3C8UA

Crystal structure of putative fructose transport system kinase (yp_612366.1) from silicibacter sp. tm1040 at 1.95 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
206
structure length
206
Chain Sequence
GMTLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPMDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLFDRARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPMADLEARLVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPADLTWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructokinase
publication title Crystal structure of putative fructose transport system kinase (YP_612366.1) from Silicibacter sp. TM1040 at 1.95 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Transferase
total genus 73
structure length 206
sequence length 206
ec nomenclature ec 2.7.1.4: Fructokinase.
pdb deposition date 2008-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3c8uA00
2AL7A 4WA7A 4P3YA 3RS3A 2XZOA 5J4VA 4LOAA 4ESVA 1UBEA 1KNQA 2ZTSA 1RYHA 2ZM5A 1CXZA 4Q7MB 4BECA 2OE2A 1E4VA 2FZLA 1GM5A 1EFUA 1IHUA 3BH0A 1VDZA 1UPTA 1GAJA 3C15C 1PLKA 2VHJA 1EX6A 2ZU0C 1KNXA 2QNRA 2WKRA 4D25A 2YZ2A 1ZAKA 4JYCA 2CL0X 4YMWA 3EXAA 3W6NA 2QTHA 2QGNA 2B7CA 3KFXA 3ZQ6A 1KI6A 1BMFD 1DARA 3SEAA 5B64A 2RHMA 2JLXA 3SQWA 2OFOA 1G291 2O8BA 4XSGA 4WAUA 2WKPA 3TGPA 4Q19A 1KI1A 4OL0A 2YWHA 1NN3A 4BLQA 2FNAA 2BOVA 4LJYA 1WCV1 2V6IA 1WB9A 1AGRA 2J7PD 4HLDA 3ZS8A 1U0JA 3NH6A 4QGHA 4Z8YA 2QP4A 2WM9B 4DLUA 4NE2A 1SQ5A 5TXGA 2F3RA 1OKKA 2ZUCA 2FH5B 4DKXA 4XIGS 3CR8A 3HPRA 1IXZA 4KFTA 2DWPA 2W83A 4B47A 4ZPXA 1NY6A 1XMSA 4DHEA 5EUQB 1KZ7B 3HP1A 4IKEA 1G6OA 3KDSE 4D4MA 1ZM3A 1Z22A 2JIZD 1U9IA 2VQSA 3A1SA 1KMHB 4B71A 3MRSA 2JJ1D 2WOJA 1OB5A 3W3AA 3R7WB 1VECA 2IXGA 2FFAA 3DM9B 5FR1A 1A82A 2XGJA 1SHZA 2WSMA 1H8HD 3EG5A 2QROA 4NTZA 1L7VC 2XEXA 4TLCA 2QT0A 5FPYA 4EQ6B 2KB0A 5B58C 3ZZUA 1KSHA 4DCNA 1Z07A 3IEVA 1XD2B 2DY1A 1GDDA 1P9RA 1YRBA 2ZYWX 1KSFX 2OM2A 5F9HA 2ODBA 2WIBA 2HJVA 3WRXC 5EJEA 4F7WA 4QC2A 721PA 1LV7A 1X8KA 1W36B 3GLGE 1DAEA 1FL9A 1NJGA 5FOWA 1E96A 2GXSA 1G21E 3RSOA 3NXSA 3PITA 3FMPB 1Z8FA 3AVTA 1GOTA 2KBEA 3NC1C 4AY2A 4GT1A 5D3MB 2XJ9A 3NBZC 2W2XA 2B8WA 4DDWA 1OXVA 1GP2A 4QL3A 1KJZA 3I4LA 2PEZA 1XWIA 2FPLA 2PT5A 1KIMA 1KO1A 1TNDA 3AGQA 3GJ0A 4D4KA 4ILEA 2WPDA 4M9QA 4OQMA 2VL7A 4JYBA 5KHOC 1XRJA 1Z5ZA 2JDID 1Q22A 4D4LA 3AUYA 2QPOA 4Q1FA 4K8OA 1AZSC 4XVUA 3DL0A 3L8YA 3NBXX 3D8BA 4ZCLA 3AVVA 3U5ZB 1COWA 3O8DA 1W0KA 2FOLA 1Z6XA 4QNMA 1Z0IA 1CLUA 1KGDA 2F43B 4WBSA 3KL4A 4D4JA 5J4KA 3ND8A 4LC1A 1ZIPA 2ORVA 4IDQA 3GPLA 3RSLA 1LTQA 4HEJA 3M6AA 3TVDA 3WRYC 1G7TA 2OAQ1 3IHWA 5EE5B 2FU5C 2YOHA 3DOEA 2P65A 3KXLA 4A6XA 2GRJA 2QSZA 1Z6YA 3KX2A 1ZIOA 4QHTA 3VU9B 3TAHA 2O5VA 4AYWA 4BRWA 2ZPTX 3TW4A 5HR5A 1S1CA 1EG7A 1YZNA 2FFQA 1PJRA 3J81k 3AEZA 4DC9A 4NKRA 1I4LD 2CBZA 2NO1A 4AI6A 1GNPA 1W1WA 4A15A 2ZYTX 4Q4LA 3B1WA 1KI3A 4TLDA 3UANA 3QVVA 5GVRA 4YMTA 5KNCA 3CRW1 3QKUA 3OESA 1JPJA 4LZZA 4JVNA 4TL6A 3KZ1E 1E0JA 4LHXA 3KKQA 4EPRA 3UMRA 4EPWA 2R9VA 2VSXA 4HZUA 2JLQA 1TL7C 2YC4C 3K09A 3LBIA 4C0AC 1GKYA 5K8TA 1TF2A 2IHBA 4R7ZA 3VHXA 4XD7D 3MSXA 4HAYA 1E4YA 4ZO4A 4URZR 3AVPA 3VR4A 1AIPA 3VR3A 5F3WB 1MKYA 5J40A 5A0FA 4IOMA 1Z47A 3EPKA 5JRJA 3MGCA 4P4UA 4ACBA 3A1TA 4ARZA 1ELOA 1W4AA 4EPVA 2ZE8A 2ZYVX 2Z6VA 1VYUA 2HF9A 2RGGA 1Z3IX 3WNBA 5EP2A 1QG4A 1IBRA 4PZZA 1E32A 3DKVA 5FPTA 3QIAA 2REXB 2ODNA 3CKLA 1MV5A 1PLJA 3AVUA 2IUTA 2HJGA 4M1OA 1YHNA 3EZFA 4EAQA 4L4UA 1N0VC 1S4QA 4B6FA 3VR6A 4Q9IA 3WYAA 2FPMA 4HB0A 1ZCAA 3IILA 5JCZA 3L0PA 4Z1MD 3TSOA 2GF9A 5E7IA 3U3MA 2ZJ5A 1XMJA 2XNDA 3TK1A 3GQBA 3P32A 1JJ7A 3KKMA 3UKDA 3KQUA 3A6PC 1VCMA 4C7OB 1G1MA 2PX0A 4US2R 1IY1A 1EWQA 4M21A 3OE7D 4M1WA 2C9YA 4E22A 621PA 1KK1A 3H0KA 3ZS9A 4DCVA 1A1VA 1SKQA 3W9YA 3OZXA 3SI7A 1Q21A 3CF2A 4L5BA 1GKIA 3AKDA 1YZKA 3A36A 1UBGA 4XWKA 1BS1A 2W6ID 3QNUA 4AURA 4MH0R 4AKIA 2WZQA 2P6UA 3MWYW 2FFBA 3GLIA 4RCYA 4HDQB 4BUJA 2ANBA 4Q4HA 4AG5A 2QMEA 4AWXA 2ZJAA 3LWNA 2D4HA 1XJ0A 5JWRA 2F1IA 2BKEA 4JLVA 5LB4A 2PJZA 2BVNA 3WBKA 4DT1A 1E1QA 5BN4A 1W36D 2WWIA 3LRPA 3WHLA 4GMXA 5FBLB 5IK2A 4IVQA 1XTRA 5DN6A 2Q3HA 1AZTA 4Q9HA 1QZXA 4DEYA 5EZ5A 2IS4A 4Q00A 3LV8A 4B43A 3FVQA 2C96A 1RRPA 1E9BA 2YYZA 3T5GA 3MCAA 2VEDA 3TQCA 3EASA 4TTQA 4BFUA 4LV6A 4DLYA 1NLYA 4DB4A 3OEHA 3O8CA 2H18A 1DAGA 1G7CA 3DHWC 4DLXA 3TSZA 2DWOA 3P26A 3TSWA 1R0YA 4A0FA 3NDBB 5BW8A 4E03A 2VP2A 1SKYB 3RC3A 1XTIA 1S1MA 2Q9CA 3RVBA 4LSGA 4PAMA 3QPUA 1CJKC 4TSFD 4F38A 1KDTA 3GMTA 3ADCA 4I4LA 4PC1A 4MDFA 3DDCA 3JZAA 4EUNA 5J4HA 1Z28A 1U81A 3EW9A 4A9AA 4B75A 2QL6A 2I3BA 1W7AA 4G5RA 3T1QA 2ZR0A 4YC7A 1VCOA 3UATA 2C03A 5KSZA 3EX7C 4PHTA 4RKEA 4DLWA 1OH7A 4CEHB 2BCJQ 3MAAC 5L3QB 2QMUA 3CNNA 5FUWA 1X86B 2GXQA 1KO8A 1MABA 1A2KC 3CX6A 2ZJYA 5E3HA 4CW7A 3IO3A 2ZI5A 3LVQE 3K53A 2GEUA 2IYZA 1FQJA 1HY3A 2CMKA 1VIYA 2A5YB 1G3UA 4LX0A 4FN5A 5DH9A 1N6OA 3S1AA 4V0OA 4WVFA 1G19A 3Q5DA 2QORA 2YJTD 1VG8A 3P27A 2AKYA 2ZSEA 3IHLA 121PA 3QKRB 4JKIA 1XEWY 4P33A 4BLOA 2ZJ2A 4TQUS 3AF3A 2FSIA 2OO7A 3OIYA 3BRWD 1U98A 1W47A 2CLSA 2GCOA 4A36A 1G20E 1JQLB 2ATVA 2HT6A 4G5SA 5FBQB 2VHUA 3VNUA 2R6GA 4FMBB 2WOOA 1GILA 3CRQA 3ZVNA 1KO7A 1U99A 2JIZA 1P7CA 1II0A 2WMOB 3LD9A 1Z6TA 5KOYA 2JJ1A 1PUJA 5EP1A 4ERNA 3GLGA 3RS4A 1DVRA 2FGJA 1UDWA 2E9SA 5AJWA 1AJEA 1G41A 4EPXA 1A2BA 3OEED 3TUIC 2YWEA 1H8HA 3E70C 1LF0A 3WHKA 2C9CA 3VKGA 2HCJB 3SFZA 4LBVA 2ORIA 3QENA 3KB2A 2JA1A 3SZRA 1YQTA 1DG1G 3GJ3A 1E2QA 4D81A 3GEHA 4IEIA 4BLPA 4EPYA 3UWKA 2IXFA 1E1RA 1UF9A 2ZE6A 3CZQA 1MOZA 3RRNA 1TUIA 4TLBA 1FTSA 2AHOA 1WA5A 1G17A 2YOGA 4RZXA 5BWMA 4MYHA 2KBFA 4AKHA 2N1BA 2HLDA 2NQ2C 4LJ9A 5DHFA 3KKPA 3IQXA 1G3MA 4UJ5A 2F6RA 1VYVA 3REGA 1DS6A 3SHFA 1N6KA 2G83A 1CR2A 2R6DA 4AG6A 2CDNA 3X1DA 3EAQA 4IVRA 4V0KA 4NYJQ 3ICQB 4JLPA 4QXAA 4UJ3A 3I1FA 2LCFA 1SVMA 1V5WA 2JDIA 3D7MA 4DCSA 4LDJA 4DZZA 3C14C 2ZI4A 2CLCX 2JJ8A 4NCNA 1WQ1R 5FTLA 1Z63A 4HAUA 2KSQA 2ZRLA 4RKFA 5J47A 2WSSA 4V03A 2ZSDA 4JVMA 4TYQA 3VNVA 4D0NA 3L43A 5JWOA 3HYRA 3L82B 4POAA 1JR3D 4JLMA 3QJYA 4TLAA 1G5RA 4XJXA 1MO6A 4OHZA 1U0HC 4PXAA 3MG9A 4W9MC 4LCBA 2VH5R 4HUQA 3NG1A 1CJTC 2P2LA 4DIDA 1VIAA 3W3ZB 2GXUA 3PV0A 4JLJA 1G3RA 2HDNB 3KQLA 2VPPA 1T6NA 3AP1A 3C4JA 4M9SA 3U44A 1OV4A 3IUYA 3SE0A 4IHQA 3RYTC 2VRWA 4ZV4A 2DBYA 4NYJR 3IGFA 1X1SA 4NDZA 4LBYA 1W36C 5CLQA 1P6XA 1JR3E 1G4AE 2B7BA 4TYPA 4Q1AA 1ANKA 5SZHB 2W0SA 1KHTA 3CUEF 3JZMA 2QGZA 2VP5A 5CYPA 5JCPA 5TY0A 4GOJA 1AS3A 4JBWA 4BLSA 1XTKA 3EWAA 1DAFA 2F7SA 1NN0A 2IA5A 4YDHB 1EFCA 5C2JB 5LB2A 8OHMA 1S3GA 1MH1A 1FP7A 4MKHA 1XCMA 5DHAA 3Q7PA 2O8DA 1J7KA 4Q47A 4CEJB 4Q4JA 2OAP1 3U7HB 3A4LA 1RKBA 1U8AA 1GITA 1NP6A 2RGDA 3GFTA 2IS1A 4IXNA 1HV8A 3ZD7A 3SJCA 3WY9A 4C0HA 3ASZA 1M7HA 1QHSA 1NMZA 1T8TA 2AX4A 1FOEB 3SNHA 2V55B 3BB4A 3ONWA 4JZKA 4EIWA 2J45A 4KLZA 2XB2A 4G5QA 5C1BA 4GFDA 1QHYA 1U0LA 2J87A 1D8TA 2CEAA 2NO6A 3IIKA 3IPXA 4PHFA 2W2VA 2DYKA 3F3YA 1ZC4A 4HATA 1M7BA 1VTKA 1E2HA 2PL3A 1E69A 3I72A 1T5LA 4IOLA 1E2GA 1IJFA 2FJUA 4IVPA 2AKAB 2V1XA 3P4YA 4TL8A 4MA4A 2BV3A 4C3ZA 1QF9A 2WTUA 3UPUA 4Z1MA 5AUNB 1E2LA 3EC2A 1YRAA 2B8TA 4ZKEA 1RJ9B 5TDHA 3BFVA 2FSHA 2NZJA 4JL8A 2R2AA 2A5DA 2GJAA 3B6EA 4IDOA 4ZKDA 3MLEA 4RY2A 4F91B 3OE7A 1S0UA 3A4NA 1PV4A 1F5NA 1ZRHA 4TYWA 5C4GB 1KKLA 5FBVB 2CJWA 3R7WA 4A2QA 4XOIA 2YWGA 2WICA 3OFNA 4DVGA 3EIEA 4WZAE 4IFBA 4R2IA 1KI9A 1AKEA 1CIPA 4UNPA 2A78A 4EQ6A 3U7GA 3AVXA 4PSAA 2ZITA 2ZSBA 4WXRA 1NIJA 1QHXA 1NN1A 3QI2A 5JHHB 4IDPA 1C9KA 1K5GA 2ERYA 1T3LA 4QHSA 3R20A 2IYUA 3THWB 1W0JD 1B23P 2QBYB 4C0JA 3NEJA 3NEYA 4TMKA 3U6KA 4LPKA 3LO5A 1OJLA 1G8GA 1E98A 2Q0HA 1E3MA 3F0TA 4V0NA 2DCUA 5ELXA 1KI4A 4Q4AB 1MO4A 1JAIA 2JLRA 3SU8A 2OZEA 4ON9A 3B1ZA 5EXXA 4U5XA 5KDLA 3AVOA 3CRRA 4ZIRB 4KXFB 4QBGB 5DIFA 1FFHA 1GRQA 1HQYE 1NG1A 3MJHA 4CYMA 4Z8XA 2L0XA 1E2IA 1ZD8A 4O2LA 4W5WA 4CT4B 3C5CA 4EJSB 2O8FB 3ADKA 2O8EB 4PQYA 5EP4A 5FI1B 2F43A 2ZRPA 3RS5A 2NPIA 2RGEA 4KYUA 3B82A 2XSZA 4Q01A 3Q7QA 4BZQA 4LV5B 1SVKA 5J4YA 3ZZ0A 2FZ4A 5DGXA 3B7GA 3C41J 4KU4A 2Z5FA 1Z2CA 2ZI7A 4TSFA 3TAUA 1SXJB 2CHGA 4OJKA 1XMIA 4QBIA 3AP3A 2QAGB 2VHCA 5JI3E 2A2ZA 3VU9A 4A82A 4X8MA 1O87A 3MWKA 1N2CE 1LNZA 2CXXA 2VYFA 3T1TA 4LC0A 3CO5A 1FMJA 3QXJA 5L3VA 3MWLA 3NHBA 4GOXA 2JLSA 4PC7A 1KDPA 2EU8A 1ZINA 1RZ3A 4MGYR 3PIRA 4PX9A 4BFWA 2ZETA 3HYTA 3X2SA 2REOA 2ZANA 1DG3A 3VR5A 3IQWA 4B3DA 3KJGA 4ZI2A 3WMEA 5C46F 1SVLA 4L15A 1NMXA 3ZH9B 1N6PA 4N0DA 3WP1B 2JLVA 1H8ED 1ZU5A 1GZSA 3PUWA 4TTRA 1XPRA 1G9XA 1BKDR 1OFUX 2BM1A 5KDDA 2OCYC 4HAZA 1ZU4A 2OESA 2PT7A 2G0TA 1IXSB 4M9XA 2DPXA 3E2IA 2D7CA 5EE0A 5F9FA 1XXHB 1FPMA 1PUIA 3DMNA 1XF9A 3GJXC 5HZKA 2UKDA 3KQKA 3KJEA 2BEJA 3NBYC 1EK0A 4KJZA 4ZDKA 1ODFA 2QM7A 3FE2A 3LAWA 2AXNA 3FKQA 5A5GA 3RS0A 1J8MF 4OKSA 4N1AA 5B2ZA 1OXSC 1HQCA 1CR0A 2BCGY 2PZEA 3LBHA 1W4BA 5CJ2A 5H1YA 1KYIA 2GZAA 2XZPA 1AM4D 1ZD1A 4U02A 1GL7A 4A92A 3SYKA 1XNJA 4Q9JA 4ITRC 4PPQA 4A2PA 2GETA 1CR1A 4L16A 4UNNA 5JS7A 5AJVB 5GVSA 3OIWA 2BMEA 1Z0KA 3T5DA 3AVWA 3VX3A 1TF5A 4MGZR 4PSVA 2EQBA 4XTCS 3AVQA 4EDHA 1P4SA 3B1YA 3CNLA 2IYVA 2PEYA 3GJ5A 4ACAA 1ZNXA 1KI8A 5H70A 5HE9A 4KBFA 3SBEA 1OIVA 4KVGA 2ZRJA 5FTMA 2QAJA 2ANCA 3H86A 4HB3A 2MSDB 3MUFA 1JR6A 4Q5IA 1D2NA 3EIQA 4FWIB 2GTPA 2EFEB 2YC2C 3ZJYA 3BB3A 5IDVA 4HI0E 4Z54A 3RDPA 4BFZA 4GL2A 5IHPA 2IF0A 4GP6A 4L9SA 4BWYA 4KFUA 1JPNA 1YKSA 1R8SA 4MKGA 1TUEA 5AUQA 1RRGA 1HT1E 1TADA 1YE8A 3EPHA 3ZLJA 5F98A 2IXEA 2OXRA 2FDCA 3VFDA 1KK0A 1Q1BA 2AFHE 4C2UA 2RMKA 4B3BA 1II9A 3OF5A 2GNOA 3AF4A 2VP4A 2V7QD 3CONA 4QJ4A 1QHHB 4Z51A 3BK7A 3WNDA 1Q44A 2D06A 2OILA 5CIQA 1DAHA 2LKCA 3IDQA 1R10A 4Q9KA 3U60B 5AJYA 2PX3A 2O0HA 2RGNC 2XOKA 5JLJA 5AUPB 6Q21A 1NSFA 3EPJA 3WP0A 3W8RA 3U4QB 3AH8A 4FCTA 1AQUA 1JR3A 2OLKA 3FB4A 2EYUA 3HU2A 3I3SR 5JHGB 5JFGA 3K70B 5FOVA 4B6EA 1IONA 1J90A 3X1YA 3A1UA 2FEOA 4WIAA 1NL3A 2ZRFA 2WWYA 2ONJA 1W2GA 2DR3A 3K0CC 4OHWA 4QNRA 3TUJC 1UEIA 1D6JA 2WMNB 4JJZA 5C4MA 1G16A 5BYJA 1Q57A 3NHAA 1LF5A 4BFXA 2CVHA 1M8PA 1P73A 4DUGD 3Q8XB 1WMSA 3BB1A 1P5ZB 1ZUHA 2XTNA 3AF0A 2G1JA 5CM8B 2EFDB 2QG6A 2WHXA 1M74A 1P2SA 3FKSA 1FX0B 2ZE7A 3GJ8A 1EFRD 3RAPR 3T1OA 1JI0A 3HJNA 3H84A 4KSCA 1SXJD 3CW2A 2RCNA 3JVUA 1UKYA 2PZFA 1A5TA 2PMDA 3HPQA 2ZRMA 1P2TA 5CITA 1HEIA 3RS7A 2N46A 1DPFA 5JZVA 2XITA 3CH4B 4II7A 2VIIA 2HYIC 3U2QA 4G01B 1EWRA 1IN6A 2GJKA 3A1WA 3NWJA 4OHXA 4YXWD 1IOZA 5L3QA 3T15A 1G7RA 1SULA 3K9GA 2BM0A 1E9CA 2QM8A 4JLBA 2OHFA 4PC6A 5JRZA 1R0WA 1SXJE 3I8SA 1LS6A 5HTKA 2IK8A 1R7RA 4PPNA 4AIIA 1R0XA 4Q1BA 1Q1QA 2GHIA 3GCGA 5DO9A 1SVSA 2P0EA 2ODEA 1TX4B 1YVDA 3QKTA 4LWZA 1G18A 3PJRA 4ASUD 1I4TD 3BERA 3DKPA 4P4SB 4AYXA 2ZSAA 3BWDD 1M6NA 2MMCA 2B6HA 2BWJA 3QKRA 1UKEA 2WJIA 4S35A 4MUBA 1KI7A 4TL7A 1UEJA 4Q18A 1Z6GA 1HTWA 4HUTA 3ZD6A 1LW7A 1XTQA 3TH5A 1NVWQ 3WNCA 1OLOA 5LDDC 5G41A 4HZIA 4KBGA 3LW7A 1TPZA 5BQ5A 3BBPA 4C0LA 2NO9A 3IPYA 4HDCA 521PA 1HE1C 2IC5A 2RGNA 1JALA 3PVSA 5H68A 2B21A 3B1VA 4JSYA 2IWHA 1IM2A 4U7DA 2F1RA 4YLGA 2A5FA 5DYIA 5G3ZA 1HE8B 3X1WA 1BH2A 1TEVA 4DBLC 3KUDA 3O8BA 4NCKA 1XXHE 4F93B 2PLRA 1Q1ZA 4D2IA 1DAKA 1J99A 4L8GA 5LD2B 3U3JA 1VPLA 2QSYA 3K0CA 4EFNA 1NVXQ 2ZREA 4YMVA 2J5XA 1GNQA 2P67A 2Q3MA 4NH0A 3SYNA 4B48A 3V00A 2CK3D 3CH5A 3M1IA 2YV5A 4URVR 2F1HA 5CIWA 1IQPA 2WV9A 2IT1A 4PAQA 3T61A 1OH8A 4IFEA 1ZM4A 1T3HA 2XNSA 1W0JA 2BHRA 3EPLA 1BYIA 1GL6A 4K46A 4NL4H 4CEIB 4HDOB 4MYCA 1BYUA 1N5IA 4JT4A 5FI0B 3U3KA 3UG7A 1KMQA 4HAVA 2QMHA 2G1KA 3KJHA 3DPUA 4A8JB 4A0RA 2GKSA 2GZHA 3KTAB 3D31A 4HLQB 1KJYA 1JXMA 4AK9A 4B2IA 4LHYA 4D80A 2X8AA 3ZGXA 3NH9A 4K81B 3BD9A 2J7KA 4OJQA 1E0AA 1JB1A 3HDTA 4R2HA 4RZ2A 3IBYA 3LFUA 1MRNA 4RZUA 5BN3A 2IYTA 4MITA 5IT5A 2NMVA 1EGAA 1SZPA 1KSJA 3CRVA 3HU1A 1XZPA 1XJQA 2Q6TA 2AD5A 2OLJA 4MKFA 4Q9LA 4B3CA 5JJLA 1NY5A 4I1OA 4XWOA 2G3YA 4TMVA 5M04A 4TMWA 2CHVA 2P6RA 4MYUA 1IXRC 4E5UA 4CGZA 3CX8A 1XPOA 3U7EB 4AYTA 1OHHD 2B92A 1FP6A 2A3RA 3SC3A 4BFSA 3K70D 2P6NA 5SZJA 2FGKA 2RHDA 3N5CA 3PUZA 1AK2A 4PTLA 4A4DA 1WDTA 1R5BA 5JSZB 4ZDJA 4KITB 2F3TA 4R98A 2R6AA 3CPEA 4JSTA 3NIBA 3B13B 1JNYA 3T12A 2VTKA 5FL3A 4KHZA 1UADA 4TT3D 1CRPA 2CL6X 1ZNYA 1UBCA 5EXPA 3TQFA 2WJHA 4DLSA 4GNKA 3OIUA 3P1JA 3QXHA 1JEDA 3R9WA 3QF4B 4MRVA 2YKGA 1QG2A 3AGPA 4PO8A 1D9ZA 2ZI3A 2AK3A 3KQHA 4A0HA 1Y63A 4AKEA 2Z43A 2WJYA 3CWZA 4C4PA 1X6VA 4V02A 3DEFA 2LKDA 2WAYA 4TQ9A 2IS6A 4MQBA 1Z6AA 5CM9C 5J4LA 1P3JA 1XBTA 4GRAA 1BMFA 4LV8B 4JMPA 2PH1A 3K0FB 5EP3A 3BAFA 1H8EA 2C95A 4FD2A 3THXB 1CTQA 4RD0A 4TZ6A 1MO3A 3A58B 3OAAD 4Q7JB 2DB3A 2IYSA 1W46A 4EJSC 1UJ2A 2X19A 3TE6A 1P61B 5JI2E 4A6PA 1YR6A 3I62A 1FTNA 2QT1A 4B76A 2J7PA 3IKJA 2Q21A 2REBA 2JCSA 3CWQA 2PCLA 3EA5A 4JL6A 1ESNA 4B33A 4N0EA 2GESA 1E9FA 4FCVA 4NCJA 3A1VA 1T8UA 1E9SA 1JEEA 3DO6A 4LHZA 1SXJC 2QI9C 2ZJ8A 4TQAA 1A7JA 4BZPA 2QAGC 2AD1A 2IF2A 1OW3B 2IHYA 1NN5A 3QXCA 4JL5A 1IY2A 1XZQA 1ZD9A 3H1TA 3AF1A 4Q66C 1II8B 1RJ9A 1OYWA 3PENA 1NJFA 2GWHA 3TNFA 2ZS8A 3MJRA 5HCIA 4IXMA 2ZRBA 2QEQA 3I92A 4Q1CA 5IF9A 4BFYA 1T0HB 4M22A 2QPAA 2FSGA 3BIFA 3GEEA 1P9NA 3BH6A 3UMSA 2GCNA 4AC9A 1OKKD 2BEKA 2DFTA 4DSNA 4B3FX 2WKQA 4D82A 4YQFA 4YMUA 4BLRA 4TZ0A 2WAXA 4FMCF 3LW8A 1GTVA 2O8CB 4GZLA 1AQYA 1YR8A 1KKMA 1NMYA 1CKEA 4JVLA 1U94A 1KO5A 1W48A 1E0SA 3UMFA 4BRUA 3VHLB 4JT2A 3THWA 5EE3A 2QBYA 1LY1A 1IY0A 2V7QA 1VMAA 1FZQA 5KO2A 5FR2A 2J46A 2I1QA 3Q85A 4QG7A 3GLFB 1AKYA 1EESA 4Q4HB 4Q4AA 5L3SB 1C4OA 4XVRA 2CNWD 1DOAA 1R8QA 4B3XA 5JWHA 2O0JA 4QFMA 1UKVY 3W8NA 2GK7A 4ZIRA 5CDFE 5HZHA 821PA 1XEXA 3GJ4A 2IYWA 3U3RA 2IEYA 1LVGA 1ZMXA 1US8B 2QQEA 4IDHA 1B0UA 4B35A 1F2TA 1TAGA 2SHKA 1ZW6A 4C9BA 4EJSA 2O8FA 2O8EA 3TBKA 2A9KA 3R8FA 3K9HA 1GRNA 1ESMA 1GVNB 5FTJA 1E9AA 4LHWA 3SJBA 4DUGA 2JEOA 1CJUC 3THYB 2WPDD 2OSBA 3IBGA 3QE0A 1YZUA 1ZNZA 3E1SA 4MUAA 5B30A 2WWGA 1EFRA 3BC1A 1Z0FA 4MRSA 3BJIC 1E9EA 1SXJA 3SFVA 4MRNA 3I5XA 2CCKA 3PEYA 2HT1A 2IYQA 2QAGA 1CRQA 4Q03A 2RGAA 4UXJA 2JLZA 4EPTA 4PO9A 1N5KA 1VKJA 3A4MA 5JJKA 3G0HA 5FOUA 3G82C 1N3BA 4RCZA 2DHRA 1KY2A 5G53C 1Z2AA 2ZAOA 3FWYA 3FHOA 4BASA 4YXWA 4OK3A 4A1FA 4C30A 2GA8A 1FUKA 5FOSA 4A0GA 2FE4A 5HE8A 3KKOA 1P72A 1ZBDA 1QBKC 2Q3FA 2C8VA 4JIMA 4NMMA 2J41A 4XD7A 3V4FA 3LBNA 2BJWA 1SKYE 5FPKA 5DI3B 5KNBA 3KQNA 1N0UA 5EXSA 4WW0A 3SYLA 1XCPA 2FSFA 2QY9A 4GZMA 5K8LA 4GSYA 3ZQJA 4G5GA 4PQRA 1KK3A 1J70A 3O47A 4EFLA 2P3SA 5GJCA 2ZROA 4BFTA 4LJ6A 2AR7A 2CVFA 3DOFA 4JVSB 2QQ0A 3K70C 4FIDA 3K8YA 4J0QA 4DDTA 1X8JA 3K0SA 4AD8A 2ERXA 3OHMA 1Q20A 4I99A 1XXHA 2XTMA 2ZRGA 3TVTA 3UXMA 4EKDA 2BKUA 3GLHB 3TR0A 2MSEB 3PR1A 1OFHA 1DO2A 4URUR 1T9HA 2X2EA 3LLUA 5C18A 2ZU6A 1DAIA 4NZYA 2ODWA 1QHGA 1KI2A 1GRRA 4HAXA 3LLMA 1PLLA 3P20A 4GPTA 4I1UA 1AN0A 1TU3A 3IO5A 3ZVRA 3BORA 5KSPA 5IRCD 3U61B 5TMPA 1P60A 1WE2A 2H5EA 1E2EA 3AVYA 1YU9A 1OH5A 4RSGA 2N42A 1KMHA 4M1KA 2KI5A 5HCNA 2ZRNA 221PA 1DADA 3IIMA 5JECA 1YR9A 3NKVA 3BGWA 2G6BA 2J3EA 3GFPA 3M0EA 5KSOA 4FI3C 1MRSA 4DEXA 2V1UA 1NVVQ 1GNRA 4LRWA 4D26A 2GILA 2ASEA 5AK0A 2VF8A 2CK3A 2P5SA 1GG2A 2W6IA 2RB4A 3NVAA 1G4UR 5L3RA 2I4IA 1XD2A 1TU4A 4PQFA 1KDRA 2D74A 4FMDF 4UQOA 1W44A 1W4RA 2IEZA 4QRHA 1QHIA 1RW4A 2JJ2D 1NBMD 4RD6A 4P31A 2ECKA 2PMKA 3ADDA 2WWWA 1OB2A 4RFSB 2GXAA 1DELA 2KWIA 5LBIA 2ZRHA 3RNLA 2HEIA 3B9QA 2RGXA 5D3MA 3X1ZA 5TARA 3K0AB 4URYR 4DJTA 2BBTA 4V0LA 4ZCIA 2LWIA 4LUCA 4BPBA 1QHHA 2ZXUA 1EFHA 1RRCA 4E07A 2WJJA 1E2PA 1ZNWA 1Q3HA 1NVVR 3C16C 1FNNA 1S3SA 1NBME 3CPHA 2XXAB 1H65A 1W2HA 2RH5A 3U4QA 3GD7A 2H57A 3QBTA 4HAWA 2FPKA 1OHHA 3AKCA 1YJ5A 2ZUDA 3EZ7A 4KYIB 4P32A 4MRPA 4PO1A 3W5IA 3LVRE 4GOKA 4PPFA 4WXPA 3Q5EA 3FMIA 1WBBA 5JEEA 5JS8A 2IS2A 2EFGA 2W00A 3D3QA 5FUVA 5LD2C 1EXMA 3L2OB 1Z0AA 4M2LA 1QVAA 2JGNA 3QUSA 3I8XA 5FUXA 5E7JA 4E09A 4XH9B 4HYYA 5FTKA 3GLFE 3FMFA 4H9GA 2O52A 3WXMA 3QVUA 2OT3B 1WF3A 4TT3A 4XWAA 1ETUA 3PQCA 3ZDQA 4ZCMA 4B74A 2QU8A 3BXZA 1KDOA 3E5HA 4GI7A 1FX0A 2YINC 2VP9A 2Q9AA 3G5UA 3B2EA 1Z29A 1IN5A 2E87A 4DSUA 2IYLD 3ADBA 4HUQB 1CS4C 4A8JC 4P0TA 3ZIAD 3RLFA 5AWFC 5FTNA 3SJAA 1UBFA 1CU1A 2CCJA 3VAAA 1E79D 4Q48A 3QEJA 5DI9A 2ZJZA 1KAGA 4US0R 2W6JD 3N70A 4OQLA 3VR1A 3KFVA 3RHFA 5UKDA 4RD3A 1XB2A 1IJEA 2OCPA 3C5HA 2C78A 421PA 3FHTA 1VCNA 2OCBA 3O8RA 5CJPA 2HCBA 1ZM2A 3OAAA 4LYJA 3QSYA 1J2JA 4URXR 1XD9A 3KJIA 2DFKB 4LJ4A 1P62B 4QGFA 4G1UC 4W5JA 1AS2A 4JJKA 2VA8A 3K9LA 3OIVA 1F2UB 3KKNA 2CE2X 2O8DB 4M1TA 1LFDB 2GAOA 1KAOA 3CRMA 5BXQC 3HR8A 4Q4JB 2OFXA 3GFOA 4P4SA 2VSOA 4B73A 3QXSA 1R2QA 5K8UA 5ANRB 3B5JA 3FMOB 5EE9A 2OEPA 1F60A 4X8HA 1NF3A 1GIAA 3W6OA 2ZS7A 3FPAA 2GZDA 2FFHA 3TIFA 4OK5A 5BN5A 3AP2A 4FMCB 5GADl 4M4SA 2H16A 3AV0B 1LB1B 2J1LA 3BH7A 2OBLA 4NBSA 2FA9A 4D0LB 3OEEA 4PAOA 1E9DA 1W5TA 2BMFA 1ZJ6A 2G88A 3B78A 4C7OA 2HXYA 4US1R 3NDPA 2MMGA 2NZ8A 3FYHA 5CB6A 1SHKA 1D2MA 3R8CA 4B3GA 4QHYA 3FHCB 3GLHE 2WIAA 2CL7X 5K8IA 1OIWA 3VKHA 1NIPA 4GBMA 2F9MA 3TJZA 1TQ4A 2X1VA 3LQQA 4ZDIA 2Q9BA 5A4JA 2ZUBA 1KSGA 4OHYA 4I81A 1N25A 1RC8A 1ZP6A 1E99A 2NO7A 1E2MA 1P9WA 4Y0AA 1OE0A 5CDFA 2CJWB 1XD8A 1Z83A 3AQ4A 3K09C 4WOPA 4XVQA 4W7SA 3H2YA 2AXPA 3QKSB 2NTYC 1L4UA 3RRYA 3V4RA 4CEIA 4RD4A 4CT5A 4XSHA 1Q1EA 2BBWA 4A8JA 2J0UB 1RPZA 3KTAA 2BBOA 4Q7KA 4IDNA 4S2EA 4UNRA 4TMXA 1QVRA 2JLWA 2J9RA 3WYFA 3AM1A 2H1LA 2CNWA 1HYQA 3R9XA 2J0VA 4DDVA 1E1RD 5CYOA 4M1SA 2OCAA 2R8RA 2WJVA 5GJBA 2GBLC 3PEVA 1AA9A 3QF7A 1SVOA 4OQFA 5LPNA 1D5CA 3PG5A 4PHGA 2HYDA 2I1VB 2HLDD 4ESHA 1UKZA 1U90A 3SHWA 2IYXA 1G8HA 3QPWA 2ZI6A 4QJ5A 5KPDA 3LY5A 1RYFA 3PUXA 4RVCA 4F4CA 4MGIR 5E7MA 1CJVC 1HT2E 1Q0UA 2V8OA 3WBJA 4MDEA 2V4ZA 1D2EA 3B85A 2V3CC 2TMKA 4DLRA 2R62A 4C0SA 1JQJC 3TLXA 3GJ6A 4V0ME 1KO4A 5HPYB 5JSZA 5CK4A 2WSSD 2GF0A 4PANA 1ZUIA 2NOAA 2ZI9A 3N2IA 5TB5A 3DVLA 4FCWA 3UK6A 1YZTA 1HURA 1MO5A 2AK2A 4F92B 4IOJA 4MGKR 4UXIA 3QF4A 4OI4A 4NP6A 2ZRKA 1N5LA 4NCIA 3CF0A 2F55A 1RRFA 5FH9A 1E2DA 2PBRA 3MMPA 2C5LA 4CEHA 2QA5A 4F4IA 1ZM7A 3EC1A 3MD0A 2Z83A 2WWFA 5KYKA 3QPVA 5HKKD 4GP7A 1U2RA 3FDIA 4MYTA 2IBMA 3BOSA 2P5TB 5JJIA 2QP9X 4TMTA 4LY6A 4M53A 2A7QA 3QG5A 1T3SA 1L8QA 1HH4A 2GEVA 3K0FA 3QOFA 4DSTA 1HA3A 3CX7A 2QN6A 2FV8A 3LDAA 4JBYA 4Q7LA 4RD2A 2JAQA 5AJXA 4FWTA 1E0KA 1VG9B 3THXA 4LBZA 1FMLA 1PZNA 4NHOA 3DM5A 5DISB 4O3MA 1M7GA 4TTPA 3QQ5A 3BS4A 4DLTA 2ZSFA 1ZVQA 3ZVLA 4LBWA 4YMSA 2D2EA 1UM8A 1MR3F 2CCGA 3Q9LA 3THOA 1CEEA 1KI6B 1GWNA 3ICEA 4QM6A 5FL7D 1VHLA 3CBQA 3RABA 3T06B 3TRFA 4U00A 2O8BB 1WP9A 1TEXA 2QE7D 2VHQA 4QM7A 1OH6A 1CP2A 4QJ3A 1P2VA 1OF1A 1S96A 4NPHA 3CB4A 2GBLA 1UFQA 4FMDB 4TL9A 1CJMA 1M34E 1II8A 1GKUB 3TMKA 2QRZA 4JLDA 3RRZA 3K9NA 1OIXA 2J0QA 4O0MA 5FOTA 4KV9A 2EWWA 2ZYUX 2G0NA 4GMDA 3PEUA 1WXQA 2EYQA 5KPJA 4PC2A 3TW8B 4DIEA 1CULC 4M0LA 2FG5A 2ORWA 4IOKA 1QRAA 1NNEA 4YONB 2YWFA 3LXXA 4FW9A 5H8WA 2PZGA 1OSNA 4QBFA 3W90A 2AN9A 1BIFA 1E94E 2MSCB 1XTJA 3C7KA 1GUAA 2ZJOA 3NC0C 4HSEA 4URWR 4DLZA 2VF7A 2BMJA 2JJ2A 1NBMA 1OYYA 4LYHA 4UNSA 2O8CA 2VSFA 2QP3A 4HB4A 4I1SA 4IEEA 2VBCA 4CVNA 2OXCA 5DE3A 3IIJA 3KXKA 1Y3AA 2XJ4A 2QTVB 3SQXA 4QBHA 2J0SA 2OV2A 3OFND 4IRUB 3B8HA 3IEUA 1CBUA 4N3NA 3VMFA 2R6CA 2VO1A 4Q1DA 4PFSA 4PR0A 3L0SA 1VYTA 3W5JA 3GLFA 4JBXA 1P75A 2O0KA 5L3SA 2PLFA 3NTUA 5G40A 3W34A 1N6IA 3Q72A 5FOXA 2RAPA 1HUQA 3CPJB 4NONA 1L4YA 3RWOA 5AUOB 4G3XA 3BFKA 3FTQA 4M1YA 4OQXA 5EXTA 1E2FA 1YZQA 1I2MA 4LJAA 4TYNA 4DDUA 4FXPA 4GDFA 1G3IA 3B1XA 3VR2A 1BOFA 1DEKA 1US8A 3F8TA 1OXTA 3PXGA 3SOPA 1W5SA 2D62A 1ONBA 1XJCA 5EE1A 4LPSA 2GCPA 3WMFA 1CR4A 5EUMA 1QHNA 1NG9A 3THYA 3Q3JB 4QGGA 4DWJA 2ONKA 1W4CA 2GJSA 1OFTA 1C1YA 4TYYA 2OBMA 4A2WA 4LI0A 1YZLA 1BO6A 1FW6A 3ZIAA 3TUZC 4JLKA 2C99A 4RD1A 2V9PA 1VG0B 1E79A 2CHQA 2XSZD 2BC9A 1IAQA 5FBRB 5FUYA 1N5JA 2W6JA 4KAXA 4BZXA 3AKYA 2WWXA 2DFLA 3LXRA 1I2DA 3V9PA 1FNMA 1JXOA 1G8YA 3D6TB 4PSKA 4YDSA 4PZLA 4B2LA 3U6BA 1NSTA 1NLFA 4NYIQ 1JBKA 4B44A 3T35A 5DI3A 4CEJA 1JAHA 2ZAMA 2HXSA 5KSYA 1KK2A 2IUSA 3RANA 2YNMA 2ZRIA 2ZE5A 4NYMQ 5JMTA 3TKLA 1ZUNB 3CIOA 5AJZA 2AFIE 4HZUB 4G0NA 5KU1A 3UG6A 2H7VA 1XEWX 2NO0A 1NRJB 1A4RA 1FUUA 4TMZA 4KVAA 2VHTA 3GEIA 4DCTA 3UWOA 4B32A 4Q02A 3RWMB 4OBEA 3GLHA 4DCUA 1G3QA 2KE5A 4Q1EA 3VTKA 4M8NE 4ZDWA 1RE0A 4ARZB 3CM0A 2V6JA 4DRZA 5CB8A 1WBDA 2FWRA 2AWNA 2XAUA 4TN1A 3EZ9A 4LJ8A 2D7DA 4JLNA 2NPFA 1E2KA 1NKTA 3EARA 4NYIR 4OI0A 3HWSA 1J8YF 2G77B 1N6HA 3VQTA 4ABYA 3R9IA 3EA0A 4NYMR 1XEFA 4M1MA 3I5YA 1TF7A 4O25A 2ZQ5A 3TR5A 2A5JA 2W58A 4O2RA 3ZVMA 1ZM9A 4B2PA 4R71A 2D3WA 1RFLA 3NBFA 3KXIA 2PJRA 4QOSA 4C2TA 1GL9B 1KZGB 2E1RA 2ZVQX 4AKGA 3EZ6A 4JKYA 2JLYA 1TQDA 2YOFA 1SVIA 1Z0JA 4I1VA 1OXXK 4OK6A 2K5UA 3ZZTA 3PUVA 3T34A 1XPUA 5E95A 2ZRAA 1N6RA 1R5OA 1U8ZA 2R65A 3PFIA 1OXUA 2GDJA 1YR7A 2C04A 2XX3A 1XCGB 2YVUA 3M4YA 5KNDA 2EFHB 3U7FB 3PCRB 2XZLA 2F1JA 4R9UC 5EQTA 4PC3A 3SBDA 2RKOA 4RFSA 1VG1A 3CNOA 2NIPA 4BGDA 1X1RA 5DYGA 3GLIB 3L0IB 4KFSA 4QGAA 4HLCA 1XMVA 3K0AA 4JLOA 4FINA 4LK2A 1XU4A 2BIFA 2XTZA 3AF2A 3RRMA 3KB1A 2Z4RA 4V0MA 2RGBA 1DE0A 1S2MA 4C0KA 1KY3A 3B60A 3HU3A 5SZKB 3SS8A 4DT1B 2ZR7A 3FGNA 2ZIAA 4HLUC 5DLQC 3N2EA 4KODA 4B34A 4BE7B 3CZPA 1D9XA 1K8RA 4IJMA 1RIFA 2XXAA 4NU0A 2CE7A 2GK6A 3X1XA 1SGWA 4MRRA 3LX8A 4RFVA 2JASA 2X77A 1OT3A 3LH5A 2FF7A 5CLLA 4DB2A 2FMXA 4IW3B 4JLAA 4BEJA 2EFCB 5GJVC 2ZRCA 2A30A 4LJ5A 2QZ4A 4OI2A 1IN8A 1G5TA 3GJ7A 2X2FA 3W6PA 2YHSA 2XOKD 3HR7A 2VP0A 3LQRA 4XTRA 2V54A 4CF7A 2UVQA 5FPSA 1COWD 5GJWC 1F48A 1QDEA 1N6NA 1RVDA 2HUPA 2W0MA 1W0KD 2QRNA 1K5DA 1X8LA 3K1JA 4C0BA 3I73A 3JVVA 2Y8EA 4RJLA 3SR0A 1XDBA 1N6LA 4KI0A 4X8OA 4LGMA 3WYGA 5B57C 1T5IA 2GVZC 1M1YE 2FEMA 2G9NA 4C0QC 1EX7A 4DXAA 2ZS9A 3C8UA 2OBNA 3QXXA 4F4JA 2OG2A 1E6CA 3CLVA 4BEBA 1S9HA 2IYRA 2ZEJA 3BFXA 3ECCA 4Y0VA 1GSIA 2Z4SA 2IYYA 1OFIA 2OUKA 5HKKA 3EZ2A 3AUXA 2ZRDA 3PEWA 2C2HA 3T1VA 4ZI3A 1UDXA 2JLUA 2R6FA 1VCIA 1T4GA 3FKSD 3DZDA 1OPXA 4UNQA 1K6MA 1IN4A 2WJGA 2NG1A 2IWRA 3QEOA 3DZ8A 1XP8A 2DFNA 1KOFA 1X3SA 1DTSA 2EW1A 5TV2A 4ASUA 1TQ6A 5KUTA 1DO0A 1JJVA 1MABB 1T0JB 4RZ3A 4W5HA 1S9DA 2WBLC 4MKIA 4UKDA 1PVOA 3LX5A 2R44A 1F2UA 3FFBA 4G5OA 4LYAA 3VX4A 1W49A 4UXHA 3ZYCA 3A8TA 1CF4A 4KLNA 5FL7A 5FFMA 3QG1A 5J5CA 4D6PA 4KO8A 2IW3A 3S1AB 2QE7A 1NLZA 5G3YA 1ZC3A 4EFMA 3UIEA 3P4XA 1R5NA 4TWZA 1EFTA 1G5PA 1P2UA 4LJ7A 2XB4A 3SDZA 3AKEA 1XFAA 1E9RA 1E2NA 1NKSA 1S8FA 3GP8A 2J59A 2F9LA 1YZGA 1DAMA 4PZYA 3WMGA 5JBQA 1TMKA 2VLIA 4HLUA 2FX3A 2GCOB 3EWSA 3F5FA 1N0WA 3I61A 3FFAA 1Z0DA 5SZIA 3CF6R 4CDGA 2WVJA 1Z08A 3H4MA 3LA6A 4PPGA 3L8ZA 1UAAA 3I32A 5CK5A 4CRWB 2IL1A 2QMOA 4DLVA 1L2TA 4LYFA 4BLTA 1TQ2A 2ZJBA 3MFYA 4NCHA 2C9OA 3GLGB 3PUYA 1VHTA 3REFA 2DWQA 4DSOA 1KJWA 2UZIR 1ZYUA 2FN4A 2XNDD 2IX3A 3KUCA 3U3OA 4WZ6A 1T91A 3AB3A 4OQNA 5TVKA 4BQSA 3B9PA 5P21A 2JATA 3QKSA 5DSZA 2IUUA 4QKQA 3ASYA 1ZCBA 1M2OB 2QPTA 2BJVA 1JECA 2J0UA 2GJ9A 4HB2A 4OI1A 1SVWA 3K0EA 4P4TA 5L8VA 1F3OA 2BBSA 2AWOA 4CZ2A 2W2TA 3SN6A 4KFRA 2UZ3A 1O3YA 1G8PA 2HF8A 5BYKA 2QTFA 5JEDA 3CR7A 2C77A 4OYHA 1G8FA 2OFWA 4PHHA 4WZBE 1G64A 4X8LA 1AGPA 2QENA 4L9WA 2Z0MA 5FPHA 1F6BA 1GFIA 1Z06A 2EWVA 4KCGA 3ETLA 5EZ6B 5FBWB 3ND9A 2NGRA 1G7SA 1MT0A 1IN7A 1E1QD 1Q3TA 3FOZA 1AS0A 1R6BX 2VP6A 2C98A 2QUZA 5E4FA 2GVDC 1R0ZA 3VKWA 5IK2D 2BMDA 3L0OA 3RS2A 5DN6D 5D3QA 4CIDA 1FQKA 5AR1A 1XEXB 2CLDX 3GLIE 1U8YA 2EVWX 2ATXA 2ZR9A 2D2FA 1U9IC 4JS0A 4TLEA 5KTYA 1R4AA 3RC8A 3QBVA 2GJ8A 1DBSA 4D0GA 3LNCA 4H1VA 2H92A 2RGCA 1F2TB 3SJZA 5DNYB 1TTTA 1G6HA 1XX6A 2BDTA 1LS1A 3A37A 3QY0A 1E2JA 3MWJA 4KSBA 1V43A 1NVUQ 1WRBA 2H17A 3OEHD 4OHVA 2HV8A 3DMDA 2ZVPX 1NI3A 4H1UA 2PCJA 4LHVA 3U44B 5F2EA 1I4DD 3EIHA 2WWHA 2GEDA 4Q21A 2H8KA 2KJQA 4BFVA 2GAAA 3BE4A 1Q12A 1XTSA 2A5GA 5KDOA 1KTVA 4M9ZA
chains in the Genus database with same CATH superfamily
4JLWA 1EWTA 1IG0A 2WUWE 3BHIA 2YWRA 4P3YA 4P5DA 2CJFA 2Q3CA 3IBFA 1KY4A 3LYAA 1XKTA 1C3OA 2LR0A 4YJ2B 3ZU2A 4B5KA 3NTRA 4YIHA 2EEPA 4G25A 1QVVA 2I3GA 1VKRA 2PUVA 3PL5A 1ZCJA 3N7TA 4WWHA 1KH2A 1SU6A 1BC5A 4ND4A 5IXYA 1EFUA 2XQFA 2TMGA 1WM1A 1W19A 2Z08A 1V1MB 3FAZA 5D84A 5EIFA 4ARAA 3C15C 1PLKA 2VHJA 3MN1A 2AJLI 4N7BA 3RT9A 1KNXA 4JXJA 5JBIA 1KARA 4GXRA 1T6XA 4IJUA 4NZ9A 4D25A 1ZAKA 4OH1A 4K88A 3PL1A 2AGVA 4YMWA 1GU7A 4YO7A 1S2LA 1YK0A 1FQWA 1PR3A 2JBHA 3MAJA 3QHPA 2WUDA 3DTTA 4H4CA 2WR8A 3PWTA 4GI2A 3H5NA 4HWPA 3SEAA 5ALGA 2GBCA 3KU1A 2BRUA 4DADA 2HJWA 5F73A 5EHXA 3DAOA 1MVLA 4U2FA 3OICA 4Q19A 5LQDA 1DQNA 3NPAA 1TE2A 3T52A 3ZE6A 3OI7A 4ZEVA 4RH1A 3UJ3X 3Q0IA 1LDEA 1K63A 1XC7A 2GBIA 2JH8A 4HGZA 5EZYB 4LJYA 1WCV1 2HUNA 2V6IA 4INPA 4UCXA 5EKSA 3TM4A 1AGRA 2J7PD 4OHUA 1U0JA 4DYHA 2VWQA 1XROA 4DLUA 2WWRA 1JDVA 1E18A 1SQ5A 5TXGA 4HDMA 4R5MA 3IAEA 2FSVA 3HCDA 5D01A 2ZB2A 5KYUA 3TZKA 3BE8A 4D56A 2FH5B 5JAIA 3QE2A 3GRZA 4MQEB 3WGMA 1WX1A 3WMRA 4F2GA 1IXZA 4KFTA 2DWPA 2W83A 1AZWA 1R27A 3ODPA 4MROA 4PWZA 1KZ7B 4HH4A 5HJ2A 4BNXA 4AO8A 3K1AA 3NVKI 1PWYE 3DZKA 2AMYA 2UVPA 3IPCA 1U9IA 1JN0A 1GGVA 2P62A 2G80A 3MRSA 3VYSB 4KIWA 4EX7A 5HZGA 1XMXA 4R05A 3GF4A 3H4VA 3W3AA 1R88A 1W85B 1VECA 1MN6A 3TS1A 3DM9B 1C7ZA 8ABPA 1A82A 1DXOA 1YULA 1E62A 4H1TA 3CSUA 2HLNA 1H8HD 3EG5A 4M9UA 1V3VA 2HIAA 4EA9A 3KXPA 2QT0A 4ENUA 1J1IA 3BRSA 2DBZA 1KFEB 4CMJA 1UZMA 3OCZA 3L7NA 4D3YA 2AV6A 3BGVA 2XECA 2BELA 4AJNA 1EG2A 4Q7QA 2ZYWX 4YAUA 1ECLA 3CCCA 2IELA 2ODBA 1N36B 3OZWA 5EJEA 4W4TA 1N5MA 4F7WA 2ZJ0A 3LDGA 1K8YB 1ZHFA 2BKXA 3L41A 5DK4A 1GPBA 3OZVA 4BNKA 4A27A 1PF7E 1QOZA 3RUPA 1J1ZA 3K35A 5LUAA 2JGMA 3FMPB 4YJFA 5TT0A 5U4QA 3IP3A 2G06A 5D3MB 1PJ4A 1RM3A 1JG1A 3BXGA 2B8WA 3BZBA 1OXVA 2GPNA 1YTLA 2OPBA 3NHSA 3KTOA 4YAOA 5DM70 1GPJA 2PT5A 2JRCA 1KIMA 1A98A 1VPTA 1XLWA 1X15A 2WFAA 2ZBRA 3B3QA 3GJ0A 4ILEA 4M9QA 3J7AC 2VL7A 3DMFA 4JYBA 3BMXA 1Z5ZA 3IJRA 1JU4A 2QPOA 1Q15A 3AUYA 3HL4A 1CEQA 2E5WA 1AZSC 3FCEA 3DL0A 1R0RE 3L8YA 3PFFA 4FR0A 3FNIA 4MV8A 4Z49A 3D8BA 2HPHA 3M5WA 3U5ZB 3PNSA 1COWA 1UPBA 3KDAA 4OGFA 3LBFA 4XGIA 4EB8A 5J4KA 2O1EA 2J4FA 1O9HA 2IHJA 2VPTA 2FN9A 3GEGA 4LC1A 5B1DA 2N3ZA 3DJFA 1Z2PX 2ORVA 3KU4A 3FBTA 4UBLA 4F4FA 5CA0F 5CIYA 4FDLA 3RSLA 5MN5A 1U9CA 4KR9A 1H9AA 3WRYC 4RETA 3KT0A 2ZTMA 1YTUA 3DOEA 4ZI7B 4GOLD 1LTKA 2QSZA 3HBMA 1Z6YA 2FKNA 2E2WA 1U1GA 1E1CB 1IPHA 2J6BA 4S1OA 3O94A 1MJHA 3LGXA 2Z2XA 2R8XA 2GPJA 1IEQA 3VVMA 2QTTA 2O5VA 4I5FA 1K0FA 2ZPTX 2XMRA 4IHAA 4L4ZA 3HBAA 1EG7A 2AXEA 3Q2IA 4DIMA 5HR5A 4FKBA 5AI0A 3V2HA 4QQNA 3HYNA 3K8ZA 1W1WA 4A15A 3FNEA 3B1WA 1JVBA 4YV7A 2EP7A 4YMTA 3HE3A 3CRW1 3VZQA 2P7IA 1C0EA 3JQFA 4QSHA 1DBPA 1RBQA 2WZDA 3N39C 3TQHA 4MPJA 1KJ8A 1SMKA 5BPHA 1E1NA 3SP1A 2IY8A 2ZXFA 3ETEA 4EPRA 1HE3A 2QLMA 3UMRA 4BRSA 1X1TA 4AUKA 1GTZA 1EDOA 2JI7A 2JLQA 2VSXA 4ARSA 4KQHA 1GKYA 3C3XA 5K3SA 2IXDA 3AQIA 3TCKA 3K8OE 3SIXA 3MSXA 4MR8A 3VYTB 3VR3A 2FEPA 1MIHA 3EMDA 4KGVA 4H59A 4URZR 2ZP1A 1MKYA 3A1EA 1CJBA 5A0FA 5JRJA 4IO1A 3DULA 3HVHA 4AN4A 1NYLA 3OCUA 5JAOA 3Q3VA 1W4AA 3ZY6A 4IG4A 1JQ5A 1QZUA 1R18A 2VJMA 4Z4IA 4CV3A 3VPXA 3AO0B 4KQXA 2O2HA 2QPLA 3EGOA 2FB9A 1A04A 3L1KA 4PZZA 5EEGA 5FPTA 5KWEA 1INLA 1AKUA 4ZYYA 1AK9A 2C31A 3D4IA 3O82A 3CKLA 4KDFA 1TK9A 4WK6A 1J56A 3WE7A 1YHNA 1TK2A 3DKKA 3GL9A 1YQ9A 4EAQA 2I7CA 5BT8A 3FLBA 4O4IF 4B6FA 3V34A 5CX1B 3U16A 3VR6A 4MPDA 4Q9IA 3DDZX 3WYAA 2P9HA 4J3FA 2OD9A 4BVKA 1V8FA 2I65A 4OCZA 3P2KA 1A8QA 1UK8A 1C9EA 1LH0A 1VJCA 2NUBA 3K31A 3HY4A 2GF9A 5E7IA 1SCAA 2IU3A 2ZJ5A 5IBQA 1XMJA 3TK1A 1EFAA 1LJ8A 3C8HA 5I3ZA 5MFZA 1JJ7A 2GD1O 2ZBFA 4K6GA 3A6PC 1JIKA 3ZUGA 3SOZA 5J5AA 4IIJB 1IY1A 4M21A 3HG7A 4JI4B 4M1WA 4MQLA 1M54A 2VJQA 3QOWA 3VBCA 4E22A 621PA 1KK1A 1GPMA 1VSUA 5EJGA 1ZS9A 4DCVA 2PQMA 1A1VA 3BE6A 1SKQA 3B9RA 3DO5A 4XGNA 4WLNA 2YZKA 3E9DA 1PR2A 3SI7A 4O8ZA 4A8TA 1OZFA 4PZEA 1GKIA 2EJTA 3EFOB 3TI9A 4QUDA 1HZZA 1UBGA 4X9XA 5HILA 3UMMA 3GNLA 4AKIA 4AURA 4U2DA 1D6MA 5H5JA 2P6UA 4JEMA 4DJAA 1FJGB 3OX1A 5EWJA 4RCYA 4UU7A 4EHAA 3BWCA 2JK1A 3G2HA 1PJAA 5H3LA 3ONFA 4BEVA 1MU0A 1YVEI 4IFIA 2ZJAA 3STWA 3JQGB 2IE0A 4KUEA 1C3EA 1U0TA 4PZ0A 4HEA6 4H6WA 1SK9A 4DT1A 2QDXA 3PE4A 4JBGA 5FNVA 5LB4A 4Q6BA 1TD9A 4AP6A 1FLNA 1QVZA 1V48A 5EWLA 1S2GA 4GMXA 1DWUA 1NHWA 4DSAA 2D00A 4Q9NA 5C31A 3TZHA 1IWBB 4ZEWA 1U2SA 4H18A 4B4WA 1AU9A 3FBGA 4BLWA 5ICFA 3GEPA 4Q9HA 5E8JA 1JQDA 1V11B 4BFCA 4HTAA 3NS7A 4CF4A 3GFFA 4MKRA 5TIIA 4IAOA 4LWQA 2JS7A 1M9NA 3ESCA 4NF2A 1N1EA 2C96A 3RREA 4AMZA 2HQRA 2YYZA 1W9HA 2F8MA 1LPOA 4N3AA 2QMYA 3SM3A 5KNBH 3PT9A 4OU4A 1YVUA 1A2QA 2PTGA 1KDVA 1N57A 3U0VA 4BFUA 2DERA 4EY5A 5BORA 2J48A 2WJ3A 1U31A 2YBDA 3GP5A 3IAM1 4G9EA 5D8DA 1NLYA 2J6IA 3OEHA 4L27A 2H18A 1DAGA 3TSZA 2IV7A 3GT3A 4RMNA 3A3OA 1S6YA 5FUQA 3QVWA 1K2WA 1E2BA 4A0FA 3B6MA 1I3LA 5BW8A 1QQ5A 4E03A 1E7WA 3GLTA 3E3MA 2YWJA 1PR6A 1H1LA 2VP2A 2OSVA 3HNPA 2Q9CA 5IT0A 1HG1A 3ESYA 5DHUA 3PDUA 3QPUA 2X42A 3LC2O 3PJGA 1KDTA 4I4LA 1IZ7A 4MDFA 4XQCA 3DDCA 2R7MA 4YRCA 2ZWMA 2RG1A 2BP7A 4KQ2A 4RVOA 2J3IA 2JVJA 1JDPA 1TI7A 1J2UA 3EW9A 2ZBUA 3UAWA 1YC5A 3E1KA 9LDBA 5IW8A 1U2QA 1MP0A 3GC6A 3LPNA 1L4KA 4PCAA 5AW9A 5EWMA 3LCUA 4PHTA 4RKEA 4CEHB 3CUWA 5L3QB 1EFKA 1ZGJA 1T2DA 3OE4A 1JQBA 4E0BA 4CLDA 3N58A 3WDLA 5JZMA 1KO8A 2BL4A 4LF8B 1HDYA 4PYJA 1QF6A 2O7VA 3CX6A 1OFGA 2ZJYA 5HIIA 1B16A 1U0EA 2QRQA 3DBHB 3K05A 4OV6B 5KTNA 5KVAA 3WIOA 1O4VA 4QPZA 2DWUA 2LRHA 4TMFA 4GE0A 3HMKA 1ORWA 1AXRA 4LXHA 2HGZA 3W8FA 3ZHBA 4G0ZA 3S1AA 4EF5A 5AW8A 1ZR4A 3AYZB 2HU7A 2DFDA 5E1BA 2HI0A 3YASA 2YJTD 3VTAA 4DPMA 1VG8A 5ICMA 3H4TA 4YR7A 4ZHSA 1RKQA 3EEBA 1XO1A 2H1SA 2HHJA 2QK4A 2AR0A 5CRIA 2I6UA 3ND6A 4XUEA 3WL7A 2V98A 2QRVA 3KVNA 1W88A 3PVCA 4JKIA 5LZ5A 2Y2UA 6GPBA 2ZJ2A 1YD7A 5H3CA 4D9KA 5LZ4A 1QANA 2JFVA 4TQUS 2FSIA 3JD2A 1C2YA 4TZTA 4WZAB 4Z3DA 4MR7B 1U4OA 3WLMA 3OP4A 5JNSA 3KSMA 2YJ5A 1JQLB 4L5IA 5GINE 3HDHA 1V96A 4G5SA 3T4EA 3WSWA 2IYAA 3AHDA 1HDCA 5FF9A 3KIPA 3UEOA 4L51A 5LQSA 3M3DA 4BEWA 5EYPB 2WHPB 3BQMB 4RC9A 2NYVA 2JCYA 4L8FA 1TT5A 3LD9A 2WMOB 1X7GA 1BN7A 2UUPA 4MEAA 3KEFA 2FQWA 5DHPA 5EP1A 2XCIA 5AFSA 3USES 3RS4A 1BEZA 4BJ6A 3JQQA 5HF5A 1LK7A 1G21A 9GPBA 1A96A 2Q2QA 1A2BA 2H59A 3ML1A 4DV1B 3IR5A 3KT3A 3F4KA 3RHSA 3X1KA 1YO6A 3NFRA 2PKYX 3WHKA 2C9CA 5L3ZA 1UOOA 5T64A 3QENA 2JA1A 3DAHA 4UE3S 4PVCA 1F9AA 3P9RA 1RWWA 4D81A 4IEIA 4BLPA 1Y9JA 4UTNA 2G71A 3PQDA 1OWNA 4KRYA 3PF9A 2BN4A 3A9VA 3UWKA 2UZ1B 1OVGA 4MJ7A 1UMCB 4F5YA 5CFLA 4ZQBA 1VJ0A 2XDWA 1WA5A 4H3KB 4IQGA 5B3JA 4WK0B 4BNWA 1XK7A 3S81A 2F8LA 3I4FA 1XRNA 2PZBA 3GCDA 3KTFA 3NT5A 2Q1UA 1VA5A 3KKPA 4FONA 4OQZA 4OBWA 3CZ4A 5JMOA 1T1GA 4HH0A 1G3MA 3A9SA 4IGFA 5H4GA 3AJ8A 1DS6A 4R0NA 1GV1A 2ZYIA 2CDNA 4YCAA 1CIJA 3PFNA 4KIUA 4BX2A 1Y81A 2CLLB 5EG5A 4UE6A 3ICQB 3RADC 3KP1A 1ZZGA 4JLPA 1V5WA 3D7MA 2JDIA 1RWQA 4IWNA 5E3JA 3T7IA 2YQZA 1RAHA 2VYVD 4PLWA 2ZATA 1LNQA 3DPSA 5FTLA 1Z63A 6ADHA 4DJEC 2AOTB 2KSQA 2PKQP 3TG8A 3EGDA 4V03A 2ZSDA 3IE2A 1AB5A 2P11A 4GI1A 4TYQA 2Y9PB 2VDRB 4RA6B 5DT2A 2ZYRA 1LRKA 3HYRA 4GUDA 2ZIWB 5DGIA 3VGJA 1YL6A 3ENWA 3U7JA 1F8GA 4JLMA 3G2KA 2GVNA 1G5RA 4TLAA 2P8JA 4OHZA 3RU3A 4KWTA 1Y1KE 2RAVA 1E3EA 1RCFA 3IRVA 3JQRA 4ENVA 3KR0A 3NG1A 4EK9A 4RLHA 3LX4A 2JFFA 2B4KA 2W98A 2Y67A 2JCXA 3PV0A 3TYXA 4F6RA 2H0QA 3C4JA 2Y9MB 1SCBA 4PZ9A 3OM9A 1I9CA 1ORIA 3HMQA 5LKAA 1HRDA 4BCBA 3RUEA 2CXHA 3EIXA 4L5YA 1GSOA 3A9UA 5ALQA 5H4HA 5CLQA 3PC8C 1E3IA 3MWEA 3B70A 1IHDA 1G4AE 2B7BA 5A7GA 5CDTA 4TYPA 1ANKA 1HE5A 3E82A 2P3QA 3CUEF 1TJNA 3HNOA 3JZMA 4C07A 4YAFA 3QMPA 2M1XA 3UK1A 2VP5A 2EV9A 5CDYA 1R5JA 2NQ8A 4J1SA 4EAAA 1IBCA 1GGFA 1J24A 2ZKIA 3EWAA 2IA5A 4Q3NA 1EFCA 1W5EA 8OHMA 3MYYA 3CNHA 1MH1A 3A3NA 3OPNA 3HLTA 1ZG3A 3T7EA 3EE6A 4XGKA 1TEZA 2O8DA 3TX2A 4H27A 2ICAA 3ZKAA 1JAZA 3HABA 5TJHA 2OAP1 2FPIA 1NP6A 1JSZA 2Y1GA 3D6HA 10MHA 3GFTA 1QIEA 4IXNA 1QO7A 5M5BA 3DBRA 3SJCA 1K3UB 1M6VB 4HSGA 4NQZA 4TRNA 5DYTA 1M7HA 2AX4A 1T8TA 4C0HA 3ESDA 3SNHA 3BB4A 1TMYA 3ONWA 2P1ZA 1L5OA 5B37A 2FW7A 2XF8A 1N0IA 1T8SA 2WUFA 3DQQA 5J58A 4X66B 3A3YA 1A71A 1U0LA 1U0SY 1DTWB 3AEQA 4FC7A 4FGKA 5IYZF 1G5FA 3RIHA 4B7XA 4EEXA 4NMWA 4HATA 3R77A 3I72A 1E69A 2O48X 4IOLA 5HEKA 1I4OA 5B4UA 1CY6A 1JT2A 2FJUA 2JKVA 4IVPA 3M5PA 2V1XA 1Z88A 4M0CA 4U9IS 5CT4A 2XI4A 3VGPA 4QGSA 3DBOB 2HPAA 2VK1A 2WTUA 3UPUA 5GONB 1FVHA 2M6KA 2PX5A 4O2BA 1YRAA 2BGLA 3ABRB 3NCHA 4L57A 5TDHA 3HDQA 1ADCA 3OLZA 3EXFB 4TXJA 4DM4A 2JAUA 5BUZA 4PRLA 4X3CA 4I1RA 1RHKA 1RHUA 1USUA 4QVKA 3OE7A 5DGHA 2WSLA 1S0UA 4RTLA 3A4NA 2GO7A 1Y6FA 1PV4A 4XPIA 1CE8B 3RROA 2JFUA 4MUXA 2J6HA 3TEFA 5FBVB 2QE6A 2CJWA 3QELA 3ZK8A 3L4BA 4A2QA 1EAMA 2YWGA 1F0KA 1VRWA 4XQGA 2ZWIA 3EIEA 4YAJA 1QPGA 2ZUTA 1YGPA 2PH3A 4R2IA 1AKEA 1CIPA 1MGOA 3ZGYA 1RLMA 5IVIA 1DJNA 4PSAA 4EW6A 1V37A 2Z2KA 4XM1A 2D0PB 1QHXA 1NN1A 3QI2A 2C3PA 3H97A 5C34B 3WSVA 1C0KA 4R16A 2NTNA 2QRJA 1HLPA 3AM1A 3OD5A 1KMCA 4IDPA 3A7DA 2PUWA 1DC6A 3R20A 2EL9A 2IYUA 3S6JA 1TJYA 1HF3A 1YR2A 2M6SA 1W0JD 1P4HA 2B99A 4C0JA 2P27A 3RTAA 3U6KA 4DV5B 2RHHA 5K4HA 3NB0A 1U6JA 3LO5A 1OJLA 4KIGA 4R3UC 3DF9A 1CW2B 1T1RA 3SXUB 1E3MA 3SD7A 2C58A 4V0NA 3W9UA 4E7OA 1KI4A 4Q3BA 4UHCA 1U8XX 4Z7QB 3GH3A 2G9VA 2X15A 1R9NA 2CF5A 2OZEA 4ON9A 3B1ZA 2OGWA 1MRZA 4JQCA 3WMXA 2X5KO 2H2HA 4DNXA 5DIFA 4OHFA 2QXTA 3KYDA 2Q2NA 4X1OA 2RAUA 1UAGA 4CYMA 2L0XA 1E2IA 3AEUB 5CBPB 2GWRA 4RAQA 4G85A 4GM1A 3KDPA 1Z26A 3DSRA 4GOND 3ADKA 4LOHA 2CMGA 2F43A 3UA4A 4B3SB 2W4MA 2ZRPA 4CTMA 4F5WA 3ABQB 2YN0A 2NPIA 4B6SA 1XAIA 2CZQA 3B82A 1ZY2A 4U5QA 1VYHA 1O9BA 1F2VA 3VDNB 3ZZ0A 1GZHB 3FXAA 2QGFA 1D04A 3HV2A 1Z2CA 2DUNA 5C8VA 4OJKA 1XMIA 2XEDA 1RIIA 4P3OA 1Q1NA 2QAGB 5IMSA 5JI3E 2H2WA 1TT7A 2EG5A 2A6PA 3O31A 4JOSA 2V5VA 1SC6A 4XX0A 1O87A 1WZEA 4A82A 1AO0A 3T1NA 5DULA 3DDUA 1TAUA 1ENOA 4TTAA 1VMEA 1VXOA 3L8FA 3LUJA 4R01A 3M9XA 3ONNA 4W1SA 4AF8A 4CI9A 4KE7A 5EGNA 1NQ5A 2F8SA 4MW5A 4OAOA 4GMGA 3WI7A 4BMOB 3MWLA 1NDQA 5K3OA 4Y7CA 1MNQA 1NJ1A 2JLSA 3FVWA 3KQTA 1KDPA 4JYZA 4BO0A 1ZINA 3GWZA 2IZ7A 4I4TF 2IUEA 3MGAA 4IHJF 5KMGA 3GB9A 4G9GA 2O2XA 3CVYA 1DG3A 3IQWA 4PCUA 1HM5A 1PDVA 2Z8YM 3EYAA 4Q3CA 1G20A 5LDGA 2G28A 3LG2A 1Y5NA 1TM4E 5AOBA 3VR6H 4CV1A 1SVLA 3MOIA 3WS7A 4WACA 4J2HA 4V2IA 3WGIA 1CY4A 2F59A 2HQSA 1ZU5A 3PHLA 2JLVA 4WQMA 4JOQA 1GZSA 2X8JA 5M3BA 2NZ2A 3TQRA 2OCYC 1EFLA 3F90A 2G0TA 5EJIA 3RBVA 3NTQA 3CKKA 2D7CA 1WV0A 3IHTA 4IO0A 4KN5A 5AVWA 4NBLA 3GJXC 1EFVB 1GZDA 1XF9A 2ADMA 3C87A 3FTFA 3KJEA 3BRWA 5JYCA 2BEVB 4OUKX 1EK0A 2G5GX 1QH8B 5AT1A 4MVJM 1YFKA 2C8JA 2QM7A 4HWTA 4MYDA 5AI9A 3F1KA 4Z4CA 5A5GA 2IZOA 2G25A 1EWYA 1MX5A 3DDNA 4JASB 1VL0A 4OQEA 4P1ZA 4N65A 1W30A 1DKUA 1DUVG 2PZEA 4UUPA 3E9EA 5CJ2A 1W4BA 1RPTA 1ZD5A 2ODTX 3AFOA 3CZMA 2GZAA 2JFBA 4E2YA 1YJ8A 5FUBA 4F2HA 5B1EA 4YMLA 3PLAE 1YS9A 4REOA 1XNJA 3VNSA 3V97A 4Q9JA 3BUSA 5FLXA 1CR1A 5THKA 3HJBA 3LPLA 4YRKA 3FSGA 3HO6A 1JJBA 3OZ7A 4FHGA 1FDWA 3OIWA 1XZLA 3T5DA 1AVTA 3VX3A 3E22A 1TF5A 3GFVA 3OECA 1GT91 1SOVA 5EIBC 3AVQA 4CTKA 4C87A 1LSSA 3OO1A 1SBZA 2IYVA 5TPZD 2PEYA 2YIVX 5IEJA 1JFLA 1C0IA 4KZKA 2J3JA 2VJKA 2QAJA 3G9QA 3H86A 1KAMA 3AR2A 3LDFA 2JJMA 1D2NA 3EIQA 3V6LA 2WT8A 2GTPA 3EDYA 2YC2C 5DU2A 1H5UA 5E0OA 2JGLA 3C1TA 1RLOA 2C2ZA 3CRNA 3MOSA 5JV5A 1GSAA 2PA3A 5CFRA 5IHPA 4KX5A 3U39A 2AG1A 3AL3A 3UFXA 4ZGGA 1ONNA 3BXEA 3I04A 1R8SA 2MSWA 3DLBA 1TUEA 5AUQA 1RRGA 3V42A 1DRKA 4JK3A 4EMTA 4II3A 3ZLJA 1NVKA 1V7CA 1PJBA 3TB4A 1EM8B 1FUIA 1KK0A 4TKVA 1II9A 5G4LA 1XFDA 4YR9A 1A27A 2BFCA 5LWQA 1M1YA 4GXTA 4BQEA 1B43A 1TJ5A 1Q44A 1U0FA 4XB6B 1AH2A 3PF8A 5ED0A 2LKCA 1I7DA 4KO4S 2JZNA 1GGJA 1R10A 4ETIA 2HSGA 4BQQA 4Q3OA 1Y1SA 1J0EA 5H83A 1UK7A 1DV2A 3EPJA 4ZXFA 4BLUA 4BNVA 1JG3A 4NU8X 2X0NA 3D3JA 4GOOD 4ZEOA 1RADA 3BXFA 4IQ8A 1JI3A 1FVFA 2HTEA 4LDZA 1BQ3A 2UXDB 1UOEA 2W11A 1JR3A 2C4VA 3BAZA 3RC2A 5L45A 2ONYA 5F1OA 1MJGM 3HU2A 5JHGB 5JFGA 3K70B 5FOVA 4MS3B 3ZWWA 1J90A 2IU4A 4G0YA 2ACWA 3G0GA 2ONJA 5FT9A 4HGPA 1N2BA 1AC5A 3O93A 2P1DA 3TUJC 1GGMA 4MVJH 5C4MA 2P69A 1G16A 4L74A 3PHJA 4B3TB 4JFAA 3NX4A 4Q37A 2QNIA 4K9SA 1M8PA 1HI9A 2O50A 2VKTA 3PNPA 2XF2A 1GZ7A 4DUGD 1P5ZB 5BQ3A 1ZUHA 2G17A 4QJBA 2QG6A 5CM8B 3RAPR 1QJCA 3HJNA 3HKDB 4KXVA 4GGOA 4S1TA 5DGCA 3JVUA 2PZFA 1ZJ4A 2PMDA 5KYXB 2ZRMA 3BJMA 1HEIA 4MUMA 3T54A 5JAHA 1DPFA 2CVOA 2EBFX 5IAKA 5G1NA 3ZZ1A 3BSYA 2I6XA 5DM0A 1FEZA 3TL2A 3TMAA 2O2JA 2VPZA 3LRXA 4WJLA 3ZVKA 4XASA 1M10A 1OASA 1IATA 3K71B 4EG0A 1EWRA 4ZA2A 3A1WA 4YXWD 2X4LA 1QIKA 5LP6C 2V7WA 5EJ5A 4MP3A 1IOZA 4HO1X 1PEYA 4YDQA 5IT4A 2RG7A 1O2DA 3LCVB 4JLBA 4TXLA 2IDKA 4P0QB 1XQXA 1ZD4A 3NT4A 1O95D 2GQ0A 3EEIA 5I9MA 1GN9A 4PC6A 5J2TA 1R0WA 1SXJE 1C3OB 1P31A 4JGGA 5KNBD 3ZW7A 4IEFB 4PPNA 1QE5A 3DBIA 3JY6A 2WMYA 4LQLA 2IGBA 1SVSA 2P0EA 3EH1A 4LG1A 4MV5A 4YASA 3A6DA 4W5RA 3P0HA 5DYYA 4AZ3B 1G18A 1FYDA 2HMYB 4WX2B 3VMMA 1WSWA 1QIHA 2DGDA 4A16A 2EF0A 1QWOA 2ZSAA 3F6CA 3BWDD 1M6NA 3GPBA 2B6HA 4FBLA 3HO8A 3QKRA 3T3OA 3PKIA 1SRRA 2QOEA 3G49A 2F4VB 4RKWA 4MUBA 3FTNA 2AYZA 4F56A 4TL7A 3SVZA 4Q18A 2YDXA 3ZD6A 1IN1A 4NEQA 3TO5A 4D4GA 4WLUA 3B1KA 2G5CA 3ZWVA 2G4LA 5EESA 5LDDC 1PQWA 3EGXB 4KBGA 3ZE0B 5BQ5A 4EA7A 1BKSB 3OA2A 4MB6A 1WVMA 1EVIA 4U7PB 4HDCA 1L7OA 1HE1C 1Q16A 2C8LA 2YYYA 4GX1A 5H68A 3S7TA 1DWPA 4P7FA 4CDMA 4PYOA 5LIPA 3KETA 5D5QA 3EMBA 5K0LA 2IWHA 2OWEA 4QPCA 3V9AA 1NF2A 3VA7A 6REQB 1TEVA 1PG0A 3N2NA 2OYSA 3EVFA 1IY8A 1MCZA 4AY5A 1DIGA 3AV3A 2XQIA 1Q6ZA 5A4FS 5C0OE 1MHTA 1JKXA 4WJZA 1YSCA 1EFDN 4L8GA 4YLYA 1MORA 2X8BA 4GGMX 3U3JA 4DXDA 2PUEA 5IDWA 4LMAA 1RWOA 4MS4A 4HN4B 3IMGA 2P30A 2ZREA 2CUNA 4B48A 3SYNA 5SY9A 4EH1A 1QIFA 4PF1A 2YV5A 4URVR 1QX4A 9MHTA 5E1DA 4YRGA 5CIWA 3N0RA 1IQPA 4CCYB 2BSXA 3T5BA 1JL3A 2IT1A 2X0IA 1YB7A 1P44A 1YC2A 2XTAA 3FDZA 4EZEA 1GL6A 1VIDA 1UBJS 2EP8A 4K46A 2VYQA 4HDOB 3UG7A 5FI0B 3H42B 3B6ZA 3MB5A 3B20A 3N2LA 4HAVA 2G1KA 1G2OA 3S27A 4B2IA 1E7QA 4OHMA 4AJ9A 2HO5A 2PZMA 3GFBA 4OJQA 1I3CA 3QU7A 1KZHA 2D1QA 3HDTA 2QJTA 2CDAA 4R2HA 1XWWA 4KMRA 4WKOA 5DNUA 1VI2A 2HA7A 3LFUA 4NAHA 4UM8B 3LWDA 1XALA 2ALJA 4BP1A 4KNVA 4U7GA 2HCTA 5LOVF 2GF2A 5IT5A 3ZI7A 1EVKA 4Y2QA 3PR3A 5TQ0A 2Q41A 4C78A 2WB2A 4UEKA 1C80A 1KSJA 7ABPA 1UWKA 2QZPA 2H1OA 1XJQA 4QU8A 2RKBA 3OJFA 2OLJA 1PYGA 4XW2A 5K7SA 3R0ZA 4B3CA 3LBYA 4I1OA 2YXNA 1FXWF 4TMWA 4L75A 2P6RA 1O8CA 3DHYA 3L0ZA 4ARIA 1NW8A 1VLHA 2WU8A 1JTEA 3BYZA 3I01A 4GD3Q 5PGMA 2VEOA 4Y1RA 3U7EB 3VC2A 4UU1A 2A3RA 2R7KA 3H8WA 1XZAA 5I9NA 3K70D 1ZVVA 5DLDA 4GI3A 3UJPA 2FGKA 1EK6A 4A4DA 2WF8A 5E4YA 3TFQA 4D97A 2A1TR 3NNSA 3ROMA 4CV0A 4KITB 4UM9B 2CXUA 2R6AA 3CPEA 3CLTC 1XQYA 1VSQA 4YRSA 1LSOA 5EC8A 5FL3A 4FBGA 2CL6X 4MI3A 1JNXX 3TQFA 2XE8A 1SUFA 4KW7A 4OU5A 1QKIA 4N0MA 1E3JA 3OIUA 1KYYA 1JEDA 4JC0A 5AIAA 3GOHA 2YKGA 4ZOLA 1IEWA 3AGPA 3H4IA 3ROKA 2FW9A 4JEIA 5D86A 2IPNA 2NZWA 1D9ZA 1EVYA 3LY8A 1EE1A 3PDIA 3PLRA 4KTTE 4MUJA 4OOEA 5BMVF 1CQIB 5K0JA 1DRVA 2D5IA 4D1YA 5LA6F 4AKTA 1T2CA 3NAZA 4GSLA 4G0XA 4YJ3A 3TJMA 4F6CA 5E6SB 5HFAA 2LKDA 4UVHA 4BNFA 3RYFA 5FWYA 4LJSA 1SA0B 3U48A 1RM0A 3NP9A 3RE1A 4N5MA 3TXAA 4HFJA 1HORA 4PU0A 4GRAA 4HDSB 4IIVA 4FFLA 1ZOSA 4PLFA 4DQXA 1S2OA 2ID9A 1X7DA 4KQMA 3BAFA 1MOSA 3GVPA 4DBZA 1H8EA 4FD2A 4NS1A 2PMFA 4ZVRA 3UN1A 3QKWA 4RD0A 2FPWA 3FRIA 5DGTA 3ZV5A 3JQ9C 3A58B 2R1ZA 3OAAD 4RIIA 4PLHA 3PKJA 4U7JA 1R0CA 2IYSA 1NURA 3L6CA 4K2HA 5U4XA 1W46A 1T1IA 4N5HX 1IM5A 4EG7A 3DMPA 1GPUA 1DRWA 3I2IA 3WSTA 4MUNA 2QUHA 4OUDA 1DFHA 4PAGA 2QN2A 4Y2UA 3C1OA 2AN1A 5K0TA 2REBA 4MWSA 3UKJA 1IWOA 2GGSA 1Z0ZA 5CNKA 4N0EA 3SEFA 4UTVA 4FCVA 3MJEA 3SLKA 3RIEA 1SXJC 1U2DA 4IPTA 4TQAA 1A7JA 1VE3A 4BZPA 1MZPA 2VYND 3O3OB 3IC5A 2Z9DA 1OW3B 2IHYA 3AETA 4OA5A 4DANA 4DR2B 1NN5A 2BFBB 2JI6A 4EKEA 1XZQA 1Y9AA 3H1TA 3HCRA 2EF1A 3WB1A 4OX9Y 1FDUA 1LPMA 1NNLA 2Q1TA 4KFCA 1NJFA 5F77A 3TNFA 1Y5RA 2G6TA 3MJRA 4KOAA 5HCIA 3VNQA 5IM4F 1JBQA 3EF0A 2ZRBA 4IXMA 4J29A 3M89A 5JD6A 3LUCA 4BFYA 1T0HB 2Q3LA 2XWJI 1OGJA 1BJTA 2QPAA 3PSAA 4KQGA 4M22A 3T0GA 3BCUA 3GEEA 3WLRA 1P9NA 1E7SA 4TRRA 3T1HB 1JKJA 1H05A 1PFYA 3I5AA 3AL0C 4WN9B 3SX4A 5F2KA 2C2MA 4UDYX 5EMJA 1PQ4A 5TF0A 3B36A 4W6ZA 4CKEB 2WU4A 4B3FX 4G1CA 2WKQA 4EW1A 4EL5A 1PWXA 2WHRA 5E4TA 1AUOA 4L9AA 3E61A 4YMUA 4LTMA 2N9UA 2XGOA 3RTDA 2DUJA 2CUTA 3OJ0A 1JIJA 3W2IA 4D3XA 4Z4EA 3SXPA 2WT9A 1DWQA 1AQYA 2ECOA 1YI8A 2GRUA 5DBIA 5G2OA 1Q3KA 4GLJA 3C45A 2IZ1A 4WXHA 1DBRA 5JDIC 3DDHA 1RPNA 1ZMTA 1JHRA 3W3AD 3UMFA 1OPRA 3ZD8A 4D79A 2BDEA 5CYGA 3Q7SA 2B37A 3TDKA 3THWA 1QHFA 3CJTA 3WZ2A 1O8BA 2PX6A 2VTVA 5HUQA 1P80A 3OQOA 2CV0A 2Q62A 2V7QA 3SHVA 5A4MS 4YALA 3TD9A 2I1QA 3G7SA 3EVNA 1P4AA 2OFPA 3RRBA 3L7KA 1AKYA 1XHEA 5L3SB 2YVAA 3HVIA 5AJUA 5JBNA 2OBFA 2V7XA 3HY6A 4IGEA 1ZDMA 4JR1A 4AUMA 4DDMA 4DMCA 5CDFE 4PICA 3L1UA 4R8KA 1XEXA 3GJ4A 4UARA 2IYWA 5DPMA 4GWKA 4BGEA 1DINA 3RFUA 2IEYA 4LFCB 4Y2VA 1ZMXA 3BMOB 5KZMB 1S7CA 2PUTA 4IDHA 5B7QA 4UZFA 4YRAA 3BT7A 3N07A 3LCJA 2A14A 2QTWB 5FLYA 5JSKA 3WWDA 2L17A 2A9KA 2WFLA 3R8FA 2AOVA 1B2LA 1ESMA 2ETVA 4WASA 2CBXA 3Q41A 4HT3B 5LYYA 3DVRX 3THYB 2ZGVA 3H5OA 2W93A 3QE0A 4PBTA 5B53A 2QJFA 4GDMA 4MUAA 1Q83A 3IQDB 4CG0A 4ZCRA 1NQAO 1SPBS 4F9EA 1J8DA 3SFVA 3V3TA 2ZUFA 1R3DA 4O2AB 1GAWA 5H59A 3PIIA 3I5XA 4ZYZA 1U6KA 2EZ9A 2JJYA 4Q03A 2RGAA 4UM9D 2JLZA 2PZJA 3OTGA 1B8PA 5LKRA 1HSOA 1OZAA 3H6KA 4XGRA 5JJKA 4W9RA 1QORA 4HADA 5FOUA 1CRZA 2DHRA 4XR9A 2NU8A 2Q3DA 1NQWA 3TPZA 2ZAOA 4BASA 4FEGA 4RVSA 1IZ8A 4OK3A 4C30A 2GA8A 3F49S 2Q9UA 4A0GA 1BKYA 2X1MA 1GFWA 3KKOA 1Y3FE 3E9ZA 1ZBDA 2Q3FA 1QBKC 4JIMA 1V35A 3X2FA 1U02A 2XAAA 3ZWPA 5B6JA 1CUWA 3CU5A 1SKYE 3I9MA 2I67A 4K6CA 1LUAA 3OWHA 3MTAA 4JCOA 1KE1A 3DWFA 3KUXA 4K9PA 3OE1A 1UODA 2E89A 2Q7XA 3T9CA 1K3FA 2OWDA 5AXBA 3HGMA 5K3FA 4G5GA 1KK3A 3E3NA 4C20A 2J3HA 1YVPA 2FN8A 3AINA 2Q5IA 4S3MA 3ETGA 5K2MA 1O6CA 3DOFA 1UCFA 3HSKA 2Y77A 3DEAA 5IPFA 3U5TA 2ADOA 3UTDA 4AU1A 4E5KA 2FN3A 3L93A 3V46A 1ECPA 1K8QA 5JSYA 5IBCA 4GRIA 1J8QA 2F62A 3DJYA 4S12A 3IMFA 1NBHA 3OHMA 3OZAA 4X45A 3BD7A 3N8KA 1XXHA 1CPYA 5JQGB 1ZEMA 3DA8A 3GLHB 3TR0A 4BNIA 4OO3A 4MLPA 2NADA