H8PB 5IB2A 4X90A 1WFUA 4O5LL 1KLUB 4Q7DA 3MRKB 4KE7A 4H25B 1YMHA 1IEHA 3VFMA 3BQUB 3RFZC 3QQ9C 3RVUD 5C0EB 3TJHD 3N1MC 5KVGL 1KN4H 2VLMD 3F5WB 2KL6A 3D39E 3MLXL 5A62A 2HJFB 4LKCB 4BC0A 2DQUL 1H23A 1GGVA 2XWBA 3GSQB 3FLBA 1MI5D 4FWBA 2ZP0T 1NUFA 1NGXA 5DJAA 1RUKL 1ZT1B 3V52L 1LD9A 2OAGA 2WU3A 5SWZD 1QHPA 3WFBH 1YYLH 3CD4A 4RFOL 3QO1B 3CDCA 3LKRA 1TCBA 5IMKA 4QXGL 1QBLH 2DB8A 4RGNC 4MMXC 1MREL 5I74B 3S37H 2WUDA 4GBXD 3UBXI 1W8NA 5KG9A 3BESR 4U1JB 5HI5C 4DUXA 1RUML 5IF0A 4V1DB 2VIRA 4EI6B 3VFGH 5IIEA 3UUFA 5GRJL 5IKCA 1ZMYA 3GA7A 3ZE0F 1OPGH 2Q7NA 4ZS7L 1RUKH 3DX6B 4PJBA 3FZUD 5T3XH 5E8NB 1T89C 3L3OB 2QSTA 1B4JH 1VFBB 4BTVA 2Z4QB 3CFKB 2WHQA 5EPMB 1YEFL 3S35L 1RU9H 5DQJA 4DGVL 5JORA 3S8WA 3AROA 3PP3H 4WO4A 3ARWA 3BPLB 3RDTD 3E1GA 3RX5A 2H6PB 2WFLA 2O7VA 1MU0A 1JUFB 3HE6B 2DYPA 5DLML 4NQEA 4G8GE 2E7MA 2EDOA 2Z31C 4JFFB 5F7HA 1THTA 4G7VH 2AV7B 3WUWG 5DSCB 3HG1B 2XUFA 4PJGB 2IAMA 3LEXA 3PV6B 4PP2A 3H8NA 3JBG7 4KZEH 3VVMA 1J05A 2FB4H 4YHZL 5EC1B 2ORYA 5E2IA 1AJ7L 3UO1L 5E7FA 2AJYL 4IH4A 1T83C 4Y7MA 3ZKQD 3OB0K 5DMIH 2PX6A 4ZUTB 1DP0A 4AM0B 3DCNA 5HXMA 3OKLA 1QOZA 3TRDA 2VXSL 4NP4H 1EEQA 5SX5K 4C6HA 2X4UA 1UXWB 2ENSA 3G6JA 1OSZA 4JO2H 3QPXH 5K9OB 1JN6B 1QFMA 2EDEA 2DLEA 2JJWA 4MX7A 1DJSA 2PW2A 3QUZA 4DEPB 3QSKB 1NUNB 3H9SA 5CMAB 3RY6A 4ZWNA 2HKFH 3QMWA 4NQXB 3GBLA 5E4JA 1QZ3A 3HMXL 1D6VH 3W9EB 3E8UL 3PGCB 3BN9C 3ZTNH 1K6QH 5BV7L 3KXFD 1QA9B 1X4YA 2V17L 1I1AD 3ILQD 2XUQA 4M7JH 3EYSL 1S7VB 4NYLB 2YXPX 5C7XL 1YN6A 1HSAB 2AEIT 1OW0C 5GGVL 1FNSH 3LQAL 4PLKC 4FLEA 1EDEA 4KV5E 4YXKH 4Q0XL 2RIPA 3DXAD 3ARGA 1LNUA 3QO0A 5CJOL 1IM3B 3GI9H 4QRUB 2DLHA 1ZJ5A 1MSPA 3VXNA 4POZC 1CE1H 4AN1A 3ULSB 1NSNL 5F9WC 3LN4A 1A8SA 2HU7A 2NY7H 1JK8A 3UPCA 3O8XA 5KSBA 2M1KA 5E08H 1SY6A 7FABH 1RK0A 4X9GA 4F58H 4J0IA 1K3IA 4UOJA 4YE4H 2YH2A 4UHEA 1U3HC 4Z7UF 3K0WA 2HG5B 2R2EB 1ZIYA 1ZS8A 4EQ3A 5EOTB 3OPZL 1N7MH 5I1JL 2PU5A 4HW6A 3H9SD 4YHNB 1D5BA 3BN3B 5D7IA 2WWKO 3MRCA 4MAYB 4Y88A 1S7RB 5EZLB 4BP9A 1EFXB 3U30C 3SO3B 3WO4C 4JN2B 1N5YH 3SCMD 2L0DA 1QG3A 4ZQKA 3T8XA 2XQYG 4J3SA 4QHKJ 5FCUH 3ULVD 1ZAGA 2JCCF 1JNNH 1LE9B 1W72L 1KSRA 2CKBA 3WI7A 4FKBA 1GPKA 2K2QB 4GHWA 1H8SA 1WZ1H 2J8OA 2XWBB 5BO1H 1Z68A 5CD5C 5JPNA 2DQHL 1EFXA 1IE5A 4P23D 1UVQA 3RUGE 1QYGH 2PN5A 4X5WA 3F8UB 4TULH 4B50A 5J9PB 1QO9A 4B81A 2Y4SA 5AYUH 1MFAL 5LCVL 3BMVA 5CD5D 4W6WB 1NLDL 4NBZB 2GSIB 4Y4FA 5C3TA 3HB3C 3MV8D 2C3HA 2KDGA 4R0LC 4AEFA 1H2YA 4HZAA 1EFQA 3ZE2F 3ZL4H 4KRYA 3QA3A 1TIUA 1KB9J 4IOSD 4FXKA 3TVMA 1YEFH 5DNWA 1CBVL 4ISVA 2J88L 4CIBA 3P4NB 4KHXH 3RKDC 4ZO9A 2XE4A 1QFOA 5FM5M 4MQLA 4HUUA 3IXTB 1ZANL 4QZVA 1FC2D 4GKNA 3QI9B 4HSQA 3ZT7A 1UWCA 2PETA 3T4AA 1WLHA 3TC9A 5KSUB 1F4HA 4CVUA 4ZFGL 1KULA 3KOOA 2PTUA 4G9FB 4ODUA 5MENB 4NZTH 4PD4K 5TF1H 3MVEA 5HVHB 4AZ8A 1SJEB 3INUH 4XMLL 1UQSA 3BIBX 1ACYH 4OFKA 1S7WB 4GSDL 2GYSA 5DZLA 1DINA 2R69L 2P8MA 1FSKC 4G6KH 1XRRA 1C12B 2IC2A 3BDYL 4NQTA 2Y2VA 1U9KA 5K3FB 3QRFM 3G0CA 1MHEB 2W9DH 4ETQA 4ZFGH 4OGAD 2F58L 4POZD 2BUAA 3FO0H 5AH0A 4ZUSB 4UAOC 4XBPA 5IROA 5CFHA 3EGSB 3EQ9A 2EDDA 4ZFOL 2GIYA 3C87A 3DHJA 1JFRA 4B83A 2DQIH 4OBSA 4X00A 3RKDD 3QIUB 5CGMA 1INDL 1AXIB 4XP5L 4EN3D 2B0SH 4XCCL 4LXGA 5DRZA 4TN9A 3TJEH 5IFJA 2F53E 1NMAH 5B3JF 1MCEA 1ZHBB 1JIBA 4NWTH 3TJMA 4YH6A 5K93A 1RJLA 4KK5C 3K4ZA 4FG6D 2LVCA 4I48A 1EGJL 3T0EB 4PJIE 4P23C 4UTBH 4NQDD 5ANMB 4YPVA 1GQRA 2IADB 5D2LA 5F7MC 3QCTH 4OFDA 3CX5K 1BCRA 4MYDA 2P24A 3FOLB 5HYJD 4I4WA 3F12B 3UPRB 4H8WH 4Y4HB 3EDDA 1ZHBA 2DI7A 4G7VL 3GSXA 5DD1L 2ORBH 4X6CB 3ULUD 1WZKA 1VFAA 3I6LE 1BBJB 1YPZB 3MREB 1N8ZA 4EHBA 3FNBA 1GZPA 1AQDA 1XGYH 3FN0H 4NKIH 1JGEB 4X4ZA 5F1NB 2CMRL 1TCRB 4EIGB 3R41A 5LKAA 5FYKL 4AEHL 1SYSB 2WTNA 3DUUA 3U36B 4PO3X 5AHXA 5GGUB 4OZHA 3HZMA 4PRHA 4LOUD 4TSAL 5MEPA 4PUBL 1R1DA 3BIWA 4AQOA 4X8JB 2VJDA 3M17A 3Q5OA 1CVLA 4M7ZC 4YJZL 1C7IA 4OB8A 2Q86B 2GK0B 1NBVH 3DI3B 2YPKB 4LEXL 2SEBA 3ROLB 3RRQA 4WHCA 4XWGL 4J0GA 1IUOA 1EB9A 4OUKX 4PTUB 1GGBL 2JF1A 1Z3GH 1CUWA 5ALGA 4KK5D 2CLVA 4MS8D 4DZBA 1S7RA 5T3ZH 1R3JB 3NH7H 3S6CA 5ALLA 1RUPL 3P30L 3FZUC 4K7PL 2A73B 3BKMH 2XLCA 3BDVA 4Y2UA 2XKSA 1AKJA 4ZXFA 2DLGA 5J12C 2GSGA 5L6YL 4LSPL 2ADJA 5LQBH 2DDQL 4N8CL 4OJFH 3I2HA 3BP6A 1U8EA 4M6NH 4PJHF 1CS6A 3FHAA 2Y1KA 4MNGA 3RVWC 4HS6A 1QSFD 2BHYA 3TVMC 4MDJB 1D5MA 3ILQC 4JG0H 1H2ZA 4KDTA 4HT1L 3TJEL 3BN9D 4GW4B 2RCSH 4Z7QF 4CMHC 4EA6A 3A6CL 1XRLA 1XH3A 4NM4H 2VT7A 4HWZB 3O2WH 4YE4L 4RGMC 1S3KH 1JF6A 3VXUE 3OKOA 1RUAL 2NXZD 3SDXE 1E89A 4HJGB 4L4TD 5BW7C 1KLGB 1K4DA 4M7KL 1NBQA 3GMLB 2XFXB 5C9JB 2AABL 5F9JA 2PXYD 1K4CB 1BIIB 5IHBA 1QR4A 3LKSB 4PJGE 3KLAB 5SWQA 1CEXA 3LMJH 2P5EB 1U3YA 2BJML 2AW2A 1JGLL 4M8QA 2PUJA 2A1WH 1A6UL 5HI3D 5E8OA 2R0WL 2ATKA 2EC9U 4Q82A 4QDTA 1X5YA 1G9MH 3X3GL 4M62H 2R0ZL 3GMLA 4GMTH 4ELMB 4XWOC 1OTUC 5BJTA 1X9QA 1FZJB 3L3GA 4HKZB 4CBPA 4M7JL 5CZXD 4HMCA 4ZUSA 2P7TB 3DETC 3O2VL 4H1LA 3JTTA 3FSGD 1J1PL 2OR7A 3BEVA 3R4DA 2J88H 3ETBF 3LAFA 5KSAC 1JU4A 3W9DB 4ELMF 2XMCA 5CZVL 3FONA 3DVIA 1FO0H 4O58H 3RIAK 3N1PC 4IO0A 4IOFC 4KQ3L 4WI2A 5CIPB 5C0DB 1NU8A 4OGXL 1OF2A 2Y36L 5EIIB 3PF8A 4JKPL 4O4YH 3VXQB 1BF2A 2BNUB 1A7OH 2R4RH 3MV11 4MQXD 4OZFB 3VFPA 1UH2A 3BZ4B 4RA3A 4Z7OF 1OVZA 4C88A 4R0LB 4IEFB 1CL7L 1DFBH 1NGZB 4BZ1L 3GKZA 1YMMA 3AB0B 4TNWF 3HAEG 4QRUA 1XF3A 2QT9A 5C0IA 3QMMA 4Y19A 1YEIH 1CQZA 4YHZH 3UDWC 4IRSA 3SCMC 2E7HA 1R3JA 1J1OL 3JV6A 4XNUL 4X6EB 4YBLB 4APQA 4EIZC 3TPUA 3PL6C 1OF2B 4PJIB 2XQJA 4F8QA 5D1QD 2NY3B 3U7YH 3CK0L 4J7AA 3ARVA 1UEMA 4HEME 4Y2PA 1MWAL 3KPNB 2A83A 2VUYA 2XWTA 3UC0H 4NKOB 1UACL 3NOIA 3TIEB 5JQ6L 4QHNB 4U7SA 2K9UA 2OR9L 1C08A 1UM4L 2BNRA 1A7PL 3NCBB 5DD5L 2QSVA 2RJMA 1F8TL 4WHTA 5F88A 4KDVA 5GS0D 4XXCA 3C6SA 2D31A 4A23A 2XKUA 4M8VA 3AZOA 2F5AL 3C70A 4I0KA 2YKLH 4NO5B 5DJ0B 5FYJH 4F8TA 5FUOL 1JZ3A 1EEYB 2VXQL 3ET9F 4XJVA 3WFDH 1A6TA 2WAHA 4LBEB 4XAWL 3RZWA 4Y5XB 1QBLL 3SJVB 4KRMB 4LLWA 3C6SB 4OKDA 5A16B 4QXTA 3W9BA 3MR9A 3MRJB 1YEIL 4PRIA 1C7TA 5ECJE 3QVMA 2XLBA 2I3ZA 3THML 2R9HD 4MVBD 1UKQA 5EOCH 3RJQB 1LO0L 3QUYA 4BSWB 3X3FH 5JD4A 5HYSG 4PLKD 4X0KB 2FD6L 4F33B 2VZ3A 2BHUA 3CFJA 4P2OD 5I9IA 4R90H 2F74A 1DUYB 5HHOD 2XUHA 3O2DL 2WZPD 4X7SH 5D72H 3IBTA 3K1KC 4RFOH 1G9NL 2NXYC 4D0DA 3BAEL 1UA6L 3QXVA 3VFTB 3OM8A 1JUFA 3ELAT 4OLUH 5INDB 4K9EC 1SCKA 4HBCH 3M1BB 1CXLA 1HYSD 4JHBA 1RURH 1PZ5B 5DGQA 4YFLI 2IGFH 2HVJA 4W1SA 1CFSA 4JE4B 3S4SB 3RVXD 2HA7A 1XR9A 1FFOB 2BXZA 1TZIA 1YEKL 3UBXA 3DRTB 1HH9B 4HQQL 3SN6N 3M8OH 2PSHA 4I19A 3MV01 4G8GA 4R4ND 3QO0B 3A2MA 1DANT 2F53D 2H32B 4PRID 1I1YA 4HIEA 5TGBA 1FYTA 3P9LA 3ARBC 1JBJA 4KUCF 4RGOL 5JXEA