3C8DA

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-glycine
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
392
structure length
378
Chain Sequence
VGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
molecule keywords Enterochelin esterase
total genus 116
structure length 378
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c8dA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c8dA02
4CRPA 4OJFL 4RWYH 5DJYA 1OT2A 4G3YL 1UWXH 4MAYA 4QYOA 5EO0B 4E11A 2L7UA 1B2WL 2ZYIA 3STZA 4Z7NF 4NRYB 1H0DA 3ZLQC 4HS6B 3WKEA 3DUUA 4ZUVA 3WKMH 1HHJA 1A4JA 1SMAA 5BWCA 1AXTH 4N8VG 1U65A 3B8SA 4QTHA 4Q1VA 4X6YA 1CF8L 1I9RL 4NNPL 3PP4H 1H5BB 1UYWH 2OQJA 5I8EA 2XQBL 2CLRA 3MLWL 3HS0A 3ZYZA 3L6FB 3SDCD 2GTWA 1CLZL 2ZG3A 4BUGA 1ZGLM 4JQVC 4YHPA 1JPSL 5HDBE 4M3KB 5LZ8A 2OR7A 2F8OA 4XBPB 5E4YA 4FHBD 4O2EA 2F53B 5E1HB 5FYLE 2O5ZH 1AQLA 4J3JA 4QDZA 3VVLA 1BQUA 4XNUH 5JOFB 2BHUA 3WDHA 4IDJH 2C1OA 5DJXB 1OAKH 1V7NL 2ARJB 3PWNA 2OJEB 1EUTA 4BRZA 3O9MA 4ENED 2ENSA 5C0DB 5JW4R 5KWIA 2V7NB 5DZOA 4JO3H 5TH2A 4AO8A 4X6DF 1T5WB 3KPOA 4J7AA 4LXGA 5AKEA 5K3BA 4X4XB 3W9BA 3HNVH 2ENYA 3T0EB 4U1JA 2DKSA 5ESQB 1CDIA 4TSCL 3PQYB 4OCSL 2W0LA 3PNWB 3IF1A 3O2DA 3QULA 3WI7A 4ZAKC 3K4ZA 3DWTA 1T3FA 3NCYS 2WBJC 4ZPTB 1QBMH 1A0QH 1RZKH 5TDOB 2YWYA 1JI2A 2HRPH 1T2JA 4PGDB 3RWHB 1X2BA 4HX1B 1OAQH 1JPST 3S36X 1NCUA 1BX2A 4WO4C 4LXHA 1S7UB 3QI9D 3OB0H 1ZT1A 1GVIA 2C5DC 5FO9B 4HS3B 3WFHB 1NQBA 1R0AH 3Q3GB 2VJCA 1GZPA 2DD8H 5I2IB 4AY0A 2P5ED 2P46B 3K74B 5AKGA 3AXLA 1EJ6A 4KI1A 2RCSH 3Q0HA 5FYKH 3VW3H 4C6HA 5FO9A 1NDGA 2CJUL 3ZSTA 3K7UA 4GS7B 5C0RL 3U7YH 4NN5B 3GIVA 3TCXA 1E5TA 1C16A 4WCYH 3SQBA 4WTXA 5CJXA 5BV7A 4MJ4A 4Y5VA 5BZWA 3GROA 3NZ8B 5F93C 1WF5A 4UHFA 4NQSA 4DN4H 1EXUB 5HI5D 2WFZA 2BNRA 3QWRD 4FQLH 2CH8A 1AGFB 1U8IA 5DNWA 1CLCA 4B81A 1ZSDB 3AFIA 3IGAB 1U3HD 4YHKL 2Y1VA 1A4JB 3PHQB 2BHZA 4RZCA 3CPLA 4X4XA 3MRQA 1KIPA 3CU7A 1A3QA 2XTJD 1YAHA 4UB0L 4BP9A 4UFPA 4Q3OA 4YZFE 1A6ZB 3WUZA 2ARJA 1QFSA 5L2KE 1KT2B 3H6JA 3N50A 1T7WA 4F7TB 4LRNH 3RBGA 4P2OD 3GMNB 2VDRH 3GMQB 4EVNA 3FSGD 2E6QA 5I8PA 5T1LA 5CD3A 2VDQH 1ZTXH 3I2HA 2ARJQ 3RJDA 3ZDZE 4YNYA 4JLRA 1ZV5A 2W0PA 5IFHH 5A7GA 2H32A 2K7QA 2FH6A 2BFVH 4HUUA 3LMJL 1NC2A 2C26A 3L3KB 1CDGA 2GTWB 1RUAH 3QG6A 1M7XA 4UBDD 3LN4A 4JANA 5HHMB 4Y4KA 2AXFB 4K7FA 3RPIB 3R3YA 1Y18B 4W4OA 5LGHH 1R5VB 1A22B 4PJIB 4F2MA 1GKKA 4JKPL 4FABH 4Z6AT 4J03A 3QDGB 4I77H 1E4KA 5BQ7A 1S9XB 4PG9A 4PREA 5DRXB 1ZD3A 4TRPH 5FRDA 3I6ZA 3W11D 1GCFA 4YHYB 1RHFA 1RFDL 4DEPC 3QI9B 4U1SA 2FB4L 3STZB 4DKFL 3QO0B 1L6XA 2CLVA 4N1CA 1GHFH 3S37H 4PLJD 1J0IA 3M17A 4DGQA 2ZCKL 1VB9A 4HUXA 5JZSA 4RFOH 4P3WA 1CK0H 3BJMA 1I3GH 1KJ3H 3P30L 4MQ7B 3S34L 1PAMA 3RWGA 5IEKB 3JTSB 3BGFC 4OZHF 2YPKB 2G2RA 1JU4A 1U2EA 1IQWL 1FQ9C 2CRMA 2K1MA 4OCRL 2VDPH 4WFJA 4AH2B 4P46A 1XGPB 4HSQA 4LSQL 4DSAA 1YA8A 4ODXB 3IDJA 4EIZC 2X4PB 5F3BA 4D9QE 2C0PA 2FJPA 3BI9X 3RGVC 1U8NB 5DMIL 5KANI 4WO4B 3O0DA 5EIEA 4OCWL 1OAXL 4UV7H 4XNXL 5C8ZA 4HLZG 2I3DA 2R1WB 4RIRA 1TVBB 1F3JB 3HAEB 5FOBB 5CT5A 1U6AL 3VGGA 4DKDC 4KKBD 4OF6A 5EPMA 3CK0L 1HYSD 4XPTL 3W0WB 5GGTH 3LSOA 3SC2A 2YPVH 3EYVA 1Q9OB 4OLUH 3FQNA 2KH2B 1L0QA 3BWXA 3H2JA 3RK4A 5HYSG 3O9WD 3QPXL 4XP9H 2JJWA 5IFHL 1RIHL 1X5HA 4PRIE 4X6BB 3I6MA 1KIQA 4NQTA 4J12A 4PJBF 2OQVA 4YDLB 5C6PB 4JDTL 3PHSA 3PWPD 5D7SL 2EDOA 1ACYL 1TQBB 2E7CA 3LB6C 1CBVH 4N0CD 2DMCA 5CSGA 1P4LB 1T1ZB 4M62H 5F44A 1RURH 3D2UD 4JHAL 1DBJL 2AV7B 1LK3H 2R4RL 2D0HA 4XH2A 1BE0A 2C9AA 1GPNA 1CICC 4M8QB 1UVQB 1YN6A 5CBAA 4BCDA 4JQXC 4FZEH 4BM7A 2Q6WB 3R06A 2W0FB 3V7AG 2IMMA 5D7JC 4QRSB 3VWKB 2XICA 1NFDF 4ZUSB 3MUY1 4JE4B 3VKFA 3QJHB 4OZHE 1QBAA 5CEZL 1VFMA 4ONOA 1BS9A 4KI5F 4HKXB 2AJYL 1RQ5A 1YUHA 2B0SH 5IEHA 1GAFH 3DNKA 1B0WA 1EPFA 3QFDA 3VFNB 2QJRA 2FGWL 3B43A 3U7WL 3SBWA 4O9HL 5IR1A 1AD9B 5ACZA 3LPGA 4PJEA 5I1HH 3T1WA 1GGBH 2HKHH 2Q8BL 2XTLA 3DSFH 1A3LH 4NNPH 1IVYA 5IBTL 1VFUA 1J1XH 5GIRA 1MNQA 1D6VH 3R0MA 5DVLA 2JF1A 1YEEH 4HXAL 3RAJH 4ELKB 5ADOH 2YD4A 2AK4E 3BQUC 5JALA 1OGTB 2UZYB 3LHPL 1YJDH 2QR0B 4PJDE 3OKKB 1QR1A 2JK5A 1JWMA 2A77H 2NR6D 3RL2B 2WAHA 5F7EL 2OL3H 1K4CA 1X5YA 2Z92B 1N2RA 4PJEB 2K2QB 2J12B 5DQJB 5HYSA 1D5MB 4OCNC 3E1GA 4N9GB 5JPNB 1ZHNA 1MNUL 4PRHD 4W1RA 3JYHA 3JWDL 2FHCA 1FE8H 3AREB 4NJAH 4PJBE 2Y06L 5GJTH 3VH8G 1ETZB 2BNRD 5JNYB 4XHJC 5C3TA 4MNHB 1J8HA 3CVHL 1YZZA 4HGWB 5C9JB 4QE3A 2F5BH 3CZFB 3PF2A 1A8SA 4HAFA 3FN0L 2ZZUT 5ID0A 3BKYH 5AI4A 2ERJC 1KTDA 3I02B 2PU7A 4NM8L 4DN3H 2J6EL 3SDYH 1A4KA 2OXEA 1NDMA 2HLFC 3UMJA 1T2QL 4PRIB 1CT8A 2NY4B 1HXYA 4LEOA 4OQTL 3H7LA 1P4LA 2BVTA 2AJUL 2EKJA 5IM7A 3EIFA 3D6GA 2EKSA 1AGBA 5EIIA 1TCRB 2VIRB 4HMEA 5IP4A 3VI3E 3QUYB 2X1OA 1AE6H 4K3EL 1JKMA 1KULA 1UH4A 3BPLC 1FNGA 3QH4A 5KOVC 1ADQH 1DL7H 1OAUH 3DROA 1Z9OA 2VL5B 4NWUL 4POZD 1RD6A 1EK1A 4L5FL 1K8DB 4X0KA 2ADJA 3TFKD 3TPUB 4PW0A 3IVKA 2AEPH 3TBSB 1IZJA 3MOAH 1XRNA 2IITA 3CLEH 3VFNA 4YHNB 1F97A 1JNJA 1FO0H 2FEDD 4KROB 4KY1L 2A0LD 1MCBA 5DYYA 3HNTL 3SK0A 4M03A 2DTSA 2HKHL 2XLBA 5BW7A 3IETA 3WFZA 2CJPA 3FT2A 3GSNL 4RQQA 4WW2F 2P44B 2CO7B 3UTQA 4OLEA 5IFAL 3V4PH 4ROTA 4L1DA 3C60A 5CCKH 5AOBA 25C8H 3QUZA 4MJ5B 4U1GB 2IPUK 2V2XA 5K9QG 2A9NH 4YDJA 5FCUH 5CH5A 2W9DL 3E8UH 5I75C 1MAMH 3RTQB 4RX4A 2I60L 2AV7A 4UBKA 3WXVL 1NUDA 5C0FA 3VFSB 4B80A 4KHTL 2O2GA 2FDBP 4GRWB 1TZGH 2AVGA 4OFYD 1U3HC 4NSKA 5MERA 5ALYA 3WYRA 1DWPA 4OF3A 2CEKA 3G9TA 4EB0A 4GKZB 4HS8L 1NJ9B 1EEZA 5TFSH 3O6FD 3HI5H 3VFVA 1G7HB 4P5MB 5EO9A 4LSSH 2WZPD 5DWUH 1WZ1H 4D0BA 2P5EA 4QRPA 1FAKT 1ZD5A 2Q86A 2E8YA 1JFQH 5DC4B 9CGTA 1GPOH 4RFEB 3D39D 4MS8D 2BFVL 3W06A 1YMMD 1QO9A 4OUUB 1I7RA 5AKKA 3FQWB 3V9AA 1RIVH 3OKOB 1CFNB 2LE9A 3HN3A 3LPWA 5ALVA 4CU7A 3WFDH 2EXWD 4QOKD 2GJ6B 2FHFA 1MFBH 3VXRA 5JHDE 4RGOL 5J13C 1TCMA 3U9UA 4JG1H 4H7HA 3ULUH 3W9DB 4OLZL 4OGYH 3L3IA 2FIRT 3QZWA 2DRUA 4MD5A 4E0RA 3UO1H 1U3HA 1CXHA 2NMSA 1Y18A 4PJ9C 4AMKL 3IDGA 5C0ND 4FQCH 1U58B 1AGYA 3ARSA 4OD1L 4OKVB 3RGVA 3E6FB 2A6DA 2JF0A 3RWFB 4CKVX 3L5IA 4B7IA 4PGBA 2J8HA 1ADQL 4HWZB 5DYOB 3HTLX 4IH4A 4TUJB 5GS0H 3LQMA 1OILA 1LVEA 1ZA3B 4NUJA 1MCLA 4ZO9A 5GS1B 1A14L 1NGWB 2ZKHL 4FN0A 4CFSA 3BJRA 4Z0BL 3BD4A 4NCDA 3W82A 3DUSB 1JGVH 4XVJH 1QO3A 3RVTD 3S36L 1FL5A 3MRIA 4XXDB 2B20A 3LS5H 1J18A 5ICXB 4EKXA 4F9PA 1OWWA 1Z6JT 4Y5XB 4BCBA 4QRRA 4M4PA 3YASA 4U0RB 5A6VA 4X7TB 2ZCHL 5LZ7A 4ORZC 4WEBH 5D7LE 3O4LB 4ZOEA 5T5NG 2R0ZL 3MLTB 3QEGH 4Z77B 5J8OA 5LWYL 1M4KA 3R0NA 3T1FB 1G6RB 1IKNA 5JW3H 3WA6A 3WIIL 5BV7B 5EIVA 4HIEB 4KVCH 5E00B 3OPMA 4JR9H 4QHMB 2YC1B 4CVWA 1VA4A 2D5LA 2DMBA 5EULV 1HI6B 1BLNA 3L3KA 3QG6B 1HPLA 5D1QD 3LEYL 3JBG7 4Y7DA 3ECBB 4ODHH 1YMMB 1MFCH 5MEQB 5INDA 4U2YA 2HDWA 5I6XB 3VXMB 1R5IB 2HYMA 3ARYA 1XKLA 5CBKA 2GUOA 3EZ8A 3FTGB 4EY4A 1JZ7A 3RUGF 1HNFA 1A6TB 1TCBA 4WNQB 2DM2A 5M94B 1U4NA 2KL6A 5C0CB 3WS3B 5I9IA 4X91A 3DNMA 2QRUA 4JY6A 1BLNB 3QISA 3B8YA 1QLFA 5MEPA 4P5KB 1IGFL 1CGYA 4PP1C 4A2LA 3DX7A 5TDOA 1CTNA 3DX8B 4WU7A 5E8EA 5FF6B 3GM0A 3HZYA 4E5XA 4JFFB 5L2KA 4KK5C 5TGBA 1IAMA 3L7EA 2VDKL 4TUOA 35C8L 1JJFA 5C8XA 5HHVH 2A9ML 2Y72A 4LYDA 3PP3K 4GRLA 1OCWL 2ADGB 3C6LA 3L5XL 3PP4L 3RIAK 2VZOA 5L2KB 1MWAA 3TV3L 4OB7A 1KTRL 2AJ3B 5BJTA 1XR9B 5E94B 2J8UB 4JFYB 2X40A 3D39A 3ESCA 2BVQB 3B5EA 2C1OB 3GSRB 2DLEA 5C07B 1M71A 4Y2TA 3NOXA 1N3NB 1BJMA 5BOZG 1PG7L 5KVGL 2WU3A 5D2NC 1N6VA 2I9TB 4X6EB 2WBWB 4BRSA 3LKPB 5D3ZA 2NZIA 5I30H 2I78A 4FXKA 4ZXBD 4Z7WB 1MN6A 1CQZA 5ESAB 4G8GA 3WNKA 1A6AA 2OAGA 3JWOL 1NBYA 1D5IL 4MJ6B 4X4ME 1BFVL 4OLYL 2YUVA 3SO5A 1G6RA 3ZDXF 2NR6C 2I5YH 5IK3B 5T33L 4CW1B 2V98A 1AKNA 5DJ8B 1S8OA 1KJVA 2NXZC 5JXAH 3BDBA 3SBWC 1BZ7B 1PQZB 3R1GH 4PJXB 2I26N 3LZFL 5FYLH 1KENH 4M5YL 3LQAC 1WIUA 4RAUB 1EVEA 1PFQA 3F7PC 5KREA 3UAJC 3SDAD 2JGLA 4PTTA 4EHBA 3V5DB 1T22B 2R0KH 5C0JA 2LAGB 4G8FA 1WEJH 3ULSB 1IGMH 4Z95H 4HC1L 1CQWA 1RZJC 4TYUA 1JGDB 5F7UA 1NFIA 1VENA 3C2AH 4QNNA 4LBEB 2X42A 4M7LL 3FHAA 3I28A 1N7MH 4AM0B 5SWZA 4PRDA 3W9EA 4PJFB 1KJ2H 4G4IA 4LNRA 1KPRB 3RWEB 3BZEA 4Z5RA 3WA7A 4LLUB 2EDQA 4DW2H 2LFGA 5MI0B 3R40A 4DM7A 3MXWL 2WIGA 1ODAA 3L6FA 2R2EB 1RK1B 1XGTA 1UEYA 3RA7H 2AJCA 1GPLA 2RHTA 4E0RB 4JN1L 4JVWA 4MCZB 3NGBC 2R0WH 3L3IB 3QZWB 5J11B 1FLTX 5FM5M 1MJJA 1F45A 1BJ1H 3H1AA 4ODWA 2XUFA 1KC5H 2DWDB 3DEAA 5J9PB 4NP4L 1Q0YL 4AL8L 3DCNA 4PJ7B 1AXIB 4FMKA 3TCLB 3QHFL 4LPTA 5HHMD 4S1SH 2Z9TA 2AJVH 2A1WH 1NMBH 1HSBA 3W2TA 2EYSB 3WFCL 4NQXB 3BX7C 1JK8B 4ZQKA 5HHPB 2WG2A 2FGZA 3OF6A 1AC6A 4B0OA 5HQ3A 4GRMB 1QKZH 1CGSL 1VERA 4FQQB 1CFJA 4Y19B 1HE7A 5AM0A 1D5ZB 1JTPA 2ZNXA 2VQ1B 4L4VD 5I1KH 5BS0A 2W6CX 1P7QD 3NCJL 1Q1JH 3OSKA 1Q9WB 1YPZF 2DQHH 2IJ0C 2QHLA 4Z78B 3DGGA 1HYRC 5J3HC 4GECA 3LMJH 1R88A 1ZVSB 4FQXC 3V7AE 3CSYA 3O6LH 2FLBT 1FDLL 1THTA 1XZHA 2MMXA 3TBYB 3QIWC 5BOPA 2ZNWA 1JN6B 5GJSL 4W68A 1X4XA 1GGCH 1MCNA 4M1DL 2I3ZA 5DEFA 4UHDA 1Q83A 4HAIA 1EEYB 1QRNA 1WZ1L 1XIWD 3WKNA 2M8XA 3S88H 3FT2B 4R7NB 3EJYD 1YEJH 2Z0BA 4ZODA 5H8DA 4C58B 1JFQL 2OQIA 1F8TH 4PJDB 3SX4A 3GKWH 4PLOB 1S3KL 5GQBA 5MENA 1HDEA 1FIGL 4JFEA 5C0BA 3O4OC 3QUYD 3V1LA 2VXUH 5BRZE 5JPNA 3ZWQA 5SX4I 4F9LC 5CTAA 4UDTB 5K9JH 4JM2B 2FWOB 3DVNB 5D72L 2XWTB 4L3EE 4YXLH 4FG6C 5LZ4A 3MRGA 2R39A 3QP3A 4K55A 4FXGA 4OCYH 1NGPH 1ZTXL 2Q1EA 3B9DA 3OKKA 2F19L 3DV4B 1P6FA 4M9OA 3K3QA 1OWRM 2EXYD 1J06A 3MX0A 3I6GB 2JCCA 4H7IA 1AQDA 5HK9A 3PL6D 1JPTL 3TP4A 3G6JA 4IOIB 1JIBA 1FO0A 5IG7B 1NX9A 5A2JH 1MAAA 5H3HA 4KRPC 5F8QC 3UBXB 5I1EL 4KZEL 3T4YB 3IDNB 2VDNL 4J3UA 1OF2B 2VLJA 4L8BA 4HK0B 4RMWA 2AABH 3RM3A 3GI8L 4YHOL 2W38A 1U3ZA 3QUYC 2PW1A 4HBCL 4U1IA 1H8OA 1GIGH 1VPOH 5EIHA 4LARH 4X99B 1LLFA 2IIVA 2QZPA 1L7RA 4Z7VB 2F53D 5DGRA 1SYVB 4QCIB 4X4MA 4U6XA 4XPFL 3WWDA 1JGEA 1AD0B 1OARH 1F13A 4G8GE 1CK0L 1AR2A 4GAJL 4DZ8B 5EOTB 1T04B 4ETQB 3OKDB 4KKCD 3R06B 4WEBL 1QTYT 3GHBL 5ELIA 2PKYX 3DJYA 3V4VH 5ESRA 1CVLA 1EHNA 3SE3C 5LWYH 3TNMA 1QD0A 5EU7C 1XFDA 1ZT7B 1FCCA 4Y2PA 3L3OA 4Z7UB 1OTTD 1P7KB 1FNSH 4I48B 4KI5C 2PM8A 5D1QC 2JCCB 4AQOA 5LCVL 4Y2DC 5DT1L 2EH8H 5F1KC 2BY2A 3WJ2A 3PGFH 4HK3J 3BP6A 1IC7H 4NQCE 5HHOA 3PUCA 1ZGLA 4ZUUA 5AHXA 4I1NB 4MJIB 2C3VA 1MCCA 2CUIA 4YFDB 3P4MB 3LD8B 3SE8L 3NABL 4GAGL 5D8JL 1ZGCA 3SDCA 4RISH 1KSRA 1J0ZA 5DJ2B 3QZUA 1P4IH 4CL7A 4B83A 4OD2B 3VD9A 3BZDA 5D96C 5MENB 1XCTA 2GYVA 1RJZB 3AUVA 4JFFD 3MLPA 1ONQB 3BUYA 4OZIA 3DTXA 5CEXB 5BVJA 2V9RA 1SY6L 2OLEA 5HBBA 3WSQL 4X6DB 1G7MA 4XNQB 4TVPL 4BSJA 3IUNA 5F7FA 2H6PB 2YYSA 3OKEA 2XRAH 2AV1A 1QSFD 4HQQH 2ECFA 4ELMB 4XCFH 1WWWX 2NXZB 1J9CT 3HCVB 4XH2B 1OY3B 1PZUB 3ULUD 3JV6A 4POZC 1OM3H 2E9IA 1S5HA 1IJ9A 1AHWB 4TSBL 2HKFL 2CMFA 2R11A 5CLTA 3BJ91 5GGTA 3R3XA 2WK2A 4GBXB 2AK1L 2WFLA 3NFPB 2F54E 4W4OC 3VXUE 1FH5H 5A16A 5C3LD 4OU5A 2N4IA 3TIDB 3QG7H 1HHIB 1MRDL 1EHYA 5LLSA 4BVLA 4OTXL 1W72L 1D9KC 1A6WL 1FFAA 5CT6A 5EHZA 4X6CA 3D3NA 5HXMA 4UV4L 1BECA 3KYOB 2P8MB 3QI9A 4YR6A 3GSQB 5F1OB 5C7XH 3BKMH 5JW4Q 1YCDA 2OR8A 3MRMB 2XNAB 3QBTB 3OKYA 3WFBL 1UA6L 5KS9A 4OB5L 4NC1E 4NFDA 5F6HJ 1HH9B 3H2HA 3AGVA 3MRLB 4GBGA 4PV8B 3G5YB 4NHUB 2EO9A 3ESVF 4XGZA 4EY7A 4WUUE 1I8MA 3V6OE 5EHQA 3KYNB 2GYWA 1QACA 4MVBC 3V6OA 3TYGL 1WTGT 2NY7H 5F88B 2WIJA 3S8WA 1ZVSA 1T66D 3CMOH 1LO0L 3DGGB 3BEWA 3BP7A 4YUEH 2FD6L 2HWZH 3WD5H 1EVTC 2GBFA 1MQKL 3BN9C 4WHCA 4DQOH 5HKBA 5IW1A 4Y2JA 1PY4A 3PGDB 3GZKA 1FN4B 4LPXA 3I84A 4MMXC 4WHDA 1ZAGA 4K3DL 2NLJB 1KT2A 3ARBD 1UH2A 5HGBB 5IVIA 1CUJA 1RZJL 1KLUA 4QT5A 4G3YH 3C5WP 2F74A 4LSPL 4R0LC 1UEMA 4JREC 3UBXG 1U8HB 4TVPH 4HXGA 2RFXB 3KPPA 1MEXL 1ROWA 4OV5A 5FUOL 3QVMA 3MRRA 4BSWB 1ODTC 5JYCA 4HQQL 2YD2A 3I2CL 2YPLB 1NUFA 1PY9A 5DR5H 2CKMA 5D70H 1JF6A 3K9BA 1MQ8A 1K8QA 2R4SL 1CFVH 5F9OL 1A1MB 1OQOA 4P5TC 1G7IA 4MNQD 3I2KA 2DMKA 1K3ZA 3W5MA 3M8OL 3INUL 3ARDD 5CT4A 3RQ3A 4G9FD 2X9YA 4BQ8A 3C6ZA 2UY7A 2A6IB 3RWEA 1FNHA 1R50A 4Z7NE 4JYMA 5GRJH 2GZRA 3FLBA 1A47A 2NTFB 1JWUA 1U36A 3H42L 2WHPA 4U1NA 3QFJD 3TO4B 1OSPH 1A5FH 2AXJA 1F6AB 4ZD3L 1YY8A 2IF7A 3T2PA 3STTA 3LRGA 4HS3A 3HI5L 4YHYC 5EZLB 1OHQA 1EAPA 4RCAA 4LDLB 5CT9A 1XQYA 4HT1L 2XN9D 5DVKA 1JYXA 5E24E 1SCKA 4X4ZA 4R4ND 3C45A 5I8CA 4KK8C 4ZOBA 5DHYB 3OJDB 4U33A 1IKNC 1PG7X 5FCSH 3OPZH 5SV3A 3IF1B 3HZKA 3WL9A 4OYYA 1N8ZB 3X11B 1FBIL 4R90L 3RY6C 1IM3A 4JRYE 4U1JB 3QWOA 4IH9A 3EDKA 5D5ME 3S88L 5AI5A 3ULUL 2R8SH 2CBGA 2F53E 2JKXA 3KWWA 1FZMB 2W9EL 1ZSDA 2OTWA 2DDQL 5B39B 1P2CB 1RJLB 2BMKB 3ISWA 3QMMA 1H2XA 1CRLA 2Z3ZA 4JHZA 5I1DA 5AWNH 4TPKA 1CFSB 3QEQB 3SEPA 2DD8L 4HS8H 3B9KB 5CJQH 2DJ4A 1GH7A 4MWTA 1HLGA 4PJAB 3EDJA 5CZXD 4X6EA 1MFEH 1UCBH 3EYQD 3L3HA 3VW3L 3VDBA 1NKOA 2NY6D 3MC0A 5HHNB 2AJSL 1HI6A 1TXKA 3D0VA 4GMSH 5ALTA 1XCQB 4Y5XC 3CFJB 1CZ8L 4OCSH 3FYTA 4RGOH 5FYJE 4YHKH 5F89B 4BZWA 3FOMA 1M7DB 3OAYK 4NKDB 4JKLA 5EUOE 4G4JA 5DMGD 2GJZB 3NA4A 5GGRA 4NO0A 3MR9A 4X7TA 3PWPA 2QADB 3H9HB 4D3CL 4YGVB 1T21B 1XZMA 4OQ1A 5AK4A 3SO3C 2APXA 1DBMH 3WO4C 4P48A 4JFFA 2J3QA 4LDOB 2J5LB 1MJ8H 5F1IA 5F6IC 3D2UA 5AAWA 2NZ9D 4F9PC 4L9AA 1F6LL 2VZTA 4XC3H 5CZVH 4U6YB 1UM6L 2PNDA 2IFFH 3VXRE 1WB6A 4ODHL 4OSEA 3GHBH 5IIEA 5HHOE 1XRPA 4YAQA 4PJ9B 4Q9RL 2FEEL 3C5ZD 1BFOA 1UWXK 1T4KB 5E8PB 3L95A 1INEH 3FB8A 1U8MA 3BEWB 4LASH 5C2BH 4RNRA 3CCCA 3X3FH 3HI1B 3DL4A 3UC0H 2B4CC 3WIHL 5LGJB 3D39E 4DNFA 4WJLA 1JT2A 3WLWD 4R90H 5MEOB 4UIKL 5E5RB 2ZJFA 1MSPA 3HE6B 3ILPB 4NQDA 3JWEA 1EMTH 4OCLC 4I77L 2HTKD 4ODVL 2GIYA 5I16B 2WTMA 1QIJA 1QSEE 3RZCA 4PJCB 1L7AA 1X4ZA 3VXRB 1KTLB 1WHSA 5JO5A 3MA9L 1VKHA 1U8QA 4QRRB 3BPOC 5FO7A 5KSBE 5J12C 4QO1A 1EHLH 4OUUA 2IBBA 3WIBA 1XROA 3A70A 5AKLA 3S96A 3B3IB 3DDUA 3DX6B 3LDBB 4QXTA 1HSAA 3VRJB 4X7CC 1CFSA 3QEQA 4CN6A 1BD2D 4RDQF 1CDJA 3P0YL 4DAGH 5JR1L 2PSJA 5IHZA 2ZCLL 3QJFA 5E2UL 3DKRA 2XRAL 3RUGB 1FN4A 3IDAA 4DGYL 1I8IA 5JHLL 4NBXB 5FLKA 1WOMA 1MO2A 1KCVH 1YEDB 2NXYD 3I2IA 2YR3A 4HZLB 1IFHL 4JCMA 1XQWA 1S5HB 3WKBA 3LV3B 5KSUA 2QQKL 4LGRB 4C56D 3KPLA 3HCVA 3F12A 2RJMA 1I9IL 1J8KA 2CR6A 5JW5B 1CUDA 1HHGA 4R97B 3NN8A 3EHBC 1DQML 1SCIA 3FQUA 1T6WA 1CE6A 3O6KL 2X9WA 3S37L 3DVGA 4QXGH 2FECI 1H9VA 5BVJB 3AZPA 2D7OA 4CADA 5GZND 2APVA 3QIWD 4M61B 5FYLL 3WE6A 1YPZE 4ARBA 1PLGL 2DM3A 2G60L 3SGEI 2EEDA 4NMWA 2A74A 1ZWIB 2Y7QB 3H9YA 4OU4A 4ODUA 1C7TA 2EH7H 1AH1A 3LS2A 3QEUA 1J12A 5L8LB 3FRPG 3B2UC 1A7RL 4QRPB 2D03H 4KTDH 4LSDA 1FGVL 3P4LA 4I4CA 3F7VB 1R1DA 2VWEC 2YKLH 4D0CB 5KBYA 2VAVA 3C8DA 3BKCL 1YPZA 4DMHA 1ZA6A 5I17A 1W0WA 1MY7A 3D0KA 2E6PA 5FHBH 4O2CA 5K3CA 4XZUB 1XKTA 2OP4L 4HV8B 4UIMA 1S7RB 4KAQH 2VLKA 1S7VB 4PB9L 2XPGB 2AXGA 4EIGB 3EFFA 4LK4A 4JHWL 2GSIB 5KSBB 3ZDZF 1XF1A 3OKEB 5I19H 1XZ0A 5H94B 1OTSD 4BSVB 2IH3B 5DD1L 4ETQA 3FOBA 4U6HB 1EEQA 1F2XK 5C0AB 3LIPA 4M5YH 4I5BA 4Y1AE 1CLYH 1CVRA 2WWMD 3MXVH 2XTJE 3WFEL 1C1EL 1FFBA 1N5RA 2ZOKA 1LWRA 1IEBA 5J6GA 2NX5B 4GEGA 4HF5L 1AGEA 2JJUA 3BN9D 1FLRL 3FKUS 3IAGC 3DHMA 3SKUD 5A3IC 2HAZA 4QOKE 4TPRL 4UDUA 4XCNB 4I4WB 4X83A 1JP5A 1HCFX 2XT0A 4PJGF 1MCQA 3D87B 3NFNA 4N0UA 3I2CH 4KRNA 5DR5L 1OAZL 4HD9A 5K9OB 5IBTH 2PXYD 5JIKA 3TF7C 1KXQE 2VATA 4S1QL 5D7IF 4P3DA 5GSVB 4M43L 5CIPH 4LGSB 1B90A 1S5IH 4S10A 4MS8C 5I1JH 5HHXL 2N56A 2ADIB 4XT1C 4C88A 5IW3A 1S9YB 4Y16B 2ICWB 4K8RH 2QKIB 4HS9A 3INUH 1KLGA 2BZDA 3HA0A 2ZUUA 3B12A 3MBEB 1JF5A 1CICB 2ZSHA 3B3QA 2HLFD 3C8KA 1EGJL 3EOBA 4Y2YA 4NZJA 5CEZH 4A6YB 5FKAA 4LCWE 4N0FA 5F97E 4CVXA 2D7TL 1L7TH 4L4JA 1CUFA 2P8SA 2CMRH 1F58H 5DQ9B 1JNHA 2DQGL 2VXSH 5EB9A 3VXSA 5FGCE 4UHEA 5DD6B 1T04A 4PQEA 5I18L 4HGWA 5C9JA 3EOAB 4H1LG 4JFDE 1J0HA 3MV7B 1XH3A 1JF1A 3CCHA 4G80A 4MA1B 5TE7L 3QWQB 4ETYA 1BROA 4ZOAA 1JHLH 1KBGH 3NFPA 4M93B 5C08A 4K7PL 3A0OA 5AD0A 1YDPA 4DGVL 5EH1A 1YAJA 1AHWA 4K9EL 4ZFGL 2Z8VC 4MJID 1FFOB 4GLBA 1S7WA 4OM0L 3LHPH 5DJ0A 1LO4H 1UZAA 3OJVC 1BEYH 3GMLB 3CCBA 2KBGA 2XPGA 3B83A 2NNAA 1JWMB 4R4NC 4C83A 1TRHA 3QUXD 5MHSD 1C5BH 4JZOA 2OXGA 4J1UA 1UXSB 3BGMA 4F7MB 1FFNB 4Z7QF 3U4BL 5HFNA 4MA3B 4RNCA 5D1QB 2V5TA 3BZFA 1YDPB 4PV9A 3FT3A 5C0BE 4K94L 1X5FA 3TA3B 3GMPA 4JB9H 5CJBA 2RGUA 1OL0A 4Y19A 3O95A 4H20L 3VFRB 1MNUH 2QSVA 4AIXA 3NH7H 2C4FU 2KZWA 3JWDH 5K9KB 5C9KA 4NQEB 2FLRT 2AEPL 4PS4L 1SM3H 4YHOH 2B1AL 3C5ZB 2QL1A 4HBCH 4RRPG 4IQ4A 5T3XL 3KPRD 3G0DA 4HKZB 1S9KC 1W0VB 3DLQR 5GS0C 3DQZA 2CKBB 3G5XA 1HZHH 3QFDB 1MIEL 3WE6B 3QPCA 1R0AL 1DFBL 1RMFH 4I13B 5GGUA 4MYDA 2CPCA 2XZAH 3W05A 2Y4SA 2ESVD 4YHZH 2YS4A 2F19H 4L4TD 4ZTOH 4HEME 4EN3A 4KXZI 1U8NA 4V1DD 1K4YA 3L3OB 1LPPA 2P5WB 5JAPA 3EOYG 2X10A 5A1AA 1H3VA 2JE8A 2UZIL 4Y2RA 3TNMB 3MLRH 4GKNB 3T0DA 5GRVK 1RZFH 3H2WA 3WL7A 4KKAD 4BH8B 3RVUD 1IUOA 4F37K 2VDNH 4HZLA 2D7TH 2MSPA 1F4XH 3PIQA 1QO7A 2VXSL 4EBQH 3RLIA 2HA1A 1AFVL 4TUKH 4FQQA 3K80A 3MV9E 5FA3B 3O2VL 3NCBB 4U6XB 5HQ3B 1GZQB 4CN1A 1MNAA 3QIUA 3V95A 4F7EA 4B7ZA 3S35L 4MXQC 1GZ7A 4HFWA 2ATPB 3O3DA 1HDMA 4NDMB 3RWCB 3WFDL 5FV2A 4WUUB 2GSIA 5CCKL 3AILA 3R8QA 2ZJSL 4K9EH 1HOCB 1M6OB 4LYEA 4HZAA 4JO2H 2W9DH 3J7HA 3UCRA 4ODWB 2J6EA 1EFXA 2X6MA 2AQ1A 1FO0B 3BJLA 4NQED 4G8CA 5ALGA 5EC2B 3U36A 4CVZB 1U95A 3MUGA 2VOTA 3HMWH 4AG4L 4OV6F 3X17A 4ZXBA 3RPIA 4G7YL 5SYNA 3HB3C 2ZG2A 5DDHB 4UTAL 1J5OH 4ODSL 3FO0L 3SJVA 2HFFB 4FOMA 3ESUF 5H37H 4G8GB 2B4KA 1A9EB 1XF2A 2ZPKL 5TFSL 3MLVL 3HKFA 4ZYKA 4XBGA 4AO6A 4S11A 5KSVB 2ZKHH 3SDDD 1IAIM 4WGWB 3VFWB 2IQ9L 1KJ2A 3NGMA 4PD4K 4GS7C 5I74C 1YN7A 2FB4H 1USWA 3B4NA 3ARWA 5GGRY 5CFHA 1GHFL 2X4RA 2X5XA 1FGNL 2V9QA 1UJ3A 5ALBL 4YPGB 1WCBA 3VI3F 3L5JA 4TOYH 5SV4A 3D2UB 4EXPX 4UT6H 4EY8A 3NN8B 3KR3L 1INDH 1WT5C 1OTUC 3ULVC 2NY1D 4BP8A 3GDBA 1I9IH 2IX9A 3CFIC 4AEIH 4P5TD 1AO7B 4RZCB 4FQCL 1SQ2N 1XF4B 4Y19D 3BDXA 2VR9A 3KPMA 1Z9SA 4X5LA 2D31A 3D85D 3HZYB 4E5XB 3D9AL 2EIZB 1PJAA 1TCAA 3QH3A 3F7YA 3O9WB 4JKWA 1MF2L 4XRCB 3O3AA 3P77A 3TM6A 2DQIL 4P9NA 5L0QB 5HHME 3R3VA 2FH8A 4NBZB 2OYPA 4LNVA 4QRUA 1YB6A 4HXBL 1HWHB 4LSVL 3PL6A 2EH7L 3HFMH 3SKOB 1KEZA 1JK8A 4FXKB 4ZQKB 3WS3A 2PUHA 3TN0A 5I15H 4J7RA 4NQXA 2JEZA 1NCWL 4OZHA 4PRPE 3T65A 3K81A 1EEUA 4PJAA 3PI6A 5T3XD 2HA5A 1Q72H 1LDSA 4LCWD 4U1HA 3CXHK 5CZKA 3T3PE 2DQYA 1OP3H 1M71B 4XVUD 1S7TB 3BIKB 1IGJA 1KPUA 3RGHA 3F7RA 4IRSB 4JFZH 1NPUA 4FMFA 4LSPH 5F7HA 2DQJH 1DT5A 2HH0L 2BMKA 2K3TA 4PYHA 5FA4B 4ONHB 5HK8A 4HUVB 3STXA 4PB9H 2XLCA 4C56A 2OTWB 2D31B 3DMMB 3PNWA 5DTFB 1RU9L 1UWGL 2J88H 1WCQA 3RL1B 1J1IA 3V0AC 1GT6A 4OF7A 2YK1H 1TJIH 4LLUA 5BS0D 4BE4A 4MJIE 1F4AA 2Q8AL 2D3VA 1QSFE 4M7JL 3T0AA 1D9KD 3OJDA 2UUDK 5F9OH 1C1EH 3QXDA 4ZREA 1RVFH 1T1WA 2FD6H 3UTTE 3ZHKA 5JZ7D 2BVEA 1JCKA 1F3RB 1PG7H 5KVGH 1J10A 2PYEA 3BKJH 1RJCA 1BZ9B 1CD1A 3RVVD 4HZGA 2A83B 4NUJB 4PRAB 1IL1B 3AXLB 4I18A 4BDTA 5GHWL 3U9PH 4LLVA 5I1JL 3P9MA 3LRSA 4QTIL 5JW4N 4JDZA 5FV4A 3TIEA 5C0BD 5I76B 3E3QC 4O9HH 4U0RC 3QPQC 5F7WC 2HFFA 4ZS6C 3FB5B 2YC1A 1RULL 1WBXA 5HHVL 3X13A 5JD6A 1EVQA 2YXFA 3U0WL 4MDJB 3D69A 4RGYA 1BZQK 1MFDL 4P9HH 5FA4A 4HIXL 5SYMA 3DHJA 1EINA 4UINH 1L7TL 3SDDA 1Z9LA 3X12B 2RAMA 1I1AD 5HHNA 3RVXC 4P4RA 2XY2A 4HS6A 2OPHA 1PYWA 3T77A 4R96B 3A6BH 3WK7A 3O45A 4YIQA 2OAEA 1T5WA 3PL6C 1NCCL 2VZSA 4FFYH 3L3HB 3OAYH 4K6KA 3PJSA 4PRAA 4B0PA 1VFAB 3RDTD 3F6IA 4ISVA 3RWDB 2PSEA 1G42A 2OGSA 3SE9H 2VAXA 43CAA 4ZD3H 4U2FA 1I3RB 1JMZA 1N64H 2BVQA 2DQEL 3DYPA 4A6YL 3CLFL 4V1DA 1UWCA 4JFZL 2QQQA 1Q0RA 2D7NA 4M7KL 2F53A 1FE8L 1MWAB 3KPSE 5LXGL 3O3BB 4WI5A 2H7YA 3BAEH 4KKLD 4UOJA 4GKSB 4LHJB 5C08E 2D0FA 1HXMB 1KN4H 4GMSL 4KKCC 5DTFA 3IFOA 5LP1A 3GNMH 4LLMA 5HHQB 3BF8A 4EN3B 5E8EB 1FYTD 1FNEB 3KGRA 1CCZA 4R3SB 4JYPA 3ARQA 2WBKA 1GOFA 4YX9A 1JZ2A 4EXKA 1HH9A 3G9AB 5FM4A 1RUQH 3M07A 2W0KA 2ATKA 2B1AH 4UT9H 5JLZA 3VXKA 5JXEA 1TITA 3MNVB 1S7TA 1OPGH 3BIWA 5C0GB 4U1HB 3G5XB 3FB7B 1NAKH 4L4VA 1EDBA 1UZ6E 1FL6B 2GUOB 3TBSA 3SGKA 3VXMA 4UQ3A 1X7QA 2W92A 1H23A 5IW6B 1CGSH 3CU1A 1MFEL 1UCBL 1A9EA 2CSPA 4LGPB 3SQOH 1XF2B 4V2CB 1MJUL 4FNMA 1XGYL 4WJ5A 2HN7B 4QY8B 3P11L 2CXGA 2Z91B 3OXSA 3U4AA 1F02I 4P2OA 5HZGA 2PO6A 3RWIA 4NKMB 4Y2DA 3WN5C 1FYHB 2ED8A 3GMRB 3MLRL 2IAMB 1EFXB 3BGMB 5AEAA 5JORB 4AB1A 3JV6B 3BRDA 1HHKA 1A7BA 4L3CA 1BF8A 2H3NB 3C5SB 1WC7B 1VOTA 5HPOA 3HG1B 3CDYA 1YB7A 1XF5B 3WLBA 1MUJB 4DEPB 1GC1L 1JHTB 4MJ5A 3CN7A 5I8KH 1NSNL 2DWEB 2I60H 4LPWA 4XXDA 4MA8H 5JUEH 4ZNCD 3MRFB 4UBOA 4G43B 2X4RB 5JNYA 4L9LC 4K2UH 5JA9A 3IIIA 2W07A 4LQ1A 4OZIB 5GGTL 1TZIB 4Y4HB 4XAKD 1AO7D 4YE4H 2EXWC 4B53A 1EB9A 2BUBA 1EJOH 4HWZA 5D2NE 5KVFL 2ITCA 3DYVA 1A6VH 1LZKA 3QFJA 4HIHB 1G5FA 4WFGD 2A2QT 2H45A 3KYNA 5HHOB 1MI5D 5D7IA 1EHAA 4GQPH 4YWGL 2FBOJ 2OL3B 3GI9L 1KLGB 2CDFA 1U3HB 1AC5A 1EI9A 4BAGA 3EYFB 2PXYC 5B8CC 1UKCA 2YEZB 4OUOA 4Z7UA 1I1RA 1C7IA 4M6OH 2EYTB 1X5JA 3GKZA 4PJGE 5T3XE 2GJ6A 2JGMA 4OFYA 2AJZB 3TVMA 5DMYA 4LXIA 2H2PC 5K9OA 2X1QA 4QF1B 5ITFA 3IVMA 2P8MA 5GGSA 5D4QA 4CVUA 1PZ5B 1CDHA 4WFHE 4UHCA 4X4YB 5JADA 4XCNA 1IGIL 5AZEL 4AYFA 5FOJA 1ERNA 1MHEB 2CKBH 4YBLC 5LVEA 4YK4C 5A2LH 1FSKC 4KK8D 1AJ7H 1K5NB 4M48H 4E46A 1A3RL 3GGWA 3P0VH 4MQXC 3RNKA 1PLGH 2E3VA 2F15A 1N5MA 3I6YA 4LP5A 2FJFA 3WN5B 3MBEC 2DB8A 3A6ZA 4TQEH 2EEPA 3HUJE 4N9GA 3SGJC 1MY5A 1JV5B 4NN5C 4X7FC 4BSVA 4L8CA 3ABZA 4RGND 1UKBA 4WHYG 3F5WA 3VXRD 2CRZA 5IQ7L 1UK6A 3PWUA 5HHOD 1FYTA 4UT7H 1SMOA 3V5HB 1FGVH 1MHHA 4O58L 3LEVH 1IFHH 3HEAA 3TESA 1MF2H 2YPLD 2YKLL 4GHWA 3ZI7A 4PJ7F 3UTTD 1N5YL 2H2PD 1TFHA 1F90H 1MJ7L 4A5SA 2EICA 5DFVD 1NSNH 5GSRB 4U2ZA 5DEZA 1P0MA 4PGEB 3I50H 3FJTA 2HADA 4AIOA 5DTJA 1T0PB 4AIZB 1FC1A 4XPFH 1OARL 4YO0B 1U92A 4D9QD 5FO8B 4JR9L 3P4MA 4DKAA 2Y7QA 2YD5A 4E41B 2PO6D 3SPVA 2DQJL 2WLSA 2VL5A 3DROB 1QIGA 1EJOL 2APWA 1CIJA 2GQHA 4GUPA 1FSSA 1G1YA 3LKQB 1MLCA 3DVGB 2PPLA 4X6XA 3FQRB 4P3CH 2BXYA 2X05A 1RUAL 4P5TA 4G8IB 3ARRA 2Z8SA 2NY6B 4KVNL 5IMLB 1LEIB 1KPVA 1ZVYA 4ZAKA 2UZ0A 2QBWA 4M7JH 5E6IB 1MHHB 3KYAA 4BAZA 5K93A 1MCWW 4NKOA 1TKRA 2XXCB 4FQJL 2JLLA 1JZ4A 4KK6C 1MIML 2ZJ7A 5EI5A 5AD0B 2VQ1A 5CP3A 1CUGA 1FH5L 4Y16C 1W75A 1RFDH 4WEUD 4NNYB 3H0TB 3W39A 5JMRA 3VRLF 4R7DA 1DL7L 1OAUL 2DBJA 3RWGB 5IEKA 3C09B 1RPQA 1ZE3C 3BWAB 2PVSA 1VE6A 1RZ8A 2EZ0C 4NBYB 1JE6A 1EVUA 3AC0A 3TH4T 3M17B 1AXSA 5DQ9A 4G6AC 3AM8C 3AVEA 3ZLUA 4AENB 3U0WH 1RHHA 1S9WB 3LKOA 4NCC2 1SJEA 2DWDA 4UIMB 4BFEA 3A67L 2C7BA 2PU5A 1MH5A 1AKJA 1CQYA 2ZSVA 1BWWA 3ILPA 4NQDB 4BFGA 2NY6C 3H9SD 1LDPL 2BVPA 4XCCH 5HYIA 1MCDA 3MRNA 5TE6L 3ALWA 5F1SA 4NC2B 5DRZA 1F90L 1MJ7H 5JAOA 5GRYA 4C4ZA 2Y6SC 3JV5A 3SE3A 1T7VA 4S0TD 2H9GB 3NOIA 3L1OH 3CX5K 4WTZG 3QPDA 2XUQA 1X6LA 3WJJA 4GG8B 1BAFH 1I8KA 2H7XA 1A6WH 4JUIA 1M1SA 3VGBA 1SHMA 5J12B 1I3UA 4OM1L 4S2SB 3WKCA 3LZFH 2AKRA 4BELD 4ZXFA 1B4JH 5KWJA 3GBNH 2BRRL 1BIHA 3IDYB 5IVHA 4G8FB 4KXZH 3VMOA 3MRFA 2RONA 2JJSC 2BOBA 2V96A 4XWOD 1EA9C 1IGTB 1GC1C 3CVIH 5ID1B 2C3XA 1QNZH 3UDWA 1XZ0B 5H94A 4KAFA 5F72S 3AZOA 3B5GA 4G8GD 4J0IA 4WUKL 2AXGB 1ORWA 3PWPB 4JVPA 4YX2H 3CSYB 3KPLB 1T2NA 1A2YA 4PRHE 3EOTH 3TYGH 4D9LH 1XGUB 3HC3L 5E6ID 3WEXA 2VB5A 4Y7MA 5DJ8A 3C6XA 4KKLC 2DLIA 5T1MA 2F54B 3GSXB 4DMCA 2RBLA 3NUZA 3O4LD 4K7FB 1BQHG 4H7FA 4QDTA 3T0WA 5FKJA 2X41A 2OZ4A 4HUUB 5T5FH 2PYEE 4YDIH 3TGLA 1E66A 1Y7HA 2JJSA 2R0LL 3QAZB 4P2QA 1Q9KB 1OLZA 1J86A 2H2SD 3S96B 3UUEA 2BVOA 1XF3A 5HGDA 4M0EA 1FVEB 2V7HB 4PRPB 2I9TA 2MQCA 1GXSA 4LSUL 1T03H 4JZJB 5A2KH 1IQDA 4JFEE 3UPAA 4KUCF 1OGAA 5BWBA 3ZTNH 4F7TA 1UB6A 2HJFB 1VDGA 4M1GH 2ZYHA 2XZQH 4PJXF 3TGXA 2GJ6D 2VLLB 1HILB 5JW5A 2R2EA 4YQXL 4XMLL 3IFOB 3KPRB 2R4SH 3FB5A 3IDUA 1RI8A 5D7LA 4B41A 1V05A 5TE6H 2GCYB 1YJDL 3GSVA 3PHQA 1R9NA 2Y36L 3LRSB 4O02H 4Q7DA 3S4SB 4JDVA 2I25N 2BJMH 4HH8A 5DK2B 2BGNA 1UCTA 1NAML 4LBEA 2E8ZA 3IAPA 5HGGS 1J87A 1JL8A 2YPLE 1T1YB 1J2EA 1J5OL 4F7PB 5ISMA 4OIIH 3MZGB 1RJYA 4OUKX 4U31A 4FQ2L 1GGCL 3EJJX 1WBYB 4M1DH 1CUIA 3PDCA 4EBQL 4B7LA 3NIDF 1B4JL 2XTJC 2OGTA 3MJ9L 5FDYA 3UXFA 5HYEA 3S3PA 2WTNA 4XI5C 3D85B 1MWAH 3N9GL 4HIIA 3ULUE 2WINA 2FNBA 5FV1L 5EU6A 2EXYC 4RMVA 4KRMB 2UYLA 3G08A 3DI3B 2APFA 4MCYB 3EW3B 3RJQB 3X12A 1XZFA 4GW1B 1DBAH 4NKDA 4Q74A 1RZ7L 3DMMA 3BP5B 3CH1B 3CX5J 4XVSL 5FHAH 4EDWL 4PJ8B 3QHZL 2XI9A 2JJTA 1XZBA 4MDJA 3CFJA 1WAAF 3ARDB 1LPSA 1XRLA 2YWZA 3U1TA 3WBDA 1N0LA 5T4HA 2APTA 3BIKA 5JHDA 3MRHB 1NBVH 4OLWL 5F9DC 4ZS6D 4BQCA 4JO1L 1PFCA 2NW2B 4JLRB 2BVYA 3KPOB 3NMEA 4OT1H 3BIAX 1CEXA 4D9RE 2ZPKH 3T3PF 3F9CA 1IL1A 2PR4L 3VMNA 2NLJA 3CDGA 1OP9A 2OTUB 4NO3A 2YZ8A 3ZTNL 5JANA 1JNLL 4QA9A 3CSBA 1BVKB 3Q5TA 2W1NA 4HWBA 1P53A 5EUOF 3P4OB 1EK2A 2UWEA 8CGTA 3VXOA 1K6QL 3F6LA 3TPKA 1Q72L 4ZUWB 3G6AA 3MQIA 4FTVB 4W81A 3MBED 3FCTB 3ARPA 4U3CA 1AIFA 3KLDA 3KPRA 4CNIA 1U58A 4TN9A 1M7DA 3L1HA 1MAML 5IF0B 5FF6A 5ALKA 3DRQA 1JRHL 2LVEA 3W81A 5I71B 3UYRH 3WWPA 4U6VL 3W9DA 5A7FA 5C0AD 5DRWB 4PGJA 3Q2CA 2D9QB 4CG2A 5KOMC 2VN7A 5C0CA 3ZV7A 5F7KC 5EBMB 3VFWA 4CJ1A 5DYTA 5DRNA 4QEKA 4QLRA 4O4YL 5IESL 3V0WH 5L2JB 1GXEA 5AOAA 5KANG 1OD9A 3P40A 1FVCA 1LK2A 5D5MF 4P3CL 3RZCC 3PL6B 1RUPL 2DQUL 3HC0A 1M33A 4D0BB 4OZGA 5HI3C 1CDUA 5IT2L 1WAAA 3JUYA 4CMMA 2Y07L 4XNZC 4KJXA 3GSWA 2ICEA 3MCLH 3G5VB 3OZ9H 4DVBA 4UIKH 3DMMC 3FFCE 4C57C 4AO7A 3AY4A 1UM5H 5DK2A 2ORBL 3CVHA 3L7FB 3O3UN 2YPLA 4MQLA 3UO1L 3VFMB 3FT4A 5B39G 1SY6H 5BVPH 3QWOB 3TJHC 4FZEL 4AMKH 4PY7B 4N9OB 5DJCA 1YQVL 1BQHB 4WFIA 1FFPB 2VXQL 3O6KH 3SGDH 1GGVA 1WVZA 4YDVA 4IMKC 2F74B 4P99A 2ITDB 2H8PA 1Q9LB 4MXVE 4CIBA 5JPMA 3DUSA 4LLDB 1ITCA 1CXLA 4G42B 3S9DB 3NACL 3OR7A 3WL6A 2HRLA 1K2DB 4LL9A 4PG2C 4PLKD 1UKSA 4F80A 3QRGL 1U0QA 1CYGA 3SDCB 3HPLA 1XRMA 2D4DA 2LU4A 4Y19E 2GAZB 4RMQA 3EFDL 2VSQA 5CRIA 4PJ5A 4KTEH 1A3LL 3QG7L 4HXFB 1DUZA 5DMKB 2EDFA 2YN5A 4I9WD 2XMRA 5DRZB 1DVFC 1PW3A 4UBJA 2P5WE 1FRGH 5DMGC 1PKOA 5D2LE 3IU4L 1A9BA 2GITB 4P2RA 5DNVA 4M7ZB 3GSNA 3DL7A 3R3ZA 1HK6A 5CJOH 1QIHA 5T4BA 1XGUA 4BZ1L 3L3GA 4Q6IC 3FQXB 4B5EA 3DUUB 4ZUVB 3ZYJA 2ILLA 2GTZB 1FG9C 2X4OB 1BF2A 1P7QB 1Y0LB 1UYWL 4JGUA 3UTSA 3KPPB 3OKOA 2BY1A 5JOPE 1HQ4B 3BPCB 4ELMF 3ARUA 4WY7H 1CLYL 5E8NB 3QXWA 2EDCA 5H2BA 5ALXA 4UNTA 3T04D 1UADC 4F7EB 4NKIH 5DJDB 4WI2A 2R9HD 4GAYA 3WHE0 4DJMA 3I85A 1FLRH 5FA3A 5J13B 3G5ZA 3SJVE 1NJ9A 1MVUA 3DO7A 3TJMA 2DAVA 3GMPB 5C0IA 3U6RB 3H2IA 5DUMH 3F97A 5KS9F 4MA3A 2IMNA 2MHAA 5SWSD 2J3SA 3V48A 5IMOB 3PV6B 5E99L 3UPRA 1E6OL 5J6HA 4WI6A 1NEZA 2IGFL 4XWOC 4P4KA 2GT9B 1AP2B 4L8DB 1FFOA 4UBLA 1PBYA 1HL7A 2IPTL 1FAIL 3I6GA 1E27B 2XXMB 3BOVA 3DTXB 5CEXA 1UJ3C 3QDJB 1EFXD 2X4TB 3BF7A 4FQXD 5DS8A 3MRCB 5IQ9A 2V5RA 4GBXC 1ZT4A 2XA8L 5I74B 4BQ9A 1QSED 3OKLB 3MGTA 5D7IE 1OPGL 3VE0B 3IVKB 4MJIA 2YA0A 4W9RA 3G04A 4DTGL 5TE7H 2HA7A 2NXYC 4GW4B 1V5JA 1YYMH 2XQGA 3GSNH 3BWAA 2KQNA 4WV1A 1ZGLB 2ROQA 2Z4QB 3QNZB 2VLKE 1H3TA 25C8L 5I30L 1UT9A 3T0EE 4IRSD 5HD8C 3JW8A 3MMEB 2WMPA 5T1KD 4CBPA 5EZIL 4JPWH 2PTUA 3V4VL 3OR6B 3WHXB 3HRZA 4HCRL 4TULH 2O5YL 2B5IC 1JN6A 3OMZA 3RX7A 2WIIA 2V2WB 1HXYB 4LEOB 4J8RA 3AS3A 3BZ4A 4U6TA 3MYJB 5DJ6B 5E6IA 2NNAB 4WI8A 4XB7A 2QQNH 5J6HB 4K9EC 4DNPA 2UY6A 3OR6A 4LOUD 3CZFA 5J06A 3E6HA 2G63A 1KJMA 2HVKB 4DGIH 5HF6A 4HMCA 3QNZA 3GRWL 3G5ZB 4FABL 3IFLH 1QTIA 2NX5E 1AD0A 4XX1E 3EYQC 4CCYA 2K9UA 1R3LB 2XTJB 3VFPB 3B2UD 4MA7L 1BVLA 1I7UB 5C1MB 2G5BB 1P0IA 1IGCH 4PRBB 3SPVB 2PTVA 1YQ2A 3WZLA 5C6TL 1IGML 1R3IH 1ZHNB 1KB5B 4WFFD 5BMFH 2IH3A 4F58H 1D5MA 1M05A 4K07A 4QF1A 4DGVH 2MKWA 4YE4L 2FL5B 1RMFL 1SVCP 5T1DH 4ZFGH 4WWKD 1NL0L 4WHTA 4OLZH 4Q6IA 1LO4L 4FLMA 4PJGA 1WK0A 3S34H 1E4KC 2P8PA 3MGOB 2RHEA 1KOAA 4AQDA 4DW2L 2CDFB 1W0WB 4KK6D 5TPWL 1HIMH 5A2FA 3WXWL 3IURA 3MNZB 1VEMA 5ECJE 3CFCH 2PYFB 4YC2C 4X80L 4WDQA 4K94H 5CGMA 3ORJA 3QIUD 3VXQA 3C08L 4JFDA 4DOHB 5IMMA 4C54A 4YBLB 1QE3A 1A7QL 4N0UB 3DVNA 4HHAB 4R8WH 1FVDB 3G9VA 3K8KA 3N1QC 5GGVL 1YEIL 3R4DA 3I2JA 4QLOA 2VERN 4PGCB 4LIQL 1A8QA 1YECH 3GGWB 3RNKB 4WDIA 2HT2D 4APQA 3Q5YA 3WFCH 1W72H 2QQLL 3QRFM 1YNLL 2PXYB 5B8CB 2YPVL 5H2BB 4QKXB 4X4YA 1JPFA 4U1IB 4XC3L 4BJLA 4Y4FD 1QKZL 2CQVA 2I9LB 1LO3H 1TJGH 4M1CD 1QOZA 5IVNA 1QLEL 1Y0LA 1I85C 1E6JL 4G5ZH 2RQ8A 1A1NA 3MJ8B 1UA6H 3VXUA 1CR6A 4HV8A 4WWID 1WUNT 3VGDA 5ALHA 4O2CB 4LF3B 4Q2ZA 4G7YH 5BS0B 1F5WA 3CFDA 3HLKA 3MLZH 1B41A 4EN3C 4ZPVA 1DQQA 1NMAL 3WUWG 3RUGA 3LS4H 4ZO6A 3QUKA 3S5LG 1BGXL 4DMKA 1OAYH 2XMSA 4IS6A 3QUXC 2VJDA 5AOCA 2X4UB 3VDXA 3HUJF 5IB4B 5DI8A 4P23B 3VCLB 1CS6A 3ZL4H 2FWOA 1QZ1A 2DQUH 4PRID 5F9JA 3AS0A 3NTCL 5F70A 5FO7B 5T3ZE 1PD6A 1Y7IA 2ACKA 3UX9B 3MLUH 5DJ5A 1BRTA 5T1KA 1TJHH 1N3NA 4M1CC 1K2DA 4YLQT 3FYUB 4MWFA 3NCEB 1CL7I 1CTOA 3S37X 1QFUL 1IC5H 4MMZC 4TOYL 4YXLL 1ZIYA 1MPXA 3VFGL 4WFHD 1Y6KR 3ELAT 4HWNA 1P69B 2FGWH 4NT6B 4JKKA 2JIXA 3ARED 1KGCD 3EDEA 3WLBB 1R3JA 4PTUA 1XLVA 3N0PB 1T0NA 3DXAA 5CJ5A 3GJFH 4Y9SA 3HI4A 3D9AH 1A6UH 5CP7A 2IAMA 4FS0A 2GY5A 2VLRA 3P4OA 4UILH 2E3JA 3NACH 1BFOB 4PJFF 2Q87A 2IG2H 2G5RA 5MHSE 4R8WL 2CRIA 4XIIA 5MEPB 4EI6B 3ZTJH 4JG0L 1GIGL 2G5TA 5C70A 1HQRA 3L3DB 3WK6A 2PKDA 4QXTB 1QEWB 5GRJL 1YEGH 4Q97A 4QXGL 2EE3A 4HPYL 1J8HD 1FL6A 3MCKB 4XX1G 2AJXL 5CILH 2YA1A 1U8QB 2SEBA 2VSCA 43C9A 4QDXA 3MOBH 4NO0B 1AGDB 5F9WB 3WWCA 5E8DL 1BFVH 4OLYH 2Q20A 5C86A 3L5HA 4XNMA 5CJOL 3BP4B 3STLB 4BVKA 1A7NL 4KMQA 6CGTA 2DHEA 4LCCB 5GGQH 3HE6A 4KJWC 2VE6B 1T3FB 2V2TA 3U2SB 1UXWA 3BRGC 3MA7A 3TBTA 1J1XL 1IC1A 5E03A 2X70B 2B4CL 2VEOA 5DZLA 1NC2B 4XP6H 2DM4A 1LDPH 1CFTA 3G0GA 5D2NA 1ZJ5A 3QUMH 4L4TE 4G6MH 5EU6B 5HFAA 3ARFC 2EE2A 1QSVA 2AJUH 4ORGA 5INCB 4JPKH 4PRNB 4PBXA 2JIDA 1I4FA 3B9KA 5IVXA 5CW2A 4YPJA 3CDGB 5E2JA 1Q8MA 4DIUA 1N7ML 3LKNB 1V3KA 4LCYA 3HABA 1I4FB 3ET9F 4NGHH 3AUKA 5F1IB 2CZQA 5INCA 3MXVL 1DLHB 2NZ9C 4J4PD 5HI4D 3U1SL 4BFIB 2BOCB 2NW2A 2AW2A 6FABL 5DTIA 3RARA 1NCNA 1JU3A 4PJ9D 4P08A 2GCYA 4YASA 3H3BC 2WUBH 1A7OH 1G0YR 5F7LB 1G7PB 32C2B 2XZQL 5F89A 1JMKC 1IBGH 3MV8D 4HH9A 3V52L 1I3VA 1U8KA 1ZI8A 4YK4B 3LIIA 1NGQH 4XVTL 5IOPB 1QVOA 3X14B 2WIMA 3BP4A 2NY1C 4Y0GA 4KAJA 4YBHA 1C16B 2XA8H 3OKNB 4GW1A 3PABA 2EDJA 5JQ6H 4K8RL 1EO8L 1NGXB 2Z8RA 4I3RL 5JIIA 4NO5A 2AJVL 4LPYA 2CIIA 4BK5A 2AK4B 4AZ8A 1HKLH 4JKMA 1DZBA 2OMBA 5J56B 1FNFA 1X3DA 1QHPA 1QEWA 3HRHA 4EUPA 4L5FH 1N64L 2DQEH 2OR9H 3V2AR 3WQHA 5EZIH 3WO3B 2UVEA 3HRPA 4MNQE 4OGXL 5GRVL 2PF6A 1T5XB 5J4MA 5EUOA 4W70A 1EEZB 1P84J 4OZGF 1LE9A 4XC1H 1FL3A 4FFVD 3ULUC 2DQCL 2JJTC 3GBML 3OKMB 5GGQL 3PQYA 4JY5H 3FVRA 1TVHB 3PUIA 2JCCE 2X7LA 3TA3D 3GNML 3U79A 1RYYA 3OBAA 5C7YA 4NZDA 1H15A 4FZ8H 4P2QE 3DECA 3C6LD 1HILA 2NY7L 3QB7C 2CRYA 3W5NA 1RZKL 5ID1A 5AI9A 2YSSA 3C5JA 1YEJL 3MACL 4MSWB 2R1XA 2Z31A 3LCRA 4YUEL 4I8DA 4MAYD 1UOOA 1U8EA 5CEZE 2A73B 4U1LB 1AGDA 5EIQA 4WW1B 4O51B 1VHPA 4JZJA 2EDHA 2ZSWB 5L0QC 3VFTA 1QP1A 2P7TA 1KCRL 1JPGB 2LVCA 3LKSB 3T65B 3VA2C 4XX1A 3F67A 4HBQA 1O6FA 2MQ0A 4JEIA 1HHHA 3AU1A 4ERSH 1OP3K 2C1PA 4JO3L 5ILTL 2P4AB 5EGNA 4QRUB 2ZUSA 3M83A 2J4FA 5D1XA 3QNXA 1QFWH 1DQQB 4KKNA 3QDMD 4KQ3H 1BMGA 1PVHA 5IB1B 3MV8B 2V5YA 3E0XA 4HMDA 3SKMA 4B84A 2CK2A 3QQ4B 3WO4B 5FECA 1J7VR 2JEYA 4FQ1L 2F8XC 5D6DA 4ZPVB 4JFXA 4A16A 1K4DA 1KTDB 4Y4HD 4YDKL 4N8SA 4Z8FL 1ZHKB 4MQSB 4KPHL 1IAOB 4PB0H 3WIOA 2EDLA 2UZIH 4U6VH 2P5EB 1J8HB 4YPGA 5D2LF 2XDWA 2BDNH 4D9JA 3WIIH 2IAND 2Q7YA 1WIPA 4L3EB 1AC0A 2EDXA 2NY5C 3VDAA 2B7DT 3AREA 1R3DA 4H7DA 5DJZA 3VGAC 4DVRL 5T1KB 4S2SA 1THGA 3IKCA 1DQLH 2QSCH 5L7XL 5D7JD 1W72A 4KK9C 1JGVL 4RAVB 3HAEH 1CUYA 3C6SA 4KHXH 5IMMB 4DN4L 12E8L 2EC8A 1EH9A 3SGEH 1J88A 2J1KA 5HGAA 5C09D 3RTQA 3RKDC 3AB0C 4R2GC 5EOCL 3I2GA 4IJ3B 5CGYD 4OCZA 3RY6A 3J8F7 2YD9A 1IEAB 5LCVH 4HRXA 5IROC 3MUGB 3WUWA 3BESR 3O2DL 5I9QC 4HDIA 1JGLH 1IKFH 1HNGA 2GJJA 3ARGB 2FSEA 1OOAA 2VO5A 4EUSA 5KVMC 3IAQA 2XWBB 4OD2A 3UYRL 4PRHB 3BH9A 4PV7A 1IVLA 3C9NB 5IB5B 4NQDE 1AURA 3UTPE 3KYOA 4UTAH 2C3VB 5SX4H 5FP0A 4RFEA 2A0LC 5AWNL 1EA5A 4Q0XL 1IMHC 2XZZA 3R0VA 4APQD 3EIOA 3AY4C 3CFBB 3S5LB 1ORVA 2QEJA 3OB0K 2WBJA 1N59B 2WG1A 3AIMA 3PP3H 1QBBA 3I6KB 2FR4B 2BHYA 4MHHI 5MP6L 4HF5H 1JBJA 4L0CA 2IPKB 4UQ2A 3QJHA 3MLYL 4H26A 3QO1B 2AJSH 3ZSSA 1UXOA 1SBSL 1YEFL 3MV9A 2JJVA 4G9DB 3PICA 4WTZA 1FFNA 3HYSA 1IGFH 1A6UL 3DIFB 5B38G 1JTOA 3ARXA 2YRLA 4GKNA 1Z0MA 1J07A 1TQHA 2HA6A 4M6OL 5ANMA 5D2LA 4DZBA 1SFRA 2WJ3A 2PYFA 2VSDA 4OGZA 1AUOA 1HEZA 3MV9B 4JZJC 3C60B 5FGCB 3CFEA 1B0GA 4JQIL 3NIGF 4UV7L 4LRIC 4OI8A 4WI3A 1I7TB 5CLWA 1U6AH 1ETZA 3VA6A 2ZCKH 4H7KA 4IM8A 4WHTB 4KDWA 1MCOL 3HRZB 3MZTA 2CKBA 3EOAA 1U93A 2DF3A 3RIAF 2CMRL 4JFED 3P30H 4CN4A 3PFBA 1V8HA 4OD3H 5JHDD 5CIPA 4LVNC 4JJHA 5CMAA 5E8DH 2IPKA 4UQ2B 4M5ZH 3VVMA 1O6GA 1N2RB 2JGEA 4K6HA 3IJHA 4U0QB 2B2XH 4I3GA 2NY4C 5IQ9B 5KSAC 2OM5A 3EQ9A 5DUML 4AX4A 5I1GL 2VIRA 5E0QA 1JJUA 1R24A 1KCSL 1Y6NR 2XWBA 5C0EB 4F7MA 5FAAA 4GXVH 1NLDH 1RURL 5JDJA 3DBXB 3MV01 1KCUL 1KACB 3ARFB 2FJ0A 1NEZB 4LIPD 2VLJD 2HLAB 1WITA 5KSBF 3DIFA 2LAAA 4NN6C 3I1YA 3WHXA 5AKHA 5F7DB 1CD9B 4UDUB 3BPNB 3IKCB 2IPUG 3HG1E 5C0BB 5BRZB 4GXUM 5TDNA 2PTTA 3TN0C 3ZKXC 4EOWL 3FFCD 4NGHL 4PO3X 1RUKL 4QCIA 5J1AA 1AY1H 3D25A 4XP9L 3CFBA 3S5LA 4NC1C 3V6BR 3PQYD 4L29B 5F9AC 3W2DL 3MREA 4Y8DC 3W11C 3D2CA 3P2TA 1JHTA 2MWCA 2WUBL 4QWWD 3WLWC 3VXSD 1IT9H 3CSGA 1LD9A 2B8OT 1ZT4B 4MX7B 4N68A 2E9WA 2HT2C 3RL2A 1H3PL 3UYPA 4JQVA 1YA5A 4M7LH 3SKNA 3VFOB 1D7FA 2FSEB 1IAOA 3FBWA 2BKLA 5IG7A 3G6JB 1DBJH 2C58A 1L9MA 3JTTB 3RVXD 1DWQA 4MQTB 3SDCC 5D1XB 5D71H 1YMHB 1FFDA 3MUHL 1FJ1B 4M00A 1P1ZB 3UBXI 3QQ3A 1C12B 4Z7VF 1DQMH 2XUJA 4JVUA 4APQC 3QDME 3T2QA 1CG9A 5GSVA 1BAFL 4FXGB 2BUAA 2DI8A 4JJ5B 3PV6A 2C5GA 4PJHE 1NEZG 2BX5A 3MLSL 2HFTA 2X76A 4KI5D 4GLRI 3HC4L 5DLML 1TETH 4WW1A 5J57B 2ORYA 3BGFB 4PJ7E 3EO0A 2VLMD 1DN0A 5T5NF 4NQCD 5TF0A 1NMBL 4MB3A 4BATA 4UAOC 3NBNA 3VJMA 4KK5D 1R3IL 4AK1A 1ODSA 5FGBC 2XQYK 5DURD 1HHGB 5JOEA 2A6KA 1O0VA 5K9JL 5H35B 5FPQA 3BPOB 2GYUA 1X5XA 1UVQA 4UNUA 1DEEB 2E7LC 2DYPB 5DUPH 5GRWA 3HG1A 2ITDA 2Z31B 1LBTA 4ODXA 5KSUB 4GKSA 4KWUA 3VD3A 4Y2VA 3NCFB 2XV6B 4JFFE 3A6CL 3MUOA 1BQHA 2A77L 4PY8J 3TWCL 5IKCB 5JDSB 4GLRH 1U91B 2X4NB 4PY7A 5E5MA 4WW2C 2Z91A 3OXSB 2WIFA 1WBZA 1KIQB 4WJ5B 2E7BA 3RWJB 1YASA 1T20A 4EOWH 1FZKA 1VFAA 2WW8A 1VE7A 3GBNL 4EI5A 2EYSA 2R69L 3BFOA 2IBZY 3MLXH 3ZE1E 5EU4B 1Q0ZA 3FQNB 5GGVH 4DMFA 3Q3GA 3FB6A 3O45B 4YIQB 3P9LA 5FUCE 2L4OA 5C0CD 4NUGL 1FVCB 1LK2B 2BGRA 3PABB 2PBLA 5J9PA 3KPSA 1BX2B 3QR2A 4AZ3A 3SDDB 4HX1A 1LNUA 4AT6A 1KJVB 2Y2VA 5AJHA 1MCFA 4HJGA 5AM3A 2R1XB 2VQUA 3U30C 1DTUA 3UTZB 1OLLA 3DD5A 3L5WA 5CAYB 3IU3A 4IRJC 4ZTPH 1K63A 2X4QB 3SQOL 3UPCA 5B38A 3G0CA 1QLRA 2RIKA 1Q0XH 1DDHB 1QFMA 3VD7A 1INQB 3H0CA 3WXVH 1SJHA 4ETWA 3T3MF 2CXKA 2XA3A 3E3AA 4LNRB 5E7FA 1PKQE 4PJFA 4J0DA 1LP9A 3FFCB 2D2OA 1QBLL 3LKRA 2NQCA 4NWUH 1E4XL 4CNIB 4TSAH 2R29H 3PE9A 1JYVA 1BVKA 2IFFL 3G8YA 4DVRH 2IEPA 3D3VA 4Y2OA 5C07A 1I3RA 2WUDA 4LSSL 2DL9A 3GI8H 5FKPA 4ZRDA 5C07E 3CXDH 1CQKA 3G6AB 3ULSA 4HAGA 1WTLA 1R9MA 3DXAE 2JB6A 1FO0L 4K23L 2J8UE 4LIQH 5J11C 3QCTL 2QQLH 3ZPXA 2H32H 2OTUA 4WTWA 2GBCA 2PX6A 3ZE2F 3ZMRA 1F4WH 3FOLB 3UYOD 1I8LC 4C01A 1KIUA 3RVTC 2RI6A 4PRNA 1ZLVK 3N2ZB 5HGHB 3U4EA 3KJ6H 5EWIH 3KLAB 3K2UL 4PFEA 4HUWB 4R2GD 3U4BH 1FP5A 2XUDA 4C4XA 5JHDB 4U49A 4OIIL 4IHAA 4N5EC 5AM1A 4LKXB 3ULUF 4P2RD 4Q0XH 2P24B 4KZDH 5J7CC 1L0YA 3PGFL 5EDXA 3HAEG 2XT1B 1F6FB 1U8MB 5IJKA 1EZVX 4FKBA 3D85A 1MCPL 4JKPH 3PDDA 1LEKA 3I3EA 1SM3L 3KPSB 1OQXA 2VLJE 3E1F1 2XY1A 4LSTL 2EDDA 4QXUL 3QUZD 4YAQB 1BZ9A 1MCWM 3Q6GH 3UTSE 5F1NB 3V5KB 5FUZL 3KD2A 3G6DL 1B88A 1MRDH 1T6VN 1TJHL 3D39B 5H37G 5IMKB 1TENA 3T1FA 4HKBA 5DEGB 2HJLA 2JB6B 3VFGH 3KPMB 1UQSB 3RZCD 3BO8B 4JFOA 4JRXB 1UK8A 1CFTB 5C7XL 2FEDC 3IUQA 4IHOA 1QLRB 5CJXC 5SWSA 2DHCA 3H1BA 1UXWB 4FFVC 1H8SA 1CF8H 4HUVA 4ZO7A 3H2KA 1ACLA 4F57H 5C8JB 1KIRA 4JFHE 2IANB 4PJ8A 3GSVB 2PETA 2WIKA 2DYPA 1NMCB 1OM3L 1QLFB 4KRYA 4MNGA 5C8VA 3QUML 2HKFH 3JUZA 4UNVA 4J3TA 3RIFF 5CT8A 4CI9A 5IESH 1KJ2B 3NFSH 5CD5C 1ZA3A 1X5ZA 1JPSH 4Z0BH 2GFBA 2FCBA 3VG9B 3EYUH 1ZIXA 2WBJD 3PDOA 1B3JA 1IUNA 5E08H 4WRLA 2IQAA 2AK4D 4XCYB 4IRJD 4ZDHA 2O61A 5FUCC 3ESBA 2XYCA 1CR9H 1MLBB 1QSEA 3LP5A 4V1DE 4NO2A 1WBZB 2P8LB 3QXAA 1JZ5A 2YXMA 1V7NH 3T52A 4E9LA 1XF3B 5IB4A 3O11A 2MQ3A 3TO2A 5I1AA 4NHCL 5EOQL 1KXTB 2NY3D 3TT3H 3KVQA 1JRHH 3K2UH 1T7XA 1TVDA 1MEXH 4L3WA 1WJ3A 4LFHG 1BOGA 4G4GA 3IJYA 1DEEA 1NCDH 1YQVH 2GJ6E 4OV5B 3QXTA 3OL2A 1XLWA 3GMOB 4QYOB 4KUZH 4XP6L 1CBVL 1NCTA 1A0QL 2HG5B 3L1IA 2WU4A 3L3JA 4LCUA 4Z9KB 2LV4A 2HRPL 4JHAH 5E2TH 1LK3L 4B9AA 1MCEA 4BQ6A 1UB6B 4YK7A 3IB4A 1OAQL 1KU0A 3QRGH 4QWWC 4O5LH 1YN7B 4IEFB 5DD5H 1MIMH 5GRUH 3VFVB 2EDNA 1N26A 1H8NA 3S35X 5AAMA 3N85H 5DC9B 2YH2A 5DGQA 4DK3A 3ZKMC 2HHAA 1BQLL 2WP3O 4LPVA 3VH8B 3W0WD 1CUBA 5F96H 4WU5A 2OK0L 3SDAA 3CC5A 2AI0H 2XG4A 4PGBB 4ELME 2H9GA 4JAMA 1KFAH 3FO1B 1XGYH 4JY4A 1B6GA 1JVKA 3DLTA 1C08B 3HS0B 1IAKA 2V2XB 3O6FA 3WIFB 2EDBA 4XGZB 4G6AD 1WV7T 2A9MH 5I1HL 4IIQA 5EC2A 1MH5B 2HU7A 3DSFL 4QRPD 3L5XH 4HJJH 2Q8BH 3MRPA 3VXNA 3ED1A 2ACEA 2NCMA 5KS9E 1J8HE 3D3VE 3QIBD 1UH3A 3THMH 3KYKL 4MD0B 1D6VL 3P9WB 4YHNA 5EUKB 2C3WA 3DURA 1CFVL 5IWLC 1IC4H 5T4EA 1M05B 3SOBL 1HDMB 4Y4KC 5JQ6L 4H77A 1UM4H 2XN9E 5SWQB 3LDBC 3PWLA 5FYKD 3V4UH 4XCEB 3HZVA 1NAMB 3IRPX 2PXYA 5B8CA 2VXTL 3EYUL 5KVDL 4KRPD 5K9KA 3KG5A 5I66A 1U8OA 4K7PH 4ZSOB 1PJ9A 5E2WL 3SGDI 1SJXA 2ED9A 4P9ML 1AXSB 4MJ2A 3W39B 1PEWA 4X95A 1F4HA 4NNXB 4OM0H 4PRBA 3KXPA 5ALRA 4G8DA 1BVLB 1I7UA 3ZE1F 2Y06H 1S7SB 2DJSA 4JFDB 3NA9H 3LLCA 1H2YA 3RVWC 3GMLA 5EU7E 1XZIA 4NJ9H 1A4KB 5DHVA 5C0EA 2H6PA 5C07D 5K5EA 4PPTA 2YK1L 3R1GL 1FBIH 3QIBB 4XP5H 3FO9A 1A7PL 1KENL 3VFUB 3BISA 4KUZL 4P23C 2QJDA 4D9LL 5IJVA 4NZTL 3G6JF 4HUKB 3AIKA 1JGUH 4XPGH 1RUMH 4G9DA 1RVFL 2WUFA 4YR6B 4HKZA 4S1SL 5DJ2A 1ES0B 4H5SB 2YD3A 4NUGH 3N85L 1B6DA 1UT6A 3LKQA 3OKLA 4UU9A 4WFEE 1MJ8L 4LU5H 1GGYA 5I1IL 5AG8A 1EDEA 2G5BA 1EX0A 2DKUA 4PGEA 2B39A 3U9PL 3CIQA 3NIGE 1NAMA 4OJFH 3C8KB 1EV2E 2B9VA 3VRLE 4TQEL 3O81A 1VCAA 1Q0XL 5GS1C 5I1KL 3BW9B 4K71B 1Z2KA 3JZ7A 4NPYA 1HN1A 3TZVD 3OV6A 3WNNA 1HEZB 5AG9A 4JPVH 3MCG1 2DTML 5ANMB 4EJ1C 4JRWA 1PEZA 3HNTH 4J1UB 3KHOA 1KV3A 4KKAC 4FOLA 3OAUH 3H9ZA 3OGCB 3ZE2E 1F4YH 3B2VH 4IIQB 4QZVA 3WUWB 3PWUB 1MREH 4MXWH 1BBJB 4PJHA 1AD9A 5ACZB 4DGIL 4L8DA 5EOTA 4J2XA 5FCUL 2J7LA 5C0IB 5BXFB 2HA2A 1UM4L 1XR8B 3HLAB 4I0CC 4YDKH 5A40E 4WGVB 2V97A 2IBZX 4LVHB 1KYOK 3OQ3B 2EDWA 4P2QD 2FR4A 4KPHH 3CC5B 2NY4D 5DD3L 1PDKA 4NIKB 4X7SL 4NNXA 5IVXE 4Y2UA 1T83A 1QOKA 3T0EC 3S8YA 2DS4A 5CBEA 5CZVL 4JQXA 2PW1B 2Q6WA 1QFWM 5D72H 4JEGB 2G9HB 4A6YH 4X6FB 4N0YL 4JHBA 3WHE1 3UTSB 4L72A 1K5NA 4OCYL 2YASA 3NAAL 2VLJB 3DYMA 4TULL 5ICYB 4AJ0A 2BC4B 3BVNB 3MV7E 4Y1AD 1QFOA 1CGVA 4TTDD 2HT3D 3IDIB 4BAUA 1VEPA 1CUAA 4IOIA 1X5GA 2BXZA 3X3FL 4P2RB 4N5ED 2QKIA 3WIHH 4F8TA 1ZGBA 2ADIA 3KPQA 1IGYA 3DX9B 3QDGD 5ALSA 4M62L 1AQKH 4HIHA 5FHAL 4EDWH 4EDXB 4G6KL 3V1NA 2GHWB 2B61A 4OGYL 3SDAB 4NZZA 4AEHL 4M9PA 4JM2A 4ODUB 2W59A 4GQ9H 4TNVF 4OLWH 3W04A 5BMFL 5KW9H 2NY0B 3OAZH 3MA9H 5DJZB 1LGYA 4M61A 4FA8A 1YUHB 2Y2UA 5ADPH 4OT1L 4PP2B 4X90A 2BNUB 1A1OA 3GIZH 1SYVA 3ROOA 4GWLA 3PDOB 4PJ5B 2OI9B 3STYA 5IB2B 5TQ2L 3KR3H 4LAQH 1G7JA 5C08D 3B9KD 5I1CL 2JB5L 3FNBA 2B5IB 4O51A 2LU7A 1PZ5A 1X70A 1DEDA 3SDXA 4V2IA 2CJUH 1X44A 2ZCLH 1F11B 1U8PB 4Y5YB 5J89A 4K5QA 1CDCA 2X4OA 3BWUC 3OG9A 3O2WH 1OF2A 5TDPA 2J2ZA 3QUXA 3REWA 3VI4F 2YEZA 2X89D 3VD5A 3TEJA 4ZS7L 3R3UA 5F4ZA 5HD8D 1CIDA 4LKOA 2JTDA 2J8OA 3ILQD 1JJIA 3TC9A 3CDCA 3GHEL 2X7LB 4NZUH 3QJFB 3BDYH 4L3CB 5HVWA 2DFPA 2FEEI 3PWJA 4MQ7A 1U42A 2ZUXA 3D7RA 3QQ4A 1CE1H 4R0LB 3GJEA 3L1OL 3MV8A 3S4SG 4ZDHB 2HJLB 3GRWA 5HJ3A 4X5XA 4HUXB 3U0VA 4KFZC 1XGQB 1NANI 3T8XA 4OCXL 3LKSA 4J0GA 1TQBC 4OM1H 4KJPC 4CU6A 4L4VB 2OCKA 4LP4A 3TCLA 2Z35A 4OAWA 2HFKA 1TZIA 4XPBL 4Y4HA 5IVOA 2H1PH 3VWJD 4PJCA 1QLEH 3HAEA 5FOBA 2G75B 4B85A 4ZFOA 2H8PB 4F60A 4UBMA 1IMJA 2IANA 1CE6B 4YDVB 2DLFL 4UZGA 1UWGH 2J88L 4ZMAT 4LLYB 1H15B 2XMDA 5EU5A 2KZ1B 1DT3A 1JZ3A 3MLZL 2ZUVA 4NM8H 4DN3L 2YBRB 1QRNE 2Z93A 3BKCH 5C09B 2XUIA 3S7GA 4RNRB 4HC1A 2WSKA 4GKOA 5C81A 1REIA 1AKJD 3JVGA 5SWSB 32C2A 1YEDA 4O5LL 1PV1A 1D5ZA 5TQ0L 3GMNA 4CMHC 1AE6L 2BSRB 4LVEA 4E41E 3NWOA 5EUOB 4NO3B 1NCBL 4NC0B 4C55A 3SDXF 2FYYA 4PJXE 1W8NA 2VMFA 4FRWA 4FG6D 2VC2H 4J0HA 2CDEB 5D3KA 4D8PA 5DXWA 2XWJA 4LPCA 2HT3C 2V9TA 4IRJA 3RX5A 3VWJB 5ABDE 1G84A 5L6YH 3BEVA 4Q58C 3WFEH 1NANH 5I1CH 3STUA 2CIIB 3FB7A 5B4MC 3LCYA 4QOKA 4EUPB 4W63A 3F8UB 5IQ7H 3QDGA 1KEML 5EIAA 3FOMB 4FNLH 2CUMA 1YEHL 4LSQH 3QXVA 3U0TA 5HY9B 3CDFA 3DRQB 5D96B 4MAUH 4ONFL 4XWGA 1I1AC 3EAKA 5K3FB 1FNLA 1A8UA 4JGJA 1WWBX 1LQSR 3MFFB 1G7PA 5E1AA 1CUHA 1EH5A 3GIVB 5MEOA 4W4NA 2FX5A 3TBTB 1TZHA 4HKJA 4Z7WA 1QHOA 2JGFA 3O8XD 3PWVA 5F8RC 1NCCH 2AS5M 4OF8A 3HE7B 5HY9A 5E6IC 4BFIA 4Y88A 3W9EB 4PSDA 4LLVB 4RE6A 3ZT7A 5CD3B 1GZPB 4MB4A 3E2HC 2Y5TB 4PJCF 5I2IA 2HFJA 3FYUC 3Q1SH 5D93B 4PJ9A 1CD1B 1SY6A 3PE6A 1DBKH 2D0GA 4ZI5A 4XP1L 4FNGA 3KPTA 1T80A 5EU4A 4DK6A 1H22A 3NH7L 4HIIB 1A6ZA 4PJ5D 3QUMB 1RJLA 3WK4A 5FIEA 1G9NL 2VLRE 5HTSA 2XFXB 4EUPG 3KHQA 2VQ6A 4IMLB 1JHLL 1MCHA 5FKPB 5JAUA 5T3XH 4ZOCA 3PQYE 4RSVA 4EN3D 4QGTA 4KYVA 5GGRB 1FG2A 2B4CH 3EHBD 2CLZA 3K4DA 2WM2A 1ZHBA 3IFPB 3V52H 2E27H 4C56B 2R56L 1E6OH 1BEYL 4NQSB 2IGFH 3MV7D 4MZ3A 4OZFH 5D2NB 3STLA 2V9ZA 4HJGB 5C09A 3RTQD 3U48A 3REVB 4UFOA 1NBYB 2BNQE 4P5KA 5DJXA 1YMME 4X85A 3QUZC 5JOFA 1OGAB 1IQDB 7CGTA 1ZKAA 4WNQA 4NM4L 3DRTA 4X5WA 5DUBA 3WMSA