3C8UA

Crystal structure of putative fructose transport system kinase (yp_612366.1) from silicibacter sp. tm1040 at 1.95 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
206
structure length
206
Chain Sequence
GMTLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPMDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLFDRARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPMADLEARLVQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPADLTWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructokinase
publication title Crystal structure of putative fructose transport system kinase (YP_612366.1) from Silicibacter sp. TM1040 at 1.95 A resolution
rcsb
source organism Silicibacter sp.
molecule tags Transferase
total genus 73
structure length 206
sequence length 206
ec nomenclature ec 2.7.1.4: Fructokinase.
pdb deposition date 2008-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3c8uA00
2JJ2D 3NWJA 3PG5A 4GZMA 5HE9A 4M1SA 3U44B 1GZSA 4M1WA 2GJ8A 1OH6A 1OF1A 2JLWA 1E9DA 1KJWA 2RGNC 3GJ7A 4GL2A 3EWSA 3T1QA 2EFHB 2V8OA 1LB1B 3MG9A 2RHDA 3TW8B 1VCNA 4DC9A 2OBMA 3MGCA 1IXRC 3GJ4A 4CZ2A 1F2UA 1MV5A 1Z0KA 4EJSC 3SDZA 4C7OA 4DKXA 5CM8B 3PEYA 3QBVA 2CL0X 1HQCA 2GXUA 4OKSA 3NC1C 2D2FA 5JEDA 4M4SA 2F7SA 3IO5A 5EQTA 1YZQA 1R0YA 5FI1B 1FP6A 1CP2A 4P0TA 1D2EA 2VHJA 1NN0A 1S8FA 3PEUA 4IOLA 4L8GA 3K09C 3WY9A 1Q57A 1I4LD 5BQ5A 4DUGD 4DLSA 4IW3B 3KXLA 3Q7QA 4WXRA 2QAGB 4OI4A 5JJIA 3VX4A 1VIYA 4RD3A 2ZRAA 2CCJA 1OKKD 2PZFA 2GDJA 5EZ6B 1NMYA 1CRPA 2PL3A 1NLFA 5JSZA 4BLPA 4MITA 4F7WA 4LBVA 3BFKA 4Q9HA 1NSFA 1KTVA 2W00A 3CWZA 4C0BA 2GK6A 2A7QA 5TXGA 1VCIA 2XSZA 4EIWA 2BV3A 2DPXA 1SVIA 3QKRB 3GD7A 3ZQ6A 1Z63A 4TQ9A 1T3SA 1R8QA 1EXMA 1MO5A 2O0KA 4Q7MB 1E0AA 1OH5A 5FOTA 5ELXA 1OXXK 3NBFA 3K0FA 3UWOA 2BM1A 2H5EA 1E2EA 4IVRA 4GRAA 1E2PA 3G5UA 2XEXA 1RYHA 3ZJYA 1GNPA 3TBKA 2Z4RA 2HXYA 3A1UA 4MGYR 621PA 5FPTA 2IX3A 2IS2A 2XB4A 3B60A 1QHGA 3F8TA 1G291 2OEPA 2DBYA 4DLRA 5FOUA 1UKYA 2QTFA 2FSGA 2QBYA 1TQ6A 2WSSD 4RJLA 2R6GA 2V1XA 5G3ZA 4DEYA 4CDGA 3SBDA 3QXSA 1NG9A 3GMTA 3SE0A 5LD2B 2QY9A 1VCMA 5E95A 1G41A 2EFEB 2W2TA 4DDTA 2ZI5A 1Q0UA 2WPDA 1OXUA 3R8CA 2C78A 4Q01A 1BH2A 1FQKA 3CRVA 2ANCA 5EP4A 3W8NA 3IQWA 2JA1A 3Q85A 1XNJA 2JJ1D 3CX6A 1JEEA 3QUSA 4CT4B 1T6NA 1ANKA 1XXHA 2FU5C 2GCOB 4DVGA 3PV0A 4IKEA 3ADKA 3A58B 2BDTA 3WYGA 4GOJA 2NZ8A 4XIGS 3CPJB 2R6FA 3ADBA 1J7KA 2ZYTX 4BLRA 3TLXA 1SXJB 5G3YA 3AVXA 1T8UA 3AV0B 1HE8B 1EFCA 4DT1B 4UQOA 5KTYA 5JECA 1RKBA 1U9IA 3MWLA 4JBWA 1XP8A 3BORA 1SHZA 3GLGE 4DCUA 1P9NA 4U00A 2AD5A 4PHGA 4LV6A 4LHZA 3CUEF 1N6RA 4PPFA 3K0AA 3UWKA 4CF7A 2JIZD 1OFHA 2GXQA 1ZMXA 5CK5A 4R71A 5H1YA 3FFAA 1Z06A 1N5JA 2PEYA 1GILA 1E96A 4YMUA 1U0HC 5G41A 1KDPA 4QBGB 3UMSA 1E1QA 4DEXA 1VPLA 2FGJA 2F43A 2PZGA 1KO4A 2O8EA 2X19A 4LHWA 4A9AA 4BRWA 1CXZA 4R98A 1JQLB 5FFMA 4D80A 1L8QA 2ZJ8A 3CNNA 4LV8B 1NKSA 4D25A 1HA3A 4EKDA 2CHQA 1XRJA 2ORWA 2WHXA 4AYWA 1HUQA 2W83A 1D8TA 3UANA 1P75A 3U3MA 2QROA 1Q1EA 4MGIR 2D7DA 1OXTA 5L8VA 1H8HA 1RRFA 3VR6A 1CTQA 1GKYA 2BMDA 2W6IA 2ZI6A 5TV2A 1W0JA 5CDFA 1QG2A 4NTZA 4XSHA 3I3SR 1N6NA 2RGDA 5C4GB 2RGEA 3NTUA 4C0HA 3K70D 1R5OA 1KO1A 1U94A 3L0OA 1A4RA 4D6PA 1BKDR 3HJNA 3RWMB 1ZAKA 3B9QA 3IILA 2YWGA 1AJEA 3AP1A 3IGFA 3UATA 4E03A 1JPNA 3B2EA 4GFDA 3THYA 1HQYE 2I1VB 3QG1A 1Y63A 4Q19A 2CHVA 2A5GA 3EC1A 1HE1C 2AL7A 3OIWA 3KB2A 4GDFA 1ZU4A 4HUTA 1CR2A 2G9NA 3ADDA 3DOFA 4PHFA 5KSYA 5KPDA 1R4AA 2WJVA 2X1VA 1G7RA 1E94E 3OHMA 1X1SA 2J1LA 3MSXA 3SBEA 1TQ2A 2FWRA 2AWNA 2V4ZA 2YWHA 3C16C 3QKSB 1XD2B 4C0KA 4U7DA 4B3XA 2WICA 2BM0A 3MFYA 3VKWA 3DZDA 4O25A 4JVSB 1V43A 4E22A 4TTQA 1ZCBA 3MRSA 4O2LA 3B1ZA 1OLOA 1ZD1A 2ORIA 2ZE5A 5TMPA 2WWFA 1G7TA 4PTLA 2OAQ1 3W9YA 4A0RA 1MABA 2IYLD 2E87A 4BUJA 2RGGA 1TF7A 1DE0A 4D4JA 4BFUA 1I4TD 1IHUA 1Q12A 4OHXA 3I62A 4TL7A 3EIEA 1Z6XA 2HYDA 4PFSA 4B35A 4DSUA 5KSZA 3KJHA 2WWWA 1W49A 4CGZA 4B3GA 4A0HA 1E79A 1T5IA 2OCAA 5BN5A 4B75A 1OPXA 2LWIA 4P31A 1SKYB 1CJKC 2YNMA 3QKTA 5FOWA 2XAUA 4EJSB 5L3VA 2J5XA 3DMNA 4IRUB 1LTQA 3T12A 2J0UA 1M74A 1Z2CA 4LPSA 3UXMA 3KZ1E 4I1OA 5EUMA 4ZI2A 4JSYA 4UXJA 4NCIA 1MT0A 1XJ0A 2K5UA 2RGAA 4A2WA 4JIMA 1A7JA 4IVQA 2DCUA 4IFEA 1E2JA 1ZCAA 3OESA 5H68A 2YWEA 3TSWA 4PC2A 5AJWA 2ZI3A 1ZNXA 2VP6A 4IOKA 4KVGA 1OJLA 4IDOA 4F93B 4X8OA 1IJFA 1FUKA 3TKLA 2E1RA 2YOGA 1NVXQ 3WYFA 3MWJA 3P4YA 1YHNA 1NIPA 5DH9A 2PX0A 2ZJ5A 1ZIOA 3VHXA 1U2RA 1FW6A 4LC1A 4LUCA 4D0NA 3V9PA 2NO0A 5DO9A 1CJUC 2HV8A 1M6NA 2IUSA 2GZHA 1E2IA 1JXOA 2ZYWX 1WE2A 2AKAB 3LY5A 1EG7A 2J45A 2JLSA 4CEIB 4B32A 2CCKA 2EYUA 1ONBA 4ESHA 4W7SA 1OT3A 4KSCA 1ZNYA 3MJRA 4DCVA 2VEDA 3X2SA 1SVMA 1P72A 2QPTA 1N3BA 4M22A 4OI2A 4JLDA 4JYBA 4ZDWA 2LKCA 4N0DA 3M1IA 1EK0A 1XTIA 2G6BA 1N0VC 4G01B 4RD2A 1P60A 4FWIB 4R7ZA 1GRRA 2ZYUX 4Q1FA 4Z1MD 2X2FA 4JJZA 1GIAA 4BLOA 1JEDA 5BWMA 4US1R 2ZROA 2IUUA 1KOFA 3LWNA 3AUXA 1IONA 3WHKA 4GP6A 1D6JA 3AF2A 3ZVRA 3GLFB 3S1AB 1W0KD 4NL4H 2JLQA 5D3MA 2B6HA 3BJIC 3E2IA 1YR6A 2V1UA 1TUIA 5UKDA 5F3WB 2FPKA 1OIWA 1ZP6A 3ASYA 2QA5A 3QEOA 4I1SA 4D0GA 3REGA 3GLIE 3NHBA 2QMEA 1SVOA 3U3RA 2BBTA 2IUTA 3N2EA 1DG1G 3R20A 3KKPA 5FTMA 4BWYA 4JVNA 3GLHE 4UKDA 3ND8A 4W5JA 1IBRA 1SZPA 3CO5A 5KSOA 3F0TA 2N46A 3R7WA 1GRQA 3AF0A 2G1JA 2PBRA 4IEIA 3LQRA 4MRVA 1ZVQA 3PENA 2G0NA 4OJKA 4NH0A 1J8MF 4HAYA 3QENA 2PMDA 1G6HA 1UFQA 5E7JA 2XITA 1GDDA 1DAEA 3B9PA 3AVPA 4NP6A 1GNQA 5CIQA 4TLAA 2YZ2A 2IWHA 4CYMA 5HCNA 1T5LA 1M7GA 1V5WA 1AKYA 3K9GA 1H8EA 2OHFA 2AK2A 3MWYW 3THOA 1FX0B 3G82C 3VFDA 4UNSA 4F38A 2JASA 2O8DA 1S96A 4G1UC 1VG9B 3SZRA 1JR6A 3D3QA 1P5ZB 2PX3A 3PEWA 1MO3A 3NBZC 3EAQA 5EXTA 1XTKA 3N70A 5B58C 2CCGA 5J4YA 1L2TA 1N6HA 5IT5A 2NIPA 2FX3A 3TSOA 4Z51A 5EE9A 4JVMA 1NN3A 3CONA 4M9SA 1RRPA 2JATA 3CR8A 4XTRA 4GMXA 2C8VA 1AA9A 5FBRB 3THXB 5CYPA 1DO2A 3QF7A 2WJGA 4DJTA 3FMFA 2WIAA 3K70C 1OW3B 2AXNA 3PCRB 1JNYA 3QPWA 4GI7A 1G20E 3RABA 4OI0A 2OV2A 3EZ6A 4XD7A 3UIEA 4A8JA 1IN8A 1IQPA 2ANBA 4PC6A 1MKYA 3VAAA 4LHVA 1NMXA 3VKHA 2JLVA 1E69A 2IYUA 3BWDD 1YZKA 4M2LA 3FPAA 5AUNB 1ZJ6A 5EXSA 2CK3A 1GM5A 2DWOA 1CEEA 3CNOA 2AFIE 2O0JA 4B2IA 2OUKA 3LBNA 3LV8A 5CJPA 3QSYA 2R9VA 2ZSBA 2Z0MA 1CR4A 2AKYA 3KQNA 2GCPA 2GAOA 4CEJB 2XB2A 2D06A 1AK2A 5ANRB 1KSGA 4JLOA 4MRRA 3DEFA 2ZRIA 5CLLA 1LVGA 1ZBDA 3M6AA 1YZGA 5AUQA 2QRNA 1QHSA 1GL7A 5J4KA 1G64A 1NRJB 3ZVLA 1O87A 3B8HA 2VA8A 1U8YA 2AR7A 2OILA 2ZI9A 1UF9A 2YOHA 4NYJR 2XOKA 2QEQA 1NVUQ 3JVUA 3AP3A 1ZD8A 1CJVC 4R2IA 4GT1A 2FF7A 4OQFA 1P2UA 2H7VA 4BZXA 4LI0A 4IVPA 3W6NA 2QMHA 1KK0A 4WZBE 2IYZA 4ZPXA 3SFZA 2VH5R 4FD2A 4ZIRB 1E0JA 3CPHA 2XNDD 1N6PA 4ZDIA 4PQFA 1K8RA 3QXJA 4WVFA 2DB3A 4R2HA 2OLKA 2V9PA 1OYYA 3TQFA 3GP8A 1AGRA 2CVFA 3QF4B 4W5HA 1GG2A 1KJZA 1E98A 2H92A 1IOZA 3HR7A 5AUPB 2D62A 2CDNA 1F48A 3X1XA 3B1YA 1LS1A 1W4AA 3KXIA 3RS7A 4YLGA 2DWQA 3L0SA 2N42A 4LPKA 3I73A 5FUVA 3P1JA 3U4QA 1Q3HA 3AVUA 2CVHA 2NG1A 1J2JA 5JWRA 4B73A 3PUWA 4JVLA 4ZCLA 1GITA 3FDIA 4O0MA 1FMJA 1Z6GA 1ZUNB 1Z8FA 4MKIA 2A78A 4PHHA 2P6NA 1TU4A 1Z3IX 4PPGA 3DVLA 1E4YA 4TL9A 2B7CA 1ODFA 2QTVB 3I8XA 1G4AE 1NBME 1NL3A 4TMTA 1A2KC 4MRPA 5EZ5A 4UXIA 3BXZA 4L5BA 2Q21A 3RS3A 4DLUA 1AS2A 1G8PA 3HPQA 4X8LA 1NBMA 4B3BA 1W1WA 4QL3A 3BOSA 1M8PA 3T1VA 1E0KA 1W4CA 4V0ME 1OIXA 1T9HA 2CLCX 3KTAB 1AZTA 2WWGA 1U81A 1Q20A 4LYAA 4Q1AA 2GJSA 3M0EA 3RS5A 5JMTA 3W8RA 4B2LA 5SZJA 4TN1A 3JZMA 1Q21A 2WJHA 3C8UA 4RD6A 4QJ3A 3Q72A 3I5XA 1ESNA 1SULA 2FSHA 1R5BA 4A92A 4MYHA 4AKHA 3RSOA 2RGXA 1KDTA 2VLIA 2XZOA 1U0JA 1R0WA 3O8BA 4Q7KA 4ESVA 2OLJA 4JLMA 4TLBA 2O8CB 1OXVA 1CF4A 3GEIA 1II9A 2KJQA 2G77B 1KJYA 3QXXA 2P5TB 5FTLA 2Q3HA 1G7SA 2DHRA 1AGPA 3AKDA 4H1VA 1N5KA 1ZRHA 2G3YA 3PXGA 3TNFA 1OH8A 3EA0A 1COWA 3FMPB 2HCJB 4HAZA 3ZS8A 2NOAA 1JALA 1FOEB 5JZVA 3L2OB 1J99A 1KAGA 1DAIA 4PO8A 2FZ4A 3OIYA 3LA6A 4JL8A 3ZS9A 1XTQA 3QG5A 1E9RA 2H1LA 3OF5A 4KVAA 4PPNA 2XGJA 2R6AA 4OI1A 1KNQA 2TMKA 3AGQA 1OB2A 3BD9A 4HB2A 5BN3A 4E09A 1G3UA 5DN6A 1EGAA 1ZYUA 1U9IC 4JT2A 3QKRA 4Q02A 1J90A 3P26A 1N6LA 3DDCA 4A36A 4M1YA 1KY3A 5K8LA 3V4RA 2Q3MA 1G21E 2P5SA 3L8YA 4K81B 2C9YA 2J3EA 2R65A 1FNNA 4YC7A 2REOA 4HB3A 4ON9A 5DIFA 3AVYA 1U0LA 1IJEA 4M21A 5FI0B 4DLWA 3BC1A 4Q4AA 3K0SA 1XEWY 2HLDA 3HWSA 4D4KA 4OHZA 1VTKA 2VQSA 3REFA 2VHUA 1P4SA 2XJ4A 3FMIA 6Q21A 1IAQA 2ZR0A 3CRRA 1RJ9B 5AJXA 4V0NA 2KSQA 1L4YA 3GFPA 3PIRA 3CRQA 5HZHA 1UDXA 2QL6A 3FHCB 3EZ9A 3QEJA 4GOXA 4N3NA 5HPYB 1Z47A 5L3RA 2ODNA 3CRW1 4I81A 5JEEA 1S0UA 2NPIA 2QENA 4QGAA 3BFVA 4PPQA 1QDEA 2WKPA 1YRAA 3Q9LA 3IEUA 5DNYB 2BCJQ 1N5LA 2WWHA 4BLSA 4NU0A 4B44A 2VP9A 2GK7A 1G9XA 4A15A 5K8UA 4HLUA 5KOYA 2F1HA 4M9ZA 3BB1A 5IHPA 4NYMR 2ZJYA 2VHCA 4XD7D 5CK4A 4ZKDA 3QY0A 1A2BA 1XMSA 2GCOA 4W9MC 2PJZA 1Z28A 2RGCA 2QNRA 5FOSA 3CF0A 4V0OA 2CK3D 4LYHA 2FA9A 2GVDC 2WM9B 4JBYA 1OE0A 5DE3A 1GVNB 1SXJA 3RC3A 3TH5A 3T06B 2OXCA 2Q9BA 3ZDQA 4DT1A 2ZI7A 4DCTA 1G5TA 2R8RA 2BEJA 1BOFA 3LFUA 3FE2A 4AG6A 3ZIAD 4HB0A 3TSZA 4AURA 2F9LA 1E1RD 4FMDF 3ONWA 1FL9A 1YZTA 2B8WA 1E9AA 2BBWA 3A36A 3K70B 1TMKA 4QGFA 3Q7PA 4NYJQ 5DI3B 5C46F 1GL6A 2CNWD 2UVQA 2XOKD 1II8A 3CKLA 4OHYA 4RZ3A 1JQJC 4Z8YA 5L3SB 1I4DD 1RIFA 3RRNA 5EJEA 2LKDA 2BMEA 1TUEA 2C03A 1NVVR 2IYSA 4LX0A 1G18A 1F3OA 4D0LB 1KK1A 1VMAA 2BMJA 3SI7A 1G4UR 1BYUA 2ZU6A 4DSOA 1UKVY 2VSFA 3W34A 1OH7A 2BHRA 4TT3A 3VKGA 4HAXA 3QPVA 4URXR 3C4JA 4F4CA 3G0HA 3KDSE 3IIJA 3TUJC 3LAWA 1YQTA 2VIIA 3OE7A 4QM7A 4Z8XA 3L43A 5DYGA 3K0CA 3UKDA 1QBKC 2XZPA 1XXHE 3QJYA 3T61A 4KU4A 4Q9KA 4JLBA 1XPUA 5BW8A 4DRZA 2I1QA 4F4IA 1QVAA 2QT0A 3RRYA 1WBDA 4PZLA 1IY0A 1E9FA 4ASUA 1Z08A 3NXSA 1G3MA 1KSHA 2EQBA 2A5JA 4NKRA 1GOTA 5AK0A 4J0QA 2JDIA 4QRHA 2JAQA 2V7QD 1DADA 4QHTA 4O3MA 4C7OB 1NJFA 2QN6A 1S3GA 1T91A 2WVJA 4KBGA 1SVLA 3BAFA 4US2R 3O8CA 5FTKA 5J4VA 2J46A 2H57A 4FMCF 3NEYA 4POAA 4P32A 3AKYA 4ZCMA 1X8LA 4BASA 3TE6A 1NBMD 4HUQB 2ZPTX 2GA8A 2WJIA 3NKVA 4MRSA 1VYTA 1ZU5A 1VHTA 4JS0A 3FKSA 2PZEA 1G8FA 3FVQA 3HU1A 3QKSA 4L9SA 2ATVA 2GILA 1AZSC 1FTSA 4IOJA 4LJYA 4B43A 3SYNA 2YJTD 1R5NA 4KITB 3BH6A 4GBMA 3TMKA 2GXAA 821PA 4B6FA 3A1VA 1YU9A 5EP2A 2A9KA 4JL6A 3NG1A 4G3XA 1XTRA 3LLUA 1E99A 2Q0HA 1MRNA 1ESMA 1SVWA 2JLZA 1KMHB 3QQ5A 1N2CE 2JEOA 2CBZA 5J47A 1PLJA 5DYIA 4PSVA 5JI3E 3U7EB 3EASA 2IYVA 3CIOA 2XXAB 1KI8A 3SJZA 2CMKA 2VHQA 1QHHB 2ZRFA 4D4LA 1OV4A 4FWTA 4M9QA 5DHFA 5CDFE 1WQ1R 1AS0A 3K0FB 1RW4A 2A30A 4C0LA 1DAFA 4Q66C 4PC1A 4QHSA 2QAJA 4C9BA 2QGZA 3CX8A 3RLFA 1XMVA 1SVSA 3C14C 1KNXA 2OSBA 5JJKA 4TYPA 4PO1A 2FN4A 3LW8A 2RGNA 3TUIC 2ODWA 3RDPA 2D7CA 1CIPA 5LPNA 1OB5A 1US8A 3T15A 2BOVA 2UZ3A 4EJSA 1HT1E 1U90A 2J41A 3K9HA 4FN5A 1XBTA 4OQNA 5KU1A 2AK3A 5DLQC 4P4TA 4MYCA 4UNQA 1P61B 4ZKEA 2AN9A 2ZREA 3GJ3A 5DI9A 721PA 3A4MA 5EUQB 3B5JA 3V4FA 5LB4A 4GSYA 1TU3A 1NVWQ 3PUVA 4W5WA 4C4PA 1KSFX 1VIAA 1KMQA 3EZFA 3LNCA 1G8YA 4I1VA 4BLQA 4V02A 5B64A 3L0PA 4B47A 4E07A 3WBJA 3VHLB 3H84A 3IO3A 1CLUA 3H2YA 1RVDA 1T3LA 1E2LA 3LX8A 4G5QA 4YDSA 5JI2E 2ZAMA 2SHKA 1FZQA 1AIPA 2WTUA 1OSNA 2ZRJA 5CB8A 2ZJ2A 3R9WA 1C4OA 1FNMA 1B0UA 2WKRA 2NO9A 4RD1A 3TW4A 2ZRCA 4Q9JA 2F3TA 3W6PA 4QJ5A 3WRYC 2Q6TA 5FL7A 1N6KA 2QTHA 5JCZA 4ARZB 2A5DA 3P27A 2QQ0A 3EWAA 4MYTA 1T3HA 2PLFA 4N1AA 5B2ZA 2C5LA 3T1OA 3RRMA 5FUXA 1Q3TA 1GAJA 4BFXA 3CH4B 5LDDC 4PX9A 1NMZA 1W47A 2F1RA 3THWB 3DPUA 3AGPA 3IIKA 3M4YA 2ZRKA 2R62A 4G5OA 4IFBA 4JLVA 3TR0A 3GLGB 4O2RA 3LBHA 3OAAA 2O0HA 3BIFA 4LJ7A 4LJ4A 3B1XA 4IDPA 4DDUA 4CRWB 2DYKA 4TMZA 5FUYA 1KO5A 5G53C 4HZUB 3X1DA 2WJYA 4PR0A 3LH5A 2CXXA 4ILEA 1NKTA 521PA 2N1BA 1E9BA 4LYJA 3S1AA 2IHBA 3I32A 3U7HB 1TAGA 4Y0VA 1RYFA 2WSMA 5JRJA 2XSZD 1JR3E 3N5CA 4TQAA 4EQ6B 1FFHA 4PAMA 3FHTA 3KKOA 3KB1A 5JWOA 2P3SA 4DLZA 2NTYC 3A6PC 3EIQA 2ZRNA 3JVVA 3FB4A 2G88A 4Q21A 1GSIA 1KI1A 1JR3A 3TJZA 3NHAA 2ZJOA 3CX7A 4IJMA 2FPMA 4LHXA 4QC2A 1S4QA 2EYQA 1D5CA 2AX4A 1NVVQ 3U7GA 4M9XA 2V3CC 4DIDA 2C99A 3HYRA 3QXHA 1R2QA 2FSFA 5FBQB 5HTKA 1UBGA 2O8BB 4DZZA 5IRCD 3OEHA 2XTZA 2NPFA 1Z2AA 4MQBA 1SVKA 4CVNA 4TT3D 5H8WA 3EARA 2XTMA 1E9CA 2I3BA 1P62B 3DOEA 4DLTA 2HT1A 5H70A 4AY2A 2HXSA 2ZUDA 4QBHA 5FH9A 3ZD7A 1VYVA 4RSGA 2WOJA 3TGPA 2FV8A 4LJ5A 1KSJA 4OQXA 3WNDA 3OE7D 1LV7A 2XTNA 3FHOA 4R9UC 4C0JA 4QNRA 3Q3JB 1KZ7B 1WA5A 2O5VA 2GZAA 1W46A 4ACBA 2WPDD 4RZ2A 3R9IA 1DTSA 2JJ8A 4GPTA 3VTKA 1E4VA 2C96A 4Q1EA 2VP0A 4BGDA 3HDTA 5GJVC 4UNRA 3SS8A 3RNLA 5FOVA 3B7GA 1YR7A 2JDID 4FMBB 4JLJA 4LY6A 5A0FA 2ZM5A 1CJTC 4PC3A 5JS7A 4DSNA 4CEHB 1M2OB 2XNSA 4BEBA 2IS1A 1KIMA 5CYOA 1UBEA 3O8DA 2W0MA 4LBYA 4LK2A 4EFMA 3D31A 2RCNA 2QE7A 4KO8A 4Q7LA 1XMIA 3SHFA 4TZ0A 1QHYA 4QJ4A 3DL0A 1JJ7A 3AKEA 2WJJA 3GEHA 1OFIA 1TL7C 3PUXA 5IK2A 3TQCA 3THXA 2UZIR 3I72A 3KJIA 4K46A 2O8FB 2GXSA 4KLNA 4EPVA 5FPHA 1VDZA 5CM9C 2BJWA 3NH9A 1I2MA 2J7PA 1DO0A 3CLVA 4MUAA 4FI3C 4A6PA 2A5FA 2GJKA 2ZQ5A 1KKLA 2RH5A 4KYIB 1Z0FA 4M1MA 1CRQA 4HSEA 2PLRA 3SHWA 2KWIA 1FPMA 1X8KA 4Q1BA 4EFLA 1G8HA 1IXSB 3GEEA 4LDJA 3UPUA 3C15C 1E1QD 4AKIA 2J0QA 1K5GA 4HDCA 4Q47A 3RSLA 4CEJA 4K8OA 1HT2E 1KYIA 2GETA 4G5SA 5JWHA 2DFLA 4DLYA 1GWNA 4RZXA 1XFAA 4RFSB 1H65A 4HAWA 2R2AA 1HYQA 1CS4C 3MD0A 4B34A 1IY1A 2GCNA 1GFIA 2REBA 4WW0A 2ZVQX 3RC8A 3FKQA 1H8HD 1C1YA 3W5JA 4PANA 5F98A 2W6ID 1KI6B 1W0JD 3SR0A 1YZUA 3ZZUA 5KPJA 5KYKA 3LO5A 3AKCA 2MSDB 4JJKA 3AH8A 4TL6A 1W7AA 2FE4A 4XSGA 1RFLA 3KXKA 5C2JB 1N5IA 3AEZA 3WNCA 4ZIRA 5JBQA 2NMVA 4TMVA 2JLXA 2QQEA 3BS4A 2GRJA 4I4LA 4XOIA 3QIAA 3EIHA 2ZRMA 4HAVA 2REXB 2CL7X 2GF0A 3QF4A 1G17A 1JPJA 3KQLA 2QRZA 1D9ZA 5JLJA 5F9HA 1DAMA 2JJ2A 3U3OA 5L3QB 1KI7A 4PAOA 3VR2A 2AFHE 2IW3A 2YHSA 3SQXA 1TQ4A 3AF3A 2ZS8A 5AWFC 4WZAE 1P7CA 4Q1DA 1A82A 5FBVB 4A2QA 2EU8A 5KDOA 4JLAA 3ZVNA 1D9XA 4YONB 4KFTA 1U99A 3P4XA 4I99A 3D8BA 5DISB 1UADA 3QOFA 1OXSC 3SNHA 3T1TA 5EE0A 2C9CA 1F2TB 3K9NA 1SQ5A 3K0EA 1NJGA 2J0SA 4PAQA 3EPLA 3R9XA 2QSYA 2WKQA 2Z4SA 2CL6X 4HB4A 3RWOA 1VYUA 2F3RA 4DLXA 5GADl 4MKFA 2IYQA 1W5TA 3TVDA 3AVWA 5GVSA 1XEWX 1ZM9A 1P9WA 1NN1A 2D2EA 2VBCA 2GAAA 1TF5A 3EA5A 1EX6A 4YMVA 3NEJA 2C04A 1OKKA 1FP7A 3OAAD 4L15A 4NONA 3BGWA 2H8KA 3GLIB 2KB0A 1XPOA 1ZM3A 1YKSA 5KSPA 3SC3A 2HJVA 3I1FA 1UKZA 4TLCA 4UXHA 1E79D 3VU9B 1SHKA 2E9SA 3DMDA 3B78A 4YQFA 5CITA 4A1FA 3GLHB 2ZI4A 1W2HA 4WZ6A 2ZS9A 2NO6A 2QP4A 1ZUIA 3W3AA 5DSZA 3PITA 1BIFA 3U3KA 3ZQJA 2C2HA 2HEIA 2DY1A 3O47A 4NE2A 3L8ZA 2O8CA 2ZSEA 1EWRA 2KE5A 3ETLA 5C18A 5K8IA 3IHWA 1FMLA 2FNAA 2WBLC 1VG8A 4PQYA 3IHLA 1IN7A 2ZRBA 4HLUC 4RCZA 1GP2A 2OFOA 3H0KA 3SOPA 2ASEA 5AR1A 4MYUA 2IYYA 2O8DB 5KNBA 2IF0A 1OIVA 4CIDA 2BWJA 3E70C 1JR3D 1ZINA 1XJQA 2QPAA 1TF2A 1QRAA 4X8MA 5FL3A 5EE3A 2GBLA 3RS4A 3I61A 1UPTA 5EE5B 4B3DA 2ZJAA 3L0IB 2OE2A 1O3YA 2A2ZA 1G3QA 4Q4JB 2CJWB 3OEHD 4Q00A 4LBZA 1KGDA 2ZR9A 2KBEA 3X1WA 1NG1A 2JLUA 1KI2A 3HPRA 3PVSA 2IA5A 3KJEA 1NY5A 3KFVA 5SZHB 4QM6A 5HE8A 1LW7A 5TY0A 3ZZ0A 4WXPA 2ODBA 1Q22A 1UDWA 1CJMA 1Z22A 2A5YB 3O8RA 1WBBA 3VNUA 3TVTA 3F3YA 3KQUA 3U44A 1QVRA 1Z07A 3GFOA 4EPRA 2OT3B 4DHEA 1XEXB 2DFTA 2GEVA 1X6VA 1PZNA 4ZO4A 4KHZA 3IPXA 1RJ9A 2J59A 4B3FX 4AYTA 4A82A 3IEVA 3RHFA 4YDHB 2NO1A 1ZM4A 3DKVA 4FXPA 5E7IA 2ZE7A 5KHOC 2IXFA 2MSCB 2QU8A 4KAXA 2G83A 2EFDB 1W5SA 1X8JA 5KDLA 4URVR 2P65A 2OCYC 1BMFA 3U5ZB 2RAPA 2VF8A 3BK7A 1JB1A 3Q5DA 1ZC4A 3JZAA 4P33A 2ZXUA 5AJYA 2JIZA 1C9KA 1YR8A 2DFNA 3H1TA 2OO7A 3CH5A 4AC9A 1L4UA 2J7PD 1Z6YA 5LB2A 4Q03A 1AQUA 2QAGA 1P73A 1CR0A 2IL1A 4PSAA 1DARA 4EPTA 4MDEA 4NHOA 4GMDA 2ZIAA 4Q1CA 4KYUA 3A4LA 2WWYA 2VL7A 3IQXA 1II0A 2OCBA 3RAPR 1N0UA 4TYQA 1HURA 1QF9A 2FPLA 4LOAA 4N0EA 4UJ5A 1W36D 2OM2A 1GKUB 3H86A 1UJ2A 2QZ4A 4FINA 5KDDA 3SYLA 3KFXA 3HP1A 1MR3F 1KAOA 1G16A 1ZNWA 2IF2A 4XVQA 1MO4A 4ITRC 3VR4A 4QGHA 5DI3A 1H8ED 2GJAA 2NZJA 2YVUA 3B1WA 1D2NA 5BYKA 2VSOA 4ACAA 1W44A 5L3SA 2FG5A 4PO9A 1NNEA 1RRGA 1TADA 4OL0A 1S9DA 4DCSA 1PJRA 1KZGB 1GRNA 2FOLA 3I92A 4V0KA 5DHAA 1P6XA 1G8GA 3QVVA 1QHIA 4QGGA 4AYXA 1FUUA 4L4UA 4A6XA 1ELOA 3A1TA 4HZIA 4Q9LA 4HLQB 4UNNA 4FMDB 4H9GA 2ZRHA 1KI4A 2C95A 4MA4A 3ICQB 1X3SA 4EPXA 1X86B 2EFGA 1ZUHA 4U5XA 2D4HA 3V00A 1VHLA 2QI9C 2GESA 2G0TA 4C2UA 2GEDA 3X1ZA 1GTVA 1VECA 2NQ2C 3KKNA 421PA 4ZV4A 3CZPA 1GNRA 3QKUA 1WXQA 5CLQA 1DVRA 5EXXA 5LBIA 3W3ZB 3PUZA 3SEAA 1DELA 4B33A 5GJWC 2JLYA 3AQ4A 2BVNA 1SXJE 3T5DA 4Q4HB 2CLDX 2BBSA 3IIMA 3K8YA 4Q9IA 2FDCA 4OK5A 4URYR 3MJHA 5CJ2A 1D2MA 3C41J 1N25A 4P4SB 4DDWA 1XJCA 2BKEA 3DM5A 2IEYA 1NN5A 3K1JA 2P6RA 3RRZA 4QBFA 5J5CA 4LV5B 1R10A 4MKHA 4Q4LA 4RKEA 4US0R 1EFRA 2WIBA 1VG0B 2EW1A 3U2QA 4DWJA 2QM7A 2QG6A 4TWZA 4TLEA 4HUQA 4QNMA 2QP9X 3PR1A 1E2HA 1EFTA 1SGWA 2Y8EA 3NBYC 4LJ9A 1DAHA 1EX7A 2RMKA 2ZUCA 4C30A 3BFXA 4D2IA 3VNVA 1UBCA 3UMFA 1ZW6A 3A1SA 2CLSA 4WIAA 2FH5B 1GL9B 1RE0A 4HEJA 5HKKA 2MMGA 1JXMA 1EFUA 1JBKA 1OFUX 4FMCB 4RD0A 1KMHA 2R6DA 4HDOB 1AN0A 2VP5A 3LQQA 3EG5A 2BIFA 4DLVA 1M7HA 2RB4A 4DXAA 4URZR 3UG7A 1T0HB 4KBFA 4BECA 3FYHA 3SJAA 2GEUA 2G1KA 2XXAA 2CE2X 3B13B 3ICEA 2HF9A 1PUIA 3I4LA 3PEVA 1QHHA 4QFMA 2H16A 2ZYVX 5FPSA 2FGKA 5EE1A 3NDPA 1N0WA 1RRCA 1DPFA 5TARA 3EPHA 4Q4AB 4V03A 2WWIA 3OFNA 3FGNA 1Z6TA 4NYIR 3HU2A 4P3YA 4XVUA 5FPKA 3A8TA 3AVTA 1AKEA 2P67A 4YMWA 5BXQC 2ONJA 4ABYA 1F2UB 4KLZA 3SYKA 5SZKB 4TMKA 4II7A 2UKDA 1W2GA 2P6UA 4Q48A 3P32A 3VMFA 1S9HA 4B2PA 2BCGY 2KBFA 2PCLA 3CWQA 3BERA 5TVKA 2FFHA 3UG6A 3R8FA 2W2XA 1ETUA 2IT1A 1GKIA 2VP2A 2OBNA 3WMFA 1K6MA 1YZNA 3CPEA 3TK1A 1E2KA 3CNLA 1NLZA 4TYWA 3KKQA 3T35A 4UJ3A 4OHWA 1RC8A 5BN4A 4RZUA 4IHQA 1OYWA 1EESA 2WZQA 2ZRGA 4Z1MA 4AK9A 4A0GA 1XF9A 1NSTA 3BB4A 3DO6A 4HAUA 4M1TA 4MGKR 5C1BA 1XD2A 3BBPA 1IN6A 1Z0JA 2HF8A 4C0QC 4AKEA 5A4JA 3W90A 4RY2A 2CHGA 3FOZA 5JSZB 3AVVA 4HATA 2QMOA 4Y0AA 5TDHA 3X1YA 2BKUA 1P3JA 1G6OA 4C2TA 1FTNA 4DB2A 1W0KA 1R8SA 3WP0A 3U6BA 4BFSA 3RYTC 4ARZA 1S1CA 2XZLA 2ZE6A 2OAP1 4DBLC 2ECKA 2IXGA 4QBIA 1BMFD 3T5GA 3THWA 3ZVMA 2HCBA 2QGNA 1TQDA 2W6JA 4DDVA 1VG1A 3GLGA 5B30A 1COWD 1II8B 2ZU0C 3MUFA 3KQHA 4D26A 1SKYE 1IM2A 2X8AA 4BLTA 5FPYA 3KX2A 4JZKA 3D6TB 3BH0A 5K8TA 2F1JA 4HZUA 2IYRA 5CB6A 2AHOA 3LVRE 5J4HA 3TUZC 5IF9A 3LXXA 4LJAA 2FJUA 2L0XA 3AVQA 3SFVA 3NIBA 1CR1A 4FIDA 2QBYB 2NO7A 5FR2A 3KUCA 2RHMA 221PA 4RD4A 4MRNA 5C4MA 5DN6D 3IBGA 2GHIA 2V6IA 4EQ6A 1E2DA 3B1VA 4WA7A 5E4FA 4A2PA 2OG2A 3MLEA 5DGXA 3VR3A 4B3CA 4C0SA 3QE0A 2IYTA 4OQMA 4IXMA 3W5IA 5A5GA 3K09A 4OBEA 4TMWA 4NCJA 4M1OA 4DCNA 5GVRA 4PHTA 3GQBA 8OHMA 3NH6A 5EP1A 5B57C 1XXHB 3U7FB 2EVWX 3BRWD 1R0ZA 4KFSA 1X1RA 1YJ5A 2HLDD 3FFBA 1LS6A 2FEMA 3LDAA 4IXNA 3KQKA 2VHTA 3FTQA 1N6OA 4ZCIA 4UNPA 2O8BA 1AM4D 1UEIA 1W36C 3DKPA 4XH9B 2MSEB 3IUYA 4DIEA 5JHHB 2IC5A 4M0LA 2FZLA 2Q9AA 1KY2A 4S2EA 1MRSA 4DB4A 4CEIA 1XD9A 5KNDA 2RKOA 2QP3A 4URUR 2ZJZA 4ZDKA 1OHHA 5JS8A 2B8TA 3MAAC 3ZLJA 2BMFA 4JLPA 4JMPA 4TYNA 4KCGA 4EDHA 2Z83A 2OZEA 2BJVA 3VR5A 3K0AB 3ZH9B 1IN5A 4LJ8A 4EUNA 1W4BA 4ERNA 4PZYA 2YC4C 3OZXA 2XX3A 4NYMQ 3LVQE 2ONKA 4WOPA 1ZM2A 3LW7A 4S35A 4G0NA 3MMPA 4Q5IA 2IWRA 1CULC 1KI9A 3GLFE 2R6CA 2GF9A 4LYFA 2F43B 3U61B 3PUYA 4LSGA 3EW9A 4B6EA 1PLKA 2ZITA 3E1SA 2O8EB 4CEHA 4JKYA 3AF1A 4PC7A 3SU8A 3GLFA 3ZD6A 1SXJD 5FBWB 3AP2A 2QSZA 4HI0E 1JI0A 4NPHA 2I4IA 1EFRD 1E2MA 2DWPA 1NI3A 2ZJBA 1CBUA 4RCYA 1LFDB 1FQJA 3VX3A 3SQWA 4A4DA 1UBFA 2O8FA 2J9RA 4JT4A 3TAUA 3ZGXA 3D7MA 4X8HA 5FR1A 4L16A 1KHTA 4D81A 1ZIPA 2YYZA 4NCNA 5JJLA 2WAXA 3PJRA 4A8JC 4ZDJA 4G5RA 1US8B 4IDQA 4LC0A 2WMNB 5HKKD 2PT5A 3ECCA 4B76A 4OJQA 4XTCS 1XCGB 2XNDA 1HTWA 3LD9A 4FCVA 4TTRA 4BFYA 1F60A 3CBQA 3IPYA 3K53A 3THYB 2YKGA 2AWOA 3EX7C 2PT7A 2Z6VA 1PV4A 4NCHA 2W0SA 3UK6A 4TQUS 2NGRA 4LJ6A 4RFSA 1W4RA 4JLKA 1NLYA 4KJZA 2GKSA 3VR1A 2AXPA 4Z54A 1Q1BA 1HV8A 2HJGA 2ATXA 4LWZA 1AS3A 3GCGA 3BE4A 2PEZA 5FBLB 4NMMA 2H18A 4BFVA 4TSFA 3GJXC 5HR5A 4NYIQ 5JCPA 4WBSA 2VTKA 2A3RA 5KUTA 1KI6A 2PCJA 3C5CA 3OFND 1NIJA 1Z0AA 4B48A 1FX0A 3PFIA 1B23P 1E9EA 1DG3A 4OQLA 1NY6A 2IXEA 5E7MA 4OYHA 1TX4B 4F4JA 4Q18A 1DAGA 1VKJA 4CT5A 4QXAA 4FCTA 4ASUD 5EXPA 4MGZR 4MH0R 1G3RA 3A1WA 3NVAA 4EFNA 2OCPA 5TB5A 2P0EA 2ZSDA 2ZE8A 3MCAA 3OEEA 3WP1B 4M1KA 2ZTSA 1U98A 3U3JA 3WMEA 4C0AC 1J70A 1G5PA 121PA 4AI6A 1MABB 3ASZA 2Z43A 3GPLA 3T34A 3RS0A 1R7RA 1XZQA 5L3QA 5GJCA 1XDBA 1XEFA 4BPBA 3A37A 4NZYA 2IYWA 1DEKA 1YVDA 5BYJA 2IS4A 3PQCA 1BS1A 2JCSA 5JHGB 2GBLC 3FKSD 2F55A 2Q3FA 5FTJA 4LCBA 2YINC 3AUYA 2IS6A 2X2EA 3Q8XB 4GNKA 4AWXA 4KODA 3EPJA 4OK6A 4BFTA 1OFTA 2R44A 1NP6A 1PUJA 1QHNA 3QBTA 3WRXC 2PH1A 1YRBA 2J0UB 3E5HA 1XX6A 4YXWA 2X77A 1F2TA 5JRZA 1G7CA 1QHXA 2IK8A 2VF7A 1T0JB 2B92A 3FWYA 3HR8A 3QPUA 4QOSA 3LLMA 4BEJA 1GUAA 4LRWA 2C77A 1MH1A 3LRPA 2VP4A 1KK2A 2OFWA 1LY1A 2W6JD 1F5NA 3B6EA 2ZR7A 5IDVA 2W58A 2EFCB 4PQRA 2ZS7A 1LF5A 2IHYA 3EZ7A 3I5YA 2CEAA 2V55B 3GLIA 1QZXA 1E9SA 2Z5FA 2KI5A 2HDNB 2OFXA 1M1YE 3QVUA 4PXAA 1R0XA 3VU9A 1LNZA 1LF0A 3C7KA 3RS2A 2F1IA 1DBSA 2QORA 3GLHA 4OHVA 1KO7A 1XWIA 2FFAA 3QNUA 4LHYA 2ZSFA 5SZIA 1RZ3A 2QT1A 1UM8A 1I2DA 2W2VA 5EP3A 5J40A 1IY2A 1P2TA 5FUWA 2QPOA 2ZANA 2ZRLA 4YMTA 4BZQA 1Z0DA 1NF3A 1U8ZA 4CW7A 3GFTA 4GOKA 4IDNA 2WV9A 2FFBA 5KO2A 2J7KA 5F9FA 3MWKA 2YC2C 1XU4A 2ZUBA 2FFQA 3CB4A 3C5HA 2ORVA 3P20A 4HDQB 4NBSA 3ZYCA 2PJRA 2QAGC 3NBXX 1RPZA 5E3HA 2O52A 1S1MA 1KDRA 2J0VA 2YV5A 4M53A 4E5UA 4Q7JB 3DM9B 3NDBB 1XCMA 2BBOA 2CE7A 2GTPA 5GJBA 4HYYA 4B71A 2GZDA 3IBYA 3WNBA 1KO8A 1PLLA 4Q4JA 2CJWA 1N6IA 1Q44A 2ZAOA 4L9WA 1Z0IA 3VQTA 3AM1A 2WMOB 3AF4A 1T8TA 5D3MB 5FL7D 2AD1A 4HLDA 4KV9A 4TZ6A 1UAAA 3CZQA 1DOAA 4P4UA 5HCIA 1U8AA 3CR7A 4JLNA 2XJ9A 2F6RA 4QKQA 1OHHD 4FCWA 2YOFA 1M34E 4MDFA 5F2EA 5AUOB 4AIIA 5P21A 2J87A 4DUGA 5M04A 3KJGA 1KDOA 3DHWC 1AQYA 3KTAA 1K5DA 5G40A 2VPPA 2BC9A 3LX5A 1XD8A 2ERYA 3EXAA 1XEXA 4XWAA 1YR9A 2ODEA 4TYYA 2B7BA 4F92B 2HUPA 2MMCA 1P2VA 1S2MA 2JLRA 3RANA 3RVBA 2GVZC 1BYIA 3R7WB 2V6JA 4D82A 4JSTA 4AG5A 4TLDA 4EPWA 1W36B 1TEXA 1Z5ZA 4B74A 1S3SA 2ZVPX 4KFRA 1BO6A 3GJ0A 3CRMA 2ZSAA 1WRBA 3ZIAA 1IXZA 1YZLA 3F5FA 4XVRA 2H17A 1CKEA 1QG4A 4U02A 3B82A 1P2SA 1E1RA 1E6CA 5LD2C 3AB3A 4KI0A 4LGMA 3N2IA 4KXFB 4TMXA 4URWR 4MKGA 2F9MA 2CNWA 4C3ZA 3BH7A 1W48A 3KKMA 3SJBA 3OIUA 1DAKA 1XCPA 3TRFA 1ZM7A 5AJZA 2LCFA 1E2FA 1HH4A 2ZRDA 4V0LA 3TIFA 4OK3A 1E0SA 2JGNA 1KI3A 2QUZA 3IDQA 2D3WA 3WMGA 1WB9A 1M7BA 3Q5EA 3ZZTA 2HT6A 5FTNA 1SXJC 4RKFA 1Z83A 4ZI3A 2WSSA 2FMXA 1L7VC 3K9LA 3HU3A 1ZC3A 1Z6AA 1JAIA 4JYCA 3ADCA 2P2LA 4IOMA 4AKGA 1WF3A 4EAQA 3TAHA 4TTPA 2VO1A 1E2QA 1TEVA 3WBKA 3EPKA 2DR3A 4NDZA 1HEIA 1F6BA 2OXRA 4TSFD 4IEEA 2JJ1A 1HY3A 4A8JB 5D3QA 1A5TA 3WYAA 4G5GA 2V54A 4JL5A 2V7QA 1XTJA 3LXRA 1XPRA 1XZPA 1JECA 3W6OA 4LZZA 1G1MA 4F91B 2PMKA 1TPZA 1WP9A 4BZPA 2ZETA 2HYIC 1JAHA 5J4LA 4M8NE 1KK3A 4QG7A 3SJCA 3OEED 1Q1QA 2WAYA 1A1VA 3SN6A 1XTSA 3CF2A 2ERXA 4BFWA 1J8YF 1E32A 3GJ6A 2QE7D 1WDTA 4BQSA 4GP7A 5FOXA 3U6KA 3J81k 2FEOA 1ZD9A 1WMSA 3K0CC 4FW9A 4EPYA 4LBWA 1MO6A 2QM8A 5IK2D 2C98A 4D4MA 1UEJA 2OBLA 4XJXA 1IN4A 4V0MA 1VCOA 3OIVA 2FSIA 2EWVA 2WWXA 4YMSA 4GZLA 1G19A 2VYFA 4HLCA 4Q4HA 3H4MA 4KFUA 4MUBA 2IBMA 4BRUA 1KKMA 1XB2A 4JBXA 1E2NA 3A4NA 1E2GA 3HYTA 3KUDA 1TNDA 1G3IA 1G5RA 1WCV1 4PZZA 3LBIA 2VSXA 1R6BX 2Q9CA 1CU1A 4P4SA 4YXWD 5AJVB 3U60B 4A0FA 1YE8A 2WOOA 1E3MA 3EZ2A 3NC0C 1TTTA 3QI2A 2B21A 3CM0A 3BB3A 4NCKA 2ZRPA 3DZ8A 1Y3AA 1EFHA 2ZEJA 3AVOA 4H1UA 3QXCA 3FMOB 3IKJA 2IYXA 1XMJA 1DS6A 2EWWA 2OESA 2C9OA 1PVOA 1EWQA 2BEKA 3GJ8A 1Z29A 4WAUA 3UMRA 3U4QB 1JJVA 3CF6R 3KL4A 2D74A 2RGBA 4TL8A 5HZKA 1ZNZA 2GNOA 4BE7B 5KNCA 4XWKA 3GJ5A 3I8SA 4PSKA 4QHYA 1T4GA 4IDHA 4KSBA 1MOZA 4JKIA 5CIWA 4DSTA 2IEZA 2GJ9A 2DFKB 3WHLA 1P9RA 3L82B 3CW2A 1Q1ZA 1SKQA 2VRWA 3EC2A 1UKEA 4I1UA 4RFVA 3WXMA 2QMUA 5JFGA 2YWFA 4RVCA 4XWOA 4BFZA 4AD8A 3B85A 3TR5A 3ND9A 2GWHA
chains in the Genus database with same CATH superfamily
3ZNOA 1EQAA 1N8KA 1I94B 2BMWA 4KGDA 4GZMA 1GO2A 5JVDF 4EHLA 4P3KA 2IHJA 3QQPA 4X6YA 1ODLA 5DXFA 1L5HB 1ML4A 3V1UA 2OHVA 4X62B 2VDRB 3I34X 1FDOA 2V8OA 4L5JA 4BX9A 4HDRA 3TW8B 5K4GA 1VCNA 5EQJB 3MGCA 5KQRA 3TZQA 1TA9A 3VPAA 3ORHA 3GJ4A 3M89A 1NW4A 1TVKB 1Q0QA 2C7RA 3HVRA 2X9QA 4DKXA 4W1SA 2CL0X 1HQCA 4PX2A 4OH1A 1YE3A 5FA5A 2GXUA 1RKXA 3WSTA 2MSKA 1BC5A 5TS2A 5JEDA 5TQVA 3WWPA 1Z82A 3VC2A 1YZQA 2V9ZA 1FP6A 1CP2A 1YONA 1D2EA 2QTGA 1S8FA 3G7UA 1DTWB 2GERA 3DOOA 3M9WA 4QDZA 3K4QA 4E88A 1I30A 4IOLA 4L8GA 1L7OA 2QVBA 3K09C 4C1NA 4EVIA 2JFZA 1AN9A 1O6CA 5BQ5A 1WBJB 1Y1TA 4FDLA 2WDPA 3E7FA 3MGAA 2L18A 4LQ4A 3LZDA 4PXSA 4LSZA 4M99A 4RJTA 1WCIA 5B4TA 2XDYA 4KO4S 2PZFA 1ZVJA 2Q1SA 1BDMA 1GQFA 1T8WA 4Y3UA 4ENPA 2YN0A 5LJIA 2EWMA 3AG5A 3Q7SA 4RLSA 4F7WA 1ZHOA 1LPSA 2VJPA 4L0QA 1NSFA 2C4HA 2J9GA 1U7ZA 2NV0A 3B89A 1UZLA 2XE7A 3DKIA 3EXEB 4J91A 3CZ4A 1NPDA 3DOJA 5ESWA 3SF8B 3GN2A 5BN3B 1SUSA 4J0GA 5JH7F 4J16A 2XSZA 3CG4A 4PR3A 4U2BA 5LZ7A 1M1ZA 1SVIA 3PEFA 4XVHA 1KARA 3PT9A 3S40A 1T3SA 1ZI8A 1TTHA 4L5CA 3LT0A 1W2WB 1MO5A 2O0KA 1WUTA 1OH5A 3OO0A 3AXTA 3ADPA 5ELXA 4L7QA 3K0FA 1JYFA 5LP6F 4L22A 4B7XA 4IVRA 2R48A 4GRAA 1G0OA 3TLGB 3ZWBA 3NDIA 2Z57A 2VPYA 1EHIA 1RWNA 3H1GA 3HZHA 3L4BC 1AURA 2D0IA 2J3LA 4QASA 2HXYA 5JAHA 1WQ4A 1XDGA 5FPTA 1H85A 1W5FA 4Z9XA 1Q6YA 621PA 5AVXA 2O2JA 1U7TA 3BREA 1FCJA 3IJPA 4G2NA 2P91A 5C7LO 1G291 3V8RA 2OEPA 2Z6QA 4IYJA 2R7KA 3PKZA 2Y2VA 4JUFA 5CGQB 4OXXA 4NENB 3E22A 4WH0A 3JQ7A 4L8FA 4Z6KA 1TQ6A 3IDAA 2WSSD 3OX4A 3S8MA 1Y42X 1RM3A 2B2CA 2PGLA 2WU3A 1U1GA 4BNHA 4CDGA 4UEWA 3LY7A 5BNWA 3JARB 3OCJA 4TVBA 1RDFA 5LD2B 2EFEB 5BXYA 4LWPA 5I7SA 3W7AA 1NBAA 5LNK6 2WPDA 2B82A 1XU9A 1PKEA 1SQSA 3OWHA 1DC5A 1DX4A 3E9EA 3QOXA 4MR9B 4Q01A 3CRVA 1FQKA 1NTOA 3R8CA 3TEJA 5IJWA 1EP2B 2O07A 4DJ5X 4AJEA 4K6GA 1RYZA 3IQWA 4GR5A 3GZNB 3CX6A 3QHPA 4H31A 2BGUA 3QUSA 4CT4B 1ZPDA 3DAOA 4XASA 1XXHA 4CCYA 1RJGA 3D5TA 5JDCC 1D6MA 1OYVA 1JHUA 3WFIA 3ZD8A 2E6UX 3F4LA 3NTOA 4BMXA 5LU8A 1CJBA 4E1AA 3GK3A 2BDTA 1PF7E 5ITVA 2NZ8A 4OFBA 4B85A 4IMIB 4ND4A 1PJAA 4TM8A 3R1IA 1J7KA 5H80A 3V8VA 4ZQFA 3FPJA 4KIUA 1NW8A 1RXEA 5K03A 3DE6X 1F6DA 1HE8B 4R6WA 1Y7LA 3DUWA 4L78A 2QR2A 4HWGA 5DT9A 5ULLA 3BMXA 2HHAA 1EHYA 3MWLA 4JBWA 5C9ZA 5EIOA 3FCEA 1Y7IA 2BKAA 2HNAA 3TIIA 1YACA 3NVKI 2Q5EA 1VZ3A 2H54A 3DV0B 1Z2EA 4MS1A 5GAJA 4BBAA 4AMVA 2ZWOA 4B09A 3CUEF 4OUKX 4DC0A 1OX4A 3K0AA 3UWKA 2X23A 4ZYZA 2GXQA 2XIJA 3QPDA 3RHSA 4OJNA 1W73A 1RQXA 3FNQA 2OXEA 1E96A 4YECA 4QBGB 3H8VA 3STXA 1WMAA 3IQGX 4RKQA 1SU7A 4CPDA 3RJ9A 3E9YA 5EJ8A 2P4HX 2O8EA 2FPGB 4P34A 2IHZA 4BRWA 2C8JA 2Q0SA 4OCZA 4GAEA 2QLFA 3PFWO 4HT3B 3CNNA 3W9UA 2WM8A 4JJ7A 3MBIA 4CKZA 3WGIA 3VPGA 1GQOA 2HQ1A 4LDNA 1Z5GA 1HUQA 2UDPA 1D8TA 3DVAB 4IF6A 4YWHA 3TJRA 4X3PA 5FD8A 4BIMA 3LGXA 3RR2A 2OK8A 2AE1A 3N2KB 5AJTA 4BU0A 4UM8B 3FBGA 1MB0A 5BR8B 1SCUB 1RU3A 2DM6A 2VF4X 2W6IA 2ZI6A 3L6RA 2XCTB 1HZZC 2XVMA 3U44B 1NDUA 3PFCA 5CXXA 2I7VA 2YVQA 1BGWA 1N6NA 2RGDA 3P9CA 4JXJA 4BFCA 2BGLA 2G9UA 4BUZA 4X1IB 1L5MA 5MDHA 1QBGA 2O3SA 3U1VA 1KO1A 1WXGA 3JYHA 4TXMA 2FPRA 5EFZA 4D6PA 5JSHA 2JHGA 1JFTA 1C3JA 4RWEA 1N1MA 3I1IA 3R9KA 4DDMA 3SZLA 3AP1A 1HDIA 3UJPA 4BGEA 1BROA 1JPNA 1Z0UA 3THYA 4QQKA 7MHTA 1Y63A 4RPJA 5KTRA 2A5GA 3H5LA 3KB2A 3OC6A 4O33A 4HUTA 4ILKA 4TUYA 4UUPA 3UV3A 3WWOA 1ZWLA 4PHFA 1VSVA 4X24A 3BXXA 2R1TA 4OP2A 3UK2A 3AKZA 3OA0A 5CDUA 5CHEA 1G7RA 4ZMRA 1I7NA 3RBZA 2QF7A 3C7TA 3ICCA 3RVQA 3SBEA 3A0UA 2FR1A 1TQ2A 4X1KB 2V4ZA 4C0KA 4YMLA 3QYAA 3C5VA 1XD2B 3ESDA 2QZSA 4D45A 2H3HA 2Q2QA 5LA6B 4B3XA 5LQNA 1EUDA 2VATA 1E5XA 1Q91A 3MFYA 2FHPA 4O25A 3UAGA 5KWSA 1V43A 1TAUA 3FPGA 4TTQA 1ZCBA 3IMGA 4TV9A 4X7BA 3CCCA 3TI9A 3BDIA 4O2LA 3LHSA 1IZ0A 1Q95A 3HFGA 3RUAA 3CFYA 2PBFA 3ZCQA 4C4OA 1P4JA 5JY6A 3KHTA 2BHTA 1G7TA 2RGYA 4PTLA 3LCJA 2RKWA 1Y6GA 5BV0A 1ZN9A 1KOGA 1N5OX 4A0RA 2H06A 3SR3A 2I2AA 1NAIA 2J3JA 2RGGA 3ZPXA 1W5EA 1DE0A 2YHUA 1M1NA 1AMOA 4PVDA 1EK5A 3W2TA 2CMHA 1I4TD 3C98A 5JT1A 1ZUWA 5JO9A 3EIEA 3AESB 4WLOA 4B35A 2FHSA 1H2HA 3KJHA 5IJ9B 3ZNPA 4WX2B 5I3ZA 2WWWA 1H6BA 1YQGA 3KD3A 1V37A 2G80A 1CZHA 1MW8X 4YJ3B 2OCAA 4B75A 2WTMA 2OORC 2QTAA 3NOQA 4Q34A 2AC2A 3CIFA 1SKYB 2ZUWA 1GKKA 3BCUA 2F67A 2XWBF 2RAVA 3M6IA 5A5FA 3DC2A 4KE8A 1QP7A 3O0TA 3QVXA 2F3UA 2PT6A 3R6LA 3CVWA 4X20A 3VH3A 3CTMA 1XVUA 1E3IA 1KETA 1V7CA 1IUOA 4I1OA 5EUMA 3UA4A 3ZKWB 4G9EA 2F8MA 2RBKA 1CZLA 4TTTS 5AI6A 4CLEA 2I3DA 2W6OA 3QP9A 4N3AA 4A2WA 1FNCA 3W3AH 3LC1O 1A96A 4XDYA 2VWQA 5G2OA 3RFVA 3RAGA 2DCUA 4IFEA 1S89A 1UXKA 3K6SB 1PQPA 1Q14A 4WCDA 3OESA 5H68A 1ZI9A 3TSWA 4B3MB 1KFJB 3V4LA 1I01A 5AJWA 1HFKA 2AI2A 5TX7A 3U80A 4O4LF 5LZ4A 1LPNA 2ZWMA 1TKCA 5BUQA 1VE6A 2WFLA 3FOCA 2IZ1A 3GNTA 3NNNA 1OJLA 5FO1A 5EJIA 3U49A 3F46A 1PX2A 4V1CI 4W9RA 5DWVA 1JRLA 3O1HB 3TKLA 2E1RA 3H1BA 5KNBH 3P4YA 5K0NA 1YHNA 1RE1A 1NIPA 2UZ1A 3AEXA 3BTUA 3KQTA 4MTLA 1VPTA 3AUSA 3VHXA 1TVMA 2KPOA 4LUCA 3KELA 3ZDDA 4D0NA 1S8OA 3V9PA 2XUGA 2ASVA 2HV8A 4KACA 2GZHA 1E2IA 1JXOA 3TIFA 4UE3S 3MWFA 4EG1A 5JAZA 1N77A 2AKAB 3U7QB 5KYYB 4LTNA 2OLEA 3GP3A 4PYKA 1R0SA 3Q7EA 5TMBA 1VA5A 4D9HA 3HZZA 1I3CA 4JQYA 4B32A 1EDBA 2CCKA 2EYUA 2IY9A 3RVDA 1QG0A 4ESHA 1H9CA 3EH2A 2G9ZA 4KSCA 4R1NA 6AT1A 4UDYX 3FZGA 1PWHA 2QUBA 3PEEA 4BCDA 3F6CA 3X2SA 3AXSA 4M22A 1N3BA 1PGPA 3GEPA 3PWKA 1TK9A 3B38A 3HJGA 4OI2A 3PC4A 4C22A 3KTOA 4UEQA 1AHPA 3KT6A 4JLDA 4K2HA 3TS1A 5ADHA 1QJ4A 1UPUA 4E33A 1CYDA 3LGSA 1VI6A 1RWBA 1DX9A 1P60A 2FZ5A 4R7ZA 2ZYUX 2FUEA 2DTDA 4X90A 2GN0A 1N2HA 4IIYA 2Z9CA 5B1EA 2D1SA 3QA9A 2ATIA 3TTXA 2W2LD 3OM0A 1K4YA 2OL4A 1JEDA 2QM0A 3P9YA 1N92A 2ZROA 3UN1A 4HNVA 3LWNA 3AUXA 4OOEA 1IONA 5DRTA 2P2GA 4K9DA 1B0ZA 4MCJA 2PRYA 3USCS 3F4BA 2B20A 4YRPA 2ROQA 3R3VA 4OM7A 5JMPA 4W5NA 3O83A 2GBPA 3RIGA 5YASA 1OPRA 3BJIC 2V1UA 1ZIDA 3HHPA 1TUIA 1YIDA 4UTPA 4BX3A 1YB1A 3ZI4A 1ZP6A 3M3HA 1Y9DA 3PXEA 3QEOA 4OBBA 1F8YA 4TUYF 4D0GA 5HF8A 1QANA 4JELA 2H4FA 3NHBA 3HBMA 4I1YA 1M73E 2ID4A 2V98A 2BGNA 2PH5A 1QQAA 2F00A 1L7QA 4N6OA 2BBTA 3E3LA 4FHEA 1A5SB 1U1EA 3R20A 2IE0A 1UJ4A 3KYCA 5FTMA 1GLGA 3H8WA 2QN7A 4HHEA 1X7XB 2OZKA 3GLHE 4JVNA 4UKDA 4FYYA 2DSTA 5GWXA 4DPMA 4Z7OB 5IANA 1L8AA 1YCFA 3NBUA 4RXMA 5ECWA 4W5JA 1BVUA 1JMVA 3G8DA 1IBRA 5J63A 4B6RA 3ZW8A 5KSOA 3ON5A 3ZD9A 2DWCA 2FWMX 3AC0A 3QEAZ 1QP8A 1CQWA 3G5MA 2P62A 4TV9F 1Z62A 1QGZA 3LQRA 1VL6A 3P2YA 4FYKA 2RHTA 4H1TA 1W93A 4MRVA 2C4NA 4PV7A 3WRYA 2BH9A 3IEMA 2A0YA 3Q1LA 2Z5GA 3P2JA 3WB0A 2PMDA 1KBZA 1AO0A 2HA3A 5E7JA 1IMJA 4E6PA 2P1ZA 3ODPA 1DAEA 2C0QA 4NP6A 1GNQA 2MINA 5CIQA 4K6KA 4TLAA 1ZK4A 3KL2A 4XLLA 3RS9A 2VQ3A 4XI9A 4OQEA 2FW6A 1T5LA 1M7GA 1V5WA 3HCRA 1H8EA 2BUCA 2OHFA 4HBGA 1D6SA 1FDTA 2AK2A 2O2YA 3DMTA 4XZ3A 3MWYW 3UC5A 4AJHA 3VFDA 3G82C 1V6AA 4ZO7A 4KUEA 1V8FA 2O8VA 5HQ3B 4CMEC 3KQMA 1JR6A 1GAWA 1P5ZB 2FK8A 1Y8QA 2GLUA 5D87A 3N76A 1TVCA 2CC2A 2D0DA 3PEWA 4HF7A 3EGIA 4JA2A 5AIAA 4EFKA 2N0SA 2OCLA 2R1ZA 3B2QA 3NCHA 1YULA 5HM8A 4J7UA 2OVBA 1KFEB 2X0FA 5AP9A 4IIDA 2NIPA 2EARA 3TSOA 5JAQA 2P2YA 2A58A 3H0CA 4L9RA 3PHLA 2WIFA 3IVGA 3UMVA 3CR8A 1T2DA 3WX0A 5BOVA 5DK4A 1TUBA 1AA9A 3EVCA 3M6WA 3IQDB 2XUOA 5CYPA 3QF7A 1FRNA 3HB9A 5KMGA 3UT5A 4EATA 2WIAA 5JMOA 5LOVA 1RQLA 3B6KA 5EVJA 1Z74A 4NEGA 4WD3A 1JNYA 4OI0A 1JILA 1FS4A 4FX5A 3K96A 1TYDE 3J7TA 4XD7A 1R12A 1IN8A 2ANBA 4PC6A 2XUFA 1ZJWA 4BNYA 1FYXA 2PD6A 3IHTA 3IR7A 4M2LA 4CBVA 1T3GA 1ZJ6A 5EXSA 3V8NA 3KHSA 3LSYA 3M6LA 4GW3A 1PFYA 2AFIE 2G07A 1S4MA 2E0IA 3G59A 3K9QO 1SBQA 2O0JA 3EC7A 1G5FA 1MEOA 3RFXA 3RUHA 4B2IA 2R9VA 2ZSBA 4Q0MA 1U3FA 2Q3JA 4N12A 3QSYA 3KKKA 2GCPA 4HNRA 3ZNNA 4ZO8A 2NU8A 4ZZ3A 1AK2A 2ZBGA 4EKGA 4TVOA 1QX3A 5LXTF 2JC3A 3DEFA 5IMSA 5H4GA 1QYCA 4RVGA 3FNGA 1LVGA 3DD5A 3EVTA 1PTJC 3IR5A 2DETA 1H5QA 2PUEA 4FHDA 4RM2A 4TX1A 4RJ2A 4WEOA 4B80A 1MJGM 1YZGA 1QHSA 1HL7A 1LBSA 4TWRA 4V2IA 1NRJB 1CHNA 3DLTA 4EG0A 1A2QA 1M9NA 2J5BA 2VA8A 1M0WA 1W581 3LCRA 2AR7A 1W9HA 3MT8A 4R69A 5LR6A 5LSAA 1R0KA 4NYJR 2XOKA 3N8NA 4HOYA 3ERCA 3AP3A 4D8VA 4GT1A 2FF7A 4HGNA 1TT7A 2E21A 4OQFA 3WK5A 1E3JA 3FI9A 3KQYA 3W6NA 2QMHA 1ZGZA 2WYWA 3R77A 2YY6A 1ORHA 3HFJA 4GUAA 3HJFA 2VH5R 1M1YB 3A3OA 3ZY6A 3CPHA 4QE3A 1P0FA 2BFFA 5KVQA 3EFOB 2OV1A 4CMAA 2PWAA 1P6UA 2G04A 5IDYA 4JJEA 1RYEA 2LV8A 4FOPA 1KJZA 4EUSA 3N6RA 5CCXA 2VCYA 4DRXA 4JC8A 1L1RA 5KWJA 3X1XA 1KWKA 2OG1A 1W4AA 2AUMA 3KXIA 3RS7A 1DT3A 1P6QA 3BGIA 4UVIA 5HKBA 3FJOA 5JXHA 1GGMA 2N42A 2Y99A 4LPKA 3P1JA 5FUVA 1H5UA 1P0CA 3PXAA 4HH0A 3TRKA 4QFDA 1NC1A 1Q3HA 4ENUA 2AEFA 3CXRA 4OHMA 2NG1A 1J2JA 5A9SA 1FU8A 4JEIA 4B73A 5JWRA 5M2QA 1PNQA 3PUWA 1JEAA 2JGIA 4PLPA 3W5SA 4MMYB 3L8GA 4O0MA 2FEPA 5LKRA 1ZUNB 1YBVA 3CWCA 3N2LA 2WUWE 4NQRA 2P6NA 1Z3IX 4JD5A 4PHHA 1JG6A 4D9GA 3DVLA 1E4YA 4EF6A 1NVTA 4LEIA 5F7XA 5EUCA 3M9XA 2O5CA 2B7CA 2EJUA 4XEHA 5E3IA 1C5KA 3I8XA 2GN2A 1PV1A 1P1JA 1T26A 1NL3A 1ZD3A 4TMTA 3FFXA 4K1XA 1NI4B 4MRPA 7GPBA 4UXIA 4PYOA 4C4TA 3HJCA 3HMQA 3R9XB 2GKGA 1BFDA 3R41A 3RS3A 1B26A 1WNFA 2XDAA 4LOKA 3KYJB 2NSJA 3M2TA 1DAPA 4V0SA 4RACA 3ZXSA 3BOSA 5LVAA 1M8PA 3PGMA 3T1VA 3UBMA 3V3TA 4E51A 2CLCX 4RK4A 1L4BA 4KWEA 1SR8A 3ILYA 4P08A 2V74B 2QZ9A 4BY9E 5BWOA 1AUOA 3T38A 1Q20A 1B73A 2LUOA 1M34B 4KIJA 4LC9A 4Q1AA 5TT1A 1QGOA 3M6UA 4ZVTA 3VBCA 3GEDA 2WJ3A 1HETA 5JMTA 4BKUA 2OP0A 2Z98A 4B2LA 1IXYA 5SZJA 1QGUB 2QQ5A 5HFJA 4OO3A 3STWA 3C8UA 1FJXA 4GVPA 4CM3A 2C1XA 1VIVA 1U4OA 3Q72A 3RRXA 1DI0A 4BCCA 1LDBA 1U7WA 2XCUA 5EN4A 4TRMA 1UOEA 3I5XA 2B1GA 2RHGB 1T4DA 3O2JA 5C51B 2FSHA 1R5BA 2XUJA 2X0IA 3L6EA 3PFFA 3OD1A 4IX1A 4KUGA 3HBJA 3VZPA 2B61A 1JMYA 1ZICA 3W5AA 3O8BA 2QN9A 4NBLA 2IW1A 1KC1A 2P4EA 2VJDA 3L7LA 1M0SA 4PINA 3I0MA 4RQBA 5LN1A 1KJYA 3RFFA 3I6QA 2EHDA 1TTPB 1BWQA 1G7SA 2DHRA 2J48A 3AKDA 2OB1A 3DONA 3HJTA 2DHCA 3CQ9A 3WYBA 3P4UA 4G26A 1N36B 4HAZA 3GVXA 2NOAA 1BX3A 4PRZA 3TIVA 3IP3A 2OWEA 5ARCA 1DAIA 4PO8A 2X0JA 3OIYA 2CLMB 1O94D 1MORA 2HRZA 1XHFA 3QX7A 5KKCA 4DSZA 2VBGA 3IVAA 4K3UA 3TEMA 4RMNA 2FXVA 1X2BA 1EB8A 3P52A 1RABA 3KOZA 2P9EA 2X6QA 4AG3A 3V34A 4OI1A 1RT9A 2C2MA 2GZSA 1DHTA 2PXAA 2H0AA 4X6LA 4HB2A 4REMA 4TLLB 2QG9A 1T1GA 3H5RA 5KCZA 1PT7A 1TW2A 4REOA 1ZYUA 1U9IC 3DCJA 1AK9A 2UZAA 3FOAA 4Q02A 1GG9A 4PN7A 1GCUA 3DDCA 2BFEA 1I10A 1NULA 1FIUA 1J4AA 4TWIA 4M36A 2EKBA 5EWJA 1SOUA 3O1IC 3IUJA 2P5SA 2VT2A 1UC9A 3FDZA 4YRJA 3THSA 1BE0A 2PL1A 4NEQA 2JBHA 2B6NA 1N0IA 2J3EA 2RK3A 3CV3A 1FNNA 4IVNA 3DCNA 4MZXA 5DOVA 3V4OA 4WJLA 4PG6A 2JHCA 1U0LA 3E15A 3GMDA 2AI1A 4EP1A 2AW5A 2QX6A 3BC1A 3K0SA 1OOEA 3E5NA 2HLDA 3P0HA 1VTKA 3QVOA 4G1FA 5DNVA 3UTCA 1N1EA 4INZA 1P4SA 1Z33A 2XJ4A 3FMIA 5KYUA 4G5HA 1JEYA 2UUCB 2ZR0A 2BGTA 3CEJA 3E3MA 3IFSA 1V1MA 1ZGJA 3IAEA 4V0NA 4XWYA 4CN9A 5JARA 4U7GA 5DM70 2V3VA 3CH7A 4KQIA 3OQNA 2PX8A 3EZ9A 3QEJA 4N3NA 3V7NA 1Z47A 4C05A 1KBQA 1JV2B 1THZA 1Y80A 1Z4KA 2QENA 3D02A 3DYBA 3ECAA 4K3VA 4K9QA 4QGAA 1Y6ZA 4MUHA 4B87A 1RAFA 1JG2A 5ALXA 4YR9A 5E4YA 2HPZA 2WKPA 3GYBA 3P2KA 2PKQO 1L7DA 5DNYB 1N5LA 2ONZA 1XZJA 3G0IA 3H4TA 4QUAA 1Q0TA 1GG8A 4W9NC 2GK7A 1G9XA 4KQCA 1T5BA 5KNDH 4A15A 2WABA 2YMPA 2JD0A 4HS4A 5AW6A 3SQLA 1X9HA 1N7GA 2UUAB 2BSAA 2PZ8A 3PT5A 5CK4A 4ZKDA 3SOZA 1XMSA 1OX6A 4W9MC 2PJZA 2RGCA 2WIDA 1NQAO 2QNRA 3AOEA 3LUFA 2A6PA 2YZ7A 3WLIA 3SSOA 3FW1A 4BNUA 3AR6A 3DTTA 5K0SA 4LYHA 2JIDA 4JBYA 3FA2A 4L2IA 5DE3A 2XDQB 4MB2A 2W8BB 3T06B 2OXCA 4ER0A 3OCZA 1EUZA 3OLVA 4DT1A 1FP1D 2WE7A 4ERXA 1G5TA 2G5TA 2RI0A 2Q0XA 4YP1A 5EXDA 1KZYC 5L95A 4G86A 1BOFA 2XRYA 3LFUA 2XV1A 2W2NA 1OXKB 3R3JA 2NQ8A 4I46A 3UWMA 1IBLB 2EX1A 2KQUA 1NATA 4WN9B 3TSZA 3UAWA 2F9LA 3CA8A 4NS4A 2D59A 2QT9A 5CH5A 1E1RD 2HJRA 3OOSA 3UUEA 1YZTA 1U3DA 1PSZA 3H18A 4YRRA 5K99A 2BTOA 1TMKA 5C5CA 2CWDA 4ARAA 1F3LA 4AZ3B 4F21A 4RF3A 1NYLA 1P7PA 1JQJC 3J7AC 2CB0A 1I4DD 3ROQA 3CZAA 1VZ2A 2LKDA 4TVSA 2VZ0A 2C94A 4P3PA 4LX0A 3P5BA 1G18A 1Z4QA 3LUGA 3WJ7A 3BL6A 1JKXA 3JD1A 5DKFA 1VMAA 2P0AA 3LQFA 2BI8A 4C3OB 1G4UR 2O8NA 2W8ZA 2ZU6A 2CDRA 2ZB3A 1SBZA 3SHVA 4MAFA 5DULA 2EV9A 2O1SA 3T9FA 1MOQA 2GAIA 3FPLA 2LE0A 1LDNA 5DYWA 3OEYA 2Q5OA 1R88A 4HAXA 4M0PA 1U2PA 1SCNE 3QPVA 3C4JA 1NQXA 3TNLA 3VU8A 2OUIA 2SECE 1IATA 4O59O 5ALSA 3UJBA 1YQTA 1GPLA 4KC0A 5EJGA 3RARA 4Z8XA 4QM7A 2FW9A 3OLWA 4LK3A 4YWJA 2IBSA 1ZH2A 2A9JA 4LYEA 2AOTB 4HGYA 4JI1B 2P41A 3HDGA 4JLBA 3HRHA 5GMOA 4ZFNA 1NQUA 4ZGGA 2H7CA 4PZAA 2ZZNA 3KPJA 5TF0A 1X7YB 1IY0A 4ARVA 4WJKB 2EZ4A 5FULA 2EQBA 3GPIA 3DFMA 3M7IA 5D3ZA 3DHVA 1MDFA 1T0IA 2PQ2A 2JAQA 2V7QD 5FI5A 4DXDA 4YALA 3EZGA 1PW5A 2QN6A 3FSJX 3P7MA 4NFHA 5ALHA 4EZIA 1OU4A 1DKUA 1E6KA 1A9SA 2F17A 4A26A 4BEVA 3LDFA 4UAGA 2WAMA 1BAPA 2HA5A 3D7RA 5BQ3A 1QU3A 3NEYA 3DPSA 3A28A 4REQB 4M6WA 3IDSA 1X8LA 1YQDA 3TE6A 2XLBA 5CEJA 2ZPTX 3GARA 4X93A 2WJIA 5EEGA 3LKVA 2PJUA 4N76A 1GZ3A 4J43A 3IRVA 1ECCA 1ZGBA 2AUTA 1G8FA 4JNKA 4CMCA 2D5LA 5DXJA 1FFYA 5AK3A 4Z4GA 4NNPA 3FCSB 3QKSA 3ZE8A 4LJYA 1O7JA 2I1WA 3QH4A 3QLTA 1B6GA 1J0DA 1FMTA 1UP4A 3BH6A 1D04A 3DW1X 4X1YA 3TMKA 1N2SA 3A1VA 5EP2A 3UA3A 4JL6A 2NO4A 1E99A 3RAFC 1RM5A 3BM5A 2JLZA 5DN6D 1SBIA 4IIUA 4R6XA 2DGDA 4EVQA 5J47A 3VI3B 1PLJA 1V3TA 2IRWA 4TXHA 4EMUA 3I2HA 2EAUA 1XI2A 2WT4A 3L1UA 2GDZA 3DP9A 2ADFA 1HRKA 3DBRB 4BYMA 1Y8RA 5L7WA 2CMKA 2DBVO 3VZCA 4HVLA 2FPSA 1EM8A 4Z0PA 5JS1A 4FWTA 4O0LA 4M9QA 3OZBA 5DHFA 2CJYA 3DB1A 5CDFE 2R4TA 2IHKA 3A1EA 4UE2A 1SB8A 3ECSA 2BFPA 2H4JA 4OYRA 4Q66C 4ZYWA 1FE8A 2QGZA 2QYTA 1WULS 3FUXA 1KNXA 3EVNA 4RYLA 5AW3A 1D0VA 4RZQA 1K9SA 3UMMA 1UWVA 4OGFA 2FN4A 3TO5A 5B4UA 2RGNA 3I5MA 3AUAA 4Q4DA 4LJLA 1CIPA 3EUAA 3D6FA 4HO1X 4KX3A 3CTPA 1US8A 4R9RA 1Q0RA 4Z7QB 2BOVA 4EJSA 1NJ1A 4CLDA 1U90A 3BMOA 1LQUA 3GUVA 5FYQA 1W0CA 2IEIA 2REQA 4P4TA 3DYIA 5E6RB 5FNVF 3TLZA 4DR4B 2X7HA 721PA 3MS4A 3NOOA 4BLWA 5GZ3A 4GSYA 4X91A 3NHMA 2FK7A 1RZVA 3ZDXB 3LNCA 4RXUA 2WKSA 2FPPA 3D2LA 4BTEA 3FOFC 3L0PA 2YRWA 3CINA 4YV2A 4C89A 1PEYA 3CJTA 5FBHA 1V96A 3GLSA 4O5AA 3MRTA 3QWFA 3WBJA 1YIAA 3B9RA 1T3LA 1MV8A 1ZGCA 1O94C 3BCRA 3LX8A 4OMUA 2I0FA 3UF0A 3C3JA 2ZAMA 2PRIA 3P0JA 2PSFA 4LX8A 1H4SA 1XTBA 2V4UA 4AJNA 5I4IA 3LPNA 2AXEA 4NOLA 2EJWA 1MPTA 4D3FA 1L7BA 1C4OA 1E4EB 1K0FA 5LQCA 3FPCA 2OD2A 5I9NA 4KPGA 2WVHA 4GEGA 1VL0A 1H69A 3UFXA 2ZRCA 1A8SA 2AFRA 4YUZA 2C7VA 3G1TA 3IOEA 3L1VA 4LY0A 5JCZA 3F1LA 1SXIA 2C9BA 3P27A 1PT9A 5IAJA 1WY5A 4MYTA 3DVSX 1LRKA 2ABWA 4N1AA 1GPJA 3K9BA 3T1OA 1YF3A 3HKBA 5HF6A 1JNXX 1KIAA 3RIEA 2IY8A 3EGDB 3RRMA 4CMKA 1NRIA 2V3CC 1GAJA 1U2DC 3ANMA 1NMZA 3LVBA 4FJ2A 1FY2A 4L74A 1VIDA 4PX9A 3THWB 1SCAA 3AGPA 4IRXA 3IIKA 1XA4A 4WSOA 3A6LA 3UO8B 2ZJFA 1D4FA 2IYFA 2XYGA 1QYIA 3EMDA 3HKCA 1GPAA 3LYLA 4QQFA 4FDUA 3RG8A 3UQZA 1CRZA 1BEUB 4IDPA 1OYOA 4TMZA 3FR8A 1EH5A 3IEPA 2WQZA 1U3GA 2BP7A 2WJYA 3X1DA 2I6SA 2X4GA 3NOXA 4NDAA 1DKRA 5EESA 4DGSA 3NJRA 3LHFA 1TJYA 3H7AA 4NC9A 4DWWA 1FYDA 1QIHA 1KJ8A 4YAJA 5GONA 1QAOA 1GRCA 5KB3A 3TB4A 3U7HB 1JDNA 4Y0VA 1K08A 5JCJD 1V4VA 2E55A 3VTZA 2EKQA 2WSMA 1JR3E 2GBIA 3PNVA 1KY5A 1FFHA 2J5QA 3FHTA 3AWDA 3KKOA 3IVXA 4MVJP 4Y8VA 4AO7A 3ZTTA 4C4YA 2PFSA 1W85B 4DLZA 2YBDA 3KDAA 3LVFO 2HKIA 2ZRNA 3JVVA 1UK8A 2GO7A 2D1QA 3N0TA 1JR3A 2Y93A 2I3GA 1GAQA 2Q3EA 4R41A 1HMYA 1OFGA 1EXNA 1E5TA 2YWRA 3WK4A 2ZW9A 4MVJH 1GV0A 1F0KA 4LF5B 5BSEA 4LHXA 5EWLB 4GDMA 5EKXA 2PKQP 2VTEA 4CUJA 1KDYA 3U31A 1XK6A 2DECA 3U7GA 1MHPA 1VC2A 3AERB 5DHPA 3HYRA 3QXHA 4DIDA 2WHEA 1IPHA 2V9CA 2Y1KA 3Q0IA 5FBQB 2O8BB 2YV1A 3OZGA 4RTKA 3JQBC 4P9NA 2F4NA 2NPFA 3NUZA 4N7BA 3X1KA 1JJFA 3KHUA 2B99A 3EMKA 4UZEA 4C01A 4MQBA 5AHKA 4BN5A 4TT3D 3RPEA 1DC7A 3EARA 2TMDA 5H8WA 2HR1A 4AY2A 3HY6A 2VTBB 4TMYA 4MEJA 4QBHA 2BSQA 1H2RS 4HDKA 2OV8A 4WKGA 1KSJA 1QUEA 4YIKA 1ZXLA 3BAZA 3OE7D 4CI0B 2I6UA 3IIEA 3E58A 2O0LA 2GN6A 4HDNB 3GRVA 5JUWA 3NTQA 2HIGA 1W46A 1R27A 1QH1A 2OQIA 3GGGA 2JJ8A 2O2HA 1Y3CE 5JYEA 3MMNA 3UK0A 1AF4A 1E4VA 3N74A 4Q1EA 3NGMA 1FEZA 2VP0A 1JH9A 3NHJA 2M1ZA 1K8YB 3HDTA 5GJVC 4UNRA 1LFAA 5FOVA 1LSSA 1NXTA 4O2AA 3LKBA 1AVTA 2OCGA 4OB7A 4DC1A 1MC5A 1U3TA 3O90A 4G1MB 4FBLA 2ZM5A 3LUPA 4GNRA 1Y9JA 3QHQA 1Q83A 5JIBA 5JS7A 1T35A 4CEHB 2XNSA 3UMGA 3ZV3A 2ZJ1A 3MINA 1FS5A 1TMYA 3TLAA 4WEQA 1E66A 4Q7LA 4RIGA 3SHFA 2OXTA 1Y1PA 1WXEA 3PNKA 3QEKA 3PQ5A 2WG0A 5DZSA 5E4JA 3H6KA 2RHRA 5T8KC 2ISSD 3TQCA 3THXA 2UZIR 2XMRA 5F4ZA 2UXCB 1NVAA 4NFYA 2WJWA 1VDZA 2ZBRA 2ZYGA 3E48A 2OBFA 4ZAZA 1I2MA 4C76A 3DA8A 4UU1A 3H6HA 4FI3C 2JRCA 4M1QA 3OZRA 4PX5A 1Y5MA 3T3NA 4M1MA 4WGFA 3CPSA 4HSEA 4DW8A 1DPGA 3U7IA 2HRQA 2C61A 3TQOA 1H2YA 1XK7A 1G8HA 1IXSB 3G9QA 3H8JA 1A9OA 2C3UA 1E1QD 2I78A 1WSAA 5CFNA 5ICFA 1QC5A 3M6FA 4Q47A 1JIVA 4W1PA 1UR5A 5BVHA 1UC8A 3DSRA 5ILQA 5K2MA 5JRDS 3NBAA 5L4SA 2GETA 1I8TA 4S0XA 3F78A 1ORIA 4G5SA 4YRSA 1GWNA 1GEEA 1M83A 4J1TC 2Y1EA 4RFSB 3KETA 1CEYA 4HAWA 1XZ8A 2R2AA 2K4MA 1I6WA 1HYQA 1M6WA 1IY1A 3DQPA 2GCNA 3KOYA 2REBA 3OPXA 3AR7A 4E3WA 5B3LA 2OR3A 3ROKA 5L4LA 2DH5A 2IXBA 3VR6D 1C1YA 3M1LA 4M0UA 2OC9A 5CVJA 3ACBA 3QVMA 3JR3A 3DH0A 6REQB 1PNRA 4ZQEA 1W0JD 1YRQA 2EJBA 1SHTX 1Y1QA 2EX0A 2LTAA 5JC1A 3IAAA 1ZEMA 5L7YA 5KPJA 5DP1A 3AKCA 5THXA 2IKQA 1I2ZA 1XV5A 3QK7A 5L45A 1ZOOA 1W1IA 1RFLA 1C9NA 3LWZA 2AC4A 2JL1A 1BHSA 1JQAA 1VKRA 4TMVA 3WQQA 3K71B 3TQTA 4RPKA 4HNSA 3HYCA 4UU0A 4CM4B 3IBFA 1YBFA 1NJ6A 4X7RA 5FJJA 5GONF 5ERGB 4XQ0A 2FFRA 3GDGA 5CLFA 4DMMA 2OBBA 4WFIA 2LVBA 2W90A 4ZAFA 3KYBA 1KI7A 4JCCA 3VR2A 5L3QB 2AFHE 4RGQA 2H4WA 2JS7A 4UCXA 4RMGA 2BKVA 4RH3A 2B8NA 3KQQA 3O74A 4ISCA 4WZAE 1P7CA 4E12A 1A82A 4BJ6A 2O05A 4RADA 3GF4A 1Y4AE 1H0KA 4FNAA 4PZUA 1G60A 2GZ1A 4KFTA 1KMMA 1QDLB 1U99A 1SO8A 4I99A 4OV6B 1GYPA 3D8BA 1D7AA 5T41A 3U3ZA 2PZAA 3REQA 1UADA 3QOFA 1KQNA 3AEQA 1YZVA 3W05A 4CKEB 5I7UA 2X7JA 2C9CA 1VB5A 5DPMA 4IZIA 4L5IA 4BU1A 4F96A 1BXGB 3RREA 2WQ7A 2XB2A 4MS4A 4DA0A 2PPLA 2PYZA 4ZC1A 2QSYA 2WKQA 5EGNA 2Z4SA 4BZWA 1JSZA 1RLTA 4S2UA 1O0SA 2CF6A 4LRQA 1CVLA 1OAOA 2J9YB 2AG0A 1JLLA 2VNSA 2X8JB 2OWDA 3O4RA 4ZU6X 4ZICA 5ITSA 1KQGA 3AVWA 1QAMA 1ZM9A 3DDUA 5CNMA 1DFHA 3DE4X 1JE1A 4I6JA 4BXOB 3AK4A 4IQ8A 4QWWA 5PNTA 3DHNA 4NWIA 2P7IA 3OAAD 1WMEA 5ALWA 1FA9A 2ZIXA 1YKSA 5KSPA 3N3AC 2O6HA 1OBVA