3C9CA

Structural basis of histone h4 recognition by p55
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
405
structure length
380
Chain Sequence
SFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPCQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of histone H4 recognition by p55.
pubmed doi rcsb
molecule keywords Chromatin assembly factor 1 p55 subunit
molecule tags Transcription repressor
source organism Drosophila melanogaster
total genus 88
structure length 380
sequence length 405
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3c9cA00
2EBSA 4J0XA 2Z2OA 1U4CA 5HE2B 5EARA 4A7JA 3OW8A 3EI2B 4A2MA 3SBRA 4CZYA 4JT5C 3IJ1A 4Z8LA 1PGUA 2W18A 2I0TA 4GM8A 3W15A 1FWXA 2AQ5A 2QXVA 1MG3A 3UKRC 5I5IA 5H17A 5FQDA 3ODTA 4PSXB 2H13A 3C5MA 1QNIA 4CC9A 1NR0A 3SXTD 4E5ZA 5FKTA 2IAAA 4OZUA 4FAVD 4GQ2P 2B5MA 3OTTA 2OVPB 5THAA 3RLMD 5EAMA 3DXMC 3DSMA 2H68A 2B4EA 5HYNB 2XL3A 5GXHA 5CYKB 3RN0D 2H3XA 5CXBB 4K3JB 2H9MA 2H14A 3PE7A 4GGAA 4J77A 2XU7A 5IGOA 4BL0A 1ERJA 4X63B 2PM9A 2H6KA 5GMKn 4O3UB 4Y5RD 3UVNA 2HJ4A 2CE9A 4CY2A 1U2VC 5GSAA 5FKQA 2OK6A 5AMSA 3RMZD 4QRJA 2AGZA 2OJYA 4D0KA 4MK0B 3OKTA 4PSWB 5IC7A 5EM2B 3PXTD 1Q47A 3AH8B 5EMKB 4J82A 4CI3A 5GXIA 3IKOA 2YBAA 4TZ4A 4PXWA 5TDHB 4A08B 3MKQA 4J84A 2H47A 2TRCB 3FGBA 4PC0A 3I7HA 3OKYB 2HKRA 4ES0A 3F3PA 3I7KA 5SXMA 2I3SA 4BUJC 3F3GA 4H5JA 2QC5A 2IUVA 1XIPA 2H9NA 4JT6C 3C9CA 1JMXB 3AL8A 3EI1A 4A09A 5TF2A 1PI6A 3SVWD 4BH6A 1SHYB 4L1QD 3PVWB 4H5IA 2I0RA 3EI2A 3IJCA 4FA9D 3PXSD 1GXRA 2O9KA 4GQ1A 4O1QD 2B5LA 3AL8B 2I3TA 3EI1B 4N14A 4A09B 1SQ9A 1JJUB 3NVQA 1L0QA 2J55H 3I89A 3N0EA 3SFZA 5AJAA 4GQBB 4J81A 4JSVC 3V5WB 4E54A 2HESX 2PBIB 4FB1D 3I2NA 2PM6B 2HYEA 2P9KC 4PNKB 1RI6A 5HE0B 5IGQA 5HE1B 2YNNA 1N6EA 3PSLA 3JZHA 5TEFA 1PBYB 4HDJA 3SLED 2H9PA 4J8GA 4E54B 5AFU3 5CYKA 2IURA 1N6DA 4LG9A 3B7FA 4QL1A 5IJ8E 4X60B 5CXBA 5C2WB 1TBGA 5EMJB 5EMLB 2UZXB 3JZGA 4KFMB 3RFHA 5K19A 3IJ0A 4J79A 4L3HD 5CXCB 2AGXA 3E0CA 2Z2PA 2YNOA 3J80g 4J86A 3A0FA 3SN6B 4CZXA 2G9AA 3UVKA 5FLXg 3EG6A 5K1CC 3I7PA 5FA5B 3MMYA 1TYQC 1XKSA 3EI3A 4LG8A 3MZLA 3CFVA 5EM2A 4O9DA 2P9SC 3VA6A 3JROA 3L4MD 4A08A 3EU7A 4PBYA 3FM0A 2H6NA 4GGCA 4ERYA 2J56H 3OKYA 3EI3B 3IIYA 3KRWB 2I0SA 3SMRA 5I5MA 3AFCA 1JOFA 4L9OA 2AH0A 2UZYB 4Y7RA 2AGYA 3U4YA 2PM7B 3FRXA 4PBZA 2P9PC 3SBQA 2P9IC 1K8KC 3JZNA 2G99A 4GMBA 2YMUA 4U1EI 4J87A 4ERQA 4ESGA 1B9XA 3DWLC 1VYHC 3GREA 4ZOYA 3SCYA 1K32A 4OWRA 3RRMC 4J73A 2J57G 5H1MA 2CE8A 1YFQA 1B9YA 3NVXA 2MTAH 4JD2C 2AH1A 2GC4A 4IA9A 3I7LA 4G56B 1JMZB 4AOWA 1MG2A 3OL2B 5HQGA 4O45A 4FA5D 3DM0A 4CY3A 4A11B 1P22A 4A2LA 3L4OD 1SQJA 1NEXB 2P9NC 3PSCB 4ZOZA 5HE3B 5A2Qg 4JSPC 3RSEC 4FWWA 3SJLD 2BBKH 2GNQA 4ZOXA 5KDOB 2Q7QA 3KRXB 5C2VB 4CZVA 2H9LA 5C9ZB 4JXMA 5CXCA 3DXKC 4LGNA 3P4FA 3UVOA 2Z2NA 4O3TB 3I7NA 3SHFA 3K26A 1A0RB 3JPXA 3I8EA 2HKMA 3J81g 3VH0A 4YVDA 5EMMB 2CO0A 3BG1A 4J0WA 3BWSA 3N0DA 2XYIA 3RFGA 4FA1D 4AEZA 3ZWLB 3UVMA 4IMMA 1MDAH 4K3ID 4CI1A 3EMHA 3MXXA 1N6FA 2CO0C 4L3GD 1PEVA 1S4UX 2CNXA 3OKWA 2IWFA 4JSNC 2P9LC 3VGZA 1GP2B 2XL2A 3AL9A 3NVNA 5FKSA 4U7AA 3V7DB 4E5ZB 3EWEA 4XEIC 4JSXC 3MKSB 5IJ7E 2GC7A 4EWRA 4X61B 5JWZA 2HXCA 4I79A 3IIWA 2OIZA 2AGWA 3K27A 1GOTB 4GM3A 1GG2B 4FA4D 4QQEA 4FHLA 4A0BA 3F3FA 3SWSD 2CN2A 2OK4A 3CFSB 4UI9R 2H6QA 2IUPA 2PM9B 5TEEA 4XYHA 2BCJB 1XHMA 4X3EA 5FXYA 4CY1A 3MZKA 5I5JA 4A0AA 3JRPA 5H14A 4D6VA 4A0BB 4XYIA 4GGDA 3C99A 2YNPA 3C75H 3OL2A 3I7OA 2OVRB 3ULEC 2HJBA 2AGLA 4A11A 3EI4A 3JAMg 4GZ8A 2IUQA 3ORVD 4ERZA 1R5MA 4J8BA 5EALA 4A0AB 3PVUB 4CY5A 4GM9A 2YB8B 4ZN4A 5B4WA 2OVQB 5EAPA 4NSXA 4J78A 3UKUC 3UVLA 3V9FA 4CI8A 3BG0A 5FKRA 2P9UC 2CN3A 3CIKB 4QT8A 2B5NA 4FAND 3EI4B 1OLZA 2IWKA 4ZOVA 5IT9g 3JB9L 3HFQA 1OMWB 3RN1D 3I8CA 3GFCA 3PXWD 4CI2A 3UR4A 4R7AB 3SBPA
chains in the Genus database with same CATH superfamily
2EBSA 4J0XA 4NAAA 2Z2OA 1U4CA 5HE2B 1TYEA 5EARA 4A7JA 3OW8A 3K6SA 3EI2B 4A2MA 3SBRA 4CZYA 4JT5C 3IJ1A 4Z8LA 4BCBA 1PGUA 2W18A 4BCDA 2I0TA 4GM8A 3W15A 1FWXA 2AQ5A 2QXVA 5FFOA 1MG3A 3ZE0A 3UKRC 5I5IA 5H17A 5FQDA 3ODTA 4PSXB 2H13A 3C5MA 1QNIA 4CC9A 2WQ8A 5C86A 1NR0A 3SXTD 4E5ZA 5FKTA 2IAAA 4OZUA 4FAVD 4GQ2P 1VE6A 2B5MA 3OTTA 2OVPB 1VZ3A 5THAA 3RLMD 5EAMA 3DXMC 3DSMA 2H68A 3EQ8A 2B4EA 5HYNB 2XL3A 5GXHA 5CYKB 3RN0D 2VDNA 5C92A 2H3XA 5CXBB 4K3JB 5E6SA 3OF7A 2H9MA 2H14A 3PE7A 4GGAA 4J77A 5M5RA 2XU7A 5IGOA 4BL0A 1ERJA 4X63B 4G1MA 2PM9A 2H6KA 4DNUA 5GMKn 4O3UB 4Y5RD 4AMZA 3UVNA 2HJ4A 3O4IA 2CE9A 4CY2A 3IVMA 1U2VC 5GSAA 5FKQA 3NIFA 4UM8A 2VDKA 3K72A 2OK6A 3VI4A 5AMSA 3RMZD 4QRJA 2AGZA 2OJYA 4D0KA 4MK0B 3OKTA 4PSWB 5IC7A 5EM2B 1E5TA 3PXTD 1Q47A 2QZPA 3AH8B 5EMKB 4G55A 4J82A 4CI3A 4BP8A 5GXIA 3IKOA 2YBAA 4TZ4A 4PXWA 5TDHB 4A08B 3MUOA 3MKQA 4J84A 1L5GA 2H47A 3ZE2A 2TRCB 3FGBA 4PC0A 3ZDXA 3I7HA 3OKYB 2HKRA 4ES0A 3F3PA 3I7KA 5SXMA 2I3SA 4WK0A 3F3GA 4H5JA 4BUJC 2QC5A 2IUVA 1BPOA 1XIPA 4AX4A 2H9NA 4JT6C 2XE4A 3C9CA 1JMXB 3AL8A 3EI1A 4A09A 5TF2A 1PI6A 3SVWD 4BH6A 1JV2A 3ZDYA 1SHYB 2HU5A 3K71A 4L1QD 1YR2A 3PVWB 2I0RA 4H5IA 4DNVA 3EI2A 3IJCA 4FA9D 3PXSD 1GXRA 1JTDB 2O9KA 4GQ1A 4O1QD 2B5LA 3AL8B 2I3TA 4DNWA 4N14A 3EI1B 4A09B 1SQ9A 1JJUB 3KCIA 3MUNA 1L0QA 3NVQA 4MMZA 3T3MA 2J55H 3I89A 3N0EA 3FCSA 3SFZA 5AJAA 4GQBB 4J81A 4JSVC 3V5WB 4E54A 2HESX 2PBIB 4FB1D 4G1EA 3I2NA 2PM6B 2HYEA 2P9KC 4PNKB 4Z7OA 1RI6A 5HE0B 5IGQA 3IJEA 5HE1B 2YNNA 1N6EA 3PSLA 3JZHA 5TEFA 3IULA 1H2XA 1PBYB 4HDJA 3SLED 2EIDA 2H9PA 4J8GA 4E54B 5AFU3 5CYKA 2IURA 1N6DA 4LG9A 3VI3A 3B7FA 1UOPA 4QL1A 5IJ8E 4X60B 3T3PA 5CXBA 5C2WB 1TBGA 5EMJB 5EMLB 2UZXB 3JZGA 4KFMB 2EICA 3ZE1A 1GOHA 3RFHA 4RE6A 5K19A 3IJ0A 4J79A 4L3HD 5CXCB 2AGXA 3E0CA 2Z2PA 2YNOA 3J80g 1UOQA 4J86A 3A0FA 3SN6B 4CZXA 3QHYB 2G9AA 3UVKA 5FLXg 3EG6A 5K1CC 3I7PA 5FA5B 2QR5A 3MMYA 1TYQC 4NENA 1XKSA 3EI3A 4LG8A 3MZLA 3CFVA 5M61A 2VDMA 5EM2A 4O9DA 2P9SC 3ZDZA 3NIGA 3VA6A 3JROA 2XZGA 3IUNA 3L4MD 4A08A 3EU7A 4PBYA 3FM0A 2H6NA 4GGCA 5HDBA 4ERYA 2J56H 3OKYA 3EI3B 3IIYA 2VZ1A 3KRWB 2I0SA 4WK2A 3SMRA 5I5MA 3AFCA 1JOFA 3IURA 4L9OA 2AH0A 2UZYB 4Y7RA 2AGYA 3U4YA 2PM7B 3FRXA 3GC3B 4PBZA 2P9PC 5FFGA 3SBQA 2P9IC 1K8KC 1A12A 3JZNA 4BP9A 2G99A 4GMBA 2YMUA 4RE5A 4U1EI 4J87A 3EQ7A 4BCCA 2VDPA 4ERQA 4ESGA 1H2WA 1B9XA 1VE7A 3DWLC 1VYHC 3GREA 4ZOYA 3SCYA 1K32A 4OWRA 4AN0A 3RRMC 4J73A 4WJKA 4AN1A 1O6FA 4Z7NA 4JHPC 3IUJA 2J57G 5H1MA 2HU8A 1T2XA 2CE8A 1YFQA 1B9YA 2BKLA 3NVXA 2MTAH 4JD2C 2AH1A 1E8MA 2GC4A 4IA9A 3I7LA 4MMYA 4G56B 1JMZB 1C9LA 4AOWA 3NIDA 1MG2A 3OL2B 5HQGA 4O45A 4FA5D 3DM0A 3DDUA 4CY3A 4A11B 1P22A 4MMXA 4A2LA 3L4OD 5M5UA 1QFSA 1SQJA 1NEXB 2P9NC 3PSCB 1H2YA 4ZOZA 5HE3B 1E8NA 5A2Qg 3GD1I 1H2ZA 4JSPC 2JKXA 3RSEC 4FWWA 2VC2A 2VDRA 3SJLD 2BBKH 2GNQA 4ZOXA 5KDOB 1UOOA 2Q7QA 3KRXB 5C2VB 4CZVA 3O4HA 2H9LA 5C9ZB 4JXMA 1VZ2A 3DXKC 5CXCA 4LGNA 3P4FA 3UVOA 1GOFA 2Z2NA 4O3TB 3I7NA 3SHFA 1C9IA 3K26A 1A0RB 3JPXA 3I8EA 2VDOA 2HKMA 2HU7A 3J81g 2VDQA 1I2MB 4YVDA 5EMMB 3VH0A 2CO0A 3BG1A 4J0WA 1GOGA 4L1MA 4AMYA 3BWSA 3N0DA 3V4VA 2XYIA 3RFGA 4FA1D 4AEZA 3ZWLB 5E6UA 3UVMA 4IMMA 1MDAH 4K3ID 2VZ3A 4CI1A 3EMHA 3MXXA 1N6FA 2CO0C 4L3GD 4O02A 1PEVA 1S4UX 2CNXA 3OKWA 2IWFA 3FCUA 4JSNC 4UM9A 1QFMA 2P9LC 3VGZA 1GP2B 1M1XA 2XL2A 3AL9A 3IUMA 3NVNA 5FKSA 4U7AA 3V7DB 4E5ZB 3EWEA 4XEIC 4JSXC 3MKSB 5IJ7E 2GC7A 4EWRA 4X61B 5JWZA 4D9SA 2HXCA 4I79A 1U8CA 3IIWA 1O6GA 2OIZA 2AGWA 3K27A 1GOTB 1K3IA 4GM3A 5M5SA 1GG2B 5E6RA 4FA4D 4QQEA 3QI0A 4JHNA 4FHLA 4A0BA 3F3FA 3SWSD 2CN2A 2OK4A 2EIBA 3CFSB 4WK4A 4UI9R 2H6QA 2IUPA 2PM9B 5TEEA 4XYHA 2BCJB 1XHMA 4X3EA 5FXYA 4CY1A 3MZKA 5I5JA 5M5TA 4A0AA 3JRPA 5H14A 4D6VA 4A0BB 5M5VA 4XYIA 4O2WA 4GGDA 3C99A 2YNPA 3C75H 3OL2A 3I7OA 2OVRB 3ULEC 2HJBA 3O4JA 2AGLA 4A11A 3EI4A 4QAMA 3JAMg 4IRZA 3EQ9A 2VDLA 3MVDK 4GZ8A 2IUQA 3ORVD 4ERZA 1R5MA 4J8BA 5EALA 4A0AB 3PVUB 4CY5A 4GM9A 2YB8B 4NBMA 4ZN4A 5B4WA 2OVQB 5EAPA 4NSXA 2EIEA 4J78A 3UKUC 3UVLA 3V9FA 4CI8A 3BG0A 5FKRA 2P9UC 3O4GA 2CN3A 3CIKB 4QT8A 2B5NA 4FAND 3EI4B 1OLZA 3IUQA 2IWKA 4ZOVA 1UTCA 3V4PA 4Z7QA 5IT9g 3JB9L 3HFQA 1OMWB 2XDWA 3RN1D 3I8CA 3GFCA 3PXWD 4NC4A 4CI2A 3UR4A 4R7AB 3SBPA
chains in the Genus database with same CATH topology
2EBSA 4J0XA 2Z2OA 1U4CA 5HE2B 5EARA 4A7JA 3OW8A 3EI2B 4A2MA 3SBRA 4CZYA 4JT5C 3IJ1A 4Z8LA 1PGUA 2W18A 2I0TA 4GM8A 3W15A 1FWXA 2AQ5A 2QXVA 1MG3A 3UKRC 5I5IA 5H17A 5FQDA 3ODTA 4PSXB 2H13A 3C5MA 1QNIA 4CC9A 1NR0A 3SXTD 4E5ZA 5FKTA 2IAAA 4OZUA 4FAVD 4GQ2P 2B5MA 3OTTA 2OVPB 5THAA 3RLMD 5EAMA 3DXMC 3DSMA 2H68A 2B4EA 5HYNB 2XL3A 5GXHA 5CYKB 3RN0D 2H3XA 5CXBB 4K3JB 2H9MA 2H14A 3PE7A 4GGAA 4J77A 2XU7A 5IGOA 4BL0A 1ERJA 4X63B 2PM9A 2H6KA 5GMKn 4O3UB 4Y5RD 3UVNA 2HJ4A 2CE9A 4CY2A 1U2VC 5GSAA 5FKQA 2OK6A 5AMSA 3RMZD 4QRJA 2AGZA 2OJYA 4D0KA 4MK0B 3OKTA 4PSWB 5IC7A 5EM2B 3PXTD 1Q47A 3AH8B 5EMKB 4J82A 4CI3A 5GXIA 3IKOA 2YBAA 4TZ4A 4PXWA 5TDHB 4A08B 3MKQA 4J84A 2H47A 2TRCB 3FGBA 4PC0A 3I7HA 3OKYB 2HKRA 4ES0A 3F3PA 3I7KA 5SXMA 2I3SA 4BUJC 3F3GA 4H5JA 2QC5A 2IUVA 1XIPA 2H9NA 4JT6C 3C9CA 1JMXB 3AL8A 3EI1A 4A09A 5TF2A 1PI6A 3SVWD 4BH6A 1SHYB 4L1QD 3PVWB 4H5IA 2I0RA 3EI2A 3IJCA 4FA9D 3PXSD 1GXRA 2O9KA 4GQ1A 4O1QD 2B5LA 3AL8B 2I3TA 3EI1B 4N14A 4A09B 1SQ9A 1JJUB 3NVQA 1L0QA 2J55H 3I89A 3N0EA 3SFZA 5AJAA 4GQBB 4J81A 4JSVC 3V5WB 4E54A 2HESX 2PBIB 4FB1D 3I2NA 2PM6B 2HYEA 2P9KC 4PNKB 1RI6A 5HE0B 5IGQA 5HE1B 2YNNA 1N6EA 3PSLA 3JZHA 5TEFA 1PBYB 4HDJA 3SLED 2H9PA 4J8GA 4E54B 5AFU3 5CYKA 2IURA 1N6DA 4LG9A 3B7FA 4QL1A 5IJ8E 4X60B 5CXBA 5C2WB 1TBGA 5EMJB 5EMLB 2UZXB 3JZGA 4KFMB 3RFHA 5K19A 3IJ0A 4J79A 4L3HD 5CXCB 2AGXA 3E0CA 2Z2PA 2YNOA 3J80g 4J86A 3A0FA 3SN6B 4CZXA 2G9AA 3UVKA 5FLXg 3EG6A 5K1CC 3I7PA 5FA5B 3MMYA 1TYQC 1XKSA 3EI3A 4LG8A 3MZLA 3CFVA 5EM2A 4O9DA 2P9SC 3VA6A 3JROA 3L4MD 4A08A 3EU7A 4PBYA 3FM0A 2H6NA 4GGCA 4ERYA 2J56H 3OKYA 3EI3B 3IIYA 3KRWB 2I0SA 3SMRA 5I5MA 3AFCA 1JOFA 4L9OA 2AH0A 2UZYB 4Y7RA 2AGYA 3U4YA 2PM7B 3FRXA 4PBZA 2P9PC 3SBQA 2P9IC 1K8KC 3JZNA 2G99A 4GMBA 2YMUA 4U1EI 4J87A 4ERQA 4ESGA 1B9XA 3DWLC 1VYHC 3GREA 4ZOYA 3SCYA 1K32A 4OWRA 3RRMC 4J73A 2J57G 5H1MA 2CE8A 1YFQA 1B9YA 3NVXA 2MTAH 4JD2C 2AH1A 2GC4A 4IA9A 3I7LA 4G56B 1JMZB 4AOWA 1MG2A 3OL2B 5HQGA 4O45A 4FA5D 3DM0A 4CY3A 4A11B 1P22A 4A2LA 3L4OD 1SQJA 1NEXB 2P9NC 3PSCB 4ZOZA 5HE3B 5A2Qg 4JSPC 3RSEC 4FWWA 3SJLD 2BBKH 2GNQA 4ZOXA 5KDOB 2Q7QA 3KRXB 5C2VB 4CZVA 2H9LA 5C9ZB 4JXMA 5CXCA 3DXKC 4LGNA 3P4FA 3UVOA 2Z2NA 4O3TB 3I7NA 3SHFA 3K26A 1A0RB 3JPXA 3I8EA 2HKMA 3J81g 3VH0A 4YVDA 5EMMB 2CO0A 3BG1A 4J0WA 3BWSA 3N0DA 2XYIA 3RFGA 4FA1D 4AEZA 3ZWLB 3UVMA 4IMMA 1MDAH 4K3ID 4CI1A 3EMHA 3MXXA 1N6FA 2CO0C 4L3GD 1PEVA 1S4UX 2CNXA 3OKWA 2IWFA 4JSNC 2P9LC 3VGZA 1GP2B 2XL2A 3AL9A 3NVNA 5FKSA 4U7AA 3V7DB 4E5ZB 3EWEA 4XEIC 4JSXC 3MKSB 5IJ7E 2GC7A 4EWRA 4X61B 5JWZA 2HXCA 4I79A 3IIWA 2OIZA 2AGWA 3K27A 1GOTB 4GM3A 1GG2B 4FA4D 4QQEA 4FHLA 4A0BA 3F3FA 3SWSD 2CN2A 2OK4A 3CFSB 4UI9R 2H6QA 2IUPA 2PM9B 5TEEA 4XYHA 2BCJB 1XHMA 4X3EA 5FXYA 4CY1A 3MZKA 5I5JA 4A0AA 3JRPA 5H14A 4D6VA 4A0BB 4XYIA 4GGDA 3C99A 2YNPA 3C75H 3OL2A 3I7OA 2OVRB 3ULEC 2HJBA 2AGLA 4A11A 3EI4A 3JAMg 4GZ8A 2IUQA 3ORVD 4ERZA 1R5MA 4J8BA 5EALA 4A0AB 3PVUB 4CY5A 4GM9A 2YB8B 4ZN4A 5B4WA 2OVQB 5EAPA 4NSXA 4J78A 3UKUC 3UVLA 3V9FA 4CI8A 3BG0A 5FKRA 2P9UC 2CN3A 3CIKB 4QT8A 2B5NA 4FAND 3EI4B 1OLZA 2IWKA 4ZOVA 5IT9g 3JB9L 3HFQA 1OMWB 3RN1D 3I8CA 3GFCA 3PXWD 4CI2A 3UR4A 4R7AB 3SBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBS A;  4J0X A;  2Z2O A;  1U4C A;  5HE2 B;  5EAR A;  4A7J A;  3OW8 A;  3EI2 B;  4A2M A;  3SBR A;  4CZY A;  4JT5 C;  3IJ1 A;  4Z8L A;  1PGU A;  2W18 A;  2I0T A;  4GM8 A;  3W15 A;  1FWX A;  2AQ5 A;  2QXV A;  1MG3 A;  3UKR C;  5I5I A;  5H17 A;  5FQD A;  3ODT A;  4PSX B;  2H13 A;  3C5M A;  1QNI A;  4CC9 A;  1NR0 A;  3SXT D;  4E5Z A;  5FKT A;  2IAA A;  4OZU A;  4FAV D;  4GQ2 P;  2B5M A;  3OTT A;  2OVP B;  5THA A;  3RLM D;  5EAM A;  3DXM C;  3DSM A;  2H68 A;  2B4E A;  5HYN B;  2XL3 A;  5GXH A;  5CYK B;  3RN0 D;  2H3X A;  5CXB B;  4K3J B;  2H9M A;  2H14 A;  3PE7 A;  4GGA A;  4J77 A;  2XU7 A;  5IGO A;  4BL0 A;  1ERJ A;  4X63 B;  2PM9 A;  2H6K A;  5GMK n;  4O3U B;  4Y5R D;  3UVN A;  2HJ4 A;  2CE9 A;  4CY2 A;  1U2V C;  5GSA A;  5FKQ A;  2OK6 A;  5AMS A;  3RMZ D;  4QRJ A;  2AGZ A;  2OJY A;  4D0K A;  4MK0 B;  3OKT A;  4PSW B;  5IC7 A;  5EM2 B;  3PXT D;  1Q47 A;  3AH8 B;  5EMK B;  4J82 A;  4CI3 A;  5GXI A;  3IKO A;  2YBA A;  4TZ4 A;  4PXW A;  5TDH B;  4A08 B;  3MKQ A;  4J84 A;  2H47 A;  2TRC B;  3FGB A;  4PC0 A;  3I7H A;  3OKY B;  2HKR A;  4ES0 A;  3F3P A;  3I7K A;  5SXM A;  2I3S A;  4BUJ C;  3F3G A;  4H5J A;  2QC5 A;  2IUV A;  1XIP A;  2H9N A;  4JT6 C;  3C9C A;  1JMX B;  3AL8 A;  3EI1 A;  4A09 A;  5TF2 A;  1PI6 A;  3SVW D;  4BH6 A;  1SHY B;  4L1Q D;  3PVW B;  4H5I A;  2I0R A;  3EI2 A;  3IJC A;  4FA9 D;  3PXS D;  1GXR A;  2O9K A;  4GQ1 A;  4O1Q D;  2B5L A;  3AL8 B;  2I3T A;  3EI1 B;  4N14 A;  4A09 B;  1SQ9 A;  1JJU B;  3NVQ A;  1L0Q A;  2J55 H;  3I89 A;  3N0E A;  3SFZ A;  5AJA A;  4GQB B;  4J81 A;  4JSV C;  3V5W B;  4E54 A;  2HES X;  2PBI B;  4FB1 D;  3I2N A;  2PM6 B;  2HYE A;  2P9K C;  4PNK B;  1RI6 A;  5HE0 B;  5IGQ A;  5HE1 B;  2YNN A;  1N6E A;  3PSL A;  3JZH A;  5TEF A;  1PBY B;  4HDJ A;  3SLE D;  2H9P A;  4J8G A;  4E54 B;  5AFU 3;  5CYK A;  2IUR A;  1N6D A;  4LG9 A;  3B7F A;  4QL1 A;  5IJ8 E;  4X60 B;  5CXB A;  5C2W B;  1TBG A;  5EMJ B;  5EML B;  2UZX B;  3JZG A;  4KFM B;  3RFH A;  5K19 A;  3IJ0 A;  4J79 A;  4L3H D;  5CXC B;  2AGX A;  3E0C A;  2Z2P A;  2YNO A;  3J80 g;  4J86 A;  3A0F A;  3SN6 B;  4CZX A;  2G9A A;  3UVK A;  5FLX g;  3EG6 A;  5K1C C;  3I7P A;  5FA5 B;  3MMY A;  1TYQ C;  1XKS A;  3EI3 A;  4LG8 A;  3MZL A;  3CFV A;  5EM2 A;  4O9D A;  2P9S C;  3VA6 A;  3JRO A;  3L4M D;  4A08 A;  3EU7 A;  4PBY A;  3FM0 A;  2H6N A;  4GGC A;  4ERY A;  2J56 H;  3OKY A;  3EI3 B;  3IIY A;  3KRW B;  2I0S A;  3SMR A;  5I5M A;  3AFC A;  1JOF A;  4L9O A;  2AH0 A;  2UZY B;  4Y7R A;  2AGY A;  3U4Y A;  2PM7 B;  3FRX A;  4PBZ A;  2P9P C;  3SBQ A;  2P9I C;  1K8K C;  3JZN A;  2G99 A;  4GMB A;  2YMU A;  4U1E I;  4J87 A;  4ERQ A;  4ESG A;  1B9X A;  3DWL C;  1VYH C;  3GRE A;  4ZOY A;  3SCY A;  1K32 A;  4OWR A;  3RRM C;  4J73 A;  2J57 G;  5H1M A;  2CE8 A;  1YFQ A;  1B9Y A;  3NVX A;  2MTA H;  4JD2 C;  2AH1 A;  2GC4 A;  4IA9 A;  3I7L A;  4G56 B;  1JMZ B;  4AOW A;  1MG2 A;  3OL2 B;  5HQG A;  4O45 A;  4FA5 D;  3DM0 A;  4CY3 A;  4A11 B;  1P22 A;  4A2L A;  3L4O D;  1SQJ A;  1NEX B;  2P9N C;  3PSC B;  4ZOZ A;  5HE3 B;  5A2Q g;  4JSP C;  3RSE C;  4FWW A;  3SJL D;  2BBK H;  2GNQ A;  4ZOX A;  5KDO B;  2Q7Q A;  3KRX B;  5C2V B;  4CZV A;  2H9L A;  5C9Z B;  4JXM A;  5CXC A;  3DXK C;  4LGN A;  3P4F A;  3UVO A;  2Z2N A;  4O3T B;  3I7N A;  3SHF A;  3K26 A;  1A0R B;  3JPX A;  3I8E A;  2HKM A;  3J81 g;  3VH0 A;  4YVD A;  5EMM B;  2CO0 A;  3BG1 A;  4J0W A;  3BWS A;  3N0D A;  2XYI A;  3RFG A;  4FA1 D;  4AEZ A;  3ZWL B;  3UVM A;  4IMM A;  1MDA H;  4K3I D;  4CI1 A;  3EMH A;  3MXX A;  1N6F A;  2CO0 C;  4L3G D;  1PEV A;  1S4U X;  2CNX A;  3OKW A;  2IWF A;  4JSN C;  2P9L C;  3VGZ A;  1GP2 B;  2XL2 A;  3AL9 A;  3NVN A;  5FKS A;  4U7A A;  3V7D B;  4E5Z B;  3EWE A;  4XEI C;  4JSX C;  3MKS B;  5IJ7 E;  2GC7 A;  4EWR A;  4X61 B;  5JWZ A;  2HXC A;  4I79 A;  3IIW A;  2OIZ A;  2AGW A;  3K27 A;  1GOT B;  4GM3 A;  1GG2 B;  4FA4 D;  4QQE A;  4FHL A;  4A0B A;  3F3F A;  3SWS D;  2CN2 A;  2OK4 A;  3CFS B;  4UI9 R;  2H6Q A;  2IUP A;  2PM9 B;  5TEE A;  4XYH A;  2BCJ B;  1XHM A;  4X3E A;  5FXY A;  4CY1 A;  3MZK A;  5I5J A;  4A0A A;  3JRP A;  5H14 A;  4D6V A;  4A0B B;  4XYI A;  4GGD A;  3C99 A;  2YNP A;  3C75 H;  3OL2 A;  3I7O A;  2OVR B;  3ULE C;  2HJB A;  2AGL A;  4A11 A;  3EI4 A;  3JAM g;  4GZ8 A;  2IUQ A;  3ORV D;  4ERZ A;  1R5M A;  4J8B A;  5EAL A;  4A0A B;  3PVU B;  4CY5 A;  4GM9 A;  2YB8 B;  4ZN4 A;  5B4W A;  2OVQ B;  5EAP A;  4NSX A;  4J78 A;  3UKU C;  3UVL A;  3V9F A;  4CI8 A;  3BG0 A;  5FKR A;  2P9U C;  2CN3 A;  3CIK B;  4QT8 A;  2B5N A;  4FAN D;  3EI4 B;  1OLZ A;  2IWK A;  4ZOV A;  5IT9 g;  3JB9 L;  3HFQ A;  1OMW B;  3RN1 D;  3I8C A;  3GFC A;  3PXW D;  4CI2 A;  3UR4 A;  4R7A B;  3SBP A; 
#chains in the Genus database with same CATH topology
 2EBS A;  4J0X A;  4NAA A;  2Z2O A;  1U4C A;  5HE2 B;  1TYE A;  5EAR A;  4A7J A;  3OW8 A;  3K6S A;  3EI2 B;  4A2M A;  3SBR A;  4CZY A;  4JT5 C;  3IJ1 A;  4Z8L A;  4BCB A;  1PGU A;  2W18 A;  4BCD A;  2I0T A;  4GM8 A;  3W15 A;  1FWX A;  2AQ5 A;  2QXV A;  5FFO A;  1MG3 A;  3ZE0 A;  3UKR C;  5I5I A;  5H17 A;  5FQD A;  3ODT A;  4PSX B;  2H13 A;  3C5M A;  1QNI A;  4CC9 A;  2WQ8 A;  5C86 A;  1NR0 A;  3SXT D;  4E5Z A;  5FKT A;  2IAA A;  4OZU A;  4FAV D;  4GQ2 P;  1VE6 A;  2B5M A;  3OTT A;  2OVP B;  1VZ3 A;  5THA A;  3RLM D;  5EAM A;  3DXM C;  3DSM A;  2H68 A;  3EQ8 A;  2B4E A;  5HYN B;  2XL3 A;  5GXH A;  5CYK B;  3RN0 D;  2VDN A;  5C92 A;  2H3X A;  5CXB B;  4K3J B;  5E6S A;  3OF7 A;  2H9M A;  2H14 A;  3PE7 A;  4GGA A;  4J77 A;  5M5R A;  2XU7 A;  5IGO A;  4BL0 A;  1ERJ A;  4X63 B;  4G1M A;  2PM9 A;  2H6K A;  4DNU A;  5GMK n;  4O3U B;  4Y5R D;  4AMZ A;  3UVN A;  2HJ4 A;  3O4I A;  2CE9 A;  4CY2 A;  3IVM A;  1U2V C;  5GSA A;  5FKQ A;  3NIF A;  4UM8 A;  2VDK A;  3K72 A;  2OK6 A;  3VI4 A;  5AMS A;  3RMZ D;  4QRJ A;  2AGZ A;  2OJY A;  4D0K A;  4MK0 B;  3OKT A;  4PSW B;  5IC7 A;  5EM2 B;  1E5T A;  3PXT D;  1Q47 A;  2QZP A;  3AH8 B;  5EMK B;  4G55 A;  4J82 A;  4CI3 A;  4BP8 A;  5GXI A;  3IKO A;  2YBA A;  4TZ4 A;  4PXW A;  5TDH B;  4A08 B;  3MUO A;  3MKQ A;  4J84 A;  1L5G A;  2H47 A;  3ZE2 A;  2TRC B;  3FGB A;  4PC0 A;  3ZDX A;  3I7H A;  3OKY B;  2HKR A;  4ES0 A;  3F3P A;  3I7K A;  5SXM A;  2I3S A;  4WK0 A;  3F3G A;  4H5J A;  4BUJ C;  2QC5 A;  2IUV A;  1BPO A;  1XIP A;  4AX4 A;  2H9N A;  4JT6 C;  2XE4 A;  3C9C A;  1JMX B;  3AL8 A;  3EI1 A;  4A09 A;  5TF2 A;  1PI6 A;  3SVW D;  4BH6 A;  1JV2 A;  3ZDY A;  1SHY B;  2HU5 A;  3K71 A;  4L1Q D;  1YR2 A;  3PVW B;  2I0R A;  4H5I A;  4DNV A;  3EI2 A;  3IJC A;  4FA9 D;  3PXS D;  1GXR A;  1JTD B;  2O9K A;  4GQ1 A;  4O1Q D;  2B5L A;  3AL8 B;  2I3T A;  4DNW A;  4N14 A;  3EI1 B;  4A09 B;  1SQ9 A;  1JJU B;  3KCI A;  3MUN A;  1L0Q A;  3NVQ A;  4MMZ A;  3T3M A;  2J55 H;  3I89 A;  3N0E A;  3FCS A;  3SFZ A;  5AJA A;  4GQB B;  4J81 A;  4JSV C;  3V5W B;  4E54 A;  2HES X;  2PBI B;  4FB1 D;  4G1E A;  3I2N A;  2PM6 B;  2HYE A;  2P9K C;  4PNK B;  4Z7O A;  1RI6 A;  5HE0 B;  5IGQ A;  3IJE A;  5HE1 B;  2YNN A;  1N6E A;  3PSL A;  3JZH A;  5TEF A;  3IUL A;  1H2X A;  1PBY B;  4HDJ A;  3SLE D;  2EID A;  2H9P A;  4J8G A;  4E54 B;  5AFU 3;  5CYK A;  2IUR A;  1N6D A;  4LG9 A;  3VI3 A;  3B7F A;  1UOP A;  4QL1 A;  5IJ8 E;  4X60 B;  3T3P A;  5CXB A;  5C2W B;  1TBG A;  5EMJ B;  5EML B;  2UZX B;  3JZG A;  4KFM B;  2EIC A;  3ZE1 A;  1GOH A;  3RFH A;  4RE6 A;  5K19 A;  3IJ0 A;  4J79 A;  4L3H D;  5CXC B;  2AGX A;  3E0C A;  2Z2P A;  2YNO A;  3J80 g;  1UOQ A;  4J86 A;  3A0F A;  3SN6 B;  4CZX A;  3QHY B;  2G9A A;  3UVK A;  5FLX g;  3EG6 A;  5K1C C;  3I7P A;  5FA5 B;  2QR5 A;  3MMY A;  1TYQ C;  4NEN A;  1XKS A;  3EI3 A;  4LG8 A;  3MZL A;  3CFV A;  5M61 A;  2VDM A;  5EM2 A;  4O9D A;  2P9S C;  3ZDZ A;  3NIG A;  3VA6 A;  3JRO A;  2XZG A;  3IUN A;  3L4M D;  4A08 A;  3EU7 A;  4PBY A;  3FM0 A;  2H6N A;  4GGC A;  5HDB A;  4ERY A;  2J56 H;  3OKY A;  3EI3 B;  3IIY A;  2VZ1 A;  3KRW B;  2I0S A;  4WK2 A;  3SMR A;  5I5M A;  3AFC A;  1JOF A;  3IUR A;  4L9O A;  2AH0 A;  2UZY B;  4Y7R A;  2AGY A;  3U4Y A;  2PM7 B;  3FRX A;  3GC3 B;  4PBZ A;  2P9P C;  5FFG A;  3SBQ A;  2P9I C;  1K8K C;  1A12 A;  3JZN A;  4BP9 A;  2G99 A;  4GMB A;  2YMU A;  4RE5 A;  4U1E I;  4J87 A;  3EQ7 A;  4BCC A;  2VDP A;  4ERQ A;  4ESG A;  1H2W A;  1B9X A;  1VE7 A;  3DWL C;  1VYH C;  3GRE A;  4ZOY A;  3SCY A;  1K32 A;  4OWR A;  4AN0 A;  3RRM C;  4J73 A;  4WJK A;  4AN1 A;  1O6F A;  4Z7N A;  4JHP C;  3IUJ A;  2J57 G;  5H1M A;  2HU8 A;  1T2X A;  2CE8 A;  1YFQ A;  1B9Y A;  2BKL A;  3NVX A;  2MTA H;  4JD2 C;  2AH1 A;  1E8M A;  2GC4 A;  4IA9 A;  3I7L A;  4MMY A;  4G56 B;  1JMZ B;  1C9L A;  4AOW A;  3NID A;  1MG2 A;  3OL2 B;  5HQG A;  4O45 A;  4FA5 D;  3DM0 A;  3DDU A;  4CY3 A;  4A11 B;  1P22 A;  4MMX A;  4A2L A;  3L4O D;  5M5U A;  1QFS A;  1SQJ A;  1NEX B;  2P9N C;  3PSC B;  1H2Y A;  4ZOZ A;  5HE3 B;  1E8N A;  5A2Q g;  3GD1 I;  1H2Z A;  4JSP C;  2JKX A;  3RSE C;  4FWW A;  2VC2 A;  2VDR A;  3SJL D;  2BBK H;  2GNQ A;  4ZOX A;  5KDO B;  1UOO A;  2Q7Q A;  3KRX B;  5C2V B;  4CZV A;  3O4H A;  2H9L A;  5C9Z B;  4JXM A;  1VZ2 A;  3DXK C;  5CXC A;  4LGN A;  3P4F A;  3UVO A;  1GOF A;  2Z2N A;  4O3T B;  3I7N A;  3SHF A;  1C9I A;  3K26 A;  1A0R B;  3JPX A;  3I8E A;  2VDO A;  2HKM A;  2HU7 A;  3J81 g;  2VDQ A;  1I2M B;  4YVD A;  5EMM B;  3VH0 A;  2CO0 A;  3BG1 A;  4J0W A;  1GOG A;  4L1M A;  4AMY A;  3BWS A;  3N0D A;  3V4V A;  2XYI A;  3RFG A;  4FA1 D;  4AEZ A;  3ZWL B;  5E6U A;  3UVM A;  4IMM A;  1MDA H;  4K3I D;  2VZ3 A;  4CI1 A;  3EMH A;  3MXX A;  1N6F A;  2CO0 C;  4L3G D;  4O02 A;  1PEV A;  1S4U X;  2CNX A;  3OKW A;  2IWF A;  3FCU A;  4JSN C;  4UM9 A;  1QFM A;  2P9L C;  3VGZ A;  1GP2 B;  1M1X A;  2XL2 A;  3AL9 A;  3IUM A;  3NVN A;  5FKS A;  4U7A A;  3V7D B;  4E5Z B;  3EWE A;  4XEI C;  4JSX C;  3MKS B;  5IJ7 E;  2GC7 A;  4EWR A;  4X61 B;  5JWZ A;  4D9S A;  2HXC A;  4I79 A;  1U8C A;  3IIW A;  1O6G A;  2OIZ A;  2AGW A;  3K27 A;  1GOT B;  1K3I A;  4GM3 A;  5M5S A;  1GG2 B;  5E6R A;  4FA4 D;  4QQE A;  3QI0 A;  4JHN A;  4FHL A;  4A0B A;  3F3F A;  3SWS D;  2CN2 A;  2OK4 A;  2EIB A;  3CFS B;  4WK4 A;  4UI9 R;  2H6Q A;  2IUP A;  2PM9 B;  5TEE A;  4XYH A;  2BCJ B;  1XHM A;  4X3E A;  5FXY A;  4CY1 A;  3MZK A;  5I5J A;  5M5T A;  4A0A A;  3JRP A;  5H14 A;  4D6V A;  4A0B B;  5M5V A;  4XYI A;  4O2W A;  4GGD A;  3C99 A;  2YNP A;  3C75 H;  3OL2 A;  3I7O A;  2OVR B;  3ULE C;  2HJB A;  3O4J A;  2AGL A;  4A11 A;  3EI4 A;  4QAM A;  3JAM g;  4IRZ A;  3EQ9 A;  2VDL A;  3MVD K;  4GZ8 A;  2IUQ A;  3ORV D;  4ERZ A;  1R5M A;  4J8B A;  5EAL A;  4A0A B;  3PVU B;  4CY5 A;  4GM9 A;  2YB8 B;  4NBM A;  4ZN4 A;  5B4W A;  2OVQ B;  5EAP A;  4NSX A;  2EIE A;  4J78 A;  3UKU C;  3UVL A;  3V9F A;  4CI8 A;  3BG0 A;  5FKR A;  2P9U C;  3O4G A;  2CN3 A;  3CIK B;  4QT8 A;  2B5N A;  4FAN D;  3EI4 B;  1OLZ A;  3IUQ A;  2IWK A;  4ZOV A;  1UTC A;  3V4P A;  4Z7Q A;  5IT9 g;  3JB9 L;  3HFQ A;  1OMW B;  2XDW A;  3RN1 D;  3I8C A;  3GFC A;  3PXW D;  4NC4 A;  4CI2 A;  3UR4 A;  4R7A B;  3SBP A; 
#chains in the Genus database with same CATH homology
 2EBS A;  4J0X A;  2Z2O A;  1U4C A;  5HE2 B;  5EAR A;  4A7J A;  3OW8 A;  3EI2 B;  4A2M A;  3SBR A;  4CZY A;  4JT5 C;  3IJ1 A;  4Z8L A;  1PGU A;  2W18 A;  2I0T A;  4GM8 A;  3W15 A;  1FWX A;  2AQ5 A;  2QXV A;  1MG3 A;  3UKR C;  5I5I A;  5H17 A;  5FQD A;  3ODT A;  4PSX B;  2H13 A;  3C5M A;  1QNI A;  4CC9 A;  1NR0 A;  3SXT D;  4E5Z A;  5FKT A;  2IAA A;  4OZU A;  4FAV D;  4GQ2 P;  2B5M A;  3OTT A;  2OVP B;  5THA A;  3RLM D;  5EAM A;  3DXM C;  3DSM A;  2H68 A;  2B4E A;  5HYN B;  2XL3 A;  5GXH A;  5CYK B;  3RN0 D;  2H3X A;  5CXB B;  4K3J B;  2H9M A;  2H14 A;  3PE7 A;  4GGA A;  4J77 A;  2XU7 A;  5IGO A;  4BL0 A;  1ERJ A;  4X63 B;  2PM9 A;  2H6K A;  5GMK n;  4O3U B;  4Y5R D;  3UVN A;  2HJ4 A;  2CE9 A;  4CY2 A;  1U2V C;  5GSA A;  5FKQ A;  2OK6 A;  5AMS A;  3RMZ D;  4QRJ A;  2AGZ A;  2OJY A;  4D0K A;  4MK0 B;  3OKT A;  4PSW B;  5IC7 A;  5EM2 B;  3PXT D;  1Q47 A;  3AH8 B;  5EMK B;  4J82 A;  4CI3 A;  5GXI A;  3IKO A;  2YBA A;  4TZ4 A;  4PXW A;  5TDH B;  4A08 B;  3MKQ A;  4J84 A;  2H47 A;  2TRC B;  3FGB A;  4PC0 A;  3I7H A;  3OKY B;  2HKR A;  4ES0 A;  3F3P A;  3I7K A;  5SXM A;  2I3S A;  4BUJ C;  3F3G A;  4H5J A;  2QC5 A;  2IUV A;  1XIP A;  2H9N A;  4JT6 C;  3C9C A;  1JMX B;  3AL8 A;  3EI1 A;  4A09 A;  5TF2 A;  1PI6 A;  3SVW D;  4BH6 A;  1SHY B;  4L1Q D;  3PVW B;  4H5I A;  2I0R A;  3EI2 A;  3IJC A;  4FA9 D;  3PXS D;  1GXR A;  2O9K A;  4GQ1 A;  4O1Q D;  2B5L A;  3AL8 B;  2I3T A;  3EI1 B;  4N14 A;  4A09 B;  1SQ9 A;  1JJU B;  3NVQ A;  1L0Q A;  2J55 H;  3I89 A;  3N0E A;  3SFZ A;  5AJA A;  4GQB B;  4J81 A;  4JSV C;  3V5W B;  4E54 A;  2HES X;  2PBI B;  4FB1 D;  3I2N A;  2PM6 B;  2HYE A;  2P9K C;  4PNK B;  1RI6 A;  5HE0 B;  5IGQ A;  5HE1 B;  2YNN A;  1N6E A;  3PSL A;  3JZH A;  5TEF A;  1PBY B;  4HDJ A;  3SLE D;  2H9P A;  4J8G A;  4E54 B;  5AFU 3;  5CYK A;  2IUR A;  1N6D A;  4LG9 A;  3B7F A;  4QL1 A;  5IJ8 E;  4X60 B;  5CXB A;  5C2W B;  1TBG A;  5EMJ B;  5EML B;  2UZX B;  3JZG A;  4KFM B;  3RFH A;  5K19 A;  3IJ0 A;  4J79 A;  4L3H D;  5CXC B;  2AGX A;  3E0C A;  2Z2P A;  2YNO A;  3J80 g;  4J86 A;  3A0F A;  3SN6 B;  4CZX A;  2G9A A;  3UVK A;  5FLX g;  3EG6 A;  5K1C C;  3I7P A;  5FA5 B;  3MMY A;  1TYQ C;  1XKS A;  3EI3 A;  4LG8 A;  3MZL A;  3CFV A;  5EM2 A;  4O9D A;  2P9S C;  3VA6 A;  3JRO A;  3L4M D;  4A08 A;  3EU7 A;  4PBY A;  3FM0 A;  2H6N A;  4GGC A;  4ERY A;  2J56 H;  3OKY A;  3EI3 B;  3IIY A;  3KRW B;  2I0S A;  3SMR A;  5I5M A;  3AFC A;  1JOF A;  4L9O A;  2AH0 A;  2UZY B;  4Y7R A;  2AGY A;  3U4Y A;  2PM7 B;  3FRX A;  4PBZ A;  2P9P C;  3SBQ A;  2P9I C;  1K8K C;  3JZN A;  2G99 A;  4GMB A;  2YMU A;  4U1E I;  4J87 A;  4ERQ A;  4ESG A;  1B9X A;  3DWL C;  1VYH C;  3GRE A;  4ZOY A;  3SCY A;  1K32 A;  4OWR A;  3RRM C;  4J73 A;  2J57 G;  5H1M A;  2CE8 A;  1YFQ A;  1B9Y A;  3NVX A;  2MTA H;  4JD2 C;  2AH1 A;  2GC4 A;  4IA9 A;  3I7L A;  4G56 B;  1JMZ B;  4AOW A;  1MG2 A;  3OL2 B;  5HQG A;  4O45 A;  4FA5 D;  3DM0 A;  4CY3 A;  4A11 B;  1P22 A;  4A2L A;  3L4O D;  1SQJ A;  1NEX B;  2P9N C;  3PSC B;  4ZOZ A;  5HE3 B;  5A2Q g;  4JSP C;  3RSE C;  4FWW A;  3SJL D;  2BBK H;  2GNQ A;  4ZOX A;  5KDO B;  2Q7Q A;  3KRX B;  5C2V B;  4CZV A;  2H9L A;  5C9Z B;  4JXM A;  5CXC A;  3DXK C;  4LGN A;  3P4F A;  3UVO A;  2Z2N A;  4O3T B;  3I7N A;  3SHF A;  3K26 A;  1A0R B;  3JPX A;  3I8E A;  2HKM A;  3J81 g;  3VH0 A;  4YVD A;  5EMM B;  2CO0 A;  3BG1 A;  4J0W A;  3BWS A;  3N0D A;  2XYI A;  3RFG A;  4FA1 D;  4AEZ A;  3ZWL B;  3UVM A;  4IMM A;  1MDA H;  4K3I D;  4CI1 A;  3EMH A;  3MXX A;  1N6F A;  2CO0 C;  4L3G D;  1PEV A;  1S4U X;  2CNX A;  3OKW A;  2IWF A;  4JSN C;  2P9L C;  3VGZ A;  1GP2 B;  2XL2 A;  3AL9 A;  3NVN A;  5FKS A;  4U7A A;  3V7D B;  4E5Z B;  3EWE A;  4XEI C;  4JSX C;  3MKS B;  5IJ7 E;  2GC7 A;  4EWR A;  4X61 B;  5JWZ A;  2HXC A;  4I79 A;  3IIW A;  2OIZ A;  2AGW A;  3K27 A;  1GOT B;  4GM3 A;  1GG2 B;  4FA4 D;  4QQE A;  4FHL A;  4A0B A;  3F3F A;  3SWS D;  2CN2 A;  2OK4 A;  3CFS B;  4UI9 R;  2H6Q A;  2IUP A;  2PM9 B;  5TEE A;  4XYH A;  2BCJ B;  1XHM A;  4X3E A;  5FXY A;  4CY1 A;  3MZK A;  5I5J A;  4A0A A;  3JRP A;  5H14 A;  4D6V A;  4A0B B;  4XYI A;  4GGD A;  3C99 A;  2YNP A;  3C75 H;  3OL2 A;  3I7O A;  2OVR B;  3ULE C;  2HJB A;  2AGL A;  4A11 A;  3EI4 A;  3JAM g;  4GZ8 A;  2IUQ A;  3ORV D;  4ERZ A;  1R5M A;  4J8B A;  5EAL A;  4A0A B;  3PVU B;  4CY5 A;  4GM9 A;  2YB8 B;  4ZN4 A;  5B4W A;  2OVQ B;  5EAP A;  4NSX A;  4J78 A;  3UKU C;  3UVL A;  3V9F A;  4CI8 A;  3BG0 A;  5FKR A;  2P9U C;  2CN3 A;  3CIK B;  4QT8 A;  2B5N A;  4FAN D;  3EI4 B;  1OLZ A;  2IWK A;  4ZOV A;  5IT9 g;  3JB9 L;  3HFQ A;  1OMW B;  3RN1 D;  3I8C A;  3GFC A;  3PXW D;  4CI2 A;  3UR4 A;  4R7A B;  3SBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...