3C8UA

Crystal structure of putative fructose transport system kinase (yp_612366.1) from silicibacter sp. tm1040 at 1.95 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
206
structure length
206
Chain Sequence
GMTLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPMDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLFDRARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPMADLEARLVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPADLTWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative fructose transport system kinase (YP_612366.1) from Silicibacter sp. TM1040 at 1.95 A resolution
rcsb
molecule keywords Fructokinase
source organism Silicibacter sp.
molecule tags Transferase
total genus 73
structure length 206
sequence length 206
ec nomenclature ec 2.7.1.4: Fructokinase.
pdb deposition date 2008-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3c8uA00
1LVGA 2QTHA 2ZI6A 5G3ZA 4DJTA 2QNRA 3WYGA 2VEDA 4HZIA 3TBKA 1U98A 5EE5B 2J7PA 2OEPA 2BWJA 4Z8YA 3CONA 3IQWA 2REXB 1MV5A 1PLKA 4BZPA 4TWZA 3GJ5A 3V4RA 3CLVA 1S4QA 1E96A 1Z6XA 4Z54A 1KTVA 5DI3A 1NN3A 4LBYA 1GDDA 4QM6A 2QGNA 4JYCA 1F2TB 1N6PA 1WCV1 3QF4A 1C9KA 4Q7MB 4Q9LA 1E99A 3VR2A 1QRAA 1HUQA 3R9IA 4EFLA 4A8JB 2JLUA 2ECKA 4KVGA 3K09A 3VFDA 1XXHE 2OG2A 3EZ2A 4ZDWA 3NVAA 3BGWA 4LY6A 4CEHB 2YVUA 3SBDA 3UWKA 3VHXA 3K0CA 1N0WA 4EJSB 1W48A 5KUTA 3GLGE 4RD3A 4PPQA 5HCNA 1G3UA 1N5KA 1OFIA 2DWQA 1R0YA 4Q9JA 5BN5A 2E1RA 1W0JD 3WBJA 3SS8A 1IN6A 2RGCA 4CGZA 1I4LD 1E98A 2NPFA 5FTLA 3FMOB 2PJRA 4NP6A 1W7AA 1W1WA 1Q1BA 3SJBA 4MYHA 2FSGA 3DKVA 4FXPA 2XXAB 4LOAA 4OL0A 4PPGA 1U8ZA 5FR2A 2IYUA 5FTNA 5KYKA 2YOHA 3CX8A 2BEJA 1NBME 3CR7A 2H5EA 1ZBDA 3AF3A 1XB2A 1LS6A 4JVLA 3FTQA 4EUNA 5KOYA 3HU2A 4IDNA 2VP4A 1UBEA 2ZJ2A 3B7GA 3KQKA 4JBYA 1T6NA 5IRCD 4PXAA 5FOWA 2VHTA 4NBSA 4TLBA 1M1YE 3B9PA 2VQSA 1XCMA 3RS7A 4DRZA 3AP3A 1FP7A 5CK4A 1U99A 2H8KA 3UG6A 1OHHD 5K8TA 2JLVA 3Q72A 4MKGA 2OLJA 2WPDA 4PO9A 5SZKB 4QXAA 4EIWA 1XXHA 3KB1A 3B6EA 2GXAA 1J99A 1X1SA 1Z0AA 2QEQA 1MO4A 4Q01A 1WA5A 3H0KA 3U5ZB 1ZC4A 4ESVA 5HZKA 4Q02A 4IEEA 5IF9A 3ZVMA 4OJQA 1E6CA 1G4AE 1S1CA 1IXSB 4WOPA 1T91A 1W4BA 5EXTA 4A8JC 4Q1DA 4GP6A 2Q3MA 3RRZA 5BWMA 1DAIA 2BJVA 5B57C 5G40A 3G0HA 3BAFA 2ERYA 2EYQA 2DWOA 3QG1A 3KUDA 1C1YA 4EJSC 1VIAA 1J70A 1G5PA 2ZU0C 2OE2A 1TL7C 4JVNA 4MRPA 5CLQA 1EFUA 3I92A 5AUOB 1OXSC 4OQFA 2Z4SA 2XZLA 1NJGA 1TEVA 1TUEA 4BRUA 2WSMA 3NIBA 1NBMA 1DO0A 4A15A 2GJ9A 1Q3TA 4IVQA 4RD1A 2QBYA 1F2UB 1MH1A 5EZ6B 1E1RA 3QY0A 3RLFA 3T5GA 3A6PC 4DT1B 2XZOA 1HQYE 2G77B 4AIIA 4P3YA 1NVVR 2ZTSA 4DIDA 4Q4AA 4B73A 2I1QA 2OCBA 2ONJA 4Z51A 1JPJA 2QT0A 4NMMA 1GIAA 4WIAA 2ZITA 3WRXC 1KYIA 3D31A 4XWOA 3AKYA 2G1JA 4DLUA 1Q1QA 3EC1A 4J0QA 1K5GA 1TUIA 4BWYA 4BFVA 2NO1A 5CDFE 2AWNA 4HI0E 5CB6A 4FCTA 4AC9A 4LUCA 1W47A 1JEDA 1ZU4A 2EFDB 3E5HA 4G5QA 2KE5A 1XEXA 4D4JA 1Q44A 3LW7A 1W5SA 4QBGB 1F60A 2Z43A 1ZYUA 1QVAA 2NGRA 3L0PA 2FNAA 2UKDA 4G5SA 1AS0A 1Q21A 5H70A 4GFDA 4JSYA 2YJTD 3UXMA 1JNYA 1N2CE 1QHHA 1KSJA 1SHZA 2D2EA 2E9SA 4FIDA 1KDOA 1Z6YA 2C98A 3NWJA 5DN6D 3U61B 1R5BA 2IYWA 2QN6A 2JLRA 1DELA 1O87A 3I1FA 1S9DA 2ZJ8A 4AY2A 1RVDA 4CIDA 3RRNA 1UBFA 5BYJA 3MG9A 3RS3A 4DDVA 1Z6GA 4HAVA 2A30A 1KAOA 1XX6A 4KFRA 2WSSA 2ZJZA 2IS6A 3C5HA 2ZU6A 3NH9A 1ZUNB 4DCTA 4YMWA 1AJEA 4V03A 2E87A 3WY9A 4IW3B 4M1MA 5AUQA 3IPXA 1NJFA 1ODFA 2PBRA 2CCJA 4F91B 3A4MA 4GZLA 4BFSA 4P33A 1X86B 3U3RA 3CF2A 1E9EA 2IHBA 4GOXA 4MGIR 5CDFA 3SI7A 3ZDQA 1W36B 2FEMA 1VYTA 3AUYA 3LWNA 1W4AA 3QENA 1CJUC 4KLZA 4TL7A 2D3WA 1ONBA 2HCJB 2FPKA 1Z0IA 2V4ZA 3A1TA 3NHAA 2OFOA 2IWHA 3P1JA 2Q21A 3U3OA 2QPAA 3GFOA 2B7BA 5EUQB 5M04A 1NIPA 2V7QA 1E94E 2CHVA 4Q1BA 5DISB 2A5GA 2J45A 1ZMXA 3HR7A 2ZRKA 1VKJA 2CCKA 2CK3A 1AN0A 5FI0B 1UDWA 2VIIA 3CRVA 1Z2CA 4NH0A 2VP2A 3L8ZA 2ZI3A 3PCRB 3Q5EA 3RANA 5AUPB 1RIFA 2QTVB 4KV9A 3PVSA 4C0SA 2WWWA 1FP6A 1YZTA 3RRYA 4RSGA 2FPMA 3FKQA 2ZYUX 1KI3A 3L43A 2J0VA 4OHXA 4EQ6A 1B0UA 1NN1A 3K9HA 2A9KA 2F9MA 4DLTA 2XNDA 3AVVA 3T1VA 4AYXA 4KU4A 2GBLA 2WJYA 3LO5A 1UADA 2QPOA 5AK0A 1SVKA 3CNOA 1UAAA 2N46A 3M6AA 5HTKA 3QXCA 4EAQA 4F7WA 1XP8A 1T0HB 3VQTA 2VTKA 4BLOA 3KJHA 3LLMA 2RGXA 3MD0A 2HJVA 4R2IA 3TR0A 4W9MC 3KX2A 3PIRA 4RVCA 4TQUS 2FSFA 5DO9A 3R7WA 1KO1A 2ZRIA 3DDCA 1R4AA 3IEUA 1CR2A 1VCNA 2GZAA 3ND8A 4WZBE 4NCIA 1G8PA 5EJEA 1J2JA 3U6BA 3E2IA 1TQDA 2A5FA 3QPVA 4TLDA 3REFA 2O8CA 1GWNA 1AM4D 3FKSA 2Z6VA 4A2WA 1W36C 3DO6A 4MRSA 1P75A 4NTZA 4XJXA 5L3QA 3VR3A 2GAOA 4B32A 1YE8A 4YONB 4XSHA 3I5XA 4AURA 3SYKA 3ZGXA 3B78A 2I4IA 4Q66C 1JALA 2QPTA 1W0KD 1Z47A 2RHMA 1G3RA 3E1SA 5GJVC 2PJZA 4Q00A 1T5LA 2HXYA 1IBRA 2ZE5A 2HLDD 1RPZA 1FNMA 4NYMR 4RD2A 1XTQA 3DOEA 3B13B 4Q4LA 2GJKA 4WZAE 2YHSA 5JCZA 3K70B 1LW7A 3OIVA 3OIUA 4OQLA 1GG2A 3EIHA 1G16A 1X1RA 2X77A 3QPUA 3TNFA 4PHFA 1KSFX 4RFSB 2J7PD 4HLDA 4ZIRB 5G3YA 3ADBA 3AF4A 3TKLA 4JKYA 1ZM3A 3PJRA 3PUXA 2V54A 4FN5A 2DR3A 3EASA 4H1VA 1GRNA 1KO8A 4LWZA 1VPLA 4NCKA 4U5XA 5A5GA 2RB4A 4C7OA 2ZROA 1CRPA 1NL3A 4Q1AA 4K46A 4DLZA 3B1VA 4GMDA 3FVQA 2VL7A 4MH0R 4LHXA 1U2RA 1E0KA 3ICQB 4F4JA 4X8OA 4XVQA 1LB1B 5LB4A 3EZFA 4D4LA 1FFHA 1AZTA 4JLAA 2W2VA 4JL6A 3W34A 3MJRA 5DSZA 5GVSA 5EP4A 1CULC 3QKSA 3LBIA 5AJXA 1COWA 1F2TA 1X8JA 5J4HA 2BKUA 3EZ7A 2IC5A 2WTUA 4YMTA 3AGQA 3LY5A 4DEYA 2ZJBA 4A8JA 4B71A 2FE4A 2R65A 2VP0A 2D06A 5KNBA 4CEHA 1N6KA 1NI3A 2QGZA 3HU1A 1Z0KA 4FMCB 3WYFA 4JJKA 4BE7B 4EJSA 2RH5A 2ZRLA 2ORWA 3A4NA 3TSOA 3U3JA 1N6IA 4UJ5A 4MQBA 4TMWA 3C15C 2PZEA 1RYHA 3TK1A 1G3QA 2O52A 4M4SA 2FFHA 1CEEA 3K70C 2XSZD 2ORIA 3FPAA 4UXHA 4OK6A 1TAGA 2FPLA 2FFAA 2CJWB 3TAUA 3SHFA 5J4LA 4TZ0A 1Z3IX 3B1YA 3T61A 4N0EA 2G9NA 2LKDA 4JL8A 4BLRA 1DARA 2XXAA 4DZZA 1OH8A 3IDQA 1JR3E 3KXKA 3IHLA 4IOKA 4MUAA 5C18A 3PEYA 1SXJB 5FFMA 3T06B 1LNZA 2KB0A 4YDHB 3GD7A 2V9PA 3NBYC 1LTQA 1SVOA 4L5BA 3SFVA 5IT5A 4JS0A 1P9RA 1TX4B 1SGWA 1KI4A 2OXCA 1KY3A 3H4MA 3KQNA 2J41A 1ELOA 3BS4A 1PJRA 1E9DA 1GNPA 4L9SA 4N3NA 3VX4A 1E69A 2PT7A 4US0R 3KQLA 2CL6X 1NVUQ 1E2GA 2IHYA 3W3AA 2RMKA 2ZAOA 1I2MA 4RZ2A 3GJ7A 2P6RA 4N1AA 4PQRA 1EWRA 2QMUA 2EFEB 2ERXA 1LF0A 2F43A 2AXNA 1J8YF 1NBMD 1G7TA 4TYYA 1FTSA 3A1VA 3IO3A 5J47A 3TR5A 1E1RD 3GPLA 3FFAA 1XEFA 4MGYR 3AVOA 4FMDB 4O0MA 4WAUA 1H8HA 4TYPA 4P4TA 1II8B 3ZZ0A 4LJ6A 4HDOB 4UNPA 2FN4A 4GT1A 1P2UA 5TY0A 2JLWA 1JR3A 2XTZA 5BN4A 1Z28A 2EWVA 3LW8A 3IIKA 3QPWA 1FZQA 1XD9A 3GEEA 1WB9A 4RD6A 2JCSA 2NPIA 3GLHE 5FTJA 4D81A 1TF5A 2CBZA 3RC3A 4DSOA 3U7EB 1IY0A 2WAYA 1VG8A 1YRAA 4OK5A 1SXJC 4JLNA 4M21A 1G64A 5EP3A 3WP0A 5KO2A 3GLFE 3TVTA 4BRWA 1IN5A 4AD8A 4ZCIA 1W46A 1F6BA 1NVXQ 4V0NA 2IYVA 2HYDA 3AVWA 4HUQB 4JT2A 2XTNA 5IK2A 3GP8A 3RS4A 4UNNA 4WW0A 3V9PA 1EGAA 4PX9A 4JKIA 2WMOB 3IPYA 3JVVA 1AIPA 1FUKA 3I72A 3OE7A 3N2IA 4P4UA 4C0BA 4TZ6A 3RHFA 2ZRAA 4PO8A 2A2ZA 3LX8A 1HA3A 1HURA 1BYIA 1G8GA 1ZM9A 3QEOA 1Q20A 2XNSA 4IOMA 4AWXA 1KI6A 4DHEA 1KNQA 2WZQA 4Q47A 5C2JB 4YDSA 4FMCF 2ZI9A 2DY1A 1PV4A 1KKLA 4NCJA 4B48A 4FI3C 2NZ8A 4JYBA 5K8IA 2HUPA 5CK5A 3FOZA 2AX4A 5FOUA 3CB4A 5KPJA 1KSGA 2O0KA 3Q85A 2IS4A 2V3CC 1KDPA 3W3ZB 2MMGA 4IKEA 3GLHA 1T3SA 1HH4A 2B8TA 5AWFC 2JLXA 4OHYA 4WXPA 4WXRA 3X1DA 3DZDA 1XD2B 1GILA 3NBZC 4TLAA 5GVRA 5CIQA 2CL0X 2A78A 3GLFA 4BQSA 1SVSA 4TT3A 1OFTA 2O8FB 2QP9X 1CU1A 4LPKA 2HT6A 4GZMA 2GCOA 1A82A 4D2IA 4PSVA 1D2EA 1NP6A 4M1OA 1FQKA 1MRSA 1M7GA 1NLYA 1OXXK 2ANCA 2CK3D 3GJ8A 3QVVA 2QY9A 1XWIA 2B92A 1RYFA 3THYB 1CR1A 1J7KA 2X8AA 2VHCA 1SKYB 1CJVC 3CRRA 3EA0A 3KKMA 4D6PA 1GSIA 2IS2A 3KKPA 1NVVQ 2P3SA 2W83A 3UG7A 3S1AA 2G6BA 4OQMA 4RZXA 2CLCX 1IQPA 1VIYA 5FH9A 3BB4A 4HB2A 2FH5B 2XNDD 2WJGA 1BMFA 1E2KA 1KO7A 1JAIA 3U3KA 3R8FA 5L3SB 2D4HA 3AF0A 3BIFA 4FWIB 2OCAA 3EG5A 3PEWA 2JLZA 5DYIA 1ZJ6A 1P2VA 4Q1FA 1EX7A 3T34A 1A7JA 3MRSA 2QRNA 3THXA 1KIMA 5BYKA 2R6AA 2ZRHA 1ZCBA 4E22A 2YOFA 3ZYCA 1II9A 4GBMA 3OAAA 2VF7A 4OQNA 2IA5A 2Z4RA 2GETA 2VP6A 4FMDF 4HB4A 3SHWA 1TMKA 3RAPR 1IHUA 1TNDA 2QUZA 2W6JD 2OLKA 1VHLA 1I2DA 3CF0A 4G1UC 2WWIA 1Z5ZA 2G0TA 4RKFA 2R6DA 1MABB 3BB3A 1H8ED 2QI9C 4QGGA 5LPNA 3TMKA 1U8AA 3HPRA 2YWEA 3MGCA 4JBXA 2YWHA 4URXR 1G5RA 2V6IA 4YLGA 1N6OA 4KFUA 2QAJA 2PT5A 2VSOA 1DADA 1LV7A 1W4CA 1L2TA 1QVRA 1OV4A 2C9YA 2AHOA 2WKRA 4D82A 4M1KA 4F4CA 5EP2A 3RWMB 3SYLA 1T8TA 1U81A 4BFZA 1IM2A 3T1OA 3G5UA 4B2LA 3CKLA 1E2QA 1FQJA 2FGJA 3ZH9B 3MFYA 4PPNA 3I4LA 3K0AB 3CPJB 1OB2A 4C0QC 1XMJA 1G7CA 4HLQB 5JWHA 2C5LA 4PPFA 2WIBA 5JWRA 4A6XA 4Q1EA 4MRRA 1XTJA 1GL9B 3D3QA 2YC2C 4QOSA 1GL6A 1YU9A 2ANBA 2V1XA 2Q6TA 1KJZA 4LJ5A 1ZNZA 4E09A 1PLLA 5J5CA 1G41A 4MDEA 4IXNA 2GXUA 1NMXA 2WKQA 1EESA 3GEIA 4Q18A 1ZINA 1YR8A 4RD4A 3QKRB 2XJ9A 3LFUA 5JFGA 4ZIRA 3FDIA 3CH5A 3O8BA 4A6PA 5E3HA 2ODNA 4JBWA 4QBIA 5JBQA 3U60B 1AGPA 2W0SA 3W9YA 4LYHA 4D26A 1JJ7A 4DCSA 3B60A 3ZZTA 4M8NE 1D5CA 3FFBA 3H1TA 4I99A 2JJ8A 4HZUB 1COWD 1T3HA 1S9HA 4ZDJA 1B23P 3TAHA 3Q9LA 2ATVA 5C4MA 3LV8A 4BFWA 3R9WA 5KTYA 5TARA 2F9LA 3NBFA 3M0EA 5FUYA 4M9XA 1ZUHA 3CNLA 1S1MA 3B1WA 1Z0DA 1US8B 1TPZA 2WKPA 1JQJC 4D0NA 2F1IA 4A0HA 4US1R 1T8UA 1CRQA 1N0UA 3C8UA 3B2EA 3THWB 1N6RA 3DL0A 4I1VA 5BN3A 2C2HA 2JLQA 2FJUA 4OI0A 1EK0A 2D74A 2GAAA 4Q9HA 2AKYA 1BS1A 3QBVA 3RVBA 1XJCA 2ZSFA 4ZKDA 3AEZA 3I32A 1WE2A 3ADKA 4HAWA 3EIQA 2YKGA 4URZR 2FSIA 2ZRGA 3TQCA 3LDAA 4I1SA 2OFXA 4DDUA 2IYTA 5GJBA 3CUEF 1ESNA 1GP2A 4MYTA 2P65A 5FBQB 4ABYA 3BC1A 2H7VA 3RSLA 3CWZA 1SVMA 2ZRJA 4ACAA 2XB2A 3NHBA 3RDPA 4ZKEA 2OUKA 1YJ5A 1P2SA 1GITA 1AQUA 1OF1A 5CJPA 5J4KA 3ZLJA 4KYIB 1NVWQ 4NYMQ 2CJWA 2VHUA 3ZD6A 4ASUA 4PZZA 5CYPA 2RGBA 1Z6TA 1VG0B 5FPYA 2NZJA 4DVGA 1E2PA 1IN7A 2KJQA 5JEDA 4LCBA 4HAZA 2X1VA 4IOJA 1QG2A 3TSZA 4JLPA 4O25A 3UIEA 2O8EB 4QBHA 4QJ5A 3HYTA 4QHTA 2CVHA 4BECA 3OEHA 4I81A 3F8TA 4MYUA 3IBGA 4M0LA 2J87A 1G19A 1LS1A 2W6ID 1XMVA 2OESA 2YOGA 2P67A 4JVMA 4N0DA 1C4OA 2R6CA 2ZS8A 1HY3A 2CEAA 2ZI7A 3ETLA 521PA 1DE0A 1N5JA 2AN9A 4ZDIA 1DAHA 3A1WA 1JR3D 3VAAA 4K8OA 3QNUA 4KFSA 4AKEA 4PANA 1R0ZA 2BHRA 1QHGA 3OF5A 1L7VC 3TE6A 4DB4A 1L4UA 1AS2A 2EYUA 1IN4A 3CR8A 2GCNA 1II8A 3QOFA 1OIWA 4DIEA 4JVSB 5AR1A 1HE8B 2KWIA 4WA7A 2G83A 1T9HA 4TYNA 2IK8A 4JMPA 1EXMA 1UKVY 4G5RA 4PZLA 4DCVA 5LD2B 2PMKA 2ZRNA 2YV5A 2WWGA 1DAKA 4PAMA 1VG9B 2UVQA 1KDRA 4CEIA 1E3MA 3CNNA 4PQFA 4JLBA 1ZD8A 2NQ2C 4LJ7A 1OH6A 5IK2D 3D8BA 2ZVQX 1KO4A 2QROA 2P5SA 3LQRA 4YXWD 3ADDA 2GKSA 2VSFA 2ZR9A 3P32A 2RGDA 3PG5A 4Z8XA 4TN1A 1Z0JA 2BJWA 3KUCA 5TXGA 1QHNA 3TGPA 4QNMA 3MWJA 1ZW6A 1RRPA 2BMEA 2RKOA 1G5TA 4BLSA 4MUBA 3AKEA 4LC0A 1J8MF 3FMFA 4HUQA 2C8VA 1CJTC 4QFMA 3T1QA 3UK6A 3WMEA 2GJAA 1NY6A 2FZLA 3IBYA 1Z8FA 2OAP1 2W2TA 4Q4HB 1OYYA 5F9FA 4DUGA 4CVNA 4OHZA 4B43A 1QHIA 1NRJB 2J7KA 1DAGA 5FOSA 4ZI2A 3SE0A 1UKEA 3PUZA 1K8RA 3ZIAA 3UMFA 4LV5B 3AVYA 1KZ7B 2JA1A 1UEJA 2BBSA 1OFUX 3K53A 4TL9A 4ZV4A 2GZHA 4LJ8A 4KLNA 2H57A 1WMSA 2AL7A 4TT3D 3I5YA 4LPSA 2ATXA 2PZFA 4HAXA 1TF7A 1M8PA 2RHDA 3NEYA 4MYCA 1OB5A 1BOFA 3NH6A 1HYQA 2QE7A 1XNJA 1NNEA 1GFIA 2WHXA 1BH2A 3FMIA 3LXXA 5LD2C 5J4YA 3OEED 3AVUA 3CF6R 1U0LA 3LAWA 3GLIB 2O8FA 2TMKA 1OH5A 1GTVA 3MCAA 1Q3HA 1JXMA 2QP3A 4B6EA 4G5GA 1BMFD 4NL4H 2JDIA 1XEWY 3ZVLA 4A4DA 3OFNA 4ARZA 3Q7PA 1EX6A 2C9OA 1GM5A 2BEKA 2XOKA 721PA 3VTKA 4I4LA 3KTAA 4NHOA 4L15A 3UPUA 2HF9A 3VMFA 1E1QA 1KJYA 1NLFA 3CPHA 4MA4A 4MRVA 5D3MB 5E7JA 5FL7A 5C1BA 1DAFA 3D6TB 1KGDA 2HDNB 2VHQA 3FHCB 2ZJOA 1ANKA 2D7DA 2BIFA 2RAPA 3VKWA 4DCNA 5A4JA 4B2IA 4Q1CA 1IJFA 1A2BA 4QJ4A 4PQYA 4RZUA 2ZYWX 3EZ6A 2MSEB 4PFSA 1NG9A 1HEIA 1I4TD 3NDBB 1KI7A 3M1IA 2REOA 1XZPA 2W0MA 4BLPA 2PL3A 3BH7A 1VCOA 4M1SA 1S96A 1PLJA 2ZREA 1OSNA 4XH9B 3UMRA 4B75A 2HT1A 3U44B 1ZD9A 2ZPTX 2QMEA 1JXOA 4JT4A 2B7CA 3K9GA 2FV8A 1QHSA 1QZXA 1ZNYA 2GZDA 1MABA 1VTKA 2UZ3A 2XJ4A 1GKYA 3FHOA 1L8QA 3CX6A 1CKEA 2EFGA 5F2EA 3CRQA 3REGA 1G7SA 2VRWA 4LGMA 4B3BA 3EW9A 4MKHA 4TMVA 4TTRA 2VF8A 1ZU5A 5AJWA 4A1FA 1G8HA 2XEXA 4JLMA 1X8LA 2CCGA 5G41A 3SJCA 4GPTA 3BE4A 2OV2A 3RWOA 1SZPA 3BFVA 3EWAA 5FUWA 1DBSA 1KNXA 3GFPA 2GA8A 1YR6A 4B3FX 4QC2A 1DG1G 3VU9B 2AKAB 3KFVA 3IKJA 1QBKC 4IFEA 3CWQA 4PC6A 2JJ2A 2NTYC 3AB3A 1IY2A 1R8QA 3BFKA 1E2EA 1JECA 1FNNA 2P5TB 4A0RA 3NBXX 5FPSA 1YQTA 1DG3A 4ON9A 2FWRA 5D3QA 1IN8A 1DAEA 3MMPA 5DGXA 4A92A 2DWPA 4NCHA 1XMSA 4QKQA 3ZJYA 3QF4B 1TQ6A 4BPBA 1PVOA 1A5TA 2F3TA 3L0OA 3HU3A 1Z0FA 4QHSA 1JR6A 3JZMA 4NPHA 3QKRA 2LWIA 1IXZA 2EVWX 4M9QA 3CIOA 1KDTA 1E4VA 2D7CA 3UWOA 4KXFB 4UNQA 2SHKA 4DSTA 1NN5A 3Q8XB 4Q48A 2ZQ5A 2ZRMA 4BFUA 3VX3A 5ELXA 4ZPXA 3V00A 4C0HA 3X1YA 2MMCA 2CL7X 4HZUA 2VP9A 2QAGB 4Q7LA 4F38A 2ZVPX 3RS0A 2G0NA 1XPRA 1M74A 1NY5A 3K9NA 2WICA 4CT4B 4M1WA 3OIWA 1SULA 4CW7A 5K8UA 1OJLA 3K1JA 3C14C 3W5JA 2ZI5A 3AVQA 3SEAA 1XDBA 1SVLA 1IAQA 4PO1A 4BFTA 1US8A 3VNUA 4S35A 3WHKA 3A37A 4IDPA 1W0JA 4BLTA 3QSYA 2CLDX 3FWYA 4LV6A 3V4FA 3QJYA 5H1YA 3WHLA 1KOFA 1CLUA 4JJZA 4OK3A 1YZGA 2VP5A 2EFCB 2WPDD 4YQFA 3CRW1 4TLCA 1NLZA 5FOVA 2GJSA 1DTSA 1G17A 1P5ZB 1MO5A 3BD9A 4FCWA 2O8DB 2AD1A 3SR0A 3GJ4A 4LI0A 3SYNA 4DCUA 2QZ4A 4IHQA 3KJGA 4RY2A 1G9XA 1XXHB 3M4YA 3J81k 1Z06A 4P31A 3EC2A 2EW1A 1P7CA 2IWRA 1JB1A 5CJ2A 2JLSA 2IF2A 2Q0HA 1G8FA 1CR0A 2CVFA 3CRMA 3AP2A 5KDLA 1G1MA 3PQCA 3GLGB 3SQWA 2F6RA 1R7RA 2RGGA 4WBSA 3TRFA 5HKKA 1HT2E 1VYVA 2PZGA 5JCPA 2GXSA 2QSYA 2C95A 3OEHD 2VPPA 4AG6A 4KYUA 4NYJQ 1JI0A 4II7A 4LHVA 5FOTA 4V02A 3IILA 4QNRA 4TSFA 2QAGC 1VDZA 2XAUA 2ZJ5A 5IHPA 3HDTA 3KKOA 5EE0A 2QBYB 2O8EA 1G6OA 2XZPA 2FFBA 2EFHB 3JZAA 3K9LA 3LVQE 4W7SA 2GRJA 4DLVA 3DOFA 3LX5A 1NMZA 4ZO4A 1W2GA 4DEXA 3O47A 4UXIA 1F2UA 4H9GA 5KDDA 4OJKA 1YVDA 4DT1A 1DPFA 1E2JA 4DB2A 4DLYA 1TU3A 4GOJA 3U4QB 1E2MA 2GJ8A 3QXHA 2UZIR 5LBIA 1W44A 3JVUA 2ZUDA 2ZR7A 1VYUA 2R9VA 4OQXA 2IYQA 3FB4A 1L4YA 2JLYA 1TQ2A 1JBKA 4BZXA 2GF0A 3X1XA 2GVDC 5E95A 3P20A 5H68A 2GILA 3ASYA 1R10A 1MR3F 4HAYA 3EX7C 1F5NA 2OHFA 4TQ9A 121PA 2QP4A 4NE2A 1QF9A 2DYKA 1P4SA 3QG5A 4QRHA 1EFTA 1GUAA 1DS6A 3ICEA 2XB4A 1QHHB 3MSXA 2OBNA 3QXSA 2ZRPA 3SU8A 3U7FB 2R8RA 2WSSD 2OXRA 3B8HA 2H17A 1CTQA 221PA 2GF9A 4QGFA 4TL6A 1AKEA 2AK2A 3U2QA 3LLUA 3MUFA 4G01B 4C0LA 4CRWB 3BRWD 1SHKA 1SVWA 2IW3A 1G18A 1T3LA 4H1UA 1XFAA 2ORVA 4DUGD 1GKIA 2FSHA 3GLIE 5KDOA 1NIJA 4HEJA 2KSQA 4B35A 4W5HA 1CBUA 2FFQA 3EPLA 5EE1A 1OLOA 1WRBA 621PA 1S3SA 3ZIAD 1XD8A 3T5DA 4HDCA 1UDXA 3AP1A 2JJ1A 3T12A 1G20E 4M9SA 5SZJA 4B34A 4IDHA 4CYMA 3AVTA 4POAA 3KQUA 4C3ZA 1Z07A 1ZP6A 1E2HA 1PUIA 4U02A 4BUJA 1XPOA 2VH5R 1FW6A 2IUUA 4AKIA 3KL4A 1MRNA 2V7QD 4TTPA 3LBNA 3L8YA 2QE7D 2KBEA 3TLXA 4O2LA 1F3OA 2H16A 3FE2A 4QGHA 4KSBA 4NDZA 2OM2A 2PLFA 3T35A 2WOJA 2V8OA 2BCJQ 3GQBA 1R8SA 2HEIA 4Q7KA 3WNCA 5FBVB 1RRCA 2L0XA 1UBGA 3K0FB 1UF9A 4NKRA 1SVIA 2HJGA 4ITRC 4TLEA 1FMLA 4JLVA 4R7ZA 4S2EA 1Z63A 4Q03A 2QQ0A 1DVRA 1GRRA 2GDJA 4GRAA 1DAMA 4R2HA 4O2RA 4MRNA 2QQEA 4PSKA 1KMQA 4UQOA 1GNQA 3ZVNA 3LXRA 2F1HA 2JDID 4WZ6A 5J40A 1P2TA 4F93B 1KSHA 3OFND 4BASA 2ZE6A 1CJKC 3ASZA 2QM8A 2REBA 2XOKD 3GLIA 3TH5A 4PC2A 3RYTC 2ZUCA 5J4VA 3TUZC 1E1QD 4KAXA 5P21A 2RCNA 1HQCA 2R6FA 4XWAA 1M7BA 2ZXUA 5KU1A 4LV8B 5FI1B 4RJLA 3TVDA 3R9XA 2F7SA 4GMXA 3AVPA 3BXZA 1QG4A 3B1XA 3GEHA 2ZE8A 2Z5FA 3AF1A 2PEZA 3WYAA 1E0AA 2K5UA 2VO1A 2ZS9A 1RC8A 3C5CA 3GJ3A 3QUSA 5F98A 3FKSD 5D3MA 1R0XA 4CEJB 2ASEA 3W90A 4ZCMA 1XTIA 1FUUA 4YC7A 1NKSA 4DBLC 4A0FA 3PENA 1UFQA 3WMGA 5EUMA 4LBVA 2J9RA 3I3SR 3N2EA 3EZ9A 5CM9C 3P26A 4OHVA 4AYTA 5L3QB 2Z83A 4V0LA 3LRPA 4DDWA 4KBGA 3QIAA 4NCNA 2NIPA 4QBFA 3SBEA 2A5JA 4D25A 3QEJA 4PR0A 4EPYA 1P73A 1A4RA 4OKSA 1OXVA 2CDNA 4KO8A 3U7HB 2BM1A 4MGZR 5FOXA 1R0WA 1CJMA 4IXMA 3I61A 4R9UC 5JI2E 1FL9A 1FOEB 1KJWA 1LF5A 1E9AA 1YZNA 4XWKA 5GJWC 5E4FA 6Q21A 2W00A 1IOZA 4C9BA 1E9CA 2WMNB 2ZS7A 4FMBB 2B8WA 4AYWA 3CZPA 2ZYTX 2D62A 5L3RA 4YMUA 4EDHA 2X2FA 1K6MA 3X2SA 2RGAA 1S2MA 2WM9B 3WNBA 3SN6A 3Q7QA 5BW8A 5JSZB 2R44A 3W5IA 3KKQA 2JJ2D 3KKNA 3NC0C 1W0KA 2I1VB 2GK7A 1DOAA 3KJEA 4MKIA 2FX3A 4NYJR 4DWJA 3ZS8A 1FPMA 2IXGA 3BFXA 3C7KA 4P0TA 1XF9A 3AGPA 2X2EA 2C9CA 4RFSA 3U3MA 3ZZUA 4XSGA 3W8RA 1MT0A 3NC1C 5L8VA 4IOLA 4FINA 4AKHA 3CX7A 3O8DA 2GTPA 2BCGY 2OBMA 2CHQA 1UPTA 4AKGA 1RJ9B 2AXPA 5TDHA 2NOAA 2QTFA 2PX3A 3K0EA 2IEYA 3N5CA 2FF7A 2VBCA 4G0NA 5DIFA 2V1UA 3DPUA 2NO0A 5DI9A 4EKDA 3QKSB 1SXJE 4JIMA 1Q57A 4YMVA 4C2UA 5FR1A 3KQHA 2OO7A 2GWHA 4GDFA 8OHMA 3OIYA 4XIGS 1GAJA 2Q9CA 1Z6AA 4ESHA 1P62B 4IDQA 2PMDA 1N6NA 2CMKA 2BV3A 3B5JA 4LJ9A 3EAQA 2DCUA 3F0TA 4V0KA 1U8YA 4BEBA 2B6HA 4LJYA 2ZRDA 3R8CA 1VCIA 2GEDA 4I1OA 2DFNA 4LC1A 4EPRA 1N5LA 2VHJA 2YC4C 3LD9A 2OFWA 4TTQA 1XTRA 1W49A 2QAGA 4LYJA 1E32A 1VMAA 2G1KA 2WOOA 3BH0A 2ODBA 3DKPA 2O8BB 1QHXA 3AKDA 3CBQA 5HE8A 3W8NA 4OI1A 3FYHA 2J0UB 1CXZA 3UMSA 1AS3A 3A36A 1D9XA 1N0VC 1U9IC 2CE7A 2Y8EA 4PC1A 1VECA 4RZ3A 3THOA 1T5IA 2ONKA 1OXTA 4CZ2A 4X8MA 2QL6A 4A82A 4LJ4A 3EXAA 4M9ZA 2JIZA 1G6HA 2BVNA 3VHLB 4B76A 4QG7A 1YZKA 1YRBA 1XTSA 2XSZA 1E2IA 2IUSA 3GMTA 2FOLA 2G88A 3EPKA 1SXJA 2EQBA 2IYXA 2IYSA 3IO5A 5B58C 1UJ2A 5HKKD 2O8DA 3GJ6A 2PX0A 2EWWA 3RRMA 3WMFA 4PHHA 5EQTA 4KODA 2O0JA 3EWSA 2PEYA 4BGDA 2QORA 3ZVRA 3L0IB 1E2NA 5G53C 4XVUA 3LVRE 4UJ3A 2J3EA 3GLGA 4TSFD 2F43B 3QI2A 1H8HD 5JRJA 5FUXA 2QENA 1W2HA 1GZSA 2V55B 4OYHA 1YHNA 1Q0UA 4JZKA 4TMXA 4LBWA 4B47A 1J90A 3GFTA 1MOZA 2BBWA 3L0SA 4U7DA 2BBOA 4PC7A 4B3CA 2WJIA 1TTTA 1IJEA 3PUYA 1Q12A 1P61B 2FG5A 2XTMA 5UKDA 1ZIOA 4W5JA 4TMTA 4O3MA 1XTKA 3KXIA 3R20A 3EPHA 3C4JA 3TUJC 4KHZA 1VCMA 2R2AA 3ZD7A 3HR8A 3QKTA 1E79A 1V43A 4MDFA 2IUTA 2JATA 1E0SA 1YR9A 2LCFA 2W2XA 4KCGA 4NONA 5FBWB 3WXMA 5HZHA 1KMHB 1OFHA 2A3RA 3BBPA 4TL8A 5B64A 2C99A 1WQ1R 4QGAA 3PEUA 3WP1B 4XD7A 4DKXA 2IYYA 3U4QA 2D2FA 2Z0MA 3VKGA 3I8SA 3OZXA 4Q9KA 2CNWA 1KK1A 1TU4A 2HV8A 2BMDA 2FA9A 1RKBA 1EFRA 4A0GA 2ZE7A 3OE7D 1ESMA 4KI0A 4LDJA 3TIFA 2JAQA 1XMIA 3A1SA 4GL2A 4HAUA 2VYFA 4LBZA 3RNLA 1VG1A 4Q4JB 4D0LB 1FMJA 3T15A 3TSWA 3VNVA 2WAXA 3ADCA 2IS1A 2H92A 1OKKA 5FUVA 1XEWX 4LHWA 1SKYE 4V0ME 1W4RA 3NKVA 1M2OB 1ZAKA 3B85A 1KI6B 1VHTA 1T4GA 4AG5A 2HCBA 4QM7A 4G3XA 4U00A 1KHTA 1N3BA 2FGKA 2QMOA 4HATA 2H1LA 2JJ1D 2O0HA 1Y63A 2IYLD 3ND9A 4PSAA 5FBRB 1FX0B 2C03A 1OIXA 1OH7A 2F3RA 1KI1A 1SQ5A 2VA8A 1D2MA 3OHMA 3MWYW 1N6HA 2OBLA 1ZVQA 5HCIA 5AUNB 4IEIA 1A1VA 2DB3A 2NMVA 2XITA 3PUWA 1UBCA 1E2LA 3HJNA 3GLHB 1Z22A 1TADA 4X8LA 4B44A 2IF0A 2GEUA 4EPWA 4AK9A 5TB5A 2BMJA 1ETUA 1KAGA 4URYR 3GLFB 3CO5A 1W36D 3TQFA 2GCOB 3BWDD 1E9FA 4X8HA 4C0KA 1XD2A 4HDQB 2AFHE 5DH9A 5KSOA 3KJIA 2VSXA 4EPVA 2QMHA 2IX3A 5EZ5A 1P72A 2GXQA 2HXSA 2Q3HA 2W58A 3GJXC 5DYGA 1Y3AA 4D80A 3ZS9A 2ZRCA 3WNDA 2LKCA 2QU8A 2B21A 4LSGA 3VR1A 1Z08A 3S1AB 2FU5C 5DLQC 3LBHA 1ZCAA 3THYA 1P9NA 4JLJA 4V0MA 3K0FA 4MITA 1T0JB 1XCPA 4M1YA 2GHIA 1RE0A 1WBBA 5JJLA 3IUYA 4QJ3A 4JSTA 5K8LA 1X8KA 1G4UR 1Q1EA 1U0HC 3B1ZA 4NZYA 1MO3A 1NSFA 4C0JA 4L9WA 3FHTA 3I8XA 3WBKA 5JS7A 1NMYA 5JHHB 4W5WA 1P3JA 1N25A 4TYQA 3OAAD 3QXXA 1CIPA 1D8TA 3F5FA 3THXB 1RRGA 1KI9A 5L3SA 5H8WA 1GRQA 1P60A 5E7IA 2DFTA 2GVZC 4P4SB 3LH5A 1FTNA 2BKEA 4G5OA 4D0GA 4UKDA 1GNRA 5B2ZA 2QSZA 1KO5A 3SC3A 4JLDA 3ZQJA 4RKEA 4L4UA 4EPTA 3KXLA 4TMKA 1OW3B 2WWXA 1OIVA 1II0A 1EFHA 1KK0A 1KK2A 2J1LA 1CF4A 2YNMA 3PUVA 1KI2A 1V5WA 1ZM4A 4URUR 2WBLC 3A58B 2OAQ1 4RFVA 4B6FA 2I3BA 1WXQA 4HLUC 3BORA 4CEJA 4QHYA 2NO9A 3RS5A 3HPQA 1ZM2A 2W6JA 1Z29A 4GNKA 2WJJA 1Z83A 4IVPA 1S0UA 3H84A 3RSOA 1JPNA 1A2KC 1H8EA 2ZSAA 1XZQA 1RRFA 4F4IA 421PA 3MAAC 1EFCA 4BEJA 4FCVA 5FPKA 2WVJA 3QQ5A 4RCZA 4RCYA 4PAQA 3PXGA 4WVFA 1ZIPA 2F1JA 4OHWA 2ZYVX 4LZZA 4M1TA 3ZQ6A 3CPEA 5C4GB 2BC9A 3BJIC 4Q5IA 3K70D 5FBLB 2FMXA 4XTCS 1CR4A 5KSYA 3K0AA 3PV0A 1P6XA 4Z1MA 3NTUA 1BO6A 1XU4A 5DE3A 4TMZA 3SNHA 1ZRHA 1ZD1A 4C0AC 2A5YB 3QBTA 1AZSC 1E2DA 3H86A 4LX0A 1BKDR 3MWLA 2Q3FA 5JSZA 5DI3B 4UNRA 3MLEA 4Y0AA 3C16C 1NSTA 1XJQA 4DC9A 1U9IA 2IXEA 4LHYA 4PZYA 5KPDA 3EIEA 5TVKA 3U7GA 3O8CA 2RGEA 3L2OB 4HLCA 1E9BA 2WIAA 3P4YA 1E9RA 1IXRC 1QHYA 3BERA 3DZ8A 4YMSA 2ZETA 4CF7A 5JI3E 2KBFA 4GP7A 4XTRA 1XRJA 2AK3A 1U0JA 2RGNC 3D7MA 4PTLA 2WWHA 1E2FA 1IY1A 1UM8A 2C96A 1GOTA 4OBEA 5FL3A 3AV0B 4HYYA 2GESA 3VR5A 1JAHA 2YYZA 4PC3A 2IYRA 3G82C 1RJ9A 3DHWC 2C78A 3BOSA 4DLWA 1OYWA 3VKHA 1OPXA 5EE9A 1N5IA 1MKYA 2XX3A 1Z2AA 1RZ3A 4M22A 3Q3JB 4R98A 2R62A 3SDZA 1N6LA 4RD0A 1KI8A 1XBTA 3N70A 3IGFA 2BDTA 4KITB 2C04A 4GOKA 2F55A 3QKUA 2QT1A 3B82A 4KJZA 4OI2A 3THWA 5CITA 4D4MA 1UEIA 2YINC 2P2LA 4ZCLA 2WWFA 5C46F 5JJIA 1G3IA 1HTWA 2OCYC 2ZSBA 2XGJA 2OCPA 1WDTA 5TV2A 2ZIAA 4E07A 1AKYA 2V6JA 4US2R 5JWOA 5EXPA 4ACBA 2JIZD 3BH6A 5SZIA 4D4KA 5GADl 1R5NA 4C30A 1F48A 4ASUD 3I73A 3NDPA 3RC8A 5IDVA 5JEEA 2O8BA 4NYIQ 1S3GA 2CHGA 3W6OA 4XVRA 5EP1A 2J0UA 1SXJD 2ZSEA 2FEOA 2P0EA 2DHRA 2QM7A 3KB2A 3AF2A 2JASA 3DM5A 4B3GA 1R5OA 1R6BX 4LJAA 2QG6A 1HV8A 3K09C 1AGRA 2FZ4A 3LA6A 2ZUBA 1OHHA 5CB8A 1TQ4A 1OXUA 5GJCA 1GKUB 3HWSA 1P9WA 3K0CC 5DHAA 4EFNA 1NG1A 3ONWA 2BOVA 3RS2A 3L82B 4KFTA 1H65A 3C41J 5FTKA 2BBTA 1Q1ZA 4OI4A 1PUJA 2ZI4A 1D6JA 3P27A 4QL3A 5CLLA 4A36A 3B9QA 4PHGA 1D2NA 2JEOA 4Q19A 3UANA 2DBYA 1M34E 1G8YA 1MO6A 2OSBA 3NEJA 4KVAA 2Q9BA 4LYFA 3AH8A 2H18A 2PCJA 3W6NA 3E70C 1JJVA 3K8YA 4DLXA 4FD2A 3SJZA 5KHOC 1TEXA 4JLKA 1I4DD 4HB0A 4Q4AB 2AFIE 5KSZA 2J0SA 2IEZA 5JMTA 1U90A 1XCGB 3GCGA 1DEKA 1GL7A 1S8FA 2N42A 4B33A 2P6NA 2W6IA 5HPYB 3DMNA 1E79D 4Q21A 2FDCA 1HT1E 3KZ1E 3UKDA 5KNCA 4GSYA 3PITA 5ANRB 3CZQA 2ZR0A 3TJZA 1AK2A 4LYAA 1E4YA 2G3YA 3DMDA 2KI5A 1EWQA 1YZUA 2NO7A 4BFXA 4B3DA 2O5VA 2HF8A 4XD7D 1XEXB 3VR4A 2IYZA 5A0FA 2J59A 2CNWD 5DNYB 2GEVA 4CEIB 3CM0A 3SJAA 1O3YA 4HUTA 1RFLA 2IL1A 3PFIA 1EFRD 1AQYA 4LRWA 3A8TA 1UKYA 1WP9A 5HE9A 3I62A 3NXSA 4A2PA 1KMHA 1WF3A 4A2QA 4B2PA 2PCLA 3HYRA 4CDGA 1OKKD 3KDSE 3EARA 4AI6A 4Q7JB 1BIFA 3NG1A 4URWR 3ECCA 2OILA 3SFZA 2YWGA 3A4LA 821PA 3BK7A 3IIJA 4NU0A 5CM8B 3AVXA 3P4XA 1Q22A 3GJ0A 3RABA 3IIMA 1U94A 3PR1A 4I1UA 2YWFA 3MWKA 3A1UA 1YR7A 2ZAMA 2ZRBA 2ODEA 4UXJA 2YZ2A 4YXWA 2OT3B 4F92B 5DN6A 4Q4JA 3WRYC 2N1BA 4DLSA 3AKCA 1LY1A 3SQXA 1YKSA 4IVRA 3OESA 2MSCB 3IEVA 3CH4B 4R71A 4Q4HA 5JRZA 5KNDA 1TF2A 5JS8A 2WWYA 4GI7A 2C77A 1OE0A 2QRZA 4EPXA 4MKFA 4FWTA 1KZGB 1DO2A 5BQ5A 1ZNXA 1FX0A 3LQQA 3QF7A 1G291 2BMFA 4DDTA 4HB3A 4L16A 4BZQA 2ZJAA 3DEFA 5JECA 4URVR 3T1TA 5JHGB 2DFKB 2HYIC 4ZI3A 4XOIA 1ZM7A 4LK2A 2AD5A 2WV9A 2ODWA 1UKZA 3TW8B 1CP2A 1IONA 1E9SA 1XPUA 4DSUA 3AM1A 4ZDKA 3LNCA 2AWOA 3SZRA 1NN0A 5L3VA 5LDDC 1PZNA 1BYUA 5CYOA 4HLUA 1NKTA 3QXJA 4ILEA 5AJVB 3EA5A 5EE3A 1E0JA 4M53A 5BXQC 5SZHB 2CE2X 1LFDB 1NF3A 5TMPA 2AR7A 1QDEA 3HP1A 5DHFA 4DLRA 3TW4A 1KK3A 1XJ0A 4UNSA 4BLQA 1RW4A 4FW9A 1JQLB 1D9ZA 2R6GA 4HSEA 1JEEA 4Q9IA 5LB2A 4EQ6B 4JL5A 2ZRFA 4L8GA 3DM9B 2J0QA 1M6NA 3BB1A 5B30A 3CW2A 1HE1C 2GK6A 3MJHA 5FL7D 3VR6A 2JGNA 3AUXA 4LHZA 5E7MA 5EXXA 4ARZB 3OEEA 2A5DA 2IT1A 4E03A 3KTAB 3DVLA 1ZC3A 4CT5A 3F3YA 1G7RA 2NG1A 3IHWA 4C2TA 1K5DA 2DFLA 1GVNB 5HR5A 1CS4C 1SKQA 3X1ZA 3X1WA 5AJZA 4BFYA 2IXFA 3SOPA 5CIWA 2MSDB 5KSPA 3UATA 1YZQA 3R7WB 1X3SA 2DPXA 4TYWA 1AA9A 2QA5A 2X19A 2PH1A 3AQ4A 2WJHA 3U6KA 1W5TA 4M2LA 3O8RA 4E5UA 2O8CB 2P6UA 4EFMA 5FPTA 4KBFA 4PHTA 2J46A 4ERNA 4PAOA 1G21E 2F1RA 4P4SA 4KSCA 3W6PA 3EPJA 1G3MA 1KKMA 4TQAA 4IFBA 3TUIC 5F9HA 2IBMA 3IQXA 4A9AA 1OT3A 4C4PA 5F3WB 4IDOA 4B74A 1ZNWA 2RGNA 2WJVA 5JLJA 1R2QA 4P32A 2GNOA 2J5XA 3U44A 4NYIR 4DSNA 3H2YA 4MGKR 4V0OA 1EG7A 2NO6A 2Q9AA 3QE0A 3Q5DA 3K0SA 4IRUB 2ZJYA 1KY2A 3FGNA 2VLIA 2ZANA 1WBDA 5FPHA 4JLOA 3KFXA 5FTMA 4DXAA 1ZUIA 2ZEJA 2BM0A 5JJKA 1M7HA 3PEVA 5EXSA 4Y0VA 4Z1MD 5JZVA 2ZM5A 4IJMA 5AJYA 2GBLC 2HLDA 1YZLA 1X6VA 3FMPB 4K81B 2GCPA 2OZEA 4B3XA 4C7OB 2A7QA 2CLSA 2EU8A 2PLRA 3VU9A 2ZSDA 3QVUA 2CXXA
chains in the Genus database with same CATH superfamily
1LVGA 2QTHA 3BHIA 4HEA1 4DCPA 2BGMA 1JI3A 2ZDGA 4BJ5A 4DV1B 1V8ZA 1FFEA 4OO3A 2BWJA 4C7XA 5B6PA 1N78A 3AJ8A 2O05A 1MV5A 1PLKA 2YDYA 1RS0A 3OIFA 4WESA 1NUPA 5JTUA 2ON6A 3CLVA 2NQTA 4JITA 3GCWA 4K6FA 1Z6XA 2ICAA 3OI7A 4FZ3A 1DC8A 4B4OA 2R6R1 3H0EA 4PSCA 5BPFA 5ALUA 3ZKWB 1QP8A 2Q27A 1XDDA 3P96A 4LBYA 1GDDA 3JS5A 4JYCA 4URHA 1N6PA 4ZT4A 3QF4A 4Q9LA 4PPYA 1E99A 3VR2A 1Z7BA 2Q6LA 3HCPA 2ZAGA 3N0VA 4C3VA 2Z8YM 3JQGA 3V4OA 2JLUA 4UBIA 2VJBA 1T4MA 2G36A 2GPTA 1F0PA 2OG2A 5TMBA 2TMDA 1TXGA 2CDCA 1I7SB 2Q3EA 1KH2A 1P1KA 3CZAA 1ZN7A 3K0CA 1N0WA 1DCMA 2ZBGA 5D3KA 1G8KA 2A84A 3ZY5A 3GLGE 1W6RA 2VHEA 4RD3A 3U13A 5HCNA 1BKSB 5BN5A 1R0YA 3NHPA 4Q9JA 1EK1A 3QEKA 2P2NA 2YQZA 4W5OA 3SS8A 4BB9A 2RGCA 5BMVA 1P2BA 2FW8A 3E7PA 4RM2A 4DW8A 1PQWA 5FTLA 1NUQA 2DQYA 1IOVA 1W1WA 2X3UA 3A2LA 1U8CB 5FYDA 1R3UA 3SJBA 1V0JA 2Y77A 5A4FS 1YI1A 5HJEA 2BFCA 1LPAB 1F0KA 4MYHA 2PHZA 2V5VA 4FXPA 4EA7A 4LOAA 2ZGVA 2IYUA 2YOHA 2BEJA 3KQPA 5IH7A 1VFNA 3OZIA 5IHXA 3AF3A 4FR0A 1TO6A 4IDNA 2XUJA 4UTVA 3ILVA 4J8PA 1NONA 3H2SA 2ZJ2A 3B7GA 1VL1A 4JBYA 2J9ZB 5E1DA 5IRCD 3OVMA 5FOWA 3U7RA 2FN8A 1YH3A 1ISFA 1XELA 2OGSA 2A9OA 3I9FA 3ND7A 3PC3A 3RS7A 2ZBDA 2ERCA 3PS9A 1ENOA 4Y30A 5CK4A 5THXA 5K8TA 2FKNA 5ERXA 4O29A 4WTOA 3L4JA 3EIOA 4MKGA 2AOVA 2WPDA 3FZNA 4HBGA 1X39A 2BTOA 1YJCA 1O5TA 3GK3A 4IIBA 1XXHA 1D03A 3B6EA 1KARA 4P2GA 4UAJA 4YHHB 4Q01A 3MCVA 3T5PA 4KQXA 3AEUB 2VOEA 5IKXA 3HYNA 5M34A 2PL5A 4XJVA 3UK7A 2BGKA 3TTTA 1T91A 2ZRQA 4YFVA 5ITVA 2XGGA 1IH8A 5JC1A 1ONOA 4IDCA 1Q0PA 4PG7A 3U4CA 3WGGA 1DAIA 1N2IA 2AQ8A 2BJVA 1YS1X 4PGAA 3EVGA 5G40A 2Y2UA 4HWRA 3G0HA 3L05A 3L40A 4PZUA 2EYQA 2QRJA 5CMLA 3QG1A 1DC6A 1HQDA 4ODIA 5T3UA 3T9FA 2JCYA 3V97A 3H8WA 4BCBA 4Y2YA 3AONB 1HFWA 2WD9A 3G85A 4N7MA 2ZU0C 1TL7C 3DFZA 4QTYA 3KQTA 5CLQA 2ZB7A 4ZGWA 2WHQA 4PYNA 4KACA 4OQFA 1ILEA 3OD5A 1TEVA 5BV7A 2EKZA 2ZTMA 4JEMA 5BR8B 1NBMA 1DO0A 2BFDB 3G2OA 3WRYA 1SVUA 3QE4A 2QBYA 1F2UB 1MH1A 3T5GA 3CLTD 1E7YA 2RHOA 3D81A 2QTCA 1YBAA 2H1SA 5EEHA 1L6RA 1MAWA 1SM4A 1NVVR 4DIDA 5BRNA 2AMJA 1M6YA 3IMKA 1U7TA 2IP1A 3FF1A 4B73A 5T7BA 2YS7A 4LNUB 3Q2IA 4RS4A 2WT9A 4ZYWA 5CW2A 1Y3IA 1GGEA 2YQ4A 4N4AA 4GKAA 4OXKA 3R5HA 4M88A 1JPJA 4TKVB 5DLEA 1SUCA 4Z51A 2C2ZA 2QT0A 4QREA 3WRXC 1A5ZA 1SUBA 4WIAA 3RC2A 4COOA 1KYIA 1T9BA 1WZUA 4OBBA 4JAVC 5HKBA 1FU4A 1WBJB 3WLOA 2PKEA 4IIUA 4FHFA 1Q1QA 1P2DA 3L6DA 4J0QA 1E5XA 4KH0A 4UARA 4IHJB 5GP1A 4AJEA 4QDJA 3FPBA 4ZMSA 2GEFA 5DLYA 2BKAA 2R7MA 5CB6A 3LUFA 3GLQA 4FCTA 1XAGA 1DMSA 1UBOS 2YY7A 4AC9A 4GKKB 1B6RA 1JEDA 3GP5A 1HL7A 3L8HA 4FHZA 4GNRA 2HU2A 4EG6A 4JUFA 4LF7B 2YYSA 3U40A 3PSAA 4D4JA 3EMBA 1Q44A 3IX7A 1X80A 1YDEA 3NKFA 1ZOPA 1GPAA 3Q9NA 4AO8A 1L4KA 2HKIA 5HJ5A 2E82A 4G5SA 3AINA 2V97A 1K86A 3GGJA 3UXMA 1GHTA 1N2CE 3N28A 1QHHA 1KSJA 1KETA 2D2EA 3DL4A 1JHZA 4FIDA 1Z6YA 1V9LA 3NWJA 5AW1A 4IHKA 3EDYA 3U61B 2QSUA 4JWTA 5J1TB 4D9CA 4AY2A 3G0CA 5DEOA 1UBFA 5BYJA 3MG9A 4DDVA 3Q3VA 4DSAA 1HF3A 4PWYA 1Z6GA 4AP9A 4JI8B 2GAJA 5I7AA 3SX0A 4G1CA 1D1QA 5AHOA 3UK1A 5IU6A 1DU4A 2WUEA 2IS6A 3JQBA 2IDKA 3NH9A 1Y3CE 3DE4X 4X1YA 3LC0A 2YJ4A 4DCTA 3A25A 4ECEA 1AJEA 3VH3A 1SB9A 3FVVA 4GR5A 4V03A 3HBLA 1WZCA 4JCOA 3WY9A 4BMXA 1AKVA 2HNBA 5HKAA 4M1MA 3SIXA 3UY4A 1UPCA 1ZICA 2Y68A 4B81A 2X8WA 4I9GA 3AR8A 4L08A 1D2HA 4Q05A 3H87A 3WGUA 4LVCA 4BFSA 3R7DA 3U3RA 3CF2A 2GWRA 1DX9A 4F3RA 1VYTA 5B1EA 1Z74A 2C8KA 2XV1A 2D3WA 1ONBA 2HCJB 1MQAA 1Z0IA 2Q0QA 3JZFA 1XQ6A 2OFOA 3N39C 2Q21A 1T2UA 4N3CA 3ZWYA 2AW5A 1WR8A 4C89A 2C9BA 3RF6A 1LLFA 5M04A 1XHEA 4R01A 4B8ZA 2V7QA 1WQ3A 5FIUA 3ZWVA 4W82A 2WRZA 5WRFA 1GCAA 3R0ZA 1JHRA 2JHCA 5FI0B 3CRVA 2VJCA 4GOLD 4OX9B 2JCXA 2GHTA 2PSHA 3L8ZA 3RANA 1Y89A 1YBMA 2QLBA 3COVA 3O4HA 3Q5EA 3RIMA 1XALA 2SCUB 3BXFA 3OQ1A 5AUPB 3O2JA 3J7TA 4C0XA 1V3QE 1WW8A 2FN9A 3PR2B 2AI1A 1G20B 1KYXA 4WOCA 3RSCA 4B83A 4DNFA 1T2CA 2IXBA 4RV9A 1KHHA 3R2JA 1JV2B 3OLVA 4TV8F 4OFWA 3WNQA 4B5LA 4F8YA 2P68A 1SIUA 1YQQA 2O07A 1N2SA 3AMVA 4KR2A 3DMFA 1UADA 1HXHA 2HIGA 1SHJA 1ABEA 2CUZA 5AH0A 5HTKA 4EAQA 4I8XA 3RU9A 5CG1A 1T0HB 3VQTA 1ZMTA 1HMYA 1IEQA 1W30A 2NADA 4TRJA 1P19A 1DIOB 2HJVA 1X2EA 2P5YA 4G5FA 1THTA 3D2CA 4C5AA 1U0EA 3PIRA 5AKLA 3E22B 4Q1VA 1T35A 4LOHA 1J4AA 2HPAA 3QIVA 2FSFA 1C9DB 2Q1XA 4QSMA 4ZALA 2F17A 1R4AA 4HVTA 1C7ZA 1VCNA 2PQ6A 1KQNA 4NCIA 2D5AA 5EJEA 1J2JA 2XCRB 5THQA 5ADUS 1TQDA 2DFVA 2Y71A 4RZSA 4TLDA 3REFA 1YNOA 4MCJA 3T7AA 1AM4D 5LQAA 2Z6VA 1W36C 1QO0A 5A5VA 5L3QA 3LBAA 1Y1SA 3AW9A 4BY9E 1I7NA 5HG0A 1Y5MA 3ML1A 1JG2A 4B3TB 4YONB 4AURA 7ABPA 2MU1A 2UV8A 4YJHA 3ZGXA 2I4IA 4Q66C 4F4UA 1JALA 5KHAA 5KTRA 2P1RA 4ER3A 1B8PA 1VJRA 2AXEA 3CCBA 5E4YA 1KQFA 1T5LA 1WUTA 5A3RA 1VJ0A 4MPDA 1IBRA 1PZXA 3BULA 5B2FA 1RPZA 1TIBA 2J3LA 1XTQA 4DDHA 4C05A 3RAGA 2OGZA 5JCZA 5DGCA 5K3AA 3I37X 2X5JO 2QN1A 1GG2A 4OQLA 4PG5A 2PR2A 4OAQA 3PHBE 4Y2QA 1P74A 1Q1AA 3X2FA 4WBNF 2OD2A 4RFSB 4ZPJA 1MAVA 1JPVA 4NPCA 2B35A 3GAMA 1JSCA 4UHEA 4JJ8A 2J6BA 4NHEA 2F67A 4JGBA 4BNNA 2C5SA 1QC5B 2V54A 3EASA 5A5GA 3KT8A 5ECWA 4NCKA 1E1CA 2X9QA 4U5XA 1TZJA 2OYCA 4OGFA 1B14A 4XUEA 1Q16A 2OB1A 3HCDA 4Q1AA 5A7HA 5ESXA 1AU9A 3B1VA 4D43A 1W581 3FVQA 4GMDA 3W5UA 1EWYA 1E0KA 2BFOA 5G0TA 3GT0A 4X8OA 5EJGA 4F4JA 2AOTB 3OF2A 1KQPA 1PTJC 1U0SY 1FFHA 4H1TA 2V96A 3RQIA 3RSGA 4D4LA 3FCOA 2VDRB 3PHJA 2VNIA 4JL6A 3W34A 4DF3A 2VNKA 5BSFA 1SFRA 5GVSA 2AN3A 4AB1A 1D6NA 3QKSA 3BG5A 1FEZA 3RLIA 1CQZA 1DKOA 5AJXA 1COWA 2W98A 1X8JA 1NVMB 4FMPA 1SOAA 4V1CI 2I6QA 1R0SA 2IC5A 1X7YB 2FWAA 2P7IA 2PTHA 3D7LA 2JGDB 4JQOA 3AGQA 3LY5A 3OLQA 2XNCA 1QAQA 4B71A 1A04A 2R65A 1YCHA 4ZFNA 1R0CA 3NR2A 3H9QA 5CDYA 1OI7A 4CCYB 2JGIA 2QTTA 4R81A 2QGZA 3B6JA 5EKTA 5BUZA 5CX1B 2XE7A 4RE6A 3KKKA 5JROA 1XPJA 4BE7B 1K7SN 2RH5A 1BS2A 1ODSA 1QIEA 3WAJA 1EB8A 1SMKA 2WTNA 4MQBA 1G5FA 3R3VA 3EFHA 3NBKA 3EWIA 3M34A 5L7TA 4G8CA 3V34A 4M4SA 1M2HA 5DWQA 1BCRB 1SPXA 4Z49A 3INTA 2ORIA 1F4PA 4JA0A 4I1RA 4MGHA 4UXHA 1ID8A 1FRQA 2H2GA 3SXUA 1UJNA 4LQ4A 3TCXB 3O03A 4YGXB 1XCOA 5JFOA 5L4NA 3B1YA 3WBFA 4ENTA 5AVTA 3AUTA 3MYRA 1DARA 2QJOA 4H7PA 4DZZA 3K71B 1JR3E 3ET4A 2CFTA 2LIPA 4FYVA 4X7PA 3DDHA 1C3EA 2I2DA 2VVTA 3HBAA 3HY3A 3WRXA 5IAOA 2WF9A 3T5BA 1PNRA 1JSXA 1LTQA 3FDFA 3QI7A 3R3JA 4L5BA 3TLZA 5F5XA 1P9RA 2BLLA 1KP9A 1KY3A 1HSZA 1OY1A 2Q28A 1VIMA 3B3FA 4O2BA 3LPDA 4DCGA 4UTPA 3BS4A 1PHRA 1TCVA 2Q4BA 1GG9A 7AT1A 1HZJA 4Z99A 2JK1A 2P30A 3KTOA 1JG6A 2C0CA 4NSNA 1CUDA 4N3NA 4R83A 2PT7A 4RBNA 5EQDA 4XYMA 4QQFA 3U7IA 2GEBA 1WEKA 3KQLA 3LGAA 5ALWA 2E4WA 1RDFA 5ADWA 3K5WA 2ZAOA 4BNZA 4RYDA 4RZ2A 4CQMD 4XPIB 4H27A 2YFKA 1WDLA 3GXBA 1X0XA 1CHNA 1EWRA 1JVBA 3DBRB 4H16A 1Y1PA 4GECA 2AXNA 1MN6A 5FWXB 1J8YF 3SAJA 1THZA 3MGGA 3MOSA 4FYYA 3RC7A 4YRZA 1C1HA 3EGXB 5PGMA 2Q5IA 2L82A 2IPXA 1G0OA 3LO8A 4O0MA 5HYVA 3CX3A 2A9VA 2FMFA 2YWRA 3C6QA 1EAMA 1BWSA 1GLNA 1II8B 3H13A 3H9UA 2I62A 2HH9A 3GRKA 1QYIA 4HDOB 4MI3A 2WF8A 4UNPA 5C8XA 1H2XA 2C9ZA 2UAGA 2X7JA 5DXJA 5F23A 1QIDA 1PL8A 3AJRA 5AOAA 5TY0A 5T4HA 2QE6A 3FZEA 1Z28A 4J1NA 3I8OA 4MCHA 4MIOA 1SIOA 5F4ZA 2A58A 2R1VB 3IAEA 3WGVA 4U0JA 1Q7CA 3QPWA 2C4UA 5IKMA 1K3TA 5DIZA 4F3CA 4U7WA 4X7MA 5CXSA 1FFWA 1JA9A 1K89A 1TF5A 3F3KA 4ZVTA 4JJIA 5JAUA 1DZIA 1Z5WA 3U7EB 1IY0A 4OK5A 3NAZA 1YRAA 5EP3A 5FA8A 4M21A 1EEXB 1PEAA 1RYDA 1SC9A 4BRWA 1SCBA 1EJ6A 3A4IA 1EWKA 4JFAA 4I5FA 3IJ5A 1M8JA 1MQSA 1XTVA 1CVLA 1KZ1A 1TVKB 3AM5A 4RGVA 4QBTA 5DW0A 5HGXA 4UNNA 4P3PA 2W2LA 3TW0A 1Z5OA 3K8ZA 4OMCA 5JH7A 1T2AA 2F1OA 2M6KA 4JI3B 4LXUA 4YUYA 3AETB 3MWDB 3LQ2A 3OZBA 4BAZA 2O54A 2WMOB 1XAIA 4G0OA 1HFKA 2GK3A 3U4IA 4PBSA 5M5BA 4Z4EA 2JGAA 3OE7A 4WNAA 5IEBA 5B7NA 1HLPA 1EE1A 4V3CA 1EBUA 2ZRAA 5TQVA 3PWTA 1PBTA 2A2ZA 2VYCA 2XD9A 2YXNA 3MB5A 1O0SA 1ZM9A 3QEOA 4AKSA 4F2HA 1Q20A 1NNSA 3BEDA 1C9MA 3ZWBA 2XCTB 2QD5A 3EVEA 1UUFA 2VTVA 2BEVB 3T3PB 1MAUA 4YDSA 1R8YA 2CFSA 4ZHQB 4B6RA 4WBNA 4HTFA 1BWRA 3JRWA 1KKLA 4YAEA 4J0EA 2BM8A 2NZ8A 2HUPA 2HHAA 3CB4A 2Z6UA 1BEUB 2XB8A 2IS4A 2G25A 3N2LA 1O97C 5DASA 2MMGA 1C7EA 4IKEA 3W3ZB 2VZ9A 4RK5A 4HNVA 2VTBA 3A1FA 1J21A 1HH4A 2ZIUB 1VLZA 3LOPA 2ZSUA 4WXRA 3X1DA 4UEJA 3GRVA 4MTLA 1GG5A 1PT5A 2A1TR 3OPMA 5GVRA 2A78A 4UW9A 2VXOA 3W9SA 4CKYA 2D3TA 4RH3A 3TZCA 3OJ0A 3GVXA 5TGTA 3WI7A 2NSHA 1A82A 2AG5A 4IKPA 4FS3A 3Q10A 1D2EA 1NP6A 1OXXK 3WXBA 1TM2A 1T2NA 2JI4A 1UXJA 3PYLA 4BL5A 1CR1A 2W71A 3L6EA 3R5TA 3K0KA 4QUKA 1CJVC 4RWZA 1QB7A 3SZMA 1SU6A 3HBMA 3KKPA 3X43A 3BF8A 1YMQA 2WVHA 1JLKA 1U1EA 2CLCX 5FPPA 3RC1A 1IQPA 1VIYA 2PD6A 5FH9A 3TZQA 3BB4A 3L93A 3CVYA 2WC1A 1AUOA 3N5KA 3W2FA 2JRCA 2B99A 4PV7A 1JU9A 1R6XA 3OWOA 4Y2HA 1E2KA 1H3NA 1OX4B 1YDMA 3T3GA 3WISA 3R8FA 2ZZMA 5L3SB 5PNTA 2CLEB 3BIFA 3DBHA 2GBFA 2P9CA 2FJPA 3OZAA 4UD6A 1HORA 2JH3A 3MERA 3S2FA 1NU6A 4B3RB 3THXA 5IFLA 4CCSA 5LKAA 2DSTA 3T38A 3U9LA 1T5DX 2ZRHA 1ZCBA 4E22A 4HRXA 2H4JA 1II9A 1S5PA 3HB0A 4TQGA 2VF7A 4OQNA 2IA5A 2L42A 1WVIA 4B09A 1D2CA 5AXBA 1F0YA 2B3TA 2XT0A 1IHUA 2QUZA 2NUAB 5CVTA 2OPHA 1VHLA 1I2DA 2QV7A 2GM9A 3PDCA 4L28A 3GWZA 4M46A 1JYSA 3C70A 4RKFA 4TVSA 3HTXA 4C4XA 3NANA 4QGGA 5D5QA 5LPNA 4H7FA 3R7SA 1U8AA 2Y4NA 4NF2A 2I76A 4U7HA 2O2SA 2QUIA 2YWEA 3A6JA 2PO7A 2H1RA 2LW7A 1PTJA 5AVKA 4CL8A 4UOEA 3O1JC 2ZBUA 2V6IA 4P5PA 5GV8A 1N6OA 2WINI 2B37A 4KFUA 2PT5A 2VSOA 3I9V6 1DADA 1E5DA 3ZOKA 1L2TA 1QVRA 1VGQA 2C9YA 4BKMA 1FF9A 3RKUA 3HY6A 4IIYA 1U8EA 4BZQA 2QLFA 5EP2A 2IPNA 2ZUEA 1ZSYA 2JJQA 4NFHA 2V7PA 4TMYA 3M2PA 1U81A 2H65A 1IM2A 3CKLA 3ZLUA 1GT6A 3T54A 3UHOA 4EOGA 1VL8A 2BZ1A 2ADFA 2WFAA 1UWCA 3MFYA 3O4IA 4PPNA 4RESA 4WA8A 3ZH9B 4FHDA 4DJJA 2G6TA 2GLTA 3MSCA 4C0QC 1BGVA 1MPTA 4OXRA 5TR9A 3EEOA 3QM1A 1SZJG 4IIJB 3CCCA 3M6XA 10MHA 3GC6A 3LP8A 4UQPA 4M8LA 4Q1EA 1NC3A 2YCLA 1VBFA 1XR3A 1QK5A 1GL9B 3D3QA 5KAMA 2M6LA 1QIMA 3RVDA 4JNCA 3G2KA 3RYFA 5I8WA 1HR0B 3MCUA 1EVZA 1YU9A 2ANBA 1KJZA 3P97A 4GO1A 1HEUA 1PLLA 4WRRA 1G41A 5F4BA 1GNTA 2IW1A 5MDHA 1HGXA 1VA4A 1J25A 3PEEA 4MJXA 1Y5NA 2Z2YA 3FNQA 2NYAA 3KEMA 3UGQA 3VR5D 2D1TA 4X20A 1ZITA 4FW8A 3CH5A 4X3PA 1JT2A 1X9GA 5E3HA 5EXDA 1FB5A 3WIVA 1CEYA 4I55F 3ZHUA 2BEWA 4KGVA 5J63A 2HMAA 2X1HA 1WJGA 1EP1B 3W9YA 1DEOA 4D99A 3KZOA 5GONB 3VZCA 4D26A 5EVCA 2VK1A 3B3GA 1XCJA 3H1TA 2YZGA 4OMFG 3UO8B 4I99A 3L18A 2ZB3A 3CNHA 3N2GA 1D09A 5AI5A 3TAHA 4FOLA 5JALA 5HNKA 1MB4A 2CMDA 1X42A 3CNBA 3H75A 1E5QA 3I28A 3NM5A 3V4SA 2YHBA 3PLAE 3UOGA 5F3RA 3WADA 5TARA 1U7HA 1R6TA 2EP5A 5ILOA 4ILKA 3SK0A 3A6HA 3G8YA 3COSA 3NNDA 2QJTA 1S1MA 4NBRA 4LRQA 4R84A 4F0JA 2EFJA 2OAGA 1M2FA 3NM4A 5EJ9A 5E6RB 1GUDA 2WKPA 3G2PA 3KQSA 4TV9A 2G8LA 5JYBA 4A0HA 1QYXA 2NM0A 1N0UA 1U2SA 5HJ7A 3B2EA 1N6RA 4I5GA 16PKA 3QE2A 1T4CA 4I1VA 3NORA 2ODPA 3LKZA 3DEZA 4YYZA 5BN3A 2C2WA 5IWCA 1U6IA 3CRNA 2D74A 2GAAA 3NGXA 1CUBA 4TXHA 3U0BA 4BP3A 1X7DA 3LYLA 3KYDA 2QTNA 2G5CA 2ZSFA 3E3NA 1G9TA 4LGYA 2XRMA 1IULA 1NT2A 2FPRA 2XWBF 4PR3A 1BZYA 4PX2A 5TT0A 3KYCA 3EXG2 3WNZA 1PRYA 1WW2A 1ZBQA 2ZRGA 5EIFA 3IP1A 4S1PA 3LDAA 4O5AA 3TQCA 3ZEAA 1QYRA 4CKBA 4DLPA 4AULA 5J3JA 3OOWA 1O89A 2BFPA 3CUEF 1GP2A 5HZGA 4MYTA 3RIEA 2P65A 2QB5A 3KQMA 2C4VA 2H7VA 4HFJA 4PE5B 5HQ3B 1Y1TA 3MF4A 3NHBA 1IJBA 1QGUA 1X1CA 3U60B 2OUKA 1YJ5A 3O4FA 4KHPB 4FYXA 4DM3A 3FZYA 5K4GA 2VHUA 4CG2A 1ISIA 3Q0IA 3JRNA 3KPVA 4JSRA 2IEBA 2QTWB 4PZZA 4PEVA 4BIMA 1ZIDA 4O6VA 1Z6TA 2ISSD 4DIOA 4RIEA 1R4NA 2WF6A 2E89A 4BN0A 2YR0A 2CD9A 3GDWA 4FEYA 1WB5A 2HQSA 5JNWA 2CWDA 4TV8B 1PW5A 4D8TA 2Y3IA 1NVTA 3HLKA 3KZNA 2KJQA 5JEDA 2OV1A 3MK31 4LCBA 2XYGA 3FAKA 2X1VA 2PSDA 1RWBA 4IOJA 3JYOA 1RXSA 5H3LA 3UIEA 2O8EB 4XUGB 4QJ5A 3CNEA 3RGGA 3HYTA 5EFZA 3BL5A 3UQZA 2C97A 2CVHA 2Q5QA 3OQBA 4MRMB 1L4BA 4MMYB 4I81A 1AA6A 2HHHB 2DX7A 2GGSA 3IBGA 4RM3A 2J87A 3B1KA 4YUVA 5DTMA 1G19A 4CMCA 1G55A 1UINA 2AZXA 2JHFA 2YXBA 3E61A 1HLFA 1VHWA 5KNCD 2J3MA 1V4NA 3KQQA 4N0DA 2PZAA 5SICE 1SUDA 2ZIVB 2RHRA 4ZC1A 2ZS8A 1HY3A 1RHJA 1E4EB 2CEAA 2JBAB 4GOOD 2ZI7A 521PA 3VH4A 5EJ5A 3G17A 1ULAA 1SU7A 1DAHA 3NDRA 1UZAA 3ISTA 3VGPA 3VAAA 4IV0A 3CHYA 2ACWA 2GOYA 3QWAA 5I8PA 2ZTVA 4KFSA 5L4LA 1R0ZA 4N76A 1E5TA 3S44A 2YBEA 3UHFA 1L7VC 4N41A 1MJHA 2GS9A 1FS5A 5AW8A 3BM5A 5I7FA 2FI1A 2Y2VA 3A06A 3IAS6 3T3DA 5KCZA 1KJJA 1GPH1 2H5JA 1H4VB 1PT6A 3CJRA 4R05A 4Y2SA 3VU0A 1PO7A 1SA0B 1PJ8A 1OIWA 2ESRA 4DIEA 2AUNA 1GCIA 2KWIA 3DBLB 4WEOA 1T9HA 2X0FA 2IHJA 1NDUA 2IK8A 2PT9A 3F9RA 4YT4A 3MHPA 4G5RA 4PZLA 5DX8A 3WGYA 3DW3X 2IOYA 3ET5A 2XXBA 5KKCA 1ZCZA 3UFXB 4PAMA 4QNNA 1CW2B 1E3MA 2G40A 1KEUA 1RIIA 1ZD8A 2JHPA 1KOLA 3EPPA 4BZZA 3I1IA 2OYSA 4PBTA 4YRAA 3L7YA 3LQRA 2P5SA 1Z7YA 4IJ5A 3ZJ5A 3MBOA 4GUAA 3K6RA 1LK5A 2PZKA 2ZYHA 5SZJA 3UBMA 3ADDA 4JLWA 4XQ0A 1F6WA 3ZQ4A 4CM9A 1JDPA 1XA4A 1TDJA 1W88B 2WAMA 2Y1LA 1E6WA 3MWJA 4YRLA 4EY3A 1RRPA 1P2GA 3GP3A 4BVAA 3NVKI 1DUIA 1G5TA 4KN9S 2XMQA 5ARDA 2VATA 3LT1A 4WBXC 4BLSA 4YV2A 1TAUA 2PTGA 1QF7A 5GZ3A 4J0KA 1REQB 3HLYA 4BFCA 2FSSA 4QFMA 3VOAA 3DJYA 4HDAA 5KNDH 2P4HX 3TGPA 1XVTA 3TFWA 3I6MA 4Z9AA 3IBYA 1XZJA 4M8SA 4FXOA 1E1YA 4FPXA 5LLSA 3ZDYB 4CVNA 3TDMA 1GCGA 2F62A 2JGFA 4B43A 1YU6A 1I6KA 1NRJB 5FOSA 3JALA 2O3QA 1K8RA 3CTMA 1FVFA 5KOHB 4UEQA 4YXFA 4OQDA 3UJAA 3UMFA 3WV4A 5JV5A 4XSVA 2E55A 1L5KA 5EHXA 4PNPA 3S2ZA 4NZMA 4TL9A 4P81A 2PX5A 1GPWB 2DF8A 2G4CA 5BMOA 4KLNA 4HQ6A 3I5YA 4H7IA 1L8XA 1I4EB 3PU6A 3DHNA 1A77A 4I55A 1YI8A 1V39A 1P4RA 1QCCA 4O8ZA 4QUJA 4WDRA 1Z4IA 3LQFA 1M8PA 4KPGA 3KHTA 2FXIA 3WIDA 5FBZA 5EPOA 4RVSA 3NH6A 5JDIA 1U7XA 4E2WA 5IXSA 3WG9A 5JBIA 2QE7A 1RC0A 5JDCC 1XNJA 1NNEA 2V0NA 3OICA 1GFIA 2VCYA 4XCQA 1AZWA 3FMIA 3GHYA 3RUIA 3OEED 3AVUA 3I2KA 3LAWA 2QRQA 1G8MA 4KMRA 4IIFA 3RV4A 1AGNA 1YGYA 3VR6H 2K87A 4BNGA 3OIGA 2TMKA 3KJZA 2I71A 5LYJB 1GTVA 1T4DA 1TUBB 3CY6A 4Z9FA 3MCAA 4WCFB 4ZYTA 1TI7A 1YDFA 2ECOA 2VPQA 1BMFD 2Z4TA 4YBRA 4UZEA 3WDKA 1HRDA 5JYEA 1NX9A 2PWBA 1C8BA 2Q45A 2X4GA 2XVYA 4A4DA 1NI4B 3OFNA 2VUSA 4IFTA 2VC2B 2WPNA 3JQAA 3K73O 3VYRB 2OHOA 3C3KA 1N8NA 1UKCA 4Q12A 3ZZMA 5KKNB 2C1EA 3VMFA 4AUMA 2O0MA 3SQOA 4BTLA 3M6UA 5IM4F 3D6TB 3HDQA 1QU3A 1PHPA 2XDWA 2HDNB 4IRMA 4ZO8A 3D6MA 3FHCB 1TT5A 2ZLBA 4CHTA 4Z6KA 5BSKA 1BS9A 2AOUB 3L02A 5KJ1A 3M81A 4MS3B 4F4FA 1U2ZA 3V3TA 5JSYA 1IJFA 3PFHA 1A2BA 1IQ0A 4P4NA 4QJ4A 3U3DA 3NYQA 3WB1A 3E03A 4OOEA 3NBAA 1U8UA 4WN9B 2ZYWX 1MH9A 2MSEB 2RJNA 3NGMA 5ENZA 3FRHA 2J0EA 4CIBA 5JSUA 1MJ5A 3GT4A 1NBWB 1IBKB 2H31A 3EVCA 3HABA 3NYWA 4ZQGA 4ZV7A 2W0MA 1VE7A 4ZRNA 3TE7A 4BLPA 2P11A 2PL3A 3GU3A 3WICA 4YAWA 2DMRA 5D5PA 1T3GA 2HT1A 4BMCA 3B9BA 3DXYA 2PPVA 1JXOA 5DX0A 3O2NA 1W5BA 4JT4A 2QTLA 4HH3C 3JYQA 3FMVA 3Q5GA 4O4HF 4PINA 5ICEA 1ZNYA 2GZDA 1TOAA 3QELA 1V1JA 3KKEA 1MABA 1VTKA 5BYAA 2XJ4A 1GKYA 3EPRA 1UANA 3LSTA 2CLMB 4KDRA 1L8QA 1O95C 1CKEA 1YCGA 4ZEVA 1ABBA 3LDFA 3P9NA 4EG3A 1VL6A 2B8JA 4B3BA 4EVSA 3GGCA 3BQ9A 4RYLA 5AJWA 2M1ZA 3I6YA 5TGZA 5EMMA 3PR3A 5CAEB 3OHPA 4Z3OA 3ETGA 3EGWA 3SJCA 4GPTA 1QG0A 2D59A 4P82A 2IXTA 2HI0A 5FUWA 2VZ0A 3TLAA 5D87A 2GA8A 3GI1A 5DNCA 1CZHA 1UJ6A 3EVZA 1NOIA 1WXEA 4QC2A 2AKAB 4XPZA 3VU9B 2JIDA 1GTL1 1QGAA 2O8VA 1UMCA 3LC7O 1G6KA 5EWJB 5JNRA 4I46A 3T7SA 2CHUA 3CWQA 3DUFA 1Z88A 4PC6A 2JAUA 2JJ2A 4FDLA 3HYCA 4Y2XA 1SZDA 4QXOA 1LLUA 1FS4A 4KQMA 3N8DA 3HJHA 1U0RA 3OBIA 1AH2A 2CNBA 4PYOA 2VWHA 1YQTA 4BJ6A 4ON9A 1D4AA 2FWRA 4EYKA 4HLNA 4E5DA 1DAEA 1K7EB 3GT3A 4GD3Q 1L5WA 4A92A 5BSHA 1A9QA 1N36B 4M7WA 2XOEA 1TQ6A 3CZ4A 3LUPA 1PVOA 3FYCA 3OPYI 2EF1A 1JP7A 4X62B 5EOVA 1NDQA 3KUUA 3DLTA 4NENB 2AF3C 2VXYA 1WG8A 2QRLA 4K9NA 2PRZA 1D6SA 2EVWX 1DQRA 5CA0F 1XQ9A 4MR7B 3BFJA 5BUSA 4FNMA 1TCAA 2ECQA 4UNQA 3UWOA 1U0BB 3W06A 2H1OA 2DBZA 2NU8B 1QZZA 4OQQA 3DP7A 4WNAB 1S02A 2O2HA 2A1IA 2C59A 2VXBA 3O38A 2ZQ5A 3QX9A 1AXGA 2E37A 5ELXA 2ALJA 4C0HA 1FBTA 1T5SA 4NBUA 2B2XA 2CL7X 2HBYA 3G8AA 4K1XA 4IILA 2EIHA 3RS0A 4KGZA 1XPRA 1M74A 3ASUA 3UK0A 2GK4A 1SULA 3F67A 3OIWA 4CIWA 4E30A 4YCLA 5K8UA 4V2UA 3BRCA 3UAOA 4D45A 1J8FA 4G0ZA 3DMTA 1UQTA 2P8SA 1PS0A 4PO1A 1C1DB 5DTIA 4BFLA 4K7JA 4ECAA 1P80A 4NV3A 3A37A 2C0QA 2ZUVA 3OU6A 2R2GA 2VJPA 1Z56C 4IDPA 5FA5A 3W2IA 4ED9A 4LV6A 4DHEA 3IAM1 3U7QB 5E6UB 4BN4A 1KOFA 4UEOA 3EZNA 3K9CA 3DTVA 2FR1A 2EFCB 2R47A 1J49A 4QYTA 4TLCA 5CHEA 4DR6B 1BMDA 2DGDA 1IMJA 2O8DB 3BF7A 3O5AA 4FBLA 1WP4A 2JFQA 1I5EA 4HBZA 4RVHA 1A50B 2QZ4A 1CDOA 3PHCA 3KJGA 3SKYA 1G9XA 3T7TA 4CG0A 4MR9A 1Z06A 2I9PA 5LJIA 2EW1A 5CT4A 1E58A 1YFJA 3HB7A 1OU4A 2VLBA 2IWRA 3R5FA 4YPVA 1TEZA 3NONA 3CRMA 3AP2A 5FWNA 1G1MA 1ND6A 1JJFA 4AJKA 1NBEA 1G5QA 1OWLA 1CQPA 3L0ZA 4CT0A 5HKKA 2IHNA 3N07A 3ENKA 5FBKA 3AEUA 3BT7A 5C4IA 2CFCA 1UK9A 1QWSA 1A7UA 2EDCA 2PZGA 1Y7TA 1BU8A 2GXSA 2D5IA 4RIFA 2IRWA 3OEHD 5TQ2A 4AG6A 2REQA 3CVOA 3TQOA 3WWZA 3DWFA 5K05A 1UXKA 3CKYA 2O2IA 4JOBA 5B3JC 1PZHA 4CQMB 1AQJA 4V02A 3CU5A 4ZYLA 3GRAA 3PT9A 1DNPA 1YA6A 3EVAA 3QU5A 3QXGA 4P92A 3F7TA 1B1CA 3N0RA 4RK7A 2ZJ5A 4RWEA 4ZICA 2XZPA 3L7BA 4WADA 5BRJA 1BXKA 2EFHB 3UKOA 3GZ4A 1IVNA 2M9MA 2GRJA 4W7SA 3P9SA 6REQB 3IR7A 5IM4A 3TL3A 1J9EA 3Q3GE 2E5LB 3RYIB 1VC2A 2BFDA 2HFJA 3LK7A 3ROKA 3O47A 4UXIA 1JNXX 1F2UA 2FZKA 1FP1D 3TNLA 4A10A 1YVDA 1EUQA 2W48A 1E2JA 3I9MA 4G1BA 1QJ4A 3ZWMA 3WGMA 3QBDA 2GJ8A 1FRVA 1Z36A 1H5UA 4R40A 1BA2A 2FQXA 1W44A 3JVUA 2ZUDA 1M0WA 4DMCA 5JSFA 4JI1B 2ZR7A 1VYUA 1PT9A 2R9VA 3BTOA 2Q49A 2IYQA 3FB4A 4MI6A 4RX1A 3CLRD 1L4YA 4L6IA 1O8BA 4XUCA 2EGGA 1JXQA 5FADA 4DCCA 4CR7A 4LTNA 4MV3A 4EGSA 2FLWA 4H3VA 3VISA 3BHNA 2A86A 4MNTA 3ZHZA 3WBBA 3EF3A 4JUBA 4MV1A 5DK6A 4WLUA 2XA1A 4IHJA 4MUXA 3FSJX 4IGEA 1F06A 5HK9A 3BTSA 1SQSA 4EG1A 2BZ0A 3JQPA 4O4HA 1F5NA 2OHFA 4KVFA 4TQ9A 3UUWA 121PA 3WIBA 1U4OA 1OFGA 2AHRA 5JDCA 2NT3A 2C4WA 2JAXA 3V1YA 2DYKA 4QRHA 4L4YA 5JSKA 1GUAA 4GC5A 3USZA 1FFBA 2Y6UA 2XB4A 4JX8A 3ZY4A 1X2BA 3AY6A 5E7QA 1RYZA 3C3XA 4EX6A 2JAHA 2WSSD 1K6XA 3E1GA 4OGWA 3SWWA 1A7AA 4FFDA 3GFRA 4LF4B 2GF9A 2JBWA 3GG2A 4TL6A 4GYJA 4JYZA 1HO3A 3BRWD 3WK9A 3GNSA 2A0XA 2GUWA 4UMDA 4B84A 4BKUA 1Q7BA 1RR6A 1GKIA 2FSHA 5BYBA 4MW7A 1C3LA 3PNYA 4R8LA 1W75A 3RS8A 4EHBA 5AW6A 2KLHA 3K8QA 2YV2A 5JISA 4W5HA 1CBUA 1H6CA 3BWEA 2AI2A 4XB6B 3EPLA 1OLOA 1S3SA 4AXXA 1GDHA 2RG1A 4MOWA 2DZDA 3T5DA 2A1UB