3C8HA

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-serine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
392
structure length
383
Chain Sequence
b'VGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterochelin esterase
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
total genus 106
structure length 383
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c8hA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c8hA02
3UC0H 3VGEA 1BP3B 4N5IX 1YC7A 3L7EA 1Q0XH 3O4JA 4QA9A 1A3LH 5BRZD 3U36A 2V5SA 3PE6A 1D3CA 1JRHL 1JV5A 5E8PA 5FYJU 1MFBH 3T0XA 1Z68A 4X00A 4FZ8L 2YD2A 1KCRL 3PNWA 4L5FH 1OGAE 4NQED 3QMMA 2Z8WC 1IAII 4GRWB 2OJEB 2J8UF 1XGTA 1CU4L 4FQXA 4FXKB 4XCFH 4KJWC 3G5YB 4AXBA 3T2NH 1T5XB 1ISPA 4CN6A 4X4YA 4U1IA 1RZKC 1W76A 5DYWA 3DMMB 5DVLA 3RVWD 4XMKH 3ZPXA 2OL3L 3P40A 4LLYB 3TA3D 2NY5H 3B2VH 4F5ZA 3MRHB 1BROA 1WPXA 2D0DA 1AQDB 4FQQB 1KBGL 1WC7B 1FG2B 4X6CA 1J0JA 3QNZB 2GT9B 1MPXA 1CQYA 4NM8H 2RR3A 2DI9A 4LFHD 3AREA 4RIRA 2AXHA 4K2UH 1T0MB 2JKXA 3QQ4A 4X92A 4HEPG 2OR9L 3UX9B 1YY8A 3H8NA 2NMSA 3DMMD 4FTVA 1DZBA 3RL2B 4H25A 4HRXA 3BKYL 5LKRA 3FQTA 2CRZA 4KKAC 5H35B 4WWID 4JHWH 5J1SC 3WUWB 4KAJA 4LSPL 3GSQA 4Y4HB 3UDWA 1N4XH 5CEYB 1X7QA 3VG9C 3P0GB 2AABL 3H9ZA 2Q8BH 4JR9L 1KIPA 2NR6C 5T5FH 2ADGB 1IGIL 3X3FL 1P0QA 5EBWA 4NO2B 3GMRA 1OCWH 1YEJL 1Q0YH 3OM8A 3CX5J 2GTWA 1W8NA 1XT5A 5DLMH 2VLKD 4GKSB 5DNVA 1UB5A 4LPTA 1WITA 4C59B 5BS0E 1VZ3A 1MAKA 4Y4HD 2AKRB 2G5BA 3O8XB 2GIYA 3OKLA 5GJSH 4L72A 4GG6F 2JCCA 1ZI8A 4LSUL 5FGCB 2OQVA 2NY0B 3R0MA 3VW3H 4JFPA 4LEOB 4P48A 3O4LA 1S9XA 5JXED 1S7QA 3RZCB 1R3LB 2VDRH 4U7KA 5D2NA 4LF3A 3VRLF 4N9GB 2R0LL 2DM7A 4UUJA 1U58A 3S6CA 4RA0C 3DVGB 1ND0B 3O8XD 1HN1A 2W0PA 4JDVA 4ZTPL 3IVKA 1UK9A 4MWSA 4W63A 4BC1A 1LO3L 1EFXB 2I3DA 3CSGA 2V7NB 4U1KA 4D0CB 2F15A 2XG5A 2J4FA 1ZSDB 1AHWB 3DEAA 3JTSB 4YHIA 1G42A 3RZCD 3CXDH 5DR5L 3R3ZA 4LIQE 3ESVF 5BOZG 4NO3A 1YAJA 5CEZH 4FHBD 1GC1C 2BY0A 2XTLA 4CU7A 3QEHA 1HH9B 1Q9OA 2EE6A 5C0JB 2NY0C 4P46D 4PJGE 5HGDA 1L6ZA 1I8MA 2PYEB 3AIMA 4K23L 1KU6A 1TIUA 3EQ8A 3RDTD 1N2RA 1S7RB 2D2OA 4M6OH 1EFXD 1EO5A 1RJYA 1WB6A 5ESVA 3I3EA 2P5WA 1HOCA 3PWNB 5CEXA 3F7RA 1HDEA 1RZGB 4K71B 1CFJA 2ZYRA 2FR4A 1IEBA 3NCYP 2H45A 1PX3A 3BPNB 2D5LA 2NY3B 1PG7W 2PO6B 3IIIA 5L6YH 5ADPH 3HLAA 4HPOL 4DUWA 4BTLA 3FN0H 1SYVB 2YZ1A 3D3VB 3G6AA 1NUNB 2JJSC 3TVMD 2EH7L 2PYED 3HI4A 1X5ZA 5I74B 4YXKL 5I19H 4K6GA 4XNXH 3G5VA 5BQ7A 5GS0H 1V7ML 5KWIA 1P4IH 1DUZA 4S0TD 3WJJA 4I3FA 5I1IL 3D39A 4KQ4H 2YWYA 1OHQA 4JDTL 1A4KB 3QAZC 1ZWIA 4WW2B 1DBMH 5HI3D 2I9TB 3HE7C 1PLGL 4ZREA 5D71L 4RWYH 5ENWB 2NY3D 1MCBA 5GQBA 3L3KB 3MACL 1N6QH 3G6DH 1S8DA 2PO6D 3NCJH 4GMTL 3DJ9A 3NCMA 1FNSH 1G7HA 3UYOD 3X11A 4JKLA 3L1OL 1KF9B 3SDDC 2VR9A 5EZIH 4WNQA 1KTDB 4KVNH 4LPVA 3FO9A 1TCAA 2G60L 4YZFE 2DTMH 3TV3L 3EQ9A 1E0OB 3UBXI 1E8NA 1MFEH 3N0PB 3LAFA 3S4SB 1XFPA 3BT2L 2PPLA 4NNXB 5CJXA 2FX8H 4I9WE 4UINL 1ZLUK 3WK7A 5ALJA 5T33H 5I74C 4GQ9H 2R11A 5FK9B 3MRCB 4A6YH 3CH1A 5D4QA 1WTGT 2XFXB 3TBTB 3CVHA 3HB3D 1LK3H 4HGKC 2AI0H 5E4JA 1AC5A 5MEOB 3MJGX 1UXSB 3ZDZF 1LZKA 3AAZA 4YNYA 3C60A 4RMWA 1CGWA 3EFDH 3BWAA 1JNNL 4PG2C 2NY7H 5F1NB 1J2EA 1VFOA 3HE6B 4P2OB 3QDHA 1W0VA 3G9XA 2EE3A 5FV2A 3MRJB 4BDSA 1UACH 2A6IB 4S1RH 5DMKB 3IT8D 3Q6FA 5IB1A 5CT9A 3STYA 5DD5H 1T6VN 4JO1H 3VFPB 1SCIA 2BVPA 2V9ZA 5AKYA 3DUSB 1J1IA 5I1LB 1JL8A 3NZHL 4G8GA 2VDOH 1R3DA 1NAMA 1CUYA 1TZGL 2CDGA 2NY4C 5F7MC 4YXLH 3QNXB 4O02L 3S36X 4RFOH 1PYWB 1H9VA 3UMJA 5J9PB 3HE6D 4P2OD 1CBVH 3HNVH 2VDKL 4PJAB 3E0XA 1L6XA 4IIQA 4LMQI 4NQDB 1HK6A 1NDMA 4X97A 3VXUE 4BK4A 3KPOB 1KB5A 4RCAA 3RVUD 1VFBB 1CI5A 2AXFB 2AJXH 4GKOA 4X6EB 5ISZB 4IHAA 4CW1B 2VE6B 2VLRA 2NLJB 1NCDH 4X6CF 4X8XA 5E70A 3S5LA 2QSCH 4X98A 3SGEH 5I7UA 3E3QC 4QDTA 1UJ3B 3NH7H 2EDTA 1AGBB 1CF8H 1MAJA 4TNWF 2YC1B 4MNQA 4PRNA 1IGCL 1UXOA 2XMDA 4NQDD 4KE6A 2EICA 2R4SH 3V6FB 2OP4H 4LOUD 3SGKA 5CKAA 1CE6B 4HKXB 2C5DC 5D96B 2OK0L 5EU6A 4L3EB 5ISZD 4PJHE 2YPLA 3BW9A 1GPLA 1C12A 4JPIA 3OKYA 1WLHA 4F7TA 1DFBH 3V5HA 5MEPA 1AX9A 1NFIB 4KI5C 5I0ZA 4U6TA 2R9HD 5HDBF 4BQ8A 4PJ9B 1I9RL 1XCQB 4DLNA 3SDAB 1FZJB 4H1LA 2PUHA 2AV1B 3MNZB 2AQ2A 5HHNA 4WFED 4FNGA 5MEND 3ZV7A 2X1QA 3GIVA 2DF3A 4HS8H 4LARL 1A6TB 1QQDA 2RHTA 2XXCB 2D7PA 3CLEH 1FVCA 2GTZA 4MQLA 1A7QH 1QFUL 1CR6A 1KC5L 3ZI7A 2WIKA 4ETQA 4C01A 4H8WC 3RY6C 4ODXB 2JCCF 4PJFB 3QG7H 4UU9A 4CVXB 4OFYD 5D1XB 2XZAH 2J4WH 5H3HA 5CD3A 1R24A 5IKCA 5D96C 5IB5A 2JGLA 4B7LA 3ECBA 5I18H 5F3BB 1EXUB 3ZYIA 1XF5B 1AGDB 2HP4A 1MF2L 4QNPE 3B43A 3MGTA 3GUTA 1A6UL 3PWUA 4P4KA 1CFQB 4UI2A 4PBVC 3QXDB 3RI5K 3GHEL 1M7DB 2UVFA 3FQXB 4R90L 4WIQA 4PJ9C 1RUML 2GUOB 4GSDL 4RNRA 5BRZA 1BQSA 2WSLA 2BGNA 1JNJA 3MFGB 3SDAC 2PTVA 3U0PB 5KSAC 1OARH 3L5JA 4X5XB 4OZHE 3HRHA 2ZUQC 4MB4A 3CUPA 5HSFA 1OGAA 5I8PA 5KANI 3B8SA 4NQEA 3ME0A 4OLYL 5FXCH 5L2KB 4K3JH 3O0DA 1KV3A 2CUTA 5CEZE 3U0VA 1HHGB 1MHEA 2X9YA 4DCQB 3A6BL 1U3HA 4KTEL 5JW4M 2BRQA 3C8KB 2EDWA 1DN2A 2E8ZA 5D1XC 2DFPA 3QEQE 3NIGE 4Z0BL 1MJUL 1KJVB 2WLZA 3TA3A 4Z77B 5I66A 1E8MA 3HS0B 4HBCL 1MREH 3R1GL 5CP3H 2Y5EA 5ALYA 2FJHA 2VYRE 4GRLC 5HF5A 3EOTL 4NRXA 4OCYL 5L2KD 1MIMH 2C4FU 1S5IL 3OKNB 4PJDB 3SGDH 4KKCC 2NXZD 1XH3A 4XMPL 1P4LA 3QIUB 3TC9A 1G7IB 3RFZC 5GS0D 1A7RH 3DMMA 2YSSB 1B90A 4WFIA 3W9EB 2V2TA 4P9HL 5E6YA 4BAUA 1F45A 1MCDA 2FYYB 4OIIH 4ETYA 1WC7A 2HWZH 4U2EA 4L4VB 4UTBL 4RAVA 3FB5B 3FMGH 1UEMA 3CCCA 2DQEL 1T0MA 5AWNL 3U0TA 2LTQB 3TO4A 1W72H 3QIUD 4N0CD 1C1EH 3T08A 4QZVA 1TQBC 3ESUF 3I6GB 1A3RH 2W60A 4JGUA 4Z7VF 1RAMA 2VLKA 3OZ9L 4BATA 2FGWH 4LFHG 4O51B 4QEGA 4Y4HA 4M62H 1J7VR 1BJMA 3FOLA 4L4VD 4MQ7B 4KPHH 5I8EB 3BKJH 1D5BA 5ANMB 2WJ4A 3BUYA 2CGRL 5AAMA 2ADGA 4NCC2 5BOVA 4DGYL 3S35X 5TE6H 5JXEA 2BSRB 4F8TA 1MCPL 4NKMA 4JFOB 5D5MB 2P24A 2VITB 4NRYA 4NO2A 5IB2A 4B85A 1XZHA 3MV8B 4B50A 1MRCL 3A6OA 1H2YA 1L4IA 1H2ZA 1YB7A 2XA3A 3REVA 3DO7A 3DETC 4WJLA 5F8QC 3VCLB 3BZDA 3U4BH 5ALXA 2LTQC 4ORGA 1EHLL 2V9QA 3ZHKA 3SEPA 2F53E 4HH8A 3BHBB 3WCYA 2DR0A 1DWQA 3N85H 3T0ED 5AO9A 1U6AL 2IEPA 3WUWG 4XNQB 2GY7B 2VR5A 3C9NB 2QQQA 2XA8H 5FYJL 1WCYA 3FO0L 1SMAA 3I2CL 5D1ZC 4WW1A 4KMTH 3LP5A 1K6EA 1INEH 4LLMA 2A6JB 4Z8FL 1YNKH 2B4CH 5EPMB 4OYYA 4P46A 2O5ZL 5ITFB 2Z31D 4ELMB 5BJTB 3RKDD 2KL6A 7FABL 3B3QA 3RDTA 3HJUA 4O00A 1A4JB 1YA8A 5C07B 1I9IL 1AHWA 3CN7A 4GI1A 3ARFA 5LZ7A 1EJOH 1T04A 3WL9B 3QBTB 5EIEA 1UOOA 1AY1H 1JN6B 2YUZA 3U9UA 5GS1B 2NYYC 2C0QA 4B5EA 3GROA 3KDMA 2JGEA 2D03H 4DZ8B 3NVQA 1HH9A 5GRYA 5JAPA 2RHEA 3O9WA 1A6PA 1MHCA 4PTUA 3RLIA 4XWOC 3TVMA 5I1JH 2PYEA 1MHHA 3LS5L 3MSPA 5FO9A 4WV1A 4JJ5B 3BIBX 4L1DA 2NXYB 1XZKA 3O2DL 1PG7H 2LQRA 4XVJH 4BZ1L 3W9BA 4LRIC 5A2GA 2VIRB 4OBRA 3BIAX 3CFDB 4YWGL 4NO0B 4XMLL 5IVZB 4DZBB 5JLZA 5HK8A 2PO6A 1MCHA 4R4BB 5LQBL 3U0WH 4NWUL 1G7QA 1JFQH 2XE4A 2W22A 4MJ5B 4P0DA 3FRUA 2W0LA 5T3ZH 2VZ1A 3EUUA 5D7LD 2JK5A 1WWWX 1LILA 1SQ2N 4HJ0D 1KPRA 2PYFB 4RMQA 3K46A 5GS1C 4TVPL 1YMMB 3W9DB 1FC1A 3MCLL 5J1AB 3TBVB 2DKUA 4ZFOB 1A4KA 3EHBD 3CZFB 1UWGL 5L7XL 3RX7A 2GZSA 1JZ5A 1JT2A 3VA2C 2WWKT 5ENWA 4NO0D 4FBLA 3ZO0A 4UHCA 1U8MB 1VGKB 2WIIA 1XF2B 5I8OL 2SEBA 3EYSH 2NXYC 5I1GL 4ZV7A 1B4JL 3MLTB 4KTDL 1NSNH 2HKHL 4MAUH 4M3JA 5LCVL 2M2DA 3E6HB 4ZWNA 4DVBA 3HZOA 1BVKB 1YMMD 4M8QB 1QOZA 4XVTH 4UQ3A 2Y2VA 4J03A 3M83A 5DVKA 2R0WL 1B6GA 4QRQB 1U95A 3WJ2A 2MPAH 5IJVB 3LY6A 1LHZA 5GRXG 5AAWA 3GSVA 5MHSE 4KGLA 3RIFF 4G43A 5EIQA 1KCSH 2OG1A 5EBMA 3V0VA 5ACLA 3OJVC 1XGQB 4FFVC 4LCCB 1NEZB 1YEDB 1REIA 4OFIA 4U4BA 3AS2A 4ZPTB 1HINH 3KNBB 1EAPB 5A7HA 4JG0L 1ZEAH 5CP7B 4K7PL 4XP5L 4ZUUA 4OLVL 5J8OA 5ITBL 2GCYA 1BZ7B 4OD2A 5K93A 3VXUA 2R1XA 1T20A 1P69B 1IAOB 2BVQA 2ITCB 2W9DH 5DFTA 1A1NA 4J0IA 5EWIL 5GGVL 4W70A 1FSSA 3FQNA 3TNNB 5CZVL 5AZ2L 5DRZB 3OF6D 3VXPA 1HPLA 3KVQA 1AE6L 1FNFA 4XHJC 4XPTH 3BVNB 4XB7A 4ISVA 1JIBA 3WXVH 3ARGD 1QTYT 1YMHB 1FZMA 3EYOB 4K9EH 2WM2A 1GOHA 3MLWH 4U6XB 3S4SG 1I7TA 2VDNH 1FC2D 1OAXH 3MCKB 1DVFA 1BIIA 4WDIA 43CAB 3CU7A 4NQDA 5B39A 1XQWA 4PJCE 3V9AA 1DINA 3V4VH 4LCCC 3BRFA 2XV6B 1VFBA 5GSRA 1K3IA 4X8JB 4L4TE 4N90E 4MNGE 5ISZA 5DI8B 5E8OA 1BFOA 1QO3B 4M7JL 4EI6B 4R97B 3EDKA 2ZPKL 1QSVA 2ADFH 5EU3A 3BSZH 4MD4B 3V95A 3LN9A 4EDWL 3MRQB 4KFZC 5ISMA 1UJ3A 5GZNC 1RZJH 2C3VA 4S1QL 2YC1A 2R0KL 4YPGA 5TDOB 1GHFH 1RIHL 4Q6IA 2I60H 1Q94A 3GSUB 3MMEB 3U4EA 4YDVB 4QRPE 3ZLQC 2FHCA 5MENA 4XC3L 5IGXH 3B6SB 4XVSH 4ZUTB 3B5HA 3R8QA 1NCTA 3MYZA 2VAJA 5EO0B 2CRYA 3VJMA 3EF3A 1ADQH 3RBSA 3RA7L 4YQXL 3O6FB 3F7YB 1G0XA 4I2XA 3HG1B 1FFEA 4QTHB 3IU3B 4HSQA 5IF0B 4OB8A 5B39G 1UM4H 4H26B 4ERSH 1VA5A 1KENH 4L8SC 5GHWH 1U9KA 5JAHA 4GXVL 5C0BB 3WIIH 4Q9BA 2ZUWA 1XCQA 3L5XL 4HIJB 3V7AE 1QTIA 1B0GA 1CFTA 2O61A 5HHOB 5FV1L 4PV7A 5EO1A 1X2EA 2UUDH 2J3QA 1HCVA 5EDXA 5INDA 4HGWA 2EEPA 4R97C 1EHYA 3AB0C 1KJ2B 3BP7B 3B5TA 4MD5A 5DJ5A 4Y5YB 1QRNB 3O6FD 3HG1D 1FH5L 5IHUL 4UV4L 3EO9H 1QLEH 1TQHA 4Y2VA 4OCMC 5C0BD 3IGAB 2DD8H 4L9LB 1GXSA 1MX5A 5HHOD 4UBMA 1KLGA 1EXUA 4HIEB 5JW4R 1XF5A 1OAKL 1KN4L 4IRSD 3FB7A 2WNGA 3QEGH 2HIHA 1FSKB 2ICWJ 3QXDA 1O5DT 3SE9L 1M7DA 3HA0A 3QDME 2DM4A 2OCFD 1QRND 3HNTL 5DWUL 2IGFH 4J0JA 5GSVA 3VFVB 3U0PA 4X5LA 3NCBB 1QYGL 3TO2B 4EY6A 4KAFA 3QMVA 4R7NA 3OAZH 4N0UB 4CNIB 5L2KA 5DHYB 1RU9L 3RAJL 1A7PH 4KY1L 2DQFA 3IJYA 3V6ZB 4FFYL 5HI5C 1E4XL 3FT4B 4R4FL 2J8HA 4HWEL 1MLBA 5D8JL 3BF7A 3RRQA 4YLQT 1K6QH 5DD0L 1DBJH 4M6NH 2Q76A 3GB7B 3RJQB 4EVNA 3CSPA 2FBJL 1FE8L 4OD3H 2YK1L 3STTA 1M7XA 3WN5A 5C7XL 1QR1A 3MFFA 1OLZA 3I6LD 1N5AB 4P4RA 3QUML 3Q6GL 5SWZB 4K07A 2ITDB 3NGBC 1H2WA 1M6OB 5EO9B 4FA8A 4EZIA 5FYLL 1ZICA 1HHHB 5I1HL 4NQVA 2DQTL 5D9SA 1IVYA 2NCMA 5T3ZE 4J6RL 4L8BB 2OI9C 2XG4A 4NZUL 3FKUS 2DRUA 1YEIH 3FFDB 1N6VA 5D2LE 3IURA 4MD0B 2I9LA 3UCRA 3LZFL 3N9GL 4MXVE 1KPVB 3THMH 1BWMA 4A6YA 4BCCA 3DV6A 4Y16C 4I5BA 4XAKE 1T4MA 1ZLWK 2IQAA 5SWZD 8CGTA 5I76A 5ALDA 4BZWA 4WFHE 4PGCB 2FATH 3V1MA 3LEYL 1KNOA 4BH8B 3QUKB 5CWSA 5KAQG 3ULVC 4U2CA 1HZHL 1YNTB 1MJJA 4PUBL 5C81A 4P5TD 5DC9B 1PFQA 1LO4L 1CZ8H 4OJFH 2BJHA 3FN3A 4N0RA 5HGHA 1D5ZB 5HJ3A 3VWJB 5ALHA 5FM8A 1NCBH 4DMKA 5I8EA 1BAFH 3T0AA 3IFNL 2F53A 2MQCA 4MQTB 3TZVC 1J0HA 4JZJC 4MWFB 5HPMB 3C5ZA 3TN0B 4QYOB 5ILTL 3T0EA 1DQQB 4G8BA 1GZQB 3FQUB 2HFTA 3MJ7A 5TFSL 1RJZB 1I8KB 5DEFA 3MV9E 4ZUWB 3WO3B 3RGVA 5IM7B 4PBXA 1Z2KA 4BK5A 5DTFB 5E8DH 2WHRA 2M8XA 1B2WL 2ICWB 5FXMA 4W1RA 2E6QA 4YHPA 2Z31A 4XB8A 3VXRB 4IMLA 5ICYB 4G42B 4X5WA 3HI6L 4PGBB 5AM4A 1C16B 1PY4A 3GJFH 4U7SA 4J4PA 4YGVA 3VWJC 2GYWA 1LPAB 1NCCH 3WFBH 3QYCA 2VH5H 2CIKB 1V3KA 3AXLB 4JFYA 2BK8A 5EPMA 3TN0C 4ELMA 5ITFA 1FL5B 1XGUB 3HMXL 4XCNB 2AJYH 5CSGA 5DLPA 1CQZA 3VFGL 4ZPVA 1G5FA 3RIAK 3VFNA 5AKGA 1A4JA 2QJWA 4IH4A 2YXFA 4HV8B 3BP5B 3QA3B 3VI3E 3WO4B 3WL9A 2ADIA 4BUHA 5TE4L 5EOCH 3T2QA 3MGOB 3DX6B 3UO1H 3EBAA 2WZPD 3DRTA 4MJ6A 4G3YH 4FOLA 1MY5A 3OGOE 4ZS7H 1OP3H 2H2PD 4Z7QE 4LSQH 4P57B 4M7ZB 3ZSSA 3EYVA 4QXUL 3IJHB 1Z9LA 2C7UB 5E08L 3MODH 1LDPH 5D7LA 1A7BA 2ZKHL 3VJ6A 1JCKA 4JJ5A 5GRVL 1W8OA 2HLAB 4E42B 4I8DA 3V5KB 3CX5K 35C8H 1IT9H 3VFUA 4GAGH 5EGNA 2BSSB 3ICVA 5EZLA 1OQOA 4UT7H 4QGTA 2BXYA 4FZ8H 4XXCC 1E89A 1ACZA 4GRMA 1D5XA 2WAHA 1P7QA 2ZCLL 3RARA 1FIEA 15C8H 4MQMA 1P6FA 1CU4H 3RPIB 3WO4C 4V1DD 5IW3A 3SC2A 4MYSA 4QNPF 2BVYA 3I9GH 4XBPA 3NFSL 5IWLA 1P7HL 3I75A 4PRHE 3QPCA 3CZFA 2OPHA 3ZE0E 4RGND 5IP4A 2HH0H 1XZDA 1F2QA 2Y36L 1LLFA 2Q6WB 2W0FB 2GJJA 7CGTA 1VLQA 3QPXH 1MCIA 2CLZA 3QWOA 2EDKA 5ALCH 2PXYD 4ZAKB 3ZKND 4PJXE 1GC1H 4HT1H 5I1DB 2ZUXA 3IUMA 3E6HA 1THGA 4HS3A 3S8YA 4GKNB 5EU4A 5KW9H 1XGYH 3VG0H 2VA9A 3G5XB 5JIPA 3KPLB 1H8SA 3BKYH 2HJLB 3DBXA 3MV7B 5CP3A 1TJHH 3NIGF 4QRQA 2GK0A 3U48A 5DZLA 1LBSA 3GIZL 5HHME 1BFVL 1JHKL 2X4OA 3FO1A 1QLFB 1F4WH 1YEDA 1Z9SA 1A9BA 1IGIH 3ARGA 3Q5TA 4MNHA 4ZPTA 3X3FH 1T7XA 5JATA 2VJXA 1ZS8A 3VGHA 4LSVL 2DWEB 5F7EL 3QNYA 2BMKB 3M1BB 4HX1B 1SCQA 3D18A 4NT6A 3ZMRA 4JM2F 1BZ7A 3DGCR 3P0VL 4PJCA 5C08B 3ELAT 2GYSA 4MXQD 2ITCA 3MV7D 4LCYA 5L8KB 3VFTB 1MO2A 1LGVA 4POZC 4GXUM 4ZAKC 4HXEB 4MNGA 5JQHC 5DRZA 1IZ7A 2Q8AH 1FZOA 4LSUH 2I25N 1NC2A 4HXBL 4PJ8B 4TQEH 3L1JA 3DX7A 1FJ2A 2BDNH 1R5IB 1YMHA 2V5RA 1SBSL 1W72A 5C09B 1IJ9A 5JW3L 3KXFD 1JPFB 4PV9B 2B2XL 3EDDA 1D9KB 3GELA 2XKUA 3X13A 4ITVA 4QRPA 2E9BA 5C08D 1UVQA 3ARYA 3L5IA 2FLBT 4NP4H 4MA7L 4O2CA 4TULL 1NEZG 3MLSH 1ZJ5A 2XKNB 4Q0XL 4ZGBA 5J3HC 3GK8H 4HAGA 4M03A 2Q1EA 2X44D 3NAAH 5MEQA 3Q5OA 1AD0B 3RWJA 4H7KA 4M1CD 4PJ8D 1NAKL 3ETBF 4Y5XB 3QFJB 3VKFA 3OPZH 1PG7X 3SE4C 4TUOA 4QWWC 1D9KD 4OF5A 1Q38A 1CUIA 1CL7I 3C6LA 4HWBH 2CXGA 4RGMB 3RX5A 3NWOA 3MLXH 3GSUA 1A2YB 4PREB 3IU4L 2X1XR 2WUFA 4OFPA 4LHEA 3WHXA 4WDRA 3F9CA 1CFVL 1N26A 1GIGL 4ZD3L 1R3IH 3OX8B 1UM5L 5IFAL 1CDJA 1YC8A 1EINA 3QFJD 3LKNB 2P47B 4WTXA 4Y2RA 2XT1B 4HC1L 3EJZD 1IUNA 4HIJA 1HQDA 2WIMA 5HHOA 5JW4Q 2A6DB 1QIGA 2Q7YA 1CYGA 5HYJE 4IRSA 4HPOH 5AM1A 4Y5XC 2K3TA 5ID1A 2WW8A 3QDMA 4YXKH 1MLCA 1FAIH 3BP7A 1DQML 3TWCL 1V7MH 1QRNA 3FVRA 4P2QB 3GBML 3BPCB 1BOGA 3MA7B 2QR5A 1I9JH 3QCTL 3IGAA 3MZGB 3HPLB 4MGXA 1CGUA 3IXAB 5IQ7H 3ZDYE 4AN0A 5CGYC 5D71H 1DT3A 4KKBD 1RK1B 3WNKA 3MACH 2QR0B 3O9MA 4HGMA 2DQUL 2X9XA 3OAUH 5HHXH 4MMZC 1H8OA 1LMKA 1S9WA 3LQAL 4C4KT 1F4AA 3LD8C 3HC0A 4FXGA 5F44A 2EYRA 1YEEH 1FFOB 4PJEB 1CVSC 2NW2B 1VA9A 3BAEH 4JO3L 4DFIA 4P2QD 1UWXH 3UP1A 3EBLA 2E6JA 1A7NL 4EQ3A 2Z92B 2XUPA 4N0UA 1TFHA 4Z0XA 4QRRB 3D87B 1CIJA 4UB0L 4XBGB 4XPFH 3V6ZA 4Y7MA 4PPTA 3IDMB 1INQB 3WKCA 1CTNA 3IAQA 4KRPB 5TJWK 4WEMB 4OPMA 1JNNH 1F3JB 1IFHH 1IBGL 4Y1AE 4HUVA 1NJ9B 4NNPL 3SE3A 3WUZA 3H3PL 2OL3B 3SCMC 3HXKA 5J6HA 4WY8A 4YHML 32C2A 4JEIA 2QZPA 1ZAGA 4N8VA 1DBKL 3TBWB 4F7PA 3K1KC 5DA0B 1XRPA 1TPXC 1ITBB 3RWEA 3DPBA 3NACH 4JHAH 2YD1A 1YYLL 3WXWH 1AO7B 2CMRH 1VGEH 1WV7T 5DFVC 1I7ZA 2ERJB 3FZUC 3A70A 5EA0L 1TZGH 2AJ3A 1MFDH 4PGEA 4HUWB 4KRPD 4OZGB 3Q8WA 4H20H 4P5TA 3MRNB 1IGJA 3HCVB 4KXZH 3UROR 1ZD4A 1NMBH 3HNSH 5K3CA 1CDHA 4AG4L 4EN3C 4EXPX 4JAMA 1EHNA 4K8RC 5CMLA 5JW5B 3BZEA 3OTQA 3I50H 1J5OH 5CT4A 3STWA 3CSBA 5DUPH 1AO7D 5IKXA 1SVZA 1QTRA 4BH8A 3MV9A 1LO2H 5A2KH 3CVIL 4JPWL 2WWKO 5AZEH 1IQWH 3DIFA 5FGCE 3LHPH 1T66C 1J88A 4JZOB 4Y4FA 5T3XL 2QJRA 3U4AA 2OZ4H 3K6KA 2CJUH 2X05A 1IGCH 2BC4A 2XNAA 5CIPH 3V0AC 2F9BT 2D0GA 4OAWB 5FGBC 1DR9A 1VFUA 2E9JA 5ALEA 4PIRF 5DEGA 1AGFA 2FX7L 3QQ3B 4UBNA 3H2IA 1J05B 5IG7A 1F0PA 4UFNA 3G0CA 1IGYA 3UTTB 2V6HA 1QIIA 1TJIH 3GMNB 3QEUA 3P73B 2Y7QA 5L8JB 1XKLA 2HRLA 2FO4A 1DL7H 4OGAD 3TIDB 1NANI 1P5UA 4JN2B 1PZUB 3D69A 1MIEH 4MQXC 1BQLL 5CAYB 3VFMA 4ODVH 2HT4D 1RUKL 4HULB 1G9MC 5DGQA 3T3PE 1W0WA 1JE6A 2J5LB 4LARH 1LO0H 1FHGA 1U8LB 4P5KA 4PJCF 5F1IB 4K6HA 4Q34A 3SOBL 3Q1SH 4G8FB 2FJGB 5AM0A 3BMWA 2D7TL 1QEWB 1A6ZB 4ZXBC 1JK8A 3AC0A 2C3HA 4M7LL 3RNQB 3WMSA 1EZVY 5KBYA 1IGML 1XZLA 3MUZ1 5IHLB 4PJBE 3K8MA 4WHYH 5EIVA 3AXLA 4EJ1C 2DLHA 2VL5A 4QRSB 4CADB 1MF2H 2B61A 4ZSOA 4HAIA 1A6UH 1T4KB 1ADQA 2AJLI 1AXIB 4L3CB 3JV4B 2UY7A 4X85A 1RUMH 3D3VE 4JQVC 4GSDH 3BP5A 4KUCD 5F1SA 3MGOA 3WS3B 4WFGE 4PP1D 1ES0B 5CJBA 4GAJH 5EFIB 1D6VL 2J5LC 2FH8A 1C5DB 2CK0H 4C83A 4MJIB 1CDGA 3D6GA 1U41A 4S1SL 4V1DA 3LS2A 1KEGH 1BCSA 1WISA 3FOMB 2XKSA 4KTEH 3ESDA 4K3DH 5LKAA 4Q9RH 2WINA 5CJOH 3VDBA 3BIXA 4Z0BH 4KK5D 5EIIB 3JTTA 1ZTXL 3R1GH 4QRTB 2V2WB 1G7PB 4X3CA 1CDBA 3TH2T 3MLYL 4OCXL 3LCRA 3ARBD 4IDJH 4PJXA 5L88L 3DVNB 5FOQA 1E6JL 4PW0A 2PXYA 3CSYA 1Z9OA 1PSKH 3HABA 1AUOA 2EECA 3RVVC 8FABA 3BX7C 3UPRB 3VFOB 3GKWH 2JJVA 3LSOA 4P23B 4P9HH 5K33A 2AJVH 4UPDA 2CO6B 5ALGA 3WEXB 4MEAA 4UTBH 4C57C 4IMKC 5EB9A 2DIAA 2XTJC 4J2XA 1QO9A 2X4PA 4LAQH 2DQEH 4QCIB 3HPJA 5GGSB 1QOKA 3ZL4L 2A38A 1NBYA 2HDWA 2P5EE 3QG6A 5C8ZA 2R2CA 3TLRA 4XRCB 3R41A 1EPFA 1KYOK 2CRMA 3PGFH 4P23D 3P9WB 3I02A 2WLYA 3WK9A 2CPCA 5AI0A 1AP2B 1IGTA 3EGSB 2RAUA 5DSCA 4PJAE 2FECI 1J86A 1O0VA 4XVUC 2EDJA 1DN0B 1GPOL 4QHKI 2CGRH 1KFAL 1QLFA 4KI5E 3QIWB 4D0DB 1MRFH 1CFSB 1ZK9A 3HZYB 4U1GB 3IDYB 3VRJB 4DGYH 3KXFA 1HYRC 2VAAA 5B38A 5JZ7C 2WTMA 1JTOA 4ZO8A 5ALFA 4I1NB 4KAQL 4KDTC 2F5BL 3QO0A 1YNLL 4HIIA 5GISH 4POUB 1NCWL 4X9GA 4GBXD 5HY9A 2VLJB 2XMSA 1K5PA 4LSSH 1R0AL 4FBMA 3TNMA 4M1DL 2AVGA 1TCBA 4WWKC 4MXVF 4O2FA 1R5IA 3QIWD 1GGUA 4Z7WA 5SWSB 2JIDA 1QIHA 4QNNA 5DHVH 1FNGB 5D7BA 5HDQL 4L3EE 1A88A 5HF9A 1DJSA 3FO0H 3I2GA 5L2JB 4NKDA 3I2CH 3MLPA 4BQ6A 5SYMA 1JWUB 2H26B 1F4XL 4NUJA 5C0CE 1RURH 4Z8FH 3WKML 2O5ZH 2XKNA 5T5NG 3WS6A 2VLJD 4PY7A 1S9YB 1IC7L 3ALXA 5HKAA 5B38G 1UM6L 3C5VA 3VXTA 1UWEH 3GM0A 4O08A 1Z9MA 3MREB 4MJ4A 3TJHD 1I9IH 3IRPX 5SWSD 1UCBH 4M9OA 1NU8A 5EZJA 3O6KH 2H7CA 5J57B 4NZRL 1MPAL 2APXA 1A1OA 2JJTC 4W6XB 3L3GB 1E66A 3GMLB 5AKZA 4KRYA 4AX4A 4QXTB 2D0HA 4JANA 3CVHL 3LRSA 3CPLA 4X80H 2ESVE 5D6CB 3PXJA 2BOCA 2NX5E 3GJFA 5A1AA 2XWJB 1UKCA 4QE3A 2V97A 1JGVL 3W2DL 5I30L 3NTCL 3U7WH 5J13C 3V9FA 1WBYA 3BO8B 1XGPA 4HIXH 1RWQA 2XLCA 1TTFA 4XMLH 1X44A 5MP6L 5D70L 1NMAL 2WIDA 3C87A 5GS2H 1W75A 5JHDE 3B9KB 2EEBA 5LQBH 2IH3B 3MLRL 4WVRA 4OLWH 3ALPA 4D9RD 3JWOL 1D5IL 4I48A 3QHFL 1NAML 4ACPA 2GJZA 2WQZA 5F7KC 1IRAY 3RZWA 4G9EA 4UOW0 5FM5M 4GEGA 2G63A 3FFCB 3RVTD 5K9OB 3MCLH 2X4UA 1RSFA 2BNRD 3MXVH 5EN2A 3VE0A 2BY2A 4ZFZB 1KEZA 5L7XH 3ARWA 1QSFB 3V5DA 3VI3F 2WG2A 4H18A 3IXAA 4HJGA 2Z4QA 4XCCH 2PSHA 2H7XA 1W6RA 2CKNA 2QR0A 9CGTA 4I3GA 3SGDI 5IMMA 3T4AA 3UPAA 3B9KD 5B4MD 4ZFFB 3IETB 2JTDA 1M05B 1X9QA 4KTDH 4HAFA 3D85B 4Z7QF 3LN4A 1FFOA 4PJEA 4PJDE 4G8CA 3FFCD 2XQGA 3K1DA 2CR3A 2QBWA 2HA7A 1DSFL 3BH8A 3OKEB 5CILL 1QSFD 1TQCC 3ESBA 4Z76A 3LKOA 1OD9A 4XC1L 2YRLA 4NBXB 2O26U 1XF1A 3OR7B 5E94A 2NPLX 5E9DE 5E2UL 3U83A 4QF1A 3D85D 4LQFL 2B0SH 3LKQA 1A7UA 4NZJA 3PQYE 1CUHA 3HUJE 4K7PH 4FQHB 4OLVH 3VRIA 4PFEA 4FRWA 3AMLA 2PW1A 5C70A 1MRDL 3CN9A 2L7UA 1ZT7B 4YEFA 5C0ND 5EWIH 5GGVH 3VMPA 5C0EB 1EXWA 3EOAA 1A21A 5AZ2H 5E95B 3ZE0F 5T1KA 4DN4H 2BVUA 2OTUB 1PKQB 3OXSA 1AFVH 4OZGA 4PJXF 2C1PA 1FNHA 1U2HA 5TQ0L 4G8DA 3MRNA 4LASH 2E3VA 1MI5B 4CVUA 5D5ME 1S3KL 5C2BH 3NCCB 3WL5A 3CU1A 3UAJC 3QIBC 2WMPA 3MV8E 4ZUVA 3UJTL 3FONA 3ARUA 5EBLA 4ZOEA 2BNQE 4YXHH 2H6PA 2JB5H 3F12B 4ZNEE 1OILA 1BREA 2VLLB 3MJ6A 5C9JA 2QQKH 4KGJA 2DL9A 5EUKB 1J0YA 3SPVA 5KVEH 3VXQA 2EC8A 3EO0A 5I75C 2ID5A 2HLFC 1HHKB 5DDHB 1FL3B 2FD6L 3HR5B 4HUXA 2AJZB 1PEWA 5B8CC 2R0KH 4UDUA 5AKJA 1S8OA 1U8NA 3KYKH 4XAWH 4OAWA 2H2SC 1A47A 2XY1A 5KVDL 3QQ3A 1RP1A 2Z9TA 1UKQA 4G6KL 5DQJA 5KREA 1QD0A 4J3SA 3ISWA 1T22A 5ALLA 2FUKA 3OKMB 2P44B 4POYA 1KEML 4JDZA 3VWKB 4I19A 4LKOA 4PJBA 1XF3A 3IUNA 1FL6B 4QHNB 4NFDA 4HQQL 5C07E 3SDDA 1T89C 2HJFB 3MUGB 2GBIA 1U8QB 5J11B 1C5CH 1RJCA 3FT3B 3AM8C 4F33B 1OAUL 5HTSA 5AK5A 4M7KL 3ZTNH 1EK1A 4RFNB 3C6XA 4LHJB 4J1UA 3MBEC 4GWLA 4RFEB 4LVHB 3WIHL 4DAGH 2FJGA 1RZ8B 3QDGB 1WBZA 4Y19E 2QT9A 3AZOA 5GRJL 3QQ9C 1A6ZA 3MBXL 1HNGA 1FH5H 4JY5H 1ORQB 2X10A 4UV4H 1DU4A 5IQ9B 4FG6D 4K3HA 4P3CH 3F7VB 5FYJD 5I15L 2FEDC 1F58L 3ULVH 4Z7WF 3CCHA 3EDEA 1BGXL 4PG2A 1IVLA 1E27B 3TPUB 1OAKH 4CADA 3WMRA 3LKSA 5C0AB 4S1DC 3PL6B 1YPZB 1G66A 4Q2ZB 3LQMA 3VWKC 4NHUB 1OTUD 4LPXA 3V4UH 1BRTA 3BH9A 4PB0H 3NFNB 4PTTB 1Y18A 2H32B 4QHUB 3QDGD 5DWUH 4FABH 2ARJA 1RUQL 1MJ8H 1CV2A 2X76A 3M17A 2LIPA 2HT3D 1GQSA 3D2AA 2QKIA 4RISL 3BXNB 1YMME 1EA9C 3ARBA 3QULB 3P9LA 4RFNC 3SDYL 5IROC 3RJDA 1WEJL 4FFYH 5AUMA 1FO0B 1XF4A 5C0AD 4R4FH 3GMOB 1RHHB 1CGTA 4M3KB 5JOPE 3MUY1 3V4PH 3K2UL 3T0BA 3BDVA 3PI6A 5IBTL 1G7LB 1XGRA 5EIIA 2XN9B 1JYXA 1FE8H 3IFOB 3FCYA 4OFDA 3I6KB 2ZUYA 1NMCB 5IVXB 4LPUA 4UV7H 3PL6C 4XPBL 4MA1B 3DNMA 5CSZB 2QXTA 1NLDH 2CD0A 2XQBL 4MVBD 4FQPA 4F3FA 1KUMA 3O41A 4QXGL 5CZXC 3DVNA 1ETZA 4CU6A 5GS2D 2FLRT 4JB9H 4JFHE 5DMJB 3ZDYF 2P5EA 1KTRL 4LCUA 5I17A 1AR1C 4GAYB 3MO1A 4X4ME 4IRJB 4XI5C 1BQHA 2WBWB 1NUFA 2GJ6B 4J6RH 5DXWA 3MR9B 2BAGA 4J0GA 1LEKB 4LIQL 1JJUA 1MQKH 4LRNH 1QFMA 4NZUH 1LGYA 2XN9D 1S7TA 4WI4A 3FB8B 1AR2A 3JXAA 4MLSA 2W38A 3WEXA 5ADOH 2VZSA 4XP4L 1F0NA 3H7BB 5F6IB 3EYUL 3DD5A 1QFWL 4UBDC 5C0RH 3F6IA 3IS1X 4HF5H 2HRPL 3BE8A 1YEKL 4QCIA 3V1KA 3QRGH 2PN5A 1PJAA 1I4FB 1TTGA 4OCLC 2RIKA 5AOAA 2MTPA 3KYOA 3NFPA 2GJ6D 4X9FA 3WFZA 2LAAA 1EERB 5E1AB 4PRAA 1T0NA 3TGXA 3PHOB 2ICWI 2FX9L 2RJMA 2BY1A 5FO7A 1RI8A 3NN8B 4GBXA 5IW1A 2WP3T 3O2VL 5KJRL 3RY6A 5HYSB 2EH8L 1EVQA 4NN6B 2MCPH 3F7QA 4IRJC 4KJQD 1DN0A 1DX6A 1VB9A 1QSEE 5ILTH 3QIWA 4D0DA 3HZYA 4F60A 3TBYA 2G2RB 2WWMC 1T1WA 4HKBA 4KJPD 3S35L 4AEFA 4H7IA 2P46B 1NKRA 2DQJL 3BP4B 5F6IC 5C0CA 1H3XA 1I3VA 4DGVL 1EDBA 1XQYA 5KBNC 3Q0HA 3DOSA 1B2WH 3UTOA 3DUHA 1Q84A 1FPTL 1DTUA 3BE1H 5KSAA 1IM9B 1TCRA 4KACA 4F0JA 1HILA 3C5WP 4QO1A 4GS7B 1L9MA 2EKJA 1ACJA 1TK3A 2XZQH 3L3IA 3WLWD 3ARSA 3RHWF 5HGBA 2QMQA 5SWSA 1GZPB 3TT3L 1V7NL 1RVFL 1T7ZA 3FLEA 5C0FB 1CICB 4WFFE 1XEDA 2OZ4A 2YMXH 4NN6C 1UENA 1ED3B 3IKCB 4RGOH 12E8H 4J8RB 5CIPA 3C5JB 1CUBA 4JM4L 5FPPA 5LZ2A 3BKCL 3HMXH 3STVA 5LBSH 3LDBC 2AJ8A 3AY4A 1IM9D 2ESVA 2C3WA 4GBGA 3STXA 2B1AH 4KKLD 2UZIL 2NX5A 1K9TA 3PDOB 3VFGH 5T1MA 2AEIT 3BP6A 3IDNA 5ICXA 3IUJA 3WJ1A 4LXGA 4GRLA 4EI5B 3MREA 2NNAB 5AYUL 3ROOB 4DKFL 1TZHB 4OD0A 3UC0L 4PJIE 2PKYX 1F3DJ 4OCNC 3DL7A 4CG2A 3GSWA 3U2SB 2OR8A 1Q0XL 5JR1H 1CGSH 1CICD 2YZ8A 3ARZA 1KPUB 5HFNA 3F7PC 4R96B 4DK3A 4GS7C 3ZT5A 5JHDA 1MFBL 3B5GA 2Z35A 3QZWA 4U1JB 2HA0A 4X91A 4RQQA 3C5SB 4U2BA 3FB6A 4QXTA 2JEYA 2DYPA 2K2QB 5GIRB 4ONHA 2W91A 2NY2C 2D3VA 1FLRL 4YJZL 3T2NL 2X4SA 3VGAB 3KYMB 2ZYHA 4DMCA 2F54B 3WFHB 3BEVB 4EI5D 1ZHNB 3WNPA 2BNRA 3DGGA 2F5AH 2XMQA 4G1FA 3P3YA 3FCTB 4XMKL 1WT5C 2RFXA 2I07A 1YZZA 3M81A 3BO8A 3VXOB 3L95A 4LNRB 1QIJA 3B2VL 1FZKA 4NNYA 3TYGL 2BOBB 2D9CA 2F19H 2ZCLH 4LP5A 1K4CB 4AEEA 2IH3A 4JJHA 1T2QL 5IVOA 4PJBF 1AQKL 1IKNC 1X4ZA 4NM8L 3RWHB 4YBLB 3GMMB 2H7YA 5J89A 5BXFB 4OSEA 3W0WE 4K2UL 4XX1A 4JZNA 3OHXB 2F54D 4CU8A 3UTSE 1A7OH 4DSZA 3HI1A 2GFBB 4JY4A 4BFIA 2A74A 3SWWA 2CEKA 1QSFA 1DEDA 4N0FA 1EBPA 4KUCF 1A22B 3U9PH 3ARDB 5E9DA 2IQ9H 5CLWA 3ULVE 5IMLA 1E4KA 3MJ8B 4PP2A 4DK6A 2QSVA 3PQYA 3HUJA 3EW3B 2ORBH 3IDIB 5T5FL 3ZYOA 4GG8A 1QHPA 4IOIA 1JUFA 4QOKB 4OB6A 4X93A 3X14A 2H41A 3PIQB 5BO1H 1OCWL 4R8WH 3LRGA 4X4XB 3OJDB 5DJ6A 5F93C 4E41E 4P2RB 2GZRA 4ODSL 3NCFB 4YBLC 3PFBA 1RMFH 2A0LD 5IR1B 5GGRA 5GJSL 4C89A 4XX1G 3QUMB 4PRIB 1JHKH 1ZT1B 3T1FB 4M48L 3VXMB 3IF1B 5D1ZA 1YYML 5T1DL 2YH2A 2HFEA 3WNOA 1AXTL 3VW3L 3CDGB 4LSVH 1I85A 1E3QA 1NLBL 4MWTA 5JD6A 1KCKA 3P0VH 3ARDC 2KZWA 1KG0A 5GGSY 1XZGA 4P2RD 5E4YA 2BNQA 3PWPB 5ID0B 2APBA 4ZNEA 4WENB 1MX9A 4XPHH 3UJJH 2NZ9C 5AIBA 4PRID 3N1GC 1T83C 3FQRA 4UIMA 5DQDH 1PKQA 3OR6B 4JY6B 4KI1A 3IYLW 2UWEA 5IFJB 5FYLD 2OLEA 1SBSH 1H0DB 2QV2A 4BH7A 2IIVA 4E11A 5H2BB 1C7SA 2C58A 3R3YA 4JFDB 2DMKA 3P0YH 3CXDL 2IBGA 4KJYB 4EBQH 4J3WA 5DQ9B 5HHQB 5CEZL 3GMPB 4MA7H 4TULH 4ZFGH 3SQBA 5HDLA 3PWPD 4LRIA 4U6HA 2HU7A 1S7WA 4X0KB 4PJAF 4M6OL 3VXRE 2OTWA 2VISB 3VXSB 4KI5F 4PGDB 2P7TB 5ALSA 1JYWA 5F88B 1TLKA 4JFDD 4IS6B 3RWCA 1P1ZB 2NY6B 1FNEB 1ACYH 4QHMB 2NY1C 2WM0A 5DC4B 4MA3B 3IU4H 4UBIA 3CX2A 1OF2B 1YDPB 5L6YL 1WAAE 5ADPL 1L0XA 2MJWA 1ZGCA 1GIGH 1WFUA 3FN0L 1JF6A 3HAEH 4Y19A 4HHAA 2AEPH 5I19L 2VR4A 4KK8C 4XNXL 1IMHC 1IARB 2QQLH 4FFWD 3OKMA 3LN5A 1P4IL 3P4LA 1MOEA 1NL0H 3VXSD 5JPNB 1X4XA 1MSPA 4KQ4L 1HEZA 3CXHJ 1G9NL 2NY6D 3G9AB 4UNTA 5JQ6H 2HJFA 1DBML 4HDIA 4JPKH 4U3HA 3B9EA 2PUQT 4DKDC 1NUDA 3G6DL 1EFQA 3NCJL 3IXTB 4KAAA 2OS7A 5L0QB 5JNYA 4NPYB 2DKSA 2ILLA 4RFEA 3TWCH 4K8RH 5DUBA 1CD9B 1UZ8B 4OUUA 2XMZA 1CUZA 1EGJL 3RKSA 3MYJA 1CPYA 5JDJA 5HCUA 4KVNL 1JRHI 5JALA 3VH8B 2VLMD 1MVUA 1DQJA 3P4MB 1RJLB 4OZIB 1MFEL 5IHBA 2OCGA 3DJYA 4MX7A 1EBAA 3N1QC 2A2QT 3RU8H 5I1CH 4CCYA 2FX8L 5IOPA 4GQ9L 4BVKA 5D93B 4A6YL 3WZMA 3MRPB 2X7LA 4OF7A 4C56B 1LK3L 3H9HA 2AI0L 4JFZH 1RV6X 3EZJB 1WOMA 2FB4H 2LU3A 3KG5A 2O2HA 4PTTA 1QZ3A 4QHUA 1EX0A 2DI8A 4OGYH 5E1HB 4K7PX 3EFDL 4FQIL 2V5MA 1LK2A 2NY7L 3O45B 3PWLB 4G9FD 3DXAB 1GH7A 2CR6A 2X4TA 5DD5L 4JO1L 2GYUA 5J0BA 2PSEA 4OF6A 1R3KA 5AKXA 4X4MA 4QLOA 3GMOA 4Y0GA 4ZUSB 2VDOL 1L7IH 4C56D 4CI9A 1FYTB 2OXHA 4Y2OA 4QRUA 1G9MH 3E0GA 3SBWC 1IBGH 4NNPH 4QT5A 3MNVA 3IFOA 3BDXA 1EB8A 3I6KA 1ZGLA 3NPSB 1QONA 3DKKA 3HNVL 4HRYA 1BX2B 4Y2PA 3QHZH 2YUWA 3LV3A 1OTTC 3ULSA 3BD5A 3L3JA 2AS5M 5AK6A 1S9VA 1USWA 2V98A 3F65A 2AJXL 3LKPA 2X1OA 4LCWE 1J8KA 3ZWQA 5DVOA 2UYLA 3PHQA 1QBLL 3FBWA 1C5BH 5EORH 1FYTD 1NCDL 4F9LC 3B8YA 1SEBB 1NC4D 2W9EH 2OSLB 1T1ZA 2QSCL 2DAVA 5JA9A 5E00A 2H1PL 4AO8A 3NH7L 5LIPA 1CF8L 1G6RB 3E6FA 4KMQA 4F15B 4AG4H 3V6OC 3H3BC 4WEUD 3BQUC 3ZKMD 1XZAA 3H7BA 5TF1L 3BJLA 4L8SA 4A23A 1QSEA 2OP4L 5F7DB 5D7KD 1OAZH 4J0DA 4X6XA 4PJ5B 2DHCA 3DYIA 1VE7A 2YASA 5IB4A 1QR4A 4Z78B 3IDUA 1OGTB 5E5MB 5FKAA 3FYUA 5T3XH 3P2TA 4HWUA 4HZGA 3G5ZB 1VA4A 2J8UB 4PR5B 2ZNWA 5C09E 1NX9A 3HUJF 1C4XA 4YE4L 4NN5B 1YUHB 3GI9H 4NKOA 3IJSB 4O9HH 4YO0A 1BD2E 1NFKA 3MRMB 3A6CL 2C3GA 4BC0A 1C08A 1F11B 5IV2B 4PJ5D 1CXHA 5IHZA 1B4RA 1BJ8A 3D0LA 1ROWA 5F7UA 4Y2YA 2BVOA 1A7QL 5KS9E 1HSBA 4HG4J 1Z6JT 5FHBL 4G80A 1OAQL 1U8HA 5FA3A 3H0TB 4ZOBA 4X6YA 4HKJA 2J4WL 1BQLH 4Z9KB 3J8F7 4LSTH 2VABB 3LB6D 5DJ0B 5I18L 5EC1B 1IUOA 3BPOB 3O11B 1I7RA 4PJIA 3W11D 4HUNB 3UZVB 4U6YB 5TH2B 5JORA 2VXVL 1OARL 5HYSG 3ULUC 4G4IA 4RZCA 2FSEA 5DTJA 4BSWA 2UWEF 1MJ7H 2O5XH 5H37H 1NGPL 4K3JL 2X1WL 4U1SB 3RNKA 3ZKXC 4I18C 3SO3B 3LMJH 5C0GB 3HAEB 5CGTA 3FSGA 3MUOA 4LLVB 4OIAA 3ROOA 3SDCB 3KPTA 1EUTA 3HZVB 3MOAL 3U2SA 1BMGA 3H2WA 1QO7A 5CRIA 4D9QE 1TJGL 3KPRB 4GG6B 3B9DA 3KLHD 1D6VH 1MREL 4UFPA 1BM3H 2NW3B 4JFFE 2BZDA 2CZQA 4RAUB 2GSIB 3C5SA 1QKZH 3JVGC 3I1YA 1MIML 2OBGA 4CUCA 4RDQG 1R1DA 3BIWA 3DX8B 4XNMB 3UTSA 2DWDB 3T04D 2O7VA 1JYVA 1A7RL 4OF8A 1P2CB 4Y16A 2XQYG 2EXWC 3TRDA 4NRZA 2DICA 4WTZA 3BL8A 3KPRD 2HM7A 4LNRA 3MXWL 2C4FT 5F89B 1WB4A 2N1KA 3SO3C 2G4LA 4NQCB 4OQTH 3SY0A 1K5NA 1E6JH 4Y7DA 1PAMA 3SDCC 5E8EA 1U91B 3PF9A 3I2JA 4QRRE 4QHLB 5D3ZA 2HVKA 1Y37A 5JD5A 4YR6B 1W72L 4CJ1A 2EDOA 3TZVA 4JZJA 1JWMB 2X4NB 1C1EL 2R4RH 3C09B 3A67H 4E41A 5I16A 4DMHA 1M71B 1G7JB 2FGWL 2IAMC 3WL7A 4Z7UE 2CDFA 5HD8D 2J2ZA 1B0RA 1U8PB 5CSBA 5IFHH 4JREB 1F6FB 3UTZB 2V7HA 2R8BA 5DYOB 1N3NA 4KPHL 4IOFD 3BKJL 2OQJA 1VADA 5DA4A 5B3NA 5T4HA 3BPLB 4LGPB 4PY8I 4WHDA 5HDOA 3FAXA 2FIRT 1MY7A 1QPPA 1HXMA 1VACA 4WTZG 5I8KH 5TE6L 4AN1A 3MRFA 3PIQA 4M61A 2P1YA 3HI5L 2ZCHH 1YY9C 1P9MC 1S7VA 3ZYJA 1ULVA 4G9DB 1HKLH 4N5ED 4DN3H 4MZ3A 4ZG1A 1TVBA 2CLVA 4FQLH 4PRIA 2XACC 1FV1A 5DJYA 3T1FA 4KU1A 5HKBA 2RQ8A 1GQRA 4AQDA 4APQB 2EDEA 1BVLB 5DYTA 3BWUC 3CDGA 2EYSB 2K9UA 3TFKD 5ICZA 2H3NA 1A0QH 3MOQA 5LGJB 3PWJA 4GUPB 2XA8L 1X6NA 2V9TA 4JREC 2DJ4A 3ZLVA 2YWZA 2B39A 5FB8A 2HYMA 1CTOA 1YNLH 2J3SA 4WRLA 4KMTL 1INEL 2B4CL 1X5FA 3HZMB 5HFAA 1BVZA 4OV5B 4L8CB 1R5WB 3CFBA 4K7PY 1MFAH 3L1IA 2EDQA 3AS3A 5MERB 5AI8A 4V2CB 4EY4A 1DLHB 4MDJB 5I6XC 4APQD 2ZSHA 1F3RB 5GGVY 1KTLB 5HDQH 1EJOL 3GSXB 1OAYH 5IB3B 3VD5A 3UTTE 5DMIL 5FYKH 2UZYB 1F4XH 1WAAA 2R2EA 4HS6B 1U92B 3CMGA 4Y2XA 3ED1A 2XWTB 3STZB 2CH8A 1JWSA 4FMPA 1J10A 4XCYA 4M93C 4HKZA 1FQ9C 3MV01 4FFWA 1DDHA 1HYSD 2X6MA 2XUOA 4ZYKB 4KTYA 4P49A 3EQ7A 4N8SA 4Q05A 5E0QA 1JGEA 3CNKA 1PG7L 4XVJL 3WBDA 3L7EB 5SX5K 3U36B 2WTNA 4IS6A 5T3XD 5E2IA 1P1ZA 2CKBH 4NZRH 1JV5B 1MPAH 5BW7C 2ZNXA 5E8PB 3PNWB 4HIHA 2ZZUT 1KJMA 1MNUH 2EXYC 1JFQL 1XGTB 2ATPA 4FQXB 5T1LB 5JASA 4H0GA 4W1QA 5T3ZL 4YFLI 1JF1A 1CFNA 4L9AA 1NFDA 5BVPH 2WP3O 4X4YB 1LZLA 1JGVH 2ZSVA 1G0DA 5GJTH 4OCZA 3TYFA 3FQWA 2ZYIA 1ITCA 4S2SA 3LCYA 3SKUD 5I71C 1HWHB 5A7FA 5MP6H 3ZKQD 5D70H 1NMAH 1R3JA 4X6CB 1XZ0B 4HXAH 1U42A 4F7CA 3DOIA 3HMXA 4Q3OA 2EKSA 3EYSL 3JWOH 1Q8MA 4H35A 4MJIE 5T1LD 3AREB 5EOQH 3QQ4B 3CH8A 1DLFH 3IDJA 4OU5A 4YUEH 1FFPA 4G9FA 2QL1A 1YY8B 2XTJE 4XTRC 4FTVB 2CJPA 4H25B 1TNNA 4XVTL 1RJLA 4LDOB 3FQTB 4PJIF 3LOWA 2WBJD 4R26H 4CN1A 1J1OH 4FQXC 5D1QC 1VCAA 4FFZH 4RDQF 4ALAH 5F7WC 3AILA 3FL7A 1X7QB 4LEXL 1JZ7A 3FOBA 1KCSL 1KIRA 1WZKA 3CDYA 3SQOH 5TQ2L 4NMWA 1U8JA 1HINL 3T4UA 5EHZA 4KMLB 1ZEAL 3GMRB 3EDJA 3PWLA 1XLVA 3S96B 1BEYL 2A6KB 4OLUH 2VEOA 1ZVHA 5JIBA 2GTWB 4FDMA 4PQEA 4M1GH 1U2CA 2W9DL 3MRLA 3BDIA 1UB5B 4XC1H 4D9LL 3RWFA 3AREC 1Q9KB 2G5BB 1UT6A 4LCWA 1SJXA 2JCCB 4ZOCA 4I77H 4UMGA 4EUPH 4XPTL 3VH8G 1JPSL 2ZJSH 4DW2H 1U3YA 1GOGA 3WXVL 1PZ5A 4MJ3A 4BUGA 4JFPB 1NC4A 3O4LB 1S9XB 1S7QB 4J3XA 2VDNL 2E9IA 1OAXL 3UDWC 3NIDE 1KLUA 4LF3B 1IAKA 1XRQA 2EIBA 4UUJB 1U58B 4BE9A 3SE4A 1B9ZA 3G6JA 3V4VL 1JZ8A 4X90A 1UK7A 3ILQC 5INCA 4JDVB 3IVKB 3ULVF 4UOW1 4U1KB 1DANU 2C1OA 3VJKA 1H3UA 5ALQA 3TIEA 2V5TA 1S7SA 5TQ0H 2ADFL 4YHIB 5E5RB 1N5YL 1RZJL 4C55A 3EOBA 4HW6A 1BD2A 1QFHA 4NO3B 5JW4N 1WB5A 3O6LL 2I60L 1Y0LA 3RKPA 4JNCA 1Q9OB 4NBZB 4NQSA 1VEMA 5HGDB 1I8MB 3QI9D 4TTGA 4NIKB 4YFEA 2D7QA 1ADQL 4DMFA 1N2RB 3IDXH 2HA6A 5D2NC 4JLRA 1S7XA 3CDCA 4G6JH 5ESVB 2P5WB 1HOCB 3GSNH 1IUPA 5CEXB 1INDL 2APTA 4ERSL 1KENL 5GHWL 2J8UA 4X7EC 4PR5A 3HFML 4RMUA 3WIIL 1IEBB 3ILPA 2FR4B 4CFSA 3KPPA 4UQ2A 4JRYE 2YPVL 2COQA 3H9SE 3K80A 3QWRA 1SBBA 2ED9A 5AICA 2EDCA 5IEKA 3HLAB 1OW0A 2VAVA 5L8LB 3G6AB 2DIBA 1ZA6A 3G5VB 5DRWA 3T77A 5BQ7B 3KPSD 1NCNA 4B0OA 2OMNA 2P5WD 3D39B 2FEEI 1D5MA 2XQJA 3EO9L 2R1WB 1YECH 1PEZA 3X12A 5KZCB 3C70A 1ZWIB 4LCIH 4WU7A 1Z0NA 2VZUA 2IANB 4KROC 2O7RA 3PF8A 2OXEA 1L9NA 1S8DB 2O5YH 4V2IA 3O3UN 1OAUH 1FN4A 3JZ7A 5I1AA 1G7HB 4U49A 3X11B 5K3FB 3WIHH 3RQ3A 4CIAA 1CUXA 5TH2A 5GRJH 4WFKA 4GLRI 4WNQB 4YHOH 1CN4A 4PV8A 5HPOA 1JMZA 2IFFH 2IGFL 3K2IA 3FO9B 1HHJB 4FOMA 1U65A 3QITA 4JFFA 4X6BA 1N5MA 1SEQL 3D39D 4BRSA 5KZCD 4OI8A 4CBPA 2KQMA 2Q86A 2IAND 4Y2SA 4IDLA 3QWQB 5FYKE 3VI4F 3SCMA 2VTVA 5IBUB 5CH3A 1A7PL 3CH1B 5C0IA 2GITA 1I8IA 4XP9H 3QPQD 1UKSA 3CVHB 1TCMA 1DUYA 3HAEA 1WAAF 1A9EA 4YNYB 3C60B 2I26N 3HZVA 5HVFB 4DTGL 3BWAB 2JJWA 1K6QL 2ICCA 4G9GA 1W0YT 1DBJL 3KPRA 4M6NL 1DCLA 3SN6N 1W0VB 4OD3L 4RISH 1OSPL 2X70A 3Q6FB 4C58B 3ZT7A 5IB1B 1J8HD 1WWAX 4MSWB 1M4KA 1QFWM 4M6MH 1RZ7H 4G8GB 3K74B 1NAMB 3CCBA 4EN3A 3DX8A 1MAAA 4UNVA 2CDGB 1QBMH 3C60D 1P2CA 4LDEB 3JWDC 3G8YA 2WANA 5J3JA 4QLAA 1YEIL 4PSCA 4IIQB 3BKMH 1NDMB 3ES6A 3HAEG 1KB5B 1MCFA 2P49B 2ECFA 2GW5A 4R4ND 4ZDHA 4HJJL 2Z93A 1X4YA 3NMEA 3EJYD 5FGBA 4KHXH 3T0WA 2VLRB 5LAXB 2FATL 2HFKA 1IEHA 1GVIA 1ZHKB 1RULH 4PLOB 3S5LB 1EVUA 1CE1H 3MROB 4PRPA 1QGED 4X98B 3WK6A 4AIOA 1CLCA 1FDLL 1YCDA 1CZ8L 1HIMH 1T2NA 4MNQB 5IUSA 2PCPA 3FYTA 2HTLC 1CD0A 1EDEA 3FT2A 1BAFL 3BJMA 6FABH 5LXGH 5E4EB 1MUJA 1PX4A 1EHAA 5EU6B 2KZ1B 2YXMA 2VLRD 4JKMA 2IBZX 3D9AH 1ZANH 4YC2C 3BW9B 4OB7A 4CG3A 1C12B 4JPIB 3BF8A 3BGMA 3V5HB 5MEPB 5BV7H 1H5BB 3WIFA 4EOWH 3AMKA 1LO5A 3V1LA 5D7IE 4G9DA 1RZKL 5E8DL 1OLLA 4H1LB 3GDBA 3QBJA 2EH8H 4ZXBA 1MI5E 5HHNB 4MXDA 3GGWA 3MUNA 4BP8A 2YA2A 3GIVB 1IZJA 1XZCA 4JKKA 43C9A 5FKJA 1F2XK 5DK3A 4APQA 5EU6D 2GTZB 2VDMH 2BNUA 1CXFA 4JFQA 3LKRA 2EDXA 1EIBA 2N7AA 4UBJA 2XQIA 3TJEL 4ETQB 5LGJA 1F5WA 3AUVA 1MX1A 1AGCA 2LABA 3PV6B 3H9YA 2DQJH 4D8PA 3H2GA 5JUEH 1NCCL 4FTWA 3WFBL 3KS0J 3T8XA 2CO7B 3SGKC 2VH5L 1NEUA 5FUCC 3R0NA 2UY6A 1R24B 5CD3B 5IKCB 1FPTH 5IB5B 4PGZA 2V96A 3ECBB 4OV5A 2F8XC 5CS7A 2AJYL 3GI8H 1R5WA 2V2XA 3MGTB 3GUTB 1PKOA 3PWUB 2P8LA 4ODTH 1NGXA 1IQDA 1V7NH 1RVFH 4RNRB 4Q6YA 2OR7A 2DQYA 4KK6C 1LQSR 5FKPA 3SO5A 3EOYG 3UO1L 1OGAB 4MS8D 4YIQA 4NQEB 1QIKA 4G3YL 1GXEA 1HL7A 4LPCA 3BKCH 4Y5VB 3RWDB 4LSQL 2XWTA 1LPPA 3DSNA 3WLBB 2UZIH 5K9JH 3MODL 1MHEB 2RB8A 4Y4KD 1U3HB 1IAIH 3WJLC 1IMJA 2LAGB 4Z6AT 5FAAA 1ZXQA 5SYNA 2O93L 2GKIA 5CGMA 35C8L 1IT9L 3TA3B 5I66B 3DTXB 4FZEH 4GAGL 5KS9F 2X09A 4UT7L 2GBFA 1OGAD 2VSCA 2JIXA 2FJHB 1VXRA 2YD3A 4NRXB 5ETUA 4P4KC 3KHQA 15C8L 4ODWA 5T1LA 3VDAA 1JGUL 1FLRH 1QG3A 2XOTA 4X7TA 2Z91A 2EO1A 1XH3B 1WBXA 3CFEA 1U3HD 3S37H 1P4LB 1SJVA 1YPZE 3I9GL 1JGDA 4GQPH 5GRVK 1A8UA 2V2TB 3MZTA 2OGTA 2WBJA 4U2GA 1HXYA 4OBSA 2HH0L 3TYGH 4U2ZA 1XZ0A 5LP1A 2CIIA 4RAVB 1E4XI 3QPXL 4CVZA 1EVEA 1T2QH 3W2TA 3GBNH 3D1MC 4IQ4A 1AQKH 3OGCA 2BHYA 5BVJB 3RVWC 5ALCL 5ALRA 5ESAB 1GC1L 1RIUH 4HT1L 2AJSH 2HFGH 3TA3C 4QTIH 3FCXA 3U0TB 5A43C 3WZLA 4P5MA 3MRIA 3TO4B 3IVMA 5KW9L 5C6PB 2QADB 1XGYL 3VG0L 5C86A 3GM8A 2W60B 4HLZH 2VLKB 4IOSD 2BCKA 1CDCA 4LHQB 4M4RA 3H18A 4TVPE 1TJHL 3DNKA 4WUUE 3FOLB 5IVXE 5IVKA 1RUAL 2F8VA 2AJDA 1D5BB 1GGCL 3BUYB 5JO5A 3DMMC 2GK2A 4JKWA 4X9HA 1F4WL 5DHXB 4UHBA 3G02A 5FDFA 4NKMB 2P24B 5IB2B 4NRYB 2WUBH 3TO4D 3WD5H 1WIPA 3IB3A 3L9RA 4F58H 5JIIA 5CJQL 2QADD 3S96A 2A6KA 4WI5A 4WWKA 5H37G 2X8BA 4AJ0A 1Z5LA 1YQVH 5JDSA 3EAKA 4ODSH 5BS0D 3LVEA 4XXDA 3KWFA 3EYFA 4OQTA 3REVB 3T0DA 1Q9KA 4K7FA 3DO7B 1F4YL 4UT6H 4M48H 1YYMH 5T1DH 4XP6H 2Q8AL 4ORGB 1BBJA 1BFTA 3R06A 5EH1A 3DL4A 1AXTH 4TQEL 4KE7A 4DEPB 2BDNL 3MV11 1OM3H 2RGUA 2GAZA 4HCRH 6YASA 1NLBH 1TNMA 4Y4HC 3CXHK 5E5UB 5DVMA 3MCG1 5C3LD 3GBSA 2GI7A 1I6WA 3W81A 1FFNA 1OTSD 4WW1B 2BJMH 2HMID 4ZO7A 3DV4A 4NP4L 1AH1A 2FJFA 4LLMB 3UJIH 4FLEA 3MLSL 5E56A 1AJ7H 4P46B 3NIFF 1H3GA 4Z7UF 5JXEC 1MCWW 3QI9A 1X2BA 3CXUA 3GK8L 2WU4A 1EEQA 1UGNA 3C45A 3NAAL 4W68A 2IWGA 3RDTB 5ALBL 2JJTA 3RTQB 4LXIA 3RWGA 4RAHA 4NYLA 1XIWD 3OPZL 5SV4A 3ARFB 1T04B 4AQ1B 5DD1H 1J12A 3H9SA 3O8XC 4HWBL 3U9UB 3KDMB 5GXBB 3MLXL 4OM0H 1LP9E 4AENA 4X6UA 4LDLB 3O9WB 4L8DB 1MHCB 3GKZA 4DEPC 4PTUB 2VT7A 2R69H 3TVMB 4YHZL 5DO2D 1MHHB 5FM4A 4MCZA 1N8ZA 4LLWA 3RZCC 2R8SH 1MWAH 4P3DA 1R3IL 5FO9B 3KPSA 4WV1B 2AP2A 3FTGA 1ZT4A 3RTQD 2CLRB 3OKDA 3C6BA 3ARFD 1JF5A 2AERT 1ZHBA 4P46C 3PP4L 3BESR 4MXWH 1UXWA 5JLZB 4MJ2A 1UOQA 3K3QA 3RDTC 1DQDH 4H5SA 4I3RH 2Y2UA 3O9WD 1G7QB 5IVNA 2KQNA 3FRUB 1AHWC 1F8TL 1FAIL 2JK5B 2Y1VA 3GSOA 4W1SA 1KPRB 1F42A 4G8EA 4GMSH 2QS9A 1I9JL 2R1WA 5J12B 1G9NH 4GW5A 5ESQA 5IMKA 1BU8A 4DSAA 3AUKA 2IANA 3TVMC 5IQ7L 3HSSA 3VMOA 2I03A 1AGEA 2WIIB 4TNVF 2SEBB 3B83A 2JGIA 3OAUL 2IALB 2IBZY 5HHXL 4Z7VA 5K3FA 4I4WA 3H17A 4K71C 1EGJH 1YEEL 2DOCA 4DVBB 1L0QA 5HI3C 3BPNC 1HHJA 3BAEL 2NY3C 4G7VH 4YDKH 2PO6C 2CKBA 2P48B 4UQ3B 4I9WD 1J8HA 1QPXA 3BDBA 5A62A 1U95B 1EA5A 1ONQA 2YPKA 3HYSA 3PGDA 4HUMB 3R0VA 3GSVB 4I0PD 4XPFL 4G43B 1CRLA 2PSFA 5IMOA 5EBMB 3V0VB 3SE8H 4RBPK 3G7NA 2J88H 1H3PL 4FQIH 4PLKD 4WW2C 1IFHL 2RBLA 1AZWA 4ZUUB 4LLUA 5F72S 2GCYB 5KOMC 4OD2B 3VXUB 5KG9A 2R1XB 1T20B 3HB3C 2D7NA 2BVQB 1A1NB 1AIFA 1ORSA 3LEXA 4H8WL 3FQNB 4MSWA 2IMMA 2VB5A 3NACL 2ZSIA 4JHAL 3VXPB 3WXWL 2CMRL 1VGEL 3VGFA 3QIBA 4ISVB 1MFDL 4HG4K 1CLZH 1FZMB 3FRPA 3VVMA 1CCZA 3IDGA 4KZDH 3PUIA 1I7TB 4H20L 2ADJA 1E28A 1TZIA 1BCRA 1DVFB 1BIIB 4QOKE 1NMBL 5IBUG 3HNSL 4WDIB 4BQCA 1X5LA 4M00A 3VXUD 4PO3X 3GJEA 5B39B 4V2BA 3IKKA 4DOHB 2AK4A 1G1CA 2RCSH 2R2HA 3I50L 4ZS6D 5GSRB 5B8CA 1J5OL 5CHNA 3TBSA 3V79C 5DUPL 1L7TH 1QBLH 3HE6C 4P2OC 5LAXA 2IPUG 5DJCA 5E8OB 1BFOB 1LO2L 2CRIA 3TH3T 2CKMA 3VXME 5AZEL 1ZHKA 3UTQA 3ZTJH 1IQWL 2NY5C 3MROA 3RWIA 4LPWA 5EU3B 3LHPL 2H1PH 3PF2A 5D7IA 4U2FA 1TVHA 3RVUC 2OZ4L 2XUJA 4KE8A 2C3VB 4TTDD 5EUOE 1TIBA 4J3TA 1DVFD 4YPGB 1QA9A 2CJUL 3S34H 4RA3A 4Q6IB 5DK0A 5TF0A 1Q94B 3RX8A 5TF1H 3U4EB 3MRBB 5MENB 3LQZA 3P2MA 3U7AA 5F96H 4JN1L 1BHGA 3QRFM 4EUPA 4MAYB 1FORH 1KIQA 1N0XH 4I2XB 3AM8A 1TJIL 3LEVH 1H5BA 3MBEA 3QCVL 4LOUC 3ZYZA 5J6GB 4BVJA 1DL7L 2EEAA 2EDFA 1LD9A 4YE4H 1B0GB 1CFTB 1IGFL 2O61B 3T65B 1MIEL 5EO1B 4ODVL 5I73B 5IEHB 2DQDH 5INDB 3A6CH 1WZLA 3OBAA 4HGWB 1LO0L 2H9GA 3QDJE 3S5LG 4HBQA 2VXSH 2AEQL 1RZFH 3W5NA 4MAYD 4G6FB 2H8PA 2R9HC 4YBQD 1UJ3C 3Q1SL 4HFUH 4MD5B 3W82A 1GGVA 3PV6A 5L9DH 5FHBH 1UYWL 4GH7B 1R5VA 1OAQH 1U8KA 1SCKA 4AL8H 2YUVA 3O4OB 3VXSE 5LJYH 1YS1X 5KSBE 2CMFA 1KLGB 1JP5A 4MCYA 1NGYB 4CGTA 5K3AA 3FB7B 4Y4KA 4F80A 3U46A 3W39A 1C7IA 1T1XA 4G6FD 4Q3LA 2ZSWA 2VXVH 4R0LA 5GSVB 4H1LG 5JIHA 4M0FA 4R7NB 4QHKJ 1ZLUH 4GAJL 1JPTH 2VLME 2CK0L 1OSZA 3T3ME 5CEZD 1NGPH 4Y5VA 2ONCA 3RWDA 4HS9A 4Y2UA 2DQFB 3IJYB 3WLBA 1NGWA 4RBPH 3TEJA 2A9MH 4S0XA 1QNZH 1KEGL 4JM2B 2NXZB 1MLBB 4H0IA 3TCLA 4K3DL 1F97A 3QEQD 4YHNA 3MOAH 4GXUN 2XI9A 3ZE2E 4Q9RL 5CJOL 1TJGH 4TNWK 3SDXE 1AKNA 2Q76B 3DTXA 4EVNB 1UK8A 3WKDA 3A6ZA 2PTTA 3VFRA 4BZZA 1CUSA 3WN5B 2EDRA 4WU5A 3MFFB 5TGBB 1QR1B 1XR9A 4P4RB 2PR4H 4IDJL 1YN6A 2QVBA 1WICA 1PSKL 2I5YH 2BGRA 4JM2D 2HA2A 3WIHA 4NQVB 5D9SB 4NQTA 3FO2A 4WHTA 4YHKH 4NFBA 1HI6A 3GKWL 3MXWH 5DJ2A 4WUUA 3P4NA 5IIEA 2AJVL 4YX2L 4YDJA 3QUYD 3WWDA 2I9LB 3DXAE 2NXZC 4LKCA 3LH2H 1NPUA 4A6YB 5GS0C 5BVJA 3DV6B 3HMWH 4I5BB 4LAQL 5ESAA 4FHZA 2HTKD 2IQAB 5I76B 3H0CA 1BEEA 4TYUA 1KNOB 2HU5A 4XH2B 3V6OE 5CWSB 2IX9A 3AIOA 1VEPA 1MJJB 4Y2DB 3WN5C 1KTKE 1N7MH 4J7AA 3PGFL 5BS0A 1GSMA 1KSRA 5TDNB 2LVEA 3D5OF 1GKLA 5HGHB 4FKBA 5HJ3B 3S3PA 3SGJA 4GW1A 2JE8A 3O0RL 5D7JD 2F53B 2OCKA 3ZE1E 3QIUC 5ALOA 4N0CC 3BI9X 1QIDA 3C5ZB 1MRFL 5SX4I 3T0EB 2OJZH 3MJ7B 3EDFA 1A3QA 1IM3A 2IBBA 3WI7A 5DEFB 3HI5H 3A2MA 3RGVB 2QQNL 1CGYA 2VZVA 1KIUA 4Y2DD 1I1YA 3V1NA 4PD4K 1IZ8A 3R3UA 5GISL 4YHPB 2Z31B 3K8LA 1K4YA 3P77A 4IMLB 2PU5A 4LSSL 2IC2A 2F53D 4X5WB 1XZBA 3C5ZD 1XIWA 4LMQE 5KSUA 1BN6A 1G0YR 5MI0B 4NQXA 2YD9A 4PJ5E 2WFLA 4YGVB 1OT1A 1VXOA 4KRMB 2I3ZA 4NC0B 3FHQA 5C3TA 3RGVD 3S8WA 3RVXD 2M1KA 1LP9A 5C8XA 3I84A 3STLA 4PJGA 4N8CH 1RURL 3VFWB 4JFYB 2Y6VA 4TPRL 3T0EC 4N1EA 4O58H 2VL4A 3EO1A 3P4OA 3ULUE 3ANSA 4ZPVB 1QRKA 3RTQA 3WDHA 1UWEL 3VFNB 5GGUA 4AT6A 1N64H 4URTB 1ZD5A 1MH5A 3KPQA 5DD6A 1UCBL 4AH2A 4PYGA 4A2MA 2ADIB 4J4PD 3BJRA 5C8JB 3O6KL 2Z31C 1HBJA 5BV7A 5DMIH 2HFFA 1B3JA 3OAYK 3RKDC 2AV7A 3DROB 3GMQA 4ZFOL 3SKOA 1RYYA 2FEEL 3DRTB 4MJ6B 1ZI6A 5DNUA 5FHAH 5HHPA 5EFZA 2VUYA 3L6FA 1KCVH 4XCEA 1WT5A 4L8DA 4BSJA 3EYVB 3VJLA 3RUGE 5D7IF 4PNZA 5D7LB 4X80L 3S37X 3VJ6B 4MLIA 3ARXA 3I28A 2CLRA 4AK1A 5JHLH 2VSQA 4ZTOH 3U7WL 1IKNA 3C6ZA 3VFUB 4HIXL 4IJ3B 5DRXB 4KRXA 5EZLB 2XDWA 4EDXA 3B2UD 4GRMB 1D5XB 5M7QA 1P7QB 5A7GA 2E7BA 2ICES 2O2GA 5DTIA 1FCCA 3I3DA 5HI4D 4OLWL 3X3HA 1CR9H 4MYWB 2BFNA 3QFDB 2QHLA 3F8UB 3N06B 3D4LA 4KKNA 4XBPB 3KR3H 3MXVL 3UUEA 3I75B 5HYQA 1CLOH 4ARBA 4XCCL 4GG6E 4I0PA 2Y6SD 2CLZB 4HJ0C 3QWOB 4Q9QH 1P7QD 2IALA 3IA2A 3WWCA 5A6VA 1K2DA 4DUXA 1FLTX 3EHBC 2ZJ7A 4HS3B 3H42H 5EU4B 1RZIA 3WE6A 1KU0A 2VXTL 3VRLE 1IL1B 3DBXB 3C2AL 5EI5A 3VFSB 2ZUSA 1YS2X 5DYYA 2HU8A 1SJEA 2P8MA 2UVEA 3ARVA 5MHSD 4LSDA 1CK0H 2GK0B 4MA8H 1LPMA 4N1CA 4LEXH 2X4OB 5EU5A 3FO1B 3D2UD 4Q7DA 2FIKA 4NQCE 5A16A 5TQ2H 3ARGB 1A9BB 4H0CA 4MNHB 2B0SL 2EYTA 1KN2H 4PRDA 5DJAB 1ZS8B 3WK8A 1SVCP 3QNYB 1T83A 1BEYH 4X7DC 4LQ1A 1LEIB 3D18B 4NT6B 2ZCKH 4PJCB 4YH6A 3AJAA 4LCYB 2OXGA 4D9LH 1D6EA 4MNGB 4OCWH 4JRXE 2OX5A 2J6EH 1FZOB 1J87A 4DN4L 1NC2B 4TGLA 5GZOD 1JPSH 2Y07H 3DX7B 3C6SA 2CDEA 2YD6A 4X6DE 1LE9A 1XRNA 1W72B 1AFVL 5EUOA 5A3ID 4P9NA 1JJBA 3BEWA 3X13B 1UFOA 4LASL 3G0IA 4YK4B 2RGSA 3ROLA 4H88L 1UKTA 4QRPB 5F9WB 4AZ0A 4NN7B 5C2BL 1UVQB 1YEGH 4O2CB 4L4TD 3ARGC 2P4AB 4N90D 3F97A 4PJHA 4YXHL 4WJ5A 2WIFA 2JB5L 4UTAH 5MEQB 3WFCH 1NC2D 3RWJB 5JXAH 2QQKL 1A8QA 1KJ2L 1AC0A 1S7UA 2QHRH 3PGCA 1HSAB 5KVEL 2Z5GA 3FLBA 3OAYH 2VZTA 4TUOB 5KSVA 5DURB 1N5YH 3C6LB 4HWZB 1X6LA 5HVHB 3T4YA 4QRPD 3KYKL 3O6LH 5FA4B 4XAWL 1PY9A 3MRBA 1JZ4A 3QDJA 4OUOA 3WHXB 5AOBA 3KPMB 5D3KA 5KVMC 3MLUH 4H7EA 5CZKA 4MAYA 2IFGA 1T21B 1JTPA 3T52A 4OCRH 4YK4C 4HCRA 5F9WC 1VKXA 5IBLD 2HVJA 1INDH 3CK0L 3E2HB 2VSDA 2VXQL 3HFMH 5DURD 5J6GA 5E99H 4M43H 1R4ZA 1R50A 3BZFA 3C6LD 5DF0A 2YPVH 3LPWA 4ENED 3RIFK 3T65A 3JWDH 3OJMB 2Q7YB 4ODUA 1C5CL 3IDAA 5F7LB 4IRSB 5IEHA 2CBGA 4D0BA 2LU7A 4DVRH 2VJCA 4KRNA 5ID1B 3QDMB 4OQ1A 3ZTNL 4BM7A 5CJ5A 5CURA 1MLCB 2YN3A 5ALPA 1IEAA 4DAGL 3H2HA 2RONA 1P84J 5JTWA 4OZHA 5HVHC 2HHAA 1RIVH 4JY5L 1BOGB 1R6VA 4HFWA 2DDQH 4LKXB 2QXUA 4P3CL 4RGYA 1TVDA 1R3HA 5A2JH 1WUNT 3ULVL 3DWTA 1KCLA 3HRZA 2R1YA 1NGYA 1BPVA 5LKNA 2XUFA 3O6FC 3KJ4B 2KKQA 4NWTH 4AEIL 1S9WB 1LP9F 4FQJH 1MWAA 3QDMD 1S78D 4OCSH 3V4UL 3QEQA 3HC0B 4FXGB 2PU7A 5JZBA 3SDXA 2EYRB 4PB0L 4PJGF 4K94C 4E0RB 4WY5A 1FYHB 2FNBA 2DL2A 4FABL 1MJ8L 2EDDA 5JADA 3QUZD 1SEQH 2AQ3A 4C54A 4LP4A 4IRSC 1JBJA 5I8CA 4Z0XB 4HMCA 4PYHA 5HBBA 1U8OA 4JO4H 4Y5YC 3M3DA 3SK0A 4JM2A 4PJ7E 4KVCH 2GBCA 2FX5A 2DQHH 3MTRA 2N56A 3V4PL 4DTGH 4L9LC 4HUVB 4BQBA 2R29H 2X89D 5J6HB 2FH6A 3QUYA 4JVPA 32C2B 1OSPH 3H04A 4UV7L 1CWVA 4N8VB 5TGBA 4F7PB 5C6TH 1T7VA 4FTVE 2AJUH 1NLDL 3Q0TA 2F58H 3RWEB 5DJDA 1FSKC 1ZIXA 4JB9L 5DJXA 2XPGA 2NTFB 3V6OA 1I7ZB 3OKKB 4UHHA 5ALNA 4Q58C 3SKNB 5T3ZD 4LSRH 2AJ3B 3C8DA 4PGEB 4WI3A 1EGJA 3CFCH 3GHBH 1CFBA 5HDBE 4KK9D 1MQKL 4LRNL 4P5TB 4DKEH 1IGJB 1IILE 4OLZL 4N0YH 4B9AA 5ADOL 1H8NA 3EKCA 4YZFF 4JAMB 2XMRA 2DJSA 5D7JA 3FHAA 3BZEB 2ES4A 4XAKD 2XQKA 5C0RL 5IT2H 2VQ6A 4HF5L 5FECA 1I1AD 4HJJH 4WFHD 3QRGL 5KN5A 4X9BA 5DNWA 4N5HX 2ZOKA 1KXQE 3MV9B 4XH2A 1N8SA 5DMGD 4XP1L 4PSDA 1AXSB 3DUUA 3DIFB 1YB6A 4Y2DA 4Y4FB 2AJCA 1FDLH 4FWBA 1H3VA 1K4DA 5TDNA 3IAGC 3O4LE 4PRBB 4E14A 2VXUH 4AEHL 2BC4B 2IPKA 2XNAB 5J1TC 5E7BA 5E4IA 2OYPA 4G6AD 3QUXD 4R2GB 5D2NE 2R0ZL 5DEGB 4BFBD 3GA7A 2MCPL 1AGFB 2A1WH 1VOTA 5IG7B 1X5XA 4P5TC 1IGYB 3MV9D 4O2EA 4LLAA 3N1FC 3QEUB 5ACZA 4B7ZA 4PS4L 3INUH 2Y7QB 4RMVA 5H8DA 2WHQA 3WLAA 3D0VA 4Y4FD 2FO4B 4BCDA 2YBRA 1RZKH 1UT9A 2YXPX 3D69B 3WNLA 3VFMB 1CUJA 3BE1L 4R2GD 1W0WB 4AM0B 2XZQL 1WFNA 4P5KB 4UBLA 5CLTA 3WNMA 4CVWA 1ZGLP 3EFFA 1ZGBA 4X6FA 3JV6A 3O6MH 4I18A 3TJEH 2WHPB 1WIOA 5EOTA 3BIKA 4BCBA 1ZVSA 1NGQH 1JK8B 4LVNB 3O3AA 1YJDC 2YMXL 5FDWA 4EEEA 4OGZA 1KLFA 4RGOL 12E8L 1N1MA 3NOIA 5CD5D 1XQVA 3RUGA 3VFWA 1HHIA 5DJ8A 2F74A 4XNZB 5EUOF 5E6IB 2VL5B 2XB6A