3C8KA

The crystal structure of ly49c bound to h-2kb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Molecular architecture of the major histocompatibility complex class I-binding site of Ly49 natural killer cell receptors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c8kA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3c8kA01
4FN0A 1U3HA 1IAOA 2YPLE 4BH8B 3MBED 5I16B 4RIRA 3GRWH 3F7PC 5TJWK 4PJAA 3RTQD 3GSNA 4Z5RB 1HEZB 3HC0A 5DSCB 1U8KA 1PY4A 3WNOA 1T89A 4X5XB 3HAEB 1BEYH 4LASL 4WDIA 3VFTA 5HVGB 1EJ6A 2HG5A 3VXPB 4U05A 2FJGB 4ELMF 4M1DL 5IM7B 4RX4D 1T1YB 3IAGC 1ZV5A 3SDAD 3EOAA 5D1ZC 1RJLB 3WO4B 2ZSWB 5SWQB 1RD6A 3SDCD 4U6TA 4PJ7B 2Q86A 4FHBD 1CFQB 1QBBA 3TFKA 3G5YA 4MHHI 3UROR 5HPMA 1LMKA 2EO9A 4I77L 4NNPL 4U1KA 2ZOLA 5D70H 3THML 3MNVA 5A43C 3OGOE 2X4UB 1MUJB 5B4MD 7FABL 4OZHE 2R0WH 2CLZA 1FP5A 2R29H 1S7TB 4P46C 1TQBB 3WIHL 3KJ6H 5HVHC 2BY0A 3UTQB 3TCLB 4OCNC 1JGDB 3AB0B 1FVEB 1WEJH 3GMMA 4ZG1A 3W5NA 4MJ5B 5IBTH 2JJVA 4DVBA 5C9JB 3BIAX 4GBXB 2R2EB 2VERN 3QIUB 3C6LD 1TZGL 5DI8B 5EUOB 1INEL 3HC0B 4KMTH 2R39A 3LPFA 4X6DE 4QWWC 3ZHLA 1U3JA 2YUWA 3CK0L 1S78C 2ITDB 4LIQE 5IB5A 1TJGH 5HGAA 3ILQD 3LHPH 1AO7E 2OXHA 1KN4H 3WDJA 2BSSB 2HG5B 4PJEB 3VXQA 1IEAA 3MXWH 5FUOL 3HCVB 4L4JA 2E7LE 2DWDA 3FQTA 4MQXC 5IMOB 2CJUL 4JJHA 4OGZA 2Q86B 3F12A 5LAXA 5C0AB 2GY5A 3L7FB 3SGKA 4XGZB 2Y36L 3ZKMD 4JRYA 3UPCA 4OZIA 4OF5A 2HFEA 2ZCKH 5F96H 1WBYA 4MDJB 4O9HL 4J6RH 1NAMB 3BPCB 3KG5A 5C2BH 4PV9A 5BZWA 1INQB 3H3PL 3QCTH 5DMYA 4Y2DC 2DQGH 3PF2A 5J0BA 3TESA 5SX4I 4P4RA 4E0RB 5T3ZE 3DMMA 1OAYL 1NEZG 5HYJB 1KEGL 2QADC 3T4AB 3H2WA 2D7MA 5EO0B 4DKFL 1A8JH 5HHME 2SEBA 4FFWC 5DFVD 4GRMA 1PZUB 4IDLA 4P5TB 1J0JA 4XCFH 3MA7B 3E6HA 4HC1H 5E24E 5FDWA 1A6ZA 1CFTB 2ADIB 3IS0X 4FTVE 2GT9A 1CLYL 4XXCA 2FBJL 3RWGB 2R1YA 3QO1A 1SVZA 1S5IH 3GO1L 3ALWA 4LVOC 5IBLC 3IJYA 3MCLH 1HINL 2QSCL 2N7BA 1U8JB 1Z9SA 4K94L 3O8XB 4OGAD 5FYLE 1KV3A 3CVIL 1S8DB 2XG5A 4QCIA 1NGYB 5D7IE 1KCKA 4MJID 3VXUD 5IVNA 2E9JA 2CRYA 5T3XE 4H0GA 3SJVE 4F58H 2VLJE 1QBLH 2F5BH 2UZYB 4YXKH 2NX5A 1QRND 1QSFA 2NY2C 1X3DA 1DUZA 2YD4A 3LKSB 3N1GC 3PWUB 4FQ2H 5I17B 4WV1A 4LFHG 2JTDA 2HKHL 2DLIA 3KPLA 3MPCA 4C55A 4CVZA 4J3TA 3RZCD 1E4WL 4G3YL 5CINL 1JUFB 4Z8FH 1R3KA 1S7QA 2I60L 4HIXL 3MBEC 4MXVE 5HPOA 1NUFA 5JW5A 2DWEB 1UYWH 3RTQC 3GSUA 1SYSB 3VXNB 1CDUA 1KCVH 1QFOA 2EE3A 4O51A 5F93C 4P23D 5C3LD 4HF5H 4NUGL 3QJFA 1KIRA 4WO4C 1DSFH 4XWOD 4RAUA 3WHXB 5EBWB 1JHTA 2JB5H 4OBRA 4JM4H 5DJCB 1EO8H 4X7FC 1VACB 3V6OA 1MH5B 4ZO8A 3ARTA 1NCNA 2V5TA 1A6ZB 2DI9A 3C5ZB 5IKCA 5BMFH 5IHZA 1W72B 4M3JA 3SDCC 4Y2OA 1F2XK 4LDLB 1U92A 5D5ME 2B20A 4EJ1C 4FMKA 2NW2B 3ARBB 1JI1A 5DD1H 3MLSL 5TQ2H 3PQYA 1B4RA 5KANG 3FFDA 1DLHA 3DHJA 5DVKA 1ZTXH 1IQDB 1PKOA 3LQMA 1NC4D 4TN9A 3VGAB 4UQ3B 5FK9B 3O6KH 4G6FB 4OLUH 1HHKA 2DQCL 2JCCB 2NY5H 1A6UL 5C9KA 5F9OL 1YEJL 3BZFA 5C0JB 4WI5A 2ESVB 1PDKA 5JOPE 4ZD3L 1QSFB 3O2DL 2VXVL 3SOBL 3VD4A 4ZUTA 1DE4A 4E41E 3BO8B 3R06A 5FGBA 5DJAA 2APBA 1FZKA 4CVZB 3T77B 2VWEE 5TF0A 3MRQA 1R3KB 2QHRL 3QEQB 3C6LC 3VA2C 4JFFE 4NO3B 2NY4B 4EI6A 2IFFL 4RFOL 5JO5B 1MOEA 4XMPL 1MNUL 4X7TB 4XB7A 3H3KA 1ZGLP 3MR9A 3RUGB 3V4UL 3WFDH 5LXGH 4Z76B 3LKOA 4F9PC 3K1KC 3VG9B 5T1LA 3O4LD 3WEXB 1E4JA 4OCWH 1Z0NA 5CKGA 1U8QB 2X1OA 2OI9C 3H9HB 3AY4A 2HH0L 3AREA 3HNSL 3NTCH 3FO2B 4RISH 5IKCB 1WISA 1YMHB 4AENA 4O2CB 1MCRA 4ZUSA 1H3GA 4NQEB 4DFIA 1J18A 4ODXA 1RUPH 3U4EA 3X3GH 1CGWA 3ZKMC 2WWKT 1MCHA 1EO5A 1RFDL 4R7NB 4AIXA 4BYHA 5J4MA 4M9OA 5IEHA 2DTSA 4JFEB 5CJ8A 4XPFH 5AD0A 2C26A 4NJ9H 3QWRD 2IWGA 4HWBH 1G7MA 3QWQB 4DEPC 3ZL4L 4WUUA 5MHSD 1I7UB 5DJAB 2NXYB 2VMFA 3U46A 1IM9D 3IXAB 3L3DA 4KRPD 3HZVB 1QVOA 3MRQB 2P43B 1I3GL 4PJBE 4RZCB 5DFVC 1OQOA 4Z7WE 5AG9A 3QUZD 3SGEH 5DRWA 1DQDL 4NNXA 4UTAL 2FGWH 4GLRI 3C5SA 4YXLH 4YUEH 4DCQB 5JPMB 4UV4L 3MRRB 1S7RB 1Y18B 3V4VH 4PBVC 3N0PB 2G9HA 4L4TD 2P5WB 1DBJH 1IMHC 4PJDB 1S7SA 5BXFB 3AREB 4OGAC 4RSVA 5GS0C 2PW1A 5DT1L 1K3ZA 2MOVA 4PJ5E 5SX5K 4NKQB 4HKBB 4MXWH 3QISA 5D6CA 3P0VH 5F9JB 4X7SH 3HS0A 5J06A 3M8OL 5EO1A 4EQ3A 1LE9B 2IALB 2V5RA 2XTJE 4Y5YB 5DUPL 3MRLA 4OCLC 5FYKH 4ZXBC 3S4SG 1MCEA 1LILA 4LHUB 5JIKA 3VFOB 3LKPA 3HNVL 3OX8B 2YK1L 4EUPA 2B0SL 3HE6C 5HDQL 3P73B 3RZCC 4HPOL 3MRIB 3V0WH 3D25A 2FCBA 1H5BC 2Y07L 1YEHL 1M7DA 2AV7A 5D7IF 4RGOL 4X6FB 1JPFA 2AK4D 3B5GA 2EICA 3D18B 4Y4KB 3U46B 4P23C 3WIHA 3UAJD 3BYYA 2Y6SD 2DLTA 5F1SA 1QLFA 4OCYL 1SJEA 4KMLB 2B2XH 4BZ1H 4YPJA 3BQUA 3P9LA 2ZUXA 5K9OA 5DRWB 3RNQA 4CGTA 5F7WC 4RCAA 1D5BA 5CEXA 4K3EH 3OF6A 4KY1H 5F88A 3ARYA 1MFAH 1FNLA 4NZTL 1WIPA 1FCGA 2CMRL 1R3HB 2ZZUT 1VCAA 3TZVD 3QBTB 1XF3B 3PDGA 3CX2A 5KSUA 3G6DL 3RVXC 5ENWB 1C5CL 1YYML 4M6OH 1E4XL 4MNHB 5DJ6B 2VZTA 1FNHA 2OS7A 5T1KD 3VD9A 2CD0A 4Z95L 2R4SH 2VH5H 4HXAH 5E0QA 2UY6A 3VFMB 5GGQL 3MRLB 2OCFD 1BFSA 1QOKA 4URTB 1U3HD 2WIIA 2PYFB 3UYRH 5L2KB 1PQZB 5SV4A 1MLBB 3KPRA 1LE5A 5D2NE 2CRIA 5D5MF 5EOQL 1GL4B 4J3UA 4XRCA 2J4WL 2IAND 1B90A 1T6WA 4PJGB 5TDNA 5AAWA 4Y16A 2WIMA 3VWKA 5IFAL 1I8KA 3KYKL 5FUZL 1J8KA 3IB4A 4O58H 3FQRB 3L3IA 3WIFA 1EUUA 4JLRA 3D0LB 5D6DC 1NUNB 3CLFH 1BX2B 5D96B 2ENSA 1TLKA 1UADC 5CAYB 4XP1H 1I7RA 4F3FB 4YHNA 3LV3A 2FO1A 4KH2A 1S7XB 3WXVH 3WCYA 1V3JA 1UKQA 5M7QA 4Z7OE 3GMQA 3GUTA 4FQQA 4KJYA 3CSPA 3HHRB 1T2QL 5D7JC 3NABL 4KZEL 1OARL 4WW2C 3BH9B 1KCRL 4Y1AA 5C0NC 2X4SA 5GS1B 3O6FB 3QZWA 3MODH 1DVFB 1I1AB 1NGQH 2BERA 2IH1B 4HMDA 2JELH 2VLLA 2P42B 4YGAB 2PXYB 5HDLA 4JFQA 3Q5OA 1CXEA 4OGYL 3UTSE 3FB8A 5IEKB 4G8FA 1BFVL 4XHJD 4EI5C 1ZKAA 3OMZA 2YA0A 5I19L 3MLZL 3I84A 1T7XA 5TDNB 4ZMAT 1SQ2N 2AJYL 3VGBA 5ANME 3QUZC 1A6PA 3DROA 1LDSA 5C0BA 4N0YH 1Z3GL 4YAQA 2XZQL 1S5HA 4QTHA 4HEPG 4X0KB 3VFPA 4XCEB 4QLRA 2CGRL 2P44B 3DO7A 3F7YB 3KYOA 1DQJB 2VDQH 3BD4A 3DURA 3FOLA 3QQ4A 3VFVA 5I9QC 1IM3A 4QRUA 4JRYD 1FYTB 2MQ3A 3WKMH 2FD6H 3P0YH 4MNGA 2ZPKH 4ONFH 3LDBB 4PJBF 4NZDA 4ZS7H 4RQQA 4CJ1A 4FQQB 4JRXA 4WJ5B 4XVJH 4RGND 4P5KA 5H2BA 2G5BA 3BZDA 5EZLB 3E8UL 1F4XL 3N85H 1JNHB 3MV8B 4IRJA 1FL3A 3VG0H 3U9PL 3ZTNL 1KFAL 1ZHLA 3ULUC 3MLWH 4NKOB 4UNVA 4WI3A 5I74B 1XT5A 1MAKA 4F7EB 4ETQB 1MCPH 3C8KA 4GW5A 3GEWB 1ADQH 1A6VH 1Q1JL 2AJ3B 3HC4H 3D3VE 1U8OB 3N06B 1ZT1B 2DLHA 1FH5H 1GOFA 3RVTC 4WNQA 5JIHA 2X4OA 5J11C 2FJHA 2ADJA 2FNBA 3UAJC 2Y6SC 4KJPD 1HQRA 1QLRB 3CFKA 1LO2L 1FNEA 1UKTA 2C1PA 2FYYB 3O2DA 3AM8A 2NY6B 4HUNB 5FDYA 1PZ5B 4QTHB 1NFIA 1YEEH 3QPXL 3VI3F 2Q7NA 1JFQH 3P30L 3TPUE 3D85A 4GKZB 5ISZE 1ZA3B 1OSPL 2EKSB 4RMRA 3CU1A 1FC2D 2I07A 2BOBA 4F9LA 4YHLL 4OQTH 5CP7A 2MKWA 3QUYD 3TZVC 3KHOA 5I75C 4BFBD 1IM3B 1MF2H 2B4CL 2NX5D 1JVKA 1I8MA 2J8UA 5CWSB 3DUHA 2BVQB 3QULA 4UT9L 5H2BB 3VXOA 2DQIL 3MXVH 3V9FA 1UJ3B 4DK3A 4YHML 1JYWA 1VFAB 4JQIL 1BMGA 2HWZH 1U3HC 1QFWM 2X1QA 3JWOL 4R3SB 4M1GL 2QJDA 3U0PB 1KEML 1CGSH 1Z9LA 2YRZA 1T89C 4K8RD 3EOTH 4LF3A 2IAMA 4X6CA 3QDHA 3SKJL 3JV4B 4GW5B 1A4JA 1ZWIA 1FSKC 3PABB 5CJOH 3VFNA 2R1XA 3LKNB 4QRPA 5DD5L 4WFGD 3JTSA 4JFZH 4LEXH 4MDIA 3TIEA 3O9WB 4BQBA 2FX8H 1MCIA 4WEUD 4Z7VE 3DUSA 2QL1A 2C1PB 1FFPA 3GMPB 3TFKC 3PQYD 1EFQA 3T3ME 1G9MH 2R1WB 1I1YA 3C8HA 5FO8B 3GJFA 4NN7B 2Z92A 2XICA 3Q5TA 4GG8A 4OLYH 3UP1A 4Y19E 2EXWD 3MFFA 5FHBH 3DX8A 2X1WL 1MCWM 3W2DH 2OK0L 3V6ZB 1D5ZB 4OTXL 4CN1A 2W0LA 1Q94B 2ATKA 5E99L 1VEPA 2LVCA 5T5NG 3SDXE 3BDBA 5I1DA 5MENA 5FO9A 4JO2L 3NFNB 3BDYH 3CSBA 5E7FA 4HK3J 4PY8I 2ZNWA 3BFOA 5FOBA 3BT2H 4C57C 2BMKA 4UV7L 1NCDL 4AJ0A 3O11B 3VWJD 1JN6A 1JYNA 3HZMA 1OL0A 1CGYA 3FRUB 3FQNB 3NMEA 4P2OA 4KI1A 4UB0L 4MHHG 5HHOD 1U8MB 5E6ID 3GBLA 4LF3B 1IGTB 4YQXH 4ZDHA 4M5ZL 2XWTB 1FGNH 3B83A 5T1LD 1ZWIB 5FKPA 2GJ6E 4X9BA 1BQLH 4LSVH 3NA9H 5F71A 2UZIH 5I2IB 3O8XC 3P0GB 3JTSB 5LQBL 5IBUG 1NAKL 2D0GA 3CX5J 5K33A 4S1QH 3BRDA 4S1RL 5BOZG 4G80B 3ZSSA 2GYSA 3OG6B 1CL7H 4ODWB 5KVDH 2QKIA 3SGKC 1UB6B 4H20H 3J8F7 1Q72H 2EC8A 2VUYA 2KL6A 5C0FB 4R96B 1CE6A 3MFFB 2GI7A 3RPIA 1LO3H 3TH3T 3IJHA 5H37H 1GGIL 3MUHL 3JVGA 2YZ8A 4L3AA 1X5ZA 4P2QE 1JGUL 1UT9A 1D6VL 4NM4H 5IB3B 1TDQA 5C6WH 2IADA 4XHQA 4WUUD 1KLUB 4KI5D 3DMMC 4DQOH 1G6VK 3RIAK 5HBBA 1J0KA 43CAA 3B2UC 5FOBB 4HCRL 3OAYH 5TDPB 3CH1B 4QHNB 2P5EB 2V2XB 1BFOB 1JN6B 5EC1A 3HZMB 4N0UA 4L8SA 2VQTA 2KKQA 4QKXB 1LO4H 5IMMB 1MCWW 3WLWD 3GM8A 4NQDE 1AKJD 5A2FA 2ICWI 4C56B 5CFHA 4PRHB 4KJPC 4F8QA 1G7JA 1RZ8A 3CMGA 1FL5A 4M6MH 5FKPB 1UC6A 5E8PB 1HXMA 3ARBC 1BVKA 3JV6B 1AC6A 3Q1SL 3U30B 1KACB 2Q3ZA 4X8JB 3W0WE 3WD5L 3JZ7A 3MJ9L 1DBMH 1ZEAL 1B2WH 2YMXH 1BOGA 4UMGA 1EHLH 3IDMB 2AXFA 1UM4H 1D5IL 1WBXB 3GB7A 3STBA 5DJXA 4LFHD 4KHXL 1U91B 2OX5A 1B88A 3OB0K 4MSWB 3QXAB 1JMZA 4DVRH 3DVGA 5DRXB 2CLRA 3GSNH 3BEWB 1CE6B 4WV1C 3P9MA 4O2FB 1PKQE 1HIMH 2GFBB 5D1QB 2XWJA 3HFMH 4UAOB 3OKMA 4MJ2A 1NMAL 3JTCA 1FNGB 2WUBH 4X5LA 1MHHA 1X6NA 1OAZH 1T21A 1JF6A 3B2VL 1II4E 4PLNC 4K8RC 35C8L 1QBML 1MFDL 4JREB 1P7KA 3PNWB 3OL2A 2YKLH 1S9YB 4AK1A 1KCGC 2BFVL 1I4FA 2O61A 2X9WA 3BQUD 3VG9C 4HD9A 3S37H 1C12A 5J3HD 1ITCA 3V6OC 1HYRC 2CDGB 3HC3H 5CCKH 1YQVL 1VERA 4PTUB 4FS0A 4IOFD 3MLPA 4U49A 1UA6H 3OF6D 2JIXA 3UJIH 4HUXA 2IBZY 1AQDA 4FP8L 3I3DA 3QT2A 2QTEA 1MCDA 4J23A 3UPRA 1HXMB 2H8PB 1VHPA 3TA3B 5E6YA 1KELL 3TIDA 5J13C 1DEEB 4X6EB 4XCNA 4MX7A 5E8NA 1IT9L 1BOGB 2EXWC 5JA8B 3KAAA 4OGXL 3HZKB 2AXFB 5FYJL 1VGEH 3LEXA 4QHMB 4P3DB 1J5OH 2MJWA 4AY0A 4LGRB 4F33A 2BC4A 1CLOH 4X9FA 1AGFB 4GG6E 5AUMA 5JIPA 3ZE0E 1MELA 3DYMA 3DVGB 3KPRD 5I1IH 2ATPB 3QHZH 1KLFA 5FGBC 3EYOA 2NXYC 3SE4A 5D1XA 4LK4A 3RY4A 1EV2E 4X9HA 1D5MA 4H5SB 4J7RA 5TQ0L 3VWKD 5MEQB 4ORGA 1YPZA 2D4DA 2YD6A 5D71H 1U0QA 2VLKA 1T21B 2IQ9L 4OLVH 4JFXB 1KF9B 1F6FB 3OAUL 1IGFH 5FM4A 2HT2C 3RI5F 4YWGL 2AEPL 3WNNA 3QXUA 5JMOC 1C12B 3FTGB 2CXKA 2UWEF 1WSST 1NBYA 2AQ2A 3AY4C 4GQ9H 3AREC 5JHLH 1KN2H 3JV5A 5DO2C 1DANU 2Y7QA 2DYPA 4QXWA 5EOCH 3OKYA 3MREB 1I1FA 2NPLX 3TGXA 2WBWB 3RWFA 3RA7H 1EEUA 4WWKA 3TC9A 2PW2A 5DJDA 1RZGB 2OLDA 3C60D 3BKYH 1UH2A 2W91A 4Y1AD 1DL7H 3V5DB 2DJUA 4A6YL 2OTUB 5E8NB 4GW4A 3TBYA 3D9AH 1F4YH 4NQVB 1FG2A 2YBRA 4JAMA 5IF0B 3O3DA 1WBZA 4BZ2L 2UYLB 5EBMB 1YEIL 1RUMH 4N8VG 5CIPA 2GTWA 1A6WH 3LIZH 2YPKB 4FQHB 1MRCH 5I1JH 1KPRB 1ORSA 4KI5C 1ZMYA 5C3TA 1V5JA 4EZMA 1WAAE 4WU7B 4NFCA 4OSUL 4JO4L 2XN9B 4HG4J 5B3NA 1ACZA 4YX2H 4P2RA 5DA0B 3MV7A 2A6JA 2MCG1 4XP9H 5E8DL 4HDIA 4LLDA 1Z9OA 2BZDA 4XZUA 4CDGC 5KS9E 2AXJA 1LK3L 5C0BD 4ORGB 1XZ0B 2MPAH 5HGDA 1BBDH 4Y5VA 2MHAB 5LBSH 1RJCA 2I26N 1HHJA 3WLWC 3W39B 1A1NB 4J3SA 5F7HA 5JW3H 1BPVA 5EG6C 3WE6B 1N4XH 3PGDA 2D7NA 4OM1H 1HSAB 4K7FA 1FPTL 1T7ZA 2FL5B 4APQA 4M5YL 3FFCE 4JM2F 5CSBA 1NJ9A 2HVJA 1A4KA 4NO2A 1AH1A 1CFNB 5TF1L 4NQSA 4X6BA 4JRXD 3VXRA 2BNUA 1J1PL 1HHHA 2W38A 4PJCF 4IRZL 2HTKD 2JJWA 4MA1B 4IRJD 1AIFA 4C54A 5KG9B 4UINH 2RJMA 1Q9WB 2APTA 1FG2B 1OGAD 4JAMB 4NZJA 4M7JL 5IB4A 4K8RH 4R4NC 4LQ1A 1C8PA 4R0LB 1QSEB 4TNWK 1FL6B 1UZ6E 5E70A 1P4IL 4N1CA 4K9EL 4EQ2A 2BOCB 1ORSB 4P3WA 4AMKH 1FORH 5INDA 3X12B 2C3XA 4P2CG 4OF6A 4EIZC 3FT4A 2R8SH 1YZZA 4HDIB 4PDCE 2FSEB 2EH7L 1KPUB 3MZTA 5J3HC 4PRIA 5KJRL 2XG4A 4Y5VB 4JO1L 4IOFC 3TN0A 2D03L 3D85D 4CN6A 4PLKD 5GXBB 3E6FA 2AXGA 3VXSE 1A7OL 2CIIA 3VXME 5KOVC 4GRLB 2EIBA 3IFOB 1A4KB 3I2CH 4NO2B 3R0MA 4ZS6D 1UB5B 2AJUH 1E4KA 3T2NH 5CP3A 1I9IH 2AEQH 3S35L 5INCB 1XGPA 5I30L 2NTSP 3I02B 4HBCH 1PSKL 1Z0MA 4W70A 1DBKL 3C2AL 4J12A 1HHHB 4AG4H 1OT1A 2PXYC 2B1HL 2AW2A 1Q9KA 5IFJA 4PJFA 5E9DB 3QQNA 2MQ0A 2IQAA 4OZHB 3NFSL 4OFYA 5IB4B 5JW4R 2IAMD 3N50A 5DUBA 3LVEA 4GJTB 2XKNB 4L4VE 3IU4L 4CW1B 4Y16C 3VWKC 3UTOA 4F57L 1NCBH 1C1EH 4G6KL 4PGCB 4QRPD 2DJSA 3OHXA 5E2UH 1WFTA 1N2RA 2ZUVA 1JF1B 4GG6F 2HN7B 4I3SL 5BCAA 1HHIA 4D0CB 2D0HA 4GRWB 5DMKA 3S5LB 4LHUG 2LV4A 4ACPA 4OLXL 1KTRL 3R1GL 5DURD 1GPOL 4PP2A 5ILTL 2Z35B 4X4ME 4HCRA 3E6FB 1HK6A 3LDBC 5F89B 5DEGB 4KTDL 5CD3A 4X6DB 1YY9C 1KENL 2HT3D 4N0CA 3S37X 2X1XR 3F58L 4TSAH 2BNQA 3CD4A 3PWVA 3V79C 1XMWA 4JY5L 5MEND 3K8MA 4YHOH 4N8VA 3QPQC 4NZUH 4TSBL 1IGJB 1NFDE 3FB6B 4P49A 1OAQH 4H88H 5FAAA 3WS3A 4K94C 1GHFL 2WP3T 4P4KA 5BV7B 1F6AB 2D9CA 1Q9KB 3TH2T 1SBSH 3FT2A 2R69L 3WJJA 3K2MC 4P2OD 3KJ4B 1UWXK 2IQAB 2X42A 1S7WA 3IXTA 2QR0A 4OD2B 5T1MA 5ID1A 2ID5A 5KZCD 2I9LA 3RNKA 3SY0A 5EU6E 2CUHA 2NY6C 5AYQA 3EYUL 2AXHA 1AR1C 5LVEA 1LGVA 4LLYA 3AXLA 2Z8WC 5DHXB 3GSXB 3CUPA 4LASH 2VISB 4HZLB 3X11A 1X5IA 3ARXA 1CYGA 1A2YA 4TNVF 1U8IA 4V1DB 5HHMB 3MRNB 4ODHL 5CEYA 2DL2A 1WAAF 4U1NB 5HYQB 4MMXC 5J1TC 1MCFA 1JF5A 1CE1L 3ZTJH 1EVUA 2KBGA 3QO0B 4EUPH 5ERWA 5DYOB 3KYNB 5CD3B 4NKDB 3I6KA 4FTVB 4H0IA 1S9XA 4QEGA 3L3OA 1UJ3C 5C07E 4FQXB 5C0CA 3THMH 5HHPB 3ZMRA 2HTKC 7FABH 1CGUA 1CTNA 4IRJC 2ITCB 4KQ3L 4ZSOE 1FFNB 4IRSB 1S9WB 3T65A 3LQZB 3OSKA 4NUJB 4O2EA 2VOTA 3WIHH 3GHBL 3HRZA 2ARJA 3SJVB 3BP5A 3S97C 1CU4H 2KH2B 1DBAH 2VLJB 3FT2B 4XNUH 1GYAA 3FMGL 5DHYB 4KK5D 1BZ9A 4HJGB 1R24A 2J5LB 4U4BA 3BJ91 4X8XA 1CT8B 1M05A 4KAQL 5T1MB 3SDDA 4I0PA 2J8OA 3LEYL 1T2XA 2I9LB 3DRQB 3AM8C 1M7IA 3HB3D 5TE4H 1TZGH 4HPYL 4KTYA 3RRQA 5C8JA 3GKWH 1RUKL 4S0SD 1UZ6F 4XP5L 4F9LC 1U8IB 3HZYA 4MCZA 3KPSB 5FUOH 4ZS6C 3Q6FB 4PRAB 2JE8A 2OL3L 4QRQB 3S34L 3H9SA 4LLWB 3UTTE 2XZAH 5DTFB 3QG7L 2Y36H 5CILL 3KLAA 3GMOA 1J12A 2DBLL 5B8CA 5JXEA 3ARWA 1P7HL 3DI2B 2YHGA 4JDTL 1RZFH 3T65B 1ZHBA 3ARFB 5D2LA 3CDGA 1YMMA 2FH6A 4O9HH 4PRBA 2IAMC 2CUMA 5JHDE 4Z77A 2H9GB 1XGUA 5BJTA 3ECBB 2ICWJ 5DK0A 1UQSB 2V9RA 4OFVA 4A6YA 2EDBA 5ALCL 4MAYB 4MQ7B 1OAYH 2GSIA 3BIBX 4HFWA 1KEGH 4DKFH 4F2MB 2PN5A 4GAYA 3LS4H 5L0QB 5ITFB 5SV3A 4P57B 2JIXD 3VD3A 3MUY1 4ZUWA 1CXLA 3Q6GH 5I1GH 4LCWA 1NGWB 1B0GB 1R3JA 3X13A 1F8TL 4HK3N 5IR1B 4XNQA 4PJIE 1BJMA 2D4FA 1T04B 1CLYH 4JFFB 1BD2E 1BF2A 3GO1H 3CC5A 3KPMA 2HT3C 1A9EB 4JFOA 3FONA 4LNRA 1KGCD 4K3JL 3QFDA 4H1LA 5D7LA 2WWKO 1OPGL 1MCNA 1P4BL 1CXHA 3QDMA 1V7NH 3H9SB 1IEBB 1AGBA 3BI9X 5D1XD 4ZTPL 2R15A 3U7AA 1BIIA 3KLAB 1DQLL 1TCMA 4N90D 1ZHBB 3HUJB 2VLKD 4P2OC 4LPWA 1KCLA 5F3HA 3O0RH 2F5AL 1S3KL 4H26B 1OB1A 1T1ZB 4ONHA 4PRBB 1H3WM 5BQ7B 2YUXA 3GIVB 1J1OH 3PHOA 2VLRA 2NY0B 2AP2A 1F90L 2X70A 1AR2A 3GMNA 4JKPL 1NFDF 4JDVA 2EDXA 1TMCA 5LKNA 1KUMA 3ARGD 2H2PD 2O5YH 1AQKL 5JXAL 2DYPD 4NUGH 5HHVL 4YHYC 1B0RA 1UXWA 5GRZA 4WWKD 1DQQB 3RY6A 3X13B 5SWZE 4R2GD 3S96A 4LRIA 1TVDA 1W0VA 4OZGA 5EUKA 4Z7WB 1CLCA 3U0WL 1BEYL 2PF6A 2GITA 3LS5H 1R0AL 1AD9B 4OKVA 3JVGC 2W0FA 5F7NC 3WFEH 4ODVL 5DJZB 4I0KA 3RU8L 1C08B 3N9GL 5JORB 4MB3A 4ODUA 4X98A 1LP9E 3EO1A 1HXYA 3DGGB 1XR8A 3MRGB 3ZHKA 2NXZB 4Y0GA 3L5WA 1HDMA 2DQCH 5D70L 2R2HB 4PJ5B 3G04B 4P99A 1A6UH 3CCHA 3BPOB 4P2RD 1YEJH 3MV7D 1FNAA 2EIEA 1WFOA 4QRRA 4ZD3H 3MO1A 4DFHA 4E42B 2R29L 3F7QA 4JVPA 3F5WA 2XTJB 2VXVH 3FN3A 2BRRL 4L8SC 4GAFB 1UCTA 4KK5C 4BK5A 2XTLA 3CPLB 1IILE 3CFIC 3QIWA 3WNPA 3PXHA 4LVNB 1BVZA 1WEJL 4Q58C 4WGVB 2QHRH 4Z7NF 4BH7B 4APQD 4G8IB 2AAVA 4PREB 2EDLA 3MRHB 4KDTA 5J1AA 3MNZA 4GBXD 1MNUH 4XMPH 3V4UH 4IOIA 5IJVB 4XNYL 3VXRD 3WO3B 4KMTL 3I75B 4NQCA 1IC5H 3O45B 2Z93B 4WVRA 2HH0H 5EUKB 3HNSH 1TJGL 4OF0A 1XGRB 1KN4L 1MREH 3IDNA 3V7AG 4JE4B 4YPGB 2DQFB 3TBSA 1A7RL 3LKRA 5I6XB 3OR6B 1F3JA 1AGEB 2ZKHH 2L4OA 4TTDC 5AAMA 4KKLC 1FV1B 2QQNH 4YBLB 4TUKH 3ZL4H 3U9UB 1EUTA 5IW6B 2NNAA 4PRID 4XVUD 2ZCKL 4LLMB 4XVTL 1W0WB 4JFDB 4PRPB 3IDIB 3TN0D 3QUXA 3TYFB 4ODTH 5C2BL 4GS7B 3QCTL 3T3PE 3ULUE 2DQGL 5D2NB 4MD4A 1KIQA 1I3GH 3C9NA 3Q3GA 4F7TA 3WJLA 1PW3A 3CFBA 5FF6A 4UTAH 3QIBA 4YHKL 5ESAA 4QHKI 4YEEA 1MIEH 3FL7A 3O3UN 3O6MH 4UV4H 1JPGB 5E00A 4RAVA 4XCFL 5HDBE 2AJSL 4FRWA 4OB5H 1WZKA 5JZ7C 1WUNT 5IHBA 3T0DA 1NLDL 4HUMB 4PJ7E 3ZT6A 4PGJA 1K85A 1RMFL 4W81A 5CJQL 2ZNXA 1TVHB 4QGYA 4TVPE 2BVTA 3RIFK 5IK3B 4RAHA 3L95B 4TOYH 4HIEA 4OFYD 4Z7UA 3SE4C 5C0IA 4DWHA 5D1XC 1I7ZA 4QYOB 3DXAA 1C5BL 3BW9B 3MLYH 4OF7A 5MI0B 5ACLA 3ZYOA 3HNVH 3MROA 3O2WL 1CDIA 4JANA 3PV7A 1CXFA 3EUUA 3DHMA 4UTBL 1RK0A 4OAWA 2B0SH 5HDQH 1GH7A 1KJ3L 4YXKL 4DGVL 4FQIH 5DF0A 1J0HA 3BP7B 1HH6A 1NDGA 1ZXQA 2J6EH 4HPOH 4U6YB 3A6BL 1AXTL 1EXUB 2Y07H 5GZNC 3GK8H 3P4LA 4JZJA 2NNAB 3PJSB 3MJ7A 1I7TB 2QBWA 1Z2KA 4KUCD 2Z31A 2Q6WA 2H26A 4Z8FL 4POYA 1A1MA 4KXZH 5CBAB 4ODBD 2DKSA 1NMCB 4WWKC 2OXGA 1KYOK 1KCVL 1T7WA 1EZVX 5FF6B 2BNQD 4PP8C 4PJEE 2BXYA 4L29B 3D39A 3OGCB 1SEBB 4U6XB 5GRWA 5ETUA 1DSFL 1VGKA 3W11D 3SE9H 2HLFC 2JB5L 3WV0A 4X4XB 4PGDA 3WFHA 1U3ZA 3D69B 1A7QL 4P4KD 1C5CH 5C0AE 1NLBH 1E4XH 4N1HB 1IAIM 1CL7I 1T5WB 4IEFB 4Z95H 1NEUA 5JPNA 4KROD 2AKRB 1YEDA 5IVZA 5TQ2L 5JDSA 3EAKA 1JZ7A 5HY9A 5GGQH 3KS0H 2F54A 5DVLA 1S7UA 1ZTXL 2B4CC 4CUCA 4NN6B 3O6KL 3MROB 2OL3A 4O4YH 4S10A 2DI8A 3SO3C 5IOPB 4Y5VC 1RK0B 2NY5L 5EU3B 1J7VR 4M43H 1G7HB 2J4WH 5DRNA 3ULSB 2ESVD 5HYJE 4PIRF 3JWOC 1UZ8B 1NQBA 4JCLA 3KYKH 5DHVB 4APQC 3BZEA 4GRLC 5FUZH 4AIZB 1A0QH 3QA3B 5HHQA 3S7GA 5K59F 4NHUA 3D3VB 2YWZA 1YNKH 2FRGP 3JWDH 3QEQD 2PO6A 1RZIA 5FGSA 1QFHA 4FXGB 5I18H 1TXKA 5C0CD 5EU4A 2HKFH 1ZA6A 5GIRA 1ZGLA 4R7DA 4OI7A 3KPQB 1FZOA 4IBLT 2P24A 3WFDL 5HI4D 3FZUD 5C08B 5ETUB 43C9A 3UBXB 1LEKB 5KVMC 2ZSVA 2ICWA 5ISZB 2NLJB 3NABH 4OZFA 4HKXA 5T5NF 1KCRH 3MGAA 4K55A 4R6UA 4EIGB 1MI5A 4NQED 5FYJD 1QTYT 5DD6B 3CFDB 5JPNB 1KCUH 4OZIE 4ZFOL 2G2RA 5T1DH 2CDEB 3SDDD 3WXWH 3X3GL 4I0PD 2DDQH 3OJ2C 5E94A 4OGYH 1OP3H 2VDNL 1ZVHA 4N8CH 4X4YB 1BFVH 1FE8L 3IKCA 2V17L 3K7UA 3TN0C 3BPNB 5I19H 1EEYA 4XPFL 5DRNB 3FQXA 4NJ9L 3B3IB 1JGEB 5IJKA 3ARDB 2R23B 4MNQB 2BDNL 3EJJX 3QDGA 2ZOKA 1UVQB 3BZEB 4K7PY 4G8GB 4FG6C 2XZQH 15C8L 3K0WA 1E4KC 2VO5A 3V4PH 3MZGB 2CGRH 3EYFA 4EDXA 3GJEA 4HJ0C 4RWYH 4O02L 2FGWL 1TCRA 1ZGLB 3MYJA 4Z7VB 1HHGB 4YXLL 5BV7C 4YUEL 4U2ZA 2P24B 3T3PF 3NGBB 3ULUF 5EOTB 1J88A 3WS6A 4JN1L 3V4VL 5C0GB 1YMMD 2P49B 2EXYD 5FA3A 2ZSVB 4UU9A 1T22B 1HQ4A 2FZ3B 3E8UH 1N59A 2YPVH 4PGEB 1SY6H 1JP5A 2VITA 3NCCB 4NSKB 3U9PH 4YC2B 1MI5B 4X7SL 5HDBF 2WBJA 1QSFE 4WHDA 4G5ZH 1EPFA 3SDXB 5FYKL 4PJ7F 1P1ZB 5KSBB 1ZK9A 3FO9B 2AI0H 2K7PA 3MRCA 2ZWLT 4LCWD 1IQWH 1CDCA 3OWEA 4ZODA 1WLHA 1KTLA 3C87A 1ORQB 4OZ4B 5T3ZL 1JHKL 4KV5E 1DN0A 1EEYB 4XT1C 3FN9A 5I1LA 3V0WL 1J10A 4MCYB 3JSSA 1FBIL 3AU1A 2VXQH 4N0CC 4Y4KD 5CZKA 1EIBA 5B39G 2W59A 2YN5A 1KSRA 5CIPH 4J1UB 5D7LD 4XC3H 3QPXH 3BXNB 1BWWA 4LLVB 2GJ6B 4ELMA 3LPWA 3QDMD 3P30H 4IRSC 4RBPH 2R2BA 3H0TB 3W11C 4NC0B 1G6RH 1OSPH 1Y0LA 3CZFA 5IW1A 1HOCB 2NTFB 3MRFB 4PGBA 5C92A 4YHLH 1A6AA 5FFLA 3IJSA 4GUPA 1IE5A 3MYJB 2B4CH 3UO1H 2AABH 1LK2A 1NC2B 4P4KC 5EUOF 4QF1A 2VDPL 3PQYE 3GMRA 3WJJC 4Q9BA 3OKLB 4HV8B 1U93A 4JPIA 1OAXL 4KROC 3TNMA 4KZDL 2YUVA 4UU9B 5GGSA 4UT9H 3UZQA 3HPLB 2DQIH 2VXSH 4YHMH 4PJEF 1N59B 2VLRD 4PV8B 1FRGH 5LGJA 1WTLA 1IARB 4P2QB 5SX4H 1WGOA 4NOBA 1KEMH 2R56H 3L3KA 3L7EB 4NBZB 5JNYB 1IKNA 3SKJH 3W5MA 4LKCB 5FKAA 3BP4A 4QHUB 3QRGH 3SCMB 5GS3A 4NQTA 1KTLB 3TBVB 3HI1A 3QNXB 1DQTA 4NYLB 5DD5H 2HMID 1RHHA 2YEZB 1M71B 3V95A 3HRPA 1AGDB 1J9CT 4NWTH 2YD8A 3T08A 5CD5D 4U3XA 4BSVB 1R5WB 1NH6A 5F7UA 4O58L 5B38A 3OXSA 1OWRM 4CVUA 2DBJA 3FZUC 3LRHA 3KLDA 3MGTA 1AXSB 1HH9B 1RZJL 4V3DB 4XP1L 2Q8AH 3DVFA 4OTXH 3UTPE 1XF2B 4QRRD 3VH8A 5ID0B 2NY3B 3G5XB 5E99H 4C4KT 2GAZB 5SWSA 1KBGL 3S5LG 4W6YB 1XGQA 2X4QB 1YC7A 4JO2H 3ZDXF 1NAMH 3GM0A 4HHAA 2C3VB 3QUMB 4TUJA 3QIWD 4UV7H 5D9SA 3SDDC 1NCDH 4I0PC 3PWLB 2XPGB 1PKQB 4MYWB 4X5WA 4FQLL 3F7VB 3MODL 5LGJB 1NBQA 5I1AA 4WUUE 4KI5E 2BNRD 4U1HA 4M5ZH 4S2SB 1DBBL 1ONQA 4NQCD 3QFJB 5KVGH 4YFLF 3QWOA 5J6GB 1NAKH 5ICXA 4ZUUA 1Z5LB 2GK0A 4Z0XA 4PJXB 2DLFH 5JOFA 4HIHB 3B6SB 4N0YL 1UGNA 3NPSB 4I4WA 3NAAH 1ULVA 3A67H 3K3QA 5B38B 5IB2A 2H3NB 1NCAL 4NQUA 5B8CC 5EDXA 5JXEC 2VUOA 1KJVA 4CNIB 4U1LA 4QXTB 2JJSA 1KB9K 3PL6A 1CICD 2VDQL 5D7KE 3INUH 1GGIH 2AJXH 3KNBA 1IL1B 1KC5L 3VH8B 4WI9A 2FD6L 3QI9B 2ZPKL 1J0ZA 4ONFL 3CJJA 4KHTH 5AYUL 4ZOAA 3OKEA 4ZS7L 1PGRB 3JTTB 1OAUH 4FOMA 3VD5A 1LO5B 3QUXD 5L2KE 4GKOA 3N85L 3T1FB 3MV9A 3T0AA 4W4OA 1UACL 4M61B 1MSPA 1FZMA 3VG0L 4BSWA 4G6JH 1DQMH 3OB8A 1K4CA 3QIBD 2DICA 4XI5C 2B8OT 4HBQA 3M45A 3VW3L 5HI5D 3KXFA 1ADQL 1A6VL 2JCCF 4OIBA 3CIQA 3W81A 2CDFB 1GJIA 5KTEH 4HAGA 1MJUH 3WD5H 4P2YA 3MJ9H 1ZEAH 5ICXB 3NIDE 2C1OA 1T1XB 5ICYB 4Q2ZA 4NDMB 1T3FB 1G9NL 3DXAD 1P84K 4KHXH 1QNZH 4QRTA 4KV5F 3UDWC 3C6SB 5EC2A 5KN5A 1MVFA 1LO0H 4FXKA 4U1LB 3GMLA 4YE4L 5IVXB 5KSAA 3EYVA 1N8ZA 3RUGF 4OQTL 1MLCA 4XP4L 1IKFL 4NCC1 2IMMA 1IVLA 4Q74A 4AZ8A 1NMAH 3O4OC 5D1ZB 1I3VA 2X4TA 3ABZA 3CFJA 3T04D 3QXTA 3V5KB 3ILPB 4JKWA 1TJIL 5IGXL 3MXVL 1QBMH 4YDLC 3TVMA 3MV9B 4QHKJ 1VFOA 3RVUD 4X9IA 5E8EB 4IMKA 2VE6A 3NFPB 5EN2A 4BSWB 2IBBA 3RY6C 1BVLA 1R3LA 3LN5B 2DRUA 2VR9A 4K9EC 2B1AL 4LPCA 1YQVH 4P46B 1OAKH 4LRIC 4XCCL 5HVHB 1UXSA 4JPVL 3MRBB 2HMIC 5KS9B 4Q9CA 4DN4L 4ZFOA 1K6QL 5EPMA 4K71B 4GLRH 2HJKA 4FP8H 5GPRA 2ICEB 5CD5C 3VRLF 3K8LA 4BSJA 2A9NL 4PB9L 1LHZA 4BK4A 4JFYB 3O9WD 4F7CA 1T66C 5I6XC 2X7LA 3CVHB 1XF4B 1ZHNA 4Y8DC 1IT9H 4IM8A 1RULL 4OGXH 5FYJH 1U36A 1PAMA 1G9ML 4WFFD 3UTZA 2F54D 3RVWD 3DV4B 4MD0B 1I9JH 5DEFB 1U58A 5EC2B 5FHBL 4FQJH 1T4KA 3MV8E 1UH3A 4Y1AE 1Q8MA 2Q76A 2NR6D 2NY1B 1A3RL 3QIWC 1JE6A 1Y6KR 5BO1L 4GXUM 3FRPG 1MRDH 3DIFB 4LNVA 5TQ0H 5DZLA 2FHCA 4PJDF 5LJYH 1FYHB 3BKJL 4PRNB 3IAPA 3FB5A 4M7KL 2FR4B 3X14A 3T0XA 2FIKA 4JZOB 5BS0A 2IQ9H 4KDTC 4PJ9D 3BT2L 1KXTB 4D0BA 1BQHA 2ADGB 3RWIA 4OUUA 3NH7H 3OAUH 2PO6D 5TGBA 1YN6A 3RDTA 5I8EA 2AEPH 1K8DA 4F7MB 4DTGH 3U0TB 3T0VA 4LKXB 4Y7MA 3FO0L 5KANI 1UEMA 2G75A 2LE9A 3P4NB 5DVNA 1JMXA 1U8NA 5C0BE 1FDLH 3C5JB 3ET9F 2HJKB 2XRAH 2GUOB 2C9AA 1BQLL 4MVBA 4LSVL 3D6GA 1IAKA 3MV11 2QADB 3PV6B 2KDGA 5TH2B 2H2SC 5EZIH 3TO4A 3IT8D 5LWYH 4A6YH 4TVSa 4M02A 4W68A 5ITBL 1D5XB 1HKLH 1CL7L 3CGTA 4MNGE 1QG3A 1XR9A 5MEOB 4BZ2H 4Z78A 1YEIH 2DMCA 2P8PA 4H20L 2HVKA 3RWHB 1Q72L 1RK1A 2V7NB 1I75A 5AZEH 2UUDH 4HKZA 4QT5A 1C5DB 4Y8AA 1N7ML 2AJZA 1I8LA 1LO3L 1CF8H 5HYSB 3QQ3B 3KR3L 3QUXC 1MFEL 3DX6B 4JO4H 3D0VA 1I3RA 1INDH 4MA3A 1U9KA 5JA9A 5L2JA 4YDVA 1JZ6A 3WJLC 6FABL 4HUVA 1DUYA 3FB5B 1OTSD 2D7PA 5CJ5A 4WFHD 4BKLA 3P77A 1BLNA 3QIBC 5BS0B 4H1LH 5MEPA 1OVZA 5D7IA 1MCJA 5KSVA 4OD1H 4P3CH 2EYTA 1B9ZA 4TUOA 1YN6B 2W60A 2NY2B 4M7ZC 3PUCA 4M5YH 2D3VA 4M8VA 5HGHB 3MACL 4L9LA 2CUIA 4LSDA 4NKIH 1E28B 1KJMB 3U7YH 3V0AC 3HR6A 5F3BB 3EDKA 4AH2A 4PJGF 3MBEB 3RWEB 4UQ2B 3D2UA 1P5VA 3RTQB 4IRZH 3QJHB 2WP3O 5DQDL 1WC7B 5IQ9A 3BUYB 4NIKB 1EO7A 2YMXL 5E5RB 3B9AA 1NBVL 2WBJD 1UM4L 4M7JH 3WLBA 1J05A 4AEHH 1BQUA 2PTTA 3FN0L 4U1SB 3AGVA 3U4AA 4FABL 3NIDF 4HKZB 3RL2A 3SDAB 1HI6A 1QPPA 4JZJC 2FEDD 3GBNL 3SDCB 3QG6A 5CSZB 1OTTC 1ZT7B 5C0EA 5D1QD 1ZANL 2Z31C 3D0VB 2DQUL 4MA3B 5DQ9A 5IG7A 1XGYH 5D5MA 2DJ4A 3OKOA 2EH7H 4X6CE 1KT2A 3TNNA 2A73A 5KJRH 1H3XA 4JO1H 2UY7A 2XOTA 5EU6B 3JV0A 2P48B 2D03H 3BP6B 4RGMB 4QRPE 1BHGA 3REVA 5MERA 3WIIL 1A7OH 1UWEH 4D9LH 3NZ8A 3HC3L 5CCKL 2XV6B 2ZUTA 1VFBB 2H41A 4G6AD 4OJFL 1ZT4A 4NNYA 4XAKE 4Y4HA 3ULVC 1S7VA 2RFXA 5E95B 3IVKB 2YC1B 3QNZA 3TEUA 3S35H 2C4FT 2HLAA 3UYPA 4PY7A 3UX9B 3C6LB 1N3NB 1WWWX 1DBKH 3C2AH 4J4PC 1JK8A 1CIDA 2M26A 2B1HH 2JJTA 3E2HA 5TPWH 4E5XA 3UPAA 3ES6A 2EYRB 1J5OL 1F58L 3BPNC 2EZ0D 4ZSOB 2OI9B 4FQPA 5DC9B 2NR6C 1CK0H 4MB4A 4D94A 2DD8L 3IU4H 1KIUA 3V0VA 5I1IL 3QH3A 4F57H 1HI6B 4WTZG 1A6TB 1T0MA 4HFUL 4YGVA 4G6KH 3VXUA 2P5EE 3GSQA 2A38A 1HCVA 3OKKA 3OKDA 1H3VA 3I6GA 4TRPL 5C0EB 3ROOA 2FX7H 2PO6C 1MJ7H 4I3SH 2V9QA 2Z91A 4JR9H 5ADPL 5L8KB 4OUOA 4HH9B 2WBKA 3IAQA 4OFPA 2PYEA 1S9VA 4CRPA 4P5MA 4OLXH 4Z0BH 5E8OB 4FZEL 2YXMA 2RCSL 5ILTH 2BY2A 1IGFL 2WLZA 1ES0B 3M1BB 2GTZB 2EDKA 4DEPB 4DZ8A 25C8L 3KVQA 4KTDH 3X17A 2AEIT 1KENH 1SJHA 2YD9A 3NACH 4GQ9L 2WSKA 3F58H 5JHLL 4G43B 2V2TA 1XFPA 1VB9A 4JY5H 1HSBA 5SWSD 4CVXA 2M2DA 1ADQA 1WITA 3U36B 1T03H 4L3ED 2P8LA 4TSBH 1GGTA 2D31A 3VRIA 1K2DB 3SKNB 1AD0B 3BKYL 1EAPB 2CK2A 1DL7L 4HWEL 2J1KA 2APVA 3TP4A 2R69H 1YY8A 3D9AL 5FCUH 5ACZB 2HRPL 2EE9A 3V5HB 1X4YA 5I66B 1I9RL 4G7YL 3RHWK 4YDJB 3QDJA 1MCSA 1MCLA 5CKAA 1SEQH 4RDQG 3HG1D 2MFNA 3LIZL 5GSVB 5E1AB 3BEVA 4MA8H 5I1JL 4L8DA 2LTQC 1T0MB 4MJIB 4R4FL 1OTSC 2H32A 3EYUH 3VCLB 5BRZA 4N0UE 4OQTA 5C71A 4YX2L 1GGBL 3AVEA 3UZVB 5GRVK 4XP9L 3G6JB 3L9RB 1QRNB 2VL4A 1IBGH 3STZA 3PGCA 2MPAL 4L1HA 1BBDL 3MJ8A 4RWHA 5LBSL 3HE6B 4KKCD 1G1CA 1M1SA 5L88L 1QFUL 4UUJA 3T0WA 1N4XL 3RZCB 3VXTA 3WS6C 3PL6D 3ROLA 1AY1L 2G5RA 4DZ8B 4PJIB 3REWA 4HLZG 1A1OA 3I50L 1UG9A 4HULB 4U6VL 3OXRB 5KAQG 3S3SA 4P23B 1JWMB 3ZYZA 4OFKA 2XXCB 1A7NH 4ZO9A 2LU3A 3A6CL 3FB7A 4ZQKB 4KQ3H 3DI3B 4MJ6A 1UENA 1VPOL 4LAJH 2UVFA 4U1JA 3AAZA 3MRDA 1CG9B 1XCQB 3O4LA 4MWFA 3CXHK 1L0QA 4JFPA 1TZIA 3UJTL 5EO9A 5FCSH 3L3HB 4TULL 3N1MC 1RV6X 1VADA 4P59L 3FMGH 4PJ8A 5HI3D 4J3XA 4ZO7A 3KXFD 1N64L 3PXJA 5E5MB 2RHEA 4KAQH 5I76B 4N9GA 4QXGL 4N1EA 2R0ZL 3EOBB 1NC4B 5AZ2L 2AQ1A 5DWUL 4BQ6A 4EN3A 4AMKL 1F42A 4HPYH 4ISVB 3RJQB 3SBWA 5BVPH 5GRUL 4RFEA 3EOYG 3WFCH 1RUKH 3STZB 4XP6L 4WUKL 4XP5H 3L3JA 4UZGA 4PG9A 1UH4A 3WMSA 5IVOA 4RMVA 3VE0B 2YPLD 4G6AC 3IU3B 2V9TA 2NY3C 2VYRE 3MUJA 5EORH 2IBGA 2IH3B 4XNXH 3VFSB 4I48A 1OSZA 2OL3H 3QNYB 1R5VA 1T83A 5ADOH 5SWZB 3MGOB 3ESUF 4U6HB 2BHYA 4LMQE 4K2UL 3FOMB 3I2CL 2ARJQ 1G7IB 3NZHL 5CILH 3T2NL 2AEQL 5FUCC 3MUZ1 4X99B 4ODSL 3W82A 5F7FA 3G5ZA 3G6AB 3AAZB 4XCYB 4L4TA 5JLZA 3O4LB 4MWFB 4CMMA 4HW6A 4ZUVA 4KKNA 3TVMD 5BZDB 4P9MH 1LP9B 1IKNC 5DQJA 3PGFL 3TH4T 4GAJH 3VDCA 4OCXH 4U0RC 1L0XA 3ZE2F 2YUZA 1KG0B 4L3CA 1YPZE 3DPBA 5D7JB 2Z4QB 3P11L 4WW2B 4OLZH 4GMTL 4ZPVA 3OZ9L 3GSVA 2IPKA 2FX9L 3HKFA 5I1HL 3OR7B 1C16A 1T1WA 2MSPA 3NPSC 4JHAL 1F8TH 4OZFH 1M7XA 3LMJL 1U95B 3UYOD 3H6JA 2I9TB 1QBAA 4LLUA 2HJLB 1IGCL 3IETA 4XXDA 5FHAL 1JV5B 4OIAA 4PYHA 5HGBB 5F1NB 2W07A 2X2YA 1L6ZA 4EI5B 1MWAL 3LN4B 4M9PA 3I3EA 2C4XA 1X4ZA 4LOUD 3UTSA 1IM9B 3IGAB 3LOWA 1BF8A 5F1IB 1P4BH 4KRPB 1R5VB 3QAZC 2F9BT 1K8IB 3QUZB 1AI1L 4CBPA 1U8LB 2V6HA 3BZ4B 4ZTPH 5GRYA 1AO7D 1RJYB 2HTLD 4KWUA 4LCYB 4NZUL 1QSEE 3S35X 2O93L 4HIIA 5KW9L 5JLZB 2F5AH 1XCTA 1S3KH 3SGJA 3B43A 3RDTD 4KRLB 3MJGX 3N1QC 3IDJB 1F90H 4P2RE 4JKPH 3MV7E 3L3GA 5CUSL 1REIA 2AK1L 3WHE1 1AQKH 5IMKB 5JXAH 5FYKD 3HA0A 5GHWL 1RVFH 5DC4B 3LRSA 5HHVH 2JF1A 4MVBD 1MJJA 5FXCH 5IV2A 4DOHB 4U7KA 3TO4D 3WN5A 2V2WA 1ED3B 3IFPA 5H94B 5T3ZD 4S11A 1A7PH 2IANA 1BJ1J 5C6TL 3U0WH 3BJLA 3W9EA 1T0PB 3DV6A 3IETB 1ZHKB 2JJSC 3PL6C 4PRDB 5C0DA 4P0DA 1N6VA 5ESVB 1R0AH 1R5IA 2L7UA 3SPVB 4K23L 1QP1A 2AK4B 3KDMB 4ODVH 3F6IA 5GGUB 3RU8H 1FO0L 3N9GH 3PE9A 5TDOB 3OAZH 3VXRE 5J11B 3PWJB 5F8QC 4DKDC 1AGCB 2YSSA 3OG4B 1DN2A 4IMLB 1F00I 1GAFL 1YYLH 3O41B 4FQXD 5GGVY 5E9DE 3DYOA 4U7MA 4ZAKA 3V6FA 4D0DA 5C86A 4KJQC 2BRRH 4UOJA 5HI3C 2JK5B 1Q9OA 1T80A 4LSQL 5DJYB 3TZVB 3HMXL 5SX5H 3SJVD 5I75B 4K71C 2BY1A 1CU4L 2VLJD 4QGTA 1DBAL 2X4RB 3TJEH 1BZ7A 1XH3B 4XNUL 4ORZC 5DD3L 1DDHB 2H6PB 3NIFF 4NWUL 5T1KB 4Y4FA 5CMAB 1LD9A 4M03A 4F7PA 5B22A 4ALAL 2NY5C 3LQAL 4GRWE 4B5EA 4K7PL 1VEOA 2Z0BA 4PRIE 4Z6AT 2DM2A 1JNLL 1U3HB 4XTRD 1IAOB 3TYGH 4RIRB 4XNYH 1WIUA 5TE4L 1IC4L 4PJAB 3D2UD 3GSNB 5I15L 1QSZA 1U8KB 1ETZA 2BJMH 3DVNA 2IANB 4HS8H 4DN3L 1MHPL 4WDIB 3VFTB 3GKWL 3SGDI 4NKMA 1FSKB 2WNGA 5KSAC 4KTEH 3VMPA 1B0WA 2NY1C 1A7RH 1F11A 3HI6H 1WWCA 2RBLA 3E0GA 1JZ8A 3NCJH 3EOAB 5IMLA 5JQ6H 2NZ9D 4QY8A 2ICCA 2XZAL 3PWNA 3FT3A 2W65A 4PJFE 3G5YB 2ADFL 3PP4H 4HUUA 5HPMB 1HNGA 4U1KB 1JRHI 2X4PA 2ZOLB 3MNVB 4RMUA 5JOEA 4D0DB 4WEBL 4AEIL 2CLZB 3ARFD 1RZFL 5DDHA 1CQKA 3DX7A 3WUWA 5GSRA 5EA0L 4XVTH 3BOVA 3AROA 2P8MA 4Y19A 4Q9RH 2EEDA 3EW3B 2XWBA 3GMMB 4MAYD 2BVYA 4IDJL 5JOPD 4Y4HD 4DVBB 1KTDA 3J7HA 4YHKH 3LS4L 3LEVL 5J1SC 3TT3L 4LEOA 4E41D 4V1DE 1O5DT 1E6OH 2UWEA 3Q6GL 1A47A 5BOPA 5I1GL 2GJJA 2V5SA 2AJSH 3KLHD 4OCSH 4D9QE 2D7OA 3HLAA 1NLDH 4PP1C 3FAWA 1AJ7L 1RMFH 3TWCL 5CJQH 1IAMA 3DVNB 5IB5B 2BNQE 5HGAB 3B9KA 4GFTB 1WT5A 3VXQB 1IEAB 4S1DD 1C5BH 2VZ1A 3KPNA 1FVCA 2DWDB 1V7NL 3O2WH 3FQTB 5ELIA 3NCYS 4QRSA 4UTBH 3F12B 5LAXB 4I2XA 2W65B 2E9BA 3FQUA 4BQ8A 1KJ3H 2AGJH 3HPJA 3QUYA 4DGVH 3QYCA 4JRYB 3RDTC 3A6BH 1AXTH 4OZIB 1CLZH 4FQCH 3T0EA 3EBAA 2HFEB 4H8WH 5DMGD 3IFLH 3DX7B 2PYED 4G42A 5CEZE 4JZNA 5L8LB 1GOHA 3O0RL 4ELKA 1WBYB 1FFOA 4YHPA 4RGNB 2A74A 3DX9A 3RL1A 4PV9B 2PCPA 5BZWB 1J1OL 5J7CC 5DGQA 4NCC2 4Q0XL 4P4RB 4MVBC 3SKOA 5DR5H 3DMMB 4M48L 1TNMA 3TO4C 1XF5A 2O5YL 3RZWA 4N0FA 3G9VA 3BH8A 4CMHB 4JM2A 2F53A 2SEBB 3KPSE 4GRMB 1M6OA 3BESR 3M17A 1KB5H 3E6HB 5FDWB 5F7LB 4WU5A 1A7QH 2GT9B 5HVWA 4YHIA 4N68A 1EZVY 3EYSH 3SDAC 2R1YB 3QO1B 4PJCA 1OWWA 3LS5L 5C0CE 4EOWH 4L8CA 3IJYB 1IC7L 1WFNA 1JWSA 3VI4E 1TJHL 2XIDA 4NQDA 3QDJD 3WFEL 3BN9D 2A6DA 5B4MC 2XI9A 4QCIB 2VL5A 1PYWA 1ND0A 3CZJA 5DRZA 5BRZD 5DLML 3O3AA 1QSVA 1K4DA 4YFLI 1QHOA 1OLZA 3QUYB 3GIZL 4RGMC 3RWCA 4HIJA 4B7IA 2NX5B 2Y1VA 2XTJD 3BE1L 2QHLA 1DUZB 4JZNB 3OTTA 4NGHL 4WV1B 1MY7A 4L9LC 1RZ7H 3KPLB 3GJFK 1NCWL 4OZHF 1S7QB 4BA8A 3VWJA 1ZS8A 3LRGA 5JW5B 3DRTA 1D3CA 3GSUB 1G9EA 4O51B 4U7SA 3TV3L 4XNZB 5HHOA 5E6IA 3BH8B 3QJFB 4UIMA 1KIRB 3BGAA 3NA4A 3ILQC 1MAJA 4RAUB 5B21A 1JHTB 5I73C 4EKXA 5J89A 1IC5L 3H9SE 1EEZA 1QA9A 4L9DA 4GRWF 5FGRA 5IHZB 4PJ8D 3T8XA 4PGZA 1AXIB 3WL9A 1MREL 2NZ9C 2YN3A 1U92B 4R8WL 1FFRA 2CKBH 3CDCA 3HR5A 2A6DB 3HUJE 3PQYB 4YK4C 4X6DF 5D2LE 1MWAA 1OGTA 1YMME 1DLHB 3FFDB 5D72L 5J13B 3MOBH 2VL5B 4WENB 4EN3D 2VDNH 2QLVB 4OF3A 2HP4A 2ZKHL 1FE8H 1HHKB 2V17H 3O3AB 1NEZA 4OLEA 2DQTH 3BZFB 2QQNL 1KNOA 4NRZA 1OCWH 4TUKL 4QOKA 3SEPA 3QXWA 4ZUTB 2BDNH 1DE4B 1CR9L 5DJ0A 1ZSDA 3R06B 2O5XH 4GG6A 15C8H 4YXHL 4WFEE 4ODTL 1FZKB 4LCWE 1FN4A 3QHTC 1F13A 3EKCA 5HYSG 2RR3A 2F8OA 3KLHC 4D8PA 4LIQH 1EHNA 4EI6B 4FZ8H 4O02H 5F9WB 2MKLC 1DJSA 5CGYD 2QQKH 2JJTC 4JDZA 5DD0L 3U2SA 3E2HC 1MIEL 3MR9B 4C4KO 1AKJA 3B8SA 1ZLUK 3O6ML 3PP3H 4XAWH 3LKOB 4HMCA 5EWIL 4JN1H 4OB5L 5T1LB 3LSOA 2Q87A 1E27A 3VJ6A 4QNPE 4MD5A 2ZUQC 2GW5A 4S1DC 2I5YH 5FB8A 3CH8A 1NDMA 3U82B 4AENB 3G5VA 4ZUSB 4TOYL 3MLRH 2VB5A 2WQRA 3H8NA 4ODXB 3U4EB 5CBEA 3MLYL 5GS0L 3QEUA 1FNSH 3QQ9D 3PHQA 1FO0A 3SO5A 4GXVL 5HDOA 2P7TA 1JHLL 1RUAH 2AV1A 2OJEA 2VLRE 2V7HA 4NO0A 5IEHB 5E08H 5T3ZH 4FQIL 1JHKH 2J6EL 5AD0B 4OFDA 1G7MB 4RNRA 4TQEH 1FBIH 3U7WL 3GK8L 4JGMA 3FO1A 4WUUB 5DS8A 1CTOA 1OY3B 4BZYA 3UTSD 1BAFH 3L3DB 2FECI 3HMXA 5GJSH 1QVOB 1WAAA 4XWOC 2Y06H 1D9KA 3BKCL 5EU7C 32C2A 4NNXB 2GJZA 1J86A 3C5SB 5GS2D 1HWGB 3HMWL 1AKJB 2VDPH 3SE9L 3WFZA 3RPKA 4MXVF 4PD4J 5I1CH 2G9HB 3KS0J 2BSRA 1F4WL 1OAXH 5DFWH 4KZDH 3BN9C 1N6QL 1QFWH 1S7SB 3BAEL 3RIAF 1NLBL 5FB8B 4H0HB 2PW1B 3FFCA 4WRLA 1VKXA 3DTXA 2IPTL 5D6CB 3EFFA 1Q38A 3HS0B 2WINA 5EO1B 4BUHA 4HK0A 2M8XA 4JFDE 4PRPE 3LKPB 4XBPA 3H7BA 4O4YL 3ZKND 4EUPB 4GMSL 5HD8D 3VI4F 4JFHE 9CGTA 1YJDL 1WCQA 4M43L 1FLTX 1ZLWH 5GGRA 4KMQA 5IQ7H 4ZOCA 4DKAA 3MBXH 3B4NA 3QRFM 3D25B 5ESQA 1M7DB 2AV7B 3LAFA 1JPFB 2HFFA 2DQHL 1A0QL 1MPAH 2AQ3A 3D3VD 1LEGA 2FB4H 2A2QT 4RRPG 2OBGA 2WMPA 1YNKL 3JWDL 1N0LA 1QLFB 1SJEB 1VSCA 3BQUB 3P9LB 1EFXD 4LPUA 4PTTA 5DGRA 5I18L 5K9OB 3RNQB 1RZJH 3P40A 3WDIA 4V3EB 2HKFL 2GJZB 2EC9T 4ZAKD 5HVFB 2G60L 1D5BB 2HAZA 4HQQL 5CEXB 4Y2DA 1KBGH 5JUEL 5F88B 4PJ8C 3GSWA 3GSOA 1ACYH 4HWZA 1G9MC 4KFZC 5EBLA 3VXSA 3C60A 2OM5A 1KLGA 5KSUB 3VXMA 2PNDA 4FQLH 2E6QA 3DSNA 4Y4FD 1FAKT 2XQYK 4EN3C 1NCCH 3RY5A 5H35A 1KCUL 1U2HA 3OB0H 1A7BA 5T1DL 3SBWC 8FABA 3WXWL 3RGVA 2DDQL 2OQJA 2Q8BH 2WIIB 1DBBH 3BWAA 4N8CL 4AEEA 3KPRB 1LE5B 1NBZA 4YIQA 3MLVL 4UT6L 1KJ2L 2VDLH 2BVOA 4MZ2A 3HUJF 4XRCB 5C09A 4KRPC 4OV5A 1T83C 3SN6N 3MLTA 3ARDD 3LB6D 3BUTA 4Y16B 4KK6D 3VWKB 1I8KB 3F65A 3QXDA 4L4VA 2ZP0T 3L3IB 5F7DA 3O81A 1NCAH 3V4PL 3WIFB 1QPXA 4JLRB 5T5FL 1MVUA 1J1XL 1O0VA 1SM3L 4RWYL 4PTTB 5DUML 3ZT7A 1I7RB 4ZFFA 4YHNB 3LV3B 2MCPL 1KC5H 4I1NB 2CIKA 2EIZA 5AYUH 3DXAE 3S4SA 4WTXA 3GMQB 4NC2B 3GSWB 3HTLX 5E2VL 4Z7WF 3GUTB 4KJYB 4BUGA 4Y19D 4X4MA 4PLOB 3DSFH 2YD5A 2C7UA 2P46B 2YPVL 2WK2A 3QQ9C 4MS8D 4Y1AB 1UACH 1SY6L 3KPTA 4WO4A 2X4SB 3VGGA 3QZWB 4G9FA 2VQ1A 1I85A 5H35B 1OGAA 4I18A 4G5ZL 1FG9C 3IDGA 3DECA 3WFBH 2VLLB 3VW3H 2AI0L 4HUWA 5MP6L 5ABDE 1NFDA 3TCXA 4G6MH 4JFQB 1IQWL 3BWAB 4E9LA 3FB8B 3VA6A 4G8FB 5EU5A 4M8QA 3ZLQC 3AMLA 4MXQD 1FQ9C 4XNMA 4FFZL 2RIKA 3B9KD 5DJ8A 2VXQL 3D39E 5C08E 3DROB 5C0BB 4YJZL 1WFUA 1G9NH 4YAQB 2BVEA 1DZBA 1NPUA 4XC3L 1S5HB 4R4BA 4WI2A 3VFPB 1G6RL 3ULVE 2ZJSH 3DO7B 3KYOB 2H32H 4YE4H 3DURB 4TVPL 4LCCA 3FOLB 5LCVH 1KPVA 3QQ4B 3SGJC 5C6PB 3VFVB 4XP4H 1IKFH 3AS0A 3O3EA 1NC2D 4QRUB 3UO1L 2AABL 2VXTH 3T0ED 4MNGB 4XVSH 1JRHL 4CADA 2F54E 4RQQB 4JRXB 1WCBA 2VN4A 3DBXA 1TJIH 4AYFA 4P5KB 5IGXH 3MUGA 2G5BB 3DGCR 2VXSL 1MQKL 4NT6A 4C58B 1G7PA 1FL3B 1P2CA 3LZFL 4IRJB 1FRGL 4F9PA 5C07A 4JY4A 4YO0A 1ZHLB 4B0MM 2B1AH 3WN5C 4MNQE 3IDGB 2R56L 1DANT 4XCCH 2VDRL 4JPVH 4UIKH 4JM2D 2F53D 4G8GE 2QQQA 4DN4H 4NQXA 1K6QH 1WTGT 3I6LD 3C8KB 2X4NA 3QRGL 1FGVH 4L8BA 4Q9QH 4JG0L 5F44A 3ZSTA 4EBQL 2A9NH 4PB9H 4WNQB 3RBSA 2X4OB 2EDRA 2ERJB 1X5YA 4XWGL 2FJHB 2ADJB 3CFCL 4NWTL 1D7FA 1HQRB 3CFKB 1QR4A 1FNEB 1RULH 4NQDD 3ALXA 5TFSL 3ALPA 4GSDH 2IBZX 3T2OA 1RURH 1NFIB 3D85B 1K5NA 5FYKU 3T2PA 3W0WD 2Y5TA 2NQCA 4TNWF 5J6HA 2I07B 2CO6B 4LGSB 2BOBB 3CX5K 5CHNA 2Q8AL 1T20A 1MI5E 5CP7B 1JIBA 1A3RH 5BO1H 5IB1A 1I8MB 1JPSH 2J8UB 5KSBE 3BKJH 4M7KH 4ZNCD 1YECH 5CZXD 4YDKL 1NAML 3QULB 1WCBB 1J8HA 3VXOB 5F70A 1QR1A 4U1IA 2J3SA 3PWPA 2WANA 2LAGB 4Q97A 3T4YA 2EYSA 2VIRA 2DAVA 2EDEA 4Z7OF 3MNWA 2BVPA 5HHXH 1CDHA 1LEIA 2JB6A 4XHJC 2VXUL 3FO0H 3TO2A 1WICA 4JO3H 3QDGE 2IAMB 4X6CB 3OV6A 4WFHE 2OTWA 1XIWD 1A4JB 1W8NA 3DETD 4GKSA 3LB6C 3VFNB 4KK6C 4KRNA 6CGTA 2R1XB 5JHDA 5KVGL 4S0UC 4QRPB 5KOMC 5EZOL 5I1EH 4DAGH 1FZJA 4MDIB 4ZXBA 2A6IA 3TIEB 2J6EA 4U1MA 3DUSB 5ITBH 2X89A 2DLFL 1OW0A 1R3IH 1FFPB 4TPRL 3TBTA 3NAAL 3A67L 1I1YB 3DUUA 4LCUA 3GJFB 2H45A 2APWA 2Z92B 4GG8B 4YZFE 5I71C 5FECA 2QSTA 5DK2A 3Q48A 4JVWA 3KPPA 4M1CD 1H5BA 1N7MH 4WI7A 4J8RA 4YHZL 3DX8B 4KUZH 1QO3A 3INUL 2AJXL 3HAEG 3KR3H 4RGNC 5CHNB 1MFEH 4RDQF 2EE2A 3GNML 4XH2A 1A22B 3IF1A 2ATKB 1MHCA 4QOKD 1SJVA 4KHTL 4EVNA 3RWJA 5I1DB 5MENB 6FABH 1PG7L 1OAUL 1VEMA 5FO9B 5J9PA 4F37K 2HFGL 3V6BR 4CMHC 3L5JA 2BMKB 4MLIA 2AJVL 4G6JL 2X1PA 1DQML 4LAQL 5DZNA 3CDYA 2OJZL 3ZYIA 3CSGA 4P2OB 2JB6B 4NRXA 1YDPA 3MACH 1GZQA 2PTVA 4XXCC 2E27H 5GS2H 1W2KT 3HI5H 4M93C 4ZDHB 4JEGB 4KJWD 5KZCB 3B9KC 1V3MA 3HE7A 4ELME 2HJFA 1WT5C 1ZLVK 5KTEL 4OBSA 2Y5EA 1YNLL 5KAQF 5K9QG 3P4OA 4PR5A 1MJUL 1Q9LA 4FA8A 5DQDH 1W72L 3EGSA 4NJAL 2A6IB 3CMOH 1QRKA 1GRWA 1NBVH 4LARH 4YHYB 4TTGA 2D7TH 1RJZA 1X9QA 2OP4L 3VFWA 1QNZL 3QUYC 2QKIB 1K3IA 1LWRA 2CLVA 1HILA 3FN0H 4DW2H 1GGUA 4OT1H 3T0EC 1LO0L 4LLQA 4FABH 4DUVA 1DCLA 3RPIB 3GBNH 3IJHB 5FUCE 4NO0D 4HLZH 3OJDA 1ZANH 1SYVA 2DQUH 4NP4L 2IADB 4EVNB 3I3BA 3RWJB 4NBYB 3ULVF 3B9DA 4JQXA 5D8JL 3LN9A 3BD5A 43CAB 5K9KA 4XNZC 1A3LH 3QFJE 2FJFA 3VMOA 4JM2C 1JWUA 1YNTA 3WIIH 2D9QB 5EC1B 1D9KD 4N0UB 4CJ0A 1UWXH 2A1WL 4L8SB 4XMKL 4QHLA 4OJFH 5IWLA 1OAKL 4PJXE 1ZAGA 2HYMA 2C3WA 3EJYD 1NCTA 3KWWA 4M6NH 5HHNA 5H8DA 3PDOA 3BIKA 3FKUS 4PYGA 1G7JB 1RZ8B 4LVEA 1FL5B 5FA4A 5HTSA 1BVKB 1UCBH 2DM7A 2YZ1A 5E56A 1KJ2A 1Q9LB 1G7LA 1PX4A 4IIQA 1X5KA 3FFCD 4F8TA 3L5HA 1BP3B 1QYGH 4LPXA 2K1MA 3MA9L 4XPBL 3FCTA 4ZPTA 3GB7B 3VFUA 1F58H 4QWWD 5DJXB 3VFWB 1I9JL 2WUCH 4LSPH 2DD8H 4JHWL 1S78D 4ZYKA 4BFGA 3MCKA 4FQJL 2CLRB 4Z7VF 2WZPD 4HFUH 1NUGA 2Y25A 3P9MB 2IEPA 2UUDK 3U4BL 4Q6IA 1MCOL 4G9DA 4KKBD 3T3MF 2BCKA 3WNLA 4TRPH 1ZVYA 3MV01 2XNAA 3MRMA 2XWJB 4HGWA 1MRDL 3OKMB 3VWJC 4M7LH 1BQSA 4MQXD 1OP5K 3NOIA 5ADPH 1MHHB 3V7MA 5F9WC 2FDBP 5BVJA 2F74A 4FZEH 2RCSH 3MSPA 5E6IC 1MFNA 1P7KB 4NZRL 2VKXA 3NH7L 1I4FB 2O61B 1YNTB 2Q7YA 3DETC 2GSGA 3SDXF 1SY6A 25C8H 2FECL 2KQMA 4JJ5A 4OQ1A 4DTGL 5KSBF 4HG4K 2A6KA 3W9DA 3N1FC 3ARGA 5CZVL 1L6XA 5I1KL 5J12C 4Y2DD 1FDLL 3NCMA 2JIXB 5I16A 4HUXB 1AQDB 2XRAL 5DMIL 4Z5RA 1HEZA 3UPRB 2QADD 5FA4B 2BHZA 3VXSD 4HJJL 5EZIL 3IYLW 4X5XA 5IVXE 3VXMD 4HWEH 5A3ID 3TIDB 5LWYL 1JZ4A 4XCNB 4MX7B 1FVDA 4M1CC 3VXPA 1HKLL 2HRPH 2FJGA 4U1GB 1I9RH 3LEXB 4G7YH 3RGVD 5IM7A 3RX5A 4F33B 2BC4B 1A5FL 5SWQA 5AUMB 1RJLA 5AZEL 2ZSWA 4ZYKB 1NSNL 3MV9E 4PJ7A 1CF8L 1G6RA 2R2CA 3BDXA 4R4FH 1BM3L 1PFCA 3EYOB 1GXEA 5D1XB 1INDL 1D6EA 4LRNH 5C09D 2X4UA 1MUJA 1GGBH 3RJDA 1HWHB 4YZFF 4W6XB 1D5MB 3C08L 1Z6JT 2DLEA 1YPZB 1S7TA 4L4VD 4HEME 2VLKB 3R0NA 3UTQA 3TCLA 5L88H 1QFUH 4OD1L 1I1RA 4P3CL 1JGDA 1X5FA 1FVEA 4KJWC 1AY1H 4MJ5A 3EDDA 5FGCB 3I50H 1G0DA 1NBYB 4U6VH 3QUKA 3ARGB 2OTPA 4NKIL 4GBXA 2R2EA 2Y7QB 2DYPB 3A6CH 3QIUA 3U7YL 5JTWA 1VPOH 1I1FB 4I3RH 5DI8A 3RWFB 4LMQI 2QSQA 5EUOA 4WWKB 1RIHH 2PW2B 5DJDB 3C8DA 3GGWA 2ED7A 3UJTH 4R2GB 4TULH 2VSCA 2ITDA 4WO4D 5GQBA 4G9FD 1AFVH 1FVDB 2BSSA 4GW4B 4P59H 3TBYB 2YBRB 4PJEA 4G7VL 2YRLA 3O3DB 4D3CH 1WBZB 4AEHL 4JPKL 1N64H 5K93A 3WBDA 3VGEA 3HCVA 2ZCLH 5CIPB 4QXGH 2GTWB 2R0ZH 1UM6L 5IMOA 5AZ2H 1WJ3A 5DWUH 4H25A 5ECJE 1G6RB 5C0AA 3L7FA 3NCYP 1D6EB 4XGZA 5GRUH 5E4IA 4P2RB 1XGYL 3MV7B 2A6JB 4LLDB 3BQUC 4XZUB 1D9KC 2I27N 4XP6H 4D9RE 4KQ4H 4WUKH 4ZNEE 3SO3B 3MRPA 1VFUA 2YR3A 4MDJA 5HGDB 2W9LA 1NAMA 3BPCA 5EU6D 1Q0YL 5LGKA 1HHJB 1INQA 3EJYC 3LQAC 4CU7A 3SE3A 4DJMA 3PGDB 1UWEL 4D9LL 1H8OA 4K7FB 4E0RA 4K2UH 5HYJA 4APQB 5EULV 3T4AA 1NJ9B 5EO0A 1MFCH 2HVJB 2A9ML 1EH9A 1CIUA 3QUKB 3NZHH 1HE7A 3QXVA 4GOSA 2WM0A 5F1KC 4ODSH 2YD1A 4P5TA 4NQSB 4OCMC 4X6BB 4PFEA 5KVFH 2KQNA 1WQVT 3MA7A 3VXRB 2F8XC 2BNUB 3QUMH 3WHE0 3GGWB 1CFTA 2CR3A 2ADIA 4PJXF 3PGFH 3RWGA 5TPWL 4KDVA 5C07D 4K3GA 2BK8A 1AIFB 2EO1A 2XZZA 5FIEA 4WI4A 1U8JA 4KKBC 3O8XA 1CK0L 1S8DA 4WTWA 2FH8A 3P11H 1NGYA 5BS0E 4GMTH 3OZ9H 4R26L 3TBWA 4KVNL 4JQVA 2FX9H 3MLUH 5I1HH 1IFHH 4HWUA 2YS4A 4H25B 4JHAH 5A2KH 4S1SL 2DI7A 5INDB 3LMJH 4AEFA 4LQFL 4D2NA 2FX7L 3FT4B 1IGCH 1K9TA 1MJ7L 2LVEA 3ZE0F 5FHAH 4JR9L 3LKSA 3EIFA 3PWUA 3LH2L 1NKRA 5I17A 5FYKE 3PIQA 4PB0H 5JW4N 4PRIB 3BPLC 4Z0BL 3MRPB 1MWAH 4YFDB 3TN0B 1JUFA 2HFTA 2AXGB 2OSLA 2CIIB 4NPYA 2DWEA 3NACL 4LBEA 1SYSA 1AI1H 3VXNA 5F6IB 4YEFA 3C60C 4OI8A 2XZCL 1ZGLM 3O6LL 5A3IC 3ARZA 2WY3A 1R6VA 3WHXA 1T03L 5E4EC 5EBWA 3SE8H 1XGPB 5DJCA 3GKZA 1VACA 1MH5A 2VDKH 4N5UA 5KW9H 1J8HD 3UTTD 3RGVC 1IZKA 3C5ZA 4YDIL 3PWPD 1NUDA 1W72A 3MJ9A 1P5UA 5IFJB 4PJFB 5FCUL 2J8HA 5AWNL 5CUSH 2NW2A 3ARBA 2AK1H 3IDYC 4V2BA 3BVNA 4BJLA 1SEQL 5GS0D 5GHWH 5DUBB 5IVXF 1IQDA 1GZPA 3DARA 4MA8L 4UQ3A 5FK9A 1RZKH 3TBWB 4CKVX 5JHDD 3KGRA 2JCCA 3V8OA 3OHXB 4ZXBD 5C0JA 1N2RB 2ESVA 5C6TH 3VMNA 4J3OC 2X89D 1IBGL 1HHIB 3BO8A 3RIFF 3HE6D 2CRZA 1MIMH 2LAAA 3PIQB 4K23H 5FOJA 5DMKB 3T77A 4KK8D 3ZTJG 1FO0H 4PP2B 4TSCH 4EUPG 1QUNA 2DKUA 2OSLB 3G9AB 1BJ1H 3QEQA 5KS9F 2NZIA 1O7VA 4NO3A 4NPYB 4LBEB 1GAFH 1BD2D 2VJXA 3EZJB 4KGLA 4PY8J 5JO5A 5FM5O 1CDJA 2BNQB 4O00A 1YEFL 4X7TA 3NCBB 3PWVB 3S3PA 4UOW1 1A7NL 3RUGA 1U6AL 2E3VA 1N5YL 4Z76A 4X80L 4N8VB 1PBYA 3IRPX 3K8KA 3WEXA 1I85C 2FEEI 4I18C 1U8QA 2B5IB 3H9HA 3NCFB 4NN5C 5E2TH 4XMLL 1ROWA 4LSQH 3HMXH 3WS3B 5GRJH 3FO2A 4P4KB 1YMHA 3ETBF 1AHWA 4O2CA 5DD3H 4NWUH 4ERSH 4NQEA 2IGFL 4KROB 1S7WB 3IXTB 4P9HL 2ERJC 3BVNB 3RVXD 4ALAH 3LQAH 2QR0B 4K7PH 5ID1B 1P4LA 1X5XA 1GZPB 1JNLH 3HE7D 4R7NA 3RNKB 3SY0B 1N0XL 1IC4H 4M62L 5I15H 4FMFA 4OM0H 4B53A 4JFEA 3AXLB 3CVHH 4LLYB 5BVPL 3FAXA 4OLWH 4PLKC 1MJ8H 3CUPB 3X11B 1MHPH 4DN3H 3WFCL 2O5ZH 2CK0L 4LSRH 1A2YB 1DFBL 1I7UA 4LCCC 1U41A 2W9EL 4YFEA 5CEYB 2R0KH 5F1OB 2PKDA 3IXAA 5EORL 1V3KA 4XNXL 3HZVA 5F7EH 5SWZD 5ADOL 2XA8L 4RZCA 5ERWB 2EDFA 1W8OA 3I6KB 2ADFH 1NANI 1S9XB 3L3OB 1TNNA 5C0CB 5KVEL 4FXLA 4DCQA 4WEBH 4L5FL 5JPMA 5IT2H 4AEIH 1H3PL 3MRRA 1S7RA 4GXUN 1Y18A 1QFWI 2P5WA 5HYFA 5EA0H 4O2EB 4P9ML 4PJDA 5BXFA 4MJIE 3VXUE 3HRZB 1X5LA 2ARJB 1L7IL 3BP5B 4GAJL 1AHWB 4HKBA 4OCXL 5F9JA 2OR9H 1BZ9B 4IDJH 3G6JE 1LE9A 1QRNE 2IALA 1R24B 4U2YA 4Y5YA 5D7JD 3LEVH 1J87A 1M05B 3TT3H 5JR1L 4LHUA 3VFOA 4MA7H 4OLZL 2PYEE 3SDDB 4I0PB 1P4LB 3S88L 3GBML 5C0ND 2FLRT 3OX8A 2N56A 1EGJL 1M7IB 2KZWA 3P73A 3MLXL 3RFZC 1T7YA 1QLEL 2R4RH 3QZWG 1AJ7H 3TWCH 1NL0L 3MRIA 5C8JB 1QFPA 4X6FA 3H9ZA 5D7SL 5EH1A 4EI5D 4Y4KA 3D18A 2VABA 3HZYB 4MCZB 4YNYA 3SKUD 3K2UH 3UC0H 5EU7E 3S98A 3OAZK 1ERNA 1MAML 3DVIA 1P7QD 1MCQA 4XX1E 3GMOB 3VFGH 5B8CB 5L7XL 3QDJE 1GOGA 2ZCHL 3TT1L 2RGSA 5D2LB 3CDGB 1R3HA 1YMMB 5JIIA 3DYPA 1XF3A 3UXFA 1U8HA 5ENWA 4Z77B 4MNHA 1XGUB 5DJ6A 3FHAA 5BJTB 5LG1A 5BRZE 2VKWA 5DK0B 4Q0XH 4A6YB 2Y72A 4HFWB 2GSIB 3F62A 4M48H 3VFMA 3F7RA 4BM7A 4GAYB 3T0BA 1GIGH 1RVFL 4LPVA 4ZUWB 2PYFA 1PLGL 5L2KA 1PQZA 1MLBA 1OW0C 4LCWB 3ULUD 1R3JB 5IP4A 1IAIH 4XNQB 3VI3E 4PJGA 4NBXB 3U79A 4KK8C 1A7PL 5I0ZA 4UDTA 1E6JL 3V8CA 4HT1H 3CC5B 5ICZA 2C3HA 3KPMB 1IC7H 1TJHH 1WZ1L 4K07A 3OQ3B 3RVTD 2JLLA 4JFOB 3FONB 4LNRB 4R97C 3FQRA 2VABB 4YNYB 4JVUA 3EDJA 3QFDB 3ORJA 4H1LB 4R9HA 3O4LE 5D7LB 3D0LA 1CFBA 1PJ9A 4RMSA 3QDMB 2IJ0C 2E7CA 1C7SA 3VDBA 3D1MC 1BX2A 4I0CC 1AGBB 4TVPD 1YYLL 1MCKA 5DLMH 4F3FA 1BIIB 4G59A 4LU5L 1JZ3A 4UILL 3GIZH 1LDPL 1J0IA 1S7XA 3BE1H 4XBEH 4NGHH 5F3HB 4FNLH 2DTMH 1OB1B 4ONHB 1U8HB 1OHQA 3BH9A 1NCWH 3PHOB 3CDFA 3TJEL 2DQEH 3SKMA 2VLRB 3O6FA 5GS1A 1DVFA 3HE7C 1I1AA 3O4OB 2X70B 3S3JA 3GMNB 3HB3C 2IH1A 4JDVB 1V05A 1TMCB 4RMWA 1YJDC 3TV3H 4YDLB 2PXYA 4MMZC 5MHSE 3QIUD 3S36H 2BNRA 5IUSA 3TYGL 1B0RB 1UXWB 2BSTA 2N1KA 4ZFGL 5IEKA 3C09B 4X4ZA 12E8H 3S96B 4OZGB 1W0VB 1F3RB 2BJML 4HS8L 4UDTB 5FO7A 3KYAA 3JWDC 5IFHH 2GITB 5ICZB 4KTE