3C9CA

Structural basis of histone h4 recognition by p55
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
405
structure length
380
Chain Sequence
SFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPCQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin assembly factor 1 p55 subunit
publication title Structural basis of histone H4 recognition by p55.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription repressor
total genus 88
structure length 380
sequence length 405
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c9cA00
2PM7B 3I7HA 2CN3A 2CN2A 4CZXA 4LG9A 2P9IC 3PSCB 4PSWB 4GM8A 3JAMg 4GGCA 4KFMB 2QXVA 4CI8A 1JMZB 2H9PA 4GZ8A 1PGUA 3EI2B 4J77A 2P9NC 3EI3B 1SQ9A 3I7PA 3PSLA 5CYKA 3EWEA 4NSXA 1PEVA 4PC0A 3UVMA 4L9OA 4Y7RA 5CXBA 2HXCA 2J57G 3UVKA 4TZ4A 2BBKH 4J81A 3SJLD 3V9FA 2H68A 4PBZA 5HE1B 2H13A 3JZGA 3ULEC 4JD2C 4D6VA 4A09A 1NEXB 4E54A 4QRJA 3ORVD 5EMKB 2AH1A 2H6QA 4FA5D 3EI1A 2YNPA 4FAVD 3L4OD 4FWWA 3I89A 3JZNA 3UKUC 4CY5A 3NVNA 4J86A 1TBGA 3CIKB 5EALA 4CZVA 2B5NA 2HESX 1GXRA 1U2VC 3I8EA 5EM2B 5EAMA 3N0DA 4FA9D 3BG1A 1GOTB 4JSXC 4PXWA 3VA6A 3SVWD 1GP2B 1B9YA 4QT8A 4CY3A 2IAAA 2AGXA 5FKTA 3VGZA 4O3TB 4O1QD 4LG8A 5EMMB 4J0XA 1R5MA 4X63B 2H3XA 2H9NA 1XIPA 5K19A 2CE8A 3SHFA 3E0CA 3IKOA 2CE9A 4GGDA 3UKRC 3BWSA 2IURA 3I7LA 5FKSA 4A08A 4XEIC 3OW8A 3OKTA 2PM9A 4X61B 3UR4A 2O9KA 5IC7A 3OKYB 3SMRA 4X60B 5KDOB 2IWFA 4O45A 4YVDA 2AH0A 3DXMC 2B4EA 5IJ8E 3EG6A 2I0RA 2H6NA 3I2NA 4K3JB 1PI6A 1SHYB 5HE2B 3MZKA 1K32A 5IT9g 4ESGA 1B9XA 2EBSA 3C75H 5GXHA 3CFSB 3AL8A 5C2WB 4CI2A 4IA9A 5H14A 4AEZA 1GG2B 4J8BA 3JROA 2OIZA 5EMJB 4HDJA 2GNQA 3EI4A 4FA4D 3SBPA 2W18A 4QQEA 2I0TA 4LGNA 2BCJB 3I7OA 4GQ1A 4FAND 5I5IA 5SXMA 3OL2B 4N14A 1QNIA 4A09B 2UZXB 5K1CC 3NVQA 4UI9R 2GC4A 3DM0A 2J55H 1PBYB 3EI1B 4ZN4A 4GM3A 5TEEA 1MG3A 3U4YA 3MKQA 2P9UC 3RMZD 2XL2A 3F3FA 4CZYA 4E5ZA 5AFU3 1A0RB 4J73A 4QL1A 5B4WA 3F3PA 3PVUB 3MZLA 3PE7A 3J81g 4ZOZA 2YB8B 2IUQA 2H9LA 4CC9A 3RN1D 3K26A 5FA5B 3SBRA 2Q7QA 4CY2A 3IJCA 3IIYA 5JWZA 4G56B 1ERJA 1YFQA 2P9PC 3DSMA 2MTAH 4ZOYA 5FXYA 3MXXA 4JT6C 2YBAA 5HE3B 4A0AA 2AQ5A 4JSNC 3C5MA 3SXTD 3DXKC 3MKSB 4J82A 4I79A 2H9MA 4FHLA 4A2MA 4PSXB 4J8GA 5EMLB 2H47A 5CXCA 2OK4A 1XKSA 3SWSD 2B5MA 5TDHB 3DWLC 3C99A 2IWKA 5C2VB 1OMWB 5C9ZB 4H5JA 3IIWA 5FQDA 3UVNA 1OLZA 2UZYB 2P9KC 3P4FA 2IUPA 2CNXA 1XHMA 4Z8LA 4A11A 2G99A 4J87A 4BL0A 3SLED 4L1QD 4GGAA 3UVLA 3IJ1A 2HKRA 3B7FA 3C9CA 4D0KA 3EI4B 3ZWLB 3I7NA 5GMKn 3V5WB 2PBIB 3RRMC 4GQ2P 2IUVA 3F3GA 3A0FA 3BG0A 3JB9L 3I8CA 4BUJC 5CYKB 4CI3A 4A0BA 4XYHA 4GQBB 4OZUA 4ERYA 5CXBB 4ERZA 4AOWA 5IJ7E 4JSVC 1S4UX 4IMMA 2OVQB 4ERQA 4PNKB 2XU7A 4CY1A 2Z2PA 1JOFA 4E5ZB 1JJUB 4A2LA 1U4CA 2OVPB 4E54B 5H1MA 4OWRA 3RN0D 1N6DA 4JXMA 3N0EA 2YMUA 3KRXB 4ES0A 1RI6A 3SN6B 3L4MD 1P22A 4H5IA 2H14A 4J78A 2J56H 2CO0C 2OVRB 4J79A 3FRXA 3NVXA 2P9LC 2AGZA 5TF2A 3PVWB 4K3ID 1VYHC 2OK6A 3IJ0A 2GC7A 3OTTA 2OJYA 2I3TA 1TYQC 3V7DB 3EI2A 4A0AB 3GFCA 3EI3A 3AH8B 3JPXA 4XYIA 5TEFA 4J84A 3OL2A 2PM6B 5FKRA 1JMXB 1N6FA 3RFHA 1L0QA 3RSEC 5EARA 2H6KA 3MMYA 2G9AA 4L3HD 1N6EA 5CXCB 3EMHA 3J80g 2YNOA 2P9SC 4PBYA 5GSAA 5IGQA 2YNNA 5I5JA 1K8KC 4U1EI 2AGWA 4CI1A 5HYNB 2AGLA 3AL9A 5THAA 2Z2NA 4A08B 5AJAA 1FWXA 3JRPA 3FM0A 2PM9B 3SFZA 4GMBA 4EWRA 5EAPA 4A11B 3OKWA 3FGBA 4JSPC 2XYIA 5I5MA 4GM9A 4BH6A 1Q47A 2XL3A 5FKQA 4ZOXA 4ZOVA 5HE0B 5GXIA 2HJBA 5EM2A 2HYEA 4J0WA 2I0SA 4A7JA 3PXWD 4JT5C 2AGYA 3VH0A 3AL8B 2I3SA 3PXSD 2Z2OA 4O9DA 3I7KA 5FLXg 4X3EA 4L3GD 3CFVA 5AMSA 3RFGA 4A0BB 2TRCB 2HKMA 4MK0B 3HFQA 4U7AA 3SCYA 3W15A 4R7AB 5A2Qg 1NR0A 2QC5A 3UVOA 3EU7A 3PXTD 3ODTA 1MDAH 2B5LA 4O3UB 3AFCA 3KRWB 3RLMD 4Y5RD 2HJ4A 3GREA 4FA1D 1SQJA 5HQGA 3K27A 5IGOA 3SBQA 5H17A 3OKYA 3JZHA 1MG2A 2CO0A 4FB1D
chains in the Genus database with same CATH superfamily
2PM7B 3I7HA 2CN3A 2CN2A 4CZXA 4LG9A 4NC4A 5E6UA 3MUOA 3IUNA 2P9IC 3PSCB 4PSWB 4GM8A 3JAMg 4GGCA 4KFMB 2QXVA 4CI8A 1JMZB 2H9PA 4GZ8A 4D9SA 1PGUA 3EI2B 4J77A 2WQ8A 2P9NC 3EI3B 3VI4A 4QAMA 1SQ9A 3I7PA 4AMYA 5M5TA 1L5GA 3PSLA 5CYKA 3EWEA 4NSXA 1PEVA 4PC0A 4Z7OA 4Z7NA 1UOPA 1T2XA 3UVMA 4L9OA 4Y7RA 5CXBA 2HXCA 2J57G 4O02A 3UVKA 4TZ4A 2BBKH 4J81A 3SJLD 3V9FA 4NAAA 1UTCA 2H68A 4WK2A 4PBZA 5HE1B 2H13A 3O4HA 3JZGA 3ULEC 4NENA 4JD2C 5E6RA 4D6VA 1NEXB 4A09A 2XDWA 4JHPC 4QRJA 3ORVD 3T3PA 4E54A 4MMYA 5EMKB 2AH1A 2H6QA 4FA5D 3IJEA 3GC3B 4G1MA 3EI1A 2YNPA 4FAVD 3L4OD 4FWWA 3ZDXA 3I89A 3NIDA 3JZNA 3UKUC 4CY5A 3NVNA 4J86A 1TBGA 3CIKB 3VI3A 1O6FA 5C92A 1GOGA 5EALA 4CZVA 2B5NA 2HESX 3ZDZA 1GXRA 1U2VC 3I8EA 5EM2B 5EAMA 1JV2A 3N0DA 1E8MA 4FA9D 3BG1A 1GOTB 4JSXC 4PXWA 3VA6A 3SVWD 1GP2B 1B9YA 4QT8A 4CY3A 2IAAA 2AGXA 5FKTA 3VGZA 4O3TB 4O1QD 4LG8A 5EMMB 4J0XA 1R5MA 3IUMA 4MMZA 4X63B 2H3XA 2H9NA 1XIPA 5K19A 4MMXA 2CE8A 4DNWA 3DDUA 3SHFA 3E0CA 4WJKA 3IKOA 1E8NA 2CE9A 5FFGA 4GGDA 3UKRC 3BWSA 2BKLA 2IURA 3I7LA 5FKSA 4A08A 4XEIC 3V4VA 1VZ2A 3OW8A 3OKTA 2JKXA 4DNVA 2PM9A 4X61B 4RE5A 3UR4A 2O9KA 5IC7A 3IVMA 3OKYB 3SMRA 4X60B 5KDOB 2IWFA 3IULA 4O45A 4YVDA 2AH0A 3DXMC 3V4PA 4AN1A 2B4EA 5IJ8E 3EG6A 2I0RA 2H6NA 3I2NA 4DNUA 5M5SA 4K3JB 1PI6A 3ZE0A 1SHYB 5HE2B 3MZKA 1K32A 2HU8A 5IT9g 1H2XA 4ESGA 1B9XA 2EBSA 3C75H 5GXHA 3CFSB 3AL8A 1H2WA 1VZ3A 5C2WB 4CI2A 2XE4A 4IA9A 5H14A 4AEZA 1GG2B 4J8BA 3MUNA 3JROA 2OIZA 1K3IA 5EMJB 4HDJA 2GNQA 3EI4A 1JTDB 4FA4D 3SBPA 2W18A 1BPOA 2EIEA 4QQEA 2I0TA 3OF7A 4LGNA 4RE6A 2BCJB 3I7OA 4G1EA 4GQ1A 2VDOA 4FAND 5I5IA 5SXMA 3OL2B 4N14A 1GOHA 3GD1I 1QNIA 4A09B 2UZXB 5K1CC 4L1MA 3NVQA 4UI9R 2GC4A 3DM0A 2HU5A 2J55H 1PBYB 1I2MB 3EI1B 4ZN4A 4GM3A 5TEEA 1C9IA 1MG3A 3U4YA 3MKQA 2HU7A 2P9UC 3RMZD 2XL2A 3FCSA 3F3FA 4O2WA 4CZYA 4E5ZA 5AFU3 1A0RB 4J73A 4QL1A 5B4WA 3F3PA 3PVUB 3MZLA 3PE7A 3J81g 2QR5A 1TYEA 3IUQA 4UM9A 4ZOZA 1E5TA 2VDRA 2YB8B 2IUQA 4NBMA 2H9LA 4WK4A 4CC9A 3RN1D 1A12A 3K26A 5FA5B 3SBRA 1H2ZA 2Q7QA 4CY2A 3NIGA 3IJCA 3IIYA 5JWZA 4G56B 1ERJA 1YFQA 4AMZA 1QFMA 2P9PC 3DSMA 2MTAH 4ZOYA 4AX4A 4Z7QA 4WK0A 3K6SA 5FXYA 3MXXA 4JT6C 2YBAA 5HE3B 4A0AA 3ZE1A 2AQ5A 4JSNC 3C5MA 3KCIA 3DXKC 3MKSB 4J82A 4I79A 3SXTD 2H9MA 4FHLA 5C86A 4A2MA 4PSXB 4J8GA 5EMLB 1QFSA 2H47A 5HDBA 3NIFA 5CXCA 2OK4A 1XKSA 3SWSD 2B5MA 5TDHB 3DWLC 3C99A 2IWKA 5C2VB 1OMWB 5C9ZB 4H5JA 5M5RA 3IIWA 5FQDA 4IRZA 3UVNA 1OLZA 2UZYB 4JHNA 2P9KC 3P4FA 2IUPA 2CNXA 2VDNA 1XHMA 4Z8LA 4A11A 2G99A 3O4IA 4J87A 4BL0A 3SLED 4L1QD 5FFOA 4GGAA 3ZDYA 3UVLA 2EIBA 3O4JA 3IJ1A 3IURA 2HKRA 1C9LA 3B7FA 3C9CA 4D0KA 3EI4B 3ZWLB 3I7NA 5GMKn 3V5WB 2PBIB 3RRMC 2VZ3A 4GQ2P 2IUVA 3F3GA 3A0FA 3BG0A 3JB9L 3K71A 3I8CA 4BUJC 5CYKB 4CI3A 4A0BA 4XYHA 4GQBB 4OZUA 4ERYA 5CXBB 4BP8A 4ERZA 4AOWA 5IJ7E 4JSVC 2EIDA 1H2YA 1S4UX 4IMMA 1M1XA 2OVQB 4ERQA 4AN0A 2VDMA 4PNKB 2XU7A 4CY1A 5M5UA 2Z2PA 1JOFA 2QZPA 3T3MA 4E5ZB 1JJUB 4A2LA 2EICA 1U4CA 2OVPB 4E54B 5H1MA 4OWRA 3RN0D 1N6DA 4JXMA 3N0EA 2YMUA 3KRXB 4ES0A 1RI6A 3SN6B 3L4MD 3ZE2A 4BCDA 1P22A 4BCBA 4H5IA 2H14A 4J78A 2J56H 2CO0C 2OVRB 1YR2A 4UM8A 4J79A 3FRXA 3NVXA 5E6SA 2P9LC 2AGZA 5TF2A 3PVWB 4K3ID 1VE6A 3FCUA 1VYHC 2OK6A 3IJ0A 2GC7A 3K72A 2OJYA 2I3TA 3OTTA 3O4GA 1TYQC 3V7DB 3EI2A 4A0AB 3GFCA 3EI3A 3AH8B 3JPXA 4XYIA 5TEFA 4J84A 3OL2A 2PM6B 1U8CA 5FKRA 1JMXB 1GOFA 1N6FA 1L0QA 3RFHA 3RSEC 5EARA 1O6GA 2H6KA 3MMYA 2G9AA 4L3HD 1N6EA 5CXCB 3EMHA 3J80g 2YNOA 2P9SC 4PBYA 5GSAA 5IGQA 2YNNA 5I5JA 1K8KC 4U1EI 2AGWA 4CI1A 5HYNB 2VDLA 2AGLA 3AL9A 4BCCA 5THAA 2Z2NA 4A08B 5AJAA 1FWXA 2VDKA 3JRPA 3FM0A 2PM9B 3SFZA 4GMBA 4EWRA 5EAPA 4A11B 5M5VA 5M61A 3OKWA 3FGBA 4JSPC 2XYIA 5I5MA 1UOOA 4GM9A 4BH6A 1Q47A 2XL3A 5FKQA 4ZOXA 4ZOVA 5HE0B 5GXIA 1UOQA 2HJBA 5EM2A 2HYEA 4J0WA 3EQ9A 2I0SA 4A7JA 3PXWD 4JT5C 2AGYA 3VH0A 3MVDK 3AL8B 2I3SA 3PXSD 2Z2OA 4O9DA 3I7KA 5FLXg 4X3EA 4L3GD 3CFVA 5AMSA 3RFGA 4A0BB 1VE7A 3QHYB 3EQ7A 4G55A 2XZGA 2TRCB 2HKMA 4MK0B 3HFQA 4U7AA 3SCYA 3W15A 4R7AB 5A2Qg 1NR0A 2QC5A 3UVOA 3EU7A 3PXTD 3ODTA 1MDAH 2B5LA 4O3UB 3AFCA 3KRWB 3RLMD 2VDPA 2VZ1A 4Y5RD 2HJ4A 3GREA 4FA1D 1SQJA 5HQGA 3K27A 2VDQA 4BP9A 3IUJA 2VC2A 5IGOA 3SBQA 3QI0A 5H17A 3EQ8A 3OKYA 3JZHA 1MG2A 2CO0A 4FB1D
chains in the Genus database with same CATH topology
2PM7B 3I7HA 2CN3A 2CN2A 4CZXA 4LG9A 2P9IC 3PSCB 4PSWB 4GM8A 3JAMg 4GGCA 4KFMB 2QXVA 4CI8A 1JMZB 2H9PA 4GZ8A 1PGUA 3EI2B 4J77A 2P9NC 3EI3B 1SQ9A 3I7PA 3PSLA 5CYKA 3EWEA 4NSXA 1PEVA 4PC0A 3UVMA 4L9OA 4Y7RA 5CXBA 2HXCA 2J57G 3UVKA 4TZ4A 2BBKH 4J81A 3SJLD 3V9FA 2H68A 4PBZA 5HE1B 2H13A 3JZGA 3ULEC 4JD2C 4D6VA 4A09A 1NEXB 4E54A 4QRJA 3ORVD 5EMKB 2AH1A 2H6QA 4FA5D 3EI1A 2YNPA 4FAVD 3L4OD 4FWWA 3I89A 3JZNA 3UKUC 4CY5A 3NVNA 4J86A 1TBGA 3CIKB 5EALA 4CZVA 2B5NA 2HESX 1GXRA 1U2VC 3I8EA 5EM2B 5EAMA 3N0DA 4FA9D 3BG1A 1GOTB 4JSXC 4PXWA 3VA6A 3SVWD 1GP2B 1B9YA 4QT8A 4CY3A 2IAAA 2AGXA 5FKTA 3VGZA 4O3TB 4O1QD 4LG8A 5EMMB 4J0XA 1R5MA 4X63B 2H3XA 2H9NA 1XIPA 5K19A 2CE8A 3SHFA 3E0CA 3IKOA 2CE9A 4GGDA 3UKRC 3BWSA 2IURA 3I7LA 5FKSA 4A08A 4XEIC 3OW8A 3OKTA 2PM9A 4X61B 3UR4A 2O9KA 5IC7A 3OKYB 3SMRA 4X60B 5KDOB 2IWFA 4O45A 4YVDA 2AH0A 3DXMC 2B4EA 5IJ8E 3EG6A 2I0RA 2H6NA 3I2NA 4K3JB 1PI6A 1SHYB 5HE2B 3MZKA 1K32A 5IT9g 4ESGA 1B9XA 2EBSA 3C75H 5GXHA 3CFSB 3AL8A 5C2WB 4CI2A 4IA9A 5H14A 4AEZA 1GG2B 4J8BA 3JROA 2OIZA 5EMJB 4HDJA 2GNQA 3EI4A 4FA4D 3SBPA 2W18A 4QQEA 2I0TA 4LGNA 2BCJB 3I7OA 4GQ1A 4FAND 5I5IA 5SXMA 3OL2B 4N14A 1QNIA 4A09B 2UZXB 5K1CC 3NVQA 4UI9R 2GC4A 3DM0A 2J55H 1PBYB 3EI1B 4ZN4A 4GM3A 5TEEA 1MG3A 3U4YA 3MKQA 2P9UC 3RMZD 2XL2A 3F3FA 4CZYA 4E5ZA 5AFU3 1A0RB 4J73A 4QL1A 5B4WA 3F3PA 3PVUB 3MZLA 3PE7A 3J81g 4ZOZA 2YB8B 2IUQA 2H9LA 4CC9A 3RN1D 3K26A 5FA5B 3SBRA 2Q7QA 4CY2A 3IJCA 3IIYA 5JWZA 4G56B 1ERJA 1YFQA 2P9PC 3DSMA 2MTAH 4ZOYA 5FXYA 3MXXA 4JT6C 2YBAA 5HE3B 4A0AA 2AQ5A 4JSNC 3C5MA 3SXTD 3DXKC 3MKSB 4J82A 4I79A 2H9MA 4FHLA 4A2MA 4PSXB 4J8GA 5EMLB 2H47A 5CXCA 2OK4A 1XKSA 3SWSD 2B5MA 5TDHB 3DWLC 3C99A 2IWKA 5C2VB 1OMWB 5C9ZB 4H5JA 3IIWA 5FQDA 3UVNA 1OLZA 2UZYB 2P9KC 3P4FA 2IUPA 2CNXA 1XHMA 4Z8LA 4A11A 2G99A 4J87A 4BL0A 3SLED 4L1QD 4GGAA 3UVLA 3IJ1A 2HKRA 3B7FA 3C9CA 4D0KA 3EI4B 3ZWLB 3I7NA 5GMKn 3V5WB 2PBIB 3RRMC 4GQ2P 2IUVA 3F3GA 3A0FA 3BG0A 3JB9L 3I8CA 4BUJC 5CYKB 4CI3A 4A0BA 4XYHA 4GQBB 4OZUA 4ERYA 5CXBB 4ERZA 4AOWA 5IJ7E 4JSVC 1S4UX 4IMMA 2OVQB 4ERQA 4PNKB 2XU7A 4CY1A 2Z2PA 1JOFA 4E5ZB 1JJUB 4A2LA 1U4CA 2OVPB 4E54B 5H1MA 4OWRA 3RN0D 1N6DA 4JXMA 3N0EA 2YMUA 3KRXB 4ES0A 1RI6A 3SN6B 3L4MD 1P22A 4H5IA 2H14A 4J78A 2J56H 2CO0C 2OVRB 4J79A 3FRXA 3NVXA 2P9LC 2AGZA 5TF2A 3PVWB 4K3ID 1VYHC 2OK6A 3IJ0A 2GC7A 3OTTA 2OJYA 2I3TA 1TYQC 3V7DB 3EI2A 4A0AB 3GFCA 3EI3A 3AH8B 3JPXA 4XYIA 5TEFA 4J84A 3OL2A 2PM6B 5FKRA 1JMXB 1N6FA 3RFHA 1L0QA 3RSEC 5EARA 2H6KA 3MMYA 2G9AA 4L3HD 1N6EA 5CXCB 3EMHA 3J80g 2YNOA 2P9SC 4PBYA 5GSAA 5IGQA 2YNNA 5I5JA 1K8KC 4U1EI 2AGWA 4CI1A 5HYNB 2AGLA 3AL9A 5THAA 2Z2NA 4A08B 5AJAA 1FWXA 3JRPA 3FM0A 2PM9B 3SFZA 4GMBA 4EWRA 5EAPA 4A11B 3OKWA 3FGBA 4JSPC 2XYIA 5I5MA 4GM9A 4BH6A 1Q47A 2XL3A 5FKQA 4ZOXA 4ZOVA 5HE0B 5GXIA 2HJBA 5EM2A 2HYEA 4J0WA 2I0SA 4A7JA 3PXWD 4JT5C 2AGYA 3VH0A 3AL8B 2I3SA 3PXSD 2Z2OA 4O9DA 3I7KA 5FLXg 4X3EA 4L3GD 3CFVA 5AMSA 3RFGA 4A0BB 2TRCB 2HKMA 4MK0B 3HFQA 4U7AA 3SCYA 3W15A 4R7AB 5A2Qg 1NR0A 2QC5A 3UVOA 3EU7A 3PXTD 3ODTA 1MDAH 2B5LA 4O3UB 3AFCA 3KRWB 3RLMD 4Y5RD 2HJ4A 3GREA 4FA1D 1SQJA 5HQGA 3K27A 5IGOA 3SBQA 5H17A 3OKYA 3JZHA 1MG2A 2CO0A 4FB1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PM7 B;  3I7H A;  2CN3 A;  2CN2 A;  4CZX A;  4LG9 A;  2P9I C;  3PSC B;  4PSW B;  4GM8 A;  3JAM g;  4GGC A;  4KFM B;  2QXV A;  4CI8 A;  1JMZ B;  2H9P A;  4GZ8 A;  1PGU A;  3EI2 B;  4J77 A;  2P9N C;  3EI3 B;  1SQ9 A;  3I7P A;  3PSL A;  5CYK A;  3EWE A;  4NSX A;  1PEV A;  4PC0 A;  3UVM A;  4L9O A;  4Y7R A;  5CXB A;  2HXC A;  2J57 G;  3UVK A;  4TZ4 A;  2BBK H;  4J81 A;  3SJL D;  3V9F A;  2H68 A;  4PBZ A;  5HE1 B;  2H13 A;  3JZG A;  3ULE C;  4JD2 C;  4D6V A;  4A09 A;  1NEX B;  4E54 A;  4QRJ A;  3ORV D;  5EMK B;  2AH1 A;  2H6Q A;  4FA5 D;  3EI1 A;  2YNP A;  4FAV D;  3L4O D;  4FWW A;  3I89 A;  3JZN A;  3UKU C;  4CY5 A;  3NVN A;  4J86 A;  1TBG A;  3CIK B;  5EAL A;  4CZV A;  2B5N A;  2HES X;  1GXR A;  1U2V C;  3I8E A;  5EM2 B;  5EAM A;  3N0D A;  4FA9 D;  3BG1 A;  1GOT B;  4JSX C;  4PXW A;  3VA6 A;  3SVW D;  1GP2 B;  1B9Y A;  4QT8 A;  4CY3 A;  2IAA A;  2AGX A;  5FKT A;  3VGZ A;  4O3T B;  4O1Q D;  4LG8 A;  5EMM B;  4J0X A;  1R5M A;  4X63 B;  2H3X A;  2H9N A;  1XIP A;  5K19 A;  2CE8 A;  3SHF A;  3E0C A;  3IKO A;  2CE9 A;  4GGD A;  3UKR C;  3BWS A;  2IUR A;  3I7L A;  5FKS A;  4A08 A;  4XEI C;  3OW8 A;  3OKT A;  2PM9 A;  4X61 B;  3UR4 A;  2O9K A;  5IC7 A;  3OKY B;  3SMR A;  4X60 B;  5KDO B;  2IWF A;  4O45 A;  4YVD A;  2AH0 A;  3DXM C;  2B4E A;  5IJ8 E;  3EG6 A;  2I0R A;  2H6N A;  3I2N A;  4K3J B;  1PI6 A;  1SHY B;  5HE2 B;  3MZK A;  1K32 A;  5IT9 g;  4ESG A;  1B9X A;  2EBS A;  3C75 H;  5GXH A;  3CFS B;  3AL8 A;  5C2W B;  4CI2 A;  4IA9 A;  5H14 A;  4AEZ A;  1GG2 B;  4J8B A;  3JRO A;  2OIZ A;  5EMJ B;  4HDJ A;  2GNQ A;  3EI4 A;  4FA4 D;  3SBP A;  2W18 A;  4QQE A;  2I0T A;  4LGN A;  2BCJ B;  3I7O A;  4GQ1 A;  4FAN D;  5I5I A;  5SXM A;  3OL2 B;  4N14 A;  1QNI A;  4A09 B;  2UZX B;  5K1C C;  3NVQ A;  4UI9 R;  2GC4 A;  3DM0 A;  2J55 H;  1PBY B;  3EI1 B;  4ZN4 A;  4GM3 A;  5TEE A;  1MG3 A;  3U4Y A;  3MKQ A;  2P9U C;  3RMZ D;  2XL2 A;  3F3F A;  4CZY A;  4E5Z A;  5AFU 3;  1A0R B;  4J73 A;  4QL1 A;  5B4W A;  3F3P A;  3PVU B;  3MZL A;  3PE7 A;  3J81 g;  4ZOZ A;  2YB8 B;  2IUQ A;  2H9L A;  4CC9 A;  3RN1 D;  3K26 A;  5FA5 B;  3SBR A;  2Q7Q A;  4CY2 A;  3IJC A;  3IIY A;  5JWZ A;  4G56 B;  1ERJ A;  1YFQ A;  2P9P C;  3DSM A;  2MTA H;  4ZOY A;  5FXY A;  3MXX A;  4JT6 C;  2YBA A;  5HE3 B;  4A0A A;  2AQ5 A;  4JSN C;  3C5M A;  3SXT D;  3DXK C;  3MKS B;  4J82 A;  4I79 A;  2H9M A;  4FHL A;  4A2M A;  4PSX B;  4J8G A;  5EML B;  2H47 A;  5CXC A;  2OK4 A;  1XKS A;  3SWS D;  2B5M A;  5TDH B;  3DWL C;  3C99 A;  2IWK A;  5C2V B;  1OMW B;  5C9Z B;  4H5J A;  3IIW A;  5FQD A;  3UVN A;  1OLZ A;  2UZY B;  2P9K C;  3P4F A;  2IUP A;  2CNX A;  1XHM A;  4Z8L A;  4A11 A;  2G99 A;  4J87 A;  4BL0 A;  3SLE D;  4L1Q D;  4GGA A;  3UVL A;  3IJ1 A;  2HKR A;  3B7F A;  3C9C A;  4D0K A;  3EI4 B;  3ZWL B;  3I7N A;  5GMK n;  3V5W B;  2PBI B;  3RRM C;  4GQ2 P;  2IUV A;  3F3G A;  3A0F A;  3BG0 A;  3JB9 L;  3I8C A;  4BUJ C;  5CYK B;  4CI3 A;  4A0B A;  4XYH A;  4GQB B;  4OZU A;  4ERY A;  5CXB B;  4ERZ A;  4AOW A;  5IJ7 E;  4JSV C;  1S4U X;  4IMM A;  2OVQ B;  4ERQ A;  4PNK B;  2XU7 A;  4CY1 A;  2Z2P A;  1JOF A;  4E5Z B;  1JJU B;  4A2L A;  1U4C A;  2OVP B;  4E54 B;  5H1M A;  4OWR A;  3RN0 D;  1N6D A;  4JXM A;  3N0E A;  2YMU A;  3KRX B;  4ES0 A;  1RI6 A;  3SN6 B;  3L4M D;  1P22 A;  4H5I A;  2H14 A;  4J78 A;  2J56 H;  2CO0 C;  2OVR B;  4J79 A;  3FRX A;  3NVX A;  2P9L C;  2AGZ A;  5TF2 A;  3PVW B;  4K3I D;  1VYH C;  2OK6 A;  3IJ0 A;  2GC7 A;  3OTT A;  2OJY A;  2I3T A;  1TYQ C;  3V7D B;  3EI2 A;  4A0A B;  3GFC A;  3EI3 A;  3AH8 B;  3JPX A;  4XYI A;  5TEF A;  4J84 A;  3OL2 A;  2PM6 B;  5FKR A;  1JMX B;  1N6F A;  3RFH A;  1L0Q A;  3RSE C;  5EAR A;  2H6K A;  3MMY A;  2G9A A;  4L3H D;  1N6E A;  5CXC B;  3EMH A;  3J80 g;  2YNO A;  2P9S C;  4PBY A;  5GSA A;  5IGQ A;  2YNN A;  5I5J A;  1K8K C;  4U1E I;  2AGW A;  4CI1 A;  5HYN B;  2AGL A;  3AL9 A;  5THA A;  2Z2N A;  4A08 B;  5AJA A;  1FWX A;  3JRP A;  3FM0 A;  2PM9 B;  3SFZ A;  4GMB A;  4EWR A;  5EAP A;  4A11 B;  3OKW A;  3FGB A;  4JSP C;  2XYI A;  5I5M A;  4GM9 A;  4BH6 A;  1Q47 A;  2XL3 A;  5FKQ A;  4ZOX A;  4ZOV A;  5HE0 B;  5GXI A;  2HJB A;  5EM2 A;  2HYE A;  4J0W A;  2I0S A;  4A7J A;  3PXW D;  4JT5 C;  2AGY A;  3VH0 A;  3AL8 B;  2I3S A;  3PXS D;  2Z2O A;  4O9D A;  3I7K A;  5FLX g;  4X3E A;  4L3G D;  3CFV A;  5AMS A;  3RFG A;  4A0B B;  2TRC B;  2HKM A;  4MK0 B;  3HFQ A;  4U7A A;  3SCY A;  3W15 A;  4R7A B;  5A2Q g;  1NR0 A;  2QC5 A;  3UVO A;  3EU7 A;  3PXT D;  3ODT A;  1MDA H;  2B5L A;  4O3U B;  3AFC A;  3KRW B;  3RLM D;  4Y5R D;  2HJ4 A;  3GRE A;  4FA1 D;  1SQJ A;  5HQG A;  3K27 A;  5IGO A;  3SBQ A;  5H17 A;  3OKY A;  3JZH A;  1MG2 A;  2CO0 A;  4FB1 D; 
#chains in the Genus database with same CATH topology
 2PM7 B;  3I7H A;  2CN3 A;  2CN2 A;  4CZX A;  4LG9 A;  4NC4 A;  5E6U A;  3MUO A;  3IUN A;  2P9I C;  3PSC B;  4PSW B;  4GM8 A;  3JAM g;  4GGC A;  4KFM B;  2QXV A;  4CI8 A;  1JMZ B;  2H9P A;  4GZ8 A;  4D9S A;  1PGU A;  3EI2 B;  4J77 A;  2WQ8 A;  2P9N C;  3EI3 B;  3VI4 A;  4QAM A;  1SQ9 A;  3I7P A;  4AMY A;  5M5T A;  1L5G A;  3PSL A;  5CYK A;  3EWE A;  4NSX A;  1PEV A;  4PC0 A;  4Z7O A;  4Z7N A;  1UOP A;  1T2X A;  3UVM A;  4L9O A;  4Y7R A;  5CXB A;  2HXC A;  2J57 G;  4O02 A;  3UVK A;  4TZ4 A;  2BBK H;  4J81 A;  3SJL D;  3V9F A;  4NAA A;  1UTC A;  2H68 A;  4WK2 A;  4PBZ A;  5HE1 B;  2H13 A;  3O4H A;  3JZG A;  3ULE C;  4NEN A;  4JD2 C;  5E6R A;  4D6V A;  1NEX B;  4A09 A;  2XDW A;  4JHP C;  4QRJ A;  3ORV D;  3T3P A;  4E54 A;  4MMY A;  5EMK B;  2AH1 A;  2H6Q A;  4FA5 D;  3IJE A;  3GC3 B;  4G1M A;  3EI1 A;  2YNP A;  4FAV D;  3L4O D;  4FWW A;  3ZDX A;  3I89 A;  3NID A;  3JZN A;  3UKU C;  4CY5 A;  3NVN A;  4J86 A;  1TBG A;  3CIK B;  3VI3 A;  1O6F A;  5C92 A;  1GOG A;  5EAL A;  4CZV A;  2B5N A;  2HES X;  3ZDZ A;  1GXR A;  1U2V C;  3I8E A;  5EM2 B;  5EAM A;  1JV2 A;  3N0D A;  1E8M A;  4FA9 D;  3BG1 A;  1GOT B;  4JSX C;  4PXW A;  3VA6 A;  3SVW D;  1GP2 B;  1B9Y A;  4QT8 A;  4CY3 A;  2IAA A;  2AGX A;  5FKT A;  3VGZ A;  4O3T B;  4O1Q D;  4LG8 A;  5EMM B;  4J0X A;  1R5M A;  3IUM A;  4MMZ A;  4X63 B;  2H3X A;  2H9N A;  1XIP A;  5K19 A;  4MMX A;  2CE8 A;  4DNW A;  3DDU A;  3SHF A;  3E0C A;  4WJK A;  3IKO A;  1E8N A;  2CE9 A;  5FFG A;  4GGD A;  3UKR C;  3BWS A;  2BKL A;  2IUR A;  3I7L A;  5FKS A;  4A08 A;  4XEI C;  3V4V A;  1VZ2 A;  3OW8 A;  3OKT A;  2JKX A;  4DNV A;  2PM9 A;  4X61 B;  4RE5 A;  3UR4 A;  2O9K A;  5IC7 A;  3IVM A;  3OKY B;  3SMR A;  4X60 B;  5KDO B;  2IWF A;  3IUL A;  4O45 A;  4YVD A;  2AH0 A;  3DXM C;  3V4P A;  4AN1 A;  2B4E A;  5IJ8 E;  3EG6 A;  2I0R A;  2H6N A;  3I2N A;  4DNU A;  5M5S A;  4K3J B;  1PI6 A;  3ZE0 A;  1SHY B;  5HE2 B;  3MZK A;  1K32 A;  2HU8 A;  5IT9 g;  1H2X A;  4ESG A;  1B9X A;  2EBS A;  3C75 H;  5GXH A;  3CFS B;  3AL8 A;  1H2W A;  1VZ3 A;  5C2W B;  4CI2 A;  2XE4 A;  4IA9 A;  5H14 A;  4AEZ A;  1GG2 B;  4J8B A;  3MUN A;  3JRO A;  2OIZ A;  1K3I A;  5EMJ B;  4HDJ A;  2GNQ A;  3EI4 A;  1JTD B;  4FA4 D;  3SBP A;  2W18 A;  1BPO A;  2EIE A;  4QQE A;  2I0T A;  3OF7 A;  4LGN A;  4RE6 A;  2BCJ B;  3I7O A;  4G1E A;  4GQ1 A;  2VDO A;  4FAN D;  5I5I A;  5SXM A;  3OL2 B;  4N14 A;  1GOH A;  3GD1 I;  1QNI A;  4A09 B;  2UZX B;  5K1C C;  4L1M A;  3NVQ A;  4UI9 R;  2GC4 A;  3DM0 A;  2HU5 A;  2J55 H;  1PBY B;  1I2M B;  3EI1 B;  4ZN4 A;  4GM3 A;  5TEE A;  1C9I A;  1MG3 A;  3U4Y A;  3MKQ A;  2HU7 A;  2P9U C;  3RMZ D;  2XL2 A;  3FCS A;  3F3F A;  4O2W A;  4CZY A;  4E5Z A;  5AFU 3;  1A0R B;  4J73 A;  4QL1 A;  5B4W A;  3F3P A;  3PVU B;  3MZL A;  3PE7 A;  3J81 g;  2QR5 A;  1TYE A;  3IUQ A;  4UM9 A;  4ZOZ A;  1E5T A;  2VDR A;  2YB8 B;  2IUQ A;  4NBM A;  2H9L A;  4WK4 A;  4CC9 A;  3RN1 D;  1A12 A;  3K26 A;  5FA5 B;  3SBR A;  1H2Z A;  2Q7Q A;  4CY2 A;  3NIG A;  3IJC A;  3IIY A;  5JWZ A;  4G56 B;  1ERJ A;  1YFQ A;  4AMZ A;  1QFM A;  2P9P C;  3DSM A;  2MTA H;  4ZOY A;  4AX4 A;  4Z7Q A;  4WK0 A;  3K6S A;  5FXY A;  3MXX A;  4JT6 C;  2YBA A;  5HE3 B;  4A0A A;  3ZE1 A;  2AQ5 A;  4JSN C;  3C5M A;  3KCI A;  3DXK C;  3MKS B;  4J82 A;  4I79 A;  3SXT D;  2H9M A;  4FHL A;  5C86 A;  4A2M A;  4PSX B;  4J8G A;  5EML B;  1QFS A;  2H47 A;  5HDB A;  3NIF A;  5CXC A;  2OK4 A;  1XKS A;  3SWS D;  2B5M A;  5TDH B;  3DWL C;  3C99 A;  2IWK A;  5C2V B;  1OMW B;  5C9Z B;  4H5J A;  5M5R A;  3IIW A;  5FQD A;  4IRZ A;  3UVN A;  1OLZ A;  2UZY B;  4JHN A;  2P9K C;  3P4F A;  2IUP A;  2CNX A;  2VDN A;  1XHM A;  4Z8L A;  4A11 A;  2G99 A;  3O4I A;  4J87 A;  4BL0 A;  3SLE D;  4L1Q D;  5FFO A;  4GGA A;  3ZDY A;  3UVL A;  2EIB A;  3O4J A;  3IJ1 A;  3IUR A;  2HKR A;  1C9L A;  3B7F A;  3C9C A;  4D0K A;  3EI4 B;  3ZWL B;  3I7N A;  5GMK n;  3V5W B;  2PBI B;  3RRM C;  2VZ3 A;  4GQ2 P;  2IUV A;  3F3G A;  3A0F A;  3BG0 A;  3JB9 L;  3K71 A;  3I8C A;  4BUJ C;  5CYK B;  4CI3 A;  4A0B A;  4XYH A;  4GQB B;  4OZU A;  4ERY A;  5CXB B;  4BP8 A;  4ERZ A;  4AOW A;  5IJ7 E;  4JSV C;  2EID A;  1H2Y A;  1S4U X;  4IMM A;  1M1X A;  2OVQ B;  4ERQ A;  4AN0 A;  2VDM A;  4PNK B;  2XU7 A;  4CY1 A;  5M5U A;  2Z2P A;  1JOF A;  2QZP A;  3T3M A;  4E5Z B;  1JJU B;  4A2L A;  2EIC A;  1U4C A;  2OVP B;  4E54 B;  5H1M A;  4OWR A;  3RN0 D;  1N6D A;  4JXM A;  3N0E A;  2YMU A;  3KRX B;  4ES0 A;  1RI6 A;  3SN6 B;  3L4M D;  3ZE2 A;  4BCD A;  1P22 A;  4BCB A;  4H5I A;  2H14 A;  4J78 A;  2J56 H;  2CO0 C;  2OVR B;  1YR2 A;  4UM8 A;  4J79 A;  3FRX A;  3NVX A;  5E6S A;  2P9L C;  2AGZ A;  5TF2 A;  3PVW B;  4K3I D;  1VE6 A;  3FCU A;  1VYH C;  2OK6 A;  3IJ0 A;  2GC7 A;  3K72 A;  2OJY A;  2I3T A;  3OTT A;  3O4G A;  1TYQ C;  3V7D B;  3EI2 A;  4A0A B;  3GFC A;  3EI3 A;  3AH8 B;  3JPX A;  4XYI A;  5TEF A;  4J84 A;  3OL2 A;  2PM6 B;  1U8C A;  5FKR A;  1JMX B;  1GOF A;  1N6F A;  1L0Q A;  3RFH A;  3RSE C;  5EAR A;  1O6G A;  2H6K A;  3MMY A;  2G9A A;  4L3H D;  1N6E A;  5CXC B;  3EMH A;  3J80 g;  2YNO A;  2P9S C;  4PBY A;  5GSA A;  5IGQ A;  2YNN A;  5I5J A;  1K8K C;  4U1E I;  2AGW A;  4CI1 A;  5HYN B;  2VDL A;  2AGL A;  3AL9 A;  4BCC A;  5THA A;  2Z2N A;  4A08 B;  5AJA A;  1FWX A;  2VDK A;  3JRP A;  3FM0 A;  2PM9 B;  3SFZ A;  4GMB A;  4EWR A;  5EAP A;  4A11 B;  5M5V A;  5M61 A;  3OKW A;  3FGB A;  4JSP C;  2XYI A;  5I5M A;  1UOO A;  4GM9 A;  4BH6 A;  1Q47 A;  2XL3 A;  5FKQ A;  4ZOX A;  4ZOV A;  5HE0 B;  5GXI A;  1UOQ A;  2HJB A;  5EM2 A;  2HYE A;  4J0W A;  3EQ9 A;  2I0S A;  4A7J A;  3PXW D;  4JT5 C;  2AGY A;  3VH0 A;  3MVD K;  3AL8 B;  2I3S A;  3PXS D;  2Z2O A;  4O9D A;  3I7K A;  5FLX g;  4X3E A;  4L3G D;  3CFV A;  5AMS A;  3RFG A;  4A0B B;  1VE7 A;  3QHY B;  3EQ7 A;  4G55 A;  2XZG A;  2TRC B;  2HKM A;  4MK0 B;  3HFQ A;  4U7A A;  3SCY A;  3W15 A;  4R7A B;  5A2Q g;  1NR0 A;  2QC5 A;  3UVO A;  3EU7 A;  3PXT D;  3ODT A;  1MDA H;  2B5L A;  4O3U B;  3AFC A;  3KRW B;  3RLM D;  2VDP A;  2VZ1 A;  4Y5R D;  2HJ4 A;  3GRE A;  4FA1 D;  1SQJ A;  5HQG A;  3K27 A;  2VDQ A;  4BP9 A;  3IUJ A;  2VC2 A;  5IGO A;  3SBQ A;  3QI0 A;  5H17 A;  3EQ8 A;  3OKY A;  3JZH A;  1MG2 A;  2CO0 A;  4FB1 D; 
#chains in the Genus database with same CATH homology
 2PM7 B;  3I7H A;  2CN3 A;  2CN2 A;  4CZX A;  4LG9 A;  2P9I C;  3PSC B;  4PSW B;  4GM8 A;  3JAM g;  4GGC A;  4KFM B;  2QXV A;  4CI8 A;  1JMZ B;  2H9P A;  4GZ8 A;  1PGU A;  3EI2 B;  4J77 A;  2P9N C;  3EI3 B;  1SQ9 A;  3I7P A;  3PSL A;  5CYK A;  3EWE A;  4NSX A;  1PEV A;  4PC0 A;  3UVM A;  4L9O A;  4Y7R A;  5CXB A;  2HXC A;  2J57 G;  3UVK A;  4TZ4 A;  2BBK H;  4J81 A;  3SJL D;  3V9F A;  2H68 A;  4PBZ A;  5HE1 B;  2H13 A;  3JZG A;  3ULE C;  4JD2 C;  4D6V A;  4A09 A;  1NEX B;  4E54 A;  4QRJ A;  3ORV D;  5EMK B;  2AH1 A;  2H6Q A;  4FA5 D;  3EI1 A;  2YNP A;  4FAV D;  3L4O D;  4FWW A;  3I89 A;  3JZN A;  3UKU C;  4CY5 A;  3NVN A;  4J86 A;  1TBG A;  3CIK B;  5EAL A;  4CZV A;  2B5N A;  2HES X;  1GXR A;  1U2V C;  3I8E A;  5EM2 B;  5EAM A;  3N0D A;  4FA9 D;  3BG1 A;  1GOT B;  4JSX C;  4PXW A;  3VA6 A;  3SVW D;  1GP2 B;  1B9Y A;  4QT8 A;  4CY3 A;  2IAA A;  2AGX A;  5FKT A;  3VGZ A;  4O3T B;  4O1Q D;  4LG8 A;  5EMM B;  4J0X A;  1R5M A;  4X63 B;  2H3X A;  2H9N A;  1XIP A;  5K19 A;  2CE8 A;  3SHF A;  3E0C A;  3IKO A;  2CE9 A;  4GGD A;  3UKR C;  3BWS A;  2IUR A;  3I7L A;  5FKS A;  4A08 A;  4XEI C;  3OW8 A;  3OKT A;  2PM9 A;  4X61 B;  3UR4 A;  2O9K A;  5IC7 A;  3OKY B;  3SMR A;  4X60 B;  5KDO B;  2IWF A;  4O45 A;  4YVD A;  2AH0 A;  3DXM C;  2B4E A;  5IJ8 E;  3EG6 A;  2I0R A;  2H6N A;  3I2N A;  4K3J B;  1PI6 A;  1SHY B;  5HE2 B;  3MZK A;  1K32 A;  5IT9 g;  4ESG A;  1B9X A;  2EBS A;  3C75 H;  5GXH A;  3CFS B;  3AL8 A;  5C2W B;  4CI2 A;  4IA9 A;  5H14 A;  4AEZ A;  1GG2 B;  4J8B A;  3JRO A;  2OIZ A;  5EMJ B;  4HDJ A;  2GNQ A;  3EI4 A;  4FA4 D;  3SBP A;  2W18 A;  4QQE A;  2I0T A;  4LGN A;  2BCJ B;  3I7O A;  4GQ1 A;  4FAN D;  5I5I A;  5SXM A;  3OL2 B;  4N14 A;  1QNI A;  4A09 B;  2UZX B;  5K1C C;  3NVQ A;  4UI9 R;  2GC4 A;  3DM0 A;  2J55 H;  1PBY B;  3EI1 B;  4ZN4 A;  4GM3 A;  5TEE A;  1MG3 A;  3U4Y A;  3MKQ A;  2P9U C;  3RMZ D;  2XL2 A;  3F3F A;  4CZY A;  4E5Z A;  5AFU 3;  1A0R B;  4J73 A;  4QL1 A;  5B4W A;  3F3P A;  3PVU B;  3MZL A;  3PE7 A;  3J81 g;  4ZOZ A;  2YB8 B;  2IUQ A;  2H9L A;  4CC9 A;  3RN1 D;  3K26 A;  5FA5 B;  3SBR A;  2Q7Q A;  4CY2 A;  3IJC A;  3IIY A;  5JWZ A;  4G56 B;  1ERJ A;  1YFQ A;  2P9P C;  3DSM A;  2MTA H;  4ZOY A;  5FXY A;  3MXX A;  4JT6 C;  2YBA A;  5HE3 B;  4A0A A;  2AQ5 A;  4JSN C;  3C5M A;  3SXT D;  3DXK C;  3MKS B;  4J82 A;  4I79 A;  2H9M A;  4FHL A;  4A2M A;  4PSX B;  4J8G A;  5EML B;  2H47 A;  5CXC A;  2OK4 A;  1XKS A;  3SWS D;  2B5M A;  5TDH B;  3DWL C;  3C99 A;  2IWK A;  5C2V B;  1OMW B;  5C9Z B;  4H5J A;  3IIW A;  5FQD A;  3UVN A;  1OLZ A;  2UZY B;  2P9K C;  3P4F A;  2IUP A;  2CNX A;  1XHM A;  4Z8L A;  4A11 A;  2G99 A;  4J87 A;  4BL0 A;  3SLE D;  4L1Q D;  4GGA A;  3UVL A;  3IJ1 A;  2HKR A;  3B7F A;  3C9C A;  4D0K A;  3EI4 B;  3ZWL B;  3I7N A;  5GMK n;  3V5W B;  2PBI B;  3RRM C;  4GQ2 P;  2IUV A;  3F3G A;  3A0F A;  3BG0 A;  3JB9 L;  3I8C A;  4BUJ C;  5CYK B;  4CI3 A;  4A0B A;  4XYH A;  4GQB B;  4OZU A;  4ERY A;  5CXB B;  4ERZ A;  4AOW A;  5IJ7 E;  4JSV C;  1S4U X;  4IMM A;  2OVQ B;  4ERQ A;  4PNK B;  2XU7 A;  4CY1 A;  2Z2P A;  1JOF A;  4E5Z B;  1JJU B;  4A2L A;  1U4C A;  2OVP B;  4E54 B;  5H1M A;  4OWR A;  3RN0 D;  1N6D A;  4JXM A;  3N0E A;  2YMU A;  3KRX B;  4ES0 A;  1RI6 A;  3SN6 B;  3L4M D;  1P22 A;  4H5I A;  2H14 A;  4J78 A;  2J56 H;  2CO0 C;  2OVR B;  4J79 A;  3FRX A;  3NVX A;  2P9L C;  2AGZ A;  5TF2 A;  3PVW B;  4K3I D;  1VYH C;  2OK6 A;  3IJ0 A;  2GC7 A;  3OTT A;  2OJY A;  2I3T A;  1TYQ C;  3V7D B;  3EI2 A;  4A0A B;  3GFC A;  3EI3 A;  3AH8 B;  3JPX A;  4XYI A;  5TEF A;  4J84 A;  3OL2 A;  2PM6 B;  5FKR A;  1JMX B;  1N6F A;  3RFH A;  1L0Q A;  3RSE C;  5EAR A;  2H6K A;  3MMY A;  2G9A A;  4L3H D;  1N6E A;  5CXC B;  3EMH A;  3J80 g;  2YNO A;  2P9S C;  4PBY A;  5GSA A;  5IGQ A;  2YNN A;  5I5J A;  1K8K C;  4U1E I;  2AGW A;  4CI1 A;  5HYN B;  2AGL A;  3AL9 A;  5THA A;  2Z2N A;  4A08 B;  5AJA A;  1FWX A;  3JRP A;  3FM0 A;  2PM9 B;  3SFZ A;  4GMB A;  4EWR A;  5EAP A;  4A11 B;  3OKW A;  3FGB A;  4JSP C;  2XYI A;  5I5M A;  4GM9 A;  4BH6 A;  1Q47 A;  2XL3 A;  5FKQ A;  4ZOX A;  4ZOV A;  5HE0 B;  5GXI A;  2HJB A;  5EM2 A;  2HYE A;  4J0W A;  2I0S A;  4A7J A;  3PXW D;  4JT5 C;  2AGY A;  3VH0 A;  3AL8 B;  2I3S A;  3PXS D;  2Z2O A;  4O9D A;  3I7K A;  5FLX g;  4X3E A;  4L3G D;  3CFV A;  5AMS A;  3RFG A;  4A0B B;  2TRC B;  2HKM A;  4MK0 B;  3HFQ A;  4U7A A;  3SCY A;  3W15 A;  4R7A B;  5A2Q g;  1NR0 A;  2QC5 A;  3UVO A;  3EU7 A;  3PXT D;  3ODT A;  1MDA H;  2B5L A;  4O3U B;  3AFC A;  3KRW B;  3RLM D;  4Y5R D;  2HJ4 A;  3GRE A;  4FA1 D;  1SQJ A;  5HQG A;  3K27 A;  5IGO A;  3SBQ A;  5H17 A;  3OKY A;  3JZH A;  1MG2 A;  2CO0 A;  4FB1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...