3C8HA

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-serine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
392
structure length
383
Chain Sequence
VGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
molecule keywords Enterochelin esterase
total genus 106
structure length 383
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c8hA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c8hA02
4U1KA 1X70A 3P0VH 4OU5A 2VXTH 1AGYA 4JDTL 4TULL 5I0ZA 3AY4A 1IFHL 5EBLB 5L8JB 2EDTA 3C6ZA 5E99L 1S7SB 5D4QA 4D0CA 5J1AB 3NTCL 3ED1A 3WIBA 2OM5A 1LILA 3BP7B 5H2BB 1QIDA 3CXHJ 4PLJD 4IMLB 4U1GC 4G8GA 3PWUB 5C0BE 4ZDHB 3U0PA 3SDAD 3RUGB 1CT8B 1PEZA 4M1CD 3G9ZA 2IQ9L 1WB4A 4M7LT 5EIQA 1UJ3C 1AE6L 4UOJA 5D93B 4RISL 2VL5B 2WUBL 3T4AA 2GK0A 4XWGA 3ANTA 4P46C 5IVOA 3UTTD 2W0FA 2F54D 3HCVB 3FFDB 2UY6A 5FA4B 1U42A 6FABH 2VDML 3RRQA 5CT8A 3GBMH 5D6CB 2P5ED 5MEQA 5LGHL 4RX4D 3V9FA 5BW7A 5E8DL 4NQUA 4DTGH 4F7EA 2ROQA 1QO3B 2PKYX 1G9ML 1IAOB 7FABH 5FA3B 5TDPB 2E8ZA 1A6VL 5FA4A 1QFWL 4JRXB 5I15L 2YXFA 5KAQG 4PR5B 4N8VB 3ARBC 3GHEL 3LEYL 3SDXB 3ICVA 1X5JA 1XCTA 1F58H 2HLFD 4PRHA 5TE6L 1D6EB 1YYLL 3GEWB 3TYGL 5C0IA 1EEZB 3SGJA 2NY6C 4Y2XA 3V1MA 4JANA 4XPAL 4XVTH 4TOYH 1KLGB 4V1DE 3O0RH 1G0DA 3HUJF 5I73B 2X4OB 1WBXA 1YCDA 4WW1B 5EB9A 4N8VA 1IL1A 3FFCE 2HT4C 4FMPA 4GKOA 2Q6WB 1NQBA 4YH6A 2FX7L 3QJFB 3EYUH 5DXWA 5F4ZA 3O0DA 1QRNB 8FABB 1XQXA 1QTRA 2VZSA 4MEBA 5BJTB 3H04A 5DLMH 3EYUL 2JEZA 4UIMA 4UT7L 1L0QA 2VLJE 4HULB 1XGTA 4S1RH 4MQMA 2JGJA 4CADB 3FVTA 1F97A 4I18B 1TZIA 5FYLD 2M26A 1CVRA 1U3JA 3I6YA 5I1HL 1L7IH 4OZIF 3EQ7A 5C7XH 4HIXL 3R0VA 3EO1A 3PL6C 2FX9L 4JO1L 4NO2B 4AENB 1KB5H 4QRTA 2AJDA 2XZQH 3T0EE 5DA4A 1QR1A 2UYLB 4KVNH 3RIFF 5I15H 5F9OL 2LU4A 4GKSB 5DFVD 4YGAB 4AT6A 3NOXA 3PJSA 1CFTA 4QDOA 1FZKB 1P9MC 1AO7D 3MJ9H 1K85A 2FIKB 1RZIB 4UT9L 2HA5A 1QSFA 4G9FD 2ICCA 4NN6B 1JRHI 4AG4H 5H37H 2GT9A 4PJ7B 1ED3A 4U6HB 3HMXH 4P2OA 1JTOA 2R0KH 1ES0A 2D3VA 4H20H 5ALOA 5I1CL 4GW1A 3HAEB 5GRYA 1AD0A 4PFEA 2H8PB 5FDWA 3VH8G 4IS6A 3JWEA 5GGQL 3MRLB 3GRWL 1UB6B 4QXTA 5LCVH 4P3CL 1KJ2A 1OT1A 3U7WL 5IJVA 5AO9A 1BGXH 2ERJC 3D0VB 3ZT6A 2R29H 5LGJA 1OQXA 3EQ9A 5FYKE 1MAKA 4JFQB 2YUXA 4JHZA 4QXGL 5EZJB 5IG7A 3PV7A 1KN4L 5DK0B 1AO7A 2EKJA 4Z7WA 2F53E 3G6JE 1CLOL 3EYFB 4QHMA 3P4OB 4DJMA 4LBEB 2BNQA 4JFDD 4S1RL 2F9BT 3QXUA 1QTIA 4XCEA 1S7RA 4WFEE 1RZKL 1Q9KA 1R4ZA 1HCFX 3I75A 3C5JA 1EHLL 4M5YH 5GGRA 1YEHL 5T4HA 4K23L 1G1YA 3QIWB 3QPXH 5DHYA 1T20B 3ULVL 3P0GB 4LVEA 3WBDA 1GRWA 4PJGF 4BCBA 4KJXA 1F3JA 3PABA 1HSAA 1JGUL 4HUVA 4IH1A 1IRAY 4U1SA 1Q0YL 1TCRB 1M7DB 3FT3B 3G6AA 4ONGL 2DQHH 5SWQA 2CK0H 1NGWB 3O9VA 4J2XA 5DHYB 4Z5RB 4NQVB 1S3KH 3FQTA 4H7EA 4UBMA 2IG2L 2FJ0A 2Y06L 1NCAH 3WFDH 3ZDXF 4UBIA 2LU7A 3LN5B 3B9AA 3S5LA 4JN2A 1E89A 3STWA 2BSRB 4OCRL 3G0CA 2BX5A 3DL7A 5LGKA 2NY3D 1AO7E 4Z5RA 3HFML 1JNHA 2IPUG 4S0SD 3ILQC 4QRQA 4RZCA 4ELMB 2G60H 3LN5A 1BN6A 2VH5L 3WL9B 1R3HB 1GKKA 3L7EB 3R06B 3PWNA 1NFDB 3FQRB 2VLMD 1OGAB 2HU5A 5B8CB 3CH1B 12E8H 1HXMA 1AGEA 5JQ6L 2W60B 4XNXH 2DYPA 3O41A 3OJ2C 4OZIA 3PQYD 4JLRB 1ZKAA 3L7FA 4KK9D 4U49A 4PV8B 2VLRD 1T7ZA 4R4ND 5DMYA 1CN4A 3HR5B 1S5HB 4NP4H 4WI3A 4D0BB 5DRNB 5HGHA 3B5HA 4LPCA 3BPLB 1GZ7A 4DEPB 4ZO9A 1U8IA 2APFA 2LU3A 4LLWB 4XMKL 4PV9A 3LRGA 5AI4A 2VISA 3H42L 2R1YB 1XLWA 3WWDA 3CDFA 3FB6A 5DUBB 4PF1A 3C5SB 3UYPA 1JUFA 1WPXA 3MLRH 4GRWH 4P59L 2V7HB 1T1YA 3CC5A 4MXDA 1XZDA 1DSFH 1B9ZA 4K7FB 2PXYC 5D96C 3OWEA 3ZO0A 1DCLA 5ALTA 3MCLL 3GMLB 3INUL 1IEBB 4JVUA 1QPXA 2R2BA 3HPLB 4XAWH 5DJZA 2BVPB 5KVEL 1JUFB 3CSYB 4MA8L 5HDLA 2VZOA 3PL6A 4Y4HA 5KSUA 3G5XB 3N85H 3FQWA 5DTFB 3RVXC 1LPPA 4YBLC 2XQFA 5I1DB 5ITBH 3U46A 4XPHH 4YHYB 3FONA 2H6PA 4PGZA 2FH8A 1DBAH 5GHWH 1PD6A 4LLVA 4MWTA 1NFKA 4IRJB 4GS7B 4NKOA 1MJ8H 3JZ7A 2PW2B 3FL7A 3IDXH 4Z0BL 3QCTL 4PJCB 4BH7A 5SWZE 4PGBA 1AKJA 4QF1B 5IB3A 2WK2A 3C5ZA 1JPTL 1CUJA 4RMQA 3VXSE 1CGXA 4NT6A 4KJWD 4X5LA 1A4KB 5BV7C 3ZE0E 4NFCA 2E6PA 5GS3A 5T33L 1LP9A 3PF8A 3MJ6A 4JREB 3WHXB 4EN3A 3ECBA 3ANSA 2FBJL 4HJGB 4N9OB 3QUYA 3N9GL 2YWZA 1C08A 1FRGH 1ZA3A 3GSRA 3CSBA 2CJPA 4EBQL 3C5ZB 1G84A 1MCKA 5HDBE 2HAZA 5T3ZD 4Y2TA 4BTVA 1BFVL 4PJXB 5KTEH 3OGOE 4OD0A 1XR9A 3I6MA 5KJRH 5J8OA 4LCIH 4KMTH 4MS8C 5JHDD 4HS3B 3HRPA 1HHHB 4FQLH 4JY4B 3JV4A 4OCMC 5I19H 1VJ5A 3FT2B 3MLVH 3QO1A 4Y2DA 1XFPA 3VFGH 5F7HA 4QNPF 5CD3A 1H8OA 3KPTA 1QRND 2Y9RT 3U4AA 1UH2A 1RIHH 4TN9A 2IBZX 4PP2B 3RKPA 3CFEB 3LEYH 3MUZ1 4U1IA 4IOIB 3SCMB 4F9PC 4Y16D 1S7WA 5L9DH 1BZ9A 4NQXA 3OURA 1CDJA 4GAYA 1AHWA 2ITCA 5B38G 1D5ZB 3AZQA 4OLZH 4BYHA 3VA6A 4G43A 3K4DA 3DO7B 5B21A 1KPRA 3UUEA 3I28A 2ZUWA 4PTTA 5A16A 2ADGB 3L5XH 1E4XH 4JGJA 5CXUA 4YUEL 5EA0H 5GRWA 5DFVC 4JRXD 4LNRA 1I8KA 2FEEL 5EIEA 2DQEL 3KXPA 1DQDH 3ULSB 2P48B 1JI3A 1WC7A 4OLVL 1JPFA 1KGCD 3CX5K 3ROOB 5D7BA 3DS8A 4HXAL 5A16B 2WFMA 3IAGC 2VLME 3PJSB 1K6EA 3CFCH 5FOBB 3NACH 1A1OB 2A6KB 2CPCA 2NNAA 1UEYA 4PJBA 4TSAL 3V6BR 4N9GB 3ESBA 4BC1A 1D5MB 5MENB 4QXUL 1WHSA 3AFIA 1P5UA 4ZNEE 4Q6IC 1HQ4A 3C6SB 2HN7A 5DC0A 1BP3B 4OFIA 4KE6A 1RIVH 4GW1B 3SQOH 2V6HA 4OZHE 3VFWB 1OAZH 2PSHA 3NGMA 1YEKH 5ICXB 5FDWB 1FNLA 4DKDC 2CIKB 2GSIB 3Q8WA 1D5XA 4MA1C 5CJOL 2NR6C 2L7UA 1QR4A 3H2GA 3TBVA 3BJMA 1GGBH 2WM0A 5GJSL 4PB0H 3VXOA 4DN4H 3GUTA 3BKJH 3F8UB 3WXWH 4V2CB 2AQ3A 1YECH 2EEDA 4WY8A 4JFXB 5F44A 1FAKT 4XPBH 5D7JA 1HZHH 3K1KC 4HCRA 3BEVB 3O6FD 4H88L 4UFNA 4Y19D 3ZT7A 2BFVH 2VTVA 2OP4H 5FECB 1UH3A 4NGHL 4G1FA 4K2AA 4D9QD 3HZVA 4MWFA 4J1UB 1AC5A 1YY8B 3DPBA 2WUFA 1FSKB 2EIEA 3S37L 1A7RH 3V48A 4U2DA 1FGNH 5TE4H 2XKSA 4Y4HC 4FQ2H 3MLTB 4GRMB 5ESAB 2WIJA 3RWJB 3H9SA 2JCCB 4AN0A 5HBBA 4FQ2L 2D7NA 3AMKA 1MNUH 1DQLL 5MHSE 1ZV5A 1OAXH 1IKFH 4Y1AB 1TCRA 3FT3A 3S36H 3WJ1A 1TZHB 3UXFA 1YY8A 5C8JB 4M48L 3RNQB 4JM4H 5EFZA 4Q9CA 4HCRL 5H8DA 4CVUA 4B0PA 1G6RA 4XVSL 4EI6B 2FJGA 1UXOA 3MO1A 1IGIH 4AX4A 1Q94B 5EH1A 5MEPB 3P77A 4EA6A 2ZOLB 4P4KC 1NBQA 1NUDA 4NHUB 3B2VL 2M2DA 1T66D 2AV1B 4UBJA 2JB5H 3RWDA 1U6AH 3IA2A 2XE4A 3D6GA 3WE6A 3AAZB 2GBGA 4QHNB 3U30C 3U4EA 1LEKB 1K8DA 4G8FB 1E4JA 4G42B 2QJDA 3GO1L 3MUY1 4OM0L 3VXNA 2AS5M 4GS7C 4ZUSB 4X7SH 4S1QL 4DAGL 1CVSC 4ODTH 5D6CA 3QJHA 2IADA 5C0GA 4CJ0A 4K3DL 4X9GA 3BD5A 1FL3A 5JHDE 5MEOB 4M8QB 1NCNA 4PJFE 2Q76A 1K8DB 1FLRL 4LLDA 2D5LA 3PGFH 3NAAH 3FQXB 1QHPA 4NQED 1A6WH 4JR9L 3OKOB 2Y1VA 4Z77A 4JFEE 3UEZA 1R24B 2F5BL 2XQBH 4YO0B 1T7YA 5TE7L 1KCRH 4FLEA 3QWOA 5DK2A 4L4VA 4Y2DC 3VGEA 3IFPA 1YUHB 4PGJA 5C0EB 3O6FB 5C81A 1NGPL 4MX7A 5LVEA 3BHBB 1HHJA 1ZLUH 4GECA 8CGTA 2XWTA 1I7RA 1KBGL 4G5ZL 4IJ3C 3AUVA 1I85C 1EFXB 3ULUC 2ZYSA 3BZFA 3CLFL 2D4FA 5F71A 4LSRH 4H0CA 1YNTB 4GW4B 5T1LD 5IOPA 3F5WA 3HZMA 3IFPB 4DN3L 4X6CB 3VA2C 1ZTXL 3DMMD 4BP8A 4DW2L 3FQNA 3WLBA 3QEQB 4AY0A 2BVOA 2FB4H 3D2AA 4R0LA 3MXWH 1XRQA 1VACA 4K3EH 3CSYA 4AL8H 4Y4FC 1YNTA 2V17L 4GW4A 5F8RC 1RJLA 1A9EB 5GS0H 2CRZA 3LKPA 4H0IA 1BAFH 2RIKA 2BSSB 2BY2A 1HHGA 2AKRA 2O5ZL 3WIFA 3VD7A 3IETB 5FGBA 1QIIA 3SGDI 2FJHB 5DRZB 2OQJA 1J8HE 2DBLL 2IANB 4HGMA 3BWXA 5C09E 1RURH 3C8DA 5EBLA 4L4VE 5HPMB 4WNQB 3MV7D 5KW9H 3HUJE 4X6CE 3MRGB 3OAZK 1H2XA 2WLYA 4CMHC 5EFIA 4P2YA 1BVLA 2NY4C 2DM4A 5GGVL 5A3IC 1X3DA 4XH2B 4KUCF 1T1ZA 2ONCA 3QDMA 1RFDL 1YJDC 1D5IL 5E2JA 1FGVL 2VKXA 4F58H 2SEBA 1XF2A 1ED3B 2BC4B 4FFVD 4YK7A 4TVPH 1YQ2A 2JIXD 1VFBB 4UBDC 5B3NA 1GXEA 1MJ8L 2B5IC 4LFHG 5A2LH 4KHTH 4H1LH 1GT6A 4XWOD 4YHZL 2X9WA 3W5MA 4L9DA 4LCCC 2B4KA 2RCSL 2WTNA 2A2QT 1ETZA 4JNCA 5I1AA 4JO3H 2MQ3A 3IDGB 5HJ3A 3VI4F 1ORWA 4EY8A 4NPYB 4GXUM 5GIRA 1ZICA 2XDWA 3H3PH 5DJ0A 5JDSA 4XNQB 2XUDA 4F21A 4KI1A 1OOAA 1NLDH 1Q9KB 1D6EA 4H26A 1KFAL 2Y25A 3CZFB 3RNKB 1DDHB 2BNQE 1DSFL 4LKCA 1TIUA 2UUDK 1ZI9A 4XP4H 3HHRB 4M4PA 4K8RD 4ZQKA 2I9TA 4HUWB 1IARB 4XPTH 1U8PB 4WWID 4LDOB 2VXQL 2WUDA 4LEXL 3G6AB 3UYRL 1BS9A 4XMLL 4ERSL 2WV3A 3GI8L 5KBNC 1QD0A 4JPVH 1W0VB 1N4XH 2ZJSL 4XRCB 2MHAB 2RHTA 1NGWA 2UWEA 5GXBB 2MPAL 1ZANL 4HUWA 4NKDB 1FSKC 1I1FA 1GAFL 3QEGH 2GK2A 5AAWA 1TZIB 2AJZB 2OQIA 2LIPA 2DTML 5EOCL 2I9LA 4G6KL 2KBGA 4I2XB 4CBPA 4HV8B 2APWA 4WWKC 3G6JF 4XBGB 3U7YH 3QCTH 2Q86B 4Y4KC 1DE4B 4WFED 5F1SA 4NNYB 2Q8AH 1B2WL 5HYQA 4QOKA 3EF3A 32C2A 5CGYD 3OKEA 1HQ4B 3TM6A 4KAAA 5I8CA 3G9UA 1DQZA 1B4JL 1FGNL 2MFNA 1OCWH 1J12A 4FQJL 5DD1L 1N0XL 1E6JL 1CICA 3O2VL 1A6UH 3H3KA 3ULUL 1DBML 1XGQA 4R4FL 5GRUH 3TBVB 1A64A 5CEZD 4YDIL 1IAIM 2ZSVB 3WUWG 2MCPL 2HVJB 2XZZA 1DN0B 3MRIB 3GI8H 4NCC1 3UYRH 1J1OL 5I18H 4AH2B 1H8SA 1DLFH 3IJYA 4QXTB 1K5NB 1T80A 1JI1A 4R4BB 4G9FE 3R8BB 1PY4A 2XFXB 1MHHB 3SQOL 3R3ZA 1GGBL 5DK0A 5EU3A 2ZUQB 1VFMA 1F8UA 4KV5F 1F42A 1W8OA 1AP2A 5HDQH 3CVHA 4LGSB 5EUOB 4U7KA 5JW4Q 4UHBA 1H22A 5F9DC 5CLWA 1K9TA 4MCZA 5DUMH 4CGTA 3IB4A 2NY2B 1U8LB 4NC2B 2EDRA 5GGRB 4M3JA 1E8NA 2B20A 3D2UB 1MUJA 1EVUA 4F15B 5E9DD 4XTRC 1L7TL 4TSAH 4CJ1A 4RGYA 2X05A 3WL6A 1YEJH 4L9LB 2NY7H 5L7XH 4H5SA 2BKLA 3TN0A 2ZOLA 2W9EH 2PVSA 3U7WH 4Q2ZB 2RIPA 2GBIA 3QIUB 4HXAH 3SJVD 5J1TC 2QS9A 3BDIA 5DD1H 2WBWB 2VMFA 1IBGL 5K9OB 4YIQA 3MR9A 3VD9A 1JWUB 3B5GA 2OZ4H 4QKXB 4NQDA 3NZHH 1JHKH 1A4KA 2CO6B 5IHUL 4AG4L 4ZOAA 2QTBA 1TENA 4R3SB 4JKWA 5ENWB 5MEOA 1HXYB 1RIHL 1GQRA 4UI2A 4EZIA 4DCQA 1MTZA 2X4UB 3DECA 2DLFL 5DI8A 2VT6A 5JALA 4FBLA 1UWCA 4RGNE 2ZYIA 1CD0A 3WS3B 1CUYA 2C1PA 5FHBL 5GRXG 5T3XL 4ZD3H 3S88L 1MNAA 4QDUA 1R3HA 4A16A 4XNYH 1IGCH 2PNDA 4HRYA 4XWOC 1Q0YH 4L3CA 5FHBH 5HHPB 4QWWA 2G4LA 4PB0L 3QIUC 4NZDA 1WB5A 4OZFB 4W63A 1EXUA 3OKYA 2WIKA 1ZHNB 3BHBA 1Q9WA 2XWTB 4X7FC 1IAOA 4Y88A 4KE9A 5AK4A 4D94A 3UPRA 4B83A 3SDYH 4KDWA 2NTFB 1Q72L 1REIA 1RZ8A 3RP1A 4MQTB 4AM0A 3TVMA 4NBYB 4AZ0A 1WWAX 2OCFD 3PWVA 4JDZB 1AC6A 3FQNB 1F4HA 1IT9L 1XGRA 4MXWH 4XP9L 3MJ8A 5HK9A 4WUKL 5FDFA 3FQUB 2BVOB 3QH3A 1QNZH 4JHAL 4ONHB 2WUCL 1EHAA 4MA1B 2XB6A 3ARPA 4KZEL 4OFYA 2Q6WA 4Y0GA 4PTTB 3QDGD 4JREC 3WMSA 2XV6B 1T2XA 4D9RE 4ZNEA 4ARAA 3V4PL 5K9QG 4CVXB 1EXWA 2R4SL 3QQ4A 2XMZA 3RWEA 1SVZA 1RVFL 3ELAT 1XGRB 3TO4D 5J6HA 2HG5B 5CSGA 1NBVL 3IAQA 2A0LC 3L1OL 2ORBH 2YD8A 1ZEAL 1JPFB 3BP4A 1KCSL 1YEGL 4MDIA 2NZIA 4D9QE 3RGVB 2OTWA 5JW3H 4HZAA 3RWGB 4GXNA 2B0SL 2RONA 5DTFA 4C4KT 4OZFG 5I30H 4KKLD 4WEMB 43C9B 4YDKH 1Q0XL 1XZHA 2Z8WC 1IQWH 1IVYA 4PJXF 3BDYH 3U2SB 2Q7NA 3ETBF 1DTEA 5GS0L 5JA9A 5ALYA 2QHLA 1GZPA 3FJTA 1BEYH 1XZ0B 2I03A 1EFXD 5B8CC 1O0VA 5AEAA 1P7HL 5LBSH 3IRPX 4WI8A 2AJUH 4L1HA 5GRJL 3I84A 5HHOE 4WO4D 3QUXC 3DMMA 3QWRA 3C2AL 2OGTA 3PF9A 4XP5H 1VPOL 3M81A 3ARGA 2HT3C 2OTPA 2WUGA 1GZPB 1M7IA 3QFJB 6YASA 4G8DA 2VL5A 1CG9B 5I1AB 3VGAB 4BH8A 1IGYB 4PJHB 3TZVB 5IUSA 3BPLC 2H32B 4ZUTB 1EZVY 4NDMA 4F7PB 3P2TA 2W0KA 1OPGL 3EJZC 2FB4L 2OLDA 3EIFA 3ZDZE 1IM9B 4Y4HD 5DJ8B 4PTUB 4M7JH 3IVKB 4RFOL 4QRRD 5GHWL 2EDNA 5CZVL 2BY1A 1W8NA 1X5KA 3H7LA 4J23A 4TOYL 4XPAH 4XVTL 4PS4H 4F9LA 5FUOH 1JPTH 4Z7WB 1EERB 2JCCA 1XEDA 3L3OB 3SDDA 3WIHA 4HQQL 2FO4A 5B3JF 3ARRA 3OPMA 2R0ZL 1LO2H 5TDNB 1XCTB 1T0NA 4M43L 3ZYIA 4BZ2L 1KN2L 5DMKB 3REWA 4FXKB 2ATKB 4K94L 2Y23A 3QBJA 4ZI5A 4K6GA 2MOVA 4JG1L 1PDKA 1W4LA 1DVFA 2IALB 1C5CL 1ZI6A 2DQUH 3QFDA 4FQIH 2XWBA 4OZGB 4N0FA 3LCRA 1MFDL 4LYDA 3S34H 1NC2D 3VFMA 1I3GL 3L5HA 4TUKL 1MCSA 3REWB 1P1ZA 2EC9U 4F57H 4CG1A 4UU9B 1FO0A 4AO6A 4YGVA 1A6ZB 3CPLA 4ZFOB 5D1XA 3N2ZB 2IALA 3F6IA 4KMQA 3DVNA 3EDKA 1AGCB 4CADA 5IP4A 3ARSA 2LV4A 2Y7QA 3BP5A 3BT2H 1A3QA 4DUWA 2J6EL 5MHSD 4LCCA 3SKUD 1SJEB 2HLAB 4ELME 5E99H 5F89B 4PLOB 3U6RB 1EA9C 3BWUC 4NNPH 5CIPH 4YXLL 1IFHH 2FD6L 5JW4M 1N64L 2B1AL 1CDIA 1YSCA 3JWDL 2JELH 3C6SA 1PLGH 5D1QD 1CU4H 4LP5A 5EBMA 1FFOA 4GKSA 5F6HJ 3GJEB 2GUOB 3LS4L 4J8RA 2PSDA 3WKMH 3IDMA 2AV7B 1MNQA 1HK6A 4JFDA 3ILQD 4AZ3A 1VA9A 5GS2D 5D7SL 2EDXA 1FPTH 3S8WA 3JYHA 2DYPB 3KG5A 2H2SD 4DZBB 4W1SA 1LE5B 4UQ3A 3V8CA 4PV8A 5D7JD 1UFUA 25C8H 1M71A 4X91A 5ALUA 4H18A 1UA6H 5D7JB 2ZVDA 4LK4A 2FYYB 4KROB 4UINH 1KT2A 5JD4A 4L4TA 5MEND 3U9PH 2EDOA 4FOMA 3RARA 1F2QA 5ALXA 2IH3B 4MJIE 1SFRA 1NANI 5K3FA 5TF1H 4UQ3B 1LPSA 3BKYL 3OAZH 4XPTL 4ZSOB 5BO1H 4NOBA 1CD1B 3VXKA 1U8NB 3NA9L 5JAOA 2F74A 2OR9H 4JFPA 4OB7A 3G6JB 1EI9A 1A4JA 1KB5L 4YC2B 5JW5B 5T3ZH 1EAPB 3HPLA 4X9BA 2EDLA 1HCVA 3TH3T 4ZSOA 1AR1C 2JGEA 4YNYB 1MJUL 4Q2ZA 1GGCL 3DX9B 2YSSA 3O45A 3PWLA 4RAHA 5CEZH 3QUZD 5LLSA 4F8TA 4H77A 1YC8A 5F7DB 4BZWA 2FJGB 1QFHA 5BXFB 2VN4A 5D2LA 1HKLL 3QZWA 3FRPG 3WN5A 5DLML 4L5FH 1QIJA 1OL0A 1DQDL 5SWQB 1CL7I 3CXDL 4FP8L 3BPNC 3RL1A 1TAHA 4E15A 3W04A 2PSJA 3VFPA 3ULVC 4IRJA 3RZCB 3S35L 1ONQA 4M7KL 5F7YC 1QFWI 1U8JB 2NLJB 4FQQA 1GGYA 3QZWB 2EZ0D 4FG6C 3WN5B 5JZ7D 1H8NA 3HNTH 1ZLUK 4HPYH 1MRCL 3L3KA 1ZGLA 2AQ1A 3ALWA 1MFAH 3HI5H 4KZEH 1F4WH 4EN3B 1FFBA 1T1XB 3H6JA 4U2BA 4P46B 1OXMA 1S7QB 1QBAA 1TCMA 5DURD 2ZUSA 2PBLA 1WZKA 1R3KB 3QRFM 5HY9A 3WYRA 2W0PA 3HNTL 2P8SA 5DD6B 1F0NA 1KJ2L 2X2YA 3L3KB 3CNKA 4YWGH 2FIRT 5IBUB 1PKQA 4PGDB 3TA3B 4X5WB 3CMGA 5JDSB 4M6AA 1JTTA 4N90D 5L6YL 1ZWIA 4IMKC 3AFLA 4TPRL 4P46A 4OLUL 5E1AB 4F7EB 1U95A 1AGEB 4X7CC 4BVKA 3FOLA 2B5IB 2FDBP 4MWSA 4UT9H 2P8MB 2UVEA 4LDLB 3QH3B 1CUCA 1UYWH 3AY4C 1QZ3A 5E00B 3IF1B 4X7SL 1RUKL 3GO1H 4OM0H 2MMXA 2JTDA 2ZUUA 4WDIA 1JWSB 1IGFH 1V05A 4X6CA 1UXWB 2HRPL 4MLSA 1DUZB 4NC1C 2ICWJ 3FOLB 1WISA 5J6HB 3N1GC 2R1YA 3GI9L 3MUOA 4KK8C 4YBQC 2BY0A 1YPZB 2Z93A 1ZSDA 2J2ZA 3QEQE 3BP4B 1FYTB 2V7HA 2JEYA 1OAXL 5KVDL 2AK4B 1YY9C 1DUZA 3D1MC 4HC1H 4JFFD 4NUJB 1CD8A 1U3HC 3MRCA 4JM4L 5ESVA 3GSOA 5D72L 4W6YB 1K8IB 3DURA 5JDJA 4GI1A 5IWLC 1TIBA 2X44D 2WIIA 4KTDL 3ARDD 1QBLH 5D8JH 3RK4A 3BZDA 1FYTA 5IMLA 2GYSA 1OWWA 3NCJH 3U82B 1PV1A 3RAJL 5IMKB 1J8HD 5F7EH 1RJZA 4GMSL 3C09B 4RSVA 4W4OC 5I1DA 1A1OA 4HMDA 3DURB 3V6FB 2QUAA 4GXVH 3INUH 5JZ9A 3V79C 2F53B 2QLVB 2QQKL 4OB6A 4MNGE 4DMKA 3K74B 2QKYA 1C7TA 3OKMA 3I02B 5F3HB 1M7IB 1QQDA 3QFJA 4YHLH 4AT6B 4RFEA 2CQVA 2P49B 1WWCA 4Z7UF 3I3BA 4PPTA 3PQYB 4KI5E 5E8PB 1RZJC 1B6GA 3EYOA 4S1QH 1QYGH 2YC1A 5IVIA 2YMXL 5CUSL 1PQZB 5CGYC 5DZNA 3VW3L 3K2UL 3VRJB 4UFPA 3BESR 4F7CB 1J0ZA 3C60B 4OGZA 1XT5A 1OP9A 3TBTB 2OCKA 1B90A 4ORGA 3EOTL 2FZ3B 1XZKA 2IPTL 2MSPA 2NR6D 3WDIA 1BFTA 1UVQB 4Y4KB 3QQ9C 3SDDB 3UROR 3H2IA 4MD4B 4MAUL 2F19H 2Z31C 4KRYA 4TVKA 5D7KD 4NQDE 1RZFL 4KACA 1I3VA 3PFCA 4F7CA 1I9IL 1CFQB 2VXTL 3O2DA 4JQXC 4RGOL 1CGVA 5IVNA 2VJBA 1J07A 2WHRA 1CQYA 2H26B 3WDHA 3HEAA 3GKWL 4JFOA 3GM8A 3B6SA 1FZMA 3AB0B 4HIJB 1XMWA 1G7HA 5F70A 1DEEB 2VERN 4UU9A 5JIIA 1LO0H 1UZ8B 2VDLH 1W0VA 2YD6A 4EOWL 5ADPH 3I6LD 2WLZA 5CSBA 4AEFA 3LSOB 1DANU 3UDWA 3IFOB 3D2CA 4OFYD 2EDCA 4HJ0C 4NKDA 1T83C 4F8QA 4JHWL 4OI9A 2ZCLL 1UEMA 2XT1B 3QIWD 4Q0XL 4WWKA 1Q94A 2AJZA 5IW3A 2WBKA 5C0ND 2ZCHH 4QHLB 3N1FC 3FYUC 3FB5B 2UY7A 2Q20A 4RAVB 3DNKA 2MQ0A 4FQ1H 4JQVA 3IIIA 2AXGA 2FX8L 4EDWH 5EO0B 2ATPB 3IDJA 4JB9L 4L8SB 3D0LB 2XLBA 5AAMA 3D2UD 2PO6D 2VAAB 1CGTA 5AM0A 1A7PL 4PJ9D 1A7OH 3MOAL 2YUWA 4YZFF 1GC1H 3KJ4C 5HHPA 1UK7A 3K4AA 1N7ML 4HIEB 3TO2A 3ZTJG 3EW3B 2GJ6E 1WTLA 5I71B 1LGVA 3PNWB 1HILA 1ISPA 5ALBH 1BWMA 3I6KB 3KGRA 3MJ9A 1FCCA 3BIAX 5FYLL 3O8XB 2HVJA 4BTLA 4OLVH 1DN0A 3T0XA 5A7FA 2GHWB 4YO0A 4G8CA 4OFPA 1LK2A 3EDJA 4OKVA 4E41E 4CCYB 2A9MH 4Y9SA 4HIEA 1G0YR 1Z9SA 3TO2B 2PUHA 3TVMB 4WFGD 2PUQT 3IDXL 4YUEH 3NCYP 1P2CB 5ITFA 3I6KA 4I19A 1HYRC 1B4RA 3BQUC 1MHCB 4YHKH 3VD4A 2RCSH 3QCUL 4HLJA 4N5IX 2OL3L 1Z3GH 4Q9RL 5DRWB 1BHGA 2VWEC 4NUGL 5AK3A 3O3AA 4INZA 3D3NA 4X7EC 1YMMD 3C45A 3V4VL 1G7IA 4RBPH 1Y37A 3ZLQC 3FB8B 4Y5XC 3TN0D 2HFJA 3I2FA 1T7VA 4LYEA 5E6ID 1OAUH 3ZTNL 4GRMA 4WUUE 3LKPB 4ODVL 4Q9BA 1CLZL 4P5MB 1XZMA 2DLEA 5ID1B 5DRZA 3KPOB 4LDEB 4MMZC 3HI5L 1UM6H 2IANA 4MNQD 3VXSA 1U3HB 5T5FL 4M6OH 4G6FB 3UTSE 4K3JH 3RJDA 1P9MA 3KPQA 3WL5A 3WWCA 1VCAA 4MJ6A 1U0QA 5J13B 3WNLA 2QSVA 1P4IL 1RYYA 2FO1A 4FTWA 5FFLA 5K3DA 2ZJFA 4P2QE 4UT7H 1JMZA 1FG2B 2YWYA 5LG1A 3U0WL 3P4LA 1IGFL 2XNAB 1ZHKB 3KVQA 1KJ3H 4FA8A 4JFZH 4O02L 3VXPA 2DHDA 4P92A 7CGTA 2PW2A 2PYED 2VB5A 3KSRA 4F37F 5F7MC 3SY0B 1UENA 1X5XA 4P99A 1F2XK 1JPGA 3VXUD 2F54E 3MRPB 4N5ED 2YPKB 5GZNC 4OLYH 3VFVA 4G8GB 3F6LA 2OR8A 3NIFF 4PJAB 1CE6B 2C3VB 4AO7A 4C83A 2YRPA 4H8WC 4N8VG 5C0CE 5DZLA 3R3YA 1AI1L 5JMOC 5T5NG 1I8LA 4WU7B 3E3QE 5KANI 3LY6A 1U2CA 3C5ZC 4MQ7B 3RL2B 4TVSa 2OR9L 3IAPA 3L95B 4O4YH 3FYUA 4XP6L 5C08E 3OKOA 1XLVA 7FABL 1J05A 3IJHA 2R8SH 1R24A 1FVEA 1J11A 3UTSA 4MJ5A 4U6VH 2OGSA 5ADOL 4H26B 4XX1G 4EKXA 1CFJA 3G9XA 2BGNA 2X4PA 1FLRH 4GBXB 3KPRB 2R9HD 3U7AA 3EIOA 2DQHL 3WFDL 1VHPA 2G9HA 2X4RB 5DJAA 2XTJC 1H5BC 2A6JA 3MRQB 4PJDA 3CFEA 1JNJA 2CDGB 4QZVA 4MJ5B 3T1WA 4NUJA 3D3VA 2Y5EA 2QUBA 1R3LA 3LKNB 5HGBB 4WUUB 1MI5B 3BO8B 3HZYA 4UQ2A 1P0IA 4HJ0D 3LN4B 3UTTA 3MV7B 2YPLB 3SQBA 4DKEL 1JMXA 1A9BA 4R9HA 3VW3H 1G7JA 4NZRL 4DNOA 4HWUA 3F7VB 5SX5H 5KG9A 1NGYA 4P0DA 4IO0A 4K23H 3IDIA 3SJVE 4U2ZA 5KAQF 1XIWA 1DE4A 4UQ2B 5B3JE 3QPAA 4L3EA 3WV0A 3BRDA 5IROC 3WXVH 3NABL 1H15B 1U8QB 3HNSH 2EIBA 3JTSA 2OPHA 4M48H 2DWEB 2IC2A 1KLUB 4F7TB 4RFNB 3OTQA 4WNQA 4PSDA 4U6VL 1TZGH 4YPJA 4J8RB 3ARFD 1LO3L 5JA8B 3VGBA 2FH6A 2QHRL 3O3DB 5GSVA 3DMMB 4WTZG 1G6RL 4MZ3A 4PB9H 5DVKA 3DKRA 1BQLH 2YPLE 3BDYL 3JUZA 3KD2A 1MIML 4DUVA 1EDBA 1RZGB 4FTVD 3MFFA 3X12B 4EDXB 5LYYA 3OF6A 5D1ZD 4O2CA 1MRDL 1MPAL 3U4BH 3ZMRA 5D2NE 5BMFH 1I1RA 1QKZL 3VDAA 2WIFA 5SYNA 5KSBF 4V1DA 3KJ4B 4RWYL 4HFUL 5HD8D 3RBSA 1RZJL 5C0AB 4ELMF 2BVUA 2AJXL 4ZTOL 1AIFA 1MCWM 3HG1B 4N5HX 2AABH 3S3JA 2F8VA 3T8XA 3IU3A 4HH8A 4B84A 4Z7QE 3T0VA 4YHPA 3PDCA 1W72H 3OKNA 5GIRB 3UAJC 5EUOA 5DJ6A 5CH5A 3DSFL 1D9KA 4XI5C 3WYNA 2VLJA 2YRZA 3DYIA 4L3WA 1N6QL 3QZWG 1VPOH 4S1SH 2ZJSH 4GKNA 1GQSA 1J0YA 4M0MA 1IQDA 4NM4L 3U0VA 2IQAB 5DFTA 2H2PD 3C6LB 1QIEA 1QFSA 4MB4A 4OF3A 3HLAB 5F6IB 1ZGCA 2CEKA 3QG7L 5AZ2L 4LLMB 5DEGA 1U8KA 3ZSSA 1CV2A 3WNOA 3QI9A 5KVGH 1U65A 5C8JA 2FGWL 4NWUL 2FATL 2F54B 3RNQA 1GZQA 5SWSE 4KQ3H 1FO0B 2JJSA 3I75B 3PHSA 4XRCA 2XQGA 3CAFA 5EO1B 3WD5L 3BYTA 3O11B 1K6QL 5BVJA 3MSPA 3FCTB 1HSAB 4HUVB 4DMHA 4NQDB 3WNKA 4XIIA 3TYFA 5AI5A 4DLNA 4LEOB 3PHOB 1X5ZA 3P77B 1TQHA 4PJEA 3PICA 1Q0XH 3TBWA 4LARH 1Q1JH 5J9PA 4OV5B 1RD6A 1YJDH 4LCYA 5F1KC 1K3ZA 5E8DH 4R2GC 3TT3L 3QULA 2ZCLH 3MZGB 1R3KA 2NY5C 2Q3AA 3PHOA 1I7ZB 2VDMH 5AOCA 1U8MB 3WJJC 2UWEF 2IPUK 4O9HH 2FECL 1GPOL 2QSCL 4NN7C 2KZ1B 4CCYA 5C92A 1GIGH 3DROB 3SE9L 2J4CA 1L6ZA 5EZIL 2VO5A 4I0KA 3H9HB 4WHDA 1XZEA 2R1XA 5EZLB 2BP3A 5E2VH 4DZBA 4Y2JA 2J4WL 2ENSA 1VADB 4O2EA 3NMEA 4DWHA 2VLLA 3CSPA 4Z7WF 1C12B 4QTHA 4UDTA 5F6IC 3O6FA 5GS0C 1HI6A 2EXYD 3PWVB 4JDZA 2A9NH 3AM8A 4A6YA 5IVZB 3HUJB 1I7RB 1VFUA 2CH8A 4ZAKC 1CIDA 4X5XA 1SCQA 2OLEA 3T3PF 4ODWA 1QSEB 1U8NA 3NCEB 1IQWL 2ED8A 4YEEA 5EN2B 1NAMB 2AK4A 4JFPB 4BAUA 3G6JA 3ARUA 1R3JB 3S7GA 3NPSB 5JW5A 5LQBL 43CAB 2VLJD 1TNNA 4HFWA 3BISA 1DJSA 1ORVA 3SDCA 2CKBB 1GKLA 1BVKA 1LNSA 3OG9A 1WCYA 1MHEA 2VXVH 3HI6L 5JLZA 2YRLA 2IAMA 4M7ZB 3RBGA 5F93C 4CKVX 1S7VB 1FZJB 1YA5A 4IH4A 1AR2A 1R5IA 1IM3A 3VWKB 4L9LA 2XQYG 3X3FL 5I1GH 1BVKB 3IURA 3GBML 2OBGA 1NLBL 4I3SH 4NKMB 2IAMB 4P2CG 3L3IA 1PVHA 1QA9A 3X17A 5I1KL 1QQDB 3TV3H 3K1DA 1N2RB 3VMNA 1ONQB 1CL7L 2EH7H 3MR9B 1QFUH 3P3YA 1JPGB 1B6DA 4JPKH 2O2HA 4FQPA 5D7SH 1IC4L 3GSUB 3WK8A 3IGAB 4ZAKB 4K71B 1ZGBA 1X5LA 3ARWA 1BIIB 3IYLW 4XNMB 3LS4H 1FDLL 5MP6L 4NJ9H 4X6DA 3T1FA 5FUCC 4L29B 1FFQA 5HDQL 2RGSA 5C0JA 3BIWA 1HKHA 2C9AA 5F9JB 2I07B 1QLEL 3K8KA 5I8OL 2KZWA 5H37G 1YB7A 2YD1A 4KTEL 2LVEA 4XCFL 4GG8B 1BZ7A 2GFBB 5E2UH 1MJJB 1QPPA 1CK0L 4RRPG 3HC3L 4C89A 5IGXL 2AGJH 5IMOA 4XCCL 3MRMB 3KPRA 5HQ3A 1R9MA 1I9JL 4U4BA 4M9PA 5DZOA 3KDMB 4J6RL 4PIRF 4XMPL 5ILTL 1DEEA 1LHZA 2ZCKL 3WIIH 4YHNB 1ZA6B 5C0DA 3H19A 2VDKL 3RPKA 4KGJA 3WK5A 5IMOB 3BVNB 1LZKA 5B38B 1T3FA 2GJ6A 3I3EA 2P5WA 1VB9A 5CMAB 1A9BB 1F13A 1LPAB 4JY6B 4D3CH 1INQA 5TQ0L 5F7EL 2F5AH 4HMEA 4LRIA 1QLFB 5D1ZA 4O58H 3V5DB 5TE4L 2AJLI 4CDGC 2XQYK 4JRXE 2AK4E 2Z4QA 3QRGH 1J1PH 4NQDD 3ZL4H 3RX5A 4L1DA 5ABDE 1AC0A 2HJKA 2BHYA 4GRLC 3C43A 3DO7A 1S9WA 1AXSB 5HYJB 1CUWA 5DGQA 2G5BB 4KRPC 1AFVH 1HPLA 2Z31B 5E8NB 2X70B 2HRPH 1UWGH 5KVDH 3NN8A 5FGCB 4LLQB 1UCBH 3ULSA 3QPXL 1RUML 1WC7B 3HRHA 1AQLA 5E8OA 5AG9A 1VESA 4G8EB 1AXSA 1D5IH 2W9DL 5E5RB 4PRDB 4QWWD 2VITA 4UDUA 1KB5A 4PO3X 3WUWB 2GUOA 3S4SG 5J89A 3MV9A 4NQCD 3V6OC 3T52A 3I2HA 3P0YL 3QWQB 4U3CA 1RIVL 1THTA 1C16B 3GMQB 4S10A 3GSQA 1JJFA 4IRZL 2A83A 3OHXB 1THGA 3AM8C 4KEAA 4XVUC 4JZOA 4X6FB 3QQNA 1VOTA 3A2MA 4B41A 4P2QD 3U36A 4YHYC 3A6CH 3FOMA 2VRAA 3V5KB 3WUWA 3VFSA 1MRFL 5IFHL 1DVFD 2EDBA 3BF7A 3GFFA 4GRWB 2O5ZH 1OILA 5HYEA 4JZJA 5GGQH 2GITB 2CK2A 5IVXB 2DQJL 3MLPA 1CUHA 3QBTB 5IFAH 2ZJ6A 3PUCA 1OGAD 3MXWL 1XKTA 4N0UE 5A6VA 4OD1H 5JW4N 4JH0A 5FYJU 1WIOA 5E7BA 3DUHA 2PXYB 5I1EH 5EOQH 3V52H 3R1GL 1IT9H 3MZTA 1JGLH 4EY6A 2C7UA 2OMBA 1Q83A 5FUCE 2QR0B 1G7LA 4EI5A 1Y6MR 5JXEC 4CAGA 4FFZH 4WU5B 5JMRA 1FGVH 4JCLA 1A5FH 2F54A 3HC4L 1OF2B 4FQXA 3VXSB 4HF5L 4LVHB 4U1KB 2YSSB 1UH4A 1UZ8A 1T4KB 4ZRDA 3O45B 3PWLB 3RWJA 4OCNC 1ZANH 5FRDA 1XAUA 1YMHB 4X92A 1MELA 1NMCC 4TYUA 4Y1AA 1EUUA 5DMGD 1A47A 1I1AD 4X0KB 5F3BA 1XZLA 3G8YA 1ODTC 3I6GA 2NY0D 1WIUA 3MPCA 3DDUA 4YGVB 2GZSA 2AJ8A 3QZUA 1IC7H 2Y07H 1CXKA 4KVCL 1E4KC 3ARGD 3SGKC 5L6YH 3V7AG 1DQJA 4RIRB 1XRNA 4RMTA 2W22A 3OJDB 2NY6D 5IB4B 2BY3A 4J12A 4KVCH 5BRZA 4DVRL 3I6LE 3DETD 4X80L 5AD0A 3QG7H 5AZ2H 1XZFA 4X7BA 2AXHA 4J0DA 1T2NA 5CAYB 4X80H 4DAGH 4AL8L 2ARWA 9CGTA 1PFQA 1JGEA 4EVNB 4QHNA 3U4EB 2X4UA 1N59B 5DI8B 5CEXB 1X5FA 1E6OL 4O5LH 4OZHB 1P6FA 1HHKA 4HEME 1B88A 1BX2B 4NM8L 4K9EL 5BV7B 1KG0B 1PG7H 1J05B 3IJHB 4FFZL 2E5EA 3VFUB 4U1NB 3TH4T 4BKLA 5I8EA 2EEAA 3BWAA 3RPIA 3OAUL 3FO2B 2YEZB 3RVVD 1N59A 4OUOA 4BFIA 5CEXA 3GMPA 5I1EL 2YZ1A 3OX8B 3ILSA 3Q6GH 3BE8A 5D2NB 2ICEB 2VIRA 4MQXD 5LWYL 2IGFH 5IVZA 2C58A 2VKWA 3ULVF 1DBJL 1RU9H 1SJVA 4BKLB 1H3VA 4Y5YA 2PW1A 2BSTB 4L4VB 4LVOB 3RDTB 3L3DB 4BZ1L 1X4ZA 1HSBA 4E41D 5DD5L 1YPZE 1HHJB 1FFEA 5E08L 3GMNB 3QUKB 2JELL 1CGYA 1S7UB 1X6NA 1YN7A 4M00A 1G9EA 4TTGA 3NIFE 4X6CF 3G7NA 1N64H 4NQSB 1A6AA 4NNXB 3L3JA 4FZEH 3U0TA 5LZ8A 3EOAA 1N3NB 5J13C 3RVWC 2AJCA 5FCUH 4QRPE 3WLBB 4JFHD 4K8RH 1UK6A 5EPMA 4JPWH 2WG1A 3F58L 1A7QL 3R3VA 1Z0MA 2BNUB 5EU4B 4NBZB 3OJMB 1S8DB 3C6LC 3A2LA 4NC0B 1QR1B 1ZVYA 3DX9A 5L2KB 3ES6A 2VA9A 3C08H 1A9EA 1P7KB 1KLUA 3RQ3A 1NAKL 2A38A 4MNQB 2VZTA 2W9LA 1Y0LB 5JHDA 4HIHB 4IDJH 1WHTA 4M3KB 2XZCL 1NAMH 3BE1L 3RIFK 2HM7A 3CFJB 1QLEH 5I8OH 4ARBA 5E7FA 3GIVB 2W65B 3WDJA 1FNFA 1W76A 1BECA 1DBJH 1RV6X 3WFBH 5EI5A 1R1DA 4PJ8A 4LSUH 2E3VA 1OTUC 1I8IB 4DMCA 1N8SA 2VR5A 4LSTL 4YPGB 1NGQL 2E27L 3MRGA 3TV3L 1AQDB 4LCUA 3ZV7A 1VENA 3DYOA 2YPKA 3STZA 5CILL 1PLGL 4BFGA 4MJ2A 4D3CL 2PYFB 1MX1A 1KJ2B 3FAKA 5A2KH 4Z7VF 3PP4L 3MBXL 1B0GA 5B39A 5IB2B 3D3VE 1HOCB 3VI3F 2ITDA 1CG9A 3OXSA 3LKRB 4KRNA 4HUNB 4RGNC 5CMLA 1AGDB 2DQEH 2OP4L 2VDQL 4ORGB 4OJFH 4ETQA 3LEVH 4C4KO 1FCGA 4PBVC 1HN1A 4QHMB 5C3TA 4LBEA 4XPGL 1DQMH 1PKQB 2VXVL 3HI6H 4MD4A 1XGYH 1U93A 2VYRE 2BK8A 3MYJB 3IVKA 3KPMA 5IB2A 2P42B 2X4QA 3SJVA 3ZDZF 2P7TB 2JB6A 3KS0J 1OY3B 1NGZA 4UV4H 1U95B 3SCMC 4HZLB 3O8XD 2DLHA 1EMTL 1F3RB 5DJCA 3BVNA 1ZS8A 3TFKC 2FO4B 4JFOB 4JCMA 1GGUA 1WFOA 4NZZA 4X98B 1I7TA 2VWEE 5JQHC 1QLFA 2G5RA 1CK0H 1D7FA 1LPNA 4YDJA 3TNNB 2HTLD 3BGMB 1W52X 4ZD3L 4Q3KA 3BRGC 1KCUL 5EC1A 2CSPA 4M6MH 3NFSL 2UZIL 3D5OF 2Z31A 5E8NA 2YS4A 4ELKA 4YBLB 3HNVH 2X09A 4FNLL 4MXQC 2BVQB 2XYCA 4XCYB 3DOIA 4J3JA 1OAQH 1CL7H 4WGWB 4YDLC 3QUMH 3KPSB 4X6BB 1JBJA 1J06A 1H0DB 4ZTPL 3T2QA 4RE6A 3TO4C 1I1FB 2QQLL 4JFDE 2XMGA 5HYIA 2ATPA 2CUHA 3E8UL 3WFEH 1IC4H 1MVUA 1X9QA 2Y7QB 5E2WL 4OQTL 1EDEA 5KWJA 5BZDB 1DX4A 4M02A 5BWCA 4BA8A 4I13B 5A62A 5IKCA 3MV9B 1MH5B 5J12B 2GJZB 3O4JA 4Z7OF 5K9QI 3U6RA 2XMSA 3K4ZA 3O3DA 1KF9B 4M93B 4JFYB 3I50L 3DRQA 4L8BA 4K9EC 2WJ3A 3VXQB 1KXQE 4FLFA 4LVHC 4WI7A 4KJYB 1RULH 1FBIL 5DDHB 3BPNB 4XC1L 3FOMB 3O9WD 4HDIB 5I1JH 4CUCA 4RFEB 4JPIA 1ZHLB 3ABZA 4NFBA 1LMKA 5DO2C 3S36X 4DEPC 1E8MA 5CT4A 2BJMH 3WZMA 3QA3B 5TQ2L 4UOW1 4P2RE 1B0RB 4UNUA 3P0YH 4Q3OA 4UZGA 1JU4A 2FR4A 2EDKA 2A1WL 3V0VB 1JF6A 2WINB 1S8OA 1GC1C 3EZJB 2FGWH 5SWSA 4QHUA 2W9DH 3MRJB 3D39B 3PGDA 5GS2H 3KLHD 2HLFC 3QA3A 5HVFB 4I5BA 3V5HB 5JW3L 5JHLH 5J1SC 3MJGX 5IHZB 4NO0A 3WQHA 1KENH 2CLRA 5ECJE 2QR5A 3L1OH 5DEZA 1BMGA 4MDJB 2UWEE 1MEXH 4EI5B 2MKLC 1P4BH 3EHBD 1AFVL 4DKFH 4KGLA 4LSSL 1MWAL 2VT7A 4GKNB 1T4KA 5E2TL 2PCPB 3VWKD 4X6XA 1YS1X 3EUUA 1SBBA 1D5BB 3C6LA 2C4FU 3GUUA 4Q6IA 2QOEA 4GRLA 4QLRA 3U46B 4GFTB 2PSEA 3BIBX 4EIGB 3LAFA 1P84K 4YNYA 4QEGA 3FCYA 1A5FL 3FFCD 2CLVA 3CU1A 5EU7C 3SE9H 4AEIH 2JGKA 3GSNA 1WZ1L 2P5WD 2C0QA 3WMRA 5FOQA 1MFEL 4PJAF 4POZD 3O8XC 4KRMB 4R6UA 1U9KA 1KBGH 1AKJB 2CJUH 3FB7B 3W9EB 3QO0B 2HDWA 2ZG2A 3T3PE 2ZKHL 4WWKB 4LEOA 5H2BA 3KXFE 1TXKA 4N8EA 5FP0A 3M17A 2HA6A 1ZHBA 5AHXA 4GQ9H 1LEIB 4MA8H 1QFOA 5ETUA 3U48A 2CLVB 3S5LG 2Z9TA 4QRRA 4P2OD 1FFAA 4PRPA 3F7RA 1PKQE 1BBJB 2JGLA 1IAKB 3RWFA 4Y5VC 5DUPL 2XN9E 4BYMA 1JWUA 3FMGL 4J3UA 1U8JA 5EO0A 1BX2A 2P46B 1RPQA 4ODUA 2QQNL 3UZQA 5E1HB 1MCPH 4X85A 5KVGL 1IAIH 4ZXFA 1F4AA 4PJXA 3MA7A 5I2IA 1QIHA 1O7SA 5DK3A 4G9FA 5TDOB 5ENWA 1NU6A 4GMTL 4GG8A 4AEEA 4X8XA 1UJ3B 1SY6L 4XMKH 3QB7C 3H3BC 4JPWL 1T03H 3FT2A 4ODUB 4JRXA 5CD3B 2C3WA 3T77A 1I3GH 1FVCA 1OSPH 4Y5YB 2C4XA 4PGDA 3TA3A 1KFAH 5D7IB 3OG4B 1YA4A 5FYJE 4IDLA 4XX1A 3VVLA 5EBWA 1TETH 4V2BA 5B39G 1AHWC 1JPSL 3RI5K 5IV2A 2FHFA 3HB3D 4NQCE 1LLFA 1QYGL 2GZRA 2ESVA 3UO1L 1UCBL 2IGFL 1MCNA 2L4OA 4H7KA 3FCXA 3T77B 3TC9A 3LHPH 1FVCB 1CI5A 3L3JB 1K2DB 4KK5D 1U8OB 2H9GA 3MUGA 3QAZC 4UNTA 5I8KL 1AQKH 2CDGA 3QDMD 5EBWB 3OQ3B 1QRNA 3PWPE 4BK4A 3MV7E 4P23C 3HKFA 4JKMA 4X93A 2OSLB 1T2QL 3BDVA 3QEGL 3DX6B 3LHPL 1QIFA 4PJ8C 4NZTL 2QMQA 2Z93B 1WTGT 1R5WA 4K8RC 3WNNA 2GJ6D 3RZCD 3EOYG 5ALQA 3ES6B 1KCVL 4PJCF 4RMRA 3G0DA 3BXNB 4G6KH 3CXHK 5ACZB 2VXSH 2XKNB 3OL2A 3BW9B 2ESVD 3H0TA 5DJ2B 1MF2L 2XG5A 5E5MB 3F58H 5BZWA 3ILPB 4K8RL 4X00A 3RHWK 1CE1L 4LHUD 3BXNA 4PRDA 4HPOL 1FJ1B 1GOFA 1UJTA 1F6LL 2IITA 1XF4B 4L8DA 2CMFA 4XX1E 2M1KA 3CCHA 4F7MB 5IGXH 3UJTH 1BEYL 2VSDA 1L9MA 2L0DA 3V6FA 4BDSA 2R69L 1VEOA 5AUMB 1NCDH 4XP4L 2AEQL 4EY7A 1JGDA 2P8PA 3OPZH 4AQOA 1YMME 3N1MC 5HVHC 1OAZL 4ZODA 3QEHA 2OX5A 4J4PC 3HC4H 3SY0A 2PTVA 4KAQH 2PUJA 4D9JA 2ZUQC 5TPWH 1CFVL 2WQRA 5E8PA 1KXTB 1UKBA 5IB1B 1ACZA 5CURA 4ZS7H 2NCMA 4F5ZA 1MCEA 1OW0C 1NKRA 1FNHA 3HZVB 2PTUA 1QTYT 2X4QB 1DLHA 1XRLA 4JFQA 3HG1A 5C70A 1OQOA 2HTKD 4KFZC 3X13B 1JYXA 4R97B 5KSBA 4JPKL 4TUJB 4LCWD 4ZFFA 5C2BL 5DJXB 1QHOA 1NGXA 4IIQA 5ELIA 5CBEA 3VCLA 1X2BA 3QMVA 1EAJA 1P0PA 1A1NA 1FVEB 1W1IA 1G9NL 4CVZA 3MLWL 3ZPXA 5JPNB 5JIPA 2H1PL 3EYVB 3KXFB 3L5XL 3AS3A 3MX0A 3EDEA 1HH9A 4ODSL 3RHWF 2C3GA 4YDJB 3U9UA 3DO3A 3UP1A 5C07B 5ALFA 1S5IL 5ESQB 2DIJA 4PJ7E 4QTIH 4P5TA 1Q38A 4HSQA 3MACH 4LU5L 2FHBA 1GGIH 3GHEH 2PTTA 3CZJA 3KNBA 2FLBT 1AY1H 2R2CA 2Z3ZA 2AV1A 3VJKA 2H41A 1R3LB 3QIBD 2QTEA 3MROB 2ZPKL 5D1QA 4ZFZA 1HHIA 5D71L 3VFGL 1S9WB 2EDYA 5IVXE 3OKLA 1ZT1B 4XNYL 4C56B 5FUMA 4Y89A 3ZZ1A 5HHOA 1P1ZB 3RTQD 4HUUB 1VFAA 2XZAL 4TNVF 4LHJB 1U91A 1GGCH 4HAGA 1ERNA 5T1MB 4DSAA 2XQKA 1LK3L 3DVFA 2A9ML 3DLTA 5CT6A 2DLFH 4B82A 1R5VB 4LRIC 2WMPA 4CU7A 3DXAA 1AGCA 4QRPD 4U1GB 1HHKB 3VXQA 5JXAL 4EHBA 1U8QA 4FN0A 1ZT1A 4KJWC 2PM8A 2PR4L 2QZPA 4UBKA 3NPZB 4G8IB 1NDGA 5AKIA 1J10A 4BSVB 2F5AL 5AZEL 5LZ5A 3QWOB 3VDXA 3SDCC 4OAWA 3SC2A 4YZFE 3TPUB 5JZSA 1UFOA 5DS8A 3H9HA 5D6OA 3QQ3B 4UBOA 3T2OA 2BDNL 4D2NA 5D7LB 4H35A 2AXFB 4C87A 2VR9A 5D9SB 4OZIB 2BAGA 1KC5L 2BOCA 2NXZB 5BVPH 1SCIA 4YXKL 3W0WB 4LSVL 2NY7L 3BZFB 3GFUA 1BD2E 1C12A 4MAYC 3I2CL 5CJ5A 5L7XL 3E4DA 3IUMA 5B4MC 2I78A 5DS8B 2VDRH 3MODH 5C09D 1CBVL 1A14H 4K2UH 4DTGL 1A6WL 1LO4H 4JANB 4R90H 1QSEE 2AGJL 3MRNA 1EHNA 4IRZH 4ONFH 4V1DB 3UAJD 2XZCH 3BE1H 2IIVA 3HG1D 5EIAA 5JR1H 4JFED 3GZKA 4UTBL 1RJLB 2XUHA 3DTXA 3BJ91 1QP1A 2X1PA 2DQYA 1LEGA 1EJOL 3CC5B 3D25B 4TRPL 5E95B 35C8L 2WQ8A 1YEFL 4IOFC 3IUNA 4URTB 2ARJA 2BNUA 5EU4A 3A67L 3IXAB 2Y6UA 4X83A 3VJ6B 1NCBL 4LPYA 4G9DA 3UYOD 4OM1H 2BFNA 2R0WH 3AU1A 1OGAE 1IQDB 2JB5L 2LQRA 4FQCH 4KJQD 2XA8H 1ETHA 4FQHB 4L72A 3H42H 4MCYA 4HHAB 3D0KA 2AW2A 4BSWB 1SM3H 3DVGA 4K6KA 1DWPA 1JYVA 1X5HA 3RU8H 4P4RB 2HWZH 4XH2A 3QEUB 2NZ9D 5IWLA 2GKIA 2YKLL 3E0GA 3I2KA 4JRYE 4FQ1L 3Q5TA 3ZKXC 1I7UB 2YD7A 1EEQA 4BZZA 3RDTC 4B7ZA 1HQRA 4LSDA 1H2ZA 3HI1B 1FZKA 3MLSH 3G0BA 4OU4A 2JBWA 2VDNH 3UTZB 2VZVA 1MNUL 3STZB 5F1NB 1L4IA 3R40A 1YB6A 4Z8FH 1DEDA 5I1LA 1T2JA 2D9QB 3UJIL 4Q82A 3FN0H 2MJWA 4UTBH 4U6HA 3SE4A 4XMPH 4P48A 4OZHA 2B2XL 1AGDA 4IH9A 4L4VD 2R23A 1S3KL 1GGVA 5BV7A 4R90L 3B12A 2BVYA 5C9JA 4Q7DA 1UKCA 4GSDL 1MIMH 2YUVA 4U7MA 5T3ZE 2DMBA 1T1XA 5CZVH 4AEHH 5HHNB 1G7MA 2WBJD 3H7BB 4MQ7A 4PJEF 3SGJC 4LKCB 3UDWC 3R3XA 4QY8A 3X11A 3EFFA 1VADA 4O2EB 1ZS8B 4ACPA 2IQ9H 5TGBB 3VXMD 1LDPL 4KHXL 4FOLA 5DNUA 4W1RA 3HPJB 1C1EL 2LABA 2YKLH 3PV6A 5HHNA 4AQDA 2DM2A 4HKJB 4D0DA 4G4GA 3EOTH 1EEZA 1FO0H 1QIMA 3GNMH 3ARBB 1T5XB 4P5TC 3CFDB 2P8MA 5DVMA 1CFBA 3TNNA 3C6YA 3RWIA 3QHZL 4NQSA 5K9KB 4MEAA 3ZTJH 5J3JA 3QNZB 1DQLH 4GO6B 3OAYK 4KRXA 3M82A 1GIGL 3MRQA 4PJDB 2X5XA 4HMCA 3IDNB 4W70A 4N0CD 1R50A 2XKNA 3BP6A 5E2VL 3LKNA 5DD0L 4UT6H 5HK8A 5I8PA 3EFDH 1KPUB 2DQGH 3GSWA 2RAMA 4Y5VA 5FO7B 3EJYC 3NFNB 2BCEA 1XGTB 1WLHA 1I1AB 4G7YH 4KI5F 1JN6B 32C2B 3B2UC 2QQKH 3RTQC 3IVMA 4N8DA 4YFEA 1CICD 2NXYB 3HE6B 4AIZB 5K3AA 4Q97A 2EH8H 4G3YL 1W6RA 3OBAA 1H3TA 1UKAA 3CFJA 3MGOB 5F1OB 3JV5A 3O9WC 2V9TA 2W6CX 4K9EH 4G8EA 4ALAL 4LAQH 2P8PB 4HWZB 1ITBB 4PLKD 4ALAH 4LARL 3S4SA 3QXAA 2HP4A 4H1LB 4BUGA 4BCCA 3R4DA 1DUYB 1U3HD 3CLEH 2XG4A 4E11A 5IQ7L 5F9WB 5KSVA 1GL4B 2VSQA 3AS2A 4HKBA 3P2MA 4W4NA 5DNWA 2X4NA 3E2HB 1WCBB 3H18A 1ZI8A 4X94A 5E9DA 2P24A 3GMRB 4ODXB 3BUTA 4E5XB 4EBBA 4HRXA 5CCKH 2FWOB 3GB7A 4PQEA 3CFCL 1S5HA 3X12A 3FRUA 2PU7A 1RJCA 2E6JA 5C0JB 5T5NF 2NTSP 3VDBA 2XZQL 1JHLH 3MREB 5F96L 3CVHB 4MYSA 4LLYA 1A7OL 1CFVH 1U93B 1I1AC 1A1NB 5ANME 4BFEA 4JGUA 4J1UA 1BZ7B 2GFBA 1LQSR 5EZJA 5D7JC 1G9MC 4EEEA 1KTRL 4ISVA 2FZ3A 1DBAL 1MUJB 3N0PB 3DRTB 1BLNB 1Q8MA 2XACC 3DETC 2C7UB 3F9CA 2XN9A 4H5SB 2AK1H 4Q0XH 3LIPA 3MBEB 3F7QA 1TCAA 4JFFE 3VFTB 5ALWA 3G5YB 4HXEB 2WFLB 1ZA6A 5C0DB 4EY5A 5KS9E 1UK9A 2KDGA 3BGAA 4TVPD 5I1IL 3G5XA 2OJEB 4P9MH 4MD0A 5K3EA 4NSKB 3NGBB 3VG9C 2YXPX 2JF1A 2Z31D 5GS1B 1S5IH 1T6WA 1UCTA 4LCWB 1CQWA 1I85A 1MRCH 4HPYL 1WAAE 5JORA 3KLSA 4HUKB 1CGUA 5ETUB 2D2OA 1HBJA 1UKQA 3VE0A 4GAJH 1BF2A 2DKSA 5C09A 3TO4A 4WJLA 2JIXA 5KJRL 5AI0A 4ZFGH 1RIUH 4GT7A 5SX4H 3WXVL 1E4WH 1A8QA 1YEJL 4PGBB 5AD0B 5HYJA 3ZKSD 5EOTA 5FIEA 3B8SA 2Z8ZA 4Q05A 3WKDA 4YHML 3LOWA 3SE8H 2APXA 1BFOB 4OZFH 4RMWA 1BREA 3AIOA 1CUIA 4J3OC 1YNLL 3T4AB 2BMKA 3SKMA 1C08B 1Z9MA 3U1TA 2WILA 3QQ3A 4IHOB 5JOFA 3SWWA 5MENE 5E8OB 1AGBA 1VERA 3QIWC 3IKKA 2BRRH 1CDUA 2W0FB 4ZS7L 3CDGB 4DYHA 3EJYD 3B2VH 4PJ5A 3DUUB 4IIQC 1DT5A 4NRXA 2J3QA 2DHCA 5FYLH 2C0PA 1OP5H 1B0RA 3GSQB 5MP6H 4P46D 4WFGE 1QKZH 2VQ1B 4NN5C 2YD2A 1A7BA 3H0CA 4P2RB 4IRJC 4PJ9A 5JD6A 2PSFA 2ESVB 3MLUH 1QRKA 5AM5A 5JTWA 1EO8H 3QCVH 3CMOL 1LBSA 3SDXA 3HR5A 4OIIL 1F11B 1MREL 4PGCA 1KN4H 1PYWA 2LAGB 2VZUA 2VLKB 5KN5A 4QXGH 1F0PA 3RM3A 3PWJA 1OAYH 4DQOL 3S35X 1S7WB 4KJQC 4AJ0A 5C8ZA 3GSNL 2HKFL 3V6ZA 1NU8A 4YBHA 1DBMH 1S7UA 4MDJA 1OAYL 4DQOH 4ZV9A 1U41A 4XP6H 2QL1A 3NFPB 3C60D 4ZO6A 5LXGH 1MJ7L 4JZNA 4RFNC 4MGXA 1KPRB 1PYWB 2HHAA 4OF7A 2VDKH 1NUGA 1JRHH 1A14L 1U8HB 5CINH 4H25A 1R3JA 3MV8E 2QXTA 4RA0C 3SO5A 4MQSB 2UUDH 5BS0A 3NZ8B 1BD2B 5EIIA 4KK8D 2O5YL 2P5EA 3NIGE 3IUJA 1YEHH 1LPBB 3GJFA 4FXLA 4M1GL 4PRIE 4QT5B 4HWBL 1KIQA 1LO5B 4MAYB 1MAJA 1JGUH 3BZ4A 2CRYA 4WV1B 5EFIB 5ALCH 3I6GB 1IUOA 3GIVA 5I1LB 5EC2B 1RI8A 3O3EB 4P9HC 2IBZY 2XTJB 2EDHA 4ZUTA 2IPTH 3MRHA 3MV8B 4S0XA 1UXSA 4G6AC 1YAHA 4PRAA 5IB1A 1EHYA 4ETWA 3O2DL 1CLOH 4PJCE 2G60L 3T09A 5KVFH 5EC2A 5D1XC 2DQIH 5JPMA 3SEPA 3W5NA 3JSSA 1ZJ4A 1Z5LA 4P2OB 2P1YA 1UJ3A 2IEPA 3VH8A 3OV6A 1EJOH 1AGFA 4LPXA 2Z92A 2D31B 3TIEA 1UXSB 2QQNH 3JVGA 2GSGB 2VE6B 2XTJD 4JY5L 4WHTB 2ORBL 4C83B 1K63A 1Z5LB 1EGJH 2BJML 2CD0A 2QXUA 4P93A 1EGJL 4ZOCA 5E6IC 1RVFH 4JY4A 1DDHA 2CK0L 2XMBA 2AEWA 3IJSA 5BV7L 1KJVB 4TNWK 4FMFA 4X9IA 3QO1B 3PGCA 4Q1VA 1MLCB 4M43H 4BZ2H 3QFDB 4DGVH 3L1HA 3AREA 2YHGA 5INDB 3ZHDA 2E9WA 1FL6A 1MIEH 4OLXH 1JZ6A 3L9RA 3BH9B 5IF0B 1CUFA 2J3SA 2Z3WA 3ESUF 1BD2D 1D9KC 2BXZA 4G6JH 3DGCR 2OSLA 2YR3A 3GIZL 3HE7C 3O4GA 3EAKA 3DLQR 1TVBA 1YMMA 1I1AA 2X4RA 1UKSA 4LF3A 5DJAB 3H17A 4WGVB 4JHAH 2FEDC 5ICZA 5E4EB 3DL4A 3QJFA 4HUUA 1EIBA 1Z0NA 2I9LB 4CN1A 5F8QC 1I8KB 5BS0D 3GNML 3SDXF 4EDWL 4XP5L 4GG6B 5E4IA 1FORH 2Y2VA 1IC5L 2OI9C 1FJ1A 3PXHA 3BPOC 1CUVA 4BVJA 4KI5C 2DL9A 3H9YA 5GGTH 4MNQA 5KSBE 4TULH 2AJYH 3QJHB 4WW2B 2VLRA 3O9WB 4O51B 1PSKL 3AC0A 4JN1H 4U1HA 3HE6D 4OUKX 1CICB 2NXYD 4HKBB 4NO2A 4AENA 4BQ6A 1A1MB 1EO7A 4Y5XB 4KJYA 2H45A 3X14A 4HW6A 4YHOL 3UMJA 2A6IB 5K5EA 3X3GL 2OL3H 4N8SA 1NFDA 3FQRA 3AIMA 3KWWB 3WZLA 3C87A 3MQIA 5ICXA 2DLIA 4JHWH 1C16A 2EH8L 4UFOA 3MXVL 3CDCA 2EE2A 3GKWH 1K5NA 3M1BB 2NX5E 3L5JA 4R7DA 3BQUB 5FEBA 1P4LA 1CU4L 3CCBA 1BQHB 3KDAA 1HOCA 2Y1KA 5LGHH 5DMIL 4QCIB 2WUBH 4YK4B 4RGMB 4D9LL 5IOPB 5KSBB 1W75A 3WSQL 4KE7A 5DD0H 4BVLA 3LIZL 3PL6D 1A88A 1SJHA 4RAUB 1U8IB 1A4JB 1ZMYA 5T1KB 1QO9A 4HS8H 2VISB 4KROD 5AIAA 4LSTH 3ESDA 1KPVB 4LSUL 1NEUA 3DXAE 3ZKND 4YHPB 2FUKA 2V5SA 4RAUA 4YXLH 1HHGB 3WIFB 4NNPL 4O00A 2YD3A 3LKOA 4U31A 1YDPA 3L5WB 5CRIA 3DYMA 1K4CA 2NW6A 3HR6A 3JWOH 2A6DA 3PL6B 2XWJA 3MROA 5D1QB 5DQDH 3LS5L 3BGMA 4JG1H 1F8TH 5FHAH 1RWQA 1UT6A 1JV5B 2B61A 4PRBB 3L1IA 1CF8L 4ORZC 3M17B 5CKAA 1SEQL 3WI7A 1CE1H 2ZG1A 5GRUL 3FO0L 1Y6KR 1H3WM 4GAJL 2HFGH 4CMMB 4XCYA 5ERWB 1XZJA 4JYMA 2I60L 3PDOA 4LFHD 1E66A 2X1OA 4TNVK 4D0CB 4HS6A 1QSFD 5MI0B 1FIGH 3T0EC 5FLKA 2YOCA 1DBKL 1GVIA 3UBXG 5FAAA 2OJZH 4GRLD 5J57B 1J8HA 3DHJA 4S11A 1DU4A 3WJLA 5DTIA 1NGQH 5IW6B 5DEFA 2C3HA 1H3XA 4K07A 1A8SA 2Q7YA 2GK0B 4JFYA 2Z35A 1CQKA 3QULB 2VQ1A 4H0GA 3FQXA 3H7BA 5ALJA 2DJ4A 2FL5A 5CILH 4GG6F 4QY8B 1UWXH 1ND0A 1FFDA 5IEKA 5E00A 1UWXK 1HZHL 1VXOA 4QDXA 2YXMA 2J8OA 4OLWL 4NS4A 4WFIA 5B8CA 4LNVA 5FM4A 4IM8A 2FD6H 1EHXA 5D2NA 1LK3H 4YQXL 4F3FB 3CK0L 4TQEL 2BRRL 2G63A 1YEDB 4NKIH 1MWAH 3FAXA 1CRLA 3DI3B 3F97A 3MLYL 3D39A 1F4YH 4OBRA 1H3UA 3AZOA 5FO9A 3O2WL 4PJIB 3R8QA 1RJYA 3VWKC 1VKHA 1LP9F 4CVXA 2PYEB 3L3HB 5J3HC 5C0IB 3REVA 1BZ9B 2CLRB 5EOCJ 5EUOE 1YEIL 4NRZB 2VDRL 3MODL 1LZLA 5FO7A 3W39A 5KSAA 2O61B 4G43B 4E41B 3I2CH 1R5WB 4YXKH 5GS0D 5I18L 4PJEE 2E7LC 1TRHA 4J0IA 1OSZB 3JWDC 3REVB 2WLSA 3FHQA 4U2EA 1TDQA 5JARA 2DJUA 4NRZA 3SBWA 2FJHA 2FLRT 1RIUL 2NY2D 1F4XL 1KNOA 4LGRB 1JF5A 3RAJH 3T0AA 5JXED 3VU2A 3WJJA 4HWZA 3NCJL 1TQCC 2WJ6A 2V2XA 3RVUC 1B0WA 5DR5L 1HYSC 2YPVH 5DUPH 1OSZA 2NQCA 3OR6B 5C0RL 1YQVH 4WHYH 1AX9A 3CDYA 1VKXB 5FOJA 4PJBB 1HKLH 1JFQL 3QXTA 4CRPA 5AUMA 5GGRY 4OLZL 1Z2KA 4JRYD 1XRRA 1RUPL 3B43A 4ZPTA 1DX6A 2BNRD 2PR4H 3VGGA 4LXHA 1JPST 3L3IB 3SPVB 2BC4A 2AK1L 4ROTA 4Z0XA 3VXTA 4Y4FB 3C60A 4PW0A 1BU8A 1CR6A 3QUML 1WGOA 5C7XL 2PU5A 4XP9H 5IB3B 4CU6A 1UYWL 1Y7IA 2B8OT 3DMMC 4H0HB 1T0MA 1T7XA 3SOBH 2AVGA 5AI6A 3ECBB 4KKNA 5I66B 2EYTB 1UQSB 2IFFL 3VXOB 1OM3L 2ITDB 1OM3H 4JGMA 5T3XE 1KV3A 1WAAA 3QIBC 2XA3A 4PJ5D 1UM5L 5CGMA 2AJUL 2VABA 1WZLA 4X4YA 1AD9A 5ANMA 1KEGH 3DHMA 1FZOA 1ZT4A 1AP2B 1QBBA 2YD9A 4PJDF 5TGBA 3MRFA 3IKCA 1XR9B 3V4UH 1CLYL 4MNGB 3EBAA 3HZKB 1F4WL 3M83A 2P44B 3JV4B 4FNMA 3U9UB 2F58L 4YASA 1JFQH 5K9KA 5IESH 1FIEA 5ESQA 5JAUA 2BNQB 1XR8A 1FN4A 3FSGD 5ICZB 2NY3B 3L6FA 1AR1D 1YEGH 2RR3A 4WY7H 2B9VA 1E27B 5ALIA 4QHLA 4B7IA 4JO4L 4EOWH 4BQCA 3LB6C 2QADC 5ADPL 3DEAA 4C6HA 3GSWB 4FTVA 3RA7H 5DJDB 4C56E 4BK5A 3MO1B 1JF1A 1XR8B 2B39A 1JGLL 1F3DJ 1HWHB 2F5BH 3QRGL 3D0LA 4XVJH 3BQUD 1ODSA 5I7UA 3E8UH 5LAXB 3WFEL 4ELKB 1A3LL 4M1CC 4P2RD 1SC9A 3C5WP 4OD1L 3V5DA 4P2QB 2R69H 3SGEI 4MXWL 4PJGA 2Y6VA 5HYQB 4IHOA 5JOFB 4UT6L 4FDMA 4XAWL 2F19L 3OKEB 2G5BA 4QLOA 2C1PB 4B50A 4MXVE 5KS9F 5IQ9B 1CLYH 1CUSA 4L8DB 1CZ8H 3MBEC 3V4UL 2IADB 1KTDA 1N7MH 2MCG1 4K71C 5C0GB 3DX7A 3MRBA 3RY6C 2PO6A 3JTTB 4L8CB 2OQVA 2Q76B 1XIWC 1CCZA 1INDL 1MFBH 4N9GA 5CP3A 1JK8B 5JOEA 1VSCA 4K7PX 4KRPD 5E9DB 3BQUA 3RWHA 3H1AA 5ALHA 4J0JA 5A71A 1M71B 2BJHA 1LDPH 4KHXH 5HZGA 2NTFA 3KHQA 1BAFL 1MF2H 3T0WA 3FMGH 4XJVA 3WKBA 3Q5OA 2A83B 1E28A 1M05B 3S97C 3VD3A 3O41B 1B4JH 4ONHA 3THMH 3GJFH 1WZMA 3U1SL 3NFPA 3W2DL 1URLA 2VR4A 1CGSL 5FV1L 1EMTH 1ORQA 3J7HA 1P0QA 1AXTH 1A7NH 4C57C 5JO5A 4ETYA 1HINH 4FMKA 4B81A 3STTA 3TH2T 4P5MA 4LLWA 2YH2A 2V5RA 1JGVL 3VFRB 3VCLB 2XN9B 4FXGB 4XHJD 1FNSH 2YA2A 4YBQD 2H2SC 4G5ZH 4AZ8A 4CVZB 1JGVH 3P73B 2CDEB 2QKIA 1GAFH 1RU9L 1MAML 4Y5YC 4M7JL 4X7TA 4WRLA 1P53A 5CXXA 4RGOH 4N0YH 2JGMA 1MAMH 3RGVA 4GEGA 1JPSH 2OJEA 4Z18A 1EX9A 4Q6IB 4XHQA 5JATA 1KIQB 4YE4H 1Y18A 2EDEA 3B9VA 1QLWA 2HIHA 4HEPG 43C9A 1IZ7A 1Q0RA 4LPTA 4Y2VA 2BXYA 3W05A 3VE0B 2N7AA 3QEQD 5JIHA 4I0PD 2YK1L 4U7SA 5D7IE 1HNFA 2ZOKB 5ESRA 4ZG1A 4WO4C 1W0WA 4Z9KB 2DQUL 5EOTB 5MEPA 2UVFA 3K2IA 1H9VA 2OTUA 5F3BB 1TTUA 1MCWW 3BGFB 3ULVE 2E7MA 3SKOB 4K94H 4TUKH 3FO9B 2H7YA 1SHMA 5I76B 5T3XD 2YK1H 3VWJD 3QFJE 5FYKU 1XF5B 4U2YA 4B9EA 1FFNA 4PRNA 5FB8B 4FHZA 5C8XA 1XLUA 5BRZB 4PJCA 5FCUL 4BH7B 4QTIL 3RL2A 3E6FB 3MNWA 3FFCB 1YPZF 1CWVA 1A6PA 5AKYA 2D7QA 5K59E 1GJIA 1C5DA 1WM1A 3UTSD 4MAYD 3VJLA 4D8PA 5DJ8A 4H7FA 4HJGA 4XP1L 3NACL 4OZFA 4N0YL 5I1KH 1TJGH 4GRWE 3PWPA 1MFCL 4S0TD 2DL2A 4Z7NF 2ICWA 3GBLA 3Q6FA 2ENYA 1WBXB 5L2KE 1INEL 4LSQH 3SK0A 1XF3A 4CN4A 3HTLX 5INDA 5I8EB 4UHCA 5EIVA 5HVGB 2A6JB 4P2OC 3BMVA 4H20L 3L9RB 1CUDA 4GWLA 3B9KC 3PWJB 1UXWA 4BFIB 2X1QA 4DFHA 4HX1B 3VJMA 1E4XL 2XUOA 5GJTH 2X40A 1T5WA 5HGBA 3FQUA 5JXAH 5FA3A 5TDPA 3NIDF 5AJHA 3DSNA 3W39B 3UTTB 5GJSH 4DN4L 2Q87A 2DTMH 4Y1AE 2HFGL 1UADC 4IRSD 3BJRA 4PRHB 5ALRA 3KPNB 5CBKA 4XPBL 3FN9A 4H25B 3KLHC 2NW3B 3IU4H 2F8XC 1UB5A 4OZ4A 4W68A 1F8TL 5FHAL 3TT1H 4ZFOA 4GHWA 1EZVX 3V9AA 1JMKC 1QEWB 5EIIB 5LQBH 5FYJH 3CFKB 3ZKXB 3ZYZA 2J8UB 2BNQD 5HI4C 3BPCB 4R0LC 4HS9A 4NQTA 5CHNA 4JE4B 5I17A 3CFIC 4M5ZL 5K3CA 1AY1L 4Z7VE 4HPOH 3RWGA 7YASA 1CQZA 2XICA 3VI3E 3H0TB 5SWZD 2OQJB 1RZIA 3EDDA 1VLQA 1QSFB 1P84J 2GCYB 5J12C 4LSRL 3QPDA 3F7YB 3PXJA 3QEUA 5L2KA 4ZPTB 1ZD3A 4PRID 1FBIH 4B0MM 3V4PH 3ARGC 4X6DF 4U2FA 3EOBB 5AWNL 1UWEL 3RGHA 3GJEA 1DL7H 2IJ0C 4EDXA 1MT3A 2X41A 2Z91A 5EA0L 1IKNC 1R9NA 3MRHB 4DGVL 3LS2A 1DR9A 2D7TL 1IGJA 3WIOA 5JD5A 4PLKC 1DBBL 1FL5A 5D96B 2JF0A 5E2WH 1BCSA 1VZ3A 1MCJA 1OWRM 4X6EA 3BUYB 5F7UA 3PHQA 4WTXA 1G9NH 4MA3A 1Q72H 2I27N 5KWIA 3CN7A 1J1PL 1CFTB 4XGZA 5EOQL 2R23B 4KDVA 1X5IA 4O58L 1AQDA 4LCUB 1OAQL 2AJSH 1IGJB 3W81A 1Q9OA 4KJPC 4UAOC 5BMFL 3RWCA 1L7RA 1MWAA 3QMMA 4ODTL 1IM9A 3VGFA 4QDZA 3IKCB 1TNMA 3MRFB 4M4RA 1SEBA 3QUZA 4PJ7A 5DC4B 5TE7H 2LTQB 1JWMB 4OB8A 1EK1A 3I3DA 5HGDA 2B1HH 4HJJL 2FJFA 1UB6A 5FECA 1FE8L 2AEPL 1JHTA 1WT5C 2HVKA 5FYJL 4YXHL 5IJVB 2N56A 1J0KA 4QYOB 1FLTX 1H2WA 3MYJA 2I5YH 1W0YT 1QACA 5F7NC 2WU4A 2JJSC 1UG9A 5FXCH 3VG0L 4B0OA 3FZUC 5DWDA 1EVEA 4LPWA 5DJDA 4OFKA 4MD0B 1PJ9A 2OZ4L 4NHCH 4L4TE 2EICA 3NCCB 3TNMA 3RVTC 2C7BA 2NX5B 5JNYA 2APTA 4PJ7F 4ZMAT 2BSRA 3ROLB 4JQIH 2WW8A 3TBWB 3BP6B 4N1CA 4DMFA 4OV5A 5C09B 2HT2D 4Q58C 3LPWA 3GKZA 4ZUVA 1HHIB 5MERA 1WPRA 1JNHB 3EZ8A 1ZJ5A 1NC2B 1YN6A 2FSEA 2R0ZH 4M1GH 3TBSA 5BQ7B 4NN7B 1M7DA 1CUZA 3CK0H 4KQ4H 2BGRA 1I7ZA 2VH5H 5CJBA 1AZWA 4W81A 4NWTH 3W06A 4ZTOH 3PWNB 3SX4A 1E4XI 2HLAA 1HINL 1JJUA 5AICA 4ZUVB 2HFTA 2E6QA 3PNWA 3DXAB 2XUGA 4QOKB 2DN7A 2W60A 2HKFH 4ZUSA 2GY5A 1MFNA 2IFGA 3RY5A 3CCCA 1XQWA 2XQBL 2XUAA 3ZHLA 4KC3B 3C5VA 3MRRA 2DWDB 3C8KB 1FL3B 5D3ZA 2XMCA 5KSVB 1FFPB 4WI6A 2YA0A 3BMWA 1YNKH 3R0MA 2KUTA 2R56L 3OMZA 3BXPA 2D0HA 5LKNA 4G8BA 5EUKA 3NABH 2QHRH 1CIUA 1W72A 4C56D 4HG4K 4X5XB 4AQ1B 3MRIA 4M62H 3FRUB 1F11A 2QVBA 4HK3J 5DK2B 2FYYA 2NX5D 3WFHB 2AJBA 3HMWH 5LZ9A 4YFDB 2PYEA 4K7FA 3UJJL 3ARDA 4PG2C 4U6XA 2CKBH 2V2WB 4Y19B 4FZ8H 1QJ4A 4NMWA 5C0BA 3L7FB 2APBA 4YDKL 2R9HC 4FQIL 5ACMA 4U3XA 1QSZA 4GMTH 4JFFA 1NLDL 5FGRA 3P4NA 4NYLB 3MOQA 3L3GB 3WHE0 2B0SH 3MUHL 4HXBH 3UC0L 4WFFD 2X9YA 4IBLT 4XBEH 2H1IA 2ZWLT 4ZSOE 4J7AA 1M6OA 4WHCA 3ULUH 4JZJC 1AH1A 2XQJA 3Q6GL 1BOGB 2DQDL 4QRUB 2ARJB 1FNSL 4QGYA 3UTPD 2X8BA 4WDQA 3HS0A 5GSRA 3TBYB 2E9JA 3ZI7A 1WBZB 4LLVB 5IT2H 1BJ1H 3F12A 3SHSA 3MV01 3GJFB 5EZIH 4DFIA 5HYJE 1DBKH 1FG2A 2OL3A 1CUUA 1OPGH 4M8VA 5GZND 2VOTA 2F53A 1TCBA 3QIUA 4WEUD 3TO4B 1AJ7L 1NJ9A 4XMLH 5ERWA 5D5ME 5EUOF 5JW4R 1FFNB 4PRNB 5FB8A 4K94C 4MS8D 3TPKA 2A77H 4JM2C 3D4LA 1ZT7A 2PYEE 2VAVA 4FQQB 3VXUB 4TNWF 2D03L 4YAQB 5E0QA 3WJLC 5A2JH 2XY2A 3HC7A 3FONB 1BFVH 4F9PA 4IJ3B 1U8EA 4ZUWB 3TRDA 4YFLF 1Z3GL 1PSKH 4NKOB 3FO1B 1HYSD 1F90L 2H32A 1L0XA 4YX9A 3L95A 2ZSHA 5H94B 5I19L 1GXSA 3VXUA 1AD9B 2NY1C 4Y2DB 4BRZA 4EN3C 1MO2A 2EC9T 4P9HH 4PR5A 3D9AH 5KVMC 4J0HA 5HCUA 3WHXA 2CKNA 3QT2A 3QUYB 4G6FD 5AKJA 1ETZB 5TFSL 1VGEL 5F96H 1HH6B 1RUAL 5ALNA 5AM3A 3UZEA 3T0EA 2JJTA 4OIBA 2G9HB 2NY0C 2WIDA 1E4KA 3SGKA 5HI4D 2VLKD 2W59A 4IRSB 4ODVH 4YPVA 1L9NA 3CFBA 4WV1C 2GQHA 3LQMA 5DD3L 5E4EC 1QSVA 5BJTA 3UPAA 5GJTL 4JFEB 1MI5A 1DVFB 3GBSA 4EB0A 1LE9A 4X6UA 4Z0BH 3VD5A 1TVBB 1YMMB 2V5TA 4BM7A 2ICWI 1TMCB 5F7LB 3BD3A 1ADQL 4LSPL