3C8HA

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-serine
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
392
structure length
383
Chain Sequence
VGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterochelin esterase
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
total genus 106
structure length 383
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c8hA01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c8hA02
1W0VA 5IFAL 5EI5A 3BKML 1DBJH 4X4ME 3CSYB 5E2IA 1T21A 4BELD 2MJWA 2QHLA 5C8JB 3NIGF 2C4HA 5FDFA 5FYKU 2DB8A 2C5GA 1XIWD 5LAXA 2WP3O 4I4CA 3LB6D 5JIIA 3KXFA 4O9HH 5IJVB 4HWNA 4U1IB 1RZKC 5C0IA 1FL5B 1HKLL 2AGJH 4NP4H 4WW2C 5CZKA 2XNAA 5E1HB 4X4ZA 1LGVA 5DD5H 3UTZA 1KB5A 5D2LA 3VVLA 3WIIL 3B2UD 1CT8B 5TQ2H 5I8PA 3H42L 2GK2A 4E41A 3PWPE 5DFWH 3VU2A 2G2RA 2HLAA 3ZHDA 4LSVL 5I66A 2QS9A 3H2IA 1T4KB 4MX7B 3ESVF 1IJ9A 1ORSB 1Q9KA 1TLKA 2VR5A 3D9AL 2NY4D 4MXWL 4BSWA 1MLCB 3LS4L 5ANME 2GYWA 3I2CL 5TFSH 1T80A 5D6DA 4LL9A 2NZIA 3ARBA 2FLRT 4HJJH 3FYUC 5C0FA 5FGCE 1CFQB 2R56L 2YN5A 1K63A 4HIIA 4Y4HD 3JZ7A 3LKNA 2B0SL 2H32H 1ZK9A 3MYJA 3NTCL 4JGUA 1FJ1B 1ZXQA 5EDXA 3FQRB 4NQVB 2PUJA 1S8DA 3WZLA 1X5GA 3MUHL 4FQLH 3F98A 5ADOH 3IJSB 2WHRA 3OKOA 3WE6A 4NO2B 2WLSA 2C7BA 5F1OB 4OZIB 3ZLTA 3FSGA 4DSZA 1EERB 4C01A 1DQLL 3S96B 3TBWA 5I8OL 4CMMA 4BH7A 3GRWA 1YECL 1J5OH 2NZ9C 2BFVL 2ZP0T 3GB7B 1FIGL 3IAGC 1FZKB 4G9GA 4XWGH 4F0JA 5HYQB 1FORL 5E5RB 2PO6D 2VDLL 2GJZA 4JKKA 2BOCB 4FABH 4WFHE 3IFPB 3DCNA 1DEDA 2DKMA 2J3DA 5ID1A 3M3DA 4M4PA 3K8KA 4CDGC 3KPMA 5EO0A 1T03H 4M8VA 1OTTC 3D39D 2XTLA 4U1JA 35C8H 3KJ4B 4GW5B 5DRXA 3SKNA 2HDWA 4HRYA 1S5IL 4FFYL 1LO5B 4Z7WE 1QVOB 4AMKL 4A5SA 4GAYA 1U8NB 1JF5A 4FQCL 3OG9A 1HHHB 4PLKD 5HHPA 3BI9X 1SQ2N 2X4SB 4M0MA 3MNZB 2EH8H 2RAMA 2VZVA 4PJAA 1U8JB 4L3CA 2E9JA 1UM4H 4DKFL 4ZFFA 4Z5RB 2PW1B 2AAVA 4XAWH 4HPYL 1AGCB 1I8IB 3PGDB 4U6HA 2WANA 3QJHA 4NQTA 4XXDB 1H2YA 4ZQKA 1LZLA 4QRRB 4Y2OA 3RY6A 2IH3A 2WWMC 2VZUA 1KG0A 3P77B 3QNXB 3LCRA 2DLFL 5HI4D 1BX2B 1KTLA 2PYEE 4R4BB 3MR9B 1KB9J 5TPWH 4KU1A 5T5FL 1IE5A 1SVCP 1LK2A 4G80B 4BZWA 1JCKA 5HYSA 3BGFC 1Q0ZA 1IM9A 5GRXG 2NY2C 3IRZA 3MRKA 3GSVB 4IDJH 1I8KA 3DXAD 3FVRA 4IRJD 5FYJU 3BQUC 4FNLL 4K2UL 1L6XA 5A62A 1JI3A 4QRPD 5SX4I 1YS1X 1S9YB 4EUPG 4XBGB 2XTJB 1CF8H 2VDPL 3RWGB 4YDLC 1MCPH 2AJLI 2ESVA 1NJ9A 1G7HB 1I1FA 2AXHA 4RWYL 4IH1A 3L1JA 4YIQA 1JFRA 4X83A 4NZDA 3EOBA 2OTWB 5GRUH 1T0MA 1AKJA 3HG1E 3SE4C 4OQTA 3W9BA 1TJHH 1TZGH 2YZ8A 4XNMB 1RAMA 4OD0A 1AHWB 4AO7A 1GOGA 1MJ5A 5GRYA 2I03A 2IX9A 4JFFD 2IAMA 3O45B 3MLTB 4JO2H 4QF1A 3C5ZC 5GJSH 3D3NA 3G7NA 1U3YA 1JHLL 3WHE1 1TVBB 1FGVH 1LLFA 1UG9A 5F7FA 2AJSH 1MRCH 1RUMH 3MUGA 2AP2A 3QDJB 4UNVA 5CD5D 4M61A 4NP4L 4Y2DB 4YDVB 1HL7A 4H7JA 5ACZA 1RSFA 4OM0L 2WIFA 4L8CB 5JLZB 5TQ2L 1XGQB 4D0CB 1BBJB 1RVFL 4R8WL 2WM0A 4PP2B 5JW4R 3M45A 1OILA 3WA6A 2W9EL 3CDFA 3ARFD 3PI6A 1CS6A 4AH2A 4HXGA 3L1OH 1FNGA 2PN5A 3LS5L 1A6WL 3E6HA 4C4KT 5BRZB 3VWKD 1SCIA 3MOBL 4PJDB 3IUJA 3GZKA 5TFSL 2AXGB 3AZOA 3OKLA 1E6JL 2E8YA 1N8SA 5EPMA 3LOWA 3QIBA 5T1DH 2Y7QB 4DIUA 3FB5A 5IMMB 3MRBA 5F1KC 2I9LB 1U8LB 4JPVH 2I26N 5IR1A 3RUGA 2EC8A 1F8UA 1FFQA 2X4UA 1I3RA 5DD6B 3WN5A 4KJYB 3O0RH 4FQLL 1OP3H 1ADQL 3M8OH 2Y5TB 1WCBB 1CN4A 2QUAA 1IILE 4M3JA 3ESUF 3X3GL 1GGBH 5A2GA 1AXSA 3IGAB 1I4FB 3VG9B 1ZHNA 2OR8A 1NC2B 3TN0B 1IM3B 2V2TA 5KSAC 4HHAA 1KCVL 1T3FA 1ZANH 4YHIA 2CDEA 1AQDB 1FYTE 3QCUH 1AD9A 5F44A 3QDGA 3RTQA 3UBXA 1HH9A 4NQDA 2R0ZL 4FABL 4EBBA 4AIZB 4G7VH 4O51A 3C45A 4HV8A 3VDBA 4KDTC 4QT5A 3OJVC 1T03L 5FLKA 5J57B 5D8JH 3UTTD 1OB1A 4FXGA 5C0JA 5IEHB 1NC4B 1KT2A 5KS9A 5E5UB 2HTLC 5CW2A 2AK1H 4C56B 1U8IA 3G04A 2EKSB 3N06B 1RZJL 1YPZB 4KK5D 1KIQB 2XY2A 3H9HA 4JZNB 1MWAL 4P3WA 3TCXA 1T66C 5EWIH 3WCYA 5JPNB 4NQEE 4DKDC 4ORZC 4R26H 5D3ZA 3OV6A 4PGEB 1KULA 3BPCA 4P5KB 1IGTB 1FL6B 4Y2RA 2ZJFA 3PXJA 4MXQC 2DWEA 4PB0L 1Z5LA 3NN8B 4NPYB 2JLLA 3E3QE 4NQCB 4MVBC 3ARPA 3MRMB 3VXTB 5GIRB 5DWDA 4EN3B 5DDHB 4E0RB 5D1QA 4FDMA 2BNQD 5E8OB 4G8GD 1LK3H 4N1EA 3DWTA 4X6CB 5FIEA 1B6GA 2O5XL 2AABH 5ICXB 5DA4A 3CZFA 1A1MB 1OP3K 5E6IC 2F8OA 1LQSR 1ETZB 2XFXA 4R97B 5F7KC 4XVJH 4NRXA 3RX7A 1WCQA 3ZHKA 4J3TA 3BJ91 3SGEH 3QG6A 5BWBA 5TE7H 4HX1A 1CF8L 1JWSA 1GJIA 5C0BA 5E95B 1LD9B 1QIJA 1RUPL 5D7IB 4DZBA 3ELAT 1DUYB 2OJEA 3GBNH 3WL5A 1N6VA 4DJMA 3STLA 1L6ZA 3DX7A 5JZ9A 3BPNB 4B80A 1J8HE 1TZGL 3CDGA 2OL3H 5I2IA 1CVSC 2VDRH 4RGMB 4JDZA 4KK9C 1RJZB 2HFEB 3CD4A 4XPAH 2NTSP 4WWID 4WCYH 4BZZA 4K3DL 5KVGH 2FATH 5IVXB 1PV1A 5GJSL 1XQXA 3KPRE 3MJ9L 1WGOA 2EO1A 4JJHA 4LRIA 5LVEA 4FQPA 2ZJSH 1MRCL 4MQ7B 1KGCE 5A1AA 3CLFH 5CAYB 2H3NA 4NOBA 5D4QA 4JREB 3M83A 1NCTA 3VJLA 5MENE 3TIEB 3CSBA 3CSYA 4XRCB 4PG9B 1XGRA 3V5HA 1P0PA 2A77H 5C8JA 3ZKXC 4HPOH 3W2DL 3TFKD 4Y1AD 1KJVB 2DD8H 5ALBH 1BJ1J 1MJUH 4U1IA 1FL5A 4AG4H 3WWCA 5T1DL 2YD6A 4OLUH 5FYJH 1EK1A 1JZ7A 1RZ7H 3SX4A 1CT8A 3MGAA 2APTA 2HHAA 4JPVL 4L9LC 1A6ZB 2EDKA 3IFNH 3BEVB 2XN9D 3G02A 3FWHA 3V52L 3FCXA 3OF6D 1BFTA 3QUXB 1S7QB 3O0RL 3M8OL 4MX7A 5ALWA 3KXPA 5GRJL 2P8LB 3UPCA 1BEYL 4M93C 1KN2L 3DYMA 5DHYB 1R3KB 2NLJB 1DQJB 2X9WA 5CH3A 1CFQA 1XR8A 4H7KA 5C8XA 3ZLQC 4RMVA 3NPZB 5BZWB 3RVVD 1BQHG 1F02I 4Z8FH 3HRPA 3UEZA 1Z6JT 1NKRA 4OUUA 1TTFA 1FJ1A 2A74B 4IH4A 4NQVA 2Q8BL 2FX7H 2DQFB 4FTVB 3ZT6A 5SWZE 4S1DC 3C08H 5LZ8A 5AM2A 4MNGB 2FWOA 3IJSA 4PJ5E 3VGDA 1WFUA 3SE8H 5DT1H 1NBYB 4Q3KA 4X90A 5IVDA 4NIKB 4OZIA 3NCYP 5D8JL 4KRPD 2DTML 4YHZH 5D1XC 3S96A 5BW7A 4LVOB 4P5TB 2BCEA 3NZ8A 5B8CB 2VJDA 3DS8A 4KEAA 1CE6B 2DQDH 3DYPA 5KN5B 4KTYA 1HHGB 1PY4A 4OLVH 3GB7A 4Y16C 1CFJA 2AK1L 1FZKA 3C5ZD 4M5ZL 4UBDD 1QSZA 3EDJA 5KAQF 3MSPA 2WBJB 5HYQA 4L4TD 3WO4B 2BOCA 3IFPA 2X9YA 3GSQA 4L8SA 3K0WA 3UTSE 4QHUB 3SGDI 3F5WB 3ZZ1A 1WF5A 5C3LD 4JN2A 4GW5A 4PP1C 5ILTH 5L2KD 5HGBA 3BJLA 3WJ2A 1QVOA 3WMSA 5ALKA 3VRLF 4P46D 1ZGLA 1HHHA 1UH4A 2OM5A 1J12A 1MNQA 2XXCB 1X5IA 4MA7L 4UV4H 3BMVA 4JFDB 2FX9L 3L3DB 3MUJA 3N50A 1U8JA 3P2TA 1BGXL 4ETQA 5A2JH 1EDDA 4W1RA 1XQYA 2PW1A 1WSST 3I02A 3PGDA 4N0RA 3MLXL 4RFEB 4ONOA 4XXDA 1TKRA 3ARVA 4QRRA 5EO1B 3O6ML 5GS2D 4JM2D 1EHYA 2OR7A 5GISH 3DVNB 2DQIH 1XLWA 5TE7L 3P77A 3QNXA 1GIGH 1BX2A 2V9TA 4WI3A 4R4BA 1IAKB 4JO4L 1QACA 4UINL 3L3KB 3MR9A 1I85C 1OAYH 1ZT7A 3MGTB 2D4DA 2IPKB 1D07A 1TFHA 2CMRH 1GL4B 4LPYA 4X8JB 1FFNB 5C6WH 5EU6D 3AGVA 4JB9H 5KSAD 3GSVA 5KW9H 5CHNB 1MPXA 4XPAL 2J88L 1KTDB 1JIBA 3KHQA 4PBVC 4WCYL 3E8UH 2NYYD 1II4E 5LKRA 5BV7H 1S9YA 3RWGA 4LSDA 1G7HA 4P2RD 2V5RA 4X4YA 2ZJSL 3H04A 5AYUH 3V95A 2YWYA 4LASL 1ZLVK 4N8VG 2I24N 4RCAA 4XNMA 2BFNA 3DYVA 3QXDB 3J7HA 5E70A 2UYLA 5T3XD 2H32B 4MCYB 1JGVL 3O45A 3EAKA 4YDKH 2A77L 4YK7A 5MEQB 5FOQA 1PSKL 4HAIA 4RX4A 4HPOL 2W9LA 3GIVB 3VH8B 1TZHB 1TVBA 5D7JB 1MY5A 2DD8L 5ALBL 4BSVB 1HSAB 1U8OB 3BIWA 2DQGH 5TGBB 4ODUA 4LHUA 3WIFB 1CIJA 3G5ZB 4AG4L 4Y2DA 2ICCA 4OLUL 5FCUL 4LCYB 1FQ9C 3VFTB 3TEJA 4EY4A 2BSRB 1WFOA 2A2QT 3NCEB 2R2CA 1BBJA 3BVNB 4MDIB 5E8NB 2DBLL 3HZYB 4PP2A 4D0CA 4LAQH 2WQZA 1T04B 4LCWB 4Q2ZB 1GZPB 3N1FC 4A6YH 4LCIH 4Y4KC 5BRZA 4S0SD 4PJDA 3O2DL 1OW0A 4PYHA 5DK0A 2V7HA 1P4BL 5HYEA 4OLWH 4PUBH 3TBYB 5E6ID 3QDMD 3C6BA 5CZVL 1IC7L 1LPMA 2YUZA 3I2HA 5ALOA 4XI5C 4FG6C 1U8LA 5DMGD 3SDXF 1QPPA 4BQ9A 3MV8B 3UMTA 4MQXD 1JYNA 4BCBA 2Y6SC 5DD6A 3OR6B 2FX7L 4XP4L 4KJYA 3VDAA 2ORBL 3CFBB 4UFOA 2Y5TA 3SE8L 4RE6A 2A38A 2EDWA 5I1CL 1MRFL 2R2HB 3IGAA 1I4FA 5LZ7A 4JDTH 4KK9D 1IM3A 1NFDF 5CJ5A 1QRNB 4OLVL 5HDLA 3MXWL 4G8FA 1QSFE 3ZLVA 1AQDA 4TVSa 1FFOB 4HXBH 3CFDA 1OTSD 1NEUA 4UBMA 1VOTA 4I3FA 5F96H 4GRLB 4BZ1H 3U83A 3S4SB 4AIZA 1QTRA 5E99H 2HT2D 1EB9A 3K6KA 4QWWD 4CNIB 1SY6L 5GXBB 2YXPX 1ZVSB 3TNNB 2OCGA 3EO1B 5C71A 2DHCA 5IEHA 1NC4A 4HGMA 4I0PC 2HU8A 1V7NH 3QPQC 4RMSA 2BVQA 2EECA 2DN7A 4PGZA 2YPLB 5CT8A 1F11B 2ICEB 3NUZA 4C56A 1G9NC 3WUWB 1U3ZA 2HT4D 1XZBA 4MB5A 1CPYA 5A6VA 2EKSA 1NLBL 2AKRA 1XROA 1KIQA 4K6GA 5HF9A 4JZNA 3PWJB 3A0OA 4JZJB 3PE6A 3WL9B 2DS4A 4X99A 4PGEA 5DZNA 1FL6A 2NCMA 3MXVH 5GS0D 5J56B 3VRIB 5F89A 5GISL 4ZOCA 4V1DE 5T1LA 2DQIL 3IDJB 3MRMA 5D71L 1WCYA 3AC0A 4EN3A 5DDHA 2KZWA 4PJIB 3SOBL 1FFPA 1YN7B 5FKPB 2FIKB 4L8DA 3JW8A 4KACA 1B2WL 1F97A 1U3JA 3OURA 2OLEA 1F4YH 3QEUB 4X6CA 1WITA 1JT2A 5D1ZC 1OAYL 1RU9L 2MMXA 3G5VB 4FZ8H 1OY3B 4X9BA 4CG2A 4M4RA 3IDAA 1DVFB 2Q1EA 3RZCB 2OCFD 2E7LA 1MLBB 1EDBA 1IAIH 5HHMD 3D59A 2XG4A 1ETZA 2FR4B 3E8UL 1TCRB 3H2WA 4XH2B 4IIQC 4PGCB 4DAGH 3BD4A 1OGAB 3RWHB 4S1DD 2VR9A 2BP3A 4PJBE 2AVGA 4KTDH 5D7IA 3Q1SL 1CXLA 1DUYA 1NMAL 3VXMB 1CFBA 4HKJB 4PREB 3PWNB 2AS5M 1XH3B 3X13B 2HRRA 4U0QB 1GGCL 3ZYOA 3CDYA 4JANA 3BUYB 4X6DF 1ZD3A 5T1KD 3FFCE 2HFEA 1H5BB 4HZAA 3ZT7A 3E2HB 4OTXH 4P4KD 2YK1L 5HHVH 2Z8SA 4PJ8A 2FJGA 3LEYH 3GSRB 4JVUA 4ZTPL 1WBYB 2DQGL 3S8YA 5E08H 3HUJF 4MQ7A 4UTBH 4HH8A 1GCFA 1A7RL 1IQWH 3UTQB 3SJVE 1XGTB 4KRNA 4Q97A 4JVPA 3S9DB 3AZPA 1WQVT 3I6KA 5CD3B 3NIFF 3DURB 3TIEA 4Y4FC 5FGSA 5JHLH 5KVMC 3HE7C 2FD6H 4Q34A 4TOYL 5IB4A 4NHCH 4XCCH 1KJVA 4YHKH 3MV7E 5DUML 2OMBA 5F9OL 4PUBL 1CTOA 4PSUA 2IH1B 1D6VH 2O7VA 3VJ6B 3LMJH 2ZUWA 3TA3C 3R0NA 2AEPL 1CDGA 4XNZB 5JORB 4Z7VE 1D9KC 2DQTL 4ODSH 5C08E 4N5EC 2EDQA 5AKGA 3O41B 3MLZL 1A6ZA 43CAB 1TAHA 5JADA 2Q3AA 1QFUH 4OLEA 4JQVC 1S7QA 5K3FA 1WZ1H 5C2UB 4Z49A 4KROB 2JCCE 3EUUA 1WUNT 5ALGA 5FPQA 2Y23A 4YH6A 2P8LA 5DHYA 2NLJA 3FRUB 2EDBA 1BFSA 1DQJA 4NBZB 3QI9B 4MJIB 1LGYA 3D69A 3MYZA 1NGWB 3W0WD 3JWOH 2PXYC 5BZWA 4J7RA 3CC5A 1S5HA 4I18B 4K9EL 1U8PB 3FFDB 1EA5A 2EKJA 3FOLB 2CPCA 1XF2A 3P0VL 2DQFA 4DNFA 3OPZH 4FTVA 4ZUSB 4UT9L 1WT5C 3QXTA 3AIKA 3BEWB 3ULVE 2NY6B 1NBYA 4HGWA 5EU7C 4UTAH 1WAAF 3HFMH 5HFNA 1G9MH 3HTLX 5D9SB 4TUKH 1UFOA 5CKAA 2GY7B 2NY0C 4P5TA 5B8CA 1E5TA 4V1DD 3LPFA 3UPRB 1IVYA 5KN5A 5SWSB 1HHGA 4PRHE 4J3VA 5D70L 5AG8A 2ZCLL 4RFOH 3W5MA 4HVTA 1VJ5A 2XPGB 2VLRE 5J4MA 4XGZB 4PJ9B 3ZKQD 2PTTB 3VMNA 2WBJA 1PJAA 5DR5L 2ORYA 4BCCA 1LEIB 3TVMB 2NXYB 1UVQA 5I1AB 2OL3B 5C0CD 2FJPA 3F5WA 4M03A 3E3AA 4UMGA 3SKJH 4YXLH 3BXPA 2X7LB 2XA3A 5JLZA 3B3QA 3QJFA 4LVHC 3V5KB 1TXKA 1HWHB 1ITCA 1IGFH 1YC8A 4EUPH 2CH8A 2HFKA 1F4YL 5LG1A 1NUFA 3S3SA 4FZ8L 5JXAL 3P73B 4OZ4B 3ZL4L 3KSRA 3HNSL 2E27L 5AO9A 1IAIL 2UWEE 4Y0GA 4I4WB 5KTEL 5EO1A 2PU7A 4EI5A 4HWEH 4KKAC 3DVNA 4X7BA 4RMUA 1M7IB 5JQ6L 3ALXA 3GI9H 1J9CT 1NL0H 3KLAB 4FFVA 3RWEB 1B6UA 3O3EB 1IAKA 1F4XH 1S7SA 5EZOH 4H25A 2IPKA 2NY5H 3TBSA 1XF5A 4X8JA 4NN7B 5DQDH 2DLHA 4HXAH 5CHNA 2BNRB 2H1PH 5JAHA 3WKMH 2DR0A 3AS1A 4OTXL 1KTDA 1K4DB 2XB6A 5GJTL 2XTJD 4HUWB 3VXUB 4MA8H 5FGBA 4AO6A 3HNTH 4KRYA 3VXKA 1VCAA 3NGBC 1MEXH 4DWHA 2D3VA 1P0MA 4UHDA 3S98A 4ZFZB 4XTRC 2YKLL 3P2MA 5LCVL 2I60L 3EYSL 4LSUH 4KUCF 2JGFA 4I0PD 4ZSOE 3O4LD 3QPQD 3QXDA 4RA3A 3T0XA 2CGRH 5HGGS 2H32A 4MCYA 5HGHB 5DK2B 4HS6A 1A7NH 4C57C 2FCBA 3X17A 3WJLA 5I15L 5IT2H 4WFKA 1IAOB 1FGNH 5JDSA 5GGVH 3GIVA 4XCCL 4BSVA 3QDJD 4IHAA 3TV3H 3U9UB 2APBA 1S7VA 1D6VL 5EU7E 5GZND 1SFRA 4GRWF 2RBLA 5K59F 2XUQA 3VFTA 3SDAD 4LCYA 1ACYH 1ONQB 1DCLA 1MVUB 2BSRA 4KGLA 3BVNA 3HZYA 3BP5B 3W82A 1HKHA 4LCWA 4M5YH 4XWGA 1IGIL 3MOQA 5I1HH 1YEFH 2H8PB 2Y06L 4Q2ZA 2F54A 1UEYA 1GZPA 1Z9LA 3HA0A 5AIAA 3ZI7A 4NJ9L 3TYFB 1T83A 4HWZB 4K8RC 4ZV7A 1RUQH 3WNOA 5JQHC 3TBYA 3MV9D 4NZJA 1CUDA 4JRXE 5EFZA 3EGSB 5CGYC 1CWVA 1KV3A 3MV8A 3WFBH 3B9KC 2G60L 3OR6A 5IIEB 4FXLA 5HYJE 4RPCA 3OPZL 4JFEE 4OGXH 1A9BB 4L1HA 4QGYA 4C58B 2X1PA 3PWLB 5HGAB 1FNLA 4UTAL 2HFGL 5BS0B 3HFML 1T7VA 2QVBA 2VTVA 1NC2D 3TN0D 3MPCA 1MI5A 1IMHC 4HK0B 1EV2E 1G0DA 1QRNA 1LP9E 4LLUB 4H88L 3S35X 3WWOA 1JV5B 4KVNH 4AQOA 5AAMA 2V7NB 2X42A 1WWCA 3LKQB 4PBWD 5DJDA 4EBQL 3STYA 3R3YA 3S4SA 4WEUD 4Y5YA 5C8VA 2BDNL 3IS0X 3L5XH 2IITA 2CJPA 3IB3A 3WIHL 5F6HI 4KHXL 4OD3L 2HJLB 2XZQH 4KDVA 1ES0B 1NANI 3T04D 1SEQL 3TNNA 2KBGA 2R69H 3EO1A 3SKJL 2DM7A 3EDFA 1X70A 3BISA 6CGTA 5BV7B 5FKAB 4LDEB 2I9TB 2A6JA 4Y4FD 1BZ7B 1I1AB 2ICEA 3WUWA 3B3IB 3KPLB 2WFLB 1BZ9B 3BZFB 4XC3L 1JFQL 3PWJA 5IKXA 2IAND 3JTTB 4ISVB 4JZJA 5KANG 3WL9A 1LPSA 5LGHH 1H2ZA 3TA3D 3BP6B 4H20L 3NFNB 3UO1L 4NQCD 5FV4A 1D9KD 4EY6A 4MZ2A 4DOHB 1V7ML 1HKFA 3JWNC 2CZQA 3IDJA 3F7PC 4DFHA 5DVOA 4PJIA 5M94B 1YN7A 1ZJ4A 5FKPA 4HFUH 5D7LB 3UAJC 2Z4QB 5LLSA 4R4NC 1AKNA 3SDXB 4G9DB 1F4XL 3WK8A 2YUXA 5GGRA 1T1WA 5ERWB 5IW1B 5ALDA 1FAIH 3G5VA 5F70A 3T08A 5ACMA 1DVFA 3RZCA 5KREA 1H8NA 2EDDA 5DQDL 1Q9OB 4HXAL 2F53A 1X2BA 2H1PL 2PXYD 4PRDB 2GSIA 3MJ8B 2CRZA 1TDQA 2FR4A 4B7IA 1TCRA 4M7LH 4XH2A 3QEQB 1RZJC 1RWQA 2YZ1A 2X05A 4EZMA 1GQSA 4XHJC 4PGCA 2Z31C 4A6YB 1OGAA 4PRBB 1NFDB 3QFJA 4YBLC 4QXUH 3MRIB 5E4YA 4Q74A 3K4ZA 4OUOA 3O4IA 3VXMA 2VA9A 3NA9L 1UJTA 4HKJA 1IZ7A 1RUAH 3PWNA 1XH3A 3X13A 5F7LB 1MAHA 3IURA 4UQ3B 4NYLB 1YJDC 3BYTA 1YEJL 2K3TA 3BUYA 4JNCA 1H5BA 2BVOA 2PTVA 1JI2A 1A7NL 4FQQA 3VFUA 1INEL 4OD1H 5ALCH 3K2UH 4HD9A 1U4NA 3STXA 2ZNXA 3GSRA 5C0DB 3F96A 1U8EA 3VWJA 4PJ7E 4EIZC 4NZTL 5IGXL 3PHOB 1WBYA 1NCBH 1A6PA 1AGFB 1OSPL 4DMCA 3C6LA 2J4FA 2NY1B 4GUPB 3UTQA 1XGTA 2EIEA 2ID5A 5ETUB 3P0YH 1XRPA 4PY7A 2ADFH 4OM1H 5CD3A 3DURA 5T4FA 1QR4A 5HKBA 3WNNA 5I1HL 1KFAH 2VXSH 5EUKB 4ZXBB 4RNRB 3CN7A 9CGTA 4IJ3C 5F21B 4PS4H 5BMFH 3L3GB 2Z5GA 4ZOEA 1TMCB 4BAGA 3JWDH 5TF0A 4X4XB 4LOUC 2IH1A 3WYDA 3C70A 2K9UA 4KTEH 5E9DE 4K3GA 5ITFA 4HQQL 2D7MA 4WWKC 3A6CH 3DETC 4S1SH 4XNYL 2FB4H 1NFIA 4KKAD 1JGLH 3O41A 1LO4H 3T65B 2VISB 4OI8A 4JVWA 3QUXD 4KE8A 3GM0A 1GYAA 1FZJA 1MJJB 1L0QA 4OGXL 3RPIB 4NHUB 2AJVL 3MO1B 1ZT4B 2APVA 5F3BB 1JPTL 4LSTH 4AENB 3V1MA 3SDCB 1MFDH 4BTLA 4MZ3A 2H9GB 2R29H 3VD9A 1CQZA 4XVCA 3ULSB 1HIMH 3G5YB 1QZ1A 3VD5A 1NGWA 2O5YL 4N90D 1I75A 4W6WB 3PP4H 4L4JA 4M6MH 3R40A 1U8PA 4MEAA 4FTVD 5I74B 4LF3B 5HY9B 3FOLA 4X6DB 5K3EA 1AC0A 2DMBA 4YDIH 5K9KB 1QLFB 2JEZA 4ZUSA 1CICB 2OSLA 1N26A 5L88H 3BEWA 4XPTH 4H7EA 4XTRD 1UB6B 1OAUL 4ZO9A 1A7OH 2P5WB 2XACC 1QOZA 1MAKA 4G9FE 4OGZA 3O4OB 4NO0B 5D9SA 1AGEB 2CK2A 3MA9L 3RDTB 5AKIA 1TPXC 3UPRA 5ALRA 3HUJB 4OZGF 5SWSA 2D7PA 3DD5A 2EYRB 3A6OA 2G5BB 3SKMA 4OCRH 1ZMYA 3CAFA 1P4IL 4X6EB 5KVFH 1NDMB 3AFIA 4ZPVA 5C09E 2OZ4H 2XUPA 4XGZA 2YD9A 4PJ9A 2PTTA 1BD2B 3GMPA 4NNPL 5J12C 1LEIA 4Z7OE 1O6FA 2Y6VA 3BDVA 3E0XA 3S35L 3TVMA 3UROR 2X70B 3CH8A 1Q83A 3ARGA 3MNWB 5I1AA 2OL3A 3WK5A 3ESAA 2D31B 2KPNA 2C5DC 3OBAA 1MCFA 4HUUB 5C6PB 5DTIA 5AOCA 4LNVA 3WJJA 2DAVA 2P8PA 3G0GA 3O6FC 1IMJA 1KOAA 1SHMA 3GSXB 2XMRA 2MKLC 3V5KA 4N0YL 1Y37A 3O2WH 1QA9B 4JFDD 4C4KO 5C0EB 4F58L 1FAIL 4Y7MA 3GBLA 3P73A 4OZ4A 3BZEA 3MRRA 2V97A 1ZHLB 1HCFX 1MELA 4ZO6A 1OAXH 4EEEA 5JW4M 3CPLB 4I4WA 5CGYD 1FVCB 3RGVC 4JHAL 3QQ4A 4M7LL 3UTPE 2JGLA 3CZJA 1N6UA 5DWUH 2P8SA 1CGUA 2P1YA 2X8BA 4YUEH 2EC9U 1JI1A 1G84A 5A2KH 3DEAA 5B39G 3RWIB 3R1GH 3T0EB 1KLGB 3RWEA 1CE1H 5A2IH 3VRJA 5CILH 1TNNA 1BFOB 5F4ZA 1JGUH 3VGBA 4QDUA 4HC1H 4ESKA 3KYMB 4GQ9L 4JRWA 1UXWB 2GJ6E 1WISA 2D0HA 2IEPA 1T7YA 2BNRA 1JNLL 4HKBA 1QONA 1K4DA 2VE6A 3BKCL 4CCYA 2X44D 3T2QA 1OARH 2BK8A 4K94H 4PJHE 4OD1L 4U1MB 3K2UL 1BRTA 1UB5A 3GSUA 4EUSA 4JFZH 3V1NA 5D96C 1A6VH 4ZFZA 1YEDA 4QXTB 4GLRI 3V7MA 3MJ7B 2AEWA 4GW4A 4N8CH 1A22B 5CJBA 5K33A 4N0UB 3ET9F 3PQYB 1HI6B 1RK0B 2ADFL 2J5LB 3T4AB 5DK2A 4BA8A 4LP4A 5DRWA 2VXSL 3KJ6L 5CEYB 3VXRD 1DDHB 1P5UA 4D9RD 5F6IB 1UOQA 5D7JD 1CIUA 3RL1B 4EI6B 3KXFE 1VEPA 1N6QL 1MAJA 1LPPA 3JWDL 3IJYB 3U9UA 2EXWD 4RMQA 2VL4A 2VNCA 4JFYB 4F57H 4KTEL 1XLUA 3HI5H 3A6CL 1U9KA 1ONQA 4JO3H 4S1SL 1BZQK 1MVUA 1CDJA 1QO3B 4UV7L 4QRUB 4Z18A 1A7BA 2FB4L 3EFDL 1H23A 4XJVA 2AK4E 3KS0J 4MJ6B 1T5WA 3OXSA 4E41E 4IH9A 2QQKH 2J1KA 3O8XB 1WM1A 3UAJD 2H8PA 1U6AH 1EIBA 2R0KH 4X92A 3BKJL 1OXMA 5EZLB 4M7ZB 4L9AA 1TVDA 5AHXA 1ZEAH 2GSGB 2B39A 2RIKA 4F7PB 3TNMA 3RVTD 3S5LG 3UC0L 1MFDL 2FJFB 2R29L 4WNQB 3S36H 5C07A 5IB2B 1PEWA 1OD9A 4LKCB 4RGOL 5LKNA 2FIRT 2D5LA 4IRZL 1EEZB 1MFEL 2ICWI 3EGSA 4TQEL 1DJSA 2WIIB 1F4WH 1IT9H 3QUYA 1CK0H 5HXMA 2Z31D 5JOPD 4EUPB 1P6AB 5HHOD 5IIEA 1GKLA 5K9OB 3GBML 4YPVA 2V5TA 3VFNB 3QQ9D 3ZYIA 4XPTL 5HGAA 3K4DA 4PRPD 2P44B 3HS0B 3BN3B 4GKNB 5I9QC 2JB6B 2R4SH 3GMOB 1YSCA 4Q05A 4HK0A 5T4HA 4LLUA 3SGKA 2O93L 4WUKL 4OCRL 1QFSA 1AGYA 4GRLD 3BJMA 4P08A 4JZOB 3IFLL 5E94B 5FKJA 4Q6IC 3NCYS 4WFEE 4ZD3L 1LO2H 4YHNA 5E8DH 3L6FB 1BE0A 3N0TA 5FO9A 3MLRH 2R0LL 4F60A 2J6EH 2HJLA 2XZCH 4M9OA 3QIBC 3DLTA 1ES0A 3V4VH 4YQXL 3T4UA 3AXLB 4KRLB 3NH7H 3MFGB 5LZ9A 3K9BA 5EBMB 3PXHA 2YPLD 4ODVH 5CT5A 1A4KB 2HAZA 4LLVB 2D7TH 5BV7A 4GRWB 1YY8B 3FO1A 5FKAA 2I9TA 5F7HA 1VACB 1BZ7A 5IVZB 3RY4A 4U49A 1H3PH 2IALA 1J1PH 3L5HA 3KPLA 2WFLA 3NPSC 3BZFA 3U0WH 1WBXA 1QKZL 3JTTA 4PJAE 4ODXB 1EX0A 1JF6A 3SPVB 3TRDA 1XGUB 1JWUB 2Z3WA 5DC0A 2DWDB 3BP6A 3DETD 3NFNA 1OAXL 1I9JH 2X5PA 3N1MC 3ARDA 3BWXA 3NACL 1OGTA 3RTQC 1G1YA 1XRLA 5GHWL 3SE9H 3R1GL 1L9MA 5D7LA 1F90H 2EDNA 2OXHA 3QUZB 1CE1L 2GUOA 4MD4A 3SDXA 5CILL 1E4KA 1NAKL 2WM2A 1A7PL 5ERWA 5IW1A 1NMBL 5L8KB 2W60B 2CR6A 2C0QA 1C5BH 1QLEH 4RNCA 1Q9OA 3UJJH 3PUIA 3STWA 2GCYB 1THGA 4PRDA 4PQEA 3MJ8A 3WV0A 4LCCB 3KPNB 3ULUC 4MS8C 1CR9H 4WU7B 5CBKA 4A6YA 1NFDA 2ESVE 3MRIA 2QXUA 3EYOB 4HDIB 3LEXA 4PRID 4JFZL 5HHNA 3VXSB 4JLRA 1ACJA 1A6VL 1IEAB 1VHPA 2Z91B 2X9XA 4BTVA 3QEHB 3KLDA 4UQ3A 4NYLA 4M02A 4YBQC 5ESAB 1T89C 4YLQT 5CRIA 2AK4D 1U58B 2QM0A 1OCWL 2MQCA 2VSCA 4FMFA 3C8DA 5A2FA 5JANA 1YZZA 2VOTA 5JMOC 5FGRA 1MCEA 4WTZA 4BK5A 2AV7A 1IGYB 4B41A 3D18B 3PHOA 4NC2B 3F7RA 2QKIB 2H2SD 1B6DA 5GSVB 5JOFB 1AGFA 1A6UH 8FABB 4H7IA 2UVFA 3OXRA 3IKCB 1NQBA 1YQVH 4GUPA 4Q9CA 5AM3A 1D5IL 4X95A 3PGFH 4PRNB 4TULH 5ETUA 2VITB 5FDYA 5J9PB 4QXGH 1WZMA 2EE6A 4YHLH 1RD6A 5E4TA 3O6FD 4RGNC 3PGCB 4GHWA 4QLOA 5ESQA 5EUKA 4ZXBA 3A2LA 1U6AL 4HIJB 2R0KL 2I3ZA 5IMKB 4FQXC 4RAUB 3DV4B 4BBZA 1JZ4A 3Q6FB 4Q9QH 1H3VA 1CGWA 3L5JA 1ZEAL 1X5ZA 3FOMB 5H2BA 2L4OA 3T2PA 1EDQA 2DL2A 2E7HA 4X4XA 1M6OA 4G6JL 4QTHA 3DIFA 5T1MB 5MP6L 4YBHA 3IDNB 3TO4C 3EKCA 3RGVD 2H2PD 5H8DA 2DYPA 3RUGE 3MCKB 3L3HB 1CK0L 2VISA 3JXAA 3DVFA 3ANTA 1MJJA 4KROD 2XWTA 2ADGB 2X4RA 3DNKA 2ES4A 1N2RA 2Y07L 5JOEA 1GC1H 1ZT4A 3PWUB 3K2IA 4YO0B 4AENA 4Z76B 4UUJB 3SDCA 5J6GB 3PF2A 3QI9D 4MJID 2EDHA 2R4SL 3ULSA 2YRZA 2QQNH 4LEOA 5FV1L 3QDGE 4LF3A 5HY9A 2FGWH 5K9KA 5C7YA 5DTFB 1QLFA 1KCRH 3MRDB 2DHEA 2XUDA 4NQDE 4TVPE 2NY6D 4M1CD 4H35A 3RVWC 5DFTA 2X4PB 1VLQA 1OPGH 1UB6A 2J6EL 1F8TL 2P5WA 4NO0A 1AGEA 5ISZB 3ZDYF 4F8QA 5KS9E 4XWOD 3RJQB 2X89D 4NKDB 3HUJA 3U30C 3ULUE 2VDNH 3PG2A 1IAIM 1J1PL 3AAZB 4GS7B 4OF0A 2AXFB 3H9SD 3VFRB 2M1KA 1BD2A 2YR3A 2OQVA 1D5BA 4X5LA 1J11A 2X70A 5I1EH 4FWBA 4GKOA 5JNYB 5HVWA 4RIRB 5IESH 3BL8A 4LNRA 3RM3A 4ZS7H 1R3JB 4HUUA 4Y19D 1N4XH 4WUUA 4IOIA 3BH9A 1CD1B 3Q2CA 1CFTA 2RFXB 4F33B 4RSVA 1XZHA 2YPVL 3C60A 1MREL 1EXWA 3QBTB 4FQ1L 5A16A 4LLMA 3VJKA 4KVCL 1XZFA 3EDKA 1QA9A 3LRSB 4C4ZA 4UT6H 4F15C 3N1QC 4OLYL 2BUBA 5DF0A 3M17B 1QBLL 1QLEL 1ZHLA 1AQKH 1I8MB 3WZMA 2ZOLB 3CPLA 5F9WC 3GHBH 1K5PA 5FCSH 2AJDA 4Y2UA 3KAAA 5DUPL 3KLHC 5HGDA 4ZRDA 1IAMA 4RGNE 1BQHB 1JK8B 3MQIA 1MCWM 5F72S 4Y5XB 5C0BE 3HSSA 1IARB 3RWIA 3T0EA 4L3ED 4LU5H 2F8VA 1KLGA 5KSBF 1J10A 4L8SC 1HSBA 5A7FA 5FYLE 3FQXB 3GNML 3B5GA 1K8DB 3ZSSA 5D6CB 3H3PH 4BYMA 1T6VN 4LLQB 1UXWA 4UQ2B 1REIA 4OB6A 3VXUD 4R7NB 2LTQC 1WAAA 4JQIH 3QWRD 3STBA 4KV5E 3I3BA 3D6GA 5LYYA 4U1MA 3D2UD 1T20B 3JUZA 1EVQA 2FL5A 4OZGB 4S0XA 4CBPA 4PW0A 2G4LA 4QXTA 1A6UL 4X5XA 2X4NB 2PTUA 3ARYA 5E5MB 4NN5B 1SM3H 1LO0H 3P11L 2F58H 3BAEL 3UPAA 4N0UA 3OB0H 4JG0H 1ZICA 1HI6A 4WV1C 1RK0A 2G75B 3NAAL 1R50A 4J4PC 2C9AA 3OAUH 4FQ2L 5CEYA 5FB8B 5IWLC 3V7AE 2VDKL 4Q9QL 2BJHA 4BRSA 5H37G 5K9QG 2X6MA 3RL1A 1ACZA 5IVOA 2IJ0C 3IJYA 3ZDXE 2XMDA 1TZIB 1YEGH 1DQMH 4WDIB 2LABA 4G6KL 3FNBA 4GXUN 1QO3A 4DQOL 1G5FA 1Y6MR 1PJ9A 2CSPA 1K8IA 1CUSA 3VD4A 2AI0L 4Y7DA 3BDYL 4BB0A 2YA0A 5C92A 4ZPTB 2MQ3A 1BVLB 4NOFA 4YX2H 1BIIA 5CSZB 1GC1L 1JJFA 1HINL 4UT7H 3PUHA 2GSGA 2FBJL 1XZAA 4F7PA 4M1DH 1EK2A 4ZS6C 5SYNA 3L1HA 2XV6B 3EJYD 3QO1B 3OZ9H 2RB8A 4FHBD 1THTA 4LKCA 5GS3A 4KGJA 1UA6L 1EEZA 1KPVB 2QQNL 2XYCA 4P48A 2OK0L 4KXZH 4H0CA 5F1SA 2BERA 3RAJH 2YBRA 4O5LH 4EUPA 1KCRL 5K9OA 4X7SL 4I3GA 5MEPB 3VFNA 5BS0D 1S9VB 4R2GB 5EHNA 4OZIE 2IFFH 1TJIH 3HS0A 4N8VB 2XQJA 3REVB 3WHE0 3SDYL 5L7XL 4S1RL 2JB6A 4I0CC 1KCUH 4NC1C 4FLFA 1HPLA 4AZ0A 1YYLH 3OB0K 4JZOA 5DYOB 3IDXH 2DKUA 2XRAH 4X7EC 5J89A 1ZOXA 1R0AH 1R4ZA 1FG9C 4XPFH 1QYGL 3GBSA 2NXZD 2E7MA 5DEGB 5EBGA 4I3SH 3WJ1A 1MRDH 2VO5A 1FAKT 5IESL 4EY7A 4JHWH 4ZS7L 3OKNB 5C0ND 2W9DH 4WENB 5ALMA 2HH0H 5I6XB 2VSQA 2A6KB 1QIEA 1I1AD 2HJFB 1A4KA 3LKSA 2HLFC 5TE6H 4DCQB 4Z7WF 1VXOA 3WL6A 1RZKH 4C87A 1YY8A 3STZB 1VACA 3OAYH 2AERT 3RPKA 1MCQA 4JGJA 1U36A 2CJUH 4FQXD 4KYVA 2HA2A 4UT6L 1A7QL 2I5YL 1HZHH 3WYNA 1T22B 3SPVA 4BQCA 2VXVH 1JWUA 1NCDH 2DWDA 3TO4D 3C6SB 4D9QE 1KBGH 4I77H 3WDHA 5J11B 4QRRE 1M71B 3Q0TA 1LPAB 1RIHH 4MWSA 4B0OA 1KU0A 2QKYA 1T7ZA 3O0DA 1K2DB 5I1GH 4OF6A 4BFGA 3V1KA 3WK4A 4D94A 5ALTA 3VW3L 2ZUXA 3MA7B 3QUZA 5I1LB 3D4LA 1JMYA 1MF2L 2ZYRA 4GBXB 5I8EB 3CSPA 2W60A 4DNOA 4BAUA 5I1IH 4WW2F 3HC0B 3H3PL 1BWWA 2Q7NA 4DUXA 2RONA 3QEQD 2GCYA 3FO9B 4JQIL 4LCCA 4EQ2A 2BSSB 3TJEH 3GHEL 4WU7A 1KEGL 1EFQA 1FLRL 4NCDA 1AR1C 4F7CB 2DMKA 3EYOA 4HDIA 3O6LL 1JNHA 3CH1B 2EZ0C 3MBXH 1IEAA 5IHZB 3T3PE 1N5YL 2Z91A 3B2VH 3BD5A 4GQPH 4M62H 1CUFA 2VAVA 1SM3L 1U3HB 3BN9D 5ESAA 1U58A 4P0DA 4EN3C 3TWCL 3A67H 5EO9A 4GMSL 1DWPA 3GI8L 1BN6A 2DQZA 3D18A 5MI0B 3OAYK 1A2YB 1YS2X 4CVZB 4R4FH 1YEGL 5GSVA 1DQML 3HXKA 4M7KH 4X97A 8FABA 4F7EB 3MOAH 3K46A 3UP1A 3IKCA 1F3JA 4PRNA 2VITA 5CGMA 4X6UA 4AJ0A 4QTIH 3GK8H 3PGCA 5DD3H 3AFLA 1XF4B 43C9B 1TIUA 1LO3H 1FFAA 3R0MA 5IMKA 1QEWB 1DINA 4RFNC 4RAUA 5BRZE 3Q6FA 4PJDE 2IGFH 3AREC 3F62A 4P2OC 3GROA 1YY9D 4YGVB 1E8MA 5IMLB 5T1MA 3OZ9L 2XUJA 2V6HA 5EU5A 4MNHA 2BVYA 1MCOL 1HDEA 4ZDHB 1NPUA 3D3VA 2JF1A 4AEHL 3KLHD 4YAQB 4LDOB 4PJ8C 3VISA 3MCKA 3L3HA 3C9NA 3W9DB 1VPOH 4O5LL 4P9MH 1DX6A 1E28A 4X6YA 3CXDL 5GGSB 5HHXL 3LIPA 5FM8A 2ADGA 1G7QA 4O58L 3RRQA 1CLYH 2CKBL 3ILQC 4ZFOL 1G6RH 3PWUA 4NFCA 2CLVB 1ZA3B 4YO0A 4Z76A 5J6GA 3L3IB 3TT1H 1ZT1B 2CUTA 3LRHA 5DO2C 5KVEH 1X6LA 4AT6B 4ETWA 1T1XB 2IG2H 1VERA 3Q3GB 1FIEA 3EYQC 3IDXL 2XRAL 4L72A 2EXYD 2YD8A 1CICD 2LVCA 5DTFA 4WI2A 4UOW0 1T7WA 1R0AL 3D85D 1L7AA 4XPFL 5EIVA 2J8UF 3CLEH 5AD0B 2XQKA 2X4PA 2JGMA 4MNQB 1JVKA 3NIDE 5GGTH 1A3RH 3RDTD 3RIAF 4JHWL 1R3HB 4U2ZA 4APQA 5EFIA 4X6FA 3PP3H 2WINA 3BSZH 5ISZA 5T3ZE 1VZ2A 1QPXA 1WEJL 4KMTH 2NX5B 4NM4H 4CG1A 4NKDA 4TUOB 5HF8A 1KIRB 1AGDB 3KS0H 1JNNH 4C56E 2OCIA 3AAZA 4KKLD 5CWSA 2ZCHH 4F8TA 5CXUA 4TYUA 4G8DA 1E4WH 4Y8AA 2XMCA 1JRHL 2MPAH 1J1IA 1AIFB 2ERJB 2JELH 2VXVL 2H7YA 4OGAC 2ZCKH 2Z9TA 5DC9B 3WFCH 1GOHA 2YXMA 3T0VA 5KZCB 1FL3B 2QSCH 1GZQB 4IHOB 1TTUA 1KPUA 4CMHB 1MIML 3WSQL 1CD1A 4WEBL 2RFXA 4F33A 4GAJH 5I1GL 1HNFA 3BIXA 3V6OA 4AEFA 4EZIA 1B0GA 4HCRL 4J7AA 2XT0A 1MCWW 5HJ3A 2QR0B 4ETYA 5GS2H 3AUKA 3IDYC 3RIAK 2IPTL 1UM6L 3E4DA 4DK3A 3GSNH 2HRPH 3ESCA 3M17A 4P5TC 3GEWB 3SWWA 3VI4E 1KJ2H 2ZOLA 1KF9B 1IGJA 4OPMA 1RUKH 3TJEL 3ZE1E 1DBMH 2P43B 1BQHA 1JK8A 5EGNA 1FPTL 4Y5VA 4Y5XA 4YWGH 3LHPL 4LP5A 5D7IE 3S6CA 5LJYH 4XAKE 3FRPG 4ZODA 5E00B 3U4BH 1QR1A 3EIOA 4FZEL 1NBZB 1X4ZA 1WBZB 1JPFB 4LCUB 4M62L 5IF0B 3FQXA 3MBEB 2X2YA 2WUCL 5IQ7H 1K8DA 1FZOB 4ZAKC 2HMID 4ZYKB 2DOCA 4UQ2A 2YSSB 3MUZ1 1DBBH 4ZOAA 3VFPA 3HMXH 1EMTH 3A67L 3PP3K 1G7LB 1OL0A 2XWBA 2Z92B 4NFBA 5IUSA 1ZV5A 3AROA 4NM8L 4WHCA 5TE4L 1T20A 4IMLA 5DURD 4Y4HB 1W72L 3F67A 4OZGA 1BS9A 4CN6A 5T3XH 2ZSWB 1NCAH 5IHUH 1JGDB 4I48B 3OGCA 2X4NA 1OM3H 1MPAH 5IG7A 3PQYD 3AM8C 1PKQB 2VLJA 3U6RB 5LIPA 2D0GA 5EU4B 4EI5C 5CEZE 2G75A 1VDGA 3QIUB 1D5XB 4HZGA 4EDXA 1C12B 2BKLA 4AEIH 4ACPA 4FFVC 2GBCA 1U8HB 5FB8A 3DI3B 1LO3L 1F0NA 5AK4A 2VQ6A 4N1HB 4GO6B 4K55A 4WHTB 4XP1H 5EIIA 4OFYA 5C6TL 4WDIA 1CXIA 2RHWA 2QZPA 2PO6B 4GH7B 1MCIA 3CFKB 3DNMA 3FKUS 4X3CA 3MZTA 1AMNA 1UJ3B 4FQIH 2WG2A 5HBBA 5D72H 3UZVB 3O8XD 5EH1A 3SCMB 1VZ3A 4C6HA 2OZ4A 4Z0BL 4KKBC 3D39B 4JR9H 4P9ML 1O0VA 7YASA 5F7EH 1VFBB 4TTDD 4MYWB 2CK0L 3BHBB 4H26B 1J0JA 4ZPTA 1WC7B 3I84A 3DGCR 5CSZA 4QHMB 1A6TB 1G6RL 5GGRY 5M95B 4PJGA 4TN9A 3QO1A 3TT1L 5HPOA 5KSBB 3T09A 4JKWA 5J1AB 4M3KB 1QQDB 5FA4A 3VI3E 5CMLA 4ARBA 1YA4A 2JE8A 3FB8B 2AJ8A 1XZJA 5HHQA 1H0DB 1S7WA 4HUMB 2YH2A 4ENEC 3HZMA 1QIHA 4LYDA 4FFWA 4BC1A 2IBZY 3CLEL 1BVZA 1QSEB 3ZTNL 4WFGE 1S9VA 5GGTL 1LNUB 1AH1A 3S88H 4N8VA 5C1MB 3REVA 2GQHA 3QBJA 1H8SA 4KMTL 3C6XA 4HIXL 4MMZC 4KUCD 3RKDC 1R3LB 2C3VB 3FMGH 1ZIYA 2ZUVA 3DXAB 5DYOA 1AE6L 1FLTX 1T83C 4QRPB 1E4WL 5ITBH 3IU4H 4P5MA 3NA4A 2AJ3B 2MPAL 3MRHB 5JIPA 2BRQA 5DEGA 1CD9B 2J2ZA 4HC1A 5D2NB 3NIGE 3WK9A 3FHAA 3WFCL 3OKNA 2VN7A 4NSKB 2A6KA 3QNYB 4JPKL 2YEZB 2H7CA 4DCQA 4XP6H 5ID0B 3NCFB 5FHAL 1C5DB 1GPOH 1ZWIB 4GAJL 4XVSH 1HEZB 3STZA 2DM4A 5I8KH 2PW2B 5DNUA 3CVHH 4JFFB 3PWPB 5GS0H 1XGPA 1EJOL 2VQUA 4P2OD 1KUMA 3UJTL 2Q86B 1KLUA 4JM4H 4U1KB 1T22A 2WTNA 3GSNL 4OI9A 1QFWI 4JFHE 3C6SA 3CVIL 4X0KA 4HT1H 3BPOB 4HSQA 3VGGA 5LWYH 4J3JA 5TF1H 1M71A 5FGCB 1L0YA 2X5XA 1HLGA 4AY0A 1DBML 5EBWB 4YFDB 1K2DA 2RCSH 4B0MM 1TRHA 2XQGA 3TBVA 4TUJB 4Y5YC 4OCZA 5I1LA 4GBXA 4V2BA 5I8EA 3CX5J 1YEHL 4Y2SA 2GZRA 5DO2D 3QG7L 2XMBA 4UFNA 5KSVA 5D93C 3MLYH 4ZWNA 4HFWB 2VWEC 5CBEA 3FO9A 4UUQA 3QZWB 2BSSA 3GO1H 3O4JA 4P23C 2H41A 1VKHA 2OCKA 3R06B 2PVSA 4UIMB 2Z8RA 5AZ2L 3D2AA 4LIQH 3VXSD 32C2A 4F7CA 1NX9A 1NGPL 3FBWA 3CH1A 4JZJC 1S78D 4KI5C 3QCVH 3WD5L 5IHUL 5IHZA 1EXUB 2VLKD 4NKIL 3H7BA 3I50H 2A9NH 4U1LB 5ELIA 1QNZH 1U3HA 2KDGA 3BESR 3IDGB 4N0FB 4NO3B 2CMFA 4H8WH 4TRPL 3MODH 2P46B 3BDIA 4N0CC 4Z7NF 1SJHB 5KVDH 3BD3A 3QO0B 3EFFB 4OSUH 4Z7WB 4XNUH 4OLZH 4HWBH 5EHXA 1A2YA 5CJXA 5BXFB 4G8BA 1RZIB 2H6PB 5JAOA 2C3WA 2CLZB 5CLTA 3HR6A 4GECA 3LPGA 3QXUA 2P8MA 4FQIL 2VQ1B 2AJYH 1WTGT 2ZOKB 3QA3A 4LCWE 3U7WH 1A4JA 3LKPB 4YK4C 4XPBH 3X12B 1XF4A 43C9A 2F54E 3IBTA 2ONCA 1QEWA 3E0GA 3NABH 4LDLB 4AL8L 2J6EA 1Y6KR 2ATPB 4YGVA 4CADB 2YD3A 4M6AA 5IMLA 4Y2TA 1P7HL 4BDSA 1MCKA 1X4XA 3OL2A 4ZDHA 4ODHH 3WMRA 1CXEA 4WW2B 3SN6N 3MV8E 4YAQA 2O61B 1Z2KA 4U6YA 1Q72H 3MACL 1O7VA 2C4FU 4HF5L 3DUSB 1FBIH 5AM0A 2BXZA 2J8OA 2HRLA 1I3GL 3VWJC 4LSPL 3QWOB 3QUMA 4W4OA 3R3ZA 3C6LC 4NZUL 2ED8A 2CLVA 1ZA3A 2R8SH 1GGUA 2BNQB 3RWCA 2QTBA 1MI5E 4G8GB 3L3IA 4ZAKD 1ZT1A 1CLZL 1QRNE 3BRFA 1IQDB 2ITCB 2VC2H 3FYUB 3FT2B 3FMGL 1T1XA 5I17A 3Q3GA 4P3DB 5KG9B 5EORH 1VADA 3IU4L 3I6MA 3O9WC 1OP9A 3QPAA 3DYOA 5AD0A 1SMAA 5BJTB 3GJFH 2WHPB 2W65B 1FDLL 4L5FH 3UUEA 1HILB 4TSAL 5DJ2B 3HNVL 4TNWF 2NX5A 2VWEE 3K1KC 4XVSL 1IBGH 2YPKA 4ZMAT 1MIEH 5I8KL 4JEIA 2Y36L 1AC6A 3L9RB 3T1FB 4CU8A 5CJ8A 4I9WD 3MCG1 1J1OH 1ZA6B 4KI5E 1MCLA 3C5JB 1J8KA 4R96B 1JUFB 1QFPA 4ODTL 1DBAH 4URTB 1FL3A 2ACKA 1GZQA 4IHOA 1LWRA 2FEEI 5F88A 2GTWB 5AI9A 3QB7C 3N1GC 1QRKA 4E11A 3LN4A 2VZSA 4PJIE 4Z9KB 2V2XB 5MEOB 5JD4A 2RCSL 2PSHA 1U2CA 2QR0A 3G9TA 1MHCB 2GEEA 5CSBA 5FF6A 4HULB 2EDEA 2AJUH 1XIWA 4TNWK 1Y18A 2F53E 5I1JH 3MLYL 2W0PA 4J6RL 1WJ3A 5E2UH 1SEBB 5JW3H 4DTGH 4PJBF 3LH2H 5CUSH 1OGAE 4OKDA 3QFJE 3VCLB 4ENED 5I75C 1ORVA 2FH8A 5JXEC 4DN3H 3VXME 3D25B 5E00A 2HKFL 3QCVL 2A83B 2XN9B 3ARGC 1K8QA 1EAPB 1MFBH 5H37H 4E14A 1WBZA 1JPFA 4LCUA 2FDBP 3I50L 5C3TA 5IF0A 3MBEA 3S37H 1QNZL 2BGRA 3KYAA 1ZTXL 1CUBA 3VG0H 1FZOA 2J8UB 3GJFK 4NDMB 1OAZH 2Y2VA 2DQJH 2YSSA 3BIKB 4X93A 3BGFB 4BJLA 1G7LA 3DLQR 5KVDL 5IV2B 1H2XA 4TPKA 2FBOJ 1CGSL 3W9EA 3BQUB 3DSFH 5JTWA 5FM5M 4OSUL 4Y4HA 1G6RB 4HWBL 3QULB 5E2WH 4K7PX 2UUDH 3RZWA 1UH3A 2WFZA 1GXSA 1JGDA 2DRUA 4YDLB 3LAFA 4ONHB 5I8CB 1ORQB 4CVXB 1GVIA 1RZGB 1KXVC 4NQEB 1R1DA 3VJMA 5HYIA 5DEFA 4J0HA 3B5EA 5E56A 4ZO7A 5FYKE 2R11A 4X80H 4F2MB 4OU4A 1D5XA 5CINH 3U7WL 3BW9A 4QHNB 4HIEA 1U8HA 4F7TA 4DGIH 4KKNA 4UFPA 5ALIA 5I0ZA 3Q5OA 2YYSA 4UIKH 1Z9OA 3R4DA 4F9PC 3C5ZB 4WHTA 4AXBA 2APXA 3F6LA 4HRXA 1X5XA 1A9EB 1EGJL 2X4OB 3OHXB 5JR1H 2PO6A 4Z7VF 1PGRB 4IS6B 4L4TB 5KAQG 1XZGA 4H1LG 4XMKH 1U2HA 5A7HA 2QJRA 2NY7H 4J0DA 1XGYL 5CJOH 2V17H 3KNBB 3CU1A 1R5IB 2UZYB 1Q72L 3D39A 5LXGL 1VFBA 3GKWH 3BHBA 2JCCF 4H26A 2V2WA 1WC7A 3UCRA 5L2KB 4HLJA 4QHMA 1WOMA 1A6TA 3B9AA 1SMOA 2FYYB 2VF2A 2NW2B 4AMZA 5KSBA 2FHCA 4LARH 4PLJC 3BE1H 1QQDA 3QFDB 4NKOB 3FB8A 5B22A 4POYA 4YR6B 5FRDA 2BC4A 5EORL 3HRZB 1H0DA 1OTUD 4WI7A 3WFHB 2E6PA 5EA0H 3J8F7 4R2GD 1EBAA 2WUBL 4YDJB 2J4WL 3GSNB 3HPLB 5I1DB 1LNUA 1KJ2B 1EH5A 1QUNA 5AOBA 4MAUL 2UUDK 5B3JF 3K7UA 2ZSVA 5IFHH 3MLUL 5LZ2A 3BGAA 5SWSE 3ZE2F 2RR3A 3PDGA 1IBGL 1R3LA 2C3VA 4Q6YA 3V48A 5EU6B 5KSAB 2JIXD 3DXAA 3PUCA 4IRJA 1RJYA 2WWKT 3U46B 2IPUK 4QRPA 4YFLF 5EHQA 3OJMB 3AS3A 2AJ3A 1U93B 2PYFA 5D2NA 4DKEH 3I6LE 4DGYH 3F8UB 4P2RB 5DYTA 1IZJA 4NSKA 3QMMA 1EDEA 4S1QL 1CUAA 2YEZA 3B8YA 3OJDB 3QUYC 1ODAA 4FQJH 3RWFB 1C5DA 1ZWIA 4Z7UA 1HEZA 3FN9A 2F74A 4AM0B 4D9LH 2LAAA 2PW2A 1H15B 3VGFA 4JFFA 4HJ0D 3G9AB 3HABA 1W8OA 2Q86A 1BU8A 2VEOA 1W1IA 2UWEF 3I1IA 3F6IA 2QJDA 4XB8A 1CV2A 1ODCA 5JW3L 5CJQL 3BPLC 5EBWA 4I5BB 1AURA 5AP9A 2DI7A 3LH2L 3P9LB 5CUSL 3TJHD 2VATA 5IFAH 1AP2B 3L7EB 3H2KA 3BKMH 4I2XA 3OTTA 5ACLA 1B41A 1PBYA 2K7QA 3ARFA 1MFBL 5SWZB 4ZUVB 5FYJE 5MHSD 3S37L 3D0LB 1C7SA 4FMPA 2VIRA 3RWJB 3VG0L 5IQ9B 1OAZL 2BNRE 5BV7C 1HKLH 5E6IB 3CUPB 3QDMB 5IB3A 1K4CB 3CN9A 3D0KA 3WIIH 1PW3A 3VMOA 4KRXA 4LSQL 3R06A 4K23L 1KEMH 1WLHA 4RBPH 4UIMA 5DD0H 3H42H 3O9WD 4AYFA 2VT6A 1G9NL 4M00A 4LSVH 1EXUA 3D9AH 2FZ3B 3QRGL 3LS4H 2WG0A 3QHZL 5C0AD 1PG7X 3I2CH 4KHTL 4NO3A 3UTSB 4OI7A 1NGYB 3ARDC 2HFFB 3H8NA 4AN0A 5AZEL 1BFVH 1IC4L 3MRGB 4UBNA 1NUGA 2R56H 1SJHA 3U9PL 1OOAA 2OQJB 3DVIA 2APFA 4GJTB 3QO0A 2B0SH 1I6WA 3EFFA 1UXOA 1FFDA 4UIKL 2LVEA 3V7AG 2EEDA 1PZ5B 4JRYD 5BXFA 3MROB 2H6PA 3VRLE 2CLZA 5B4MC 5JR1L 5F3HB 4LK4A 4XMKL 4PFEA 3ULVL 3T8XA 5ALUA 5FA3A 3WUZA 1NAMH 4K7PL 2VQ1A 3GMLB 2V17L 2ZOKA 3FCYA 1A5FH 1X7QB 1X9QA 1YECH 3UTTA 2DQUL 2BFVH 3GKWL 2C1OA 2DSNA 3DL4A 5DVMA 2UZXB 4YC2C 1OP5H 3AMLA 4Y9SA 3ZKXB 1E4XH 1JHKL 1FORH 2VDLH 1PYWB 4MWFB 3VGHA 4CADA 1Q8MA 3WWEA 3HC4H 3CX2A 3AY4C 5C07E 1AFVL 4X7TA 5D7KD 4P9HC 1QD0A 1LPNA 2XQBL 4G3YH 4R90L 4JQXC 1QHOA 1EO5A 6FABL 4WW2A 2O61A 2MFNA 3TIDB 3CVHB 3DUSA 4U6TA 1Q0XL 5JXED 4FFYH 5EA0L 5H94A 4AMKH 4FQCH 1DN0A 3MFFA 1NCWL 5IM7B 1JTOA 2JJVA 5IB5B 5F7NC 5A43C 1DUZB 2BNQA 4G8GA 1LP9F 2BAGA 1KNOB 1MHEB 5IFHL 2LV4A 3O11B 2OYPA 4M93B 4DKFH 1IQDA 5AM1A 1MQ8A 3KPQB 4PY8I 2HTKD 4HPYH 3FT2A 5HHMB 4HIHB 3P4LA 3LQZB 5DHVH 4AN1A 4MNQD 2YASA 2D03L 2DLFH 5BJTA 3G6JF 4YE4H 2WHPA 1CL7H 5DUBB 2ZYHA 2COQA 4MGXA 4WFFE 4MHHG 1MVFA 2O2HA 5D1XB 3QISA 2IIVA 4JHZA 3RKPA 3GFUA 3OQ3B 4W1SA 4D9LL 1RY7B 4FNLH 3C8KB 4K2UH 5T1KB 4XPHL 1VEOA 2BSED 4WJ5B 4Y16B 1I7RA 3L9RA 4PTUB 3T1FA 3WHXB 2RAUA 2GYUA 2R2EB 2BUAA 5F1IB 2VDPH 1VE7A 1ZA6A 3ZKMC 3SDCC 1JJUA 4RWYH 3C5JA 2J12B 1TENA 4U4BA 5T4BA 2FHFA 1PLGL 1ZHBB 4R96A 4HMDA 3GUTA 3F12A 1M7XA 4DOHE 1RZ8A 3VXNB 1OD7A 2CIIB 2GTWA 4WJLA 5J0BA 3HLKA 3LDBC 3QMWA 5D7LE 1IZ8A 3ICVA 2G5RA 3T52A 3PL6D 4QEKA 1YMMD 3SDXE 3O3DA 1UADC 1MHCA 5ALSA 1JHLH 2AV1B 4UDTB 1YB6A 4QEGA 2B2XL 4NRZA 1MN6A 4Y1AA 2CD0A 5LZ4A 2V9QA 2WIGA 1SEBA 5GGQL 3QIWC 1R5WA 1G7JB 3HE6D 1DQQB 1EO7A 3FB6B 4OD2B 2CXGA 4OM0H 3QH3B 1U8QA 1RVFH 1KEML 4R8WH 1NFDE 5DD0L 5BOPA 1KSRA 4QYOB 3R8BB 2W9EH 2VMFA 4IOFC 3D25A 2A83A 2XN9A 1CUJA 3LS5H 1A6WH 1EAPA 3MBED 4PV9B 3OF6A 4XP5L 5EZIL 3MOBH 3W06A 2OLDA 4FN0A 2DQHL 4LLAA 1KPRB 1ZVYA 3BWUC 4UOJA 1E6JH 2D7QA 2J8UA 4NDMA 3O81A 1BFVL 3V6ZA 1KXTB 1P5VA 2OTPA 5ICZB 3C60C 4NRYB 2OI9C 3WS3B 4PIRF 3W0WB 2QHRL 4Q9RL 4JG1H 4P2QD 1XEDA 1HHIA 1UWEL 3QULA 4NBXB 4B0PA 4W1PA 4DSAA 2E7BA 1ADQH 2AEIT 4ONHA 5I8CA 3KPOB 4CVXA 1RZGA 2M26A 4PB9L 4FLMA 2QXTA 4NQSB 1NAML 3X3GH 3QIUD 1ED3A 1N8ZA 3HI1B 3QEGL 3TESA 4JHBA 4F2MA 4ALAH 2W92A 4CIAA 1A5FL 4QHNA 1B0RB 1T1YB 1P1ZB 2DIJA 1PG7L 1KCVH 4V1DB 4WU5B 3DVGA 1AC5A 3GJFB 3C5ZA 1A7UA 4H18A 1KIPA 1ERNA 5GGTA 1E4XL 4IRSD 5DJYA 2WLYA 3B6SB 5L0QC 3RLIA 2R0ZH 1A9EA 2W91A 2X4OA 3HC4L 5IH7A 3OHXA 1L7TH 1K3ZA 4L4TA 4IS6A 3C09C 1OQXA 1EJ6A 4G3YL 3SCMD 5C0CB 5GZOD 3KNBA 2DQCL 1R5IA 2VLME 4DZ8B 4XCEB 5AI0A 2EDCA 4PJEF 5B39A 1T2XA 5JHDD 4NUGL 5L2KA 2GYVA 2VLLB 1RZJH 4PJBB 3VE0A 2FYYA 4P46A 2P5ED 5L9DL 1MWAH 4Y4KB 1N5AB 3O6KL 4RAVB 3JWOC 5E1AB 1F0PA 4PJCF 3QFDA 4NKOA 3CFJA 4QOKD 3SC2A 3MLVL 4ZFGL 5F6IC 4YR6A 3SGJA 3FFCB 4PB0H 1E27B 2OCLA 4FOLA 2Q20A 3HRZA 4P4RA 1V5JA 3B9DA 2E9BA 4JM2A 3RVUC 4W1QA 2EE2A 3DRTB 1QSED 5AUMB 1B4JL 3HPLA 4ORGA 4YE4L 4OKVB 1CL7L 5B38G 3SKOA 1KJ2A 1AXTL 3CGTA 2O5XH 1FCCA 3DTXB 3PABA 1U92B 1TQHA 5BWCA 3TCLB 4OYLA 3HUJE 1W0YT 1OF2A 2Q8AL 1NGQH 1XZDA 4PJFA 5IHLB 3RQ3A 4QGTA 5EU6A 3WNLA 3TGXA 5KSAA 3RFZC 1SJVA 4Z7OF 1BD2E 3U46A 5HCUA 4HS8L 3O3AB 3FLAA 1RUPH 2DKSA 4P9NA 4G43B 4P2RA 2YN3A 2XMZA 4KDTA 4K8RL 2FJHB 4WUUE 2DI9A 3IFOB 3HMXA 3CX5K 3OJDA 4PTTA 4LGPB 4Z7VB 3RWFA 1UK9A 1E6OH 3E3QC 4I0PB 4M8QB 3O4LB 4AM0A 3PWPD 1FJ2A 1H15A 1S7UA 4K3DH 3MJ9H 2PPLA 3V8CA 5EN2B 3H2GA 2VUYA 4U6VL 4QRSA 3EO9H 2JCCB 4CVWA 1MQKL 3S5LA 1LE5B 4GXNA 2DCMA 1SJEA 1FO0L 1FYHB 4RRPG 3IXAB 1UKCA 2DI8A 4RZCB 5ADPL 2XE4A 4X9HA 3SDAB 3IDUA 1DLHA 1CLCA 3P9LA 5TH2B 1PQZB 3L7EA 3T0EE 1Y0LB 3VD7A 2A73B 4K7FB 2FSEB 5L6YH 4IOSD 5DRNA 2P7TB 3NFPB 3WA7A 1RJLB 1LEKB 3W2DH 1XZIA 4E46A 4DFIA 5LBSL 2HVKB 3D0LA 3FCTB 4HW6A 2VTFA 3F7YA 2DLEA 5D1ZB 3RIFF 5CCKH 1EI9A 4K3JH 5E6ZA 1WAAE 3MV9B 5E6IA 3QDMA 4PJHF 3EJJX 2E5EA 3QYCA 3LIZH 5DRZB 4PRHB 1EK3A 3BWAB 5D5MA 3M81A 4JG1L 5CP7A 3V52H 3FLBA 1NCCL 4WFHD 4LPTA 5DSCA 3GSOB 4C59B 1P7KB 3HRHA 5GRJH 1MCBA 4WFJA 4N0UE 5KJRL 5CH8A 3WIOA 3ZE0E 2CO7B 1BEYH 1NGYA 1KN2H 2HFFA 1JPST 3O9VA 4ALAL 3MRGA 2D4FA 1INQA 4UPDA 1DBKH 4MWTA 2OQJA 1QGED 4EOWL 3MNVB 4CVUA 3O2VL 2Q8BH 1PZ5A 2EICA 3RIFK 3WIBA 1A0QL 1L7TL 1U8KA 5F3HA 3S7GA 1KU6A 5GGUB 4MJ5B 4U1GC 2XMSA 2XY1A 2GAZA 1CXHA 4QWWA 2DTMH 2OXGA 1GAFH 5ALHA 4QY8A 1HXMB 1X7QA 3P9MB 1MTZA 5FEBA 1J06A 1W4LA 5GPRA 4HBCL 4M5ZH 4Y4FB 5J1TC 3V5DB 2PYED 12E8L 2EYSB 1ODSA 1PYWA 1ZGLP 3DI2B 3VKFA 1HQ4B 1L7IL 2IANB 1Q94B 3QIWD 1VFAB 3TA3B 3JSSA 4KC3B 5JIKA 4RISL 3QPDA 1D9KB 1YJDL 3CVHA 3VFWB 4FS0A 3ROLB 3ZYJA 2WUFA 3EDEA 4IOFD 1PX4A 3JYHA 4OCLC 4JAMA 2DQEH 3B9VA 5IB5A 1SC9A 3PWVB 3ILPB 4MA7H 3T4YB 3HG1D 2FX9H 2JB5L 3RHWK 1MHEA 4YHMH 5DXWA 3O11A 4JKPL 1B0WA 1BGXH 3KPQA 3IXTB 1NGQL 4ZSOB 4HG4J 3MLXH 4MAYC 4HIHA 2C1PA 1RV6X 2R2BB 3O6MH 3EYUL 4P92A 2PXYB 2X09A 5FXMA 2QOEA 2Q76B 1KCSH 1A14L 2L7UA 2P47B 1E3QA 4KUZL 4WY7L 4JO4H 4UINH 5DUBA 3V0AC 4U1SB 3TYGL 4HS3A 2ILLA 2XKNA 2R1WB 2X76A 4KZDL 2A6DB 1A3LL 2B1HL 5JW4N 2HIHA 4OB5L 5E03A 4ELKB 1LBTA 1E6OL 2NY0B 1LMKA 1CIDA 2NZ9D 3EHBC 5ALQA 5C7XL 2J88H 5T1KA 2L0DA 3IU3B 1IGCH 4WJ5A 4P4KA 1UZ6F 4PTUA 4PJAF 4UHCA 2R2EA 4HKZB 3TF7C 5F7UA 2UZIL 3BZDA 3EO9L 4E42B 3WLWC 4DGVL 3Q5TA 3I2FA 3DJYA 4LASH 5INCB 3FAXA 1ZSDB 4J12A 3VXNA 1OTTD 3CCBA 2CUMA 4KK8C 5DI8B 2CIIA 4JRXB 5TDNB 1QFMA 4M48H 4U1HB 3OX8A 1VKXB 2WQ8A 1JGVH 1Q1JL 5TDPB 5FECB 4B85A 4CW1B 1F2XK 5L6YL 1YEIL 1PSKH 1C08B 1AO7E 5HYJB 1YAJA 1UH2A 5ALXA 4EY8A 4APQC 3U36B 1NAMB 4N8PA 5CCKL 5IJVA 4B7LA 4K3JL 2FH6A 1OT1A 3K8MA 1KJ3H 5FCUH 5F97E 1BM3L 2CDGB 2BSTB 2QUBA 1G7JA 1U91B 1DQQA 3LIZL 4OD2A 1KB5L 1FYTD 1LP9B 3QH3A 4GS7C 4MD0B 4NBYB 2VDQL 2WWMD 2DBLH 1CQKA 4QYOA 2GHWB 5K9JL 2LU4A 2HJKB 2Q7YB 5CBAB 3MJGX 3VDCA 1ORWA 5EUOF 1YEKL 4CKVX 4OFDA 2GKIA 4PLOB 1T4KA 5F1NB 1ORSA 3AU1B 3O2DH 1EHXA 1Z0NA 1MLCA 4NCC1 1P4BH 2VZ1A 2XI4A 4YPGB 1G7IB 5CZVH 4C88A 3B5HA 3G6JB 1NUNB 2NY2D 4KQ4L 1IC7H 4DMHA 4H1LH 5ICZA 2GBFA 2Q3ZA 3BQUD 1KXQE 3A6ZA 1DBKL 2N7BA 3FJTA 3V6OC 4JH0A 3WS3A 5E2VL 5C8ZA 2ZPKH 2B9VA 3W0WA 1KCKA 5F7DB 3FQRA 2WHQA 1UYWL 4XP4H 5CT6A 5F7YC 4NQED 4PV8B 2ORBH 2BJMH 3NGBB 3KPOA 4PYGA 3KPTA 4JKMA 4XXCA 4NO2A 4NQSA 1MRFH 5I1CH 4GI1A 3HACA 3HI1A 3EBAA 4B83A 1DQYA 5C9JB 4JN1L 1GAFL 5AM4A 5DD1L 3C2AL 4JFOB 4Y5VC 4LVNC 5DHVB 1T1YA 1R88A 1D7FA 1P1ZA 3MXWH 5ABDE 2KQNA 5AH0A 4V1DA 4EB0A 1J0ZA 3I75B 4WU5A 2VDOL 4OV5B 3GJFA 1ZLVH 1LPOA 2VDML 5IW3A 5HD8C 2B5IC 1RULH 5K3CA 3B6SA 2VZOA 5JATA 4F7MB 4J0JA 3F97A 4WO4C 5ENWB 3D3VE 4LSSL 1SY6H 3RUGF 3KVQA 5C0CA 3O9MA 1C5CL 4DZ8A 4XCEA 4LAJH 5IBLC 4U33A 4UNUA 4U2BA 1LO5A 2ENYA 3FN0L 1U8NA 5JIHA 1NCNA 1MCDA 4DNPA 3HI6L 4E5XB 2DQEL 1HBJA 1NLBH 4PJBA 3DGGB 5L8JB 3PDDA 2VXUL 3L5WB 2X4SA 3MNZA 1P7QB 1N5AA 1H3GA 2XUHA 5IBUB 3V6BR 1J8HD 5IVNA 4YHML 3RARA 3D7RA 5E7BA 4NCC2 5J7CC 4Z5RA 1AGCA 1I8IA 4HH9B 1CDBA 1E27A 1I9RL 1BBDL 3KPRD 2JJSA 5D71H 4ZXFA 1PY9A 5DJZB 3DRTA 3SOBH 1S3KL 1KCSL 3B9KB 5DMYA 4MJ3A 1Q0YL 1B2WH 1FCGA 1U42A 4KY1L 4OKVA 2VQTA 1GHFH 1G0YR 5KS9F 1KGCD 1RU9H 5ISZE 1VFMA 1YA8A 3DTXA 1TIBA 4OIIH 4G80A 3TCLA 3UXFA 3SHSA 3ULUF 4L4VE 3I6YA 5K93A 3BF7A 2CRYA 4EIGB 5MEND 2YMXL 1AI1H 4Y88A 1IGCL 1F45A 2ZUTA 1AO7D 4XBGA 1FZMB 3FT3B 1Q38A 3O3AA 5HF5A 4ELMF 1FNSL 3Q1SH 1NMAH 5EHZA 4G43A 5JD5A 4OF8A 2OTWA 3ARTA 3KWFA 4K7PY 1BIHA 1GGCH 4OQTL 1AHWA 1INDL 2PR4H 3I3EA 4M48L 4M9PA 1F13A 5ALJA 4EY5A 4Z7VA 1KJMB 2HTLD 4I0PA 4M8QA 3O4LA 1R3DA 3V6OE 2G5TA 3MLTA 2YK1H 4FFWC 4LXGA 1VB9A 5I71B 3VXRB 1KELL 1UGNA 5EN2A 4HUNB 2NW3B 1T66D 1UXSB 4ZTPH 1B90A 4PJEB 2FEDC 2ZG2A 4IEFB 1LE5A 3BKYL 2XUIA 2GK0B 3QDJA 1FE8L 1SYSB 4CAGA 1KJ3L 2RIPA 1A7RH 3IXAA 4YDVA 2VJAA 1YAHA 2AW2A 1JHTB 4MXQD 4BQ6A 4L8BB 3SDAA 4MVBD 4L8CA 5FP0A 1XGQA 3SK0A 5TH2A 1PQZA 4PJCB 4BUHA 1Y0LA 4NKQB 3R3UA 2JGIA 2OJZL 5BQ7B 4IDLA 5SWZD 5BO1L 3CXHJ 2C3HA 5LQBL 2P7TA 2CQVA 4TOYH 1GPNA 1RJLA 4PJ5D 3U0TB 3TP4A 3LQAL 4DM7A 5DUMH 3FCTA 1A6AB 5F9OH 2AXGA 1UKTA 4JY6B 5SX5K 1XZMA 4KV5F 1EHLL 3BYYA 2Y7QA 3MV9A 2AEPH 5IMMA 3FT4B 2I9LA 4MAYD 1GRWA 2DQTH 1JZ8A 3JV4B 1LDPL 2ZPKL 3MRFB 2MTPA 4JY5L 2HYMA 3MLZH 4O00A 4OZGE 2HFJA 3AS2A 3TJMA 2CLRB 2VABB 3K4AA 1MWAB 2Z31B 4YBLB 3GSOA 1P7KA 2BNUB 3WFEL 2BJML 5C0RH 15C8H 5HHOB 1NUDA 3UTSD 1CVRA 1WCBA 1J07A 3EBLA 2VLJE 5C0GB 4J3XA 1AXIB 1BCRA 2KUTA 4PRPB 2KQMA 2XKUA 1NC2A 3TN0A 5A40E 4KZEH 1C1EH 3EHBD 3V0VB 2DIBA 3O3UN 3MMEB 1QLWA 1GPLA 1XRRA 4K9EH 4GMTH 3MNVA 4DUVA 5B21A 2WSLA 7FABH 4U7KA 4GBXC 3ZDXF 4DK6A 2F8XC 3P0VH 4BFIB 1RULL 4X8XA 1H9VA 3WLWD 4UT9H 4DEPC 3CCHB 5F9AC 4LHJB 2BY1A 4JFPB 1S9KC 3QAZC 3PIQB 5JZBA 4KK8D 3HZVB 2QBWA 4J23A 3UJIL 3KDAA 1X6NA 2A0LC 3P9MA 2R23B 2C4FT 1TCAA 5SX4H 3WKBA 3QNZB 3NVQA 2JEYA 1VESA 2NY3C 5D70H 3KPSE 2ZCLH 1ZD2P 1MAMH 2MNUA 3PV6B 1DZBA 4Y4FA 3ULUL 3V5DA 2VJCA 1M33A 1RQ5A 1YPZA 2ZUQC 4IJ3B 2EYSA 5DR5H 4PJGE 3EDDA 3TZVC 4LFHD 5JPNA 1P2CB 1UM5H 5EZJB 2I07B 4P5KA 1IGTA 2IANA 1BN7A 1Q94A 3LN5B 4GKSB 1VFAA 4LQ1A 3TA3A 4F9LC 1ZI6A 4H5SB 3NN8A 4NQCA 1D9KA 4NPYA 3W11C 2FO1A 1GQRA 1F58H 4F3FB 3ROLA 3VXTA 5GIRA 4Z0XB 4NKMB 3WXVL 4E0RA 5CJXC 1KC5L 5FOBB 4QA9A 4JQVA 5E8OA 2DQYA 1GHFL 1RURL 4BYHA 3ULVC 4B9AA 3T4YA 1P4LB 4AEEA 4P57B 5ICXA 4OIIL 5JXAH 3ZL4H 3HNSH 2XKSA 2E27H 1A1MA 2WIJA 3BT2L 2GY5A 3BGMB 3IXTA 2YC1B 1W0VB 4TSCL 1MCCA 4LPXA 2XLBA 5EB9A 5KTEH 1AI1L 2PXYA 3CFIC 2Q76A 4C89A 4QHKI 4O02L 2GTZB 5JQ6H 5GRZA 3HEAA 1LD9A 2RHEA 3G9UA 4PV7A 1CUYA 1HE7A 1NBVL 3OSKA 3VGEA 4U2DA 3ALWA 4U1SA 1WT5A 4PRIB 2R1WA 4LPCA 2Z8XA 3FAWA 5D1XD 2A6DA 5FYLL 4BUGA 2XNAB 3FO0L 2PR4L 3N1PC 4ITVA 4BZ2L 2F5AH 5DA0B 4ELKA 2MKWA 1RJZA 5DZOA 1VGEH 3RVXC 1TPXB 4Y16D 1K6QL 2E3JA 2AK4B 5GJTH 3IU3A 5IVXA 3OKDB 2CRMA 4H0IA 2G2RB 2QV2A 1FV1B 4HKZA 3U0PB 2XUAA 5HD8D 4C4XA 1OLLA 4E42A 5J12B 5INCA 4WO4D 2ARWA 5BVPL 4G8EB 2YKLH 5LCVH 3TT3L 2I60H 3EYSH 5DI8A 4XB7A 4NJAL 3FLEA 3Q6GL 4PP1D 3SDDC 2A9ML 1VKXA 2ADIB 4CG3A 3MZGB 3O6FB 5TDPA 4XRCA 4PG9A 4CW1A 5HI5C 3PE9A 1S8DB 1C08A 5I15H 5I76B 3FAKA 3U36A 1NAMA 3Q5YA 1EHNA 5DNWA 1Q0RA 3TBWB 4LPVA 1Z9SA 1QSFD 1LP9A 4LKOA 1UCBL 3RGVB 4J8RB 4NN6C 3BEVA 2RGUA 1IGIH 2HJKA 2Q7YA 2B4CC 4HGKC 3T3PF 5CBAA 2Y06H 1MFNA 3QUXA 1A21A 3LD8C 4NJ9H 1DR9A 5C0RL 15C8L 1O5DT 5F1NA 2NR6C 4DN4L 5HTSA 2YRPA 2QADC 3QDAA 4GRMB 3WFZA 2Z35B 4YPGA 1R3KA 3R0VA 3G6JA 4KZEL 1C1EL 2WU3A 5HI3C 1DL7H 1N3NB 3KPSD 4GMTL 7FABL 1TQCC 2B4KA 5F7DA 2A74A 2WWKO 2IQ9L 2G60H 1M4KA 2VH5H 1UACL 4R3SB 1XIWC 1NH6A 4PV8A 3LB6C 4MNGA 4XMPH 2V98A 4J3WA 1IKFL 5D96B 4N8SA 4PJAB 5C2BH 2HFGH 4POZC 1R9MA 4QCIB 5C9JA 3HMWL 4JFOA 1CE6A 3B2UC 5DHVA 2IH3B 3IA2A 4H88H 5CSGA 4YZFF 1ZVHA 3I75A 1MAML 1KG0B 2LFGA 5I18H 4OV5A 3P4OB 3TM6A 1G0XA 3KDMB 1RIVL 4EBQH 3H9SB 1XLVA 4HKXB 2BDNH 2NY4C 1UM5L 1JMZA 3WIHH 5JDJA 5SWQB 4QHUA 5HDBE 4KHXH 4OD3H 4F7MA 4G5ZL 5ENWA 4LQFL 3VA2C 1SEQH 4U7SA 5JIBA 1HYRC 1MJ7L 5AI8A 2E6QA 4UZGA 1F58L 4Y19B 3BJRA 2WNGA 3DMMC 5AI6A 1MO2A 3PF9A 2EYTB 4XX1A 4Y4KD 3MUY1 4E5XA 1I1FB 3L1IA 4YIQB 2R1YB 3L5WA 4GSDL 4QLAA 4XC3H 1JFQH 3OKKB 7CGTA 2EE3A 4JFDA 3L3DA 4LIPD 5EUOB 2QQLH 1CI5A 4K6KA 1TCMA 4K3EH 4H20H 4OT1L 3FFCD 3UO1H 1UCTA 1VGKB 4RFEA 4XI5D 4FG6D 3TH2T 1V7MH 3ZKNC 2BMKB 2DBJA 4OCSL 2Y6SD 3WS6A 3QZUA 3NIDF 4CI9A 1SBSL 4HXFB 1BVKB 3KR3H 1HCVA 2PO6C 1V05A 1JGEB 4L3EB 5F6HJ 3L3KA 3MGTA 3SJVD 2NX5E 3EO0B 5I73B 1FFNA 2F5AL 3CK0L 3NCMA 4NWUL 1J1XL 1AD0B 1VGEL 1BQLL 1BJ8A 1I1YB 4GRWH 3SGEI 3WK7A 3FT3A 4Z6AT 1EPFA 4TGLA 4KAJA 3U7YH 3E6HB 1KN4L 3MV7D 3D2UB 4Q6IB 4PLKC 4B7ZA 3RA7L 2H45A 5AYQA 1AX9A 1XMWA 3NA9H 4O4YH 2Y4SA 1V3MA 3INUL 4H1LB 3U1SH 3QIBB 1FH5L 3FB5B 4C4YA 2GYSA 5C08D 2A0LD 1YEJH 3C87A 1KJMA 4W9RA 5IR1B 4MQLA 4YHOL 2I27N 2XXMB 5MEQA 1INEH 4OZFG 4EJ1C 5EOQL 25C8H 1ADQA 3VXRA 3OMZA 4MXDA 5HI4C 3TZVD 1BF8A 3VH8A 1TZHA 1UXSA 3NPSB