3C8HA

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-serine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
392
structure length
383
Chain Sequence
VGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
molecule keywords Enterochelin esterase
total genus 106
structure length 383
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c8hA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c8hA02
1CDYA 4X80H 5FFLA 4KXZH 1AO7D 3PV6A 4UHEA 4UOW1 5FUOH 4FMFA 3QQNA 1GJIA 2X4OB 1RVFL 4GXVL 1XR8A 2IAMC 4K9EH 1B6GA 5D6DC 4Z7VE 4OAWA 5HYSG 4YDLB 4HIIB 1JE6A 1G7LA 2C5GA 5LJYH 4RFOL 3GFFA 4M0MA 4NZZA 1A64A 5IMLA 1HDMB 2CIKB 4QXUH 4GT7A 4YR6B 4PJ9A 5HI3D 5AKZA 3QPXL 5I2IB 5DURB 4OV5A 3FWHA 3MRDB 1RZKL 3SCMB 4NZUL 3FLAA 1AGCA 2AK4E 2AJZB 2FJFA 3RVVD 3G02A 4Q9BA 4R3SB 1UWCA 1I9IH 2QBWA 2F5BL 1T66D 4L4VA 5CCKH 5GZOC 4QOKD 3NOIA 3CFJB 1I8MB 3OZ9L 4I0PC 3GMLB 5AH0A 1T1ZA 5F1IA 4KKCD 3QFDA 5DK0B 3MQIA 5J6GB 1A6UL 3IETB 3HA0A 3O4LE 1XF2B 1S9YA 2DQZA 5C0AB 1Z9LA 4CCYA 5AYUL 1IAIH 3PHOA 3LKRA 3MBEB 4INZA 5EIEA 1G5FA 3ZWQA 4PV9B 5IBUB 1N5YH 2B1HH 1JCKA 5CAYB 4N8DA 5JW3H 1XGRA 4K94C 2VLKB 4M3KB 5D72H 5A16A 1NC4A 3EO1B 3T0ED 4DMKA 3CC5A 3W9DA 2BNUA 1OPGL 1MRFL 1AUOA 4P46A 1CFSA 1Q72H 1CUBA 3FT2A 5L2KB 3RY6A 4L8SC 4L9AA 1ZK9A 5EB9A 1R0AL 4UHCA 4JJ5A 5HHMB 4EN3B 2WZPD 1BZ7A 2Q3ZA 4X6DA 1AR2A 2Q86B 5AZEH 1JYXA 4HWBL 3RWGB 4QHMA 4JFFD 4NHCL 4E11A 3U0PB 1UOOA 2WG2A 3FRPA 2AVGA 3QDMB 4MDIB 5L6YL 3BP5A 3OKOA 4PJDB 4PR5B 4D9LH 5JHLL 1QO7A 5K9OA 3VFMB 5IT2H 3O8XD 5C07E 5JXEC 2XICA 1CV2A 3I3BA 3LS4L 2AV1A 5IQ9B 3MRHA 4QE3A 2XFXB 2YD9A 1KB5L 2A9NL 3H9HA 4X6CB 5C2BH 2VAVA 2CXGA 5LZ8A 3TT3H 5KSAB 5D7IB 4OZ4A 5KSBB 1SM3H 2BFNA 3D87B 3STUA 5HCUA 4MQXD 2YD3A 1EAPB 3ARYA 5ITBH 2NY3D 5ICZA 4J2XA 4OKVB 3LQZA 2ES4A 2ICWA 4TPKA 1CFNB 1C8PA 1YPZE 4KDTA 5B8CC 3QIWC 5GRXG 5T3XL 5C0RL 1U41A 1MX9A 3QH3B 3K1KC 4G3YL 4D0CA 1ZIYA 3VFUA 1CFTB 1JMYA 1F5WA 3LPFA 4JREC 4J3WA 1NGPL 4LOUC 4P2OD 5JXAL 4R4FH 2R2HB 4R7DA 2HLAB 3GZJA 3Q6FA 4BAZA 3T0DA 1IFHL 4H77A 4TYUA 3ULUD 5JLZB 4ZAKD 1AD9B 2F53B 4QA9A 2XXCB 3PWPB 1ZHLA 5D6CA 3MRPB 1TMCB 2GYSA 2UYLA 32C2B 3G5YA 4HXBL 4G8BA 4JUIA 1NC2B 1K9TA 1M05A 3NMEA 2BVUA 3UYRH 5HHVH 5KREA 4POUB 3GGWA 3MFGB 2AJYH 3KPQA 1X4XA 4MCZA 3LPGA 4DTCA 2XZQH 4CBPA 3NWOA 5BOZG 4Z18A 1QSEE 4MD0A 3QXVA 3D2AA 6FABL 1JNNH 5EUOE 4DMCA 2BFVL 3HC4L 1ZT1B 4V1DA 4M5ZL 2XA8L 1YB6A 1UM6L 4N9GB 4U2CA 4PF1A 2HRPH 3B3QA 2DIAA 4MJIE 3MJ9H 4WDIA 4WJ5B 3TN0B 4D3CH 5M95B 1GQSA 1USWA 1F4HA 3O41A 5JA8B 3STXA 4PTTB 4GQ9H 3S5LG 1P0PA 2E7CA 5C7XH 1UWEH 1ZHKB 3CSYB 2ZCLH 1UCBH 2E9BA 3F8SA 3TJEH 4XZUB 2F5AH 2RR3A 1O7VA 3BX7C 3LKSB 1K4CA 4XCFL 3WDIA 3B9KC 4FQLH 3GI9L 1I8KA 4UQ2B 3H04A 4FZ8H 1U93A 4OQTA 4U33A 1UCTA 4PJ8A 2V2XA 3QIWB 1RJYA 4JPKH 1G9NL 4Y4FA 4MD4B 5DD3L 1L0QA 3TFKD 1OCEA 1QFWL 1T83A 3BZFB 3GMMA 9CGTA 4GAGH 2VISA 4HPOH 1S5IL 2XKUA 4QRRD 3IFLH 1CR6A 2RGUA 3WLBA 5LQBH 5IM7A 1UWGL 1I1AB 1PD6A 2C4FU 1MEXH 5DUPL 5KS9F 5GS1B 3SKNA 1ZHNA 5T1MB 5YASA 3IFNL 3ZL4H 3BH8A 3TBWA 4LAQL 3SGJC 1N26A 4W68A 3CFBB 3HNTH 2VYRE 5IVKA 3WL6A 4Q6IB 2XQFA 2DLFL 1UM5L 4I4WA 1YEHH 4HD9A 2X70A 3KHQA 3WHE0 5E5MB 3U0TB 5FOBB 3FMGL 3WKNA 4X4ME 3H7BA 4UTBL 3P4OB 5BV7C 3VDAA 1NBZA 3GMQB 4UT6H 2HJFA 4X7TA 4GAYB 5T3ZE 2V9TA 3C60B 3TIDB 3QUMA 3ZYZA 1YPZA 2BVOB 3EJJX 1VPOL 1VFBA 5DEGA 3K3QA 3BP6A 3TBWB 3WA6A 4BDTA 5E08H 4KFZC 5FA3B 2JCCB 4Z0BL 4YIQA 3L9RB 5FKPA 4L8BA 4MX7A 2D9CA 2VB5A 3A67H 3B5EA 1G84A 4H5SA 4XWOD 3VRIA 5D2NE 4YQXH 1P2CB 1A3RL 1U8PA 4K3GA 5GPRA 2R23A 3BH9B 4TUKH 3SGEH 12E8L 4L3CB 4X6DF 4XNYH 3P4LA 4GW5A 1TJGL 3PGCA 5L2JA 2QXTA 4JM2D 1S7WB 5CZVH 4BH7B 5C9KA 3O9WC 1MCOH 4L4TD 1PJAA 3PABB 4JM4L 3EYSL 3VXNA 3ZTJH 4CJ1A 5DQDH 2P49B 1P6AB 3CSYA 1OT2A 1UM4H 3NZHL 3QG6A 4XRCB 2NCMA 4PJHE 3FAKA 5JPMA 3C2SA 4U6XA 2DHEA 1ITCA 3K4ZA 2BGRA 3BZ4B 3QEQE 4JHZA 2IPUG 1U8EA 3AAZB 2YOCA 1C7TA 1XF3A 4FXKB 4RIRA 4Z49A 3PWJA 4PJ5A 3BIAX 2W0LA 3S96B 5FHAL 5CP7B 3BPNC 3H3KA 4HF5H 8CGTA 3H7LA 2FEDD 3D9AH 5DEZA 3VD5A 2EH8L 5AD0B 4KK6C 4OF3A 5IMOB 4OZIB 1MSPA 3INUL 5ISMA 3W11C 3AUVA 3TN0C 4G9FA 3EDJA 4J23A 4PRIB 5IIEB 4NBYB 4ZPVB 1LEGA 3VJMA 1FPTL 3RNKB 4K5QA 4DTGL 5F88B 2F54A 2XRAL 3BD5A 1A6AA 3NIFE 1A6AB 4U49A 5TDPB 3T4AB 3T4AA 4I0PA 3AU1A 1UXSA 3MA9L 2R1XA 1NAKH 2XN9B 4ODHL 2NQCA 3G6AA 4ZPVA 1C1EH 1N6QL 2YD1A 1AURA 4ZNEE 1KLUA 5FYKE 1J1OH 4ZPTA 3SC2A 5DMJB 2V2TB 1X5FA 1FL3A 4LLAA 2FDBP 3X3FL 2Z5GA 5AI0A 1X5JA 5EU5B 4XTRD 3FLEA 1QZ1A 4L4TA 5ICYB 5C3LD 4BVLA 4QRRE 2I26N 1VFOA 1U9KA 2VXQL 4PRHB 4U1IB 4KACA 3MUGA 1AJ7L 3ULSA 4BP9A 3L3JA 2XQYK 5HGDB 1KCLA 2PW1A 4Z7UB 3WSQL 4CN1A 4M8QA 4U1LA 1AGDB 2CJUH 1YEJH 1A7QL 4BFIA 3KDAA 25C8H 5A2GA 1VXRA 5BWBA 4Q9QL 1MQKL 4N90E 3TEUA 1U8LA 4CW1A 2CK0H 2FLBT 1HILB 5JW5A 5HVGB 2J6EA 5F9OL 5ISZD 3WKML 4GW5B 5MENB 3ZKQD 3VFGL 2DB8A 3TV3L 3ZDYE 3GMNB 3NA9H 2XKNB 2Z4QB 2V9QA 5CKAA 5GSRB 1ULVA 3N0TA 3FCTA 3LQMA 5ACZB 1LLFA 2Z91B 5F3BA 1ZVSB 4BRZA 3F62A 4KK8D 2F9BT 4YBHA 3KWWB 4PJ7A 3C09B 2R4SL 3GSVA 3MVEA 2C3GA 3OC0A 1CG9A 2DQJH 3QULB 1CFQA 3IDYC 4Y2DD 1JGLH 5FYJL 1QBMH 1NCWH 3GRWL 4XP9L 5ESQA 3BXPA 2L7JA 5A1AA 1JZ8A 2ORYA 3ARBC 2BDNH 2ADIB 2P4AB 4KAAA 3KXFD 4OJFH 4LEXH 1XQXA 4OZGE 3GK8L 3W9DB 1U2EA 2X70B 1FRGH 1YC8A 2EIDA 1E4KC 3GI8H 4ZQKA 1Z0NA 1MJUH 1LEGB 1F3RB 1T7WA 4MCYA 4TTDC 4XHQA 5AAWA 2C1OA 4WFJA 2EXYD 5C0JB 3IRPX 1DVFB 1S7SB 3MNZA 4YZFE 3ARBA 1DANT 2CK2A 1BECA 1MFBL 3MO1A 3LIZL 5HQ3A 1AR1D 4FTVD 3MODH 4PJXE 1M7XA 4TUOB 2GZRA 1RIVL 2Q0XA 5HGAA 3GBNL 4G1FA 5C09E 2AXGB 1RZGA 2N7AA 1IGTA 4PJHF 2DL2A 1XF4B 3C60C 4J0JA 1DFBL 4PJ9D 1VE6A 3OHXB 4P2OC 1MNQA 4JAMA 2Z8WC 1U65A 3P4MB 1OF2A 4LLUB 1MVUA 3RNQA 4U0QB 2LU3A 4OM1L 1ZOIA 2B7DT 5M94B 2Y07L 2WUEA 1KEMH 1IM9A 4TGLA 3RARA 4YNYA 2HJLB 2CUTA 3C08L 4YK7A 2Y7QA 1MFAH 3KXFA 4UT7H 1XIWA 1DQJB 5CHNA 4CMMA 1D5ZB 1YY8B 2BZDA 1SEBA 1DBBH 2QQLH 4YHIB 1VFUA 1XGYH 4QRPE 5FA3A 3R1GH 2ZKHH 1GPOL 4UINL 2BY0A 3VMPA 4LCWD 1FORL 1MLCB 3B9KD 3F8UB 2HTLD 2WFLB 4S0TD 3V8CA 5IFAH 1Q84A 4J7AA 1NFDA 3W0WE 5TE6H 1WBXB 3NPSC 3OX8B 1ZLUH 1LO3H 3LEVL 1LE9B 2XZAL 3UZVB 2HJFB 4PJBE 1MCKA 5HF5A 4C56B 1TNMA 2GAZA 4FTVA 1ORQA 3HB3C 3ZLUA 4NWTL 5FB8A 5E5MA 4MNQE 3Q5YA 3SE8H 1N59B 1KPRA 1JP5A 4LPVA 3MOAL 1E3QA 3QHTC 2OGTA 2P24A 4DUWA 4R96B 3SN6N 2QR0B 2VQ1B 1T22B 5H94A 1R3JA 2I78A 1AFVL 2FZ3B 3QI9C 2HFEA 4DZ8B 3WIIH 4OTXL 4OF7A 2EDBA 1BRTA 1M7DB 3Q8WA 1M71B 5BQ7A 5I73C 1MPAL 4ARAA 1O5DT 1F4YL 4E42A 1ZGLM 4BCCA 1U3HD 3QHZH 4OM0H 3G0CA 3CJJA 1UG9A 5GGSY 4MXVE 4LPYA 1I9JH 1F02I 2XWTB 4HWNA 3S4SG 5FV4A 5KSAA 1PY9A 3VRLF 1VGKA 3QCTL 2DLGA 5FKJA 1DBML 4XI5D 1Y7IA 2AGJH 3HI1B 3CFCH 2ZP0T 4KTDL 3GSNL 1WIPA 1CICD 1MIEH 3VI4F 5EHQA 4NDMB 4AMZA 4TSCL 3AVEA 4ISVA 4D94A 5LXGL 3PDOB 3WFBL 3QEQA 4LCYB 3AB0B 4V1DE 2EDEA 3ARTA 5DMYA 5J13B 5EHZA 3KPRB 1DQML 2H2SD 4KJPC 4LSRH 2VTFA 1MJ5A 4OGAC 1OM3L 3OR7B 1ZGBA 2ACEA 5T5FL 1LGYA 4HK0A 4GBGA 3Q1SL 3BIKB 5ENWB 1FZOB 1H2ZA 2HVJB 5J1SC 4XP4H 4EQ3A 4ZFGH 1I8IB 2DJUA 4PJ8C 1JRHL 3MJ6A 2WQZA 1URLA 5E6IB 5LZ4A 2JIXA 4NYLB 1TITA 5ITFB 2OCKA 2NY5C 3HC3L 5D6CB 4P2OB 3O4LB 1T2QL 3P73B 4GOSA 1G7HA 4BB0A 1ZEAH 4WWKC 3I2IA 3R3UA 1OSPL 1FAIH 3S88H 1WSST 5HKBA 1ZI9A 1X2EA 2A6JB 4IRSB 3DD5A 3WIFB 2K9UA 1JMKC 1HK6A 4P2QB 1T1XB 2VN7A 3MLSH 4WUUA 4R8WH 1L7IL 1EBAA 2QL1A 1KPUB 4CDGC 2FNBA 4F7EB 1BOYA 2EIBA 3JSSA 3OKKA 5D1XC 2D9QB 5B8CA 4QHNB 3IJYA 1Y7HA 3U36B 2YPKA 5EOQL 1EAPA 4PREA 5T1KB 1JUFA 4NO2A 4OGYL 3V5HA 4C4KO 5MENA 1IRAY 3C70A 1YR2A 3OKEA 4KJYB 1JF5A 5I17B 4FXGA 2JF0A 4G8GA 2G2RB 3MJ7A 5I0ZA 4PGEB 1GOGA 3ZE0F 5FCUL 4H8WC 4Y19D 5CHNB 1UC6A 5KVGH 3RVTD 4E41A 2EXWC 1ZD5A 2QQNL 2I9TA 4Z9KB 1UXWA 2ARJB 1KNOB 3OOSA 2FR4A 2OM5A 5HGDA 1R5IB 4EIZC 1Y6MR 1DN0B 5C09D 1VGEL 5K9QI 1MVUB 2MQ0A 4E41D 1R3HA 1NJ9A 2NY6B 4HK3J 5KJRH 4F9PA 4B81A 5CWSB 1MCNA 3HI6L 4ODVH 1IARB 1XZ0A 2OXGA 1EEZA 3T0XA 4QDZA 1CFSB 1Q0XH 1RZKC 2IFGA 1BX2B 4I5BB 1FAKT 2ATPB 3BDYH 2HWZH 2BKLA 2IAMB 4XAWL 3C6YA 3QDMD 1LPAB 2ERJC 5DO2C 1U8QB 4DKEH 4IDLA 5GS2H 1I85C 1Y0LA 1ZI8A 5F44A 5I1HH 1MF2L 5CT9A 3V6BR 1S78D 4JDZA 2UVFA 1NUNB 1FLRH 4Y2SA 3EYUH 1C5DA 4ONFH 4OD3L 4A5SA 5JUEH 5FYKD 5L2KD 4I3RL 4HUWB 1AKJD 4K9EL 1MCWM 4ELME 2WBJD 1S3KH 1V7NL 3WXWL 1XH3A 4NPYB 4FQ2H 4RFOH 4MXDA 2A74B 3O4OC 5D7LD 4PLNC 1IAOA 1QSEB 3WI7A 3NFPA 3DMMA 4HUUB 4P2CG 1VKXA 3W9UA 4P9HL 1PV1A 2LQRA 3GZKA 3V7AE 3QULA 1RZIA 1AX9A 2XUQA 4NRXA 4ZDHB 3IAQA 2EDTA 3CMOL 4B83A 4GG6E 1OGAD 5I8KL 1A6PA 4BE4A 4OGXH 1S7WA 1Q9KB 1FO0H 2P5EE 4FP8L 5KZCD 5C0BE 3RA7L 2DBLL 2YXMA 5D9SB 5BVJA 4X93A 3PGCB 4QNNA 1P7KA 1XZDA 3WUWB 4UQ3A 1NDMA 4FFZH 1MO2A 3QQ4A 3PNWA 1TVBB 1F8TL 1QFWM 1N8ZB 5F7FA 4QCIB 5EA0L 2IPKB 3VI3E 3VA2C 1CUSA 2WNGA 4YDLC 2BNRE 1L0XA 4LF3A 3HMXH 4DAGL 3WXVL 4P5MB 2X4NA 1ND0B 3U4AA 3TNMB 5JW3L 1AXTL 5EH1A 1RULH 1J9CT 3SJVA 1J0JA 1QQDA 1OPGH 2ZWLT 4TVSa 4X3CA 1AH1A 4WCYH 5IB5B 3QNYB 2XUOA 3F7RA 4APQB 4Z76B 2Y6VA 5HF9A 4UV4H 3IDXL 4WIQA 4DGIH 5BOVA 1YNKH 4RAUA 4W1RA 4NPYA 2VWEC 5ALNA 5D96B 1LBTA 3SDAB 3L1JA 1DINA 3B43A 4RNCA 2UVEA 1JPGB 3IDAA 4HJ0C 5AZEL 1JMZA 4IRSA 5D5MB 3QI9A 1BZQK 3ZYIA 3GSRB 5CD3A 1QSFA 3SDXE 1JHTB 5FYKL 5FRDA 2VZSA 5FKAB 5EIVA 3R3VA 1M7IB 2UWEF 1ZS8B 4P5KA 4KROB 3DI2B 3LOWA 1WIOA 1MHPH 5D1ZC 1A1MA 5IGXL 1DQLH 1ZANL 2NW2B 3BKCL 3VKFA 4TVPD 2ED8A 1HHHB 2MQCA 4RISH 1F58L 3FB7B 4HK0B 4X6EB 5ALUA 3AIMA 4NWUL 4J8RB 2WQRA 4QRSA 4WV1B 4YDIL 4I1NB 1KJVB 2O5XL 5EO1A 3ZTNL 1R9NA 1TENA 1A14H 5IJKC 2CLZB 3W81A 1DVFC 2A0LC 2EYSA 4JO3L 4FXKA 1XF3B 2FX7L 3BSZL 5FM8A 2BNRD 3UP1A 3H2GA 1UZAA 3NGBB 1KT2A 5B3NA 4UU9A 4ZD3H 1KGCD 2DYPB 3QG6B 4XRCA 5E00A 5SWSD 1UXWB 3SDXB 3ZKXB 4JY4A 4DGVH 1XROA 2W9EL 3D0KA 2CLZA 5MP6H 3T4YB 1MNUH 1IC1A 2CKBA 3S2ZA 2JIDA 3KNBB 1F42A 4GXNA 3O2VH 1E4WL 3MOBL 2IALA 1YC7A 1R88A 2WILA 1NGWB 2RIKA 4IRJB 1ZE3C 2DKUA 2NY4C 3RKDC 4WEMB 1UK8A 3RZCA 4OF6A 5HDBF 5B3JE 3V79C 4WY7H 4C6HA 3WS3A 1YS1X 2R0KL 3VVLA 4V2CB 2D7TL 3V52H 3CMGA 5B8CB 4HIEB 3MRPA 2VXSH 1OVZA 4ODTH 1CT8B 3FHQA 4XPTL 3WNPA 3QJHB 1W0WA 4PJ7E 4OGAD 2FH8A 2J8OA 4H1LA 4B0MM 1UM6H 2I07B 3PF8A 1JPGA 2XMRA 3QUMB 2CB9A 1BVKB 1A7PH 2HFGL 2QR0A 4Y4HB 1LPSA 3MJ9L 1IGYB 1QKZL 1IGFH 2VH5H 3ULUF 5ALCH 2E3JA 4U4BA 3ZO0A 4DMHA 1FZKB 1OTTD 1MHCA 2EKSB 1UWEL 3TA3A 1FNGB 1CL7H 2BNRA 4LNRB 3E8UH 4P59H 4XNMB 5HDBE 3GSUA 2H7CA 3PG2A 5BZDB 5TDNB 5KW9H 3NFNB 1NFDE 5F96H 3W0WA 1RMFL 3VFVB 4Y4FC 5IB3A 3HG1E 3CLEL 3MLYL 1FNSH 4WHYH 3S3PA 1WVZA 2LVCA 3V1LA 1QFWH 2JTDA 5J6HA 3S8WA 3IRZA 4M93C 4GAGL 2XQYG 2AV1B 5IQ9A 3P4NB 3EJZC 3IFLL 3RBGA 5D1XA 2EEBA 2ENSA 2WU4A 2NY7L 3QT2A 1MEXL 4HGWA 3QIWA 4D2NA 1ZT7B 5CEXB 3IF1A 4R4ND 3ILPA 5IHUL 5EC1B 1UJ3C 2Q86A 2FX9H 2YK1L 4JE4B 1H3PH 2YRPA 5FUOL 4J3SA 3T04D 5EN2A 3L3OA 3FMGH 3JWNC 1MFCH 2VKXA 4NN5C 4MQMA 1L7QA 2A74A 2UZXB 4PB0L 1JI3A 1XKLA 3ANSA 4HZGA 4LSSH 3QYJA 4Y7DA 3EO1A 2VDRL 4HH9B 4PGZA 1YYLL 2ESVE 1R3KA 2YYSA 4EZIA 1CWVA 1FNHA 5FDFA 4HUWA 4UB0H 2GI7A 3MGOB 3C45A 3VWKC 3MO1B 3L5XL 4HS3B 4JO2H 1DR9A 4LSDA 3G5ZB 4YHKL 5FV1L 3L5WB 4PJCB 4QHUB 4LDEB 4N0FB 2VQ1A 3EGSB 1IC7H 4KAJA 3GGWB 1WK0A 1A4JB 5C0JA 4XPHH 4TUKL 4K2AA 1DSFH 4LL9A 5DNVA 5C08E 2E6PA 1KIQA 3MBED 3QFDB 5LIPA 4XNYL 1ZAGA 2OI9B 4PPTA 5CSZB 4ZQKB 4J0KA 3UEZA 1NFDF 1MH5A 3NIFF 3BIBX 3CDGA 2HLFC 3PL6C 4JFOB 1HHJB 1A6UH 4NZJA 1BIIB 2H1PH 1XGPA 3C6LD 3EYSH 4EUPG 5AHXA 5KN5B 1PZUB 4EI5B 3CH1A 3VXQB 4HUNB 2EDLA 1CFQB 1OAQL 2YXFA 5CLWA 4PLJD 5C0CE 4YR6A 5ADOH 3MRLA 4WI2A 1N4XH 3LH2L 4B50A 3EDDA 5TE4L 2R29H 4MMZC 3TVMD 4XVTL 1BHGA 5IFHH 3T09A 2WIDA 4BUGA 3FCXA 4HF5L 3DGCR 4ALAL 1DQQA 4U1HA 4CG2A 2EH8H 3VFRA 4BE9A 1Q72L 2CMRH 2W60B 4QRPB 1ZLVH 1CQYA 1GGTA 4YJZL 3TZVA 4TNWF 1OILA 3EO9H 5L8LB 3TYGH 3CU1A 4KJQD 5ALZA 5E24E 1CLOH 1FPTH 1FO0B 3G5VB 3Q3GB 2IX9A 3R3XA 4PJHA 5BS0A 5AICA 2J6EL 2PTTA 1MI5B 1YPZF 1TTUA 2CO7B 3FT3A 4MXQD 2EDKA 3ANTA 3FOMB 4ODHH 5FYKU 4E14A 4D9LL 5JHLH 1MUJA 5LZ5A 1FYTB 1XEDA 1E4XI 1M6OB 4Q74A 4XX1G 1GRWA 4KK6D 5DJ6A 1L6ZA 4JB9L 4U1IA 2OTUA 2VXTH 3QFJA 1FNAA 4MNHB 4P2QA 4PJEB 4WUUB 5FGCE 4M0FA 1NC4D 2Y6SC 4U3CA 1JNLH 1ZSDB 1DBJH 3BJMA 2C1PB 1AJ7H 4BTLA 5ITBL 2V2TA 2QLVB 4HK3N 4MNQB 1IKFL 2R0LL 3LKNA 2CKNA 4AT6B 1WWWX 4QTHA 1I3RB 1TJHL 1NMCC 3P11H 3BGAA 4ZOAA 5B39B 5T3XH 5C0RH 2L0DA 2BCEA 3LAFA 4BH8A 3NCJL 3CVHA 4XGZB 1WB4A 1C16B 2GSGB 3UC0H 2NX5B 4K3JL 1JHTA 2AK4D 3BW9A 3WKMH 3CZFB 1SYVB 3CDFA 1XF2A 1FFRA 3SHSA 1W75A 4OZIA 2BSED 3IKCA 3DUUA 3MLVL 2ED7A 3WZMA 1JPSL 1T1ZB 1MFDH 3Q0HA 3BHBB 3HE6D 3QWOB 4M0EA 4JPVH 5GGRB 5I66B 4DEPC 1DJSA 4G43A 3EHBC 4R3SA 4U6VL 4Q82A 3LZFL 3E4DA 1KENH 4RRPG 4UUQA 3RPIA 5I1IH 3GEWB 43CAB 1JPST 4Z5RA 3V6FA 4P4KB 5F93C 5JALA 4JFXB 1I9EA 1UWXH 4NIKB 1UJ3A 3WIHH 2R8SH 1O6FA 3EYOB 3MRRA 4X71A 1ZA3B 5T33H 5AEAA 1IAIM 3QUYC 2DI7A 4IRJD 1BQHB 5I9IA 4FS0A 3S3JA 3BWAA 4F5ZA 3KLAB 1GIGH 3BQUB 3VMNA 1VKHA 5A2JH 5C7XL 2PW1B 4OB5L 4QHKJ 4XNQA 1UCBL 2F5AL 2XT1B 2WUCL 4HZAA 4R2GC 4P93A 1GL4B 3DWTA 3BOVA 5E2TL 2OCGA 4OCMC 5JARA 3VFOB 2LU4A 5CP3A 1RIVH 2ZUUA 4EI5A 1J0IA 5J12C 3LY6A 4MLIA 1AXSB 1JJFA 3HG1D 3QG7H 1L7AA 4YX2L 5EORH 1FG9C 3QZWG 3BESR 3I6LD 5FUZH 4EDWL 3BWXA 1MOEA 1A02N 2WLZA 3WJ2A 4LARL 4LSPL 4JN2A 4CADB 2CZQA 1BU8A 4P9ML 3S37X 4S2SB 1J1XH 4OSUH 2KZ1B 3VFPB 2WM0A 5J8OA 1A4JA 4WHTA 3BZDA 2IAMD 4M6AA 2BHZA 4I3GA 2WFLA 3C5ZC 3QDJE 4K7PH 3QISA 2ICEA 3OR6A 3MV8D 2HA3A 1DBKL 3BRGC 2X05A 2ZJSH 3W5MA 4N9OB 3IUJA 4N5IX 1I1AD 5HZGA 3KXFB 3S3SA 1YECH 1KACB 4KZEL 2JLLA 2ZKHL 2HA4A 1CTOA 2H32A 3DARA 4Q7DA 3EFDL 2MCPH 4N0CD 1HPLA 1QIGA 3SO3B 2H8PA 4YWGH 5I1DA 3LN5A 3KPOA 3DLTA 5JORB 1DLFL 1DQTA 4P5TC 1LO3L 4Z0BH 5DC4B 5IB4A 3CH8A 3X14A 5C8XA 1SC9A 1RK0B 2NZ9D 3ARPA 1GZPB 2H7YA 5CEYA 1EO5A 4NWTH 3TPUB 4D0BB 2NY1D 3K4DA 4S1DD 4QO1A 1SHMA 1BWWA 4WUKH 4Q58C 1G7JA 5F1NB 4WGVB 4OUUA 4ZFFA 4IH9A 3JV4A 2Q76A 4Y16D 1L7TL 3TN0A 3CU7A 5C92A 4U1MB 2QSVA 1AFVH 5LZ7A 5CZVL 4AN1A 3DX8A 1CZ8L 3ZYJA 3QPQD 4HZLA 1ZT1A 3TH3T 3WWEA 5EZLA 1PLGH 5T1LB 3WQHA 4JREB 7CGTA 5T3ZL 1J5OH 5J3HC 3KPRE 5ALJA 3UUEA 5IKCA 3U7WH 1NCNA 5E6YA 5C0EA 1HE7A 4QXTB 1NGZA 4WHTB 3G5XA 1Q8MA 4X4XA 1HSBA 3A6BH 1JYVA 2YPKB 4Y89A 4NQDD 4G6FD 2D03H 1AY1L 2EKSA 1ZVYA 4PRIE 4G7YH 5HHOD 2FIKB 1E4XL 5C8ZA 4F7EA 5I30L 2CJPA 5C0AD 5JLZA 1YNLL 3WLWD 1RUML 2V5YA 3QJHA 2D7OA 5HD8D 2WWKO 4QYOB 1CXFA 1EXWA 3V5KB 4FFWD 4ZODA 5E7FA 5IVZB 3ZKND 1I1YA 5ESVA 4NO3B 5JOEA 1MLBB 1I1AA 2Q1EA 3OM8A 1NAKL 3O4LA 3P73A 5L88H 4Y2UA 1BQHG 3U7YL 5DJCA 4PRID 4WEBH 4B7IA 4Z95H 4XI5C 1DQMH 5I8OL 2AEQL 4MQXC 5CMLA 1ZLUK 4ZV7A 4QTIL 1FL6A 1GZ7A 3S6CA 3IUMA 5IVNA 4TVPH 2VR9A 5T4FA 4J6RH 3TCXA 3FBWA 1LK2A 3SX4A 3OPMA 4MMXC 5ISZA 4BSWA 3H18A 3U1TA 1ZA3A 1ONQB 2CKBB 4L4TE 3QDJA 3HC3H 3RVUD 1EA5A 1EO8L 4LMQE 2HA1A 3MRIB 3PQYE 4ZTOL 3FZUC 3O8XB 4N0CC 4X98B 2RGSA 3TBYB 1FAIL 4OD0A 4J4PA 3S88L 1YEJL 4PNZA 1B4RA 4OZHA 2YR3A 3KJ6L 4Y2OA 1A2YB 1LEKB 1CN4A 1FGVL 4IMKC 4XP6H 5DJAA 2VUYA 3R41A 4BAUA 2KDGA 1L7IH 4ENED 4JH0A 2WKWA 4N8CL 3K46A 2QADB 2XA3A 4UBIA 3JTTA 1MY5A 4GKSA 4Z7QE 5T1LA 3VFTA 2JB6B 4FFVD 3VFWA 3NA9L 3R0NA 1SYVA 4I3SH 1OL0A 2GJ6E 4EY4A 3ARZA 3HEAA 2WU3A 4TN9A 5KTEH 1A1MB 2VR5A 4PJXA 4CNIA 1H3GA 4XPFH 3U82B 2GUOB 2VUOA 2OAGA 1AGFA 3O6KL 1UWXK 1GGCL 3QIBA 4NNXA 3RU8L 4NN5B 1DUYB 1RIUH 4JGMA 4ONGH 1LWRA 5DMGD 1MCSA 2APWA 2R4SH 2HFFB 3H2JA 1V5JA 2DDQL 3UTPE 1ZV5A 1G9ML 5H8DA 3OB0H 5AO9A 3LKNB 4G7VH 4LLVA 3RRQA 2JJTC 1XQYA 2WTMA 1FVCA 5AD0A 3PFCA 3EZJB 3BN9D 4YDKH 2JJSC 3R3WA 1Q1JL 3MV8E 5GGTL 1ACYL 3V9AA 3SDAA 3WV0A 5CP7A 3D18A 1QLWA 3WZLA 1GOHA 1X4ZA 2OK0L 5JIHA 2OGZA 2FB4H 2X1PA 5D2LB 3BZ4A 3ARFC 3V95A 5J11C 5FOJA 4L4VB 1NLDH 3HI6H 4O5LH 3WYRA 1GGVA 1UB5B 1N1MA 1OLLA 5IVXF 2V6HA 5SX4I 3GMOA 1QSZA 4G8GE 3FT3B 4BK4A 5TDOB 2ZPKL 3CN7A 3MODL 5HKAA 3ECBA 3DECA 1AGBB 4JM2A 3D69A 1R50A 2VJDA 5SWZE 2RAMA 4S2SA 4AIZB 4M7LT 3MLUL 1YN7A 3E6FA 1XIWB 4YHMH 3VXMD 5HI3C 4NGHL 1U58B 5IHBA 4N8SA 4JKWA 4HQQH 4YXLH 3LSOB 3TBTA 3Q6GL 4PJFE 5EBWB 1A21A 3DBXA 3MXVL 3JV5A 3X12B 3BWUC 1P53A 3A6ZA 3IA2A 1F90H 3RL2A 3HPLA 4A6YA 3PWPD 1N7MH 4OSEA 3CSPA 3P4MA 3RAJL 1UYWH 3AS2A 3PUIA 4OM1H 4PRPE 3GMPA 3ARDC 3WXWH 2IJ0C 3CH1B 3VXSA 1KEML 1IGJA 2HP4A 3VXQA 3VCLA 1MU0A 2XUAA 1HHJA 3DHJA 3MMEB 1XH3B 5EZIH 4WFGD 1QIMA 4YFDB 2VJAA 1DBBL 2QQLL 3QIBD 1AZWA 3MV11 2Z31B 2FHFA 2YASA 3R1GL 3CMOH 1GPOH 4UINH 3BT2H 3TCLA 3TP4A 3CFBA 1QPPA 1BCSA 5F7DB 4IOIA 2OQJA 1WV7T 2DQFA 4FP8H 3RA7H 1UH4A 2WBJC 3LKRB 4LKCB 4U1SA 3WBDA 3LEVH 1S9YB 4TPRL 1LO2L 4P5TA 4FFZL 4HHAB 4ZS6C 5ANMA 5CZXC 4DCQA 2G75B 1D5MA 1BAFL 4LCWB 2E9WA 3DCNA 5E8OB 4HIJA 3SE8L 3M83A 1P84K 5I66A 5GGRA 2J3SA 4YHNB 1DEEB 4NUJA 4PJCE 2HIHA 2WINB 3M3DA 1WISA 3I2FA 3QEGL 5F6IC 2FATL 3KPSE 4JZOA 3DLQR 4B9EA 5IHZA 1X5XA 4CU8A 1XLWA 2GK0A 3GSXB 4GRMB 5AI8A 1CEXA 1QO3B 2O2IA 1KJMA 1NBYA 4WCYL 4X0KA 5IEHA 3JUYA 1BJMA 4DGIL 4J03A 5GRVL 5JA9A 2WUFA 3M8OH 3G7NA 4KTEL 4JY5L 4K8RL 3U4BH 3V0VB 1LO5B 2P5EA 2D7MA 5ACLA 3JWEA 2FEEL 3AINA 5CILH 4JFFE 4G6KL 2Y1VA 3UTSD 4AIZA 4FHZA 5E4JA 3IDMA 4YXKH 2DIBA 3SBWA 4PGBB 2NZIA 2V5TA 2FX8H 3CFDB 4R7NB 4H7JA 1Q94B 4IOFD 3LVEA 3VXOB 4W1PA 1B2WH 4BFIB 2YA0A 2R0ZH 4I0CC 4XNMA 1O6GA 3KPTA 4FQQA 1N2RB 4RISL 3QA3B 4YEEA 5IVXE 1F45A 3L3JB 4XVUC 4Y5VB 5J06A 2ZJ6A 5D2LA 1UENA 1MHCB 2HH0H 5D7JC 3VXOA 1SJXA 5IJKA 4OIIL 1DTUA 1UZ8B 1D07A 2Y4SA 5ICXA 4P4RB 1K5NB 3RDTA 1R1DA 4XP4L 4H1LG 3MV9B 2JJSA 2AEPH 3MGTB 5B21A 4Y1AE 5IESH 2GQHA 5K9QG 4AENA 1T2QH 1OOAA 3C2AL 1X3DA 4O4YL 3RDTD 3WO4B 5KG9B 2PR4L 4NKOA 4OKVA 1S7RB 4MNQD 5TDPA 1R5VA 2WJ3A 3L3KB 4U6YB 1A6VL 4NUGL 3DUSA 4KKNA 1EGJL 2BUAA 5EOCJ 2X7LB 4UBDC 1OQOA 4B6GA 3DYMA 4BYHA 2GK0B 3GSXA 4GRMA 2DWEA 2FBOJ 35C8L 4MDJB 1UK9A 5F9WB 5ERWB 3V4UH 4MAYB 1NKOA 2WQ8A 3QZWB 2E9JA 3DVNB 5D1ZD 3HCVA 4Z7UF 2AQ3A 3GKWL 1A2YA 1MH5B 4MDIA 3DX7B 3BKMH 4NC0B 5CJXC 2R2EB 1MT3A 4JRWA 4KROD 3PI6A 1CR9H 4N68A 2DD8L 1IILE 3VFSB 2DMCA 2LAAA 2VC2L 1T1WB 4HS8L 4M1GL 3O3DB 1CU4L 4F7CB 4EI5D 2Y72A 4ELKA 3L5WA 4PJCA 4KMQA 3O6FD 4Y5YA 3D0VA 3WFDL 4LIQH 2LIPA 1U36A 2GJ6A 3QBTB 2PNDA 3KAAA 4I0KA 3MGOA 2DR0A 1YYML 3SQOH 5KVGL 4OZFB 4JFZH 1J12A 1QBLL 2NY4B 3E8UL 3B9KA 3CC5B 1M4KA 1B3JA 4NKIH 5MHSD 1IBGH 4AQDA 4FQHB 3FFCE 3TNNA 2QJWA 1PDKA 4GKOA 1UACH 2FL5B 1QSVA 2ZJFA 4GWLA 1FFNB 4XPAL 1U8KA 1DQZA 2VDKH 1IEAA 1FNSL 5KJRL 3VXSB 3NPZB 2FD6H 3VDCA 3GBMH 2Q7NA 4YHPB 3QUKA 4ODVL 3D48R 5E03A 4XP1H 3H2KA 1HH6B 4KAQL 1JI2A 2Z8XA 3AS0A 2VKWA 3MCKA 2D7QA 3VU2A 2CBGA 3MYJA 3UO1H 2H26A 3DRTA 5CLTA 3KPPB 3FZUD 4BQBA 3BP4A 3HI5L 5C70A 3D5EA 1IQDB 4AH2A 3VE0A 3UPCA 3GMQA 5IBLC 4UOW0 5L7XL 3TBVA 5HYIA 1PQZB 2XUFA 1HYSD 1T6VN 3NOXA 4C56A 5FOBA 2OLDA 5ALDA 4Z7VA 3HYSA 1FLRL 1H3PL 4Q0XH 3VG0L 4JQXC 3DL4A 3QQ3B 2X2YA 5DJ2B 1U8JB 4U2DA 4ONFL 3SJVB 3AZOA 6CGTA 4WW2C 2VLRB 5CIPH 1OGAA 4KYVA 3RTQB 3EJZD 2QTEA 4JHBA 1H2XA 4NJAH 3OG9A 1E6JL 3O3AA 5C0AE 1XGUB 3PWLA 3U2SA 5T1MA 3IVMA 3RVWD 2EDHA 3X17A 3KPLA 3EOTH 5JDJA 1V7NH 3P9MB 4Y16A 3H2WA 5FECB 5GRYA 3VXMB 3NIDF 4MGXA 4JO2L 4MZ3A 2KQMA 4YHKH 4DZBA 3T0EC 1IJ9A 3DX9A 5LG1A 4N5ED 2Q87A 3QDGE 2I03A 1NCDH 3CCCA 4OGXL 1DSFL 3FQRA 1YMMD 4XPBL 4MAUH 3SGKA 3ULVE 4LLVB 5IKXA 3IVKA 4ERSH 4M00A 2XUDA 3K2IA 1U91A 4NNYA 1GXEA 2X44D 1EJOL 3REVA 3C6ZA 4ETWA 2APTA 2ZUYA 3MV8A 4HT1H 1MHEA 4HKZA 2BY3A 3O3EB 2VIRB 3OGCA 2F54E 4H20H 4ZSOA 4LFHG 3VWKD 1KGCE 5SWSE 1UOPA 1ZJ5A 5HPMB 4GG6B 1H5BA 2AKRB 4DAGH 4CU7A 2COQA 2VMFA 3B9KB 1YJDL 2VWEE 4PJAE 1GZQA 4H7FA 1EEYA 5DRWA 4PJEE 5FGCB 1YMME 3QP3A 4ODSL 2IG2L 4L8SA 1DX4A 1GPKA 2R29L 3MLTB 1K4DA 2EDYA 4NQDA 4KI5F 5EFIB 1IAII 1IL1B 3FFDA 1FH5H 3BEWA 2JGKA 1YUHA 2VDMH 5KANG 3QMVA 2WIKA 4HCRA 1EDEA 2MHAB 3QCVL 2GW5A 5CD5C 2B0SL 1OAXH 5E9DB 5JD6A 2ADJA 5GJSH 3EIFA 3EO9L 1F6FB 1U3YA 2WIIA 3MRCB 5I18L 3RI5K 2ADIA 4PRDA 5IW6A 1GGIH 1KN2H 3DVNA 3QZWA 4O58H 3HN3A 1AE6L 3T65B 4AN0A 2RHWA 1FBIH 3RWHA 1CE6B 2A83B 4MDJA 4X5WB 3MPCA 4F7PA 4P9NA 3ARDD 4GBXA 3VGFA 5DMKB 2RONA 1NCAH 2BK8A 1LP9E 3RY4A 3AJAA 5FM5M 2GJZA 3SEPA 5I74B 4M6OH 3MLXL 1HYSC 2QUBA 5FF6A 4OCYH 5ALFA 1E8MA 4QRQA 4P5KB 2A9ML 3KDMA 3QXAB 1BVLB 1J05A 1JU4A 2ROQA 4LXHA 2VERN 2WP3T 1BD2A 2I9TB 1I1YB 5ESVB 3WNKA 4JQIH 4NWUH 3TGLA 5CT5A 2VAAB 4YDIH 5SX4H 1IKFH 2R0LH 4NQCA 3ROLA 4CN6A 1OP9A 3RVWC 1ZWIA 4P2YA 4LVNB 1XZJA 5AM2A 5DTFB 4WWKD 4JO3H 2FX7H 5L0QC 1R9MA 3DHMA 5D93C 4ZTPL 2VSQA 3RWDB 4LYDA 2EIZA 3JUZA 3DI3B 5MERB 4WCVA 1I7ZB 3ME0A 3NCJH 5E8NB 3VFMA 4Z7WE 4M6MH 4HC1A 3OKOB 4PR5A 2W9EH 4K3JH 4UUJB 4UUJA 3EYVB 1PFQA 2RHEA 5MP6L 3D39B 2E9IA 1ZIXA 2CMFA 3FQTA 4PRHA 4FQQB 1MRCH 2A6KB 4MVBD 1SYSB 4L29B 2IH1B 2YA2A 1JPTL 3RWDA 2HKFH 3U9UB 2DTML 1KPUA 5AM5A 2W9LA 4IM8A 1MFDL 2R1YA 2CDGB 4OF5A 1EERB 5FXMA 4FA8A 3SCMD 1CYGA 2YD2A 4NFBA 3WJJA 5KSAC 4V2BA 1NGXA 4S0SD 5EIHA 1CDBA 3IB3A 2QHLA 2R0KH 3WE6A 5D3ZA 3FO1A 3TJMA 1K8IA 4RGNE 5HVHC 4YFEA 4Y5YC 2D7TH 2O2HA 3V6OE 2Q8BH 1WITA 4UI2A 5A16B 4JFYB 3WN5A 4MA8L 3RNKA 4HJGB 3QPDA 5F7LB 4TOYL 3RVTC 1HHKA 1WWAX 1ADQL 1FZOA 3VGAB 4KRPB 5ID1A 2GZSA 4PJIB 4BSVA 1R24B 4LDOB 3IS0X 4LHUA 3T65A 1RZIB 3I9GH 3QJFB 4HG4J 5ALCL 4OB8A 3NCBB 5D2NA 5DEFA 3IB4A 1WPRA 4U7MA 2E7BA 3QEQB 3QCUH 3I6GB 3UXFA 4ZXBB 5IBUG 5HGBB 2GCYB 2ILLA 4RDQG 3AUKA 1HKFA 4ZFOA 1G7IA 2H9YA 2ZCKL 3MJ8B 2NXYC 4Y4KD 3RTQD 5EORL 4JFQB 4AYFA 5DYYA 1VJ5A 5DJZA 1ZGLP 3CX5J 1WZKA 3QIUB 3F7YA 3LKQA 5TE7H 4LARH 5L2JB 5DD5L 3QPXH 3PDCA 2APXA 4GG6A 4ZYKA 1U0QA 4L3CA 3ESDA 4E41E 1F0PA 3DVFA 4KGLA 1WCYA 1JWMB 4L3EA 4NO0B 5IHUH 1I9IL 1V8HA 4E42B 5A2FA 2PTUA 3MMEA 2N7BA 1EA9C 3HAEA 4ODXA 2X89D 4HG4K 4QDUA 4Y1AA 3BO8B 1UXOA 1P1ZB 4JLRA 1P5UA 1M33A 1IQWL 2PYED 5C9JB 1NJ9B 5SV3A 3UTSE 1DDHA 3GSNB 3WS6A 2YUWA 4PB0H 4OPMA 5AYUH 1MFEL 3EFDH 4LSSL 4W81A 4CGTA 3H7BB 3FQXA 4F8TA 1P4LA 4KROC 3BQUA 4PUBL 1OAYH 5CT8A 3HZKA 3DV4B 3MV7E 1ORQB 2CGRH 5BRZE 4L8CA 1EHLL 5E5UB 3L5XH 4Q6IA 1JWUA 1EMTH 2Z8ZA 1P7QA 4P49A 3TYFB 1KC5H 3CUPB 4K7FB 3AIKA 5DJ5A 3BH8B 4HDIB 1IC7L 5CTAA 4J0IA 2HKHL 3GNMH 3ULUE 3LN9A 2G5RA 1MJ8H 2AAVA 2DJ4A 4LOUD 4P4KC 1I7UB 2ECFA 5D8JL 3WJ1A 2NNAB 3KHOA 5EIQA 3L3IA 3V6ZA 3GBLA 4HUMB 2JKXA 1CZ8H 2NY3C 1PLGL 2XZCL 3C5ZD 3HAEG 5F70A 1J5OL 2ZG1A 3BJLA 4UHBA 1ZKAA 1P0QA 4DLNA 4K2UH 5IT2L 4BQ6A 5ADOL 3ESBA 4Y4KA 4LU5L 5K3FA 4G8IB 3K0WA 1XZFA 3H19A 2DKMA 3C5WP 4I2XE 3QUKB 4OZFG 4DNPA 4EJ1C 4ARBA 1I3GL 1CUEA 4UV7L 1GH7A 4L9DA 4JGJA 2D03L 3CVHB 1VADA 3HE7C 3KPSA 4PGDA 5CBEB 3HLAB 3TT3L 3GFUA 1JGVL 5CINL 3SY0A 5JHDE 4HJ0D 1YEEH 5I30H 1DUYA 3TT1H 2Z35B 4XJVA 1VCAA 4XB8A 3NBNA 3TNNB 4FQHA 2HT2D 1YNLH 1TZGL 1AIFB 4HX1A 3G6JA 5HGAB 5SWQA 5JAPA 1TZHB 2YUZA 1BJ1H 4PRPD 1BJ8A 3I3EA 5DD6B 4YXHL 1T0MB 5EIIB 4NQTA 1TKRA 4G8EA 2GTZA 2J6EH 3B9DA 4N0YL 4XMLL 3SOBL 1WICA 4X9HA 2O61A 4WW2B 1NAML 2H3NA 5GRZA 1P84J 1PVHA 4WWID 5DJ0A 4Y2DB 1G6RA 2R2BA 3P77B 2NXZC 1DQDL 4J1UB 1XRLA 1FYTA 3PXJA 3O0RH 4OZHB 4JB9H 3DETC 2AI0H 3B5HA 3S37H 3N1MC 1KG0B 4BVJA 4MB5A 3K81A 2B4KA 3E3AA 1BVZA 3L1OL 4N5EC 3SDAC 3UYRL 2NY1B 3W2DL 2DIJA 1IGYA 3HZOA 4FG6D 3G5VA 4B5EA 5JZ9A 4KVNL 4M1CD 4PJBB 4PRNA 1ONQA 4ZUUB 3BDVA 1BFOA 3HE6A 4J3OC 3V0AC 4H1LB 5KS9E 4X92A 1W72H 3O3BB 3FRUB 4Z7OF 3LQAC 5A2IH 5IV2A 1NEZB 5DUBB 5HDQH 4IDJH 2ZNXA 2LTQC 2H7XA 4NQSB 2DRUA 3KS0H 3NIDE 2HRPL 1RUAL 3QXAA 1KCUH 3KDMB 4Y8DC 3O2WH 5BQ7B 4QOKE 3BDIA 2EDCA 4TSAL 4HRXA 5HD8C 4AJ0A 3CPLA 5EZJB 5IB2A 2F58H 3QRGH 2GFBB 3L3GB 1MY7A 5A7GA 2DQHH 3B3IA 4XCYA 4YBQC 2IC2A 2EDJA 4ODUA 3PQYA 5C07B 1U8MA 3RX7A 4CFSA 4XCFH 2WTNA 2G5BB 2C3VA 4KRLB 4S0XA 2W0FA 1A5FH 4M8QB 4TTGA 2HM7A 4J1UA 5CH3A 2QQKL 2DQGH 2J8UB 3P0YH 5DD3H 2EDXA 2ADJB 3CFKA 1IZJA 3WIHL 4NC1C 3QB7C 3CFDA 4R7NA 5LQBL 1UWGH 1TTGA 5T33L 3BPCA 4XWGL 2Z93A 3HG1A 1OAUL 5DO2D 4QRSB 3MRBA 3MLTA 3PGDB 5FYLL 4DGYH 3RY6C 4M1DH 3QSKB 1TZHA 1A3LL 2AK4A 2BNUB 4NZRH 5HDOA 1J10A 2R0WL 3ES6B 4JANB 4EBBA 2DI9A 3OJ2C 1UXSB 2WUCH 4ZFFB 3FYTA 2VIRA 1S9VB 5DK2A 5FK9B 4AL8H 3FONA 3UTQA 4L1DA 5GQBA 4LGRB 5DLPA 5HI4C 3QIUA 5GRUL 1EXUA 1F11A 5B38B 1NBYB 4LSTH 1J86A 1I1FA 1DT3A 1CLZL 5DR5H 1T21B 4AEEA 4YX2H 3PE6A 2X1OA 2B4CH 3O11A 1ZT4B 4YHML 1A4KA 3RBSA 2DHCA 4MXVF 5E08L 4HQQL 1CL7I 4YXLL 4WV1C 5EO0A 3I2KA 4RRPA 1THGA 4X9IA 1QFUH 2H32B 4YQXL 5AK3A 2ED9A 5TF1L 3O2DA 3L3IB 4EHBA 2WV3A 1BD2E 1LBSA 5AI4A 3DUHA 5HQ3B 3RAJH 3BEVA 12E8H 1I7UA 3KXFE 4Q3KA 4OV5B 1MCQA 1D5XB 3RQ3A 1DBKH 4LKCA 5KVFL 3BI9X 2IF7A 3D1MC 4PJIF 2OJEB 1HDMA 3K1DA 5CUSL 4LCCA 5KSAD 5AIBA 1TTFA 3FLBA 4LLWA 1OGAB 3F6LA 3N1PC 3NZ8B 4OAWB 3MROB 2C7BA 3HE7A 4F33B 3DV6A 1CS6A 3OAUL 4ELMA 4FBMA 4X85A 2MCPL 1H9VA 2OCFD 3TA3B 2IQ9H 4CADA 4RMUA 1P0MA 4X9GA 4QOKA 2GSIA 1IGCL 4AO6A 1P4BL 5J9PA 3MZTA 3VH8A 3BP4B 1U3HC 4WDRA 5J13C 2GIYA 4NN6C 4TPRH 1NGYB 5FHAH 1MREH 5AUMA 5AK4A 1FIGL 3KG5A 5F1OB 3C43A 4RA3A 4G9DA 1JHKH 2K3TA 4HJJL 1EX0A 4NRXB 4JFEB 3PWVA 1XFPA 1TCAA 1T7ZA 4NC1E 4L29A 4L3WA 1TCBA 3HR5A 5IWLC 5ALBL 3TIDA 1B0GB 1PGRB 2A73A 4A2LA 5GXBB 3V48A 4W1SA 2NTSP 4HWUA 4DTGH 2NW6A 2FGWH 1CE1H 1CBVL 4JFFA 2EDNA 1JGEA 5GS0D 4XBGB 1RJZA 1S5HA 3FB8B 3QO0B 2CQVA 3QUMH 1C1EL 1N6QH 1YDPB 4ZUWA 1AHWA 5ALVA 3M8OL 3MRRB 4Z6AT 4ZFOL 4RCAA 2OJEA 4JY5H 4WU5B 2RCSL 4WY8A 2JEYA 4J12A 1XGTA 5E4EC 2EDFA 4Y2DC 3GJFH 1A6ZB 2M26A 2NXZB 1VSCA 3Q5TA 4G6KH 3UAJD 4JRYD 1ERNA 3IJSA 1LGVA 5DZOA 4F57H 4L4TB 5ICYA 3ICVA 2JB5L 2G5TA 2DLIA 3VRJA 1KUMA 5HGGS 3QDJD 3FNBA 25C8L 3U6RA 3DJ9A 1JHLL 4X4YA 5I15L 3NCCB 3R06B 2FBJL 4R0LC 5IW6B 4G6FB 2ATKB 2XPGB 3VGAC 2BRRH 4J3UA 5IMKA 3SDCA 4EUPA 5BCAA 1JK8B 1UFOA 1KN4H 1N6VA 1PYWB 3PIQB 4H7HA 1U3HB 4HSQA 3U7YH 5I8OH 1IAKA 1PG7L 2VDQH 2CKMA 1NMCB 4PB9L 4NQXB 5ALIA 4OZGF 3O41B 5GGVY 2KKQA 3UDWC 3HLKA 3FO1B 4CIBA 3D3VB 3RZCC 3ZHKA 1U2CA 4QGYA 4HFUL 4AT6A 3ETBF 4C57C 4V1DB 3VFTB 4PGEA 3LS2A 3QXUA 5GS0L 1XR9A 2BSSB 4XNZC 1XZCA 2R1YB 1SY6A 3D3VD 3GSQA 1R3LB 1EEYB 3C2AH 1EO8H 1CGUA 4O9HH 4PLOB 1BZ9B 1B88A 2BMKA 1SVZA 3LIIA 1P69B 2PR4H 3PWJB 4HC1L 4PJ5B 2AXFB 4X5XA 1KB5B 1QBML 4XP9H 4NUGH 5H37G 2FO4A 3SO5A 5JPNA 5C8JB 4AK1A 2BDNL 1E27A 1G66A 1SY6H 4Z7WA 4LLDA 3WIOA 1E28A 4EQ2A 4UBNA 1U91B 5MERA 4JM2F 5JADA 1LILA 1TRHA 4UFOA 3MACL 3VD4A 2MKLC 5BMFL 3HUJB 4LMQI 4MA3A 1KJ2A 4Z78A 2JGIA 3ARFA 3OKNA 5T3XD 1T7YA 2JELH 5J1AB 2VA9A 1C5BH 1HSAA 4I3SL 4Y2PA 1FO0A 3P30H 5IVXA 4BCDA 1C08A 3VXUA 3QQ9D 5EULV 2R8BA 2PCPB 2BVEA 1MFBH 3G08A 1DZBA 2F53E 1CFBA 4OLUL 5T3ZD 3E0GA 4WY5A 5EU6A 1QACA 4OCRH 2FSEB 3HE7B 1SQ2N 4N8VG 4OCSH 3ULVL 4GG6F 3GBNH 1XKTA 4LIQL 4Q05A 1U8OB 4LGPB 1JNHB 5DF0A 5D6DA 4FG6C 5C0CA 1UK6A 2JJVA 3FRUA 4M1CC 1K8QA 5K3DA 4QLAA 3E6HB 4JJHA 5E70A 5GRJH 5CRIA 1X44A 1T7XA 3LHPH 5DFWH 5F9WC 3G0DA 4C89A 3TVMB 2P46B 3DIFB 4NM8L 4RX4A 5I1LB 2AJUH 3ICWA 4PJGB 2VDKL 1HKLL 1II4E 2F19L 3CDGB 3CDYA 2O2GA 3STLB 3A2MA 1S7UB 3AM8A 5KZCB 4UT7L 4UILH 5E8PA 3EYFA 3DRQA 3E3QE 2LAGB 3BP7A 1P7HL 4KE9A 4U1SB 4PRHE 1ZHNB 3HNSH 5EZLB 1KTDA 2DF3A 1F3JA 4YHPA 4X90A 3AB0C 1JTPA 3N9GL 2C0QA 4QT5B 3FT2B 5L2KA 1TVHB 5DJXB 3SBWC 5DK2B 2FX5A 2PXYD 3HR6A 4CIAA 2FECI 4MD4A 1AKNA 1UEMA 5FYLD 5E9DD 4QXWA 1BROA 1TETH 1ZA6A 2W9DH 3C5JB 5I75B 4NJAL 4F37F 3AROA 5C0DA 2DQIH 3M81A 4YGVB 1E66A 2ZYSA 1MAKA 1Q9WB 2CIIA 4RFNC 5EN2B 1OTSC 1MJ7H 3PGFL 4MB4A 5GSVB 4FKBA 1GPNA 1R3JB 4HRYA 3PL6D 2HLFD 5I71C 1T1WA 1BM3L 5D7KE 2DJSA 1I6WA 2AJ8A 4G9GA 2H8PB 2P24B 1K6QL 2P43B 5DVNA 1HDEA 3CVIL 4MHHG 3WYDA 2R2EA 4G5ZH 4TRPH 2WG0A 1E89A 4MJ3A 1LQSR 4GBXC 4DEPB 5CGTA 3NCMA 3QHZL 3TVMC 4ERSL 5C6PB 2LU7A 5FM5O 1W72B 1TQCB 1EJOH 1F4XH 3IT8D 2I25N 5E2IA 4X6XA 2HRRA 4XIIA 4OLWL 5T1KA 3SKJH 3I75A 3VFVA 3DUSB 1F6AA 3TYFA 1W76A 1T5WB 3EW3B 1D5IL 3D0LA 3IFPA 3GSNH 5INCB 3TBVB 1A8UA 2P5WB 1TQBC 4OLZL 5FA4B 2IG2H 2HJLA 2F53A 2BOBA 1EHAA 1CF8L 3RWEB 1FZKA 2G63A 3BZEB 3QXDA 3OURA 1FVDB 4F0JA 3SDXF 1A9BA 3D18B 3BJ91 4LCWE 2X89A 4LQFL 3G0GA 4ZUVB 4B0OA 1Z9MA 2VITA 5EU7C 2H2PD 1P7QD 3B2VL 4PGCB 1AHWC 3OSKA 1VACB 5I74C 1IM9D 1HQRB 3QEUB 3PHQB 4WFEE 3MLRH 1NCCL 4PJGF 4LEOB 1KN2L 3MNWA 5E6IA 1JRHH 4O58L 5J57B 1AE6H 1WBZB 4Y2DA 1J87A 5ENWA 4OD2A 4YXKL 1H5BC 4DOHE 2WIMA 2E7MA 1XFDA 4WW2A 2AXFA 3PP3H 1J8HE 4X5XB 4XNUL 5TQ2L 3C09C 3FN0H 3FT4B 3A0OA 2W0PA 4R4BB 1NGWA 1OSPH 3LKQB 3F7YB 2CLRA 1E4JA 2DS4A 2XIDA 2BUCA 3KD2A 3FAWA 3WA7A 3SPVB 4WTXA 4LCYA 5DJAB 4P48A 1L4IA 3BP5B 3MCLH 4PJDA 4GRWE 4KHTH 2D0HA 4MQ7B 2HH0L 4JRYB 4B80A 2WK2A 1AC0A 1IAKB 3T0EA 4X7BA 3GKZA 4HLZG 5EOQH 3MXWH 2ATKA 1BQUA 1ZD2P 1KJVA 1EGJA 1V3LA 1UA6H 4HXAH 2WIGA 2BRQA 2J88H 4HIHB 4PJIE 3M1BA 4W6XB 1T89C 1QGED 4JPWH 4X6EA 2GBIA 2VXVL 1VA4A 1RJLB 4JZJC 2X09A 4GW4B 4LBEA 3RUGF 4TQEH 1A6VH 2DTMH 4QHLA 1KLGA 4A23A 4GSDL 1E8DA 4F15B 1KBGH 4BZWA 3WDJA 4GKZA 4Z7OE 1ISPA 4OLYL 3MRGA 2NY2B 3UPRB 5IVZA 4GO6B 2HA5A 4P4RA 2C7UA 1WQVT 5F7DA 2HHAA 1MWAA 5DK0A 3QUZC 4NO5A 5TQ0L 4G80B 1QIDA 2BGNA 3GKWH 5L0QB 2CDGA 3LRSB 1QHOA 1SJVA 1I8MA 2JJWA 2YSSA 4FQIH 3H17A 3TWCL 4TOYH 5KOVC 2IMMA 5K59E 5DSCA 4HFWA 3MRMB 4QLRA 2VC2H 1ADQH 5IEKB 2EC9U 3NGBC 5CEZL 4P46D 4XAWH 1HCFX 3FOMA 3T3ME 3ULSB 1WBYA 1VACA 4KC3B 4GLBA 1QQDB 3I9GL 3LKOA 1CLYL 1JFQL 5DD1L 5BS0B 4O02H 5I1HL 1D3CA 4FQXA 2WBJB 2AS5M 3RL2B 3QCUL 5DTFA 1WOMA 2J5LB 3W2TA 3VW3H 1G7LB 4NKIL 1FFEA 1IBGL 3DBXB 5JUEL 1A8QA 4LHQB 4FN0A 2W60A 5LVEA 2P1YA 1I7RB 1SEQH 4O2FA 1LO5A 4PD4J 4BKLA 5L9DH 2DWDA 4X91A 1LZKA 2C5DC 1NDMB 4CVUA 3HXKA 5F1NA 1S3KL 2YZ1A 4IIQB 4JY6B 5C71A 3KLHC 1FJ1B 3QIWD 2C4XA 4B82A 4FQXC 5MEOA 2X10A 4XP1L 2EKJA 1EB9A 4UIKH 1QYGL 4LLWB 4P9HH 4KAQH 4Y19B 2MJWA 2VLJB 5DD5H 3RY5A 3GUTB 4PJCF 2VO5A 3GMOB 2XV6B 1KEGL 1HBJA 3E0XA 3HZVB 1DE4B 4Z7NE 2C0PA 3OJMB 5ALQA 5I8KH 5I73B 4AIOA 2VLJD 3BEVB 1S7VB 4UNUA 3WK5A 1V3KA 1HNFA 2UWEB 3SDDC 3WK6A 2A77H 5F89B 4NKQB 1OW0A 4DNFA 4UDTB 2EDOA 3QNZB 2QXUA 2Z3ZA 5ANMB 2MMXA 1F8TH 3HS0B 1FN4A 1CICA 4RGND 1E6JH 1FV1A 2NXYB 5EA0H 1G6RH 1TQCC 3S34H 2KPNA 5JATA 5EFIA 4IOIB 1QLRA 3EOTL 4XCEB 2CIIB 3I2CH 1HHKB 4PUBH 5B38A 2K7QA 4QEGA 5T3XE 3K6KA 2ORBL 1ZA6B 3C5JA 2CGRL 1GVIA 1T4KB 4FDMA 4HH9A 5BOPA 5FK9A 3G6JF 2VLRD 3ZMRA 4LSQH 1PFCA 4LCUB 4P9HC 4UBOA 4CDHA 4BZ2H 1FVEA 1ETZA 3AZQA 4CG1A 1NCDL 5ESQB 3HAEH 4LLQA 4NRYB 4RQQB 4C54A 3PICA 3ZDXF 4YIQB 3P0VH 5JOPD 2P8LA 1Q83A 5HHPA 3HPLB 1T04B 1DWQA 3Q2CA 4P2QD 3BDBA 5IW1A 1YPZB 1FFOA 4E5XA 4HT1L 3PP4L 4QF1B 1GXSA 4W4OA 3UBXB 3QUZA 4WW2F 3S35L 4DMFA 5FYKH 2ACKA 3E6FB 5E2VH 1YJDH 5IR1B 3GMNA 4WI3A 4KEAA 4ODSH 3S36X 4F33A 2W07A 4I18C 3I6ZA 4JKKA 5IGXH 1HILA 3BKCH 3GELA 4NQUA 4H8WH 4MXWH 1JGVH 1FH5L 3PWLB 1C5CL 1YEEL 2G60L 2VN4A 2B9VA 3GM8A 3MV7A 5BRZA 2DYPD 4QRTA 5SWSB 3GHEL 1VHPA 1QZ3A 4P4KA 5D7LE 5DLMH 4J0DA 1MAJA 1MCLA 4ETYA 3V5DA 1MAHA 2Q8AH 4F3FA 5IK3B 4KJXA 1NEZG 5BJTA 2CLVB 2P5WD 2OG1A 1MLBA 2C4FT 4NO3A 3QPAA 1J11A 3UMTA 2FIRT 3V1MA 2OMNA 1JN6B 1T6WA 3RWCA 3SOBH 5EO0B 4H88H 4OUOA 1JI1A 4C88A 1NAMH 3MYJB 5LAXB 1QR1A 4XPGL 4XVUD 5AWNH 1G7QA 4YASA 3HZMA 2GJJA 1HH6A 1KLUB 3W9EB 5I8CB 2HT2C 4KDVA 2PKDA 4DQOL 3T0EB 2XWBB 2WHPB 4XAKE 3EYQD 1WAAA 1KJ3L 4QXGL 2VL5B 3L1IA 3ARDB 3GSOB 4JQIL 5E1AA 4NYLA 5JR1H 2FJGB 1TCRA 1IKNC 2XY2A 4KVNH 2CO6B 4XX1E 3DNMA 4FQCH 3EQ8A 4HUXA 1B4JH 1FFQA 4BA8A 4G42B 1T89A 4LLMB 1W72L 2VJCA 1SBSL 2WWMC 5E2UH 2OJZH 5TH2B 5TH2A 4ZTPH 3FB5B 3V7MA 4CL7A 3VGGA 3DX8B 1IZKA 5I8EA 5JOPE 5LBSL 4YPVA 4GLRI 1YEGH 3RWJB 2IEPA 2VAXA 3ULUH 3O3DA 4HGKC 1AKJB 3G9AB 5D70L 1ETHA 4UBKA 3V4VH 1IKNA 3ARDA 3RHWK 2AJXL 4R90L 2HT3C 1JPTH 4GMSL 4BTVA 3MNWB 5J3JA 3I3DA 3L7FA 3T0AA 3IVKB 1EVUA 2XG4A 4P59L 5JW4M 4PJ5E 5DZLA 4PJGE 5E94A 3FQRB 4WV1A 3BPOC 3PQYB 5C07A 1ZD3A 2R2HA 4R7DB 5D2LF 2OL3L 5CJBA 2DL9A 2V5RA 3O6ML 4PTUB 5A2LH 2FCBA 5H2BB 4XCYB 1ES0A 4EI5C 4EB0A 1TZIB 3P0YL 3VFUB 2JIXD 2PF6A 2PM8A 2XWTA 5IJVA 5FYJU 1BEYH 1SJHA 2HN7A 3N1GC 2BOBB 5E6IC 4BC1A 5GJTH 1DQQB 1N64H 5IK3A 3CGTA 1YZZA 4FZEH 1OAUH 1B41A 4I4CA 5JAHA 4JFDD 3OJDA 2NNAA 3DXAB 1F6AB 3V9FA 2X4RA 4W9RA 1A3LH 5I19H 2VDNL 2P7TB 2DFPA 2R0WH 3HE6B 1A1NA 1T7VA 2YK1H 5DJYA 4HEPG 5T5NG 3MR9A 4AZ8A 1HNGA 5IMMB 3A2LA 4M7JL 2BX5A 3T0VA 2FIKA 3P4OA 1KPRB 3VGEA 3WL8A 3JV6B 4JFHE 1IQDA 5GRUH 1KG0A 5FP0A 1QEWA 1CLZH 2AJVH 3QZUA 2G9HA 2J1KA 3WUWG 1N3NA 5IBLD 4E46A 3JWDH 1FFDA 1WC7B 3RL1A 1B9ZA 4K55A 4ODWB 5DT1L 3C6LC 4EN3A 4RQQA 3IXAB 1NDGA 5C07D 4C58B 2VSCA 3RWFB 5JXEA 4AEIH 3DVGB 1N8ZA 4XPHL 4LRIA 2MCG1 3MBXH 3H42L 4HGMA 2DQEH 3OKLA 5EU6D 1MPXA 1QSFD 4PJ8B 1OWWA 2ZYHA 3EUUA 1TVDA 1HINH 2DICA 4LAJH 3VG9B 2NYYD 3RX5A 2J4WH 1K4CB 3AREA 1PEWA 5HHNA 2YA1A 5CGYD 4WGWB 2J3DA 2XUGA 1MFEH 3RPIB 3LN5B 1C12A 1OAYL 3I1YA 3O4GA 3RVXC 1QR4A 5TE4H 1S7UA 4FOMA 1EHLH 4NUJB 2GCYA 3CN9A 4XVTH 5C81A 3CFJA 3C9NB 1S9XA 3C9NA 1X5LA 2VSDA 1IT9L 1R3IH 2G5PA 5FO7B 4U0RC 4R0LA 4JG0H 3T52A 4HBCH 5D1XB 1WCBB 3K2UL 2EXYC 2GITA 3LMJL 4LVOC 3ARBB 5ALBH 5JZ7C 1AQDA 3DSFL 4LHUB 4L9LA 2IIVA 3S97C 2GSGA 4HBQA 2DQFB 3GHBH 4NZTH 1CD8A 4RAHA 1P0IA 2Z3WA 2BY1A 1X70A 5E2WL 1P7QB 1QIIA 1CBVH 4AG4H 2B2XH 1AQKH 4Z77A 5MEPB 4AENB 1GAFL 3WN5B 3HZKB 4IOFC 3B83A 4LU5H 4RGNC 3ILQD 4N5UA 1QVOB 4TNVF 5ILTL 4AMKL 3MRFB 2X5PA 4N1EA 4PRPB 4M8VA 1C08B 3QDHA 4UV7H 2BJHA 4JKPL 4KGJA 4FQXB 5EOTA 3U4EB 4P2RE 2YH2A 4Z78B 2OTUB 5EG6C 4A6YB 3T8XA 1JYNA 3DROB 4U6HA 2ICES 4PJFB 4OLVL 3RVUC 5J12B 3HPJB 3NCYP 4R97C 1EFXA 2N1KA 3RZWA 2OZ4A 3JV0A 4YHYC 3P11L 4F9PC 2G5BA 2IAND 5F9JB 4JDTL 1QIFA 3SDDB 2ZZUT 4N0YH 4XMLH 3WKDA 1AGBA 4JM2B 1MTZA 3UC0L 1R3LA 2XFXA 5AAMA 4YE4L 3HMWL 3NCEB 3V5HB 3BE1L 4XBPB 43CAA 1DQDH 4QRPA 4PREB 1NBVH 4OLXL 3A6CL 3OJDB 1Q0RA 1PKQE 1YEKL 2XUKA 2DQCL 5J11B 2BVTA 1FLTX 4G43B 2X42A 5IB1A 2CR6A 4HAGA 3GM0A 3IGAB 1PZ5A 2XTJD 3O9WD 1U3HA 4KDWA 4ELMF 5T1DL 5BV7H 1HN1A 4L5FH 5F7HA 1XZLA 5A7HA 1TZIA 4O9HL 2XMZA 1JJIA 1MCPH 4PRNB 3MFFB 1F6WA 4J8RA 2YPLB 1R24A 3UAJC 4PJIA 5KANI 5MEQB 2UUDH 5HFAA 4F7MA 4IO0A 1K2DA 2YWYA 1I3UA 4TNWK 4XC1L 1MQ8A 3ZT6A 1TCMA 3QWRA 4TSAH 1N5RA 4LCWA 4ZGBA 1ZS8A 2JELL 1KU0A 4G9FE 4HIXH 4LSVH 3EGSA 3P30L 3QFJD 1YUHB 2D4FA 2QSCL 3OB8A 1FFPA 3NACL 2BCKA 1I1CA 1KF9B 2DI8A 4KPHH 5BS0D 1LEIA 1V7MH 3UBXI 5E2TH 3VVMA 5EDXA 5A7FA 3C6SA 2V7NB 3KWFA 3QFJB 2GT9B 1EZVX 1A5FL 4LPXA 1I7TA 4ZWNA 3QG7L 1H5BB 5IVDA 2GBFA 4S1RH 1FNEA 2BVYA 1RIHH 4LVHB 4S1DC 1P9MC 3GSOA 5GRJL 3N1FC 4UDUA 1LNUB 4BQ8A 3MRDA 3LHPL 1QLFB 1EBPA 1FL5A 1J1XL 4OSUL 2E7LA 1KPVB 2JK5B 3K8MA 4MQSB 5EBMA 5FYLH 5JQ6H 2XMCA 2P8PB 4XVSH 4NZRL 1FVDA 5ALPA 1EPFA 3OKLB 5C6TL 2ZJSL 5FV2A 1HWHB 2VATA 1CUVA 2Y2VA 5DJCB 4NQEE 2D7NA 1MNAA 4GW1B 4C01A 3KLDA 5BJTB 4NM4H 1P7KB 3GB7A 2Y06L 4OCWL 4LSTL 3D2BA 5BZWA 1UQSA 5IBTH 3TIEA 5DA4A 1H22A 5DR5L 1WZ1L 4Z8FL 1JVKA 2FLRT 2ZUQB 3U2SB 1BP3B 4LCCB 1C7SA 1EEQA 4QYOA 5FUMA 1VFBB 2EC8A 1VA5A 2OMBA 1K8DA 2B5IC 1Z5LA 1YA8A 2PU7A 1TETL 2XTLA 2W9DL 3OKMA 3L3HB 1O7SA 4XNZB 1NCTA 1A7NH 5CSBA 5D7IF 4L8DB 4NJ9H 4PRDB 2NY2C 4C56E 2APFA 2QVBA 3FQXB 1NGQL 4W4NA 1HLGA 4AH2B 1CDCA 3IFOB 4FNGA 3VD3A 1L7TH 1RUKL 3MR9B 2C9AA 2ADGA 1T2XA 4KRPD 4HKXB 1FVCB 3ARBD 1S7TA 1CDUA 3CVIH 5ALTA 2Z8RA 2VXUL 3BO8A 5JAOA 5T3ZH 3ZHLA 1Q9WA 3G0BA 4X95A 1FYTE 3IU3A 5F7NC 2IPTL 1YS2X 4HIEA 2B1AH 4HZLB 3U7WL 1JIBA 2IQ9L 5AM0A 4KMTH 4DW2L 4TTDD 1YNTA 1CCZA 1Y0LB 3FYUA 5IG7A 1IGCH 5FYJE 1PX3A 1SJHB 2HN7B 5F8RC 5CIPA 3BZFA 3FFCA 3GMMB 5DHYA 1DBAL 4PBXA 1MREL 3F96A 2V2XB 4WO4C 1PBYA 1OF2B 4LLUA 4OZFA 2APBA 3G6JE 4CVXA 2ZUXA 4AEFA 5ALRA 1UZ6E 2XQKA 4RMWA 3LKSA 3VRLE 2FYYA 3QM1A 1RUMH 3THML 4MWSA 4CVZA 3G6DL 2EE9A 5CEXA 5JORA 1KTLA 2QHRH 3KPOB 1F6LL 1GGYA 4QXUL 2N4IA 1QIJA 2GY5A 5IFJA 2FR4B 3KPNA 2P5ED 2WAHA 4G8CA 5E8EA 5L88L 4YZFF 4WEBL 2WLYA 3H9ZA 2PO6B 4WUUE 3OG6B 4LASL 3HZVA 1BFVH 2JGLA 2LE9A 1LK2B 1GC1L 2IH3B 4UZGA 4D0DB 4HMDA 1NCCH 4XHJC 5AI9A 4DK3A 1JNHA 1GHFH 1TCRB 4RE6A 4HJGA 4PY7A 4NCC2 1L6XA 4KI5C 1N6UA 5DYTA 5K3EA 4I48A 3L3KA 4U6YA 3RWIA 1IAIL 2L7UA 3LB6C 3BGMB 4IIQA 4JY6A 5EU3A 4XBEL 3QPCA 4ZTOH 3I6MA 3KYMB 5FKAA 4P23B 3VE0B 3WHXA 5D72L 3WWPA 3O3BA 1BVKA 3L95B 1T1XA 1CG9B 4S1SL 4XP6L 2R9HC 3G0IA 1QIHA 4N8CH 4PJBA 4KHTL 1KN4L 4QNPE 2WBJA 2WSLA 2VDQL 3RVXD 1QLFA 2PETA 1AXIB 1CDJA 3DOIA 2ONCA 2A6DB 5EBLA 1WBYB 5HYEA 4Y5VA 2IMNA 1S9WA 1HSBB 3D4LA 1WFTA 5J7CC 1I7ZA 1CUCA 2J8UE 4BVKA 1UA6L 1P9MA 4QXTA 4HWBH 4M48H 3MRNB 1BZ9A 5GS0H 4ONGL 1D6EB 2IALB 1KV3A 2CKBL 1BQHA 4OZ4B 4DKFL 5KSBA 5KVEL 4OFYD 1XR9B 2BSSA 1LD9B 1I9RL 3WK8A 1NAMB 3F65A 3LS4H 3LQAH 4YDKL 2CSPA 5DDHB 2PUJA 3GMRB 3QDGD 5I6XB 3PNWB 2DYPA 3QQ4B 4OFYA 2VAJA 4QRUB 4X7CC 4ISVB 4IQ4A 3WS6C 2P8MB 1WEJL 4MNGA 3MACH 2VZ3A 2Y5TB 2Z35A 1QA9A 3ARWA 5D9SA 5BVJB 1ZLSL 5I1EL 3SKOA 1A7RL 1T2NA 2ESVA 2XTJB 3SGDH 1F4AA 3QDAA 3H0TA 5CEYB 3HCVB 5GS1C 3BN3B 1TQBB 4O5LL 4F7MB 1ODTC 1EVTC 4MAYA 5GIRA 1QO3A 5HHXH 3TWCH 2J5LC 1B0RB 4G3YH 4KRMB 5SWZA 2OR8A 5AKGA 4HTAA 2ZPKH 4IEFB 5CEZH 5EPMB 5HY9A 4JFDA 5JXAH 4LCUA 1E5TA 1Y18A 4ZS6D 4OCSL 2LTQB 3TA3C 3N85L 4ONHA 1OP3H 2LFGA 4Z0XB 2NY0D 5I8PA 3B9VA 5IB1B 4P2RA 2VLKA 4RMTA 1GYAA 3KXPA 4NGHH 4NN6B 1M71A 5DS8B 3VW3L 5EHXA 4ACPA 2P48B 3MX0A 1G7MB 5D5MA 4A6YH 4IHOA 4ETQA 3D2CA 4O2EB 4DZ8A 1U92A 2HFEB 1NL0H 3VI4E 4NM8H 3LN4B 4PJ7F 3EQ7A 2DMKA 4L4JA 4O51B 1Z3GL 3N06B 4K6KA 1GZQB 5HK8A 2ZG2A 1UKSA 1HKLH 1UYWL 3FT4A 1O0VA 2D31A 1OARH 5LGHH 5D7IE 4OU4A 1UZ8A 2UUDK 5JASA 2ZYRA 3W39B 5CZXD 3B8SA 4LFHD 3ZE2E 3NCFB 1QYGH 4ZAKA 4NT6A 3REVB 4MA7L 1Q0YL 4YHZH 4DVBA 3VCLB 3K2MC 1RQ5A 1AQLA 5CXXA 1W52X 5MHSE 3RM3A 2I60L 3BAEL 1T4MA 5E4YA 2Y6SD 3SCMA 3RGVB 5CWSA 4KY1L 5F21B 1NGYA 2VITB 3WL5A 1QBBA 2ZCLL 5IMLB 4MAYD 2VLME 3CLFL 1L9NA 5CZKA 4H7EA 1FGNL 5M7QA 5J9PB 4ZFZB 3X13B 1LO2H 3MLWL 3QYCA 4DN3L 1BAFH 2IGFH 2Q20A 4FZ8L 3RI5F 1PX4A 1FIEA 2SEBA 4NCC1 4U05A 3S34L 1CUAA 4OD1L 1P6FA 3WFCL 2X4OA 2I5YL 1GT6A 2DCMA 3O45A 4ZFZA 4OCXL 3ZE2F 3D69B 4R97B 4EKXA 2HL6A 2F74B 3CCHA 4HPOL 1BLNB 1S5IH 4GRLD 3ZSSA 4DKDC 4LSUH 5EBMB 3IKKA 3QEGH 2FATH 1KJMB 4Y88A 5H37H 1KCKA 4LSQL 1AI1L 1J88A 1KCVH 1HEZB 3X3HA 3IFNH 1N0XH 4UAOC 4FNLL 1NBZB 5KSBE 3PJSB 5FO9A 4QHNA 3RHWF 2K7PA 4F60A 1Z9SA 3QITA 1AC5A 4B7ZA 1INEH 3U0TA 2QKIB 1N5MA 3UTOA 2BNQD 2XZZA 5F3HB 2DLFH 2PYFA 1UM5H 3P3YA 1SCQA 1MRDH 3T0WA 4OQ1A 4TUOA 2BJML 4U1JA 1CUFA 4ZV9A 2VEOA 1R3DA 4UTBH 2A6JA 3PP4H 4GMTH 5GSVA 2JF1A 2WUDA 2NX5A 5ACMA 1QBAA 3FL7A 3JBG7 4X99A 3KGRA 3TA3D 5DS8A 2FX8L 4LLYA 2C1OB 3VXSD 5D7JA 2OTWB 4OLZH 4XH2B 2VZUA 1PAMA 1CF8H 2FL5A 3G8YA 3Q5OA 4JDVB 1YCDA 4Y4FB 1U42A 3VJ6B 3W0WD 3RDTC 3SO3C 1C5CH 5EOCH 4R26L 3PP3K 2HA7A 4OI8A 5LKRA 2HTLC 2RBLA 3GHEH 4OIIH 2PSDA 1JV5B 1PKQB 5AJHA 3B2VH 3BPCB 1FE8L 4UBDD 2OAEA 5D4QA 4ORGB 1THTA 3MLRL 4GJTB 1J1IA 5DZNA 5DRZA 3H0TB 1RUPH 3IGAA 1SYSA 3FQWB 2A6KA 1ZT7A 4H88L 1QEWB 3B2UC 4NDMA 3STLA 2AJDA 2EE6A 4XNUH 3D39E 5SYNA 2P8SA 4R2GD 4WO4D 4X9FA 4JZJA 4B7LA 4QY8A 5DDHA 1K3ZA 5C86A 1A22B 4MD0B 3W5NA 3ZV7A 4NQCD 1U8LB 4CW1B 2R69L 1NUGA 4F2MB 1I8LA 4M5YL 3KPQB 3BD3A 5F9JA 3JZ7A 4OD2B 2HMIC 3V4UL 3EDFA 4U1HB 3OKDA 4M6NH 5ABDE 4YBQD 4OF8A 2XT0A 3C5ZA 1LDPL 3IJYB 5IROC 4I2XB 1BN7A 1EHYA 3OKKB 1JGUH 3PWPA 3UJIL 3LRGA 4YO0B 3MXWL 5DUBA 5EU6B 5IH7A 5EBLB 1D6VH 4C83B 4U1GB 4ZO6A 3TO4C 5D1QA 5LBSH 2OBGA 4IRSD 3OTQA 5F7EL 4ZUVA 1CU4H 4PTUA 3ULUL 5KS9A 5CMAB 5FAAA 1QPXA 3V4VL 4KRXA 2BVQA 2WBKA 3SDYH 3V8OA 5DHVA 1J0ZA 1AGEB 5EU4A 4IHAA 4NS4A 4JCMA 4XB7A 1YYMH 3ROOB 1XF1A 3LB6D 4JFZL 4GSDH 3WKEA 3QA3A 4I2XA 4YUEH 5HBBA 1X2BA 1UGNA 1KIQB 5TFSL 5ICZB 2AJ3B 3BMWA 3EZ8A 4WFGE 1X5AA 2VXQH 1CGSL 3D25B 2OL3H 1OSZB 5HGHB 1KLFA 3D3NA 3RZCB 2R9HD 1A6TA 1SMAA 4P5TD 4KQ3H 2XYCA 2AXHA 3HUJE 3F67A 5TQ0H 1X5IA 1IM3A 2OR9L 4PGBA 3LD8C 3WSQH 5BO1H 5DRNA 2HADA 4NQDB 4EA6A 3KPRA 1CUGA 1OAKL 3GIVB 4XWGA 4PFEA 2UZYB 5DQJA 5GJTL 1RK1A 4O2CA 5DRWB 1D5ZA 4Q9QH 3IU4L 5K9OB 4KU1A 1S9XB 2WG1A 4RIRB 3MGAA 4JY4B 5F9OH 3FQWA 1UOQA 3TV3H 2W92A 3SY0B 5IFJB 2OYPA 3TBYA 3BGFB 5DD1H 5I1CL 2HU7A 1OB1B 4P3CL 3QPQC 5AG8A 3W05A 4YX9A 4Q0XL 4I9WD 5J3HD 4JJ5B 5IOPA 1KEZA 4GXVH 1TLKA 4M7ZC 3L7EA 4HLJA 1RZ8B 4BSWB 5ISZB 5GGQH 1SEQL 1IGTB 3JVGA 3MNVB 5L9DL 5I1DB 2DQJL 5LKAA 2ZG3A 1BFTA 3VXMA 3ZLTA 4KRYA 1XZIA 5IG7B 1EJ6A 1ZI6A 1P2CA 1QFWI 5DT1H 4Z7UE 4JQXA 2PXYC 5ELIA 3GK8H 3R40A 4LPWA 2W22A 3L9RA 5FKPB 3QVMA 1JL8A 2NY4D 4IRZL 5EFZA 1KEGH 1XGUA 1DVFA 3QI9B 1N3NB 5I71B 2Y9RT 4XXCC 2VLRA 4NRZA 3MUNA 3JWOC 1I8LC 2DQEL 1OTSD 4WI5A 1HXYA 1KFAH 1FYHB 1KJ2H 1UH2A 1WZLA 5IW3A 1CQWA 3CXDL 3DYIA 1QUNA 3FO2B 2KQNA 1H23A 2HA6A 1G6RL 3L3HA 3OKMB 4XWOC 3TVMA 3DRTB 4MJ5A 1CFVH 1NGZB 1FC2D 2CH8A 2K1MA 4KWUA 4PRAA 4UT9H 2GJ6D 5C0EB 2KUTA 4WUUD 1UT9A 4MB3A 2ORBH 3KWWA 3OF6D 2F74A 3CCHB 1ND0A 4PJ7B 4OZHE 1NPUA 2ZOLA 2J2ZA 5KSUA 2KL6A 2PKYX 2CD0A 4I18A 1U8OA 4DN4L 2SEBB 4JFED 1QOZA 1MJJB 3GIZH 1G0DA 4HBCL 3T3PE 4YNYB 5FHBH 4UPDA 4L9LC 5GRWA 5ADPL 4PYHA 1S8DA 3C5SB 2XMDA 4H7KA 5EUKA 4RFEA 4AO8A 5AM1A 4KKLD 3PWNB 2HRLA 3ECBB 4OIBA 1MCFA 4OFPA 1U93B 3WJJC 3KNBA 4KK5D 5E2WH 3JWDC 3BN9C 5DJZB 4U1NB 3RGVA 1QLRB 4XCEA 1WZMA 1AQKL 2RQ8A 4ZG1A 3R8QA 3HUJA 4JRXD 2HDWA 1H15B 3SE3A 1GAFH 1JWSA 1FORH 5DVKA 1NX9A 2BC4B 5E2VL 2I3DA 4NT6B 4R4NC 3UJJL 3IDYB 1IAMA 4Y4HC 5ILTH 4PTTA 2X4PA 5TE6L 4JRXB 4OCYL 4PV8A 1YEIH 2A9NH 5DMGC 5C6WH 1H3VA 1YSCA 4JKPH 3SGDI 4P57B 3ARGA 4N9GA 4K3EL 4X00A 4DNQA 3EJYD 4GEGA 1SM3L 2XY1A 3VA6A