3C8UA

Crystal structure of putative fructose transport system kinase (yp_612366.1) from silicibacter sp. tm1040 at 1.95 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
206
structure length
206
Chain Sequence
b'GMTLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPMDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLFDRARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPMADLEARLVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPADLTWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructokinase
publication title Crystal structure of putative fructose transport system kinase (YP_612366.1) from Silicibacter sp. TM1040 at 1.95 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Transferase
total genus 73
structure length 206
sequence length 206
ec nomenclature ec 2.7.1.4: Fructokinase.
pdb deposition date 2008-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3c8uA00
2ATXA 3UWKA 4A2QA 4M1OA 4TYWA 4KBGA 3TH5A 2IYRA 3BFXA 1XMSA 1JXMA 1E2JA 3AF2A 1T3LA 2ZU6A 3Q72A 2ODNA 3IO5A 3AVOA 2ZXUA 1E9SA 2DY1A 4O0MA 4TTRA 3CW2A 1NVWQ 4BEBA 2FEOA 5KDDA 2IYSA 4JYCA 1ZU5A 1EFUA 3LLMA 2B21A 1RIFA 2WJGA 3X1YA 1YZQA 2ZE5A 3M6AA 4A8JA 2GAAA 2ZYTX 4JVMA 1U81A 1H8EA 1TTTA 3B1ZA 1GRRA 1CS4C 2GZAA 4WW0A 1E9RA 2H7VA 3B82A 3A1UA 1FFHA 5JHGB 3UG7A 4MGZR 3K8YA 1CULC 3NH6A 1A2KC 1E9DA 1RZ3A 3MRSA 4RZXA 1GL9B 1Z22A 3AQ4A 2HV8A 5EE1A 4HAUA 1II8A 4GP6A 1ZMXA 2R6CA 1FX0B 1P7CA 1HE8B 3VKHA 1XJ0A 1LY1A 4KYIB 2F43B 1G9XA 4UJ5A 1ZCAA 4HLDA 2GWHA 1DARA 3QI2A 3DEFA 4U02A 2HXYA 4TL9A 4EIWA 3SQWA 3SHWA 2ASEA 1TADA 2G1JA 2MSCB 1OIWA 3TSOA 4M4SA 2ZQ5A 1KMHB 5AUOB 4DT1A 1KGDA 1ONBA 4OQFA 2ORWA 1T3SA 4I99A 4RFVA 3IPYA 1VYTA 3LBIA 3RAPR 3P4XA 1E94E 3KB2A 3BB3A 2IYVA 3EIEA 3A4LA 1W5TA 3MJHA 4HDCA 4JIMA 1XCGB 1Z5ZA 3RWOA 4KBFA 5H1YA 2HLDD 5SZHB 3WMGA 4BZPA 3U7EB 2QMUA 3K0AB 2YOFA 4R2HA 1ZC4A 2Z4SA 4KI0A 4QG7A 1OB5A 2XTMA 1IY2A 1XTRA 3LQRA 5AJZA 2QU8A 1C9KA 1MABB 4LRWA 4G0NA 3RSOA 3G5UA 1RKBA 4NYJR 2B7CA 3GLHB 3F3YA 4LCBA 2ZVQX 3CRW1 2OM2A 1KO8A 2XNSA 2W0SA 2C04A 1KOFA 5TMPA 1PJRA 2A7QA 3GJ8A 1UBGA 1XU4A 2DBYA 4HAVA 1S96A 2R6GA 2GJAA 4LC1A 4C30A 2YWEA 3L0SA 3BRWD 1G3UA 1FP6A 4C0QC 4HATA 4PANA 1BYUA 4F92B 1Z0KA 4MUAA 2ONJA 3BC1A 4KSCA 5JFGA 2H92A 2HUPA 4RD0A 1CLUA 2NOAA 1N0UA 4RFSA 5CJPA 4L4UA 4XVRA 1UKEA 1KSFX 3TRFA 3VR5A 2ZI3A 5KUTA 3TAHA 1T5IA 3VR4A 2IWHA 1DS6A 4BLSA 1VDZA 4US1R 4JL5A 1W36D 2GETA 4NH0A 3R9WA 4RVCA 2O5VA 1S1CA 2Z5FA 3OF5A 1X1RA 2XX3A 4FD2A 2C9YA 1QHXA 5DHFA 2HLDA 2VTKA 1CBUA 4UNSA 4EQ6A 1XPRA 1KO1A 1P2SA 2FH5B 2V8OA 3KXKA 3T1TA 1AA9A 4A1FA 2D2FA 4C0HA 3GEHA 5EXXA 2JLZA 3THWB 4B3GA 2J5XA 2VSXA 5JS7A 2QBYB 1OHHD 5F2EA 1KKLA 1COWA 2FN4A 2XOKD 4CT4B 3C15C 4A8JB 3O8RA 5G40A 2ZI5A 1OFIA 4M1TA 5ANRB 3CWZA 1ZUHA 2ODBA 4B3FX 4DKXA 5BWMA 4DJTA 4ZI2A 5CITA 4GBMA 4GSYA 3GD7A 4DXAA 4NCJA 2DFTA 1JJVA 4MRRA 3TVTA 2ZUBA 1UBEA 1CIPA 2DFKB 3QJYA 2GDJA 3VKGA 5FI0B 2ZI6A 3B85A 2VRWA 5DN6D 1XRJA 4DVGA 4EPXA 4LBYA 4QXAA 2IT1A 3RLFA 4G5GA 4GI7A 4JZKA 4TMKA 1JB1A 3U3KA 5JLJA 4Q4JA 2QM7A 3I1FA 1MO5A 3NBZC 4M9ZA 4Q4HB 4URVR 4Q19A 2GF9A 4UKDA 4A4DA 2BWJA 4TMWA 2VHJA 1UKZA 5KSOA 3DHWC 5JECA 2OFWA 3GJ6A 5C46F 2V3CC 5AUPB 2GBLA 2G1KA 1SHZA 2RKOA 3PJRA 1IN5A 3U7HB 2QP9X 3O8BA 2AFIE 1EGAA 2BM1A 3SJZA 4OL0A 2AXPA 1TMKA 1KZ7B 1DAGA 3Q3JB 1P9RA 3B78A 1OHHA 2ODWA 2XOKA 2O8BA 2EWWA 1TEVA 3BOSA 3ADCA 5AUQA 1OT3A 3PUWA 4PAMA 3KXLA 4BFUA 4JJKA 1VYVA 4TYNA 4DDVA 1M7BA 2WOJA 3TMKA 4E07A 1KI9A 1E79D 4TL7A 4AC9A 1KO7A 3BH7A 5GJCA 1EWQA 5JEDA 1FP7A 1PLLA 3A1VA 4PFSA 3ETLA 5FPTA 4WAUA 4W5HA 4ESVA 1ZNXA 3AKEA 3R9IA 1DOAA 3NBXX 3R8FA 1XEFA 1ZM9A 1JECA 4OK6A 3LFUA 2LKDA 3GJ5A 3CF0A 3SFZA 3BWDD 2OBMA 5TXGA 2ZRAA 1J8YF 3VX4A 1WB9A 3QPVA 2H5EA 4OQLA 4RFSB 2CE2X 2OBLA 4MRVA 3Q7PA 4OI0A 1XD2B 3CNLA 2WPDD 4KCGA 2JLXA 4TL6A 1D2EA 4G01B 1SKYB 4RD4A 1TU3A 3SOPA 1E0SA 3CR8A 1FQKA 2GHIA 1Q44A 1GL7A 3K09C 1VPLA 2QRNA 2NZJA 1VHLA 2JJ1D 1YJ5A 4FMCF 2YV5A 4WXRA 4OHWA 2Q3HA 5JWHA 4IOJA 4EQ6B 4NBSA 4KLNA 4HLCA 5L3QA 3IO3A 3LW8A 5BN5A 4CEIA 5AJWA 5AJYA 3D8BA 421PA 4BLRA 5FBLB 3CBQA 3IPXA 4Q9JA 4TZ6A 4PX9A 2V7QD 2IK8A 5AJVB 3LX8A 4FMDB 4R98A 2RGGA 3UK6A 2Q0HA 3L0IB 4LV8B 3EW9A 4IJMA 3EZ6A 4B6EA 5FI1B 1E79A 4CEHA 5EUMA 2YZ2A 1NVVR 4TLDA 3HYTA 3QUSA 2YWGA 2TMKA 3Q7QA 1KTVA 2J3EA 1XB2A 1OFUX 2R44A 4S35A 3AGPA 2BMDA 3ONWA 4B32A 3A6PC 3IBGA 4I1VA 3I62A 4ZDJA 2ZE6A 3MAAC 1W49A 2ZS7A 1QHIA 3WNDA 4TYYA 3L2OB 1GIAA 4C0AC 2IX3A 1J99A 2HYDA 4JSTA 3RDPA 3A36A 4OHZA 4BLPA 3RHFA 1G64A 3UMSA 4MYTA 1TUEA 2WPDA 2R65A 2A5JA 5BQ5A 1I4TD 4GP7A 3KZ1E 4KV9A 1BO6A 3CR7A 3C5HA 1KI3A 4QKQA 4Q4JB 3GLIA 3CPEA 2ORVA 2Z83A 5L3SA 4LX0A 4YC7A 2PMKA 2BJWA 4GFDA 1HURA 4ZDIA 3SI7A 3I61A 1W36B 1R8QA 2JJ1A 1KNXA 1HY3A 4Q66C 5CB6A 3A1TA 4G5RA 5UKDA 4DLTA 1DELA 3TW8B 4F4IA 3IGFA 2Q9CA 4WOPA 2AR7A 3OEHD 4JLMA 4C0LA 2JLYA 4OKSA 4AKHA 1G3RA 5A0FA 2LWIA 2V6IA 2F1HA 2FFBA 4MKHA 3OEED 4MGKR 3TR0A 1KDPA 3CRMA 3UANA 3ZVNA 1OH7A 3H4MA 4OI1A 1B23P 2XNDD 2ZVPX 3M0EA 2YJTD 2IS1A 2V7QA 1ZM7A 1CJMA 1P2VA 1TQ4A 2E87A 4DCSA 5C4MA 2O8BB 4RZ3A 2IL1A 1CR1A 1L4YA 1A5TA 2OCYC 3F8TA 1T4GA 2EYUA 1WBDA 3SN6A 1DAMA 1Z6AA 2CVHA 4TWZA 3T61A 1Z8FA 2WSSD 1ZC3A 1WQ1R 1R10A 3B2EA 3OIUA 5KNCA 1G7RA 4GZMA 5DSZA 3AB3A 1Q3TA 3AVUA 4M8NE 1NSTA 3NTUA 1JJ7A 3PR1A 4G5SA 2FPMA 1KIMA 3E70C 1UAAA 5G53C 4KFSA 3N2IA 2HDNB 3U6BA 4N3NA 4ZO4A 3CX7A 3KQLA 1IXRC 1RRCA 2P0EA 4DBLC 1RFLA 4JLJA 3K0SA 1QF9A 1VCOA 2ZUCA 4FXPA 3CWQA 4PC7A 1XXHE 3TAUA 3VAAA 5FR2A 1RYHA 4M1KA 3WP1B 2A5DA 5FOVA 4EFLA 3IHWA 3MCAA 3Q8XB 2CEAA 3D7MA 3K9LA 2F1JA 4D81A 3R9XA 2G77B 3OEHA 1PVOA 3P1JA 1N5LA 2FU5C 3DPUA 3N70A 4DHEA 3GPLA 2NO7A 5KYKA 2ZROA 4CW7A 5L3QB 1UF9A 2QMEA 3OEEA 4IDHA 4CEIB 1P75A 3QG1A 1CU1A 4LC0A 1Z3IX 4QL3A 3QF7A 1AS0A 2XNDA 3QXJA 2K5UA 3RS2A 4QFMA 4TN1A 5JJLA 2JA1A 2ATVA 1O87A 1KK2A 2ZI7A 4JJZA 1TU4A 3UMRA 4QHYA 1HH4A 1Z2CA 4GOXA 1AQUA 1TAGA 2NMVA 2WSSA 5BW8A 1AZSC 1JR3E 1S4QA 3I3SR 4XTCS 1KAGA 3FDIA 3SQXA 3CB4A 1MO6A 3B60A 2FPLA 4YDSA 2XZPA 4OK3A 1MH1A 4FCVA 5KNBA 1G7SA 3U4QB 4Q4LA 2EW1A 1EWRA 3IIJA 2Z43A 3HPQA 4CDGA 2IYZA 3EG5A 2YKGA 4Q5IA 2ANCA 3EZ2A 4HB4A 1XMVA 4PO9A 2CJWA 3IBYA 2ZRFA 1QHSA 2GKSA 1KK1A 2CHQA 1XDBA 3CO5A 4CYMA 3HU2A 4M21A 3GLIB 5L3SB 1G3MA 4DCNA 4N0DA 3MGCA 5A5GA 3W34A 3W3AA 1NKTA 2PJZA 2QN6A 5CJ2A 5AJXA 5K8TA 2CCKA 5EXPA 4BFXA 2F55A 1K5GA 4GOJA 1CRQA 3I4LA 1F2UA 5JI2E 4C0SA 5JEEA 5KSZA 4V0LA 3BBPA 4V03A 3PFIA 4LHXA 2EFDB 2ZRHA 3SHFA 5L8VA 3GLHE 2ZJ5A 4DLZA 2REBA 2J1LA 1E6CA 3R20A 4LYJA 4BFZA 5AUNB 5DLQC 2A5YB 3I8SA 1HE1C 1G7TA 1Z83A 3CLVA 1KI2A 2XGJA 2J0UA 2ZTSA 2HJVA 1VG9B 2QT1A 3SR0A 2OLKA 1W0JD 3IQWA 1QDEA 4CRWB 5KTYA 3IQXA 2OV2A 4RD3A 3PXGA 2WWYA 3K09A 3SNHA 2XAUA 2C9CA 2JJ8A 2IYUA 3FB4A 1CJUC 5CLLA 2EWVA 2W2VA 1DEKA 2JASA 4OQMA 3R7WA 4Q48A 3AF4A 2HF8A 3VNUA 2ZRMA 5FUYA 2ZSAA 5F9HA 3SJBA 1ESNA 3ZQ6A 2F1RA 2HT1A 1JR6A 2I1QA 2QY9A 3L43A 4ACBA 4MYCA 3EZFA 2C5LA 3MSXA 1QHYA 4EPYA 2NPIA 2QT0A 4DEYA 4K46A 1GFIA 2VHQA 2DPXA 3KB1A 4M22A 1X8LA 2P67A 1X8KA 4TTPA 2O8DA 3BFKA 2GJ8A 1NN0A 5P21A 1OH5A 3NDBB 1CR4A 1G6HA 4S2EA 1MR3F 4KFUA 4ARZB 1J8MF 1M8PA 3BERA 3H84A 3NBFA 3PEYA 1E69A 5KDLA 2WWFA 3LVQE 4WA7A 3GP8A 1XD9A 2AWOA 221PA 2PBRA 1XPUA 3Q85A 5HPYB 3SZRA 1AM4D 3A1WA 2FWRA 2OESA 2BDTA 2IWRA 1AKEA 4BLTA 3LLUA 4TL8A 1E2KA 2IC5A 2QTHA 2VP5A 4AWXA 1S3SA 2JDID 3IHLA 4FWTA 1W0JA 1FW6A 1T8UA 2BOVA 1ZM4A 3QBTA 4C2TA 1TNDA 3RSLA 1PV4A 1ZBDA 3C8UA 2NG1A 2FSFA 1RYFA 3JZMA 2Q21A 2QP4A 2FJUA 2ZS8A 4DLVA 2PJRA 1XJQA 2CLSA 5G41A 1SXJD 4KFTA 2JLSA 4P33A 1BKDR 3ND9A 2C8VA 1BYIA 1SVSA 2ZSFA 3LV8A 1PUJA 1D5CA 1ZNYA 2WJVA 3QVUA 1JNYA 1NIPA 2CJWB 1HEIA 3HU1A 3PUYA 3QXHA 2AK2A 1VCIA 2IHYA 2MSEB 3CIOA 3AP1A 4KYUA 1U90A 2QQEA 4Q1EA 2WWHA 2V54A 3GFOA 2G3YA 3VMFA 4R9UC 3VR3A 3CNOA 3OFNA 4URYR 3KJIA 4HDOB 4RJLA 3T5GA 3WHKA 1F2UB 4L5BA 1GNPA 2KB0A 4A82A 3ZD6A 4R71A 2JLRA 3AVVA 4Q1AA 3LH5A 4BEJA 4YMWA 2GRJA 1V5WA 4MGYR 3VQTA 1DG1G 1NBMD 2R9VA 4D26A 1E2IA 3ZZTA 3HYRA 4GRAA 1KJZA 4OJQA 3NEYA 3UWOA 2J0UB 3I32A 2BMJA 4HZUA 2JDIA 3QPUA 2A3RA 3K9HA 3REGA 1XCPA 1MKYA 3NKVA 4QOSA 1Z2AA 3KTAA 4MKIA 4IRUB 2JLUA 1YRAA 1FNMA 1KI4A 1Q57A 3TQCA 3D3QA 3KL4A 4FMDF 3HR8A 4M9SA 1GAJA 2IXFA 3EX7C 2OAP1 5E7JA 1M74A 1R5OA 1I2MA 1GKYA 2QZ4A 2ZR7A 1FOEB 4B6FA 1QHHA 3B9QA 3R7WB 3GLGA 2BMFA 1SXJA 3TIFA 4V0MA 5FPHA 2OFXA 3EA0A 1SKYE 4GOKA 5CM8B 1Z0DA 4FCTA 4P3YA 1XXHB 2AWNA 2D4HA 1OXVA 5KSYA 4HUTA 1KKMA 3T1OA 3PITA 1BS1A 3DL0A 2IHBA 2ZRBA 4JSYA 5DGXA 4D4KA 1F3OA 4P4UA 3RRZA 1KO5A 4XOIA 3UG6A 1LF0A 1IN7A 3WNCA 2GZHA 4HB0A 1RRFA 4DC9A 2BV3A 3QKTA 2BEKA 1NG1A 8OHMA 4X8HA 2O8DB 4OJKA 1IXSB 3PCRB 1KY3A 1T0HB 3NG1A 2ZJYA 2QNRA 4O2RA 5M04A 2A9KA 1GRQA 3BFVA 2Z0MA 2KBFA 4C2UA 1EG7A 1QZXA 1GM5A 2V4ZA 3LW7A 4LJ7A 1J90A 3KUCA 1P2TA 3E5HA 3QKRA 2WMOB 2BJVA 2IYTA 2ZSBA 1TF2A 2G6BA 4PHFA 1NBMA 2OO7A 2GJKA 2VP2A 4LJ5A 4WIAA 1L4UA 1U8AA 5A4JA 1K5DA 1XTKA 3I92A 3GFPA 2HXSA 4JLKA 1AJEA 4M9XA 5KO2A 4NYMQ 3KUDA 1ANKA 1Z6TA 3TQFA 2XEXA 1U8ZA 2ZYUX 3JVVA 3M1IA 3SFVA 2VL7A 2JLVA 3LVRE 3U44A 5IT5A 1TX4B 2QP3A 1UDWA 3V4FA 2WAXA 3ZDQA 1LFDB 2W00A 2KSQA 2QROA 4MKFA 2J46A 1ZP6A 3BS4A 4P4TA 2D2EA 2HT6A 1Y63A 3A4MA 3SYLA 2ZEJA 3ADDA 1I4LD 1W7AA 5HTKA 1OKKD 1A82A 3IUYA 2O8EA 3HWSA 1KK3A 1G5PA 4EKDA 2PZFA 4JYBA 4LYAA 4U7DA 4YQFA 3FHOA 1US8A 4ZCLA 1Z0IA 2BC9A 3EWAA 2F9LA 3N2EA 4FMBB 4FWIB 4KAXA 2O0KA 4X8OA 2WIBA 1GNRA 1KSGA 3B5JA 3EC2A 5KOYA 2D74A 2GVZC 3G0HA 2P6RA 1COWD 3WYAA 2DFLA 3ASYA 4LHVA 5AK0A 2X77A 3RNLA 5DI3A 2B92A 1OV4A 1LS1A 3EIHA 5EE0A 1BMFD 4A15A 4TQUS 1IBRA 1N5IA 2RGEA 5B64A 1NVXQ 3KJGA 3RS3A 3CH4B 1DPFA 3A37A 3VHXA 5FTJA 1NMXA 1X3SA 4LYFA 3RRYA 4DLRA 1RC8A 1DAEA 3B13B 4H9GA 4F7WA 2ODEA 5FH9A 5TB5A 1PZNA 5J4LA 4UNQA 1QHGA 2GESA 4Q03A 5TVKA 5K8LA 5JHHB 2D3WA 2XJ9A 2ZYWX 4HZUB 1W4AA 4NU0A 3BB1A 4RKFA 3KTAB 2QMOA 3ZZ0A 4NHOA 4QHSA 1D2NA 2ZI4A 1N0VC 2AN9A 4CVNA 1VG0B 3UIEA 4IVQA 3G82C 4ZPXA 1YHNA 2PT5A 5TDHA 4OQNA 2G88A 3I5YA 1ZD1A 2GJ9A 3I8XA 3VR6A 1QHHB 1KO4A 2PLRA 3GLGB 2QM8A 1OKKA 2VF7A 1ZUNB 4A92A 2WJYA 3GJ3A 2P5TB 1U0JA 1P73A 3FOZA 1DBSA 2GEDA 4B76A 4B3CA 1IXZA 3OHMA 1VECA 1XPOA 1RJ9A 1LNZA 4HEJA 4PQYA 4BQSA 1F48A 2A78A 2KE5A 2QUZA 4LWZA 4B48A 1NIJA 3C4JA 3IILA 1GUAA 2Q3FA 4EFNA 4F93B 1G18A 1OF1A 1Q0UA 4B71A 1WP9A 3IIKA 2O0HA 1OW3B 1S0UA 4KFRA 2XZLA 2MSDB 3DVLA 2AL7A 1CRPA 2GZDA 1BMFA 1W4RA 1A2BA 3R8CA 3WP0A 1QG4A 1GSIA 2UZ3A 4NYIQ 2RGBA 3C7KA 4DUGD 2HEIA 1L2TA 3QKRB 4TMTA 3ZQJA 1WE2A 5FL7D 1XNJA 1II8B 3V00A 4A9AA 4PC6A 1G3QA 1YR8A 1G20E 3QPWA 4ACAA 3IEVA 3BD9A 2VA8A 3IDQA 4URXR 4QRHA 2P65A 1E0KA 4MQBA 4I1OA 1E9EA 4WZBE 4KU4A 3E2IA 3U44B 4A6PA 1W44A 4JLNA 2CL7X 2GILA 2ZREA 4RZ2A 2XXAA 2Z4RA 4DT1B 1UEJA 1ZVQA 4PC2A 4C4PA 4R7ZA 1NRJB 3QEOA 3UMFA 2FZ4A 1EFRD 1F2TA 3BXZA 2ZAOA 4GMDA 5HCIA 3GLIE 1JQJC 1G8YA 2HJGA 3T34A 1R0YA 2R2AA 4PQFA 3DMNA 5F9FA 2EFGA 4NDZA 1I2DA 1G21E 1US8B 2O8CA 5DISB 2BVNA 4Q7KA 4CGZA 1KNQA 3T5DA 3JZAA 1N2CE 3AVQA 4BFYA 1XJCA 1PLJA 5DNYB 4XIGS 2Q9BA 4GNKA 821PA 1KZGB 4MYHA 4O2LA 2FPKA 2G9NA 2MMCA 1XTJA 2NO1A 3QVVA 1N25A 4ZCMA 3BE4A 5LB4A 3VTKA 1ETUA 1P2UA 3O47A 2V1UA 1XEWX 5EXSA 6Q21A 4DUGA 3X2SA 2ZJ2A 5EE3A 1JEDA 3FMOB 2J41A 4HUQA 5L3RA 2LKCA 5FL7A 4A2PA 1G8FA 5DE3A 3CZPA 4K81B 4LGMA 2CLDX 5CYPA 5JWOA 3PUVA 2W2TA 2WHXA 3SYKA 5E7IA 1OXSC 2VBCA 3AF3A 4Q18A 1RRGA 4DSUA 2J87A 2NQ2C 5EP2A 1N3BA 2CHGA 2YOHA 1K6MA 2IEYA 3L82B 1D2MA 3TSWA 4EJSC 2GK6A 1EFRA 1KI7A 1OJLA 3CH5A 3M4YA 4IDPA 3NDPA 4OBEA 4Z8YA 1KHTA 3CX8A 4C0JA 1E9BA 2GXSA 4K8OA 1KMQA 5CK5A 2IW3A 2XB2A 5CM9C 3K9NA 5JI3E 1JPNA 1Q21A 3B8HA 4JVSB 1ZNWA 1P62B 4NCNA 1FL9A 4JBWA 3DDCA 2L0XA 4FIDA 4QBGB 1P9NA 3WNBA 3CONA 4E03A 4LJ6A 4MKGA 3GLFA 2FSGA 5FPKA 1CEEA 1CJVC 3TK1A 4KLZA 3WHLA 2RMKA 4NPHA 2Q6TA 3BH0A 4V0NA 5CK4A 4DSTA 3KJEA 3U3JA 1EESA 4OHXA 2RH5A 1GWNA 3ASZA 4GZLA 2D7CA 4IEEA 3RC3A 3KFVA 2YVUA 4Q1CA 3AVPA 1NVUQ 3QF4A 1YRBA 1Q12A 2B6HA 4A0HA 3ZH9B 3QY0A 4ZI3A 3OZXA 3U3MA 521PA 3BIFA 4LJ9A 4Q7JB 4QJ4A 5HE8A 3QG5A 3KKMA 4D2IA 3DKVA 3AVYA 3QBVA 4DLXA 1XTQA 5TARA 1Y3AA 4TLAA 2IA5A 5E4FA 3NXSA 4MRSA 2W6ID 4BASA 3T15A 3WMFA 1YVDA 2W58A 4V02A 3THYA 4RCZA 1HTWA 2XXAB 3C41J 4QJ3A 1XZQA 4DEXA 4E5UA 1W48A 4E09A 4II7A 1F2TB 2B8WA 2E9SA 3WXMA 4DIEA 1G291 3O8CA 1U98A 4BRWA 2ZUDA 1NSFA 4JKIA 3P27A 2G0TA 4C0KA 1YZLA 5EP3A 4JS0A 2O8CB 4RD2A 1KDTA 2QI9C 4TT3D 5DYIA 1OXXK 4NCIA 2RAPA 3FE2A 1L8QA 1N6RA 2ZAMA 4US2R 1NLZA 4LBZA 1HYQA 5KNDA 5FTNA 3EASA 5FTLA 1Z28A 2J9RA 2QE7A 2QPTA 1TPZA 3HDTA 2WKQA 3FTQA 4Q9HA 2VEDA 1FNNA 2C78A 1NJGA 2R6AA 1Z0FA 4B2LA 2C77A 4QJ5A 1E4YA 3AF1A 3L0OA 4HUQB 1UM8A 2H1LA 3VKWA 3W8RA 2EU8A 3BAFA 1M34E 1R8SA 1Q1QA 1U9IC 1EX6A 1XTIA 2J0QA 3KQHA 3RS5A 3ICQB 2I3BA 4AG5A 4BZXA 1IY0A 3ND8A 1T6NA 1DG3A 1MRSA 4DCUA 1NP6A 1YQTA 1SHKA 2JAQA 4LY6A 2W6IA 1DADA 4HB2A 1OH6A 1GRNA 4XSGA 1OE0A 2QRZA 2IS6A 1HT2E 2YC4C 2D7DA 1IHUA 4AYXA 4C7OA 2OBNA 5JZVA 5F98A 3RC8A 1UPTA 2ZPTX 2N46A 3OIVA 2AD5A 3H1TA 2C98A 2DR3A 4F4CA 1EFHA 3F0TA 1F6BA 2RGAA 4D4MA 1JEEA 1TUIA 2J0VA 4M2LA 4V0OA 5SZJA 2OUKA 5DYGA 2O0JA 3LD9A 1SXJC 1ZUIA 2FE4A 4TT3A 2GA8A 3CRVA 3MD0A 1SVKA 4HAYA 3TLXA 2ZR0A 4E22A 4OI2A 2I4IA 3P26A 4TTQA 4MDEA 4JVLA 1XCMA 4MUBA 3GLFB 3QOFA 4DLYA 1ZM2A 1Z47A 1G5TA 3FHCB 4XWAA 1Q1BA 1NMYA 1U0HC 4KJZA 4CEHB 4ZKEA 5B30A 3OAAD 1DTSA 4PTLA 4LK2A 4UNPA 4KODA 3QF4B 2XITA 4HZIA 1RPZA 2ZANA 1ODFA 5IDVA 3LO5A 4PQRA 3SBEA 1FMJA 2RGNC 1NN3A 5AWFC 2VYFA 4XWKA 2ZRJA 2XZOA 1BIFA 3PUZA 4PZZA 3ADBA 4QGGA 4XH9B 2AKYA 1T0JB 1P6XA 2FNAA 3ZVRA 3U6KA 4PPGA 2V6JA 4RZUA 5HZHA 2BEJA 3MLEA 1E2MA 4P4SA 3EPHA 1R0XA 5HKKD 3LAWA 3REFA 4B73A 2BIFA 5HZKA 2XB4A 3QNUA 3EC1A 4URZR 5FBRB 2XTNA 2ZIAA 4WXPA 1KK0A 2OHFA 4QNMA 4TYQA 1DO2A 5GJBA 1VIAA 2JATA 4Q9KA 1C4OA 1U99A 2OCAA 4G3XA 2ZJBA 4IKEA 1LVGA 4DZZA 3AKDA 1ZIOA 4GT1A 3TBKA 4ABYA 3V9PA 2A30A 4LDJA 1MV5A 2GK7A 3EPJA 1XD8A 5IF9A 1XBTA 1GL6A 1TL7C 2R62A 3X1ZA 2ZM5A 4L9WA 2GF0A 3P4YA 4AYTA 3U60B 4LZZA 2J7PD 4TQAA 2REOA 1IN4A 1HUQA 2G83A 4PSAA 4P32A 2CBZA 3IIMA 3TJZA 4AKGA 1E96A 2N1BA 2OAQ1 4LI0A 1DO0A 1KJYA 2FV8A 1OFTA 3OAAA 4G5QA 3QKSA 1V43A 4EJSA 3W8NA 3B9PA 2RHDA 4NTZA 3I73A 5FTKA 5JJKA 2PZGA 3U3RA 2GAOA 4OI4A 2ZI9A 2EFHB 4FW9A 1GKUB 5JBQA 4RSGA 2VP4A 5H68A 1QVAA 2DYKA 2XTZA 5DI9A 4MDFA 2QEQA 2C96A 3U2QA 4PO1A 1WXQA 2XSZD 1UBFA 5E95A 3GLGE 1EXMA 1SXJE 3A4NA 4V0ME 2RGXA 1D6JA 3WYFA 1G3IA 4EPVA 4QNRA 3MJRA 4G1UC 4LHYA 4Q4AA 3KDSE 5G3ZA 5LD2C 1TQDA 5FBWB 4YXWD 5HKKA 3AKYA 1CJKC 4DIDA 1G7CA 2H17A 1H65A 1RW4A 4Z51A 5EUQB 1ZM3A 2ANBA 2CL0X 4JVNA 4PSKA 2ZSEA 3OFND 1T5LA 1WDTA 2WWGA 4HI0E 4BLQA 5JCZA 1M1YE 4BFTA 4PAQA 2YC2C 1XF9A 3FMIA 5JWRA 1GITA 2FG5A 1N5JA 4DLWA 4LHZA 4F38A 1E3MA 1U2RA 5TY0A 5KU1A 3VHLB 3L8ZA 3QXCA 2J7PA 3DMDA 1LTQA 2SHKA 3EARA 1R4AA 4L8GA 1HT1E 3D31A 4A0GA 3KXIA 3C16C 5K8UA 4LV6A 1JAHA 3ZD7A 4D80A 4RCYA 1NBME 3TGPA 1HQYE 2CK3D 3GEIA 4OHVA 1EK0A 4JKYA 4IXMA 4YONB 3QENA 2AX4A 4MRPA 3TNFA 3QQ5A 1ZRHA 1J2JA 1L7VC 1YE8A 1N6HA 3FHTA 2NIPA 1D8TA 4AK9A 3CPJB 3IEUA 4YMTA 2ONKA 3PEWA 3S1AA 4PHTA 1YR7A 2BBSA 1W4CA 1JAIA 2VPPA 5BN4A 2W83A 4M9QA 1EX7A 2EFEB 2WKPA 3EPLA 2XSZA 1XTSA 3VX3A 4TSFD 3LXXA 3HPRA 3W90A 4PPFA 1N6LA 4KVAA 3GJXC 2F43A 1A1VA 5H70A 1KI8A 2FEMA 4X8LA 3TVDA 4LJ8A 2JIZD 1ZNZA 2A2ZA 4YXWA 2WICA 1ZINA 1Q22A 1JBKA 2BKEA 4JT2A 1KMHA 3SDZA 4IXNA 4KITB 1A4RA 5JRJA 5EXTA 1U94A 3Q5EA 2VSOA 4DLUA 4LJYA 1FPMA 2YWFA 2ZRDA 1CTQA 2GEUA 4BE7B 3W9YA 3OIYA 1NLYA 4AYWA 2NGRA 4NE2A 4QGAA 4LBWA 4AKIA 4TMVA 2HYIC 4L15A 1U9IA 2D06A 2WZQA 5E7MA 1OYWA 3K0AA 4PR0A 4TLBA 5CDFA 3GMTA 1FTSA 3UXMA 5AR1A 3ZLJA 1ZU4A 3RYTC 3DM9B 2GTPA 1N0WA 2IYYA 3AEZA 3PEUA 2CK3A 1G4AE 4NYMR 1W5SA 3PIRA 2X2EA 2C99A 2RCNA 5EP1A 3QKSB 1E0JA 4QGFA 3RS4A 4EJSB 1YZUA 1E1RD 3WBKA 4YDHB 2OSBA 2IYXA 5EQTA 1Q20A 4CF7A 3GJ4A 1U0LA 2NZ8A 4KXFB 3PUXA 2EQBA 2JEOA 3L0PA 4A0FA 1CXZA 1WBBA 3P32A 1IN6A 1XMJA 1G8PA 1WRBA 2GCNA 3NBYC 2WWIA 4B33A 4U00A 1YZNA 4TSFA 2WVJA 3NHAA 2FOLA 1GILA 4N1AA 2OLJA 3CF2A 1KI6A 3UPUA 2GXQA 2JIZA 4Q4AB 2HF9A 4MRNA 4EFMA 4QBFA 2DWQA 2KBEA 1G4UR 4PZLA 4B2IA 5FOUA 3THXA 1Z6GA 1W47A 2ZR9A 2VH5R 1TQ2A 2QORA 4A2WA 5GJWC 3KQNA 3FKSD 1M2OB 2OILA 4UNNA 1GKIA 3K1JA 3NHBA 3IKJA 3W6NA 2X1VA 3B1XA 4HLQB 5EE5B 3T06B 4B44A 1VTKA 1BH2A 3DKPA 4FI3C 2ZJZA 4FINA 4B74A 5FUVA 3AUXA 2BCJQ 2RGNA 3QSYA 1GOTA 2F7SA 2QPAA 3ZIAD 1Z0JA 1G41A 1N6NA 1SZPA 2HCBA 3THWA 1YR9A 1YR6A 4FCWA 4IVRA 1NLFA 3QXXA 3EZ7A 5CIWA 4BLOA 2QBYA 1ZD8A 1C1YA 3AUYA 1NKSA 4URUR 4CIDA 3ZJYA 1UDXA 2FFAA 2V55B 3ECCA 4Q02A 1GG2A 2ZYVX 3TW4A 1AKYA 4P0TA 2FSHA 1E1RA 1PLKA 4L9SA 1R0WA 4PHHA 1CJTC 1UADA 3D6TB 1G1MA 3PV0A 4O3MA 2GXUA 1OLOA 2N42A 2IF2A 3S1AB 4D0NA 4HB3A 4IHQA 2JCSA 5KPJA 3NH9A 4MGIR 4IW3B 5CLQA 1E32A 3AF0A 3B7GA 1SULA 2ZE7A 4IOMA 1FTNA 3Q9LA 4M1YA 3ZVLA 1P5ZB 4UNRA 2OFOA 2WKRA 1Q1EA 1G5RA 2VSFA 1OB2A 2J0SA 1G8HA 2WAYA 1SKQA 1G16A 5B57C 3WYGA 3SEAA 1TF7A 1VG8A 2GVDC 2R8RA 1W4BA 4D82A 4XWOA 3K0CA 3MMPA 1NN1A 3BORA 3O8DA 4Q1FA 1DAIA 2OT3B 5SZKB 5KDOA 3FWYA 1H8HA 2W6JA 5E3HA 3FKSA 4Q4HA 1Z06A 4KO8A 3CPHA 1GTVA 1E0AA 2ORIA 2QTVB 1LW7A 3FPAA 121PA 4M1SA 1AGRA 1II0A 2FX3A 4JL6A 4B47A 3RRNA 1QBKC 4NYIR 4OQXA 3ZIAA 1I4DD 1ZIPA 1FZQA 2VP0A 4HLUC 2ZSDA 4JMPA 4UJ3A 3I5XA 4D25A 1CP2A 4TQ9A 4BFSA 1X8JA 3SJCA 3HR7A 1GVNB 2ZJAA 5LPNA 4AURA 2C9OA 2IXEA 1TQ6A 1W1WA 1DAFA 2F6RA 2QG6A 4NP6A 3GJ0A 5B58C 3FGNA 2BMEA 1XWIA 2BBTA 2ZJ8A 2QGZA 3DZDA 2C2HA 2IF0A 4DWJA 3TUZC 2C03A 4Q21A 1BOFA 5JSZA 3K70C 3H0KA 3X1WA 1KAOA 2IEZA 1G17A 4XVUA 2CCGA 2CL6X 1P9WA 4AD8A 1SXJB 4P31A 4ZDKA 1N5KA 2AFHE 3RS0A 1W2HA 2H16A 5BYJA 1WMSA 5IK2D 3N5CA 1KI6B 3SC3A 1CR0A 3U61B 1FUUA 4MYUA 3KKPA 4I1UA 3WY9A 3GFTA 1IOZA 2QAGC 4ZDWA 2WWXA 1XD2A 4BZQA 1JPJA 3THXB 2QSZA 3ZVMA 2XJ4A 1W2GA 3HJNA 4WZAE 1KSJA 4IDQA 1NF3A 3LA6A 3GLFE 2ZS9A 3PENA 3GCGA 2DWOA 5EJEA 3W5JA 4DB4A 2QTFA 4U5XA 1S8FA 4PC1A 2AK3A 5GVRA 1IAQA 4GPTA 5CB8A 4PHGA 3AKCA 4PPNA 1VG1A 4J0QA 4TLEA 4WVFA 4B35A 4BWYA 5FUWA 5HR5A 1VCNA 1UKYA 1SGWA 4QC2A 1F60A 4QGHA 1G6OA 5HE9A 1UJ2A 2Q9AA 2DFNA 2OXCA 4D4JA 4DDWA 4I81A 3VR1A 4Z8XA 2PL3A 3U5ZB 2WTUA 4NYJQ 2QMHA 3SS8A 3WMEA 5C4GB 1IJEA 3EXAA 5ELXA 1G19A 2VQSA 2QSYA 3HU3A 2G0NA 3W6PA 4F91B 5D3MA 1YZGA 3FMPB 2JLWA 2YYZA 1R0ZA 2WMNB 3PEVA 1OSNA 2WOOA 5IK2A 4D4LA 2O8EB 2CCJA 2OCPA 3GEEA 4YLGA 3GJ7A 3H86A 2KWIA 3KX2A 4R2IA 1E1QD 3CRQA 3FFBA 2F1IA 2VHCA 4HAZA 3MG9A 4WZ6A 1M6NA 2O8FA 2W2XA 2ZE8A 3K9GA 4ERNA 3LNCA 4DRZA 2AKAB 5FOSA 2RB4A 2V9PA 1N6PA 5SZIA 3DOFA 3MWYW 4C9BA 3TKLA 5DI3B 4G5OA 1KDRA 3MUFA 1E9AA 3J81k 1XMIA 2EYQA 2NO0A 1AZTA 2KJQA 4JT4A 3W6OA 2J59A 3TUJC 3X1XA 4B3DA 4DSOA 1Z63A 2IS4A 1AIPA 1VKJA 2AXNA 3AGQA 5J5CA 1AS2A 2CDNA 2DHRA 1S3GA 2EVWX 1Z0AA 1Z07A 4LYHA 2F9MA 2WWWA 3A1SA 4Q47A 4EPWA 2RGCA 4B75A 4TZ0A 2PX0A 2ZRPA 1KDOA 4FN5A 5LD2B 1E2PA 4HSEA 2GCOA 5C18A 2F3TA 1E2LA 1MRNA 1A7JA 3B1VA 2VP9A 2NO6A 1NJFA 1D9ZA 5EZ6B 1E9CA 2UKDA 5JSZB 4KVGA 2PEZA 1ZW6A 2IYWA 1E9FA 2RHMA 4EUNA 3RABA 1G8GA 2C95A 3SBDA 4EAQA 4LOAA 4MH0R 2BBOA 2JJ2D 3CKLA 4TMXA 4QBHA 4JBXA 1VCMA 1EFCA 4LPSA 3RVBA 3NC0C 5DN6A 2I1VB 2JLQA 1E1QA 1RJ9B 3FKQA 4GL2A 1YKSA 3BGWA 2IYQA 5GADl 3OIWA 2QQ0A 2VF8A 1VYUA 1NY6A 2B7BA 3V4RA 4M53A 1ZJ6A 2HCJB 2LCFA 4PXAA 1UBCA 4JLDA 5B2ZA 2QE7D 1K8RA 5C2JB 4RD6A 4CEJA 2FGJA 3K70D 1SVLA 3MWJA 3CUEF 2EFCB 2H57A 1W0KD 4PC3A 2BHRA 4H1UA 4F4JA 2OXRA 3QEJA 4M1MA 4LHWA 3ZGXA 4AY2A 1AQYA 4IOKA 4IFEA 4D6PA 2QGNA 5KHOC 3SU8A 1N6KA 5J4KA 1J7KA 2DWPA 1OXUA 1OXTA 1VIYA 4Y0AA 1E2DA 1OPXA 3TE6A 3CZQA 3EZ9A 2OZEA 2ECKA 2X2FA 3OESA 4Z1MD 4D0GA 4YMSA 4B3BA 1FUKA 1T8TA 3EA5A 5FBQB 1XX6A 5HCNA 4TLCA 4MITA 1E98A 5FOWA 4H1VA 4LJAA 1OIVA 4LPKA 4ESHA 4OHYA 4BGDA 4RY2A 3CM0A 2NTYC 4XVQA 1J70A 4W5WA 2JJ2A 3DO6A 5D3MB 5FOTA 3A58B 2V1XA 3BJIC 1UFQA 3U4QA 3TR5A 4M1WA 1FQJA 1P60A 4HLUA 2ZRKA 4A6XA 1UKVY 4B2PA 2BKUA 4B3XA 3AP3A 3K0FA 1MO4A 1YZTA 3FFAA 4ITRC 2FGKA 1E2NA 2O8FB 4DCVA 2VHTA 1T3HA 1IJFA 3WRXC 3NEJA 3T35A 1Z6YA 4X8MA 1IQPA 2J45A 1DAHA 3B1WA 4DDTA 1E99A 4IFBA 2CNWD 1OYYA 3KKQA 5FR1A 5FOXA 3X1DA 5KSPA 721PA 3KQUA 5BXQC 4HAXA 3QE0A 4Q00A 1U8YA 2GEVA 4BPBA 4ZKDA 1ZCBA 1W0KA 3W3ZB 3U7GA 3T12A 1II9A 4TYPA 4CT5A 3PG5A 3AVWA 3LY5A 4NCKA 1MO3A 5H8WA 2X8AA 4QM6A 1XFAA 4BECA 3EAQA 1OIXA 5CIQA 2E1RA 3AVTA 1D9XA 4ILEA 2IUTA 4UXJA 2QL6A 1X86B 4Z1MA 3KQKA 1ESMA 2YWHA 3HP1A 1IM2A 1SVWA 5D3QA 2QAGA 5FPYA 2WSMA 2Y8EA 4JL8A 2GCOB 5J47A 2VHUA 1IN8A 1R2QA 4HYYA 4PSVA 4AIIA 3CF6R 3JVUA 3SE0A 1QRAA 3VU9A 1R5NA 5KPDA 1CF4A 1VHTA 4BFWA 3ZZUA 1NVVQ 1E2FA 1LV7A 1YZKA 4IDNA 1XEWY 4IEIA 4PO8A 1QHNA 2CMKA 4QHTA 1N6IA 5DIFA 5EP4A 1EFTA 1OH8A 4URWR 4YMVA 4JLBA 5EZ5A 1JQLB 4Q7MB 2R6DA 4MA4A 1QG2A 3DM5A 3EWSA 3F5FA 4V0KA 2PEYA 4I1SA 1JXOA 2FDCA 3LDAA 1TF5A 2Q3MA 1HV8A 2ZJOA 1CR2A 1Z29A 4Q7LA 1E2HA 2GNOA 2CNWA 2YOGA 4ON9A 4XJXA 1S1MA 3E1SA 4CEJB 3VNVA 3NWJA 5JS8A 4LUCA 4W5JA 3PVSA 3WRYC 4DDUA 2FMXA 1X1SA 5LDDC 2OE2A 2FSIA 3L8YA 2IYLD 4KHZA 4QBIA 1RRPA 3ICEA 1P4SA 1R7RA 3VR2A 4RKEA 4ARZA 2CXXA 2PCJA 4TMZA 3ZS8A 4JLPA 4I4LA 4NL4H 3ZS9A 4Q9LA 2GJSA 3AV0B 3T1QA 5TV2A 5GJVC 2UVQA 3LWNA 4Q1BA 1KSHA 2VO1A 3W5IA 1NL3A 4NMMA 4A0RA 4D0LB 1LS6A 2H18A 3SYNA 1JI0A 3AM1A 4A8JC 4M0LA 5FFMA 3I72A 3THYB 3AVXA 3NC1C 1SVOA 1KYIA 1XEXA 2MMGA 3C14C 3B1YA 1HQCA 4GMXA 1WCV1 3MWKA 2RGDA 2P2LA 2B8TA 2P6UA 2UZIR 3MWLA 4DCTA 5JJIA 2IUUA 5GVSA 3ZYCA 3K0FB 3UATA 4B34A 2PLFA 5JCPA 3T1VA 1NNEA 4L16A 4OYHA 2ZU0C 1N6OA 3ADKA 1X6VA 1Q1ZA 3FVQA 3C5CA 4O25A 1NMZA 5J4YA 1W46A 2ZRIA 3QXSA 4W9MC 4QM7A 3EPKA 2PZEA 3A8TA 3K0CC 1GP2A 3K70B 2FFQA 3SJAA 5CDFE 3CRRA 3LXRA 4POAA 1TEXA 1O3YA 3EIQA 4WBSA 2AHOA 5FL3A 4NCHA 1AN0A 2J7KA 2VIIA 2BBWA 1Z6XA 4UXIA 2Z6VA 3BK7A 1SVMA 2WJJA 5BN3A 3H2YA 1UEIA 4Q01A 4IOLA 1CKEA 2WJIA 1E2GA 1GDDA 2ZITA 1RVDA 1M7GA 3NIBA 4ZIRA 4XSHA 2A5GA 3RWMB 2YNMA 4PPQA 5JMTA 4KSBA 4HAWA 2OCBA 2NO9A 5LB2A 2YINC 4ZCIA 1JR3D 2QAGB 2ZRLA 4LV5B 1T91A 1S9DA 2H8KA 3VU9B 1IONA 1QVRA 3FMFA 1KI1A 3DZ8A 4UQOA 1XZPA 2JGNA 3AP2A 4C7OB 2CE7A 1LB1B 4ASUD 2ERYA 2IBMA 2FA9A 3LBHA 4UXHA 2KI5A 1KJWA 2PT7A 2P3SA 2VP6A 1RE0A 3LX5A 3RANA 4B43A 3CX6A 1GNQA 1MT0A 1Q3HA 2D62A 4RD1A 2DB3A 1DAKA 3BH6A 1XXHA 1NY5A 2BCGY 2OG2A 3P20A 5L3VA 1S2MA 1ZAKA 2WBLC 2BM0A 3QIAA 3GQBA 1KY2A 2ZRGA 3LRPA 2F3RA 1E2EA 1YU9A 3Q5DA 5C1BA 3B6EA 2CHVA 1P72A 2W0MA 5BYKA 4XD7D 3TSZA 3KJHA 2PX3A 1HA3A 4LBVA 4LJ4A 5JRZA 2IUSA 3U7FB 5FUXA 5DO9A 3PQCA 4Y0VA 5J4VA 1IY1A 1MOZA 2WM9B 1T9HA 5DHAA 3NVAA 3OE7D 2A5FA 4NZYA 4OK5A 1S9HA 3RRMA 4LSGA 1WA5A 2CLCX 3KFXA 1E4VA 1FX0A 1JR3A 5G3YA 4DSNA 1NN5A 1PUIA 4XTRA 3WBJA 3QKUA 4BFVA 3UKDA 4PZYA 1Z08A 2ZRNA 2QENA 2REXB 5FPSA 2WV9A 4JLVA 2FZLA 4JLOA 4P4SB 1ZYUA 4ASUA 4PAOA 5DH9A 4Z54A 3K53A 5CYOA 1XEXB 4AKEA 1GZSA 1NG9A 3FYHA 4FMCB 1ELOA 4NONA 2VLIA 4IDOA 2FF7A 5J4HA 2WIAA 2IXGA 2R6FA 4EPTA 4YMUA 5K8IA 2NPFA 1E2QA 1XP8A 2QPOA 4Q9IA 4N0EA 1DVRA 3TUIC 4CZ2A 2ZETA 621PA 1P3JA 2GCPA 2OEPA 1SVIA 2YHSA 3K0EA 4JLAA 3VFDA 2GXAA 1WF3A 2P5SA 1B0UA 2QA5A 3DOEA 4IVPA 4A36A 3KKNA 2QAJA 2X19A 2PCLA 3U3OA 5FBVB 5FTMA 4ZV4A 4XD7A 1AGPA 4HDQB 4DB2A 1VMAA 3CNNA 5F3WB 1MABA 3BB4A 1OFHA 4C0BA 1H8ED 4Q1DA 2PH1A 1P61B 4BRUA 3GLHA 2AD1A 4EPRA 1W36C 2WJHA 3RS7A 1LF5A 1SQ5A 3OE7A 1M7HA 2CVFA 2GBLC 2O52A 1DE0A 1JALA 5LBIA 1ZD9A 4AI6A 4C3ZA 4ZIRB 2PMDA 5EE9A 4DLSA 1AK2A 2DCUA 4US0R 3AH8A 1F5NA 4W7SA 3THOA 2IS2A 4NKRA 3LBNA 1R5BA 2ZRCA 4GDFA 5IHPA 5IRCD 2FFHA 3MFYA 3LQQA 1FMLA 1R6BX 3KKOA 2P6NA 2ERXA 4JBYA 1AS3A 4BUJA 4AG6A 4EDHA 1H8HD 2W6JD 1NI3A 5J40A
chains in the Genus database with same CATH superfamily
1LLUA 4TV9A 1DBVO 2XVMA 4EVSA 1J23A 2GYYA 4B31A 1TEZA 1ZZEA 2VNJA 2HHLA 1N1DA 4I9NA 5AXBA 5TR9A 1W25A 4E4TA 1XMSA 4D02A 1AF7A 1JXMA 1QFMA 1E2JA 4UAGA 3HK2A 5T41A 4KAAA 2ZU6A 4P2GA 1HDGO 3AVOA 1NQOA 1V3UA 1GTJ1 1DOHA 2JIBA 3CW2A 3EGEA 1XTVA 4QU8A 4R8KA 3HB7A 4UVIA 2IYSA 3ITDA 1HZJA 2JNWA 1U6KA 3BCUA 1I10A 2BFNA 2X7HA 3DF7A 4H08A 4JYCA 2B21A 1S7CA 2J6HA 2O7VA 2SNIE 3RV4A 4YJ3B 4NY1A 1SBCA 2WSIA 1MHTA 3HS3A 2O06A 4AL4A 2VZ8A 1TTTA 4D4IA 4YAGA 3B1ZA 1NW7A 1CS4C 1T43A 3F1LA 5KB3A 1U9CA 1YA6A 2ILVA 4WW0A 1C7FA 4ENWA 3D6JA 3CEMA 4UVDA 3A1UA 1Z5OA 3LHIA 4GYYA 4QTUB 5JHGB 2IHUA 3NH6A 1NXTA 1RZ3A 1E9DA 3MRSA 4XUCA 4UCFA 4LTNA 4KQFA 2QB5A 1GA4A 1RQXA 3HY3A 1II8A 4WK4B 3EIUA 4AU1A 1O6ZA 2A1IA 4QGHA 2CLFB 2VWHA 3DBRA 1FXWA 2Z5VA 1BW9A 2CFRA 4FYWA 3A6LA 1U8FO 4K1XA 1QG6A 3K1AB 5I7AA 2XUDA 1G9XA 2ZGVA 4HLDA 3TQIA 4KR2A 1DARA 4G8BA 3UMJA 1WXIA 4J6EA 4H3SA 2G1JA 1OIWA 4KJXA 2KS6A 2HGZA 5DM2A 4M4SA 1YTLA 3N6VA 3G8BA 2I55A 4RNCA 4JOSA 5F4BA 3D7KA 1HFKA 2PX5A 4I99A 3PTAA 1VYTA 1ZN7A 4HWGA 4PYKA 1PR6A 3OTQA 3KB2A 4XUEA 4D8UA 4KR9A 3NTQA 3EIEA 1Y3HA 2B8EA 4YJ2B 1DCFA 2J0EA 1OWPA 3MJHA 2WE8A 1SUSA 3G8DA 4JIMA 3S70A 1CRZA 3CGGA 1XCGB 1Z5ZA 4KBFA 4LJSA 1Z0SA 2FWNA 2ZQYA 4UM9D 1JQKA 6LDHA 5IDXA 1J42A 2ZM6B 1HX7A 4CDMA 1ZC4A 4MQUA 3R3JA 1Y8CA 1Q95A 2XTMA 2JFNA 2QK4A 5AJZA 2QU8A 1C9KA 2RG1A 3CTPA 3G0DA 4GPIB 3SIPA 3W8DA 1TD9A 4QZVA 4LRWA 3L4BA 1E6KA 1U8XX 2Y1OA 3HUEA 2IQ5A 4NYJR 3SXJA 3L0YA 3UGQA 1LI5A 2FFJA 3CISA 5LKRA 2XNSA 4HMPA 1ORVA 5DTRA 3TXXA 2E85A 3G88A 3R76A 4OLHA 2GYWA 2PQ2A 1FS6A 1ENZA 3WJAA 2J3DA 3G9QA 5HEKA 3UOAB 1S96A 3KEMA 5FO1A 4NEQA 1PG0A 2OR3A 4IIBA 5KYGA 1FP6A 1L8LA 2F59A 2KW5A 3VV2A 3REQB 3VVLA 4C0QC 3GX1A 1EIWA 3PC4A 4F92B 5I9SA 1N1GA 4N47A 1SMKA 4H1HA 3T9FA 4DV7B 2FI1A 2R0QC 3PYMA 1F0NA 2NOAA 4LE1A 1N0UA 3FVTA 4L4SA 5CJPA 2F48A 2P27A 2H9YA 1U3CA 4Z99A 3V4LA 3MMNA 1OWOA 4AP9A 5ITZB 2OZPA 3VR4A 3LT5A 3W2TA 2I9KA 4Q3EA 5EPOA 2DH5A 4MJLA 2H0RA 1NQAO 2OQ2A 2GETA 3CR3C 4RIEA 3MELA 1CQWA 5EHZA 3S2IA 4RVCA 1S1CA 2VAMA 3NYQA 4Q37A 4DMLA 1X1RA 2NXWA 1DEOA 5DHFA 1VBNA 3NFYA 4UNSA 2P75A 3ZDXB 3T1TA 1EHIA 1Y42X 4INJA 4B3GA 2WABA 2EG5A 2GHTA 5KYYB 3BGIA 4ND6A 1OHHD 4AF7A 1KKLA 3UMYA 1COWA 3ZJTA 3TX6A 3GEGA 4A8JB 2DJIA 2CD9A 3J81A 5IMBA 1DXHA 3EISA 4IIVA 5C4IA 1U5CA 3G0CA 4B3FX 5JH7F 4YB8A 2I1WA 1T1GA 2LDXA 3KC2A 5B3AA 2RBEA 4BVGA 3GD7A 3OSZA 1W5FA 1S8NA 4YMGA 4Z7QB 2BSQA 3STTA 1MOSA 3RIYA 2NT4A 3KWLA 4Q1VA 3CUKA 4M8SA 3M6LA 4RV5A 4LF9B 2P6OA 4D4GA 2PL5A 4OOFA 1RAGA 1CS0A 4JNKA 1PJ4A 3BRWA 3ZWVA 3LL4A 4R0VA 3U19A 2NSHA 1N8SA 4KKXB 3EQ9A 4PLPA 1J21A 3V8PA 3FF1A 2X4GA 4IUCS 5E2AA 4CM9A 2V98A 3EEIA 1H42A 3IAS6 2ODPA 4QXAA 3AR6A 3MMZA 2CF6A 4H1WA 2VPIA 4OHKA 2BFEA 4GI7A 4J16C 5IEBA 1KQFA 1ISPA 1WCIB 4TTJA 1UP6A 1JB1A 1GZVA 3TTYA 4EHJA 3SIWA 5AKHA 1BE6A 1DQRA 3KSAC 4Q4JA 3CSUA 3DMYA 1MO5A 1CETA 3NBZC 4MB0A 1TUGA 4M9ZA 2P9BA 3R44A 3FPFA 4FE3A 1C1XA 4A4DA 2VHJA 1BXGB 1EDDA 1PFYA 4KE6A 5A3JA 3O74A 3UQYS 4IWYA 3TDKA 3W1VA 4MIOA 4DG5A 2OFWA 5JECA 5C46F 1RYBA 2GBLA 1B14A 4BVEA 5GQSA 1OOEA 2RKOA 2ZUWA 4R69A 2FPRA 3CW9A 2XD4A 4DR1B 1ZXBA 2QP9X 4NDAA 4PGMA 4OX9B 2DGDA 4BNJA 5BMOA 5C8DA 1CVIA 1EGAA 3ICVA 1TFRA 2YHUA 1DAGA 4BKOA 2UYCA 2I6TA 1CERA 2NTVA 1D7AA 2EWWA 2IE8A 5D85A 4CCYB 4CF3A 4KPEC 1CY1A 4FFBA 3RUAA 4F0JA 3CURA 5CB4F 1DRWA 2XE4A 3A4TA 3I30X 2WOJA 2Z5GA 1JW9B 4UU8A 1KI9A 4YI5A 4TL7A 5LNK1 3DLCA 3HB5X 1LI4A 5GJCA 1XZGA 1JILA 4CM4A 1QK4A 2VXBA 2W71A 2BGLA 1F14A 1PLLA 5GMOA 2O1XA 3A1VA 5JE8A 5ILQA 4BGEA 1SU4A 2EP8A 1DX9A 4RH0A 4TXHA 4WAUA 4DHWA 1NR5A 1CE8A 4YTEA 4ESVA 2ISSD 4TKUB 3AKEA 1S02A 3KP1A 5CDHA 2C59A 4TSRA 4WJZA 1DOAA 3NBXX 4HWRA 4S1NA 5KYXB 1ZCFA 3L7YA 4F21A 1RE1A 4FYHA 3E7FA 4C4SA 5B3LA 2LKDA 1UZAA 1IEXA 2W2KB 3BWDD 3CF0A 3HXKA 3VX4A 1WB9A 2VHEA 2SCUA 3Q12A 2OBLA 1QZUA 5G0UA 3DUFB 3IEKA 1KKUA 1J22A 4G01B 1SKYB 3GYBA 1TU3A 3CSDA 3P0HA 1E0SA 4C29A 3CR8A 2GHIA 4XWGA 1SEPA 1DIHA 1JDZA 2HADA 4X1OA 1TO6A 3TLGB 5K09A 5DNEA 1VLVA 4MQEB 3OSUA 2JJ1D 2H08A 4WKBA 1I7QB 3ONDA 4LCJA 1QYIA 3T7KA 2AE2A 2R8YA 3UYLA 3W6UA 4NBSA 2WP8J 3T38A 4RPKA 4UM9B 5AJWA 3AESA 3I2FA 5TGTA 3QLVC 2C2YA 4BLRA 3DEAA 1EXWA 1EJBA 1W85A 3WKCA 3DFFA 1WMBA 2NYUA 3DDOA 2M6KA 4GKJB 2AVNA 2NZUG 1W4LA 2RGGA 2DRIA 3UK6A 1OQAA 3L0IB 4LV8B 4ZT5A 3GL9A 3EW9A 3IXLA 3T7JA 3EZ6A 4B6EA 1K7EB 4UFOA 1PL8A 1E79A 4CEHA 5EUMA 5J9FA 3A6EA 5HFNA 1Q74A 4PHCA 2HO4A 3HYTA 2AC2A 3I01M 1GTG1 4FXOA 5K3AA 1AHHA 1SBQA 1U2DA 4YI3A 4ZCSA 2QXYA 3L40A 4LYDA 4PICA 4AN1A 3L7AA 2JK1A 1H6CA 5KNCD 2I7TA 1H3NA 3LDGA 1ULUA 3N28A 3E5NA 4B32A 3A6PC 4DV0B 2P9EA 4I1VA 3I62A 4TVBA 4XXHA 1RJDA 3TIGA 3ZHZA 4KMMA 3HGMA 3WNDA 4G1FA 5KVQA 1RZRA 1GIAA 2Y71A 4HH0A 4BHTA 1J99A 1GGVA 3OP4A 2HYDA 2R25B 3SXPA 1VYHA 5REQA 4BLPA 3RHFA 4WK2B 1G64A 4ZOAA 3QTBA 5CA1A 1UXKA 1KL7A 4MYTA 3LKBA 4LW8A 2QVCA 1IFXA 3DC7A 1I4TD 4WESA 3KZ1E 2VHXA 3CR7A 3ZDZB 1KI3A 5L3SA 4JP3A 5SY9A 2W2MA 2HW8A 3CE9A 3G3EA 3LMKA 4GFDA 5DW3A 3TZ6A 2YRFA 3V8NA 4W82A 3I61A 1G21A 1R8QA 1KNXA 3DD1A 3FZYA 2JAXA 2VAWA 4G5RA 5UKDA 4F4IA 3VA7A 3G5TA 1BHSA 3TW8B 3IGFA 1DQSA 3IMFA 4JLMA 1XPJA 2B3DA 2FQQA 1QQ5A 1SRRA 3DDNA 5I9NA 1SPXA 1OI4A 1O94A 3V1MA 2I5PO 2FFBA 2V6IA 4MGKR 2M9MA 3NT4A 1OH7A 3UANA 3KZKA 1JG6A 4XEHA 1P2VA 1DTEA 3BL5A 2E87A 3E58A 1TRHA 2F3SA 3DR5A 4IAOA 2B0CA 1ZICA 1O4WA 4S1OA 5KZMB 3OQOA 3F8TA 3R3XA 4LA4A 4LZWA 5BT8A 3VH4A 1GCUA 2EYUA 4P98A 3VZPA 3GGJA 1DAMA 4B83A 1XRQA 3P19A 2CVHA 3ROTA 1LKZA 2VXYA 3V1TC 5LXTA 2WSSD 4B6JA 2PUEA 4KREA 1WZIA 1X38A 4YJ3F 4FTWA 2HC9A 3PPVA 4CQLA 4BY9E 3KV3O 1K5PA 1RM4A 1M6WA 3MIZA 4GZMA 4YECA 1G5IA 2FOXA 1WHTA 1YVUA 3QY9A 5FCDA 5BR1A 2VTVA 3AT1A 3TI7A 3EZLA 3PR1A 5AKGA 1C0LA 3FWZA 3RT7A 5KNBD 4XQEA 5H80A 2PVPA 2XE6A 4BNFA 3QYJA 4KXVA 3W9BA 3DS8A 3U6BA 2CVQA 4TKVA 3MA0A 2CD7A 3TTVA 4MDHA 2R1ZA 4X1YB 1IXRC 3ZYZA 3KQLA 4RJIA 3D3NA 3F71A 3T3NA 4CQJA 3V4PB 2FUCA 1T5HX 3FFXA 5KJEA 3K0SA 4UM7A 3TQQA 5A6VA 3FPEA 1Q16A 2OTCA 1QF9A 1P1RA 1VCOA 3EGDB 4LY3A 4QUGA 3WK8A 3TAUA 4DG8A 1EUQA 5HJEA 1V4NA 4MR7A 4YAEA 2WP0A 4XI9A 3LG2A 3W3AD 3BMNA 1EZ4A 3D7MA 1J1ZA 1NTRA 4YFVA 3W5CA 9ABPA 4D81A 2HKIA 3R9XA 1SFRA 4LQDA 1N5LA 2MOKA 3LP5A 3IUPA 1ZZGA 1QCDA 1Y4SA 2X9NA 1C8BA 1UF9A 5BN5B 4UFNA 5K3SA 1P75A 1L7XA 3TX2A 3ZY4A 4CEIB 4DQKA 1Z2NX 2PR2A 1AS0A 2XNDA 3HWWA 2IV7A 3MTAA 4YJ2F 3TQOA 3RU3A 5CFRA 5D7NA 1LQUA 5JJLA 2JA1A 1YQ9A 3MGBA 2ZI7A 4EYSA 3BRQA 4FDTA 4QHYA 4YCNA 1PQUA 1FP2A 3NGMA 5KYWB 3DTVD 4FIZA 2ISCA 1S4QA 5IVIA 1Y9JA 1QKJA 4J0EA 2P6MA 5HGJA 2C0PA 2R84A 3G9UA 2XA2A 3W5BA 2VQEB 4B3SB 3B60A 1ORHA 1VOTA 4KRYA 3W78A 2FPLA 4YDSA 2XZPA 4MV5A 3H97A 4EUEA 1SCAA 1MH1A 1XQXA 4P5DA 1SM4A 2QD4A 3GZTB 1XR3A 4O4HA 4R8SA 3I9JA 3HPQA 1JIVA 1DKNA 2B1JA 3EG5A 3ZI4A 3MYYA 2ANCA 1NDUA 1QPGA 1LC3A 4GXQA 4HB4A 3M8KA 2NU9B 3N2KA 2WT9A 3DL2A 4O2AF 5EG5A 2I29A 4OMCA 2XV1A 4QARA 5BXYA 2CHQA 3NGXA 1YMQA 4YAOA 1PJBA 5IN5A 3ZW8A 4PIPA 3VU3A 2IYEA 3ZLUA 5JAQA 2FMKA 4HCJA 1LRJA 2B8NA 4UPDA 1QFJA 3W34A 5EHNA 5KYVA 4HUJA 1DXOA 3LBAA 3LOPA 2HQSA 1JU3A 2CCKA 3U4DA 3HZHA 4BFXA 1N2CB 1O8CA 3ECAA 1F2UA 2JGDA 3D4PA 3EPRA 3GWZA 3I4LA 2TMGA 3IQHX 5CLGA 4M0PA 5EEGA 5JEEA 1JR2A 2MT9A 2RONA 4G5YA 1WNTA 1FS4A 2D5CA 1T6ZA 1XCBA 4W9NA 2DKOA 2REBA 2YV4A 3KPUA 4FFWA 4U2CA 3U9SA 3UXHA 2J1LA 3I0ZA 1X39A 1QQ6A 3R20A 5ALLA 4NDNE 5AUNB 1A5BB 1AO3A 2A5YB 1CUZA 2HA6A 2YYSA 5FNVB 2OQVA 3WZ2A 1TGVA 4CM8B 3LIIA 1TXGA 4K0KB 3IDSA 2XGJA 1MVLA 1YNSA 4RK1A 4WFQA 2QXTA 3KVVA 3BWMA 1VG9B 3DFKA 1PFWA 1XTPA 4GM1A 2OLKA 3SR0A 5JANA 3UMMA 1I1NA 3IQWA 4PNPA 1QDEA 2JFVA 1AQ6A 1SQ6A 1M34A 3AIKA 3I9OA 4ZAGA 3U7QA 1KBZA 2Q7DA 1WPGA 1HDEA 1VLLA 2W4QA 3K09A 2JJ8A 5A6SA 1AMUA 2IYUA 3OU7A 1DEXA 2ZSUA 5HIMA 1CJUC 2JGFA 3NHMA 2VBIA 2W2VA 5JPDA 1DEKA 3FZQA 3OFSA 3RFCA 3PSHA 1K6IA 4Q48A 2HF8A 4Y2UA 4EHDA 5F9HA 4P2BA 4CMGA 2I6FA 3SYRA 5CA0B 1W75A 3PT9A 3UVEA 4WNAB 4CIBA 1KFEB 5JASA 4DN6A 2FZWA 2Q9UA 4E15A 2I1QA 4TOIA 2QY9A 2JGMA 5DNWA 4UOZA 4FOSA 5LN1A 3HCDA 4ACBA 1C30A 1QIGA 2VDQB 1QIEA 3GQVA 3GRPA 4MYCA 4F12A 2C5LA 3MSXA 1Q91A 1J0EA 2NPIA 4O4JF 4DEYA 2ZYGA 1T6XA 4AO8A 4BE4A 2X58A 5FLXA 1X8LA 4RX1A 2ZIUB 3BE8A 4TTPA 3V8RA 4DUYB 3ICCA 4F04A 1NW5A 1TEHA 3UFXB 4F72A 2OB2A 5EJAA 4S2EA 3CZRA 4WXMA 1IULA 1YR1A 1S2NA 2QTLA 3JPWA 1XAHA 4P5PA 5KDLA 3DW3X 3WFZA 1KFBB 2PS1A 2WWFA 2MJLA 3VC2A 2OD2A 1L9XA 1RWWA 1LSUA 3TYXA 3MJEA 221PA 2PBRA 1WXHA 5AMXA 1V7ZA 3I58A 3THRA 3Q85A 4PU0A 3MGGA 3SZRA 1AM4D 2OESA 4BKPA 1EMDA 1WMDA 2RI0A 4A0SA 4P7BA 4EUKA 3K8QA 3LLUA 4FYJA 4GX5A 1LPPA 2X0IA 2R6HA 3N74A 4FWTA 4DTCA 1QKKA 3TQSA 1FW6A 4HDKB 1N4DA 2ZB8A 4BEWA 2CXOA 4CKYA 3RSLA 5I7HA 3DHNA 1ZW1A 2FSFA 1RYFA 2AI3A 4BRSA 5BSFA 3MINA 2VYND 3KOOA 1BFDA 3FYTA 2QP4A 2FJUA 4XYEA 1MF7A 5KTMA 1QCYA 2O2IA 3E9ZA 3AEQB 2CLSA 5G41A 5JAZA 4NJEB 5EINA 2WB4A 4XGNA 1PJ3A 4TWRA 1BKDR 3ND9A 4X1KA 5JMWA 1NBOA 1SCDA 3RTDA 1WCWA 3UJ9A 2WJVA 1GGMA 2CJWB 3PUYA 1HEIA 5FT9A 4E11A 1HNWB 3QXHA 3DAOA 3F9IA 4N48A 3QGMA 3WK9A 4ZK2A 2G1AA 1HNNA 4TTVA 4I2VA 1M1UA 3TVYA 3SAJA 1NQ5A 3L8DA 5IFLA 2J32A 3EXIA 2M98A 3ORYA 2HRDA 5HUHA 3GFOA 4KN6A 4R9UC 3OECA 1QV7A 3C6MA 2PU7A 3RRBA 1FRZA 4HDAA 4N3GA 3H9UA 1JA9A 5I9IA 3GR6A 1RR6A 2OHVA 3FCAA 2HPAA 2Z2XA 3D02A 3GFSA 4RJLA 3T5GA 1SU7A 1ETHA 4L5BA 2KB0A 3ZD6A 1TIPA 4BLVA 3GU3A 3QP9A 4GDMA 5ENVA 3TLCA 2JLRA 4G0XA 4R71A 2C7QA 5EY5B 4F1JA 1FFDA 2GS9A 3N59A 3G02A 1HFEL 1UEXC 3ASVA 5CFZA 4EGFA 1V5WA 3CZ4A 3M33A 4CJXA 4HYEA 1AK9A 4D26A 4JAVC 3ZZTA 3BKXA 1NM5C 4HYTA 2ID4A 2XUOA 4MRMB 5ALSA 4CI9A 1E92A 4ZICA 1LX6A 1K9VF 1L1QA 2XVXA 3I04A 4MR9B 4A0GA 3WLEA 3E8MA 1EZZA 1ZNQO 3UTCA 2A3RA 3K9HA 3DTVB 3NKVA 1QH1B 4EB6A 2X15A 1IQRA 3RRXA 1LH0A 1HDYA 4IRUB 4GLOA 1O97C 1YRAA 1FNMA 4AN0A 1B6RA 3OT1B 4ND4A 1U8CB 5KNCH 3SR3A 4M9SA 1IJKA 2IXFA 3BMOB 4CM6A 3U13A 1SNYA 5DU2A 1M74A 2QZ4A 1YJBA 4IX9A 3ER9A 5EERA 1VIVA 2BMFA 2D00A 4TUYA 3K1TA 3QU9A 4MWEA 3WBBA 3U81A 3R3UA 5J1SB 3KLMX 2V3WA 2RIPA 4EJFA 2H00A 4FCTA 2CY0A 2AWNA 2D4HA 3W5HA 5KSYA 1F9AA 3QKIA 8MHTA 3ILSA 1QC5A 1ZS9A 2OHGA 3HVJA 4M3NA 5AJHA 4ND5A 1G2QA 1NULA 2FWPA 3UG6A 1WY7A 1I3OA 1HFJA 3E3MA 3AOEC 1IN7A 3LXMA 2YMPA 1OXKB 4H0FA 2GZHA 3HXPA 1RRFA 4QYIA 4TGLA 1Q84A 2BEKA 8OHMA 1JG3A 3LF1A 4LDZA 1HE4A 1KY3A 1IHYA 4I4TA 4BGIA 3OTHA 1RPNA 3NG1A 7MDHA 5D51S 1NONA 1NUTA 4KDFA 2A9KA 4O2RA 1OLUB 3H18A 1BS9A 2Z0MA 3FZEA 2IGBA 5DCWA 4BMSA 4CL0A 1EG7A 2FRVA 1A9ZA 1PJZA 3FI0A 1JHRA 3GAFA 4G24A 4Y2TA 1GM5A 4EHHA 1SN7A 1J90A 3W2GA 1P2TA 3E5HA 3ED1A 3CVOA 1E60A 2ZSBA 4P86A 1GGNA 3DCJA 1NBMA 1IG0A 1OU0A 2OO7A 3CLHA 1L4UA 1I0ZA 1L7DA 1RJGA 3GPIA 1K5DA 1XTKA 5B6PA 3I92A 1P9LA 1ZGAA 2Z1MA 2YHIB 1E8MA 4OPMA 3EH2A 1O5TA 3A4YA 4JLKA 1C4WA 2LV8A 5KO2A 3HHEA 1H66A 5ALHA 3USCS 3VSBA 1GNSA 1QR6A 4X0EA 1KPIA 5K3FB 3CTMA 1DBIA 1PTKA 4P82A 1K7SN 5JS6A 4IXTA 5F7JA 2PUAA 1YQGA 3TO5A 5EVCA 4P4TA 1U0TA 1U2DC 2D2EA 3A4MA 3I9V1 2DKFA 3OMWA 2ZJ4A 3SM9A 3P2OA 2XMPA 1NYQA 5HTKA 3HCPA 4I50A 3G9ZA 1KK3A 4C43A 5KVCA 3PNKA 3TTWA 1OZGA 4CNQA 4U7DA 3FHOA 1VPDA 5D7BA 3LKZA 1R8YA 1WW2A 4BNVA 3NDJA 4XDYA 3CF4G 5HRAA 4MAFA 3AWDA 4FWIB 1GT6A 2XB6A 5CFPA 1RACA 1WUYA 5AH0A 5CBPA 2D74A 2GVZC 2A7XA 3LQ1A 3W5SA 4M38A 2XZTA 3ZGVA 1TLLA 1COWD 1DAOA 2GI4A 3QBJA 1PGQA 2QL5A 3TS1A 3ZWXA 1MOQA 2BDUA 4LGVA 4RGBA 2RH9B 4EHAA 3TG8A 1KORA 1OV4A 2Z2KA 3NC4A 3EGWA 4IUDS 5AOBA 1A9RA 2VRCD 1TZBA 1MIOB 4OQPA 1JT9A 1N5IA 2C8JA 5B64A 1NVXQ 3RS3A 2UYGA 4I55A 5G0TA 3DE1X 3KCQA 4HDSB 3QE9Y 3TTXA 2GMWA 3MS2A 3VHXA 1TLFA 1X3SA 4LYFA 4DLRA 3KDAA 1DAEA 1O4VA 3B13B 4YP5A 4YASA 3OEWA 4A2CA 3M4ZA 5F5LA 1X19A 3ZDBA 1YS6A 2BI8A 3JARB 3AFIA 1VPEA 2GESA 4YRTA 5TVKA 1WXWA 1E1MA 4E5KA 4V1CA 4E5NA 1O08A 1Z16A 5C32A 1BU5A 5IM5A 3BB1A 4RKFA 5EQDA 4HKTA 5FIUA 2W4IA 2FW7A 4MO2A 4CG1A 4X63A 2I4NA 1D2NA 1P4GA 3BK1A 1N0VC 1PTJC 1SCUB 1F12A 3SNKA 4CL2A 1WJGA 5LQUA 4ZPXA 4YJFA 1FSGA 3QA3E 2RK4A 5A9SB 5LSAA 4HWSA 2O19A 1ZD1A 2GJ9A 3KHUA 3OURA 2WFLA 1N0IA 1QHHB 2PLRA 4AY5A 4Z7OB 4U9IS 3GLQA 1PG5A 1QJCA 3WGNA 2Q2WA 3FZNA 2WJYA 3DAPA 4JUIA 4IXWA 3FOZA 1DBSA 1MGPA 1NAIA 1E89A 1IXZA 4I9UA 1LNZA 1RHKA 2W2QA 2TRSB 3OQIA 4HEJA 5GV7A 3S3TA 4BQSA 4CKCA 4Z7NB 2A78A 2XBUA 3W5AA 4LWZA 5BWOA 4A5OA 3ZGOA 2B5WA 1S2GA 4K6KA 2PWYA 5JNUA 3OE1A 3HN7A 3CJRA 4ILKA 1M1YB 3PNMA 4AI6A 4HYQA 3HKCA 2OBFA 1ZHHA 1Q0UA 4ZCQA 2HJRA 1NZFA 4B71A 1A8HA 4EY6A 1O97D 1S0UA 1XA0A 2WM8A 2Z3WA 5LCXA 2IV3A 1KP9A 3MC1A 1V45E 5JC8A 4HDMA 4WL0A 5E1MA 1N34B 2P3LA 3VOTA 1BMFA 2OMEA 1A2BA 2DUNA 4CUZA 4OLBA 3UMVA 2W2PA 2AQHA 2PPVA 3NOXA 2WJPA 1L2TA 3PT5A 3PC6A 4JBLA 5M34A 2FSPA 2HQBA 4CIWA 3ZQJA 1BC5A 4TRJA 2I6QA 3DB2A 3C87A 1CD5A 1D5WA 1II8B 1XZIA 1AKRA 1F4LA 2CKDA 1UZMA 3CMMA 3G5AA 3OLYA 3QPWA 5CNKA 4UEWA 3DBRB 3BD9A 3UN1A 2ZDGA 1BW9B 1YQXA 2MR6A 2ZUVA 3OWXA 4BNDA 1PZXA 1X87A 2C20A 4QULA 4C76A 1T4BA 1HNZB 5LZ5A 5A06A 3CUYA 3OC6A 1E9EA 4I1OA 1UMKA 1JEYB 1JYFA 2XECA 2WJZB 3WTBA 3GH1A 3N0TA 3O4JA 4GSKA 2VJQA 4NZPA 3DVAB 1BHJA 3I23A 3E2IA 3T41A 3ZKWB 3ZHSA 4E31A 3WDSA 3U44B 4JLNA 4RZ2A 2ZREA 4OQ4A 5EIAA 1NP7A 2JBAA 1ZVQA 3H5AA 2C42A 2HWUA 3T54A 3B8EA 3FW1A 3QEOA 3ROMA 4B17A 1COZA 5JR3A 4BYMA 3H9QA 3L6EA 2ZAOA 1JQJC 2HJGA 3R75A 3T34A 1I7LA 4W5TA 4C3VA 1UFKA 1GG5A 3UK2A 1UXHA 1TQ8A 3DMNA 2GAIA 3BF8A 4FU0A 4P80A 5AM1A 1I2DA 1G21E 3NP9A 4R6XA 4ZWNA 2X9LA 3L6UA 2H51A 1KNQA 3O95A 2I2AA 2CJXA 3AVQA 1UJCA 3BXGA 4UBLA 1YV9A 3PRKE 3WLLA 3V4ZA 5CA0F 2OBXA 3RPEA 3M6WA 2EP5A 5LP6F 1KZGB 4ZPJA 2FPKA 5FLEX 3ZOKA 3OP1A 2MMCA 4UBOA 4UEOA 3PYLA 2XT6A 1RWXA 3JWJA 4FILA 4XQ9A 4TXLA 5EJIA 1QANA 1PZFA 3TZCA 4LXQA 1EVKA 1V71A 3C8HA 4FZ3A 4B82A 4BVLA 4I1IA 1SUFA 6Q21A 1M54A 2V1UA 4QFCA 2V6FA 3S29A 4EEKA 4ZXFA 2DHQA 1T1IA 3RVNA 2ZJ2A 3ND6A 3M3DA 2BLLA 1JEDA 4COKA 5L3RA 2C2KA 4A2PA 4QDOA 3VI4B 3CZPA 4U7FA 5ERGB 3B52X 4P93A 5CYPA 4E0BA 4WIAA 1RU3A 2UYOA 4B2YA 3HCBA 1GZ6A 1HE3A 4JUFA 2WHXA 2WAAA 3SYKA 5CVJA 3W79A 5E7IA 4OGGA 3A1DA 5CVCA 1RZRD 4MINA 4R1MA 3FMGA 1ZX1A 3MERA 4P3YA 2AMFA 1T36A 4MS3B 4BGVA 1ZD4A 1HG1A 4KDRA 4YGXB 1N3BA 5D84A 5EP2A 4BVJA 4RVFA 5CVEA 1BEUB 4I8DA 1FFAA 4OMDA 1D2MA 2HMSA 2GK6A 1XTZA 1EFRA 1OJLA 4E14A 4O6VA 5H81A 4C88A 1M72A 4Z8YA 1KJ9A 2FDRA 3CX8A 3CS3A 4Q93A 2HSJA 1XMOB 3NJ8A 4WE3A 1C50A 2J30A 5CM9C 3K9NA 5JI3E 1Z8NA 1Q21A 4P35A 4XIYA 1V8ZA 3AFOA 1VI5A 4NCNA 2PUBA 1FL9A 4OQDA 4L51A 2ZZMA 2L0XA 1GPDG 1RYYA 5FF9A 3VHRA 4QBGB 2IOQA 2FY8A 4MKGA 4F11A 1TJYA 5CXQA 3CBGA 4CTKA 1MMFB 3WHLA 4DR5B 5IXYA 2CFTA 3BZUA 3NHYA 2Q6TA 5CK4A 2G9ZA 4A7PA 1BQ4A 4AJ2A 2P62A 4PLFA 1SELA 5T57A 4MROA 2Q5JA 3OOEA 3UW3A 3UUFA 4ZO7A 1NW9B 2JANA 3HUFA 5AESA 1V6CA 1AOXA 4IIFA 3U5TA 3T7EA 3HWRA 4LJRA 3PE6A 2D7CA 4M0MA 4QDJA 1J24A 1H9BA 3KFVA 4Q1CA 5K0NA 1NVUQ 1XL0A 5HKOA 4GU5A 3GIWA 1Q12A 2K87A 3ZY5A 5THQA 3BIFA 1S89A 2P6PA 5IJXA 1JFRA 5M3BA 2SKCA 3H5LA 2Y0DA 1EHCA 5AVVA 4GWLA 4D2IA 3DBHB 4P7GA 4R81A 5ALXA 3VM6A 3QBVA 3FR8A 4YP0A 5IABA 2IA5A 2A88A 2RARA 3LC1O 3LWDA 2BFEB 1ZCZA 2W6ID 1BX3A 2NV2B 3T15A 1QS0A 4BASA 3C0KA 1YVDA 1ZL2A 1ZO8A 4KXQA 4N39A 3PXBA 3PFBA 3WWZA 2EX4A 2XXAB 1UJ5A 4QJ3A 1V7CA 2AN5A 5I7VA 4GP9A 2IFTA 4Y2GA 1M2NA 2P2SA 3O8CA 2BMVA 4OHFA 1K98A 1NSFA 4G8DA 2EIHA 4JKIA 5AVTA 1PFQA 3SG0A 2D8AA 2P30A 1BJRE 5EP3A 2RJ3A 1M33A 1YOBA 3CZ9A 2O8CB 4DLNA 4FUQA 2QI9C 2JW5A 3IKMB 4BZZA 3HCOA 2GEKA 1FE8A 4NCIA 5JJBA 2DX7A 1NUHA 1NOJA 3FOCA 1M9NA 3FCYA 1MEJA 3KBOA 5AVXA 4RVSA 1P17A 3BMXA 5KNDA 2J9RA 1E5QA 4CMIA 4PWZA 5I4KA 1R3UA 4NV0A 3TD2A 2V7VA 1A2OA 1GR1A 3VR0A 1QIJA 4E51A 1WU8A 4YDQA 1FNNA 2PSDA 2HQRA 2R6AA 1Z0FA 5G4KA 3GIDA 4JEHA 1VJRA 4G25A 2C77A 4ZK6A 4Y6RA 4GIBA 4GOLD 1J09A 1B26A 3N8DA 4QJ5A 3WWEA 4NS4A 3L0OA 1UZNA 2H1LA 4GR5A 2GAJA 3OTGA 5AI5A 1M34E 1Q1QA 4B6SA 4F60A 5AW0A 5BR7A 3LXUX 2BGMA 1K7CA 4C4ZA 4F2DA 2J0QA 1RYMA 4ADSG 2CXSA 2V5VA 3RS5A 3ICQB 2I3BA 1DSSG 1E3QA 2XUHA 4QWWA 1KVSA 1ODSA 1BCRA 3NTXA 5JIBA 3GJSA 1ZXXA 1MG0A 1MRSA 3NOQA 5IH7A 2QSUA 4DCUA 1OLSA 1EFAA 4LY6A 3OLXA 4HB2A 1OH6A 1OE0A 2QRZA 3V2HA 5GGXA 5JZVA 5B2FA 5F98A 3RC8A 1POWA 2FMFA 3DEYX 1EGMB 1H6AA 2FEAA 1WUJS 4KV7A 1KZ4A 2D54A 2DR3A 5TT0A 5MDHA 1L5FA 4XWTA 2C0QA 1F6BA 2Q5FA 2RGAA 3ACBA 3PNOA 1J06A 3KLBA 2QYHA 3Q8WA 5SZJA 3ZWQA 2Y77A 5DYGA 1U4SA 2O0JA 1QK3A 1FC0A 3UHAA 1C41A 1EUDA 1MVNA 2XE8A 1X9HA 1NX9A 1KPHA 2GA8A 1T8RA 1MVOA 3CRVA 3HNPA 4QPZA 4WZAB 3TLXA 3DE4X 2I0FA 5AW3A 1F51E 2L42A 2GJ4A 4ZT7A 2GLXA 4MDEA 5T4EA 1XCMA 1W85B 4UZFA 3JQCA 3BL8A 1KMCA 3BRSA 3EZGA 4YRKA 5ICGA 4BP1A 3B3AA 1Q1BA 3ZEIA 2WR8A 2VEOA 3ZU2A 5BWCA 3IQFA 1RMYA 1OWNA 1DLIA 1GYPA 1MN6A 1P1CA 4JOQA 2WYOA 3A2LA 3IT1A 3QLTA 4CEHB 5CPBA 3OAAD 1DTSA 2XOEA 4MV9A 4LK2A 3S6JA 3QOYA 4C6RA 2XITA 4HZIA 1ZESA 2X22A 4KQ1A 4U6QA 4EARA 5J23A 5TF0A 2BJHA 1KXZA 2GVNA 3WGUA 3BIJA 3SBEA 3A6ZA 4EZBA 1FMJA 1UFOA 1RI3A 1MEEA 4BX8A 4DS3A 1NT2A 1C29B 1J2EA 4NESA 5AWFC 5JCJA 4DCCA 5JATA 3H9CA 2ZRJA 2XZOA 2VHVA 3IHKA 4ISCA 4PZZA 3NYIA 1I6WA 2AKYA 1QLHA 2DBZA 4FOTA 4TYMA 1YDFA 1ZVMA 1V8BA 3O2JA 3MLEA 4B4KA 3MJSA 1TZMA 3Q40A 1DWUA 3H6GA 1A8PA 3VPAA 3ZJ5A 4P4SA 3EPHA 4RF4A 2O2DA 4FQ7A 3REFA 1J5EB 2VBFA 2IRWA 2XB4A 3EC1A 2UVPA 3M4NA 1YUMA 3QWAA 3ILHA 5FBRB 4TYQA 1IQUA 2PUVA 3ZX4A 4BNYA 2JATA 1YHZA 3OG9A 3EGXA 1EEXB 2IHJA 2OCAA 2Y0CA 4IZ6A 1G21B 4FQ5A 4NZOA 5JOQA 3B70A 3UKJA 5FTWA 3ZKAA 3AKDA 4GT1A 3EVBA 4YT5A 3WFIA 3FNEA 5JPIA 4TV9F 1JLHA 1XTBA 1AH2A 3PHCA 1XD8A 1DJPA 4S1WA 4W1QA 4YPFA 4G1MB 1TL7C 4V3CA 4D5GA 3WLAA 4TRRA 5A4IS 2V6GA 3U60B 4P38A 3W0LB 4TQAA 2REOA 1IN4A 3DVRX 1UAYA 4PSAA 2ZAGA 4Y2XA 4BNMA 1DCTA 4I5IA 1NE7A 1EGQA 1OX6A 4NMHA 2AFRA 4F6RA 4YLYA 4RL4A 3CYFA 5INTA 3R7BA 4N9WA 1KJYA 2FV8A 3TZKA 1FTYA 1U4NA 3IDAA 4DG9A 2FWBA 3I39X 5IW8A 4G5QA 3UHFA 2WKSA 4EW1A 1V43A 1GPUA 1N2OA 1NVBA 4A91A 2BFMA 4EJSA 4CQLB 3D3EA 2X3YA 4KEAA 3I73A 5JJKA 4AUKA 1Z5VA 4J7UA 1MW8X 3EH1A 3KD3A 4OI4A 2EFHB 1J1IA 2C2WA 4J0IA 1JQEA 3S4YA 3JATA 4DKJA 1EWYA 5EIFA 5IJ9B 1QVAA 1T26A 4QICA 3O4IA 4AZWA 3LF2A 3ZWYA 1H22A 4NBKA 4E30A 1H2ZA 4PO1A 2XSZD 1UBFA 5J2TA 3ENKA 4PZCA 5CEFA 4LEIA 1D6JA 3WYFA 1G3IA 1R4MA 1CF2O 1WXFA 2PS3A