3C8HA

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-serine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
392
structure length
383
Chain Sequence
VGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
molecule keywords Enterochelin esterase
total genus 106
structure length 383
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c8hA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c8hA02
4FTVB 4JPKH 4LHEA 1C16A 1R5VA 4F58H 4UAOB 3IFOB 3EOBA 4N8VB 1JL8A 1MJ5A 4L9AA 2CDEA 5CMLA 2HVJA 2AQ1A 1HXYB 5DJCA 3I6LD 3WNMA 1MCLA 4PUBL 5D2NA 4Y5YA 4R26L 4U1IB 5F9OL 1G7QA 3L3IA 4X98A 3BMWA 1DWPA 3QUYA 3IGAA 4OGZA 4PTTB 1AKNA 1GQRA 3F8SA 4I8DA 5DD1H 4P4RB 1N0XL 3VFGH 4UTBL 5DZLA 3QO0A 5FHBL 3T77B 2AJDA 3DRTA 1XGUA 3IU4H 3MO1B 1BJ1H 3SO3B 5IGXL 4BSVB 4IOFC 4JFPA 4WI2A 2VT6A 2A77H 3LQMA 4WV1C 1MCQA 1QSFA 3RUGF 4XCNA 1E28A 2J4WH 5ISZE 3IDNA 4AO6A 4PYGA 3VXPA 3I6KB 2R23A 4MXQD 5IB4A 4EZMA 4HJJH 4OT1H 4WI4A 4K9EL 3RWHA 3L6FA 4FQIL 2JGLA 3BESR 1KBGH 4LCCA 5ALRA 3BJLA 1KN2L 2WMPA 3VDAA 5DK2B 3RVUC 3CD4A 3S5LB 5IWLA 2Z91B 1QSZA 2OR7A 2WBJD 1IGML 1N7ML 4P46B 4G4IA 1BQSA 2PL5A 4JY4A 4YPGA 2X76A 3EJYD 5IFHL 4TRPL 3IU3A 3P4MB 1UJ3B 1JGUH 1ZGBA 4KGLA 1V7MH 4Q9QL 5C0AD 2OPHA 3GZKA 1EUUA 3ZKNC 4BYHA 5IBTL 1DFBH 1T4MA 3DUSA 4Q97A 4HKXB 3PUHA 2XWTA 1L6XA 3LEXB 2XKUA 5D6DC 4ZS7H 1FSKB 3G9TA 5IHUL 3ZE2E 5IT2L 5D2NB 3DETD 5IMLB 3X3HA 4PJEB 3GMQB 1ORQB 1M6OA 5JW4Q 2J5LB 2XMZA 4PTTA 3FAWA 1ZIXA 4HXFB 1EH9A 2NLJA 4MNGB 3ZKQD 5C9JB 3IVKB 1J10A 1ODAA 5CWSB 4UHDA 1AP2A 2ACEA 2FDBP 4P3CH 3OKOB 1Z68A 4FXGB 1NMBL 2YPKB 1H0DA 1MLCA 4XNQB 2X1WL 4DKEL 4UBOA 3RU8H 3F8UB 4Y1AE 3I2KA 2JB5H 3FLAA 5F9JB 2D7TL 5F1NA 5IHUH 2WZPD 5DRNB 1EFXD 5F9WC 2PUJA 3QNZB 2DM4A 3LP5A 3P30H 1EGJH 2R0LH 3AIMA 2V2TB 3FO9A 4S1SL 1IARB 1DFBL 1KTDB 2Z92B 4H7IA 1DLFL 1C5DA 3MBED 3NCYS 3ECBB 4LCIH 5T3XL 5HDOA 4D3CL 2O2HA 5LQBH 2VAVA 4TSCL 4OZHE 1BEYL 1GGCH 1IQDA 1T1YB 2J6EH 1A7QL 2HU5A 1INEL 4MHHG 2BUBA 2ZSVB 4JN2B 4O51A 2EEAA 3KJ4B 2AEIT 1KG0A 3MLPA 3P11L 1QRNA 3FOLA 3O4LB 5C81A 1EBAA 2IIVA 4HFWA 4IH9A 4YGAB 5JW4N 5LZ8A 1OAXL 4NM4H 1KTLB 1N5AA 2GTWB 4N8SA 1QO7A 3C5ZA 1C08A 1U8PB 3MXVH 4GRLD 4JFFD 2UUDK 1NBZB 4MB4A 3WKCA 4R0LC 3PDOA 3FZUD 5EZIH 2R2BA 5IMKA 3O9MA 6YASA 5SX5K 4DEPC 3P11H 3U0PB 3DXAA 1MF2H 5F9AC 1EO8H 1ZANL 4AIXA 5AKKA 3P0GB 5EPMB 4BK5A 3ROOB 1KCVL 3CPLB 1BEYH 1GGCL 1FLTX 4XIIA 3NCJH 5ALWA 4MAYD 1P4BL 4X7FC 4AM0B 4GW1A 5MENB 5HF5A 3TVMA 3HE7C 2FX8L 5J89A 3DO7A 3EKCA 1KYOJ 3TCLB 2KH2B 2EH8H 2X09A 3RHWK 2XV6B 4HT1H 4WFIA 4OKVB 4KR0A 4IRSB 5D72H 4M7KH 5T3ZD 1RK0A 3WE6A 4GHWA 1GCFA 1FORH 1YEGH 3K2IA 2YEZB 4GKZA 5TGBA 3IS0X 3MV7A 2PTTB 4Y5VC 4X8JA 2DJSA 2YPLD 2IAMD 3WV0A 1YDPB 1OAKH 4R4BB 2BNQA 2YSSB 5E6IB 1DQQB 3HUJB 4OQTH 3TZVD 4CRPA 4U1SA 3UX9B 1NDGA 2WBJB 5GRWA 1KCVH 1SMAA 2F54B 4LVHB 3CMOL 1P6AB 2AJUL 4LSPH 1YPZB 2PUQT 3VWKA 2V9RA 4JGJA 1UXSB 1I9JH 1J5OH 1BP3B 4DEPB 4ZFZB 4XVSH 1DEEB 3ILPA 5DEFB 4X9GA 5ELIA 1FO0L 1I1FA 1VEMA 4TPRH 4PJGE 1FFRA 2WBWB 4PRHA 3G0DA 5DJDA 4JY5L 5BO1H 1RWQA 2CKMA 4NN5C 3GDBA 3PL6D 4EOWH 3WK5A 2EXWC 3QP3A 3OAYK 2C0PA 4F7PB 2G2RA 2AXJA 5I0ZA 1LEKA 4O2FA 5IKXA 4JKLA 3IDXL 2ITCB 4OM0L 3K81A 4I3FA 2FH6A 3MV9B 3VRLE 1QKZL 3ILQD 3MACL 4J4PA 3TVMB 5AHXA 1K4CB 2VDKL 4ENED 4AMYA 1YQVL 3NGMA 1TFHA 3GO1L 3OB8A 2Z8ZA 4E5XA 2VH5L 1Q9LB 3ANSA 3H7BB 3WKML 1RURH 3RVVD 1CVSC 3YASA 1K4YA 3V9FA 5LKNA 1BX2B 1WV7T 3FN3A 5KBNC 3QXAA 4G6KL 3LQAL 5GGVL 2BXYA 4IM8A 4QDTA 3VXKA 1WLHA 3HR5B 2QT9A 5GGRY 3I75B 3WL9B 1JHKH 5IFJA 1ZI8A 5IM7B 3HE7A 5E6IA 1RZ7L 2WHPA 2D0GA 2QS9A 1IGCH 5CURA 1G7PA 2JJWA 4JFED 3BDIA 1NGXA 3B2VL 2BHZA 4PR5B 4AYFA 1FL6A 3ULUE 4LHUG 4LSDA 1UXSA 3MOBH 3GSXA 5HDQL 4OLZL 1CD1B 5I1IH 4U6TA 1M33A 3U0TB 4NVRA 4M0EA 3MCLL 5FK9B 3CFKB 1FCCA 3ZKND 4P08A 2MQ0A 2YH2A 3VVMA 4PLJC 3L5WA 4FMFA 1L0QA 2C5FA 5DA4A 2DQIL 4QTHA 4PSCA 4QYOB 3BRFA 5I8KL 5ISZB 1MCPH 2JCCB 3C08H 4B7ZA 4JPIA 2DSNA 5BOVA 4K23L 4NUJA 4OU5A 3TWCH 2WTMA 4HUKB 2H8PB 3LCYA 2ITCA 3H0CA 2LU7A 4D94A 5KW9L 1RD6A 3KYMB 4D9RD 9CGTA 1PG7H 1NAML 1SMOA 5GS0D 4NPYB 5TDPB 4G3YL 5K9JL 2NW3A 4EY8A 4ERSL 2ICWA 2MPAH 1AGYA 4X5XB 1BOGA 2ARJA 3KWWA 3NCBB 4MB3A 4FS0A 3NTCH 4LLVA 1KC5H 3S36H 4KVCL 5FYKU 1RHFA 5HI5C 4OB5H 1LD9A 3SQOL 5D5MB 2BVUA 3QSKB 2FJHB 3G9UA 4PPTA 4LCYB 4RFOH 3K0WA 2BNRD 2W9DH 4ZUWB 4M6AA 5EORL 4L8CA 3RA7H 5FA3B 4WUUB 1JCKA 4MMXC 2I5YL 1WCYA 2R15A 1ZT7B 4GW4B 4X4YA 1INQB 5CD5C 3QFJD 4ONOA 3EO9L 3PXHA 3RWJB 4M9PA 1O5DT 4X6DA 4R97C 4HZAA 5EUKB 1M05B 3GGWB 4YXLH 1CFVH 4CMMA 5DD5H 4EIZC 4P4KB 5DUPL 4K6HA 4HIIB 1RU9L 5GGQH 3PL6A 2YXPX 4BATA 2VWEC 1C12A 1FAKT 4I5BA 4NHCL 4G8FA 2HVKA 5I1KL 3DX8B 4YX2H 1YEDA 3L95B 3ARFB 4JFHE 3IUNA 1AGBA 2HTLD 4NGHH 1ZK9A 2BRRL 3HZKB 4G7YL 5ICYA 4MS8C 4OD1L 4D8PB 3DSFL 1A14H 4H0GA 4KRLB 5AKJA 1T22B 4L3EE 4UBLA 1HHJB 2J3SA 2UY6A 2VLME 1RZ8A 3TRDA 4KI5D 3LS4H 4G6AD 3QFJA 2WLZA 3S36X 3PNWA 3BPNB 2BNRE 1JPSH 3FWHA 2F53B 3IFPA 1XF2A 1MRDL 4KI5E 2BOBA 3OKKA 3KPRB 3STYA 4G4JA 5D3ZA 4XTRD 1EXUB 1A47A 4DIUA 3CFIC 4OBRA 4K94C 4OSEA 3EBAA 1XQXA 5I16B 1IC7L 2H6PB 3A67L 4IOSD 4LL9A 3RGVA 1UK7A 2Z5GA 4BH7B 3ZDXE 2E9IA 2AEQH 4MNGA 5C9JA 5C9KA 1K63A 5JIIA 3Q6GL 2EDWA 5JW5B 2FIKB 2HFFB 3TBYB 2D5LA 2Y6VA 5GRVK 1YEJL 2A74A 2YBRB 4W81A 3X3GL 1BWMA 4OLVL 2ZUQB 5HHXL 3I3DA 1XZGA 1TZHB 4K3DL 3OR6B 1T1WA 3BPCB 4BFBD 4CGTA 4H35A 1XQYA 1IFHL 4K55A 3T1FB 3HB3C 3KS0H 4HEME 1UWCA 2WQ8A 1AFVH 5HFAA 2AJLI 5ALXA 1Q0XH 3GI8L 4ZUUA 3D3VB 3UTSD 4OD0A 1YCDA 3RWIA 3D85B 3KGRA 4M7LT 4QCIA 1ZI6A 2NYYD 2UYLA 2VZOA 3MBXL 3UTTA 1RPQA 1RZIA 1T0MA 4A6YL 2CIKA 3GMLA 4OZHB 4XP9L 3VFRA 4OLWL 4Y5XC 2XTLA 3DURB 3AAZB 1FE8H 3QB7C 4OGYL 3HS0B 2OZ4A 4LCWA 4PJ8B 2YOCA 2RGSA 4AQDA 2ZOKB 5IVXA 3T0EC 3VFMB 5BOPA 1CXHA 1GGBL 1T0PB 1IZJA 1PSKL 1YNLL 1EERB 4BE4A 2DQTH 3GBNL 3G02A 4I0PA 4RRPG 1WCBA 3MNZB 4LDLB 5EWIH 5K93A 1KCRH 1U8QB 1PKQE 1KB9J 4XT1C 2P5WE 3PDOB 1X5IA 3BPNC 1ZWIA 5FEBA 3TN0D 4AH2A 4UV4L 3C2AH 4DFHA 4U1HB 3GMOB 3LLCA 4U6XB 3W9BA 5AICA 1VPOH 1PDKA 1S8DB 1VLQA 1XZ0A 5ALVA 2W9EL 4WFGD 2UV3A 3VXUE 4KXZH 1CT8B 1VHPA 4XVTH 1BFOB 2VITA 4YR6A 3JYHA 4YASA 4S1DD 1DDHB 1GGBH 4HWZA 1A1NA 2WILA 3ULUD 2XACC 1LPPA 1Q9KA 1BOYA 3U9UA 2GTZB 2DTSA 2CZQA 4OQTA 4AEEA 3R06B 1ZGCA 5C8XA 1GC1C 3S96B 2Q7YB 2Y4SA 3SGEI 1T2NA 5JMOC 2VNCA 2UWEA 4GAGL 3GNMH 1I1YB 1TIUA 1T5XB 4XPBL 2ZKHL 4FQXA 4JHBA 5KANG 3I2HA 1QFOA 4MYSA 3QDME 3SDXB 1DQMH 3VRJB 4F57H 2BNQB 2YSSA 3P0VL 1LPMA 4JFZL 3ZKXB 5I1CH 4PS4L 2DDQL 3TA3D 1A6TA 4P9HH 4GW5A 4BM7A 1UKBA 4WFFE 1HINL 4I0CC 3U30B 5HHOB 2FL5A 3P2TA 5C07E 4BAZA 5LXGH 4H1LA 4DUWA 4M3KB 2HLAA 3QDJA 1NGZA 2D31A 2NX5E 3DX9B 4K3DH 4D0BB 1L7IH 5KSAD 5I1LA 4X6EB 4GG6E 2B2XH 4GBXB 2XUDA 3GKZA 3MLVL 4XMKL 5CT9A 2BY0A 2B0SL 4KQ4L 5C6TL 1A6WH 5I66B 2W38A 3JTTA 5DEGA 5C2UB 5LYYA 3IFNH 1FV1A 4A2MA 2DWEB 4HWBA 2GK0A 1AE6H 5F7NC 5GS1A 3HG1E 4FNLL 3IRZA 1DQML 1AJ7H 5FDYA 3MO1A 5ALCL 3NGBB 3CLEH 5ENWA 5CXXA 5L6YH 4S0XA 3MV9E 4UDTA 1EK3A 4XP5L 3WJLC 5C0CD 2XUFA 3T08A 1CD8A 2EYTB 1IILE 2GQHA 4U3HA 4RIRB 3RWCA 1ZT1B 2YHGA 3SE8H 5IT2H 3HI1A 5I30L 1KPRB 5FO9B 5J1TC 5F7EH 3LS4L 3BN9D 3QQ4B 6CGTA 3OJDA 3DJYA 5MERB 4J0DA 1CDYA 2Z35A 1EBPA 4MD5A 1JNHB 4X6CB 5DUML 5EO0A 4G8DA 4DGYH 2ZYIA 4IOIB 3D3NA 4F80A 1GIGH 1OGAE 5FHAL 4MDIA 1QO3B 3V79C 2BVTA 3V6FA 4X6BA 4WNQA 5DS8A 4Y9SA 4UV4H 3FB6A 2PYEE 4LLQA 5JD4A 1U95B 4IMLB 1VFAA 4JZJB 3CN7A 4ONHA 43C9B 4NKOA 5L2KE 3CX2A 5FGBC 1GXSA 2ESVA 3AUKA 2XOTA 1FJ1B 3U36A 5CT5A 1FYTA 3G6JB 4FFYH 2F8OA 4DOHE 2XPGB 2HT3D 4JVUA 3MRDB 1NL0L 5I6XC 2I24N 4GBXA 4G6JH 1QJ4A 1YASA 2WIKA 1SFRA 4HHAB 3VFVA 3LKQB 3O2VL 3S6CA 1BROA 5LBSL 1YZZA 3PABB 3OR7A 4HPOL 4MA7H 5TDOB 2XG4A 5ISZA 12E8H 3GHBH 3IVKA 4KZEH 3MRNA 5I1CL 2VDML 1CICD 4YDIH 5IB5A 5LAXA 3AREA 3NPSC 3BH9A 4JEGB 4LSSH 1QZ3A 1YY9C 4KDWA 1NAKL 1U41A 4GAJH 5EFZA 1VCAA 2DS4A 5F9OH 1PD6A 2JGMA 4LVEA 1XAUA 1DBAH 1NEZB 3PQYA 3KS0J 3LEYL 4LLVB 5FO9A 1AC5A 1B41A 5BZDB 2R0WL 1YEEH 4HUXA 5AO9A 1WIOA 4N1HB 2FBJH 5DMKA 2V2XA 4X93A 3DOSA 1XIWD 3HNTL 3MJ8A 5DSCA 1TDQA 3VH8B 3BKJH 3WLBB 5BV7A 3DVNB 3ZDYF 4NRZB 3DX7A 4G6JL 3FO9B 2AJVL 4OM1L 4U7SA 5ILTL 3UC0H 3IUJA 1KCUH 4DGVH 4G8EB 2A6IB 4E0RA 3FSGD 2JGIA 1VE6A 3C08L 4FQPA 3OPMA 4M5YL 4CW1B 1M7XA 2AJZB 2XUQA 3QPQC 5DFTA 3HHRB 3V1NA 2ONCA 5ALNA 1GH7A 1FYHB 3O2WL 2Y36L 3CX5J 1VB9A 1MCEA 4OCRH 2X05A 4NKDB 1HZHL 2RBLA 3B5GA 1FJ1A 2VXQH 3DIFA 2AKRA 3KXFD 1EPFA 3BAEH 2IMNA 4O08A 2JE8A 5HHQA 1GOHA 5DUMH 3LRGA 1QE3A 1S7TA 1N8SA 4PJIE 5EBWB 3EYQD 3DX8A 3ZSTA 3SBWA 1T2XA 4P46A 2E7HA 2OR9L 5E4TA 3WNLA 4WW2C 1S8OA 2G5TA 1KLFA 4KRXA 3B9KB 4MA8H 5ICYB 1T5WA 2FECI 2PU7A 5AZ2H 3AM8A 2WIIA 4PJAF 4JYMA 1HQ4A 4L5FH 4Z7UA 2XA3A 2DBLL 4J03A 1FH5L 3U6RB 4B81A 2HTKC 2APVA 5KSBE 3C6BA 2A6KA 4ZXBB 4A6YB 3EFFA 4WHTA 3LEXA 3PJSA 1YAHA 2BC4B 1VGKA 1NFDA 2BVPA 5H94A 3ZKMC 3VDXA 2WWMD 4OIIH 1IL1A 3WWOA 1WTGT 4PJ8C 5HGDA 4PJFB 4D9QD 3Q6FB 2CO6B 3ARSA 2VSCA 8FABB 3FOMB 1BVLB 1CXIA 3O4LE 3ULUC 3GSRB 4JYPA 3M8OL 3MLWL 1SJEB 3MBEB 5ALIA 4CBPA 2MCPH 1U58A 2BOCB 4GQ9H 3LAFA 4WFED 4JDZA 4ZPVB 3ZZ1A 3GSWA 3LEYH 3TBYA 3T3ME 1JZ4A 3EYOB 1ODSA 3KPTA 2GJJA 2FZ3B 5HHVL 5T1KD 4WFEE 1LDPH 1HKLH 1YPZA 3FN0L 4KROB 4XNYH 3TO2B 1IC7H 1NAKH 2DBLH 1GL4B 2A9MH 4QXTB 4X6XA 2P8LB 3TN0C 4MQSB 1F2XK 3BIXA 1TPXB 3L3JA 1HHKB 5ICZA 1G7LA 4ZS6C 2V7HB 1CBVL 3LN5B 3VXOA 3UYRH 2E8YA 2DQHL 4N9GA 2Z92A 3SKOB 5AIBA 5C09A 4N5IX 1MPXA 2DLFH 4JKPH 4HIEB 1XRQA 1I3RB 4PGCB 3BKCL 5F1IB 2JGEA 1RUQH 5IWLC 3RDTD 2OJEA 5E56A 3BAEL 4OCNC 1IGTB 4ZAKC 2Y25A 5J6GA 1HQRB 4PJHB 1R5WB 4MQXC 4NQDD 1U8EA 3EDKA 4AN1A 2V7NA 2C4FT 2GAZA 5DURD 3A2NA 1QNZL 5JNYB 4OI8A 3QUXA 3O9WA 5BRZA 4JDVA 4MHHI 4ODHL 4U6VH 1XGTB 5AG9A 4TQEL 4JPVH 5ETUB 1OP3H 1MI5E 4GT7A 1U8QA 2VA9A 1DUYB 3QBTB 1S7QA 3O0RL 3QJHB 4BBZA 1BZ7A 4MXWH 1JTOA 5L8JB 1R24B 1H15A 4C54A 3PHQB 2IQAB 4HQQH 4Q82A 2EO1A 4CJ1A 1S5IL 4XMPL 5EZJB 1AIFA 4HGWA 3D4LA 4AT6A 4XI5D 1SEBA 5IVIA 1AD9B 1CT8A 3F7RA 1MHCB 5IB3A 3B9EA 4Y2DB 4RCAA 1MJ7H 4Z0BL 1FDLH 5F88A 1OB1A 4APQA 1UWGL 5CGYD 5TQ2L 3FONA 3ARYA 1J06A 3OURA 4U2ZA 2RCSH 3R06A 4XVUC 5EFIA 3A6BH 3RUGB 3JVGA 2PX6A 5JW4M 4GAYA 5SX5H 4F3FB 3MRGB 1JI1A 2WUBH 3FCTA 4LIPD 3HAEG 4QYOA 4YXLL 4UHFA 5B39A 5BJTB 1J0JA 1EVQA 3BVNA 2EZ0D 4XAKE 2DQGL 4YUEL 2GFBB 4H1LG 5J6GB 1D5ZB 3WEXA 1BCRA 4KFZC 2F15A 3TO4B 5HBBA 3VFWB 3O3EB 4RNCA 4JY5H 4MXQC 2R69H 5F8QC 5JXEC 4OLEA 1FVEA 5TH2B 5ANMB 3D39B 2NX5B 4ARAA 1QOZA 4E11A 4P59H 4QNPF 2W6CX 3NCCB 3VXTB 1NGZB 4D0BA 1EEQA 3RU8L 3FT2A 4IEFB 3ZYIA 5J06A 3VGHA 2FD6L 4M6MH 3LQZA 1JGVH 4NCC2 2HMIC 3NA9H 4MX7B 1A6VL 4RNRB 4F7MB 3BUTA 1WITA 3ANTA 4XAKD 5K3CA 4LCYA 2FECL 4ZQKB 3FO2B 4FOMA 5CHNB 3STLA 5EN2A 1R6VA 2NY4C 1KLGB 2EDJA 4LNRB 1NGWB 3OPZL 3A6CH 1W76A 2DFPA 4PRPD 5EIHA 2F58L 3EO1B 3QIUB 4JZNA 3X13B 1DQDH 4G8GA 4KUCD 4FQ1H 2NY6C 4E41D 4TTDC 4BQ6A 2X89D 1P9MA 3WK7A 3VJ6A 2BXZA 4DVBA 4TQEH 1UZ8B 1HWHB 3KDAA 1KPRA 3CFCL 3BHBB 4LCCC 5SX4H 3JTSB 1NC4A 4I48A 1JN6A 3BZDA 4ELKA 2BUCA 3O6KH 1GC1L 1ZD5A 3BEVA 2JGFA 1JF1B 4AEFA 3UTPE 3VDCA 4BH8B 1BAFL 4JFQB 1WIUA 3HC0B 1FC2D 4HC1L 5H2BA 4X6BB 2HFGH 3TBWA 4X3CA 1H5BC 2G9HA 3LVEA 4XWGA 1Q94B 3H42L 3DV6B 1G0XA 4KDTC 1WPXA 4K8RL 4PJ5D 4B5EA 1JGEA 2XTJE 4JQXC 4QLRA 5F6HJ 4BZ2L 3HG1D 1HKFA 2OP4L 3QFJE 3KYKH 4X7SH 2GSIA 1AH1A 2HJKA 3FQRA 3QULA 4CNIA 2CH8A 4QGTA 2A9NL 1K6QH 3BF7A 4GWLA 5BWBA 1F58H 1R9MA 3V5DA 2HKHH 4TN9A 5ERWA 4HULB 1LO4L 3U4EB 4G8GE 4XCEA 4X98B 3ULVH 4X6DE 1OW0C 2IQ9H 3V6BR 4AENA 3IYLW 1L7AA 4DSAA 3B5TA 3K46A 3L3HB 4JO2H 1D9KA 1KB9K 4P9ML 1K4DA 4KUZH 3OAUH 2UZIL 2OXGA 3OKDB 1LE9B 2GJ6E 4G42A 1K85A 2AABL 1JTPA 3ULSA 2ZSIA 4EUPA 1YN6A 4R26H 5BV7H 3DLTA 4U2FA 1CLCA 3QJFA 5B4MD 3UTZA 5ADPH 2Y6SC 4HIXL 4RGNC 2HA4A 4AN0A 4KJYA 1AGDA 4MAUL 2ARJB 4QKXB 1RULH 1SYVA 1U8OB 1OTUD 3Q6GH 3P0YL 4XWOD 3FFCB 4Z7NE 4F7EB 1D6VH 1B4JL 5DMKB 4I2XA 3DUHA 5DFVC 2WANA 3LPGA 4YHIA 4NRZA 4CG3A 5T33L 3F7YA 5CRIA 4ZO7A 4JY4B 4YPGB 3ZMRA 1DVFB 1JYVA 3V95A 2PW1B 4LSQH 4HXBL 2C1OB 4GW4A 3V52H 2EH7H 1DBBH 2ICEB 3QUML 4PJAB 4MAYC 2DQCL 2EDHA 3GRWA 4KV5E 5F7EL 4OAWB 5AKXA 5IK3B 2BMKB 5DWUL 4X71A 2FJFB 1CU4L 4DK3A 3RWDA 4ELME 5SWQB 1BFVH 4Y16C 1CIJA 4W1PA 1Y6MR 1XGRB 2WU3A 5CP7A 1I1AC 1YEIH 1QLWA 3JXAA 1LWRA 5I8PA 2MQ3A 3G0IA 3SPVB 1IC5L 2YMXL 5JZ9A 4B7IA 4M7LL 5B3JE 1JJBA 3ARFA 3GSQA 4RGMB 2VISA 4OCRL 4HC1A 5IBTH 1JE6A 1N4XL 3QNYA 1ZAGA 3C70A 3MGAA 2IAMC 1R3HA 2VLLA 3PP4L 3NN8B 3C45A 1E4JA 5HI5D 1DSFL 4MDJA 5B8CC 3DMMB 3MLTA 4WI5A 2G60L 2OXEA 4HXEB 1LP9F 3IJYB 3QG7L 4XPAL 4YK4C 4P2OD 3VXUD 1CGSL 2R29L 4MJ5A 4NO0D 4YPJA 1BJMA 5KSBB 3O6LH 4WW2A 3BWAB 1F13A 4JFXB 4X4XA 1MWAL 4LVOC 1A4JA 2ZSWA 3I02B 3SBWC 3ILSA 4ZO8A 1NGQH 2HKFL 1BBJB 2GYWA 1N5YH 5AI9A 5FM5M 4PV9B 5DJYB 1IAIM 3T0AA 3MLZH 3CK0H 2W0LA 4B41A 1ZT4B 1NBYB 3A67H 1QFWM 2YPVL 3AU1B 2R56H 3D9AL 5KOVC 3V5HB 3D6GA 4G9EA 1YA8A 3QO0B 4JG1L 2VKWA 3S4SA 4Z18A 5F7LB 1FNLA 3W0WE 2W07A 3AUVA 3EDEA 2IQ9L 1CQKA 3B4NA 2Q6WA 4FXKA 4XXDA 1FVDA 4QNNA 1FZKA 1VE7A 4YAQA 3PFBA 1A02N 2WM2A 2HA1A 4NCC1 3ZTJH 3GIZL 1KG0B 2OQJB 3GSUB 4MNQE 1BD2E 1XQWA 2I3DA 4PV8B 4PUBH 4Z7UF 1JUFB 1NBQA 3V9AA 4DGQA 3WK8A 3ESAA 4U3CA 3LN5A 3ZE1E 4JFDA 3SCMD 3PE9A 4QXGL 5D2LE 1MCPL 4HKZA 3IAPA 3M8OH 1M71A 1RIVL 3VGEA 1U8IB 3QIUC 3AMLA 4OZHA 3MGOB 2AAVA 4W1QA 1OCEA 2R4RL 3DMMA 1G0YR 4BE9A 4LP4A 3ZSSA 1ACJA 5EBGA 4MGXA 1XZKA 4O9HH 3MJ7A 4FFVA 5EWIL 2V96A 3RBGA 3O6ML 1F0PA 4P5MB 2DQTL 3KLAA 4KTEH 4LHUA 5IVDA 2EYSA 5KVFL 3RP1A 2H3NA 2ZSWB 3I02A 1EDDA 2AJXH 1A21A 2EE6A 4Z7QF 2P49B 1RJLB 4KH2A 1T66C 4DGIH 2GITB 4JRWA 1S3KH 4X6CF 3VWKD 2K1MA 1S5HB 3PHOB 3QUXC 2BJHA 5K3EA 4X97A 3R41A 5C0EB 4H0HB 2WQZA 4IRJA 1HI6B 4DCQB 4UTAL 3S4SB 5DRZB 5IVHA 3AINA 3SE8L 4S0SD 1AP2B 5C07A 4Q1VA 3S34L 2C3WA 5EZJA 1ZGLP 5GGSB 4YDKL 2VITB 4B53A 5J1AB 1VFAB 5IFHH 1GPNA 43C9A 5DJZA 1YC7A 1Q0RA 2JB6A 4D3CH 3ULUL 1ZVYA 2ERJB 4FFWA 3QVMA 2EIZB 4Y89A 1KJMA 2ZUWA 1CIUA 3TN0A 4XNXL 2CGRL 4NN5B 5LXGL 3QNZA 1RJCA 2Q7YA 1CFNB 1ZGLB 1WB4A 1WUNT 5EC2A 1YAJA 1M71B 4DGVL 5D71H 1TTFA 3DBXA 3FBWA 3KNBA 1JNLH 3GM0A 2VJBA 3HRHA 3IDMA 1B0RB 2FJGB 5IROC 3R8BB 1UFOA 1VADA 2Y1KA 5JZBA 4BFGA 4Y2OA 4FP8L 4PIRF 1UWEL 4M1GH 1LEKB 1RIUH 5ALDA 3R4DA 4P9HL 2VLRE 4C4KT 1G9EA 3LH2H 3PG2A 2D0HA 1VZ3A 2Z8XA 4PRPE 2BSED 5CJXC 2YC1B 2YD6A 3J7HA 3KYAA 4KAFA 4TVPH 1OARH 1J18A 5I1LB 4NQDE 1KFAL 1KJ2A 4P3DB 4JR9H 5MI0B 4LXIA 3FT2B 4NJAH 1YB7A 5HY9B 5AI5A 4OF3A 1NLDH 3M83A 3M82A 3G04A 4EN3B 4P9HC 4MA7L 4PLOB 4UU9B 5LIPA 1A14L 4FG6D 5IIEB 2ZG3A 1EDEA 4I18B 1H3PH 4CADB 1MIMH 4DKFH 4M7KL 1W0VB 2FO4B 1OTUC 4GAFB 4O02H 4LVNB 3F12A 3KPOB 4HT1L 4WW2F 2XUKA 3MRRA 3VWJC 1ULVA 2VZ3A 5GRYA 4GFTB 5FRDA 4QXUL 1F4HA 2BCKA 4TUOA 3S37X 2VDKH 4M7ZB 4P9NA 1XMWA 4U6HA 3DGCR 1W72A 3QCUL 3VXRD 5KVGH 5DRWB 4DZBB 3JWNC 4TRPH 4RIRA 3S2ZA 1U91B 2DOCA 2NX5D 1HOCA 3UROR 4Y2XA 1EA5A 4F37F 4ARBA 3ZHLA 3QUXD 1UZ8A 3RVXD 1GPOH 1V7NL 1HXMA 3TEUA 5FK9A 3OKNB 3F7QA 2EKJA 1TCRA 4POUB 4L4TB 4LKOA 2VLRA 4N68A 2D7MA 4GXUM 5JARA 4KMTL 2VXUH 4FQ1L 4X8XA 3W2DH 4E42B 5C70A 5D7BA 4F33A 1A3LL 4K3EL 4PGZA 4NDMB 3MXVL 1CXLA 1MH5A 1P1ZB 2IPUG 3SKNA 3KYNA 2R1YB 1BIHA 1CGTA 1MFCH 3HZOA 2CPCA 1AQLA 5D7KD 1MU0A 5FYKE 3RNKB 3DGGB 3FTGA 4UHBA 3IFOA 3MA9H 1A7OH 4JFYA 2PSDA 1IUOA 1RJZA 3WK9A 3K8KA 1HHIA 1ZE3C 1VGEH 3QFDA 4L9LB 4NKMA 3QCUH 4X99B 4IJ3B 3ARTA 4UILH 1N6UA 1JZ2A 5E9DA 1GZ7A 3C09B 5T4FA 3KDMB 2OAGA 4KZEL 4FTVD 1B6DA 3L3IB 4JG0H 4HWEH 2VR5A 3I2GA 3QNXA 5C08E 2K3TA 4LDEB 3TPUB 4I18A 1N59B 4S2SB 4M6NL 4MWFA 2BVEA 4GECA 5ITBL 2VSDA 1J86A 3L3HA 2R1WB 2IEPA 2O5YH 3ZTNL 5FKPB 4NZUH 2PKDA 2OCLA 5JPNA 5CILH 2BSTA 4FBMA 4JR9L 4MJ2A 1MAJA 1TQBC 3RL2B 2GIYA 2WJ3A 3LHPL 4WCVA 1K4CA 4YBLC 4B83A 4U7MA 2I9LB 1A1MB 2FEEI 4Y1AA 2O7RA 2LABA 4R7DB 3W9DB 1AY1L 1JZ7A 1C5BL 2ED9A 4PREB 5DRXA 1PYWB 1ES0B 3QZWG 1NCTA 5FYKD 4OB6A 3P77A 2ZPKH 4U1MA 3S5LA 3ED1A 4QRQB 5D7KE 4O4YH 1UACL 3KJ4C 3UDWA 1YN7A 3IKCB 2E27L 1LHZA 3EJZD 4KVNH 3SDAD 3SKOA 3VD7A 4F33B 4JHWH 5I19H 1K3ZA 2XQYK 4TUJB 3DROA 1Z9SA 2JJUA 1W0YT 2IGFL 4LU5L 1EEYA 2M1KA 4PGCA 3BP7B 1E4XL 2B1HH 2RJMA 4JO3L 2DHDA 3MRHB 2FSEA 4GMSH 4XPTL 4RA0C 1URLA 1MFAL 1MN6A 4G7YH 4OB8A 3ETBF 4XI5C 4KHTH 4NKDA 5C7XL 3TT1H 4JFYB 1RJZB 5AM5A 3DSFH 3FN9A 2Q3AA 3SY0A 2CKNA 2ADIB 1BLNB 2C3GA 4P5TD 1LBTA 4NHUB 4JPWL 4CVZA 4HD9A 4Q6IB 2Z31C 4OZ4B 3S34H 3STWA 1J9CT 3LKRA 4L3ED 1FYTD 2WWKO 3WS6A 3AS3A 1AGCB 1PGRB 2J12B 2PR4L 3LRHA 2PSEA 1JF5A 5FA4A 3MLTB 5JMRA 2FIKA 5BQ7B 2P8PA 3RA7L 3KYMA 4FZEH 3BSZH 5FYLL 5HXMA 5F7UA 5A2IH 2VL4A 3WXWH 5E95B 5J3HC 2IBZY 1QZ1A 3WJJC 4ZFFA 2DYPD 4M0FA 2OCFD 4KAQH 4QOKA 3BPCA 4Z0XB 3WJ2A 4H8WH 5C0RH 4J1UB 1B3JA 4LBEA 1A9EB 2Y5TB 4JFEA 4JFOA 1I8KA 2FJHA 4GSDH 4NSKB 1B9ZA 2NY1C 4MEBA 4XNYL 3RWIB 1BVLA 2L7JA 3CCHA 4ZUWA 4L8CB 3P73B 2DR0A 5E5UB 5IB1A 2DD8L 4EIGB 3DYMA 5JZ7D 1L9NA 2JTDA 1Q0XL 2VIRA 4JDZB 5BJTA 5MEND 2CJUL 2NR6C 2VLJB 4WDQA 1NLBH 3EYOA 4YQXL 4LPXA 3TIEA 1S7RB 3X3FL 2P5EA 1QRNB 3TPKA 2XQBH 3WIFA 1MVUB 4HFWB 2PR4H 3RGVD 3EQ8A 2X70A 3GI9H 1FO0B 1QTYT 2R4SL 6FABL 2VAAA 1HHKA 5ICZB 2B4CL 5LWYL 3QZWB 2OCKA 4FN0A 3QPDA 2IFFH 2VSQA 1GC1H 3WUZA 5HDLA 4JFDB 3MRBA 4E9LA 1XRNA 3MLYL 1QRKA 3SEPA 4X9HA 4XHQA 2EC8A 4PJGA 5IW6B 1NGPH 1IT9H 5DQDL 5IBUG 1XF3B 1HL7A 4D8PA 2XXMB 1QIDA 3QPXL 2VQ1B 1AQKH 1T22A 4X85A 1TZIB 3MRKA 1HDEA 2VJAA 1NGWA 2RHTA 4U1JA 2ZCLL 2YK1H 1N64H 3SJVB 1BMGA 4OF6A 25C8H 3G9XA 1HE7A 5D8JL 3GZJA 4HFUH 4KMLB 1OT2A 3TBTA 2WKWA 1NCWL 5MEPB 3MV7D 4HDIA 5E8DL 3O6LL 3WFCL 3QDMA 3ARZA 3LEVL 4Q9RH 3T0BA 3Q8WA 4NQCE 2YS4A 1MREH 4YWGH 5SV4A 1X7QA 3PHOA 1Q72H 1S5HA 2VXQL 1OAUL 1CICB 2X10A 1DUYA 4U1LB 5GHWL 4W1SA 1QFWH 4K71C 4RMVA 15C8L 3R3WA 2FATL 1JF1A 4ZV7A 1J8HE 1H15B 2I26N 4B9EA 1EHLL 2KPNA 5C0JB 2PTTA 1MWAA 3OKLB 3FVTA 5INCB 2VLJA 1L0XA 1PEWA 3HI6L 5FUOH 4IRSD 1XFPA 4PJXA 1E27A 1X2EA 1FGVL 4QRPE 3KWFA 3QDGA 1KXTB 3QDHA 1LEIA 1JT2A 3ES6A 1ZJ5A 1EUTA 1QBMH 3EFDH 5HYJA 4APQB 4JO1L 2CMFA 2WUBL 3D2UB 1NGYA 1D5BB 3NH7H 3OV6A 4ODUA 1UG9A 2ZVDA 4UNVA 2XMCA 5GXBB 1RK1A 2EH7L 3DUUB 2EIEA 3QDMD 2OX5A 3MRGA 3QXUA 4JB9H 4PJGB 5KBYA 3IIIA 1EHYA 1IEBA 1RZIB 3CXHJ 4N8CH 3IBTA 4UUJA 4PGBA 5ALEA 2A83A 1B0RA 2FJGA 1U65A 4KI1A 3BEWA 2VB5A 2HA6A 3T3PE 3FQNB 4WFHE 5D96C 1HDMB 1GPKA 3AXLA 4PRPB 2HN7A 2IFFL 1R3KA 1RZKH 5DK0A 4UQ2B 4GQ9L 3EOYG 4BELD 4QGYA 6FABH 2BP3A 5E70A 4XHJD 4HUVB 3SDDA 5MHSD 5KS9E 4JO1H 4AJ0A 1G7MA 1P9MC 3TBVA 4EEEA 2XXCB 2CO7B 4RE5A 3NUZA 4C55A 3GMRA 3WFZA 3V8CA 4U6YA 4P23C 3QH3B 3P2MA 1YMMB 2PXYD 4P3DA 4U31A 4J0GA 1EZVX 2FX9L 3H9SA 3STTA 2MMXA 5LZ7A 3W11D 1MX9A 1LEGA 3UUEA 4OFVA 4KTDL 4UU9A 1VPOL 3SCMA 4P9MH 2IF7A 3N1PC 1L7TH 3F5WB 1X5AA 3RGHA 4PRBA 1XLVA 2I25N 3CXHK 4WU5B 4L72A 3RNQA 4AEIL 3OF6D 1A5FH 1AXSB 1JMKC 2Z31B 3MLXH 3MRPB 4DKDC 2PW2B 4GEGA 5T1MB 3M3DA 5EUOE 3MVEA 4Z77B 2W59A 3WSQH 1E4XI 4G8GB 2MFNA 1TJGH 4OCSH 1FL6B 4P48A 4Z5RA 1MREL 4HLZH 2VF2A 1PY4A 4X7TB 1MF2L 5E00A 3LQAC 3VXRE 2DLHA 5JXEA 4J0KA 5D8JH 4NJ9H 4BRZA 3K74B 1HXMB 4I48B 3L9RB 3SPVA 4RAHA 4JO4L 3T4AA 5AM4A 2X40A 1XT5A 3LKSB 1ERNA 1TJGL 3BQUD 4OF8A 3PGDA 2XMBA 4UTBH 3HI6H 2QJDA 5FB8A 4Y4KC 4MXDA 3FQNA 5LAXB 1A5FL 1E4WH 4OBSA 3O2DL 4E41E 3BP6A 5T5NG 3HMXA 4R2GB 3MMEA 3N06B 3JUZA 1JWSB 1L7TL 1JPGA 2Z0BA 5ESVA 5EU6D 2H7XA 4KAAA 1T66D 3O6FB 4XGZB 3OJMB 1U8MB 3QDJB 4W4OC 1OPGL 3BIKA 4MB5A 2C1PA 3X3FH 3H9SB 4OLVH 1YECH 2R8BA 2UVFA 2C3HA 1BQLL 2HG5A 3ET9F 5IMLA 1J05B 3K1DA 3QAZC 3VFSB 5DSCB 1NCCL 3QNXB 3ULVF 3LN4B 1ITCA 1WZLA 3PWPB 3KPSB 3P9LB 4I1NB 4K71B 1XZEA 5F7DA 3PGCA 5BVPH 2FWOA 4I3SL 2YD3A 2O2IA 4D9LL 4Y4HD 2OTUB 1A6AA 3SDCA 5F6HI 4Z77A 2AJZA 1YN6B 3T4UA 5ITFA 3RVTC 5JTWA 5LCVL 4FABL 5TE6L 5EC1A 1N5MA 5BVJB 4RSVA 3MJ9L 2KL6A 3PQYE 3RL2A 2E6QA 1K9TA 1AGDB 2K7PA 4P92A 3I1IA 1BD2A 5ALMA 5HD8C 2HRLA 3S37L 3DIFB 4U3XA 5GGSY 4V1DB 3V0WL 4UTAH 1PX3A 4TVPD 2CDFA 4PJCE 2VJXA 2QR0A 4UBDC 2PM8A 2CK2A 4I5BB 3KPMB 4LF3A 1G9MC 2Z35B 1F90L 1EDBA 4ROTA 5EBWA 4HKZB 4L8SC 2XA8H 2V97A 4CU7A 1UCBH 2C5DC 5I2IB 5EO9A 1RURL 4NQUA 1EEZB 3V6FB 3PWUA 4M6OL 2ICEA 5IEKB 4AMZA 1A7NH 4Y4FD 4HIJA 3S88H 4ESKA 1OLZA 5DT1L 3VI4E 1P0MA 1T7WA 3IJSA 4R8WL 1OILA 1GGYA 4Y4KD 3MJ6A 1X5XA 4KK9C 2ED8A 4ETYA 3OKKB 4N0UE 5HYIA 5LJYH 1HCFX 2EO9A 4OV5A 3PV6A 4MD0B 4WV1B 3CCCA 5D6DA 3ARGC 4Z78B 1BHGA 4GRMA 3T52A 4NC1E 1RZKC 1RSFA 3HCVA 5JZSA 4M61B 3WIOA 2KKQA 2J4WL 4PGEA 3WLWC 3BGMB 2BAGA 4LEOA 4Q6YA 5KAQG 5IJKC 5EH1A 4BVJA 2XTJC 4HJJL 4DMFA 2XQGA 5FXCH 1MY7A 4M93C 4XRCB 5CZKA 3JBG7 4NM4L 3JZ7A 1LPOA 3VXSA 4H7EA 2PYED 4M5ZH 1QSFB 4N9OB 4ZUTB 3CNKA 1JU3A 4QWWC 4YBQC 4BQBA 3BZEA 4JFDE 3RIAK 2R23B 4HRYA 4L8SA 3WIHL 3SDYH 1FNGA 1IEHA 1W52X 4P5TB 2WP3T 2N1KA 4WEBL 5K9KB 4NUGH 4DAGH 1KGCD 3H9HA 2YD4A 3D3VA 1WEJH 3HMWL 4QXUH 5I8CA 2F5AL 1D07A 1TRHA 1P7QB 4NZUL 3W0WD 3O4OB 3WL5A 2AJBA 3I50L 5E2WL 4ZNEA 5IB1B 5L7XL 2BFVL 3F97A 1A0QL 4ZDHB 2Q7NA 1VERA 1WVZA 2Q6WB 2DQIH 2C7BA 2BNQE 1H2YA 1OVZA 4HIJB 5ACMA 1MI5A 1YEKH 3GJEA 3RWFB 4W63A 4PJFF 1G6RL 2F54A 3PGFH 1H3XA 3FT3B 4PJ7F 3D3VD 5HGAB 3UTSB 1E6JH 3TIEB 3IJSB 5HD8D 5GQBA 5DJ0A 2XWTB 2QLVB 5EOCH 4JRXE 1F11B 3G6JE 5EU4B 1OSZB 4YHML 4JDVB 3MUJA 3KPPB 4KPHL 3LD8B 4Q6IC 5EOTB 1RIUL 1JFQL 5F3BA 3LIZH 2O7VA 4QRRD 5ALYA 1PKQB 3V6ZA 5CLTA 1RMFL 2VQTA 3CVHB 1Q9WA 1UM6L 1K8IA 1BBDH 3HG1B 2VTFA 3QI9C 5I15H 4BA8A 3F12B 5HHOD 1MHPH 5INDA 2WIIB 1OD7A 5HF9A 1TITA 4Y2QA 1SEBB 4OZGF 3CZFB 4EI5B 1TTUA 3OXRA 4HUUB 4LHUB 2GBFA 3HNVH 4IRZH 1AQDA 1W1IA 3E1F1 4LFHD 5DUBA 4ODVL 1JPFA 5E2UL 5DT1H 3TJHC 1DDHA 2DMCA 3IKKA 4KY1H 5DTIA 3G0BA 4Q0XL 3I2CL 3FONB 5AK5A 3O6FC 3DKKA 4M1DL 3CVIL 4XXCC 1GSMA 4OQ1A 1FZOB 1MPAL 5E8OA 1F3JB 5JR1H 2D7PA 1YUHA 1CYGA 1SJVA 2YD8A 1A4KA 3ARWA 2DN7A 3AVEA 4ODWB 5GJSL 5D6OA 5IM7A 1XEDA 1XGPA 1IGYB 5SV3A 1N3NA 1JGLL 2EEBA 1G7PB 4YC2C 1E27B 5B39G 4FOLA 1KTRL 5CBKA 3VD5A 1A2YA 1A7BA 3EDDA 3O3EA 4S10A 3DEAA 3FOLB 2F8XC 2OR8A 4DKEH 1QHOA 4OB5L 3D39A 3UTPD 1KOAA 4IRJD 2D31B 3U0TA 4GBGA 4LFHG 5I71C 3C43A 2AI0H 3VXOB 1AHWA 4NNYB 3NTCL 1C7SA 4P23A 5FHBH 2JKXA 2J6EA 1T2JA 4M48H 1RK1B 3KNBB 3VA2C 3OWEA 5F4ZA 4BTLA 2VLKB 4G9FE 1K8IB 1G6RA 1YEKL 4NUJB 4P2QD 4R4FH 2HRQA 4PV7A 1T20A 3BKJL 5LZ9A 2FUKA 1E4KA 1SY6L 2APWA 5H37H 3LS5H 3IDAA 5DQ9B 1H3GA 4YHOL 4FKBA 3GEWB 1JPFB 1T7XA 4MVBD 5KS9B 1NLDL 3BT2H 5GZOC 3PI6A 4LLDB 1IBGL 1PLGH 4WO4C 3EYFB 4WEMB 3S35H 1PYWA 3G04B 1QACA 4DZ8B 4MD5B 3ULVC 3F7VA 1EMTL 4JRYD 3IB4A 3WN5C 3OBAA 1DU4A 4TNVK 5EIVA 5HQ3B 4ZAKD 2YPVH 1MCNA 4JRYE 1EEUA 4U1SB 3BP7A 1INDL 4OI9A 4HW6A 4F9LA 5AKLA 4GMTL 1D5MB 1TTGA 4OUUA 4LVNC 3G5VA 4XH2A 5FO8B 4W6WB 43CAB 1A1OA 2P5EE 5AH0A 4HH8A 5I1EL 2VDQH 4DK6A 4HIIA 4YHLL 3QPQD 1P0QA 2OCGA 1CL7I 4WY8A 1DWOA 1TCRB 4YE4H 4HHAA 3HZYB 4DNOA 3UJTH 3GBMH 4X7CC 1Y37A 1B2WL 2LAGB 3V7AG 4E42A 3D5EA 4J7AA 4TSCH 4GG8A 3T09A 5L0QB 2XWJB 1TZGL 5DUPH 1RHHB 3HZVB 3CSBA 3SDCC 4U0QB 3TIDA 2G2RB 1HWGB 5C08D 2B5IB 4I3GA 5D70L 3QI9B 1CXFA 1XIWA 4BZYA 1E0OB 4KDTA 3T65B 4RZCB 3DHMA 4H25B 1OAZH 4DNQA 1PJ9A 3CSPA 4G80B 3IXTA 4PP1C 1K6EA 3BIKB 1CEXA 3QUZD 1TCBA 3REWB 5DQDH 4RBPH 1I9RL 3PUCA 1XFDA 2RCSL 4XPFH 5E7BA 4NO5A 3MBEC 4JFFE 4UOW0 1IGIL 4NQTA 1K5NB 1FFNA 3ZE0E 4PJDF 4CW1A 2FLBT 4Y4KA 1CDHA 3UTOA 4OGAC 4XNZB 1QVOA 1ETZB 1MFDL 3U79A 2AERT 1D6VL 1UOOA 3REVB 2WIMA 1HHGB 4K7FB 4MZ3A 3HE6C 1MAML 5ALSA 4AEHL 3OG4B 2BY3A 5ALHA 4HSQA 5ESAB 5D1QC 1NSNH 2Z8SA 4WWKA 4MCYB 5C71A 5D70H 4P2RE 5J9PB 2IPTH 5AOAA 1BVZA 1HNFA 4FQCL 3ULVD 1T4KA 1WEJL 2FX8H 5FPPA 3DS8A 5HHMD 2I60H 4N90E 4I9WD 1K2DB 3VGFA 4Z7WF 2OK0L 5I0DA 2JCCA 3WHXA 1FPTL 4ZFOL 1NX9A 3KXFB 4HCRA 5EO9B 1I4FB 3ULVL 4Z95H 2DICA 4CDHA 2H1PH 1JV5A 1G7HB 1CFSB 1RZ7H 1F58L 5I1EH 5C0AE 3P3YA 2EXYD 2HFTA 3O45B 3ZHDA 3WA6A 2CIIA 1BRTA 4DUVA 3KWWB 4JO4H 4A2LA 4OFDA 5IQ7H 3H2IA 3WDIA 4DQOL 1F02I 4RAVB 1MFBL 1LD9B 1MAAA 4DVRH 3SDDC 2P5WD 3MCKB 4E46A 1B90A 1CICA 5D7LE 4KC3B 2QQNH 2ESVE 3LKPB 4RPCA 1OSPL 4H18A 2VUYA 4NIKB 2YPLB 5FKAB 5IFAH 5CBAB 3UUFA 1CGXA 1K4DB 4ZXBD 5CWSA 1WAAE 2ESVD 5FM4A 2XYCA 1QSFE 1QVOB 1FNAA 2DM2A 3O6KL 4LMQI 2CSPA 4PJ9A 1U2EA 4L1DA 4M3JA 4AEIH 4OZIE 1DBML 4XAWH 4CCWA 3FZUC 3GKWL 5GGTA 3V7AE 4OYLA 4KTDH 1AURA 4FQJH 5EU6A 4HWZB 1AC0A 1GGTA 4HTAA 3GFFA 3BQUA 3U9UB 1WWWX 5CJ5A 4F7EA 5E1AB 3W2TA 4Z7WA 3JV6A 1G5FA 1T04A 4NZDA 4UZGA 1J1IA 4YX9A 1EX9A 5LKAA 4OZFG 2QM0A 2Q3ZA 1CFTB 2KZWA 2WP3O 4WO4B 4EZIA 3PDGA 3OAUL 5T5NF 3HI4A 1DVFA 1UCTA 4ZSOE 3O95A 3GROA 1N2RB 1NMBH 4LLYA 2C1OA 4N90D 4HWNA 4BZWA 3ARDB 1CFJA 3L5IA 3JV5A 2EIDA 5KANI 3SX4A 3FT3A 3JWDH 2H7CA 4PJHE 5D7IE 3QUZA 3HPLA 1NDMA 2VC2L 5A71A 4LOUD 2QSVA 3KVQA 3QUXB 4U0RB 3QA3A 4U2YA 1F11A 4GQPH 4R96A 1KU0A 5EZLA 1XGTA 3DX9A 4LSUH 4WCYH 5EHNA 3QDAA 5ITBH 1JYNA 1L9MA 3I50H 5E2WH 1S7QB 1CUSA 3LKPA 1THGA 2CLVB 2DWEA 4HS6A 4HS3A 5HYEA 4TYUA 5F7HA 1C7TA 1NQBA 1CS6A 4NBYB 2OK0H 1HZHH 4KRPD 4NRXB 2DIAA 3H19A 5D7JA 2HU7A 1D5XA 3RWEB 5AKYA 2A74B 4PD4J 4UT6L 2WFLA 4Q9RL 2PU5A 3BDXA 4WW2B 4OZFB 2DMKA 5KN5A 4X7TA 4YBHA 1L7QA 4PNZA 1Q8MA 3TBTB 5DJZB 4LVOB 3HC4H 1ZT1A 4UAOC 4H88L 5A2JH 1YPZF 5KZCB 5KG9B 1CTNA 3ARQA 1Z6JT 4OKVA 4OLXH 2QBWA 3DYVA 1KF9B 4TTDD 1T03L 3UTQA 4U1LA 1EVEA 3STZB 1JNHA 4X6CA 2VC2H 2I03A 1DQLH 1KELH 1D6EB 2DQCH 2ZPKL 2C0QA 3R3UA 4HBCH 4PJEE 4Z7OE 3IETB 3BFOA 3EZ8A 4FXKB 4GXNA 3NACH 1JWMA 1KJ3H 1EO7A 5GS0C 3DURA 1FRGL 4TSAL 4N5UA 4NNPL 3NA9L 3IULA 5HVHB 1U8HB 1I8MB 4W1RA 2XTJB 3WN5B 3MMEB 5JQ6H 5F3HA 3THMH 1EB8A 5ESVB 2X4UA 1GRWA 1Y6NR 4Q7DA 1MNAA 5C2BH 4Y19D 3RWGB 1S7WB 4J0IA 1HCVA 3WWDA 3UYOD 4JANB 4WHCA 1IKNA 2HVJB 2XDWA 3L1HA 5EU7C 2FGWH 3HPJB 5AI0A 2J7LA 1J07A 1E8DA 3B9DA 2CLZA 2EDNA 3VWJB 4I77H 1EVUA 1S7VA 4WUKH 1XCQB 2G4LA 3TO4C 3E1GA 4AX4A 1W0VA 5JALA 3UBXA 1OARL 1MRCL 3GMOA 1YB6A 4Y2RA 5D7JB 1JJFA 5T1LA 1IGJA 1TVHA 1CGYA 2XZQL 4BP8A 3NACL 3V48A 4LDOB 5KN5B 1VFUA 3FB8A 1U8LB 3P40A 4QHUB 3I6KA 3MV8B 5DZOA 3Q2CA 3B6SA 1HKLL 1TLKA 2GTZA 5K9OB 5A16B 2P1YA 3UTTD 3JTSA 2FR4A 3KAAA 4ZRDA 2NQCA 2BVOA 1LEGB 1UQSA 2XN9B 1OP5H 2NY4B 4XP1H 2OJZH 5A62A 1SOMA 2I07B 2WLYA 1YEHH 2UWEE 3AFIA 2ZCKH 3DV4B 3I75A 2PF6A 1USWA 4CVXA 1QG3A 3TBWB 2G9HB 3GA7A 2K9UA 4EBQH 1J0YA 5GS0H 2JEZA 5HK9A 3BP4A 2FX7L 2Q87A 1U8HA 1ORSA 2VDRL 4LQFH 1I8MA 4JFEE 4ZYKB 4K7PL 5D5ME 3I2CH 5IF0A 3BJMA 3ESBA 43CAA 4WWID 1DSFH 2HAZA 4L3CB 5E00B 1NJ9B 4HEPG 4QWWD 1CDGA 1KNOA 1KPVA 2XLBA 4DNPA 4YHNA 1CVLA 2M26A 5EB9A 2IADA 5EO1B 3O9VA 4BCDA 1CFNA 3CFJB 4P2YA 4C56B 1CUVA 1IGCL 3RVWD 1C7IA 1UCBL 4GRMB 2CLZB 4G6AC 2XA8L 3OJ2C 4G8BA 2BERA 5DEGB 3MPCA 2NXZD 1ZHBA 1MSPA 5EA0L 4QTHB 3ZHKA 4ODXB 1JGDA 5DO2D 3DLQR 3DNMA 1DANU 5JHDD 1A3QA 3GSOA 1KFAH 1J1XL 4BCCA 1MNQA 5ENWB 4QE3A 4XX1A 4NZZA 2ZYHA 1YYLL 3Q3GB 1AGEB 4P2RB 1F4YH 5HYQA 4KPHH 1JWSA 1PQZB 3BZEB 2XFXB 4HWBH 4M43L 1MHEB 5B38B 4OFPA 3HUJE 1A1MA 3O41B 4B84A 3PJSB 4P46D 1KJ2B 4QO1A 5EZOH 5F1NB 3TGLA 4OLYH 1C5BH 2Y36H 4NO3B 5HY9A 4Y2JA 4UHEA 4UOW1 2VRAA 5HVWA 3IGAB 1YY9D 2ZCHL 3LHPH 1BFTA 5F9DC 1SCKA 1K5NA 2H26B 3QPAA 1FQ9C 3MRRB 1QBAA 2F5AH 2LQRA 1MPAH 4EDXA 5JOPE 3CXDL 1GT6A 5YASA 1JGUL 1AKJB 3E6HA 2EIBA 3CUPB 2BGNA 5FDWB 2Y7QA 3ARBD 3BH8B 4L3CA 4JRXD 3F65A 3ICVA 2Y5EA 5L88H 3MA9L 5CP7B 4PJ5E 4LSPL 5K59E 3LDBC 1FH5H 1OP5K 3MUOA 1VGEL 3OX8A 2A6DB 2DM3A 3GSQB 1I7RA 3PWLB 5C0DB 1DX4A 5K9QG 2ILLA 1XZMA 4HLJA 4QA9A 5CH5A 4GS7C 5ALZA 3GSNA 2VE6B 1XGQB 5IJVA 3HG1A 4NKIL 1BGXH 1G1CA 1UEYA 4KGJA 3DWTA 1KENL 3IJYA 3W06A 2H45A 4HQQL 5C3TA 1LGVA 3BSZL 5FYLH 1JIBA 4ENEC 3AZOA 3HLAA 3BKML 2WW8A 4XCYA 5IP4A 1IAIH 1Y18B 3RY6C 3E3AA 3PV7A 1HHIB 3QFDB 1A6PA 1FPTH 4L9LA 2NNAA 5CH8A 2C26A 3BRDA 3C09C 1G9NH 4JDTH 1GPLA 3KPLA 5E99L 3RZCC 1H8OA 1SHMA 5I73B 3GHEH 3VH8A 3WLBA 4B0OA 5CJXA 5TQ0L 2CK0H 3BGMA 3Q48A 3AU1A 3HC3H 1NUDA 3SN6N 5BMFH 1JYWA 5ACZA 4ZUSA 3E6FA 5BOZG 4TSBL 5F96H 5AKGA 2QADC 5C8JB 3C6LC 4LNVA 3BE8A 2WSLA 2VUOA 4JKPL 2JCCE 3N50A 1E4XH 4HKBB 4JM2D 4IDJH 2OQJA 3GSUA 3IRPX 4Y2DA 3VWKB 1BCSA 4O2EA 3O3DA 2WUCH 2IX9A 1MCRA 4IH4A 2YXMA 5KSAC 2YA2A 2AW2A 4JHWL 2DIBA 5I19L 5D1QA 3LH2L 3I6YA 1WT5A 4Z7WB 4KRPC 2DLGA 1FFOB 4NFDA 4WHYG 1YY8B 4LKXB 4TULH 2FHCA 3U46A 5FIEA 3TYFB 1HYSC 3Q1SH 5HHVH 5TFSL 3VFOB 2D0DA 2PKYX 2X4SA 3V4UH 4I2XE 4F7PA 3VXRA 2NXZB 1RFDL 3C5JA 1RULL 4FQHA 4KJPC 3X14B 3ORJA 4YXHH 2XQBL 3ESCA 2BVQA 4BQ8A 2XE4A 5IOPB 2X4QA 2QXUA 3LV3A 4R4ND 3ZDZF 1T21B 3F96A 3ULUH 2OZ4L 4DSZA 1CL7H 2O5XH 2NNAB 4OJFL 1NANI 4GRWE 5MEPA 1HNGA 4M6NH 2OCIA 5I1DB 4NYLB 1B2WH 4KZDH 3X11B 3VXQB 4XMLL 2O61A 1EXWA 3TH2T 5HFNA 15C8H 5CW2A 4QF1A 5HK8A 5E2TL 2ZUSA 1LPSA 1FZMB 1QLFB 4PJ7A 5AD0B 3HE7B 5D7LD 3BI9X 1FYTE 4MA1B 4OD3H 5EPMA 2NY2B 3CZFA 4EI5A 4HPOH 3MRJA 3L1OL 1DTUA 3QIUA 1JJIA 4PR5A 1ZD3A 3VG0H 5LP1A 2JF0A 3KLDA 3VJ6B 3V4PH 4LASL 4K2UH 2VXVH 1U3JA 2VZ1A 2HLFD 3VKFA 2VXUL 1NC4B 3NIDF 4M03A 5I76A 4WFKA 1QSEA 4OSUH 4Y4HB 4QDZA 3BP5B 3L5WB 2EDTA 5F44A 3DUUA 4O58H 5EOCJ 5C0NC 1VA9A 4F9LC 4KJQD 1A4KB 3MLYH 3D69A 4PRHE 4ZS6D 5FOQA 2AQ2A 4JPWH 5AZEL 3F98A 4KRYA 4LPYA 4PJXE 5DEZA 3TVMD 2R8SH 1I1RA 4G1FA 2O5ZH 1VFBA 2V5RA 3ALPA 4LARL 1W0WB 5JO5B 5E4EC 3V4PL 2B20A 1FVCB 1IAOA 3LMJL 4BP9A 2JF1A 4G80A 4ZFZA 3QXDB 3O4JA 3VG0L 2HH0H 3TBVB 3ALWA 5I1DA 5DR5L 4LHJB 1IVYA 3AB0C 1FFDA 1QFUH 1IAII 2NY2C 3MRCA 4UV7H 2QKYA 4NQDB 5DD6B 3MUNA 3TA3A 3GMMB 1WBYA 1YJDH 1VSCA 3QIBD 1NKRA 1S78C 3VRIB 4J0JA 3QUKB 5CZVL 3FRUB 3I84A 1QO9A 3KLSA 1NCBL 3D18B 2F5BL 2IMMA 4QRTB 4TSAH 1MEXH 1FG9C 1QLEH 3C2SA 5JW3L 4PB9L 4LRIC 2PW2A 2ZG2A 4YDJA 4ETQA 4H8WL 2SEBB 3HE6A 5DQ9A 4NM8L 1CDBA 3DL4A 5AKIA 2GCYB 2GY7B 3S5LG 4BZ2H 3CIQA 4DZBA 3V8OA 4C59B 3BGAA 3CU1A 3TNMA 3KXPA 2B2XL 4OD2A 2A0LC 3CH1A 2OSLA 2XN9E 5K9OA 3KR3L 2FR4B 4KKLD 1U92A 5D93B 1CD0A 1T1XA 4KK6D 5CEZL 2Z4QA 1QSEB 1RUAH 1UXWB 4PJ5A 4ZOBA 3E8UL 4LSVH 5HGGS 4OF5A 1MX1A 3HEAA 4HZLB 4IS6B 1K2DA 4PG9A 4HVTA 3L3OA 5FO7B 1F4XH 2WHPB 3VFTB 3VXNA 2OS7A 4X9FA 1UWGH 5DS8B 2Y72A 4UBDD 3MRFB 4XNUL 1ZVHA 3I6MA 3DNKA 2E5EA 4DGYL 3O45A 4MNQA 4K2UL 1YC8A 1N8ZB 3MXWH 3O6FA 4O5LL 1R3LB 5SWQA 3RWDB 2ZCKL 4NZTH 1MHHA 1U8MA 5FDFA 3D1MC 3LIZL 2BNRB 2GY5A 2X89A 2YK1L 2AXFA 4XP1L 1AR1C 5EBMB 5EU3B 1LO0H 3G5YB 5CP3H 5D7LA 5F8RC 3DETC 3WFEH 1EA9C 2YRLA 4GG8B 3WMSA 3D39D 1QBLH 2DQEH 4OLWH 1RUKL 3S97C 3BZFB 4YPVA 4HXAH 1XZDA 4WRLA 4IO0A 5FGCE 3NZHL 1UJ3C 1ZLSH 3VGAC 5KSUB 1W4LA 3QI9A 2JLLA 3V52L 1KIQB 3QPCA 1ZGLM 3Q5YA 4NOBA 4JZNB 1QTRA 2BDNH 2Q86B 1O6FA 1Y0LB 1OAKL 3V4VL 3IDNB 3O11B 3OR6A 5IG7B 4DVBB 5E2VH 4HS9A 4Y2SA 2IALA 1W8NA 3NAAH 1BQLH 1CFVL 1RY7B 3H1AA 2Z93A 4MXVF 4LYEA 5JIHA 3U7WH 1E66A 4QRRB 3CSGA 1ZTXL 5F93C 4NMWA 1RUPL 3BN9C 1DBKL 4KXZI 1MCDA 3QWRA 4FXLA 4L0CA 1WFNA 3P4LA 4LLMA 1XZJA 2MOVA 4YBQD 4WO4A 3DROB 5ADPL 2Y6SD 3PICA 1AXSA 5HDBF 1KEGL 2XQIA 4YBLB 3VXNB 3MYZA 4X5WA 1CIDA 2OMNA 2HKHL 4XXDB 1FDLL 5DHYB 4QRPB 1F3DJ 1IEAA 3GNML 1AKJA 3CUPA 2EDYA 5L8KB 4UINH 1CUAA 1XZLA 3WIIH 3ROLA 2ZOKA 3FQRB 5IVXB 5C0BE 4YDVB 4PV8A 5J9PA 4WDRA 5IKCB 5KWJA 5EZLB 3AMKA 1U0QA 3K4DA 2XQYG 4RDQG 4G6FB 5GRUH 3U7WL 2HYMA 4TOYL 3VXMD 1NL0H 4EY5A 5DMIL 1OAXH 1AGCA 5E2VL 1TIBA 3WSQL 5CFHA 1LZKA 1UK8A 5CSBA 5AI4A 4AZ3A 1NKOA 4HS8H 3RWEA 2C4HA 4MLIA 3HLKA 3IAGC 3QITA 2FATH 1NAMA 3N1GC 4UBKA 1KT2B 3ZKXC 3UO1L 4YZFF 3G7NA 4KK8C 3H18A 1HHHA 2PCPB 2VLKD 3RAJH 4FQLH 3HI5H 3H0TB 1MJ8L 5TE4H 1GOGA 4I2XB 3QXVA 1EGJL 2R0LL 4J23A 4D0DA 4PJFA 3D2AA 4YXKH 4JAMB 5D7SL 3F7YB 3S37H 5TDNB 3L3GB 3T77A 1BFVL 1I1YA 2HLFC 2VIRB 1XRRA 4S1RL 4G6KH 1U58B 2BOCA 1S3KL 3TO4D 1KIRA 5K5EA 1CK0H 1RP1A 2H2PD 2VQ6A 3MR9A 3SQBA 1IEAB 4R7NB 2A6JA 5FUCC 2CBGA 4YHYB 5AM0A 3U82B 2J3QA 5ALLA 1JK8A 2NTFB 2XWBA 1EH5A 1J7VR 3O3DB 2J8OA 3NIGE 1A6VH 2NY1B 5KWIA 3FO0L 2DBJA 5JUEL 2JK5B 1AFVL 4LCCB 3L3JB 4IRSC 1FNFA 3TN0B 2OMBA 2QKIA 2X1XR 3M1BB 1G9MH 2NXZC 4X6EA 3U4BL 3WD5H 4ACPA 2JELL 2D9CA 2Z91A 2B1AH 2DTML 1MQ8A 2UYLB 1EJOL 3QNYB 2CRYA 1ACZA 1FSSA 4I4WA 4UNTA 4IBLT 1D5IH 5JHDE 1DQJB 3OAZH 5IEKA 4GLBA 5EBLB 3FQUA 3AREC 5A2LH 4FTVE 4E41B 3RBSA 5INDB 1WWBX 2EDDA 4X4MA 1JP5A 2W9DL 1XCTA 2RFXA 3HFML 3VA6A 2HJFB 5GRJH 3DCNA 3U4BH 3GIZH 3ZYOA 2BVQB 1PZUB 4FQXD 3CLFH 1JF6A 5DUBB 7FABH 1HEZA 3SJVE 1U8LA 1ZXQA 1ZOIA 3VI3E 3QO1A 3ABZA 3QDMB 4LGPB 3SDXE 4WDIA 3WIHA 2BHUA 5EULV 3U7AA 4OFIA 12E8L 1WICA 4C01A 2NY6D 2ZWLT 5DYWA 1YYLH 1YSCA 1ZLWH 3JWEA 4N8VG 2VZVA 4JO3H 4NJ9L 3RVVC 2OBGA 5AK3A 2ZUXA 5ICXA 1Q9OA 4C4ZA 3NFNB 1KEML 3D0LA 1F4AA 5KOMC 3ZYJA 1NFDF 1OGAB 3W11C 4X4ZA 1JI3A 3OB0H 2VL5B 3B9KC 4TGLA 3PFCA 1NMCC 1IMHC 1HYRC 5KVFH 2CKBL 2EDLA 1TMCB 3O0RH 3U2SA 2YUXA 3MQIA 4WU7B 3ZT6A 35C8L 5F88B 5A2FA 5K9KA 1F2QA 2Z3WA 1WK0A 2DKSA 4L4VD 3LPWA 4D9QE 2VQUA 1A64A 2IC2A 4K7PH 2YWYA 1G9NC 4I0PD 1GIGL 3CFJA 3LKQA 3BO8A 3C8KA 5DQJB 1C5CL 4PRHB 4U33A 1VA5A 4F3FA 3BDYH 1U9KA 3BXNB 4DKFL 3MUGB 1W72L 4APQD 2X5PA 5ALBL 1P1ZA 5EBLA 1MOEA 4BVLA 3HSSA 4QEKA 2AVGA 2ENYA 3HE6D 2PSFA 4P2RA 1EFXB 4TPRL 4MMZC 2B9VA 4JHZA 1CBVH 3BQUC 1ZJ4A 5JD5A 5AM3A 4NWUL 1TKRA 2XFXA 2V9QA 1S7WA 1JI2A 4NKMB 3GMRB 3SGKA 4H8WC 2VH5H 4NNXB 2VDMH 4M8VA 3IUMA 1F0NA 3ELAT 1KB5A 3DARA 5D1ZB 4CMHB 3G9ZA 5DTFA 2HTLC 4HPYH 3TA3B 3MJ8B 4FP8H 3N9GH 5LGHL 4HUNB 5CT8A 1AI1H 4XP4L 3TPUA 2BNQD 3TZVA 1MAHA 4DCQA 5SWZB 4EQ2A 5GRJL 2Y23A 5HHPB 2P5ED 1G7JB 2LFGA 4XCFH 3FQXB 2VL5A 3GUTB 1S9YB 3ZWQA 3CPLA 2BSTB 3OXRB 1T83C 4HUUA 1NGQL 2VDPL 2X9WA 4JH0A 4MCZB 5DMGD 4EI5C 2GCYA 3A0OA 2LVEA 2WU4A 2PSHA 1SM3L 4GBXD 4JVPA 1X5ZA 2R2HB 3WS3B 2R29H 2OYPA 3WZLA 2V5SA 3SDDD 3PWPD 5EIIB 1S7UA 2ZKHH 1U92B 4C56D 5IQ9A 3U7YL 2VZSA 3CC5B 5A1AA 4JM4H 5T3XE 3CFDA 1X5KA 4PRIA 4QHKJ 2X4RB 3EW3B 4PGDA 5F1KC 5KTEL 3FQWB 2XI9A 1EEYB 4WNQB 4XPGL 5F7WC 5H2BB 3K8MA 3FB6B 5CLWA 4QXWA 4YGVA 5T1DH 3BIWA 3MRFA 4V1DD 5DWUH 5A3IC 5F9WB 1ONQA 4KU1A 1RVFL 5JXED 3MRLA 4WI8A 1II4E 2XY1A 3FQTA 4WHDA 1UJTA 2XKNB 1AHWB 1JNJA 1HXYA 1QQDA 4YHYC 1SEQL 3W0WA 5LZ5A 1CLYH 2AXFB 3GO1H 3BW9B 4Y4FA 2QUBA 1OL0A 1ZHBB 3SDXF 4M1GL 3QEQD 4XCEB 5E6ZA 4GLRI 5IIEA 1MRFL 4DFIA 3VI3F 3PWPA 2DL9A 4NZRH 4OM0H 3BIBX 5HZGA 1G6RB 4ZTPL 4H26B 3CSYB 4Y19A 2AJVH 3MBEA 3UC0L 3O3AB 4FFWD 1CUBA 2PO6D 3BKMH 1RIVH 3STVA 2IH3B 1KJ2H 1UWXK 1E5TA 2XUIA 1I3VA 3V6OC 1SC9A 4BZ1L 2RHEA 5A43C 4NT6B 4C89A 2H32H 3FFDA 4D2NA 1HHGA 4K7FA 5ILTH 5CGYC 5F89A 2I9TA 3TO2A 1OGAD 1NFKA 2IPUK 1H23A 3N0TA 5EORH 4LLDA 2LV4A 4ZFGH 5ESAA 3HABA 3STBA 2F9BT 3PL6B 1BQHG 3C60A 1T7ZA 4YFDB 4RWHA 1I8LC 2J8UF 3DX7B 4UFPA 3QCTL 3S8WA 3NIGF 4PRIB 4XBEL 2QUAA 3PXJA 2X1OA 4FMPA 4N1EA 2AJUH 3WL9A 2R0ZL 5CJOL 1IC4L 3I1YA 4X7EC 1MUJB 2W91A 4NOFA 3ARVA 1ZVSA 3UBXG 1VENA 1LDPL 3FN0H 3RZWA 5T3XD 5DMGC 4ZFGL 4RGNE 1JV5B 1IGTA 3EF3A 4KJXA 3BH8A 4F37K 1UZ6F 3PUIA 3MRLB 3EJJX 3QUYD 1AGFA 1R3JA 3OKEB 3W0WB 1JBJA 1WZKA 5DJ5A 2DQFA 1B0GB 5BWCA 4TNWK 3T2NL 1OTSC 4PJEA 2A6DA 1BAFH 3NCMA 3FVRA 4OFYA 1JPTL 4NKQB 1ZA3B 2VO5A 5IW6A 5DMJB 3WFBL 3C5WP 3HRPA 4RQQA 4V2CB 1LO5A 5GIRA 4NWUH 4QRPD 1IC5H 3WS6C 5DYOA 4JQVC 4YHKL 1U3HD 4BVKA 1P4LB 5F9JA 1A7PL 5FUMA 2PUHA 3T1WA 2X7LA 3LQAH 4JGUA 1BBJA 5DNWA 5DRNA 4PV9A 1ES0A 4N0FB 3S8YA 1T1ZB 1GZQA 3LY6A 3Q5OA 4J2XA 2Z8WC 3RDTB 1CGVA 4CU6A 5TPWH 3VH8G 5DLMH 4HG4K 3IUQA 3WFBH 4BQCA 2R9HC 3DPBA 1MNUL 1FN4B 1ZHKB 1F97A 1ZVSB 1UFUA 2EDQA 2VR4A 3GBML 1IQDB 1MI5B 3GJEB 3RWFA 3RIAF 4L8DB 4Z7VE 3REVA 1D5ZA 3WEXB 1R1DA 4ZFOB 3OJVC 4XJVA 3AAZA 4DUXA 2CKBH 1JRHH 2QMQA 2A73A 4MYDA 5IR1B 4YXHL 2ADFH 2ZNXA 2ZZUT 2LU4A 5HYJE 1SYSB 3EUUA 4F8TA 4KK5C 4JQIL 3V4UL 3AY4C 4XNXH 3UPRB 3BN3B 2DIJA 1T4KB 1C4XA 1FFOA 2W22A 3NA4A 3LQZB 1YEDB 4Y8DC 3GMMA 5AAMA 2VXTH 1YEEL 5CJOH 4NQCD 4GKNB 2PSJA 2VLKE 4G9FB 2ZUUA 2UVEA 1ZD4A 4KVCH 1U36A 1QEWA 3RL1A 1OTSD 2BVYA 5BQ7A 4FQHB 5CD3B 4V2BA 3ILQC 1NCBH 2HT4D 4PJBB 5T4HA 2V7NB 4PTUA 1PLGL 3QEHA 5ABDE 1CZ8L 1TENA 1ZLVK 1AXTH 5LZ4A 4N0YH 3WCYA 4FQQB 5JW4R 1TPXC 3BHBA 4IRSA 4XPHL 4WI7A 3T0EA 3VE0A 5KTEH 3S98A 4FQ2H 3G6AA 1NCUA 2R2EB 2WTNA 1DBMH 4XAWL 3C6SA 4Z7VF 4MD4B 4MXWL 3C2AL 2X5XA 4PYHA 4I19A 4P3WA 2O26U 2YEZA 1QFWI 4PG2A 1FFCA 1NUFA 4Z8FL 1FL5B 1T5XA 4O00A 4X8JB 3V4VH 3CDYA 5FYJE 4J6RL 1WZMA 2G5RA 4K94L 3KHOA 5D1ZC 1RU9H 4ZFOA 4PY8I 2DQDH 1T1WB 1PFCA 4R6UA 4FQ2L 4MJ3A 2ATKA 2JB6B 1V8HA 2ITDA 3DX6B 1PY9A 1R3LA 2GYVA 4HXGA 2IPKB 2BSSA 5I76B 1GQSA 3HPJA 4N0YL 4QT5B 3BKCH 5A7FA 1PSKH 5EBMA 4C4XA 2JJTC 3T4AB 5CAYB 4RE6A 3WI7A 5EU6E 5FECB 1BU8A 2F19H 3MROA 4EY4A 4CN6A 1ED3A 2DM7A 4O2FB 2PTUA 3RK4A 1JGVL 1U3ZA 2MPAL 3ULSB 1VXRA 3HS0A 3VFGL 3BUYB 4YHZL 1WWAX 4LMQE 5ANMA 1K6QL 2X9YA 2F53E 3ARGB 1E89A 2Z93B 4S11A 1UZ6E 5D71L 5DJCB 4I0PB 3RX7A 3H7BA 1YNTB 5E4EB 4FFZL 5MERA 3MLWH 3FYUC 2H7YA 5IHZA 3QM1A 4HIXH 3KWJA 1DUZA 2AABH 4MA3B 4WTZA 2FBJL 4JPKL 2I27N 1TJIH 4RISL 3DQZA 5IROA 2SEBA 3HE6B 4XB7A 3UJJH 5D2NE 4Y5VA 1D5MA 3L5XL 1SBSL 3JW8A 4PJXF 4PRNB 1ORSB 2J8UE 4MCZA 5FAAA 5CINH 1VEPA 1ZLVH 3QRFM 2MQCA 3BPOB 1BQHA 1MQKH 4YWGL 3RZCD 1E6JL 4YHNB 1XF5B 1WHTA 5HYSG 4S1RH 3A2LA 1JPSL 1CU4H 4X94A 5AEAA 5BRZE 5T1LD 1I7TA 4PG9B 3OOSA 4JM2B 2DB8A 4PGDB 2HA2A 3FQWA 4HC1H 2R1YA 3INUH 2XZCL 4QRRE 5J3HD 1UJ3A 1EI9A 1CUHA 3P9MA 4G43A 4XNUH 4NQVB 4MJ5B 4K94H 1L4IA 1X5LA 3R40A 3FFCD 1JJUA 2J88H 5JPMA 5CJQH 4IOFD 1A4JB 5DJ2A 4N0UA 2K7QA 1EAJA 4OZFH 2QQNL 3C5ZC 4HUXB 1BM3L 1A3RH 3KDMA 3H0TA 3RFZC 3BW9A 5IHZB 3GMQA 3B83A 2DWDB 2NCMA 3H2WA 2P45B 2JJSC 4PGEB 2Q1EA 1FGNH 5AWNH 3NZ8B 1BPVA 1X5YA 5JD6A 5FA3A 1NFIB 3GFUA 2FIRT 1A9BB 3HNTH 4B6GA 3CZJA 4OB7A 4G42B 1RZKL 1J5OL 3S3JA 3H7LA 2YD9A 3RKDC 5EUKA 1DBAL 2A6JB 3FB8B 4ZPTA 5HPMA 4H7KA 2VABB 2NTFA 4P2CG 1OXMA 1X70A 2EECA 4HAFA 3UEZA 4WWKB 5A16A 3OG6B 1VFMA 1ZS8A 4G8FB 3ZTJG 2X4NA 3CAFA 1CR9L 4UOJA 4ZWNA 1P7QA 5DC9B 3VXUB 1A6WL 4K8RH 5I8KH 4ZDHA 5CCKH 3O9WD 5BRZD 2B1AL 3VGGA 3FQUB 4HUWA 4FTVA 1RIHL 4GO6B 1G9ML 4ZYKA 3RPKA 5FM5O 1MFEL 1A8JH 5AUMA 3TFKC 3V1MA 2MJWA 5D7IA 4R4NC 5CKAA 4WIQA 1JNNH 4JE4B 1N4XH 1KUMA 1EXUA 2HT4C 5BW7A 3NCFB 4WHYH 1CXKA 5ID1A 2YMXH 1P0IA 3ZLUA 1MCBA 4J4PC 5I1IL 4OZ4A 4QTIH 3OZ9L 4IHAA 2JIDA 3NZ8A 4PLJD 3TT1L 2R2BB 5IMKB 3CVHA 4WWKC 3WIBA 3EIFA 3MRNB 3D0LB 5C07B 2ICCA 1MAKA 2OTUA 3DXAB 3BJ91 5EUOA 2YBRA 5I30H 2E3JA 1E28B 3FB7A 3RAJL 1TK3A 3K80A 2OI9B 2NY0C 3SE4C 2XRAL 1P53A 4LK4A 4YDLC 1OGTA 2H9GB 1KB5L 1HIML 5E0QA 3P4OB 3PWVB 4HK0A 2EIZA 5HGBA 4LGSB 2CK0L 3JV6B 3ZLVA 2BNUB 4HV8B 2AK1H 4C4YA 3T2NH 5I1KH 1ZT4A 1S9XB 3V5HA 3BO8B 3VXUA 5C09B 3PF2A 2O93L 2H1IA 1GAFH 2VDPH 1T2QH 1OQOA 4XCCL 1NFDE 4KQ4H 5L2KD 3MLVH 3MUGA 3IDXH 3K4ZA 2E6JA 4XMKH 5GS2H 5I18L 4Y2PA 5DVMA 1DWQA 1MCSA 3QUMA 4KYVA 1FVDB 3L3KA 1CF8H 1OAQH 2Y9RT 5A3ID 4ONFL 4YAQB 2EICA 1KENH 3CDFA 2UZIH 4HJ0D 5CUSL 2IWGA 5E6ID 3KPSE 2QTEA 1CR9H 3UAJC 3LSOA 5FYKL 4X6UA 4NQEB 3UYRL 4DTGH 5E2IA 4RFOL 2OQIA 1JHTB 5SWSA 1NMCB 1IJ9A 4K6KA 2HRPH 3NPZB 2GYUA 4BKLA 4WJ5A 1OTTC 2B8OT 4CU8A 3P9WB 5D1ZA 1KC5L 3HUJF 4J3VA 5FF6A 1XZHA 3WFDH 2Z31D 1LVEA 3PGFL 4RMWA 4G9FA 2IG2H 1VJ5A 1M1SA 4MJ6B 5LVEA 4QF1B 1R3DA 3BPOC 2IQAA 3KPOA 4U6XA 4XMPH 1QTIA 3CN9A 3L5HA 1BEZA 1A0QH 3WKEA 4X7DC 2HJFA 3QEGL 4XNQA 5DK3A 4FQLL 3C6LD 4GUPA 1BFSA 2H3NB 2X1QA 3O4OC 4UHHA 3QIBC 4LCUA 4XCCH 3P4OA 4BUHA 1QYGL 3MODL 2QZPA 1Q1JL 3UP1A 4E14A 2RB8A 2FGWL 3KYOB 5CEYB 3FRPA 5BMFL 1LO3H 1QIKA 5ALUA 3H9HB 3NFPA 4CIBA 5T4BA 4OCMC 3GSNL 4PGJA 3UTQB 1EAPA 4CJ0A 1SY6A 1ZLSL 3NVQA 1HI6A 1P4IL 3CC5A 3C6SB 4WWKD 4O58L 3QIWB 2Q8AL 1FAIL 4UUQA 1D7FA 3IXAB 3M81A 3JV4A 5FOBB 5AYQA 3CXUA 1E8NA 4Q3LA 4U2EA 1EO8L 3DYOA 5INCA 3BMVA 5C0FA 1CE6B 1NCDL 2XUAA 1DTEA 2XZAL 2DHEA 4JN2A 4O51B 3AY4A 2WSKA 2FYYB 3C60D 2I3ZA 1CUYA 5ALKA 1J1XH 4O2EB 4Q3KA 3G0CA 4WU7A 2UWEF 1AD0A 3CFEA 3EHBC 1TQCB 2EC9T 4Y2VA 5DZNA 4YZFE 4M0MA 5MHSE 5HGHB 4UINL 3WFHB 2X44D 3HTLX 5C0CE 3H04A 1RQ5A 1ISPA 4O4YL 2NY7L 4M1DH 5T1KB 4NS4A 4TVPL 4N9GB 4M6ML 5DD6A 4EJ1C 5C0CA 4LKXA 5DC4B 1R3IL 3GJFH 3HJUA 1LNUA 3QG6A 1S7VB 2NXYB 3FLEA 4YDIL 5AM1A 5CS7A 1IEBB 4QOKE 4KY1L 3U9PH 4KROD 4F7TB 3FO2A 5IVZB 4Y1AD 3CSYA 4Y19B 2FEDC 3VW3H 3VXRB 1CTOA 4KQ3H 3ZPXA 5IMMA 3IDJB 4G8IB 1BS9A 2MCPL 1EFXA 4XCFL 2HRRA 5IOPA 5ID0B 1OAQL 1CF8L 1LO2L 5FYLE 4GW1B 2WHRA 2YC1A 5C07D 4HJGB 1F90H 3IXTB 3MV8A 4UB0L 3EO9H 3WJJA 4B80A 3KYOA 4ODSL 1S9VA 3QH3A 1U8KB 4XVJL 2HA0A 4PLNC 32C2B 3SHSA 5AKZA 3Q1SL 1XZFA 4PBVC 4U1KA 3U0WL 2QR5A 3QJHA 3TZVB 2I07A 4DLNA 4UIMB 5HDBE 2BX5A 3DRQB 4ZUVB 4KJPD 3QIBA 1T80A 4LXHA 5IMOA 4F15B 2XRAH 1MCOL 1NCAL 3BP4B 3MRJB 4LASH 1U95A 3C5ZD 3QDGE 3SO5A 3FT4B 5C92A 2XN9D 2DJUA 3M45A 3D25A 3DV6A 4Z7OF 2XMGA 3HAEB 4BFIA 4P93A 1MCIA 3X17A 4OTXL 4MJID 1FZJB 5JADA 1OB1B 1QIHA 2YKLH 4MXVE 4B9AA 2GSIB 2XPGA 4GDMA 4JREB 2W1NA 1I7ZA 1BJ1J 4NNYA 2JGJA 4OCYL 4P2OA 5ALBH 5EU3A 3VXSE 3QWOA 1X9QA 5D6CB 4PF1A 4Q6IA 3TNNB 3HC7A 4WEBH 5DVOA 2HMID 2OI9C 5TDOA 4ZSOA 5SX4I 5J6HA 1MH5B 2PNDA 3GHEL 5ECJE 3SKNB 4BFEA 1QNZH 4X92A 3PIQA 2AEPH 2G5BB 1D9KB 1CUJA 4JY6B 3FO1B 4JZJC 1LE9A 3C60C 5CZXC 3SDAC 4POZC 3T8XA 1DL7H 1YEFL 5IFAL 3O4GA 1FVEB 2Z8RA 4HK3N 4KJYB 4OLUL 3EO0B 2MSPA 3RZCB 1HH6A 5T3ZH 5BZDA 1H3PL 4U05A 5E9DB 5A6VA 3AB0B 3MCG1 2WIDA 3KPRA 5EZIL 3LD8C 4LBEB 4LCWD 3RTQC 3X12A 3C6LB 4EDWH 5E8PA 1BF8A 4NM8H 4JFOB 4P2RD 1GZQB 2DWDA