3C8UA

Crystal structure of putative fructose transport system kinase (yp_612366.1) from silicibacter sp. tm1040 at 1.95 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
206
structure length
206
Chain Sequence
GMTLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPMDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLFDRARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPMADLEARLVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPADLTWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative fructose transport system kinase (YP_612366.1) from Silicibacter sp. TM1040 at 1.95 A resolution
rcsb
molecule keywords Fructokinase
molecule tags Transferase
source organism Silicibacter sp.
total genus 73
structure length 206
sequence length 206
ec nomenclature ec 2.7.1.4: Fructokinase.
pdb deposition date 2008-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3c8uA00
1ZNYA 3MCAA 1AS0A 1XJQA 2G0NA 4Q02A 2ZANA 1UAAA 5KOYA 2WJGA 3IIKA 3PIRA 5DI9A 1OH8A 4MKHA 2R8RA 3WHKA 2PZFA 4JJZA 1Z6GA 4IOMA 1MKYA 2IYSA 1JI0A 4WXRA 1OXTA 1VG8A 3SQWA 3FMOB 2V7QA 4CGZA 4N3NA 1E1RA 4HDCA 1IN5A 1E2GA 1JECA 3QXSA 2AKYA 4AI6A 1AKEA 1Q1BA 3I8SA 3JZAA 4U00A 5SZIA 2BBSA 2I4IA 4ZKDA 2GZAA 4JJKA 4GP6A 4RD1A 4JVSB 3FHCB 3KKPA 2ZSFA 1WQ1R 2D62A 4DCNA 2GNOA 2PX3A 4DJTA 2GBLA 4TZ0A 2ZRGA 4KFUA 1N6IA 4B3CA 4I1VA 4BZQA 4OJKA 2FV8A 2FFBA 3QKUA 5GJCA 1JR3E 4JVMA 3AVQA 1EWRA 2BBWA 3HDTA 2IYQA 2RH5A 1GNPA 1W48A 4DCVA 4F93B 5ELXA 1KNQA 2YNMA 3K70D 2ORVA 3L0OA 1KSGA 2CVFA 4U7DA 2XITA 1P9NA 2H5EA 4TMXA 3ICQB 4E22A 3FMFA 1L2TA 4Z8XA 1LF0A 1E0KA 1Z6XA 2QUZA 1PLLA 4E09A 2W6JD 4TL6A 5HKKA 1FMLA 4B74A 1G16A 1OSNA 4YDHB 2QTHA 1G3MA 4EFNA 4PR0A 2GAAA 2RGEA 4PAQA 1NJGA 4EFLA 1KI7A 4D80A 4Q7JB 4IVQA 3C8UA 4KVGA 5TXGA 4UNPA 1U9IA 3WP1B 3BH6A 3K70C 1TEXA 1XJ0A 3DOFA 4HB0A 2BMFA 2G88A 3QKSB 1XD2A 4UNSA 2FZ4A 2ZRPA 2FOLA 3QEJA 4DUGD 3OESA 3LXXA 4JIMA 4HUQA 3THOA 1AN0A 4LHWA 5EJEA 1X8JA 1N5JA 1SVLA 3CPHA 2DYKA 3QPVA 3GLIB 2AFIE 2GZDA 4DZZA 4EAQA 3TE6A 3KQUA 1K5GA 2QROA 3BFKA 3IEVA 1F5NA 1XWIA 3DKVA 3HYTA 3B1WA 1E9AA 1ESNA 4IOLA 4G5OA 4R98A 1MABA 4BUJA 4A6PA 3ASZA 1E94E 3K0FB 1COWD 5EXPA 2HF8A 2IYVA 3SJCA 2PH1A 3LBNA 5EZ5A 3HR7A 1XXHE 3RSLA 4A6XA 3NG1A 2QMOA 1NI3A 3AUYA 3F5FA 2XOKD 1VHLA 1PZNA 3IPXA 3ZS8A 4LBVA 2IS1A 3T1QA 4OI1A 3KKQA 4KODA 3T34A 2CLSA 3MRSA 1TADA 1KO8A 3NC1C 3Q85A 3OFNA 2R65A 1XXHB 2IS4A 3WHLA 4PPQA 1IM2A 4HZUB 4BLPA 1N5KA 3KKNA 721PA 3GLFA 1KDPA 1ZD8A 1EFHA 3F3YA 3QENA 3FPAA 2H8KA 3CF6R 1JR6A 1N6KA 4PZYA 5EE3A 1S4QA 3N70A 1ZC3A 3B2EA 1IXSB 1DELA 4GOKA 4HLCA 5J4VA 2RGXA 5FUWA 1Z0IA 3FYHA 3QI2A 4URWR 4EIWA 4DXAA 3BAFA 1OKKD 2B6HA 4XOIA 2ZRBA 2EVWX 3LVQE 4CEJB 3MAAC 2PT5A 4CVNA 1E2HA 2OUKA 2DFNA 2HEIA 1T4GA 4JSTA 4M1KA 3OE7A 2YWGA 1VCOA 1E2DA 4HUTA 2PCJA 2WMNB 1N6PA 2OILA 1S8FA 3UWOA 2LKCA 2YZ2A 4FCWA 3VU9A 4C0AC 4PQFA 4E5UA 1TF7A 1EG7A 3LDAA 4II7A 4QJ4A 1VMAA 3S1AA 4MKFA 5HE9A 3SC3A 4R7ZA 4P31A 5KSOA 5KNDA 3KKOA 2ZAOA 4KITB 4IDOA 4D25A 3K9NA 2ZSAA 3L0IB 3THYA 2VF7A 2IUSA 1GSIA 2F1IA 5SZHB 4LJ9A 3UMRA 5AWFC 3W90A 1E96A 3R8CA 2BMDA 1JEDA 4EPTA 2KE5A 1LVGA 2V9PA 2VP4A 3K0AB 3GJ8A 1UBEA 4TT3A 4A9AA 3VKGA 3BBPA 4KFTA 3ICEA 1G64A 2O8FB 4QBGB 5H68A 1H8HA 3L82B 2OCYC 1R8QA 2B7BA 1AA9A 5EXSA 5AK0A 4A2QA 4BZXA 1QF9A 4F4IA 3IHWA 1VIYA 2O8EA 3AVYA 2NO6A 3LX8A 4NYMQ 1KO5A 5HTKA 1E1QD 2AFHE 4JBYA 4ZI2A 1WBDA 1W0KD 5JI3E 2OCPA 3NBZC 4DLXA 1LY1A 4EPRA 1YZQA 4CRWB 4HDOB 3PFIA 5CLLA 2Q6TA 2EW1A 1ZP6A 5BN4A 1DOAA 1OFTA 3FFAA 3I5XA 5BYKA 3LO5A 3AQ4A 2GCPA 4B3GA 5EP4A 2YC4C 1GUAA 3NH6A 2QAJA 3J81k 1E3MA 3LFUA 1NP6A 3AVXA 1II0A 4JS0A 4QHSA 3KUDA 3QBVA 2K5UA 2I1VB 3KDSE 2ODEA 2ZROA 3FTQA 2QI9C 1OIXA 4JYBA 2HXSA 3V4RA 3T5DA 4NONA 2JJ1A 1KO1A 3GJ4A 4UNNA 2EU8A 4IEEA 1HQYE 4D0LB 2HLDA 1G1MA 4IKEA 2JLWA 5KPDA 2GXSA 2RHDA 4FINA 4KBFA 4HSEA 2R62A 4PC2A 3TW8B 3EC1A 3AP2A 4B75A 1IY2A 2C96A 4NYJQ 4ZCLA 4US2R 3UKDA 1SXJD 5FOVA 2QU8A 3VTKA 4EJSA 1RPZA 2JLSA 2OLKA 3VR3A 4BWYA 1GM5A 3REGA 1E98A 1W49A 3VX4A 3IBYA 5GJVC 2XZOA 4GSYA 1Z22A 3THXA 5J4YA 4DKXA 4AKGA 3I62A 4KU4A 4LJYA 4Q1DA 1E9CA 5AJZA 4RD6A 4DSUA 1TF5A 2F43A 5DHAA 4MGYR 2Z4RA 4LYHA 2V54A 3VFDA 4JMPA 4KYUA 1IJEA 2GETA 2C9YA 3B9QA 1YR8A 2RGDA 3QKRA 4QRHA 5CM9C 5E7JA 1M1YE 4BFUA 4C3ZA 3X1WA 1EK0A 3ADDA 4IHQA 1SXJC 4TWZA 2P67A 2WICA 3C14C 4I4LA 3C41J 4RSGA 3U3RA 3K0SA 1G19A 1US8B 4B6FA 3KXLA 4EPVA 1XZQA 2VSXA 5A0FA 4MRNA 4Q1CA 1G20E 4YXWD 2XXAB 2OZEA 2VIIA 1G8GA 2LCFA 1TTTA 5JWOA 3CONA 4LYFA 3I73A 4JT2A 4KCGA 1ZJ6A 3U7FB 2GEVA 2BJWA 4HYYA 4C30A 1QHHB 3FDIA 4A0FA 4BLOA 5JCZA 4X8OA 1JNYA 5CIWA 3CR7A 5AR1A 2PLRA 4V0ME 1E0SA 3RS7A 1W7AA 1BYIA 1K5DA 3X1DA 1JJVA 1I2DA 1II8A 1O3YA 2GCOB 3CO5A 4S2EA 3MWKA 3SYNA 4PHGA 3QKTA 4BLSA 4HEJA 3WBJA 4GZMA 1E2JA 1M6NA 1NVVQ 2A9KA 2FEOA 2FU5C 2D2EA 1CLUA 2WKQA 3TH5A 3MFYA 2QMHA 3VHLB 4TQAA 1NN5A 5F98A 2GJSA 2G3YA 1RC8A 4OJQA 1DAKA 3QXXA 2A5FA 2DR3A 2HV8A 1KI2A 2J5XA 5DH9A 3NHAA 3AVVA 2JLRA 1FX0B 2ZU0C 2CNWA 2VLIA 4JBWA 5GVSA 2NO0A 3TLXA 4Q9KA 4LHZA 3T61A 2FFAA 1NKSA 2Q21A 1M7HA 2ZI6A 3A1SA 5HE8A 4EKDA 2IS6A 5IK2D 3BWDD 2P5SA 1AS2A 2X1VA 1UEIA 4CZ2A 3L0SA 2NG1A 3UANA 2OEPA 2PLFA 4MUBA 4PC7A 2QP4A 1A7JA 5FOWA 2NQ2C 3UPUA 3BJIC 4HB4A 4HI0E 4B76A 4TL8A 2GCNA 2UVQA 1J8MF 1OH5A 3CRMA 2W0SA 3RVBA 5FL7D 4NYJR 2EFGA 1E9BA 4XTRA 2OBNA 2ZJBA 4TLBA 3QXCA 2BMJA 3T1TA 4LJ7A 2JASA 1Z0JA 4DSOA 2YV5A 4C0BA 4M21A 4UNQA 1AS3A 4KFSA 2A5GA 4IXNA 4FIDA 4B34A 2J0QA 4PQYA 2OBLA 3RNLA 4OI4A 4URYR 4TYWA 1Z6YA 2WAXA 5JJLA 4BLTA 1OYYA 4JLDA 4M9SA 2YWEA 1NNEA 2BVNA 3TSOA 2GJKA 2WWWA 2YWFA 4ASUA 4ZCIA 3GFPA 2REOA 5CM8B 5A4JA 4BFZA 1NMYA 1NJFA 2FSIA 1SXJE 4JYCA 1KMHA 2OFWA 2QBYB 3K9HA 3VNVA 3B9PA 3WYFA 3ZZTA 1NG1A 3SR0A 1XRJA 1CBUA 3PR1A 1HY3A 4OK5A 2QE7D 1N6LA 1KI8A 4LC0A 4UXHA 2OAQ1 2IYXA 3EAQA 1GKYA 3K9LA 2HYIC 4BGDA 2DB3A 2ZEJA 3LBIA 4TMWA 1S9HA 1HTWA 1HQCA 4TQUS 4Q4HB 1VTKA 2WIAA 1RIFA 5SZJA 3U6KA 5F9FA 1S2MA 2GA8A 2CDNA 3U60B 2F55A 2AD5A 3MGCA 1NVUQ 4V0NA 1HE8B 4RVCA 4X8HA 4UJ3A 3TJZA 1WRBA 3NVAA 1XCGB 4MH0R 4OHZA 4V0LA 1J70A 2DY1A 2FA9A 4QHTA 1NVVR 4CEHB 4JBXA 1YZUA 1P2UA 3WMGA 2HF9A 2OAP1 5M04A 1T5IA 3I92A 3IEUA 2VSOA 1E9FA 3JZMA 2C5LA 2V7QD 3EW9A 4JT4A 3VKHA 1E1RD 3AKEA 4Q03A 2QAGC 3EIQA 3QQ5A 3LWNA 3MMPA 1SHKA 1W2HA 4G1UC 1RJ9A 3BOSA 3EC2A 3AEZA 3FKSA 1KTVA 5JJKA 2QSYA 2GJ9A 4P4TA 2QTVB 3HPRA 1KYIA 3IIJA 4NHOA 3RRZA 3SJBA 5CB6A 1ETUA 1TQ2A 1SQ5A 4JSYA 4O2LA 2ZJAA 4H9GA 1TQDA 2CJWA 1A82A 3L8ZA 1Q57A 4TN1A 3RHFA 4MYTA 5EXTA 3X1ZA 4Q00A 4DCSA 4OK6A 2DWPA 2ZVPX 1T6NA 1QRAA 2IK8A 2WOOA 4OQFA 1E32A 2GF0A 1OXVA 2XSZA 3I3SR 4XSHA 2GF9A 4Q47A 3U61B 2QQEA 4NKRA 3KFXA 3FB4A 3EZ9A 1QVAA 1WA5A 1CF4A 1OHHA 4R71A 1T5LA 4PPGA 4LJAA 4JLVA 5L3QA 3FGNA 2XTZA 3AKDA 3CPEA 3ADCA 1Z28A 5FBVB 4IDPA 1NY5A 5IDVA 1DBSA 1ZUNB 1UBGA 4KXFB 1VPLA 2YOHA 1VCMA 4LV6A 3U3JA 4QNMA 1NVXQ 3W8NA 1W5TA 1W4BA 5TY0A 4GRAA 4OQLA 4ACAA 1P5ZB 1UFQA 4CYMA 2BV3A 1KJZA 4F4JA 1XPUA 3KXIA 3OIVA 4IXMA 4RFVA 1LW7A 2G1KA 2UKDA 5HPYB 2WWYA 2ZRAA 1UKVY 4RFSB 3W9YA 3N2EA 3SYLA 3U4QB 5FOUA 3SBEA 3P27A 3V4FA 3RYTC 1KKMA 1G7RA 4UNRA 3U44A 3O8CA 1JBKA 4V03A 2VF8A 3O47A 4EQ6B 3RWMB 3ZGXA 3OZXA 5L3RA 4TL7A 2QT0A 4M1OA 1PV4A 2ZM5A 1NF3A 2ZI3A 2ORWA 4NMMA 3QF4B 4Q4JB 4M22A 2IUUA 4IW3B 1SKYE 1D9ZA 1XP8A 4LJ5A 2ZE8A 2X19A 2J0SA 2IYLD 2ZRIA 1DAEA 4QM6A 3OEHA 4ARZB 5B58C 2WSSD 1T0HB 1EESA 1R0XA 1W5SA 2CCKA 2VP0A 3Q7PA 4LJ4A 2Y8EA 2Z83A 1N6RA 2ZYTX 3EXAA 1CJMA 3K0CC 4G5RA 2RAPA 4OKSA 3GJ0A 3SFZA 5KDDA 1DAMA 4OQMA 1GRNA 3NDPA 5EUMA 1SKYB 4TL9A 5CB8A 1Q1ZA 2F1HA 3WYAA 1DAHA 2X2FA 1Y63A 2FJUA 2WKRA 1JPNA 1RVDA 5JS8A 1SVMA 4A8JC 4IDQA 4MGKR 3OFND 5DHFA 4TMTA 4JL5A 5HCNA 2R9VA 4PAOA 4QOSA 3GLGE 1EGAA 2E1RA 1R5OA 1G4AE 1YZNA 1EX6A 3TR0A 4DCUA 2P6RA 2QPOA 2BDTA 3R7WB 3A1UA 1R5BA 2QAGB 2ZS8A 2OESA 3PCRB 1N3BA 3DO6A 1KZ7B 4TLCA 4DSNA 3BB3A 3R9WA 2Q3HA 3PV0A 4QJ5A 1PLKA 1N2CE 1F2UB 4D4LA 3GLGB 3A58B 3MSXA 1Y3AA 2IEZA 3AKYA 1BOFA 2RGNC 5D3MA 2ZREA 4LK2A 1TMKA 3BB1A 1G9XA 1AQYA 4RZ2A 5CJ2A 3ASYA 5LD2B 1ODFA 3OIYA 2ZSEA 3HU3A 1NSTA 1Z8FA 4M9QA 2IC5A 5F3WB 2ZE6A 4NP6A 2IXEA 2ZJOA 4QBFA 3EWSA 5FPYA 1Q44A 2BWJA 2KJQA 4Z8YA 5AJYA 6Q21A 2PEZA 1S3GA 3A36A 4OBEA 3I1FA 4Y0AA 1FQKA 4IDHA 1QHIA 2CK3A 3AVWA 2EQBA 2O8CB 4HAUA 5BWMA 1ZU5A 4GMDA 2Q9BA 4FMCF 2WVJA 5JI2E 2SHKA 4DEXA 4MGIR 4J0QA 2G77B 2BKEA 1MRNA 4KV9A 3E5HA 1OH7A 1GOTA 2VRWA 2J0UA 4ITRC 3EIHA 5GJWC 3NHBA 3MLEA 3DOEA 5JECA 2P65A 2J7PA 1L7VC 4TT3D 1FQJA 3LA6A 3NTUA 3LW7A 4US0R 1XEWY 1R8SA 3C16C 1H8HD 1XEXB 1P2SA 1RW4A 4Q1BA 2EYQA 4WZAE 4L9WA 4Q4LA 3RC3A 3JVUA 4EDHA 4HLQB 5FFMA 1GL7A 1SHZA 4NU0A 4YMSA 5H70A 4B32A 4CW7A 1CJVC 2IHYA 2X2EA 1KY2A 3QY0A 2R6FA 4C7OA 1W2GA 5DGXA 4JLJA 4RJLA 4CEIB 3KJIA 4CDGA 2BMEA 1I4TD 2IT1A 3B7GA 2ZXUA 3R20A 3DMNA 1LF5A 2J3EA 4Y0VA 4AIIA 4C2UA 3FKQA 2F1JA 1R4AA 3ZDQA 5JBQA 1TU4A 4AURA 1VYUA 4NCJA 4D4JA 2CL6X 3BXZA 3DEFA 1GILA 4Q1AA 2QPAA 3TUIC 5LB2A 2D3WA 2GKSA 2GXUA 1J7KA 2G6BA 5ANRB 4L16A 3JVVA 2QENA 4AWXA 4D0NA 4A8JB 1E2EA 1PUJA 1EFCA 2A5DA 3IIMA 3P32A 2H1LA 2JJ1D 4PQRA 1D8TA 4D82A 2J46A 4QKQA 3TNFA 1GNRA 1ZUHA 2MSCB 3CX7A 3I72A 4HLUC 4OQXA 4C0HA 1DO0A 5G41A 1J2JA 2DPXA 2YOFA 3GEIA 4R9UC 1OLOA 4FCTA 3VMFA 2IYZA 2VA8A 3DPUA 5CIQA 3AH8A 3WMEA 3MJRA 4F92B 3T5GA 5TB5A 1D6JA 4D4MA 3AGQA 2UZ3A 3PG5A 3U6BA 4PC6A 3LH5A 2C78A 2QTFA 4IVPA 3TVTA 1QG2A 3L2OB 1NL3A 2ODNA 2NGRA 2A5YB 5FI0B 1KZGB 4FWIB 3WRYC 1Z06A 3GJ5A 2Z43A 3TVDA 1OXUA 4BRUA 2MSEB 2CEAA 3OAAD 3RS0A 1X8LA 4NCNA 4KO8A 1Z08A 3GJ3A 2B92A 4QGAA 4BEJA 3TKLA 2O8BB 1E99A 3D6TB 1NBME 3CH5A 4TYNA 1AIPA 2YC2C 3O8DA 1JR3A 3REFA 4FMCB 4CIDA 4DLRA 3WXMA 5L3SB 3K1JA 1KSJA 2QM8A 3FHTA 1RYHA 1XU4A 3MUFA 3KQLA 2OHFA 1Z83A 2J45A 3PXGA 4JLPA 2A5JA 5C1BA 2IYWA 1DPFA 1WCV1 2QT1A 2ZU6A 1MOZA 1E0AA 1OJLA 5DNYB 1Q3TA 3CWZA 3H2YA 1KGDA 3MG9A 2AXPA 1G6HA 2IEYA 4W5HA 4D4KA 2O8DB 3SE0A 2WPDA 3QKSA 1XD9A 2NIPA 3AVOA 2OBMA 3DVLA 4GI7A 5P21A 1EFTA 2GXQA 3NBYC 1C4OA 3TQFA 5JMTA 2H57A 3U7EB 3W34A 1FL9A 3WNCA 2NMVA 1XTKA 3Q5EA 3WNBA 4A1FA 2WMOB 1X3SA 3IUYA 3GLIA 3CLVA 3I61A 3OHMA 2EYUA 4FW9A 1ZD1A 3RABA 3RSOA 2RB4A 4QGGA 2J87A 4M53A 5F9HA 2QEQA 4BRWA 2RGBA 2WJVA 1R10A 4GOJA 2O0JA 2PBRA 3AP3A 1VDZA 3KUCA 1G17A 3T1OA 2DFLA 5L3VA 2VL7A 3K0FA 1G3UA 1P60A 5EZ6B 421PA 4AKEA 5HZHA 2NO1A 4LHVA 4BECA 4B3DA 5B2ZA 2ERYA 4WA7A 4I1OA 1FZQA 3I8XA 1XPRA 4DT1B 2A7QA 2F3TA 3UWKA 4P32A 4WOPA 1P2VA 1KDTA 2JCSA 3P4XA 3GCGA 1NN1A 3PENA 3KTAB 4AD8A 4GFDA 1XXHA 2E9SA 2Q3MA 5FTLA 3CF0A 3B8HA 3AGPA 2ZR9A 2Z5FA 4HZUA 2ZPTX 5LBIA 3CUEF 3UIEA 1TUIA 2B8TA 3K70B 1DAFA 4B47A 2DFKB 1JXOA 2H17A 3MJHA 5BQ5A 3GJXC 5IRCD 1W44A 2HXYA 3HR8A 1Z0DA 5KPJA 3TSWA 1E79A 3DMDA 3FFBA 1HT1E 4M1MA 4DDWA 4YQFA 2N46A 3ZVRA 3ZIAD 3LLMA 1LFDB 2FN4A 4ASUD 1ZC4A 3CRQA 4DCTA 4DDVA 1G18A 4ZIRB 4O0MA 4CEJA 1EFUA 1R0ZA 2BKUA 1KJWA 4FXPA 1CJKC 5G40A 1CIPA 1KIMA 4QHYA 4URVR 4Q5IA 2B21A 2VHTA 2H16A 4DIEA 3AF2A 1YQTA 5CJPA 5TMPA 5DISB 1X1SA 3EA5A 3PITA 2ZVQX 2WBLC 1OV4A 2NTYC 3W3AA 2ZS9A 2ZRJA 4UKDA 3A37A 4JLBA 1J99A 1UM8A 3KFVA 1ESMA 3I4LA 2VTKA 1G5PA 4I1SA 1M8PA 4LYJA 3RLFA 2W2TA 2OV2A 4KYIB 3B1XA 1SGWA 3RS5A 2C77A 5FH9A 3H84A 2RMKA 1CR0A 1GRQA 4X8MA 4H1VA 5DN6D 5JEDA 2XEXA 3BK7A 4Q7MB 1AGRA 3GEHA 1EX7A 3UATA 5K8IA 1LS6A 1VYVA 4E03A 1GITA 4Z1MA 3RWOA 3K0AA 1N6NA 1YZGA 2VP5A 1GIAA 5K8LA 3NBXX 4PANA 2O8FA 5BN3A 3O8BA 3TBKA 1PVOA 2GJ8A 1TX4B 2VP2A 3UMSA 4U02A 1RRPA 3QPUA 4V0KA 1GKUB 3IGFA 1XMVA 1A4RA 1XTSA 2GWHA 3FKSD 4HAZA 4L5BA 1RRCA 1T91A 1NMZA 2W6JA 4P4SA 1F60A 3TW4A 4IEIA 4C0JA 4XWKA 3WYGA 4C2TA 1KOFA 2Q9CA 1X6VA 2GZHA 5JSZB 2H7VA 1FMJA 4DLVA 5H8WA 1XTJA 1NN3A 3B85A 2GXAA 4PFSA 2WSMA 4QNRA 2GVZC 1NLYA 1ZCAA 2F9LA 4ZKEA 1OPXA 5JRZA 1IONA 4ZDJA 5EP3A 5EE0A 1OXSC 2ONJA 4L8GA 3VR4A 4DUGA 2CXXA 2OLJA 2GRJA 1GTVA 1OHHD 4WZBE 5SZKB 4US1R 5G3ZA 1WB9A 1GKIA 2IW3A 5CDFE 1S0UA 1Q1QA 4LV5B 4UXIA 2QPTA 4CT4B 2LKDA 5FPSA 1LB1B 2CMKA 1A2BA 1P72A 3RANA 1M7BA 4B71A 3WY9A 3TIFA 2FGKA 3LQQA 5KUTA 2NZ8A 2XJ9A 2BBTA 3FMIA 1COWA 3SZRA 2RGGA 4NYMR 3FVQA 4DLUA 1QBKC 2XOKA 3B78A 4LWZA 2QQ0A 1DTSA 3GLHE 2XX3A 3Q72A 3C5HA 4Q1EA 1FPMA 3BH0A 4MDFA 3AF4A 1MV5A 4TLAA 2ZSDA 3CB4A 4TMZA 3RS4A 3KXKA 3G82C 5FPTA 1W4RA 4UXJA 2AK2A 2Q0HA 1ZIPA 5KDLA 4BEBA 1TNDA 5KU1A 1U98A 1TQ6A 4KI0A 3R9IA 1PUIA 5H1YA 5BXQC 3ZD7A 2NOAA 1R5NA 4AKIA 3WP0A 3HU1A 3GLHB 3K09C 1IN8A 1XCMA 1G8YA 4GPTA 3AF0A 1Z47A 2VHCA 4Q48A 1NIJA 3W5JA 1KSHA 3LVRE 5JHGB 2WV9A 3PUYA 1Z6AA 5KNCA 1HEIA 2PT7A 4C0QC 2ZUBA 1US8A 4YMWA 3CKLA 4KBGA 3FOZA 2ANCA 1GAJA 2C9OA 1YVDA 2R6GA 1OFHA 1U81A 1DG3A 4Q1FA 2XXAA 1K6MA 4NZYA 2KI5A 3IDQA 4C0LA 4BLQA 1KY3A 4FMBB 2VP9A 4C4PA 3EX7C 3DKPA 3KX2A 1LTQA 5DIFA 1E2MA 1ZUIA 3SQXA 1HUQA 4QJ3A 3EZ7A 1QHHA 2QMEA 3MWLA 1XPOA 2CE7A 4LPSA 2FF7A 4PXAA 1VKJA 3B82A 3B1VA 4WIAA 4JLMA 1FTSA 1L4YA 2W58A 3R9XA 4BFTA 3CZPA 2AWOA 2G1JA 3ZJYA 5BW8A 3LX5A 5CITA 3U7GA 1NIPA 1Q21A 2GCOA 1Z2AA 2HT6A 2ZRKA 3IHLA 3QG1A 2HYDA 4LY6A 1MO5A 1G7TA 3IILA 3RRYA 821PA 2ZRLA 4QGFA 1W47A 2BM0A 4A36A 1G8FA 4BQSA 2IS2A 1ZU4A 1VG9B 1W46A 1JPJA 1QZXA 1KO4A 4ZI3A 4V0MA 2FPKA 1U8ZA 3SN6A 2BBOA 1MR3F 4D81A 3UG7A 4DLTA 1YZLA 3A4NA 2WJJA 1TEVA 1FX0A 3ADBA 2PJRA 3BS4A 1GDDA 1GFIA 1RRGA 5C18A 4XWAA 4DB2A 1T3LA 4A2WA 2JLZA 3HJNA 3AV0B 1SXJB 4BPBA 4DVGA 4AY2A 4M1TA 1M7GA 1S1CA 3DHWC 4AKHA 2NO7A 2VEDA 1X1RA 3BD9A 4KJZA 1E1QA 4MITA 1JXMA 2CHQA 5FTKA 2CK3D 1S9DA 4I1UA 2ZJZA 1GZSA 5FR2A 3E2IA 2Z4SA 1U90A 2J59A 2FZLA 3ONWA 5KSPA 5J5CA 1T9HA 4ESHA 1JQLB 3V9PA 2Z0MA 1XTIA 5HR5A 2ZI5A 4TQ9A 4AYWA 1U8YA 4Q66C 4ON9A 2NPIA 2C98A 3QBTA 3SS8A 1AKYA 1U94A 3RRMA 1JAHA 2XZLA 5JS7A 1UPTA 2QP9X 4LGMA 5G53C 1KI9A 1RRFA 2GEUA 2O0HA 4CF7A 2C95A 2OFXA 2FWRA 5B64A 3KKMA 2ZRNA 3Q8XB 2WWGA 1P3JA 1XX6A 2CLDX 1P9RA 5TVKA 3LW8A 2FNAA 4TYQA 4M1SA 3H1TA 1E2PA 3ZQ6A 2QBYA 2JDIA 2ZQ5A 5AUPB 3PUVA 1AK2A 3TUJC 1PJRA 1WF3A 4AG6A 1E2FA 3M6AA 4NTZA 4PC1A 4XVUA 1HV8A 1SVWA 1BMFA 5DYIA 4M8NE 5AJVB 3KQKA 1MRSA 3Q7QA 4NPHA 1S1MA 2BC9A 4P4UA 1ZNZA 1YR7A 5FPKA 3LXRA 2OG2A 4Q4HA 4ABYA 2IL1A 2BEKA 2P6UA 1KI4A 1MH1A 1OB5A 2V1UA 1FOEB 1A2KC 5A5GA 5TARA 5KYKA 5CYOA 2GAOA 1D2EA 3MWYW 4EPXA 2XTNA 3A1VA 2GBLC 4Q19A 1VCNA 4A0GA 1OE0A 1LS1A 2KSQA 2WM9B 4GL2A 2DBYA 2W6IA 4UJ5A 2BEJA 2O52A 2QNRA 4B73A 5HKKD 3ND8A 1OW3B 3QG5A 4B2IA 2JJ2A 3ZD6A 4CEHA 2XAUA 3T35A 2VP6A 4HB2A 3KJEA 1G8HA 1F48A 1YJ5A 5JWHA 3DL0A 4Q18A 2DCUA 2ATVA 5EP1A 1BH2A 3EA0A 3VR1A 4QL3A 3THWB 3LRPA 4M9XA 2PX0A 3EARA 1N5IA 4QXAA 5KSYA 1JQJC 3U3MA 1Q20A 1TU3A 4TYYA 4M4SA 1KI6B 1WE2A 4M2LA 2YHSA 1G3QA 1D2NA 1WMSA 3AVUA 1B23P 4LDJA 4XVRA 3A4LA 4LBWA 1W0JA 4FMDF 1Q22A 2IHBA 2CL0X 1Q1EA 1TF2A 1HH4A 1OF1A 3KB1A 1UADA 4LOAA 2XB2A 1U9IC 1Z07A 1Z29A 2XNDA 3M1IA 2ERXA 1ZVQA 4YMTA 4XSGA 1BO6A 3E70C 2YKGA 1KDRA 1OIWA 1C1YA 2WWIA 4M1YA 2PMDA 5G3YA 1Q12A 2PCLA 1RKBA 4QFMA 4AC9A 3FMPB 4GOXA 1KJYA 4W7SA 1JR3D 1N6OA 2PEYA 3BERA 3TAHA 1UKZA 4IRUB 3ETLA 2HJGA 4DB4A 4AK9A 1E2NA 3CRW1 2WHXA 4Q4AB 2YVUA 3IPYA 2FMXA 1EFRA 5DI3B 3ZQJA 1XMIA 2HDNB 2ZSBA 3T15A 2GILA 2V3CC 5JZVA 1SVSA 3V00A 4LPKA 2E87A 3W6NA 1Z0KA 5JRJA 1QG4A 1TL7C 2DFTA 4RD3A 1FW6A 3A6PC 4L15A 2IXFA 2QL6A 1E2KA 3TQCA 4LYAA 2D2FA 1IN4A 4RD2A 4RFSA 1IY0A 3OEEA 3U4QA 3NH9A 1VYTA 1XMJA 1G6OA 4WVFA 5E4FA 3TMKA 3N5CA 1AZSC 1OIVA 5LB4A 3L0PA 5FL7A 1DG1G 1E9DA 4NDZA 2IYUA 4OI2A 1CR2A 2WWFA 3QXHA 4FN5A 2QG6A 3B60A 1V5WA 1T0JB 4LZZA 3NBFA 3SI7A 3QVUA 5J4KA 3QF4A 1CRPA 4B43A 4Q4JA 1T8UA 4DDTA 4KSCA 1ZM2A 1FNNA 3OE7D 1KKLA 2MMCA 5FBQB 1KDOA 4ARZA 1F2TA 2FSGA 3LQRA 4B6EA 2ZIAA 2AWNA 2EFDB 4G3XA 3C5CA 2HCBA 1P2TA 2G83A 1UBCA 4NE2A 2QM7A 1ZINA 5C2JB 3HYRA 3EZ6A 1BIFA 2F3RA 3ND9A 2L0XA 3PUXA 3LY5A 1XB2A 1FUKA 3TK1A 2QORA 1RFLA 3QE0A 4TMVA 5KHOC 2J7KA 2RCNA 2ZRDA 4HATA 4N1AA 4OQNA 4WAUA 5EUQB 1HE1C 1KO7A 1F6BA 4C7OB 3HWSA 3K53A 1EXMA 1GP2A 4IOJA 3CWQA 4RZUA 3RS3A 1M74A 4PHHA 4B44A 3BE4A 5GADl 3ZS9A 1YRAA 4GDFA 3Q3JB 1BKDR 3TSZA 4QBHA 4RCZA 2IUTA 3R7WA 2QAGA 1OYWA 1QHGA 2J9RA 4JLOA 4NH0A 1KK0A 3AP1A 3WMFA 1MO6A 4KSBA 3A4MA 1E79D 1G7CA 3CH4B 4Q9IA 1FNMA 1F2UA 4XD7A 5AJXA 4KLZA 4BE7B 4G5SA 3GLGA 4DWJA 1P6XA 2VO1A 4PTLA 2EWWA 3X1YA 1ZRHA 2V6JA 5FI1B 4FMDB 1J8YF 1Z63A 5FBWB 2C99A 3BRWD 3H4MA 4G5QA 3SNHA 1UF9A 3QOFA 5CK5A 3BGWA 3GMTA 2JGNA 4QC2A 3RRNA 3SYKA 1LV7A 4MYUA 4DLSA 2NO9A 3RS2A 3RC8A 4R2IA 5FOTA 5E95A 1XD2B 3QXJA 1E4VA 5EE1A 1DAIA 1VECA 1YHNA 4PPNA 1XFAA 3MWJA 3LLUA 4JKIA 4LJ6A 2O0KA 1FUUA 3Q9LA 1Z0AA 2KBFA 4HUQB 4OHVA 5B30A 1KAGA 2AR7A 1CJUC 1ZMXA 3PEVA 2O8CA 1JEEA 1I4LD 1RYFA 4B33A 4HDQB 3O8RA 4URXR 2PZGA 1AJEA 2JIZA 2IYRA 3I32A 2HUPA 2JJ8A 3PQCA 1W36D 1E2IA 4MRRA 4ESVA 3AM1A 1S3SA 2HLDD 3IQXA 4G5GA 4LJ8A 2GHIA 3A8TA 4PSAA 1MABB 2QGNA 1KAOA 4RKEA 2ZI9A 4YC7A 4Z1MD 4GNKA 4NCHA 2ZITA 2OO7A 2F6RA 4BFSA 2QZ4A 4W5WA 4C0KA 4RZXA 2V55B 1XEXA 1ZIOA 1Z2CA 3CX6A 3UXMA 1I2MA 3ZZUA 3CX8A 2XZPA 3GLFE 1NN0A 3C15C 3D31A 3NEJA 2ODBA 3WNDA 2D06A 4BLRA 3KJGA 1W36C 1H8EA 3PEYA 1R7RA 3GP8A 4QG7A 3PEWA 4RY2A 3D8BA 5E7MA 2BHRA 3W6OA 3GLFB 3LD9A 3B6EA 4G01B 4BFVA 3GLIE 4CEIA 3CZQA 2REXB 1JJ7A 2WJYA 4TSFA 4TLDA 4A2PA 4WW0A 2ZYUX 2J41A 3K0CA 4MDEA 3C4JA 4JLKA 4EJSC 3N2IA 2ZTSA 2G9NA 3K9GA 4F7WA 3QF7A 1N0UA 4LI0A 4XVQA 3E1SA 2AK3A 4B3FX 4A8JA 1CJTC 2VPPA 5KTYA 1ZAKA 5FPHA 4F38A 3H86A 4ACBA 2P3SA 3AKCA 3DM5A 1R2QA 5IHPA 4NYIQ 2WSSA 1UJ2A 1E69A 1E2LA 1V43A 3QJYA 1QVRA 3SFVA 1CR1A 3GQBA 1C9KA 1G3IA 4GZLA 4KLNA 4W5JA 3VU9B 4B3XA 1ONBA 3SU8A 1OH6A 1NG9A 3S1AB 4Z54A 2Q9AA 2VBCA 3SJAA 4YONB 3GFTA 3RAPR 2VHQA 1WXQA 5FUYA 1X8KA 1CP2A 1X86B 4D6PA 2W2XA 2JLYA 2ODWA 5EP2A 3THYB 2AN9A 1DAGA 2RGNA 4DBLC 3U3OA 3VR6A 4XWOA 4O3MA 1DO2A 2ZRMA 1E9RA 2F9MA 1U99A 1CKEA 3MD0A 3ECCA 1CS4C 4JL8A 3P4YA 1MO3A 8OHMA 4W9MC 4BFXA 2IF2A 5AUQA 4A4DA 2ZYVX 2CNWD 3PUZA 4HAVA 2IYTA 2B8WA 2N1BA 3P1JA 2OXRA 2O8BA 1G4UR 4PX9A 1W4AA 3LNCA 1SVKA 4HAWA 1TPZA 4HB3A 3OIWA 1HURA 2WJHA 3F8TA 1CU1A 5L3SA 2O8EB 5C46F 3AF3A 1XZPA 3T12A 4ZDWA 2R44A 1JAIA 3DZDA 1XNJA 5FTMA 3W5IA 4XIGS 1NBMA 4MGZR 1S96A 4FCVA 2V1XA 3EWAA 4KAXA 2A78A 2UZIR 4B3BA 4X8LA 2OT3B 2AL7A 4POAA 4HZIA 1T3SA 5EQTA 3FHOA 4C0SA 2O8DA 1SULA 2Q3FA 1Z5ZA 4MRPA 3NKVA 1L4UA 4WBSA 3T1VA 4ILEA 2REBA 2ZE7A 4MRVA 1N0VC 4R2HA 1XJCA 2QA5A 1QHSA 4CT5A 2GK6A 2DWOA 4RKFA 4YMVA 3HPQA 1ZD9A 2R6CA 4PHTA 2C8VA 1OXXK 4IFBA 1KI3A 1EWQA 3T06B 4UQOA 4ZO4A 4LBZA 1UKYA 2AX4A 1W36B 2D7CA 2WKPA 2BCJQ 2FPMA 1RE0A 2QRNA 2ZRFA 5K8UA 3ZH9B 2JLVA 4TZ6A 1WDTA 2WOJA 4M9ZA 1ANKA 2VSFA 3EG5A 4BFWA 3VR2A 3NWJA 1YZKA 5EE5B 2YJTD 2I3BA 4MUAA 3W6PA 1A5TA 3DM9B 3EASA 4PO1A 4P0TA 1ZM9A 1CR4A 4JLAA 1E0JA 3CPJB 4OHWA 4EJSB 3F0TA 4ZV4A 2ZETA 4RCYA 4ZCMA 4PZLA 4NYIR 4P4SB 3ZZ0A 1GWNA 4DT1A 3IO5A 1JALA 3B1YA 3GD7A 3THXB 2CHGA 3ZVNA 1T8TA 4IOKA 3KTAA 1L8QA 3KJHA 121PA 4FD2A 4LHXA 2OM2A 2FE4A 2GVDC 5DE3A 5CLQA 2F43B 1E4YA 1XD8A 3CW2A 3UK6A 2WIBA 4HLUA 2C2HA 2ZRHA 3P26A 3QKRB 1IBRA 1T3HA 1XEFA 2W0MA 2VYFA 3PUWA 4HAXA 1ZM7A 1YR6A 2JAQA 2VQSA 5AUNB 2D74A 2ZR7A 1NLZA 3L8YA 4A82A 3WBKA 4LRWA 5C4MA 1KMQA 4TTPA 2B7CA 2C04A 4JKYA 521PA 2OXCA 4B2LA 1UEJA 1NSFA 1YRBA 4TLEA 1XBTA 2JLQA 4Z51A 5CK4A 4ZIRA 3CNOA 2PJZA 5JJIA 2O5VA 4OYHA 2J0VA 2JDID 4JLNA 4DDUA 2IF0A 4K8OA 2IX3A 1BMFD 2PZEA 2OSBA 1G41A 4OL0A 3BORA 2WJIA 4P33A 4K46A 3IBGA 5FTJA 1II8B 4Q7LA 1O87A 5J40A 1CTQA 2XSZD 1DADA 2YYZA 4DHEA 4OHYA 2QSZA 3M0EA 5IT5A 2XB4A 5FR1A 1GG2A 2FDCA 5EE9A 2WTUA 3NIBA 2YOGA 2EFEB 5CYPA 3U7HB 4M1WA 1FTNA 2F7SA 3VQTA 1G291 2JA1A 1P61B 4A92A 4Q7KA 1KSFX 3CBQA 3OAAA 1KK3A 4V0OA 1ZM3A 2Z6VA 1XDBA 3RDPA 3SBDA 2W6ID 2VHJA 5DO9A 2ATXA 1TAGA 2ZI4A 3CM0A 1BS1A 3K0EA 3NC0C 1U0HC 1MO4A 4LUCA 2JJ2D 4LV8B 4NCIA 2EWVA 3VR5A 5KO2A 2V4ZA 1NVWQ 1OB2A 1YE8A 2IBMA 1IN7A 1KHTA 3PJRA 4G0NA 2V8OA 2W83A 1SZPA 1D9XA 1DVRA 2CLCX 621PA 3QUSA 2ANBA 1HYQA 4EUNA 4PO8A 5BN5A 1E6CA 3AVTA 2WZQA 3A1WA 1CEEA 1IOZA 1G3RA 4PAMA 2QY9A 1DARA 5JSZA 4XTCS 4URZR 2I1QA 1W0JD 1FFHA 3IQWA 3Q5DA 3BH7A 4MYHA 2VH5R 5FUVA 2A3RA 3EIEA 4LCBA 4YLGA 3KQNA 2BIFA 1IXZA 2XNDD 3OEHD 3ZVLA 5IF9A 3BFVA 2H18A 2J1LA 4I99A 4URUR 2FG5A 1FP7A 2TMKA 1OKKA 4TMKA 4U5XA 3CNNA 3SJZA 5JWRA 1BYUA 3BFXA 1EFRD 3FE2A 1KMHB 1XEWX 1ZW6A 1G7SA 3AF1A 3M4YA 1B0UA 4O2RA 2WAYA 5J4LA 3GJ7A 5EXXA 2D7DA 3LV8A 3TUZC 4NBSA 4AG5A 4DIDA 1N6HA 3U5ZB 4Q01A 4HAYA 4DSTA 3ZYCA 2MSDB 2ZUCA 1IAQA 1YU9A 2N42A 4P3YA 3PEUA 1DS6A 4MQBA 3EPJA 4WZ6A 1NMXA 5LPNA 2HT1A 1GRRA 2BOVA 2CHVA 3OIUA 5CDFA 1M34E 3OEED 5TV2A 3CRVA 3KB2A 3QSYA 1G5RA 1KI1A 4PZZA 4IFEA 4N0DA 3CIOA 1IXRC 3C7KA 4B35A 1F3OA 3EPHA 1QHYA 2RKOA 3TAUA 5AJWA 2GDJA 1DEKA 4KVAA 2ZAMA 4OK3A 5AUOB 1KNXA 1W4CA 1UDXA 2FFQA 4YMUA 3G5UA 2ZR0A 3TR5A 2ONKA 5JLJA 3QNUA 1HA3A 3GLHA 3R8FA 3QEOA 2CE2X 4DLZA 2ZE5A 2CL7X 3B13B 4BZPA 5JCPA 3BB4A 1NRJB 4F4CA 2FH5B 2IWRA 1IN6A 2FEMA 1SVOA 4LX0A 4D26A 3P20A 4TTQA 3EZ2A 4B48A 4ERNA 1AM4D 5E7IA 1Z0FA 3ZIAA 5JHHB 3SEAA 1RJ9B 5FTNA 1LNZA 1XF9A 1ELOA 2P2LA 2P6NA 5E3HA 5FOXA 1YZTA 3TGPA 5GJBA 4JL6A 4OHXA 1W0KA 1R6BX 2FFHA 4PSKA 2C03A 1AZTA 2YWHA 1UBFA 2JLUA 5DYGA 4A15A 2CJWB 1D5CA 3DDCA 4S35A 1MT0A 2RGAA 3AVPA 4QGHA 4PHFA 4N0EA 5C4GB 3B5JA 2GEDA 2QP3A 1VCIA 3KQHA 2IXGA 3ZVMA 3DZ8A 5FOSA 2F1RA 2J7PD 4MRSA 4NCKA 2KWIA 1Z3IX 2QGZA 4L4UA 5DSZA 2IWHA 2IYYA 5B57C 3W8RA 2XGJA 2W2VA 4MA4A 4XD7D 4OI0A 5TDHA 5L3QB 4H1UA 4IJMA 2ZJYA 3AB3A 5FBRB 1E9SA 4A0RA 4FWTA 5J4HA 5DN6A 3U3KA 2JEOA 1DE0A 1Q0UA 5UKDA 5KSZA 1OFIA 2ECKA 1N5LA 1RZ3A 1VG0B 4GBMA 1P4SA 3UMFA 2FSFA 3CRRA 3KL4A 5F2EA 5JEEA 1WBBA 1SXJA 1ZYUA 1N25A 3WRXC 3CR8A 4XJXA 5KNBA 4LC1A 3EZFA 1HT2E 3U44B 2QRZA 1P75A 1XTQA 4FI3C 1ZCBA 5GVRA 2FX3A 4K81B 3KZ1E 2MMGA 1N0WA 2BCGY 4JVLA 2P0EA 1XCPA 4D0GA 1CRQA 2RHMA 4MYCA 2NPFA 2WWHA 3QPWA 1G21E 3NEYA 1GL9B 4RD4A 3NXSA 4C9BA 2X8AA 3VKWA 4JZKA 4Q9HA 1U8AA 2JIZD 4PSVA 2RGCA 4D2IA 5LD2C 1VIAA 1KK2A 1TQ4A 2XTMA 3QVVA 3SOPA 1JB1A 2ZJ5A 4DRZA 3EPKA 2KBEA 3FWYA 2QMUA 4AYXA 1AGPA 1Z6TA 2AD1A 3I5YA 1OT3A 1R0YA 5LDDC 3X1XA 2A2ZA 1TUEA 3HU2A 4TYPA 2HJVA 3VHXA 1UKEA 1FP6A 4JVNA 4MKGA 2JLXA 3GFOA 4YXWA 2AXNA 1GNQA 2ASEA 3GEEA 1ZNXA 5DLQC 1P62B 3CNLA 3TRFA 3VAAA 4QM7A 3VX3A 2HCJB 2VHUA 4LHYA 3SDZA 4ZDIA 1WP9A 4PPFA 4BASA 2CBZA 3QIAA 1IHUA 2R2AA 2PMKA 2FSHA 1E2QA 1H8ED 1IY1A 2ZJ2A 4KHZA 3K09A 1ZBDA 5FUXA 3LAWA 1Q3HA 2P5TB 5K8TA 2DHRA 4DLWA 4B2PA 1P9WA 2OE2A 1XTRA 2V6IA 4KFRA 3GPLA 1UDWA 1J90A 4TSFD 4Q9JA 2GJAA 2D4HA 4RD0A 3D3QA 1IJFA 1NY6A 5L8VA 1AQUA 4Q21A 2WWXA 1IQPA 1KK1A 3AUXA 4NL4H 1QHNA 4EPWA 2QN6A 1YR9A 4QBIA 2GK7A 2ZJ8A 4L9SA 1SVIA 3U2QA 2DWQA 1U2RA 4O25A 5D3MB 4MKIA 2W00A 3SHFA 2FPLA 1CULC 2GTPA 4BFYA 1E9EA 1U0JA 1U0LA 2ORIA 4GT1A 1QDEA 4E07A 1NLFA 4IVRA 1G8PA 4I81A 1W1WA 4YDSA 1ZNWA 2H92A 1F2TB 2BM1A 2BJVA 2LWIA 2R6AA 4V02A 4GMXA 3A1TA 2XJ4A 2GESA 4WXPA 5IK2A 2NZJA 4ZDKA 3VNUA 4PO9A 4HLDA 2WPDD 3UG6A 2ZYWX 3THWA 3PVSA 4M0LA 2JATA 4IDNA 1II9A 5JFGA 4DC9A 2ZRCA 4TTRA 5HCIA 3NDBB 1YKSA 2CCGA 4EQ6A 5KDOA 2OCAA 4XH9B 1VG1A 1KI6A 1D2MA 1P73A 3D7MA 2A30A 1PLJA 4A0HA 3X2SA 1VHTA 1K8RA 4AYTA 3IKJA 4Q9LA 2J0UB 4EPYA 3EPLA 1SKQA 1GL6A 1I4DD 1M2OB 3CF2A 2EFCB 3L43A 2IA5A 1QHXA 4ZPXA 4DEYA 2X77A 2C9CA 3BC1A 5J47A 221PA 4DLYA 2YINC 2ZUDA 5D3QA 3ZLJA 1G5TA 2EFHB 5BYJA 2PL3A 1H65A 2XNSA 3SHWA 5FL3A 3BIFA 3OF5A 1OFUX 4Q4AA 5DI3A 1R0WA 2R6DA 1P7CA 4PC3A 1A1VA 2KB0A 2CCJA 2OFOA 1NBMD 2ZI7A 2QE7A 1NKTA 4LBYA 1XMSA 2G0TA 2AHOA 3G0HA 2ZS7A 3K8YA 3W3ZB 3H0KA 4F91B 4LSGA 5FBLB 2AKAB 4RZ3A 3HP1A 3ADKA 1GVNB 3GJ6A 4EFMA 5HZKA 3LBHA 1ZM4A 4GP7A 3B1ZA 3IO3A 1CXZA 2OCBA 2CVHA 2FGJA
chains in the Genus database with same CATH superfamily
2XB9A 3MCAA 1SUIA 3QTTA 4WTOA 3SEFA 3LWDA 3BD8A 1IZ0A 4ZVPA 2ZANA 1DINA 3BRQA 5KOYA 1BS9A 2WDPA 3EXFA 1VLVA 3B9RA 4W5RA 3DAPA 3EOAI 2BFDA 4CLXA 4QARA 4BO2A 4DA8A 3EF3A 2ZTHA 1M73E 4Q0MA 4EQZA 2F8LA 3OZTA 1HLFA 4JJZA 1B0AA 3ZDEA 3PQ3A 1VJRA 1V4NA 2IDMA 4V24A 4GKKB 3BK2A 3SQWA 4LCJA 2ZTVA 4GHWA 1NM5C 4L8YA 3D2BA 4BQOA 1AKQA 1QIKA 4REQA 4WPGA 3HL0A 4KDFA 3O7WA 3HVHA 5FO1A 1JSZA 5TMBA 1JG6A 1AKEA 2I78A 1U0RA 1JHYA 1DDGA 3BGSA 4YMLA 5DRTA 4RD1A 4IJKA 4B4UA 2BGKA 2D5CA 2C3YA 2ZSFA 3EE6A 3FZYA 1WQ1R 2IPMA 2D62A 3GGJA 3C87A 1DXOA 3H17A 2R6ZA 2PX3A 5CDSA 1SEVA 4HVCA 4K0KB 4KPYA 1LKZA 4NECA 4EUSA 1A9RA 1GSHA 1GXSA 1N6IA 4B3CA 1Y9AA 3JQGA 4OJKA 1P6UA 4BZQA 4Z4HA 1QIHA 2POQX 1FDSA 2AXEA 2YQ5A 4JVMA 4FSHA 3AVQA 4JV5B 2FYTA 4OGGA 2BBWA 3GDHA 4D92A 2RH5A 2RDMA 1PF7E 2D3TA 3H1EA 4YRDA 3H11B 1LWOA 1LSOA 2XYPA 4PYKA 2V45A 2YNMA 1VBMA 4HGPA 3L0OA 2O1XA 1V41E 1V45E 2O0MA 1JFSA 1WUJS 2EX4A 4W1QA 1I2CA 1YB5A 5JAPA 1QU2A 3SOZA 4ENSA 1Q1NA 1QZTA 2YS7A 3TRHA 5ER6A 4ZHSA 2ZXUA 4E22A 3KV3O 1A4UA 3ZHUA 2QXTA 2QUZA 3ZHOA 4AP5A 4DNXA 4QYIA 2CFRA 1KAHA 3VGJA 3T3GA 5BSGA 2VN8A 5JS1A 1OX5A 1U2GA 2ZYHA 4DLPA 5LWHA 2O2ZA 2CBXA 1CRWG 4EFNA 2Q5OA 2C2MA 4PAQA 4EFLA 5K0BA 3WWCA 3WLOA 1XHEA 3O8QA 4IVQA 5CRIA 1NE7A 3ED1A 3FY4A 4KVGA 2BSXA 3BH6A 3K70C 1NQOA 1Z4LA 2EKZA 3QKSB 3LY7A 4UNSA 1DWPA 3DDSA 3R0VA 1WPQA 3JU3A 1J06A 3DWIA 4INZA 2XE4A 1WETA 3BSFA 1OGIA 1PJ4A 1BW9A 2IYPA 2VZ9A 1P5FA 2RGRA 1K0FA 1PYGA 1Y1RA 2R86A 3JQPA 2IODA 2RJ3A 3KQQA 2FSVC 1N5JA 3CB2A 3FPKA 3R40A 1V8ZA 3LHFA 4Y9RA 4Z3KA 2ACVA 3GT7A 4MMYB 4EAQA 1BU8A 1EM6A 1X39A 3TE6A 3EDMA 2Q1SA 2FXVA 2D4AA 3DW1X 2G09A 1WU8A 2G5CA 3C8HA 1JNXX 3EVTA 3IHTA 4X7MA 3ICPA 1E9AA 4JJGA 3U16A 2QVCA 3KSZO 4R9VA 5A3RA 1I30A 1AHIA 2OQIA 1NZFA 2HA4A 2EP7A 2J9FA 2WP0A 4NZ9A 4Z9BA 5F1KA 1ABFA 1COWD 1L5HA 2HF8A 1PFVA 3T7EA 3ERCA 1VL5A 3HR7A 2G5GX 4IHJA 1V35A 2ZDQA 2XYQA 3MTGA 3RSLA 4RPHA 3W5DA 4O5OA 2QMOA 4YUZA 1JHRA 1N2JA 3VNAA 5KQMA 3ZS8A 1KVUA 2G9UA 2IS1A 3D7LA 3OU2A 4A5SA 5CAEB 1H42A 1OWNA 1Y6GA 4KHPB 2KHZA 3NJRA 4YO8A 1Y7LA 4IX1A 5KVCA 4I6JA 4WXEA 4BKOA 4NNOA 2D8MA 1GG8A 5E6UB 3SM3A 1SNYA 2ODPA 3C3EA 5HUJA 2R65A 2IS4A 2EGUA 3EVFA 3OUZA 4YRFA 3IDAA 4BLPA 3FROA 1XAHA 3OUUA 3EGDA 4FNAA 3WK7A 4ALMA 3GLFA 1H2XA 4BLUA 3E23A 2CYBA 2OVBA 3QENA 2QE6A 2H8KA 4Y2UA 4A0SA 3T4EA 1N6KA 1D6NA 1G63A 1ORWA 1S4QA 4HMOA 4J1SA 1WB9A 4PGHA 1R6TA 1ZC3A 1FSPA 1FSFA 5CD1A 3PYXA 2RGXA 1ML4A 1NWCA 1XZNA 1Z0IA 2YWCA 4H16A 5AM0A 5BUQA 4DREA 4X3CA 4MPRA 2B6HA 5EIWA 4D44A 2RONA 1DOZA 1NI5A 2OD7A 3LUHA 4HWSA 3STTA 3D1VA 1V2GA 3ZE2B 3TW6A 1TGVA 4Q05A 1O2DA 1L7OA 4RTRA 1I2AA 3AWDA 4IICA 1EDEA 4WKBA 3TJMA 4BP9A 3WK8A 3ITDA 4OLBA 1L7MA 5AW6A 2YWGA 3GC6A 1VCOA 3C8MA 4BMZA 1ITZA 5JNTA 2HD4A 2OZVA 1UOEA 2LKCA 2MSKA 2DZDA 3FFXA 3H5WA 1GJRA 4MVWA 4J1NA 4ETWA 1LJLA 3V1LA 2YFHA 2CC2A 1OX4A 3R7SA 5G1OA 1EG7A 3LDAA 4LZLA 4II7A 4QJ4A 2J5RA 2O14A 4ZOCA 2G8LA 4XYLA 4CETA 4MKFA 1GQYA 3EXHB 4R7ZA 2XGOA 4E51A 3KKOA 3E3NA 3H0CA 1QVWA 4IDOA 4I46A 4DJEC 5IS2A 4D25A 3A6FA 1KYXA 3R7LA 2N9UA 1VQ1A 2VF7A 3HSYA 1GSIA 2F1IA 1CERA 5DHRA 4LJ9A 2Y1CA 3CE9A 1GQQA 2WQZA 3CJRA 3DO8A 4FDUA 4R1UA 4NARA 5EHNA 3SP1A 5AVUA 2AOUB 2Q45A 4TZTA 1I7NA 1USIA 2YXEA 1L5QA 3AMVA 3HMKA 1DX6A 1EVQA 2C2ZA 4E88A 4RENA 1YUBA 2J08A 3E61A 2V6MA 3UENA 4EEZA 1H3NA 2OGZA 3DFUA 1K4KA 3BBPA 1H6DA 1KC3A 2W6ZA 2XA9A 5EQFA 1G64A 1NJ8A 1H8HA 1Q17A 4L0QA 3UWDA 4CHTA 2OCYC 1IBMB 1U8EA 3DMGA 4EHNA 1LSJA 3NT4A 4FFBB 5BQPA 3RB8A 3RTAA 2IP2A 4AZ3B 4F4IA 1BWSA 1QF9A 4U63A 1XHLA 1GGEA 3R5JA 4Z2AA 3RFXA 4NMHA 4RTQA 4XDGA 3LX8A 4NYMQ 1E89A 1KO5A 4OJNA 4JBYA 4UVHA 3LL7A 3K4PA 1NPYA 1V8FA 5IMSA 4I5FA 4X97A 3L0YA 2OCPA 1XL1A 1HSZA 3SC4A 4EPRA 1YZQA 5TRTA 4HYQA 5LP6F 4CRWB 1K6JA 1UBJS 3A32A 3PFIA 4TS4A 2I55A 2BFAA 2Q6TA 5BN1A 1ZP6A 4XJTA 5BN4A 1OFTA 5LQJA 4YRGA 2O0LA 1KEKA 5EGSA 3I5XA 2DEUA 4NJMA 3LO5A 4EF5A 3ENQA 1DP4A 4YT2A 4ERXA 3AZPA 2GK3A 1NP6A 1OV6A 3AJEA 4WA8A 2JD0A 1C3EA 1TA4A 3FYTA 3QBVA 1L4LA 4WLVA 3DOUA 3JQ6A 1Z4MA 4NJOA 3PE6A 3FNIA 1H94A 3FTQA 2Q8NA 2HXSA 4MEJA 5H59A 2XVMA 3V4RA 3DLPX 3ZJ5A 2Z09A 1OLUA 2FLWA 4HC4A 4WNAB 4WK6A 1K3FA 2AN1A 4MQ6A 2HRCA 4DNQA 5KWVA 5KPDA 1I10A 1QK3A 1KOGA 1W94A 5IVDA 1VHWA 1OYOA 2PY6A 5DM2A 1BEEA 2JH9A 1V16B 2R62A 1TUGA 4PC2A 3TW8B 2WHYA 1S02A 3IBFA 4LRXA 2KW5A 1PU2A 1QP8A 2C96A 4NYJQ 1Z15A 5ALWA 4US2R 3DT6A 3MJTA 3UKDA 4INJA 4BNDA 3P94A 3STYA 5K6AA 1V7ZA 2QU8A 4JXKA 4MDYA 4DV6B 2CUNA 3HB1A 3BMOA 4LG1A 4P84A 1J6UA 4BWYA 4YX9A 4QG3A 3BE5A 2PN1A 3LX4A 1GM5A 4FFRA 3VX4A 1FS6A 3IBYA 5GJVC 2Q62A 3L0ZA 2N75A 3THXA 4W5OA 3BXPA 3L07A 3OMXA 4JASB 4DKXA 2OCDA 4QULA 1ID1A 4WY5A 4KU4A 4LJYA 1RMQA 3AUJB 1E9CA 4Q1DA 3V8MA 5AJZA 4DSUA 5DSXA 3A6EA 3N8NA 3UWMA 3PC3A 1F9AA 1XCLA 4R3UC 3VFDA 1G6KA 1IJEA 2O1SA 4OSOA 1WJGA 3B9QA 3UCEA 2JA2A 1YR8A 3K4HA 3IA7A 3MXOA 3IR6A 4RH1A 1M1YE 4BFUA 5E1OA 4G0VA 1V6AA 1RBQA 1U7PA 4ZAYA 5FAKA 4KQFA 4D45A 1ZJWA 4IHQA 1SXJC 1U7DA 1BDBA 1V0JA 3ELDA 5IM4F 4EVRA 4RSGA 5IWAB 1LC0A 3L6BA 3WSTA 3TD9A 1ZRNA 1FXUA 4H4EA 4R5MA 3OT4A 5EJAA 4CKCA 4U3JB 1Q84A 4JC0A 4MNTA 3V3TA 5A0FA 4YXWD 3M49A 4B4KA 4D02A 1JKJA 4RMNA 3K6JA 3TS1A 3K31A 3DQZA 3VOTA 3UMYA 1TTTA 5JWOA 1NPDA 4BTEA 4U2FA 1CYDA 3MQ4A 4KWCA 2WR8A 2AE2A 2NZXA 2Z4TA 5GP1A 3TR6A 1RZUA 3UAYA 4BMSA 1QHHB 4HQFA 4HXGA 3FDIA 5JCZA 1ZFNA 2OD9A 4AJ4A 1K2WA 3MT9A 4WI1A 1JXQA 4V0ME 1YTLA 5MFPA 3LE8A 4HFNA 3PGKA 3EZXA 5TF4A 2MYNA 2BD0A 1BYIA 4P81A 3RFFA 3S3TA 4BVFA 1JJVA 1I2DA 1O3YA 2XVZA 3U3XA 3BEDA 2Q2VA 4DIKA 1MUUA 4EVSA 1ZJ4A 4HEJA 3ICWA 1RPNA 1EDZA 1EIWA 3AJAA 4JEIA 5GPBA 5LP6B 3GA0A 1MEJA 2D2EA 4FDMA 4BGEA 4Z7QB 5CW1A 3ETHA 3RBVA 3E9YA 3MFYA 5FWYB 3KQVA 3QK7A 1RADA 4HTFB 2J5KA 4O08A 2G3YA 4Y30A 4OJQA 1FJGB 4G23A 2HU8A 3OZIA 3NHAA 3PGA1 3EGEA 3R9KA 5BSFA 4QVKA 1PK7A 1J25A 2DR0A 2PKEA 1TXGA 4HWPA 1K6IA 4LHZA 2ALJA 2FFAA 4EKDA 5EPOA 4NU5A 4EWLA 5HE8A 1R18A 2GI4A 3E3OA 1U5BA 1OLXA 2JLBA 2QSUA 2YXBA 2C00A 2H4WA 2P5SA 3G79A 3OLVA 5TQVA 4OA8A 1X3LA 1UEIA 3ENKA 3PFWO 4P7BA 4CZ2A 4EF4A 1EHYA 3UANA 4JA2A 2EZ4A 3ET5A 4PC7A 1A7JA 2XADA 1EGMB 1VBKA 5BUSA 2NQ2C 4I14A 2DXIA 1TIKA 4HI0E 1XU7A 4GIBA 3WL4A 4B76A 4EVIA 5IJ9A 2GCNA 1FF9A 1J8MF 5J43A 4Z49A 4OMCA 4QPZA 2W0SA 3RVBA 5FL7D 5U1PA 2VT6A 2IW1A 5CA1F 3VISA 3ROMA 1R9NA 4C5BA 2HWXA 4C7XA 4BQFA 1Y82A 1E9BA 3CCFA 4IZHA 4MQ4A 2FKAA 3RV3A 2PSHA 2RI0A 3T1TA 4WKPA 1DRVA 1QS0B 2FQYA 2WWTA 3SLKA 4I55F 3IRVA 2P9HA 4KX3A 3HA7A 1AS3A 1BDMA 2A5GA 4IXNA 4FIDA 3DG9A 5KWJA 3RNLA 4OI4A 3AYZB 4YY3B 3RVKA 4BB0A 4C22A 3OJFA 3IUJA 3HO8A 2WUGA 4HMQA 4JLDA 4CUJA 2IV7A 1EJ2A 3K1ZA 2GJKA 2YWFA 1KEEB 1V5IA 3O4HA 2C54A 5FBKA 4KXLA 5JLAA 3QOWA 4HSGA 1NMYA 1NJFA 3OFJA 1QIFA 5SYMA 3S2GA 3K9HA 4ZAVA 1RACA 5T4BA 2B6NA 2QF7A 3GN1A 3SG0A 3SR0A 5ETJA 1CBUA 2F48A 3PR1A 4OK5A 4TRJA 1LSUA 1XMQB 2O19A 2CXHA 4BO1A 1N6LA 3EEIA 3K1YA 1WSDA 4UXHA 5I7HA 3S2YA 4JP5A 2DH5A 4QDUA 1RS0A 4LSMA 3K9LA 1AT1A 2I6XA 2Q4TA 3PFNA 3R3ZA 3ROFA 2X5OA 4DPMA 4BGDA 2WQ7A 4JB8A 4L4YA 4TMWA 4XM0A 4WK4B 4BQIA 1HTWA 1HQCA 2ZUVA 3RTEA 3UWPA 3RVDA 4AI6A 1VTKA 2WIAA 4Z2YA 1KH2A 1YRHA 3PTZA 5L4SA 5SZJA 1WCYA 3IT1A 2Z2JA 2DVMA 2GA8A 2F55A 2DBVO 3EUFA 3LC7O 4NBNA 1BMTA 3UXHA 2PH7A 1YBAA 4V0NA 4X8HA 2ECFA 3ZKWB 1FTWA 4BGIA 3DNPA 1JTFA 4YS6A 1ZOPA 4UM9D 1WRBA 2XIQA 1KY4A 2CMHA 3EEBA 1XCGB 3L8FA 2CVQA 1Z62A 3FBGA 4GBGA 4YNBA 1WW3A 4ENUA 1J70A 2PBFA 2WE8A 3LPMA 2WHPB 3JY6A 3I2FA 4J1TA 3KR0A 5H3LA 1YZUA 1MX5A 1L7EA 1P2UA 2HF9A 4HH4A 2C2XA 3RSQA 5HEKA 1E9FA 1KMIY 1LQUA 3QY9A 2VOJA 3EIQA 3LSYA 3LWNA 4GKVA 3OJOA 4FLEA 4IV5A 2Q1UA 3WLKX 4L5IA 2ZR8A 4B2YA 3ZU5A 2JCXA 2EHDA 3KQSA 4XWGA 2WYIA 3L8HA 4BIIA 4MR8A 1EE2A 3ST7A 2Z3ZA 3IMKA 1HBJA 1X9HA 3DL7A 3HPRA 4UU1A 4YALA 3RG2A 2ZT8A 3RRZA 1YFLA 1TQ2A 3NCTA 5F9HA 2H3EA 1AO3A 2YJ4A 5JZBA 1VFNA 2V59A 4BAUA 1L8XA 2C3PA 1A82A 1YB6A 3K94A 4MYTA 3I37X 5JANA 1D1SA 4QUHA 4TSKA 1MCZA 2GO1A 3W8EA 1RKUA 3OOHA 3G7UA 2WZBA 4OQFA 4XSHA 2IU4A 4WLOA 5ECGC 2GF9A 4Q6BA 2XNJA 2EJWA 3DAOA 2D2XA 3KFXA 3V7YA 1AQ6A 4QGBA 1MDBA 4R71A 1T5LA 2DFDA 2ZULA 5CA1B 2GRAA 4U6NA 4G5XA 2CW5A 2XTZA 4MI3A 3G6KA 1JU9A 1G0OA 2YWJA 3A6JA 1Z28A 2VJMB 1NY5A 1SA0B 5K4GA 1DBSA 1QBGA 4KUHA 2JZOA 4M54A 4KXFB 5KYUA 1QX4A 1JUDA 3JTMA 1CEXA 4GE0A 4QNMA 1EXNA 1Y4DE 2J67A 3QELB 1SD5A 4I55B 4AMYA 4C7BA 1W4BA 2ZOSA 1XTVA 3HYNA 4WMLA 3MJDA 4GRAA 3ZWWA 2FKNA 1VL0A 4R8LA 3AB8A 4RFSB 1JIKA 1UKVY 2YNMC 3W9YA 3N2EA 4DG5A 1DJMA 4TLMB 1AF4A 4GX2A 3MCVA 5EIBD 3JZIA 2RHLA 4LRYA 3RYTC 1F5SA 3E7FA 3LUDA 1EP9A 1OUMA 1G7RA 3ZU6A 1TUBA 4ENVA 1CUIA 3PNMA 3LP5A 1REQB 4RDHA 5EYPB 2VF8A 1PGNA 3ZIDA 4R1PA 3OZXA 5AKJA 1QOQB 1PV4A 4DMLA 4JI7B 1UMCA 4YASA 2E5LB 1DBPA 3L84A 3NPMA 1PAUA 4F8YA 1D07A 2FQ1A 4IW3B 3AW8A 4B6RA 4F8JA 4LF4B 1XP8A 2DT8A 4LJ5A 5JAUA 1YBMA 3KCNA 2WY2D 4ENQA 1E4EA 2RHRA 3LM8A 3MOIA 1BSVA 1T0HB 1QYDA 3DBHB 2NVOA 6YASA 4FHZA 1AKTA 3EJ6A 4OREX 2VP0A 1G21A 3RNOA 2Z83A 3GAAA 4NX2A 1CJMA 3K0CC 4GGMX 3UBTA 1JZSA 1QUFA 3AJ9A 2F3PA 1UKCA 3HQ4O 4Y2YA 2VDUE 3M6LA 5ALLA 3V8EA 1GRNA 3NDPA 4ZVQA 2R4TA 3K1TA 1IY8A 5P8WA 5K2OA 4DJAA 4WWHA 3QUBA 2F1HA 5JAOA 2X2FA 1L7NA 2AOVA 2NXWA 5DHTA 1ISPA 1I8TA 1XRSB 5K3CA 5K3OA 2H7CA 4MEAA 4FZVA 3KE9A 4A8JC 3H8JA 5LN1A 4HVLA 1Y7HA 4IDQA 3VR6D 1CZLA 4TMTA 4J94A 1NXTA 3DKRA 1B76A 4PAOA 3F7NA 2E1RA 1YZNA 1G4AE 1Q6YA 4U8HA 1HNWB 2QL9A 4DCUA 1Z5WA 2YZMA 4N76A 1MV8A 5TC4A 2XUZA 5JE8A 1GCAA 1BVUA 2ZDGA 3R9WA 2HJSA 2O06A 1HGXA 2OSVA 2ZATA 4JEMA 3P9CA 1NQVA 1H9AA 1PLKA 2VDOB 5K20A 3JQAD 3BAZA 2H06A 1EDOA 4L85A 1JSXA 3A58B 3T7RA 4TTTS 2DR2A 1Y3AA 2QD3A 4C0WA 2IEZA 1X87A 4E3ZA 1Y81A 3OCWA 3W06A 3ZGZA 5EHXA 2RGNC 1LX6A 2BE7A 2QTNA 1I3NA 1MO2A 1TMKA 2F62A 1LLQA 4CR8A 4JXXA 4IG9A 2CB9A 2QLFA 1WZIA 2ZSEA 3HCAA 4U5QA 4O1MA 3INNA 3PBKA 2OWDA 4FPXA 5G0VA 4NP6A 3V4LA 2WMDA 3D2AA 4J7XA 3EWSA 1D1PA 2BWJA 2OFPA 3HO1A 2XQFA 5AJYA 2PEZA 2H1RA 2X5JO 4HCJA 2CXNA 4RKYA 4Y1GA 4F2HA 1V9LA 2WWVD 4OBEA 3I1FA 5BR7A 1CFJA 5C8DA 3RAFC 3IXLA 2BJHA 1E7WA 4IDHA 4X71A 1MHTA 1LRKA 2QQGA 1WSAA 9ABPA 4YCLA 3HVUA 3ZV4A 4C07A 5HJ5A 2MINB 5KYNA 2R8XA 2O8CB 3MWGA 3URMA 3CWCA 3FTNA 1YU6A 2QX6A 1EQUA 1PWEA 1ZU5A 3D7NA 4RMJA 4XYGA 4Y9TA 2C5GA 2NT4A 2WVJA 2R96A 2Y1XA 4DEXA 4FX2A 1CWUA 4YJ3F 1OTHA 1EZ1A 1Q11A 2QX9A 1OH7A 4MQFA 3IAFA 4ITRC 3B9BA 3Q2KA 3TLGA 4EUHA 4KJXA 5K3FA 1M2OA 4B80A 5AQ1A 4FVTA 1QWSA 1YH3A 1W19A 5JECA 3TKAA 3ELYA 1DPGA 1DGQA 1JS1X 3PQ8A 2G36A 2XT6A 3LW7A 4PLCA 1ZRSA 2H85A 1ABEA 3C16C 3GVHA 4ZCSA 4M7RA 2WAMA 2P9FA 1N2OA 1P2SA 2YVKA 4CV0A 1U0GA 5JNSA 1CUDA 3IKTA 4DV4B 4J2TA 1J4AA 4E4TA 1R0SA 3FDXA 4ODIA 4ND5A 5EXEA 2AIRA 2IZ1A 3RC3A 5K8CA 4FZJA 2QX8A 5CPFA 2FK8A 3IDSA 2Q7XA 2YY6A 3GRPA 3PR2B 3L4EA 3CF4G 4PFJA 2QUHA 3ZV5A 1H2EA 1SUWA 3JYQA 3QY0A 3OQNA 4C01A 5ADUS 3CVXA 3E4DA 4BNMA 2R4UA 4QOHA 3AR8A 3GNSA 4MHSA 4Q9DA 4CEIB 3AHJA 4WZAB 3VUFA 3ZW8A 2V7UA 1I4TD 1QK4A 2C9MA 1S8NA 2W5UA 3MUEA 1JN0A 3R20A 4IH4A 4XYBA 2R5FA 2XTJA 2ZIZA 3DMNA 4M9RA 4CKZA 1NDQA 1CS0B 3I39X 2H4HA 4C2UA 3T7TA 2P5YA 1R4AA 4OU4A 3ZDQA 5LQUA 4N5HX 1LQ2A 2CL6X 3ED5A 4DCPA 1UK7A 2O1WA 3GPCA 4D8UA 3IKLA 1QANA 3TUIC 2WJ3A 2ZBQA 3FUCA 3PFGA 5LB2A 2D3WA 4A8TA 4TLLB 4U2CA 5FQOA 2G6BA 5TJ9A 2SCUB 3BYZA 1YKGA 4L16A 1Z8HA 4Z4EA 2A5DA 1QHFA 2JJ1D 1LPSA 5IJXA 1BRTA 3ZE6A 2J46A 4ZT3A 4D82A 2YBDA 1PG2A 4HDRA 1ZN8A 3TLAA 3ZWDA 4PEVA 2EBFX 5U4XA 1GEGA 1QQ7A 4WINA 2OO5A 3QSGA 2Q7OE 3ZWQA 3JYPA 1J2JA 2DPXA 2YOFA 3GEIA 1J42A 4FLFA 4PICA 4NMWA 4M8SA 4HWOA 3FJOA 3DPUA 2NO5A 3AH8A 3BJMA 3E8SA 3EH2A 3OWXA 3MJRA 2PUCA 4QPPA 1P0IA 3K8ZA 4MRAA 2PKXA 5KOHA 2XWSA 4DUZB 3EAFA 1D6JA 4D4MA 2QTRA 3GCZA 1O97C 4D0LB 4IVPA 2QTFA 2PX4A 1N3IA 5ARCA 1F1BA 2YH2A 4NNPA 3ICCA 4ZZ3A 4UD2A 2ODNA 1EP3B 5FI0B 1RRVA 3QVXA 4FWIB 3D3EA 4U2GA 1VSQA 2HUNA 4YMIA 2Z43A 4OJMX 3DYBA 4X93A 3UMCA 1H2YA 10MHA 1PI3A 3VR0A 1U2DC 5JJ5A 1FS4A 3UPDA 3IP7A 3K15A 1NT2A 2X14A 3RVPA 1AO0A 4NCNA 3CZ9A 4X9XA 3ZDBA 1GTL1 1TMOA 4BEVA 2BW0A 2A57A 2EGGA 5E9AA 3LT1A 3D6TB 2QTLA 1LJUA 2JGAA 1F2VA 1W59A 2QRVB 3A3NA 2WTMA 1WBJB 3CH5A 3VR5D 4TYNA 3O8DA 2UXBB 2B0CA 3OG9A 3RARA 1NA5A 3WLIA 2EXXA 3RM3A 1N4AA 5DM1A 3E1KA 3IUPA 1TM1E 3R5HA 2NVUB 4CIDA 4DLRA 1E20A 1SQ0A 2GNAA 2VS1A 2ZK7A 3HUFA 4E5SA 4YJ3B 3RYCB 4O0LA 3DV0A 1RYHA 1W5FA 3MUFA 1H4TA 3IPRA 1Z83A 5A3QA 4YP1A 5IJZA 5C81A 2EAUA 5SICE 5FORA 4C29A 1AKUA 2QT1A 3JQ9C 4XX0A 1O9BA 3KZXA 3NCHA 3M8KA 4D3FA 3N59A 1Q3TA 3BG5A 4WFJA 4JBNA 3G8AA 3L92A 3U4CA 1J8VA 2Z2KA 3L7YA 4NV1A 1A9TA 1XD9A 3HFGA 3JYHA 4TKLA 2MCFA 2OBMA 3DVLA 2Q3BA 3TQFA 2P9EA 2IXAA 3VOBA 3WLLA 1TQ8A 4B85A 4U0KA 5BWBA 3W34A 3ZZ1A 2H2FA 2Q4OA 2WMOB 2X6QA 3WLTA 1PNVA 1XZDA 2XXBA 1Y3IA 2I1WA 3OHMA 1ZD1A 3G5LA 1SCUA 4QGGA 5E2AA 2I4OA 2Z9DA 2VXCA 2CLLB 2W90A 3ON5A 1SMKA 4HG2A 5BW5A 2FN7A 1R10A 4KUGA 4P3KA 3AP3A 5IT4A 1O95C 1P1IA 2MR6A 3KUCA 2OD2A 1G17A 2MR5A 4H7IA 3IMEA 4DCGA 2Q3CA 3O74A 2VL7A 2VK8A 2J9ZB 1KR2A 3L18A 4O6VA 4R5HA 1P60A 5D85A 4DS3A 5HKBA 2I6FA 3A6GA 5HZHA 4TKVA 5HTOA 2WNIA 4F6CA 2D54A 1VP3A 3NYRA 4AG3A 2DPLA 4OXIA 4JI6B 1GNTA 3BHIA 1FZQA 5B6JA 2PGOA 2IV2X 3J7AC 3BKWA 2A7QA 2F3TA 4Z4GA 2LCQA 1J9ZA 2XD4A 5IWCA 2JCSA 1YA4A 1W76A 2R97A 2H63A 3VPHA 1FSSA 2V5AA 1UXKA 2E9SA 3BCHA 3CF0A 5CBPA 1P5HA 3IBSA 3DHYA 2ZR9A 3S28A 4FR2A 5IJ0B 3L7MA 4OHMA 1CB0A 3WKBA 4QQNA 3RVRA 5KWIA 1K88A 4BMOB 4F2DA 2DFKB 2H17A 2P3QA 3EBOA 4HGZA 3MJHA 2PMBA 3GJXC 4CF5A 5B4UA 1ZK3A 2VG8A 3HR8A 1DQZA 4P83A 3SAJA 4EABA 1KU0A 2JI9A 3DMDA 2ZSIA 4YBRA 3CSUA 4FB4A 4M1MA 4YUXA 5J2UA 4DDWA 2N46A 3ZVRA 3ZIAD 1TJ4A 4LJLA 5DTRA 5TEVA 5J2TF 2IBTA 1IAVA 2GK4A 3OCYA 5FWXA 4ZIRB 3B20A 4RK6A 4AMBA 2YQ4A 2RHHA 1KJNA 2DTXA 2HBZA 5B53A 3BRWA 4O4IF 2BKUA 4Z4IA 1PD1A 1KJWA 2XDQA 5BT8A 5G40A 1CIPA 1HDRA 4Q5IA 3G0CA 1Q1GA 5JSYA 5E3JA 3TGLA 3GGDA 2H16A 2Y71A 1CY4A 1X1SA 5DISB 2ZVQX 2HWKA 4M87A 3DDHA 3NIFB 2RHBA 3ZE8A 3AC0A 3DZIA 3ZBPA 3ACDA 2IZ6A 3DNFA 1FE8A 1TZJA 4UKDA 1AUQA 1CETA 1J99A 1DT3A 1YIOA 2IDZA 3A37A 3N6VA 4W7HA 3V3KA 1MJGA 4W1PA 4U0JA 5A9SB 3CF4A 3U09A 4I1SA 4BP8A 4IJVA 4LYJA 1HI9A 2W2TA 5KC9A 4X3PA 3BWEA 2HQ1A 5FH9A 4YP7A 4Q16A 2RMKA 2ZSHA 5LDGA 1UMKA 2QIPA 4H1VA 5CT5A 5JEDA 3DKIA 1TC1A 1ZGJA 2DMRA 1JQDA 2XEXA 3BK7A 4JLUA 4M6WB 2LCIA 4IBOA 1U3DA 4GOMD 2Z8ZA 2MYUA 5HDQA 1UBLS 4W82A 3F67A 1GITA 1VSVA 5EJMA 4Z1MA 4L75A 3RWOA 3K0AA 3NBMA 4N3GA 2VP5A 1GQFA 3DF9A 3HCNA 3CX4A 4PANA 2JAWA 2O8FA 5JS2A 1VLJA 3O8BA 2XB8A 3KT3A 3NOVA 4R7GA 1JQ3A 2GJ8A 2VP2A 3G59A 1GNVA 1PHPA 1PS9A 1XTSA 1MMFB 3PWKA 5KNBD 2CLKB 2O20A 3GRUA 5EWMA 2GWHA 3PWTA 3U40A 1W29A 3CXRA 1CZOA 2YN0A 3HCPA 4P4SA 4C0JA 4MUKA 1M1NA 3WKCA 1BEZA 3LK6A 1N1DA 4GH5A 4J07A 2PBLA 3DFKA 2Q9CA 2Y6VA 4MVJM 5IBQA 1JRLA 4EY6A 2WLSA 2XKKA 3IAM6 5JSZB 1QH1A 5HM8A 5H8WA 1M2VA 1XTJA 1OD6A 1NXVA 2B2NA 4J1TC 1R74A 1LDNA 4JUIA 1D09A 4PFSA 3X1MA 4AICA 1GZVA 2I34A 4QNRA 3TOXA 2XQVA 1OPXA 4JT9A 4ZJPA 5EP3A 5J58A 5ENVA 1OXSC 3KXDA 4MAAA 1NQXA 4RE5A 3A27A 3CEPB 5ALJA 2ECPA 2OLJA 1XVAA 2GRJA 1EVKA 1XA4A 3F1KA 4F5YA 2ISCA 1OHHD 2ZRQA 4MICA 4RIFA 4US1R 5IBCA 4HDKA 4PONA 5KQGA 5TQ0B 4BO6A 1PVVA 1E5TA 1S0UA 2WTEA 5DBGA 2CLEB 2LKDA 3G8BA 4G8CA 3I6MA 3KUXA 2H1FA 4U6SA 2EKPA 2NN3C 3P96A 1L7XA 1GT91 1P72A 2PJUA 1Z5VA 3JASB 4U39A 1M7BA 4X61A 2ZWPA 3RANA 3ZEIA 4MHTA 2M2IA 4EF6A 4QUDA 1H1LA 5KUTA 1M10A 1J56A 2NXCA 1DWUA 2BBTA 3FMIA 4J4TA 1QVZA 1RQRA 1Z2NX 4GVXA 4B9EA 2RGGA 1G55A 2OBBA 4NYMR 1X0VA 2D1SA 3FVQA 3O9ZA 4R3NA 3U4GA 4KTVE 5T3UA 2BI8A 2IYFA 1RMYA 2Y1FA 3Q15C 5AVSA 4EY3A 3COJA 4Q4DA 5TF0A 5J2TB 2XOKA 3V1UA 1ZBQA 2QW8A 4YCJA 2QQ0A 1DTSA 3GLHE 3Q72A 3VH2A 3C5HA 2PKQO 3BH0A 4B87A 2Q4RA 3VJRA 2LIVA 4TMZA 2GBPA 1CVLA 4O4IB 5HA5A 1OAAA 1Z4JA 5FPTA 5ADWA 1PT5A 2AK2A 5ADVA 3Q3VA 1ZIPA 3K1AA 5KU1A 5F2OA 2W6NA 5EN4A 1JEOA 5JC8A 1PUIA 5H1YA 5L4LA 3GUHA 1OA0A 2XDYA 4JYMA 5GV8A 3WP0A 3HU1A 3PDIA 1AURA 1IZZA 1XCMA 4DBZA 6GPBA 1G8YA 1QAQA 1GYRA 2JGDA 3AF0A 3GP5A 2D13A 2VNHA 3HGTA 3S2FA 4EKIA 1Z47A 4RLHA 3W5JA 2WZCA 1NIJA 4YRPA 1KSHA 2PTGA 3WHPA 5KNCA 2VNAA 3D6FA 3DLTA 4BLWA 1RDFA 4Y3UA 1NV9A 4YMWA 1SCDA 1KP9A 4R1MA 5CA0F 3QEBZ 1XQVA 1I24A 4MB0A 4CKWA 2C9OA 1YVDA 1KBOA 2R6GA 3UXEA 1U81A 1E66A 2AFRA 3GDFA 3K7EA 3L9WA 4J9UE 4Q1FA 1DX9A 2H54A 2AMVA 3NDRA 3TCNA 4F1JA 1HWYA 1B8UA 1QFYA 3O3OB 3RFUA 5ALIA 2DBZA 1UT8A 1K1EA 1QV6A 1NURA 2FPGA 1A9YA 2RB5A 3FDFA 1QGZA 4BLQA 1KY3A 1N8SA 2VP9A 1K5PA 4MV7A 3EX7C 1CNEA 3DKPA 3L46A 1LTQA 5JNLA 4IIVA 3SQXA 2JLYA 2QVXX 3EZ7A 4X20A 3UGTA 2CE7A 4Y6SA 1OBCA 1JDVA 1JX6A 4PLHA 1C8BA 2FUG6 2BFMA 1IIBA 2W58A 3LDUA 5JSUA 3U7GA 3ZJYA 3LX5A 1NAHA 4FGLA 3ZCRA 4EB3A 1IG0A 3DV2A 1Q21A 2EG9A 3HC7A 3VYSB 1KE2A 5FFFA 2HYDA 1EKXA 3CLSD 4HGRA 821PA 3TLEA 1IFXA 1DTWA 3PPXA 1YCFA 4QXMA 4YPOA 4Z1OA 1G8FA 1KH3A 2HF2A 1M8GA 4R2KA 4ZU3A 3GDOA 5M34A 3HM9A 1HO3A 2IS2A 3ZLBA 2OK7A 1I0LA 1GQ2A 1PDVA 1SQSA 1QZXA 3FTPA 4PS1A 2YN4A 3IUBA 4V0MA 2NYVA 5EOVA 5I4CA 2FP4B 5JYDA 4UUOA 1MR3F 1P7YA 3K6SA 4XVHA 1OILA 1MJFA 3SY8A 5JNUA 3R7FA 1S6YA 2GLXA 3VHRA 3TX2A 3EYWA 2DQYA 4GXQA 2G9RA 1NONA 4K6CA 2CLMB 2O50A 4U9HS 3STHA 4XWAA 4A2WA 5HNKA 4G8BA 3PWZA 1NRXA 2LE0A 5AW1A 1MAVA 3FWKA 4AAYA 1RPJA 2HK7A 3DL2A 3MEQA 1FRZA 2VEDA 1X1RA 3JAKB 3D6AA 2RHWA 4XLTA 1E1QA 5G0WA 1JXMA 1GKKA 1B6TA 1TO6A 1UFRA 4YIHA 1TM2A 4WGGA 3T3EA 1NVFA 1GZSA 2YQZA 3A0UA 1KEZA 2FZLA 3CHYA 3ONWA 2DTEA 2F3SA 1WNTA 3V9PA 1I32A 4DGSA 2Z0MA 1JBEA 2P0YA 3OZWA 4IEFB 1U8YA 1W1IA 1UODA 2F3UA 4ON9A 5EZYF 3ZDYB 4C5CA 3BFPA 4RTKA 8MHTA 1WUHS 1D3AA 3P5BA 4LYDA 3WXBA 3BE6A 3SS8A 5KYWA 1G60A 1KYQA 1O9GA 4G0MA 4JJEA 1VRWA 3IE0A 1U7ZA 4LGMA 5G53C 4TYYA 2IX9A 4QJBA 1PFUA 4GC5A 5B64A 4N40A 2JGRA 1DL5A 4JI0B 1PJAA 3QU7A 4RLFA 1JFRA 4C4SA 5CG1A 2ZRNA 3K2IA 1HMPA 2IUYA 1FFYA 1WMBA 1P3JA 4N3AA 1VE9A 1GFSA 4YECA 3SSMA 3TI9A 3FA2A 1EEXB 3TM4A 1KZ4A 3T0FA 4D6XA 3SYMA 4CMIB 1I13A 3FPBA 2O7SA 2VP3A 1CT9A 3JR3A 4YACA 5DGCA 2CWDA 2XA1A 4MV9A 1TIPA 3QZUA 4H3HB 4XVUA 5CDUA 1V3UA 1HFKA 4H7HA 3SDBA 4RWEA 5GIPE 1M2WA 1VE1A 3S0JA 4G07A 4PBSA 4RK0A 1X9GA 5CA0B 4O63O 3Q7QA 1MX9A 4NPHA 3SZ3A 3AESB 1S1MA 1L3IA 5C1DA 5EJ9A 3RIMA