3C9HA

Crystal structure of the substrate binding protein of the abc transporter from agrobacterium tumefaciens
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
339
structure length
334
Chain Sequence
PALAQVAVFPALSGQTLVVYSSLDEPLATPMIEGFQKANPDIAVHYEDMLTGEIYDRIVKETDAGKKTADFAFSSAMDLQVKLSNDGYAQRSDLAMSARWPAWANWRNTAYALTFEPAVFVYHKPSFTTEKPPATRAEFVDYLERHAKEVHGRIATYDIERGVGFLFMSRDQEQFGDIWSVIKAMGAAGVKVYSTSSAILERVSDGRFVLGYNILGSYAADWASRHPDVGIVLPKDYTVVMSRIGLVPEAAANPELGRRYLEFFMSKEGQTIMARQLQIPAVSPEVAGENTANTMQAIHGAQLRPVPVSPGLMVYLDQVKRSRLIERWNEALRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the substrate binding protein of the ABC transporter from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transport protein
molecule keywords ABC transporter, substrate binding protein
total genus 117
structure length 334
sequence length 339
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3c9hA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3c9hA01
5TPAB 3TTKA 5HPQA 2PVUA 3R26A 2O6AA 4I9DA 1N76A 3OO7A 4F1UA 2IA4A 3PMWA 4YKKA 5ICQA 2HCAA 3H6TA 1LBCA 1VR5A 4GF8A 4XXUA 4KHZE 1MH4A 1A40A 4H5FA 3L6HA 4JB7A 4OETA 4ZS9A 2ESNA 3IB1A 4F3BA 5B7DA 1AOVA 4EDPA 1AMFA 3EN3A 5LOMA 4PE5B 3MWBA 4HCYA 1N04A 4JDFA 2ZMBA 2OK2A 1XVYA 4YB6A 3H6UA 5CMKA 3DP8A 1JW5A 3FXUA 1F9BA 1N84A 2F6GA 2A5TA 3IOVA 2OWSA 3PPRA 4H8IA 3HHGA 4IO3A 3QSLA 4G68C 2DWIA 4OERA 4F3SA 2NXOA 1HSEA 3GBAA 3A09A 2I4CA 3BBRA 1MH3A 4XKNA 3D4GA 3G3IA 3G3GA 1B3LA 1MM7A 4BDRA 5H8NB 2X7PA 5TP9B 2Q89A 5H8FB 1FTKA 2ONKE 2UVGA 1J1NA 3OEMA 3PUZE 4IO7A 3H6VA 1MQDA 3S9NC 4R6YA 4IGTA 3BFTA 5KCJA 1UTHB 1AL3A 1H76A 2XXPA 3PMVA 1EU8A 2NUVA 1PC3A 1D9YA 4GL8A 4YICA 2XXVA 3JV9A 1LAHE 3HO7A 4KPTA 4DLDA 3LSLA 3FXQA 4WKMA 2QMXA 4I8CA 5DEXB 3ZS6A 3VVDA 4X1DA 1UIVA 4NF5A 3ILUB 4NF6A 3KJTA 3MVYA 5I2KB 3FVNA 4G8NA 2W7YA 3Q28A 4GQOA 3ONMA 3K02A 4DXCA 5I2NB 5ICTA 4U1OA 2G93A 3MJNA 3Q25A 4R9GA 4RY1A 3K2DA 1GVCA 1PEBA 3TYHA 4Z7EA 5H8QA 3LSXA 5AE4A 1B6HA 2UVIA 2RC8A 3TTLA 3CFLA 3K6UA 1SBPA 5KCJB 4YKPA 4HS7A 1ZJLA 2ZNSA 1MQHA 4KYDA 2H5YA 3TUSA 3CG3A 4F2OA 1B9JA 1MDP1 4XIGQ 4KI0E 3MBPA 3W9WA 1IXCA 4PQJA 4QSEA 1NFTA 1Y1ZA 3T96B 1M5CA 3U93A 4Q8RA 1Q35A 1WODA 1WVJA 4PFYA 3OO6A 3FV1A 2ZYKA 1CB6A 2XX8A 3DLNA 2DYXA 3VE1B 1ZLQA 3VFJA 3CSBA 3BFUA 3EF7A 1QKBA 3IK6B 4POWA 3U94A 4C0RA 3I3VA 4ZE8A 1MPCA 2DXRA 2F7AA 3Q26A 3WAFA 5AA2B 4R74A 4QFLA 5I2NA 2R71A 1LFIA 1FTMA 3KN7A 3FJMA 3FUZA 1ZU0A 3OO8A 1B0HA 3TCFA 1I6BA 3CFXA 4P0GA 4R72A 5CI5A 4O3AA 2PMSA 2GHAA 2I3VA 1SW4A 4GWOA 3H6WA 1L5TA 3MP6A 4F1YA 2CMOA 5I59B 4ELQA 2THIA 1B52A 2I0BA 4JWYA 3PD9A 4DIGA 2OWTA 3OO9A 3ODBA 4BDMA 4U23A 3RT8A 1ZIUA 3SERA 3DELB 3T22A 3TTNA 3PUWE 3RLFE 3KSJA 2G29A 3IOWA 4LVQA 3RT6B 1UTBB 4MFIA 5IAIA 3KN3A 2Q9TA 3TELA 2V3QA 1MY3A 4EUOA 1MY4A 4TOZA 2KLFA 4YB5A 3IX1A 4OWDA 1A8FA 3FD3A 2P0SA 2QL3A 4KYSA 1FQAA 4OEUA 3MPKA 5AA3A 4F1VA 1URSA 1FQFA 1US5A 4GIZA 4QSDA 1MQGA 1IXGA 1MQJA 1CE2A 3OMBA 4O3BA 3K6VA 2DP8A 2XD2A 4FIMA 3ILTB 1B4ZA 1PB8A 3MPLA 1JW1A 3OSRA 2O1LA 3I6VA 3H03A 4MH5A 3RN8A 3VXCA 5TPAA 4ESWA 3IJOB 1OLAA 2ABHA 5DVFA 1SW5A 1NH7A 1MQIA 2DS9A 2R6GE 2V3UA 2HAUA 3RY3A 2OLBA 3E13X 4FORA 4FATA 4N13A 3SEYA 2ONRA 1Y3NA 4MBPA 4Q5TA 1LB9A 3N6TA 4NF4A 5I2KA 5JEIA 4OZ9A 3MP1A 4TQUQ 4BLAA 3FVGA 3H06B 3ECRA 3G3FA 4R6KA 3SEUA 1LGBC 3MVWA 2Z8EA 3K1MA 3K6WA 4AB5A 1XT8A 1Y3PA 5JK4A 3SEVA 3MZBA 4JSDA 1PB9A 4EF2A 2V93A 4F29A 2B3BA 4NE4A 5CMBA 1B3GA 1B3HA 1FTLA 3O97A 2ZYMA 4ZDMA 1H45A 1ZBMA 2GHBA 2VGQA 3FVOA 1ZTYA 1MY1A 3K6XA 1PBQA 1MXZA 3OSQA 4LUBA 3RUMA 1II5A 3IR1A 4F39A 5EHSA 2QJEA 2X7QA 4YB7A 1BIYA 2Z8DA 4OEVA 3TDJA 1SI0A 1Y4TA 2F8DA 2I49A 2H9BA 3C4MA 2XXHA 2OJTA 3C32A 3M8UA 4QSCA 4GXSB 1P1QA 4U1ZA 1IXHA 1QW0A 2DXYA 4G8HA 4RNSA 4GFRA 3T9HB 3TEPA 1QVSA 2QMWA 4F2QA 3B6TA 3D4CA 2F78A 5DTBA 1OVTA 2M8CA 1LSTA 1S7YA 1D9VA 2ZNUA 3C35A 3VDFA 3QUJA 4KCDA 2PT2A 3PUVE 2DQVA 2B3FA 4LONB 3KG2A 3OEKA 2O1MA 4LQ2A 1A7LA 1DTZA 4KFQA 4ONYA 4QFPA 5JTYB 3U92A 3UORA 3SEXA 1B5IA 1B5JA 3CVGA 5H8SA 3KSXA 4O3CA 4RPOA 3S9MC 3SKPA 1VFDA 4RA1A 3USDA 3B6QA 2QS1A 3FJGA 5K2XA 2XHDA 1IIWA 1XC1A 3LBSA 4XKPA 1D3KA 3H4ZA 3MW0A 4ELOA 1Z7ME 1TFAA 3FXRA 3RPWA 4FEDA 2H98A 3G7WA 2D5WA 2HFBA 3FATA 3IL1B 1POTA 3QIMA 4I1DA 3LSFB 3O6HA 1FQBA 5HBCA 3H3GA 4AQ4A 5CC2A 5ITPA 1M5EA 2O69A 5CMCA 2O7UA 4OESA 1TT1A 3B6WA 1US4A 1MXVA 2Q88A 2RC9A 3W9VA 4PETA 3TPAA 3KN8A 2B65A 1IUDA 1N7WA 3A3CA 4H65A 5I84A 3A3UA 4ESXA 5TU0A 4GVOA 3TODA 3FV2A 3CFZA 3HCQA 1Q1KA 4IGRA 1B4HA 3T9UA 1MXWA 3OD7A 1B3EA 3O28A 1LB8A 1B1HA 4H67A 5L8DA 2VD2A 3KFMA 3V89B 3UK4A 4R75A 2QS4A 4NF8A 5K2YA 3SEWA 3H7MA 4NWDA 1FTJA 4NF5B 3L6GA 1JQFA 3T93B 4FEBA 4RPNA 1ZMGA 3V5AA 4ELPA 1B51A 5I56B 3PUYE 1EH3A 1IITA 1ATGA 2O7IA 4G4PA 4X1BA 2Q2CA 1Y9UA 2XXTA 4YAHX 2RC7A 2RCBA 4YU0A 4ZEBA 4NMYA 1NL5A 1M5DA 1QUJA 1JEUA 1MM6A 2HQ0A 2UXAA 1Y20A 2Y7PA 3KBRA 3QYTA 4LQ5A 3FJ7A 3UN6A 4BDNA 1BTJA 1LFHA 5FTIA 1R6ZA 3UA8A 5L9MA 1R9QA 1VSOA 1R9LA 1T0KA 1GTKA 4PFTA 3E9XA 1LCFA 2ONSA 1JW4A 3ZKLA 2O84X 1VE4A 3THIA 1DMBA 2NOOA 5AA4B 1TXFA 4ND9A 3S9LC 2ANJA 5BUUA 3MUQA 1YAEA 3G3KA 5L9OA 2XXYA 2F7BA 2A5TB 2QPQA 4ZEIA 1SW2A 3KOTA 3MP8A 2H99A 4LATA 4R2BA 3R6UA 1P99A 3O66A 1VFEA 4C1TA 1I6AA 4G77A 1JVXA 2D21A 1ELJA 3IORA 3UIFA 1FQDA 4RJZA 2A5SA 4KCCA 1MY0A 3R7XA 4BDLA 1XVXA 1JNFA 2GRVA 1SD3A 3CI8A 3IB2A 1B5HA 1AH5A 3MZ9A 3KEIA 2F97A 2PBWA 3TQWA 1B05A 4DDDA 3T9XB 5DEXA 1FTOA 1ZKBA 2NWJA 3PD8A 4XKRA 4OFOA 1RKMA 1KWHA 1MS7A 1NH8A 2VOZA 1O64A 1P1OA 3AXFA 1MXYA 3UGWA 4L17A 3CSGA 5A5XB 4FECA 1NNPA 1A55A 2YJPA 4KR5A 1SW1A 3PUXE 3K4UA 1SYHA 1DTGA 3O6IA 4M4GA 1URGA 1DPPA 2VD3A 2RINA 4OENA 4ZZEA 4DCYA 4DZ1A 4UACA 2HZKA 3GXAA 4RYAA 1EZOA 4WEPA 4FJPA 4NEDA 2FYIA 5BWJA 1IEJA 4JBZA 4QRZA 3S4UA 2HAVA 5CRYA 5DYHA 4ISUA 4R6HA 1QKAA 3CG1A 3IJXB 1MPDA 4EQ9A 1OVBA 5FHMA 2Z8FA 4ZEKA 3FZVA 1LAXA 3QAXA 2WKYA 4H6DA 3TTMA 2DE4A 3PGFA 3UP9A 3HPIA 3VXBA 3EHTA 4G2ZA 2Q8JA 1TFDA 2QSXA 1OIBA 1R1NA 4H8JA 3G3JA 4U21A 4E0XA 3U1OA 2I58A 2XX7A 3C31A 2OZZA 3GBBA 4OMBA 5H8FA 2Y7KA 1B7UA 3M3KA 2LAOA 3M3LA 5F1QA 2V84A 1YTVA 3Q27A 1BLFA 4GD5A 3FIRA 4DE8A 2PT1A 4IY5A 2I3WA 1SVXB 5DVIA 3VLVA 3TKDA 4C1UA 1TWYA 3KZGA 2PX1A 4IO4A 3TCGA 4G8MA 3C36A 2F7CA 4HW8A 1HSJA 1MXUA 4TLMB 4LZ8A 2I4BA 1AIVA 2DOJA 3VVFA 3DP6A 4AB6A 2OCUA 4F19A 1ANFA 4YMBA 3TQLA 2ZYOA 1NKXA 1QULA 2VP1A 2DE3A 1I6QA 3FASA 3M3FA 5CBRA 1FCKA 4NF6B 4GRKA 4N07A 3RNNA 3CIJA 4QF9A 4ZEFA 1NNFA 4U4XA 4I62A 1UIUA 3GZGA 4MLQA 3IOTA 4P0IA 2V3TA 2XXWA 3C34A 4F31B 1MG1A 1Y4CA 2QRYA 2UVJA 3EQ1A 2ALUA 5I59A 4G68B 3LC8A 1A8EA 3K00A 1P1NA 4GXAA 1GV8A 3VLUA 5JTYA 4IO5A 2RF1A 3MAMA 1A99A 1OMPA 4BDOA 3LUYA 3MZ1A 2DWHA 4POXA 5CMMA 3T9VA 2DWJA 1PB7A 2UYEA 1Y3QA 3VVEA 4E0WA 1NMUA 1SDXA 3PPOA 1M5FA 2FNCA 1B7HA 2I6EA 2VHAA 2XXUA 3QK6A 5M2VA 3PPNA 4QHQA 2F5XA 4JXIA 2BJJX 3E3KA 3RQTA 3TCHA 3VV5A 5KZTA 3ZSFA 1XOCA 3K01A 2F6PA 1D4NA 3EPEA 4KYEA 2Z23A 4OXVA 5ELVA 5KDTB 4QFKA 3C33A 2GH9A 4H0WA 1FW0A 3O29A 4NTLA 4OYVA 4YKIA 4EXLA 5ISUA 2DVCA 2HZLA 5DT6A 2ZNTA 3HHFA 2XXXA 2E0SA 4IO2A 4P11A 3W15C 3RGYA 5HM4B 2AYSA 4EF1A 3IO4A 3FGSA 3Q29A 4OTEA 1IZ1A 2DVZA 3LR1A 3MVZA 1H3DA 4HCWA 2Y7RA 4JSOA 3VLWA 3N94A 2DSFA 3ZKKA 1S50A 1N3WA 1B40A 1XHYA 2P1SA 2QS2A 4GOTA 5AA1A 4PFWA 4LZ7A 3E4RA 3OXNA 2GFEA 2REGA 3SESA 4NF8B 4NF4B 2YLNA 1B58A 1UQWA 1IQ7A 1B3FA 1B46A 1WDNA 1YCJA 4LP2B 4MF3A 2DE2A 5I58A 1N7XA 4K3FA 3RTFB 3G3HA 1FQCA 1OQHA 3O6GA 5A5XA 1O63A 2E1SA 4YZZA 4R2FA 2AIXA 5J1DA 1H44A 3K1PA 3IB0A 4Q30B 1DSNA 2O68A 4PP0A 1RYOA 3JZJA 3S9EA 4KQPA 4RXLA 1HSLA 1Z7NE 2V25A 2XX9A 4U2RA 1O7TA 3EHSA 1P1WA 4M1VA 4ELRA 4EQ7A 4R73A 1DPEA 1B1XA 5H8NA 3BKIB 3N26A 4N6PA 3MVXA 5I57B 4IO6A 1BP5A 4BDQA 1N0TA 2H25A 3MC2A 3IOUA 3QXMA 4H5GA 5H8HB 1YPNA 1B2HA 5ITOA 4EXKA 2FA7A 4LA9A 3OENA 1JETA 2F34A 4GLIA 1GR2A 3OELA 4DXBA 5EHMA 4DCXA 3TZAA 3HSTA 1SYIA 4RK9A 2DWAA 1BKAA 3V83A 1RYXA 4QFNA 4Z0IA 3KOSA 4YMAA 3QUFA 2I48A 4LZ5A 2NVUB 3FVKA 4NWCA 1SI1A 5L9SA 1NNKA 4TLLB 1EZPA 3TAJA 3V8XB 2HXWA 3DM0A 4OHNA 2Y7IA 2R9JA 2RKMA 3K1NA 4MLVA 1UTHA 2AL4A 3TMGA 4ECFA 4F3PA 4ZECA 3I5OA 1EZ9A 2ZXTA 1PBPA 1M5BA 1LAGE 4Q0CA 1PDAA 3PU5A 2ZYNA 3CRBA 2XXIA 1USYE 4GL0A 1POY1 1QJMA 4IB2A 4OVJA 5TP9A 3SETA 4F22A 1MY2A 3C9HA 2UYFA 5KDTA 2Z22A 2RCAA 2F35A 5FTHA 1OQGA 1SQYA 2OBGA 4FE8A 2IEEA 4OQOA 1LAFE 3PV0E 3RTWB 3KJ7A 3JYRA 5FHNA 4F18A 1MPBA 4XKQA 4DXUA 4KD5A 1H43A 2P2AA 2YPNA 4OFJA 1URDA 3OOAA 3O2AA 4THIA 1JEVA 2D3IA 3K0VA 5FHOA 3U72A 2XD3A 4QFOA 5B70A 1P1UA 4YKJA 2HEUA 4PFUA 2Y7WA 3MQ9A 2Q2AA 3P7IA 4WXJA 4X9TA 3B7DA 5H8HA 4ZZAA 3WAEA 3U8QA 5AA2D 5AA4A 5CM6A 5I57A 1LLSA 4OFLA 4JWOA 5IKBA 2XXRA 2PYYA 4WEDA 4EQBA 5DVJA 2QS3A 4RK2A 1MRPA 1MXXA 4HTGA 5F7VA 3TTRA 4IY6A 3PMXA 3TFLA 1USYH 1LBBA 1B7ZA 3CR9A 3IO6A 3HN0A 2X26A 2UVHA 1DOTA 2Y84A 3F11A 3HV1A 3PPQA 4H1XA 1GGGA 3LSWA 1I69A 5I56A 2XXQA 1B32A 1UTBA 2REJA 1MDQA 1S9TA 1XS5A 2CZLA 3IAZA 3N5LA 4U4SA 2F36A 5H8QB 2H4IA 4X48A 1Y1MA 3KGCA 1IXIA 5EYFA 4FAJA 3T66A 4ZEDA 1LFGA 1LCTA 1N3XA 1QUKA 5CBSA 5I58B 3EHUA 3DP4A 3SDFA 5AA2A 4F3GA 1QUIA 2I0CA 4R9FA 1FQEA 4ZE9A 1NNTA 4UA8A 1B0LA 1OLCA 2AL5A 1A54A 3N6UA 4G68A 3S2VA 1JVYA 3O9PA 4XTCQ 2O51A 3GLBA 3PPPA 4JWXA 4U22A
chains in the Genus database with same CATH superfamily
4I9DA 3R26A 4F1UA 2L5VA 4KHZE 1MH4A 4JB7A 2ESNA 5B7DA 4PCDA 3EN3A 4PE5B 4JDFA 5ET6A 1N04A 2ZMBA 3MYUA 3DP8A 1JW5A 1F9BA 5ET8A 2F6GA 2FIXA 3IOVA 4H8IA 4OERA 4O7IA 3GBAA 4GBWA 1MM7A 5TP9B 2ONKE 1J1NA 4IO7A 1MQDA 3BFTA 2XXPA 2NUVA 1D9YA 4GL8A 5DEXB 2QMXA 3ZS6A 3VVDA 1UIVA 3MVYA 1NUWA 5I2KB 5I2NB 3ONMA 1FPIA 5AE4A 4I3EA 3CFLA 1SBPA 1ZJLA 4KYDA 3TUSA 2H5YA 1MDP1 3KBZA 1NFTA 3T96B 2ZYKA 1CB6A 2PFZA 1ZLQA 3CSBA 4PTKA 3IK6B 4POWA 3WAFA 4ZE8A 3Q26A 2Q8MA 4R74A 1DCUA 2DDKA 1ZU0A 3TCFA 4P0GA 4R72A 5CI5A 2PMSA 2I3VA 3H6WA 3MP6A 3KC1A 4XF5A 5I59B 3PD9A 2OWTA 3OO9A 4BDMA 4G61A 3RT8A 2KQZA 2G29A 3IOWA 5F24A 2WBDA 4JVDA 1MY3A 4MEVA 1A8FA 2QL3A 4P1LA 1IMAA 4F1VA 2OX3A 1RDZA 1MQJA 4O3BA 2DP8A 3ILTB 1IMEA 1OLAA 1MQIA 3RY3A 4FORA 4P47A 1LB9A 4NF4A 3SEUA 3H06B 4R6KA 3K1MA 1XT8A 2ZZXA 4JSDA 4F29A 4NE4A 5CMBA 3MSTA 3O97A 2ZYMA 2GHBA 3W15C 4GX3A 5H8SA 1MY1A 1MXZA 4MMPA 4OEVA 3TDJA 2F8DA 5EQAA 2XXHA 3BIHA 3T9HB 4RNSA 3TEPA 3D4CA 3QUJA 2PT2A 2B3FA 4LONB 4MNPA 3U65A 3U92A 3UORA 1B5JA 3KSXA 3FJGA 2WX9A 4XKPA 3H4ZA 3MW0A 3FXRA 4FEDA 2HFBA 3IL1B 4I1DA 2VPOA 5CMCA 3B6WA 1MXVA 2WBBA 5I84A 4GWUA 4H65A 4HE1A 3A3UA 4ESXA 1MXWA 1LB8A 3UK4A 4PBHA 2HPGA 3H7MA 1INPA 4NWDA 3T93B 5I56B 2XXTA 2RC7A 4NMYA 4YMAA 2UXAA 1MM6A 2HQ0A 1FJ9A 1R9LA 1GTKA 2O84X 2XWVA 1DMBA 2NOOA 5L9OA 3MP8A 4N8YA 4R2BA 1VFEA 5EYHA 1LBVA 3UIFA 5IZZA 1XVXA 1ZKBA 1RKMA 1NH8A 3UGWA 4L17A 1A55A 1NV0A 3K4UA 1NV3A 4NEDA 2FYIA 4QRZA 1AWBA 4ISUA 4I40A 4MNIA 3IJXB 4FBPA 1LAXA 4G2ZA 1TFDA 1R1NA 4UABA 4NAPA 3C31A 4OMBA 1B7UA 3FIRA 2PT1A 5DVIA 3KZGA 2PX1A 4TLMB 5EQ9A 2I4BA 4YMBA 4AS4A 5CBRA 3RNNA 3LC8A 1A8EA 1FBCA 1NUZA 4GWSA 1PB7A 2UYEA 4GX6A 1SDXA 3PPOA 5M2VA 2I6EA 2F5XA 5KZTA 2F3DA 4KYEA 5ELVA 4OXVA 2Z23A 4H0WA 2DVCA 5DT6A 2XXXA 4P11A 4EF1A 3IO4A 3T1BA 3MVZA 3LR1A 1XHYA 2P1SA 1AOVA 4GOTA 5AA1A 3TPAA 2OWZA 4N81A 2YLNA 1B46A 1B3FA 4MF3A 4K3FA 3HFUA 2QFLA 2AIXA 4N15A 4PP0A 2XX9A 4U2RA 1P1WA 4R73A 5H8NA 4PC9A 4LA9A 1GR2A 3TZAA 4Z0IA 1FPFA 2VPNA 3V8XB 2HXWA 3DM0A 2RKMA 3TMGA 4F3PA 2AL4A 3I5OA 2ZXTA 1PDAA 1USYE 1POY1 3SETA 5KDTA 3C9HA 2RCAA 2F35A 3NOHA 1OQGA 1SQYA 4FE8A 2IEEA 4F18A 1MPBA 1H43A 4OFJA 1URDA 3U72A 3K0VA 1P1UA 4X9TA 4ZZAA 3P7IA 5AA4A 5CM6A 3WAEA 5DW8A 1LLSA 1KA0A 1MXXA 2MKZA 3TTRA 3PMXA 3TFLA 4JWYA 2X26A 2UVHA 1DOTA 1LBYA 1I69A 1S9TA 1XS5A 2CZLA 3IAZA 3N5LA 5ICQA 4X48A 1Y1MA 1LFGA 1FJ6A 5AA2A 1QUIA 1B0LA 1OLCA 3S2VA 4XTCQ 3PPPA 4JWXA 5TPAB 3TTKA 5HPQA 1N76A 3OO7A 3PMWA 4YKKA 1LBCA 4GF8A 4XXUA 4F3BA 4PF6A 1AMFA 5CMKA 3H6UA 3HHGA 3QSLA 4G68C 2DWIA 3A09A 3CHGA 1MH3A 3D4GA 5H8NB 1FTKA 3S9NC 3H6VA 3GYYA 4R6YA 4IGTA 1PC3A 2XXVA 3JV9A 1EYIA 4KPTA 4WKMA 4I8CA 4GWWA 4X1DA 4NF6A 4G8NA 1FBPA 3Q25A 4Z7EA 4RY1A 1LBZA 3TYHA 5H8QA 2UVIA 4YKPA 4XIGQ 3MBPA 1IXCA 3B50A 4QSEA 1Y1ZA 1WODA 1WVJA 1QKBA 4C0RA 1MPCA 2DXRA 2F7AA 2R71A 4MCOA 1FTMA 3KN7A 2XWKA 3FUZA 4O3AA 4PDDA 1RDYA 4GWOA 1L5TA 4XFEA 2HHMA 3ODBA 3T22A 3TTNA 4LVQA 2Q9TA 2KLFA 4PDHA 3MPKA 5AA3A 1US5A 3OMBA 4O94A 1B4ZA 1PB8A 3MPLA 1JW1A 3OSRA 2O1LA 4MH5A 3H03A 2R6GE 2HAUA 3A29A 3E13X 2WEFA 5I2KA 5JEIA 2ZZWA 3G3FA 4AB5A 4QXDA 2V93A 1B3GA 1IMFA 4ZDMA 2VGQA 4LUBA 3IR1A 4F39A 1BIYA 1Y4TA 3M8UA 4U1ZA 2VT5A 4F2QA 5DTBA 1LSTA 2FIEA 4KCDA 4LQ2A 4DXUA 4ONYA 5JTYB 3CVGA 4PF8A 3S9MC 3SKPA 1IIWA 1VDWA 1FPLA 1K9ZA 2H98A 3FATA 3QIMA 4AQ4A 2O7UA 4OESA 1TT1A 2RC9A 3KN8A 2PCRA 3TODA 3CFZA 1B4HA 1B3EA 5L8DA 2VD2A 2WYPA 3SEWA 4NF5B 1JQFA 4FEBA 4RPNA 1NV4A 4X1BA 4G4PA 1Y9UA 4YB6A 1M5DA 1QUJA 4F22A 1Y20A 1BTJA 5FTIA 1R6ZA 3UA8A 1VSOA 3E9XA 1JW4A 3ZKLA 4X04A 1TXFA 4ND9A 3S9LC 5BUUA 2F7BA 2A5TB 1SW2A 4LATA 4H45A 3FBPA 3R6UA 4C1TA 1I6AA 4G77A 1JVXA 4I3YA 4KCCA 3R7XA 1MY0A 5A5LA 2GRVA 1SD3A 1B5HA 3KEIA 2PBWA 3T9XB 5DEXA 4XKRA 1KWHA 3AXFA 3CSGA 4FECA 1SYHA 2VD3A 3ROJA 4DCYA 2HAVA 4R6HA 4EQ9A 1OVBA 5FHMA 4ZEKA 3QAXA 2WKYA 3TTMA 3PGFA 2QSXA 1OIBA 4U21A 3M3LA 1YTVA 3Q27A 3VLVA 2I3WA 1SVXB 4C1UA 3TKDA 1SPIA 4IO4A 1FPDA 3C36A 3RPLA 4N6KA 2DOJA 5EQ7A 3DP6A 4AB6A 2OCUA 4F19A 4N07A 4QF9A 4ZEFA 4MLQA 3GZGA 2V3TA 2XXWA 1P1NA 4MX6A 1A99A 1OMPA 4BDOA 3T9VA 4E0WA 2FNCA 3RQTA 1XOCA 3EPEA 2GH9A 3O29A 4OYVA 4EXLA 2HZLA 3HHFA 5HM4B 2AYSA 1FPGA 3FGSA 4OTEA 2QS2A 3E4RA 1IQ7A 2DE2A 5I58A 3G3HA 4XEQA 3IFAA 3O6GA 1O63A 4YZZA 4R2FA 1H44A 3JZJA 1HSLA 1Z7NE 1O7TA 3EHSA 4ELRA 3BKIB 3N26A 5I57B 1BP5A 4BDQA 3QXMA 2H25A 3MC2A 3IOUA 5H8HB 5IZ3B 1YPNA 1B2HA 5J16A 1JETA 2F34A 4GLIA 4DXBA 4P9KA 1NV2A 1SYIA 1BKAA 3V83A 4QFNA 3E78A 5I5PA 4PBQA 3QUFA 2I48A 3FVKA 1EZPA 3TAJA 2R9JA 3K1NA 1UTHA 1M5BA 3CRBA 4IB2A 5TP9A 4GL0A 1QJMA 5FTHA 2OBGA 3PTYA 3JYRA 5FHNA 3RYDA 2P2AA 3OOAA 5B70A 2HEUA 4WXJA 3B7DA 3U8QA 5IKBA 4IR8A 2QS3A 4IY6A 1USYH 4HE2A 1FPKA 4F3GA 3HV1A 4H1XA 4AS5A 1B32A 1UTBA 3VFJA 5H8QB 4F3SA 4ZEDA 1BK4A 1IXIA 1YZ0A 1N3XA 4MJOA 1QUKA 3SDFA 4ZE9A 4UA8A 1FPJA 2O51A 4QFOA 2HCAA 3H6TA 3S4UA 1A40A 4OETA 4ZS9A 3IB1A 4P1EA 1XVYA 3FXUA 4NX1A 2OWSA 2NXOA 1HSEA 4XKNA 3G3GA 1B3LA 4BDRA 2Q89A 5H8FB 2UVGA 3OEMA 1FSAA 5KCJA 1UTHB 1H76A 3PMVA 4YICA 3HO7A 3FXQA 1IMDA 3FVNA 3Q28A 4GQOA 4OVQA 5ICTA 4U1OA 2G93A 4PGPA 4O7MA 1GVCA 1B6HA 2RC8A 3TTLA 4HS7A 2ZNSA 3W9WA 4PQJA 3U93A 4PFYA 3OO6A 3FV1A 2XX8A 3BFUA 3EF7A 5I2NA 5AA2B 1JP4A 4OVTA 3OO8A 1I6BA 3CFXA 4N6DA 2GHAA 1SW4A 2F3BA 4F1YA 2CMOA 2GQ1A 5IGAA 2I0BA 2Y5KA 4DIGA 4U23A 5I7IA 1ZIUA 3SERA 2FVZA 3KSJA 1UTBB 4MFIA 5IZ3A 3TELA 2V3QA 4EUOA 1MY4A 4TOZA 4YB5A 4OWDA 5FBPA 1URSA 4QSDA 4H46A 1IXGA 1CE2A 3I6VA 4N91A 3RN8A 4ESWA 3VXCA 5TPAA 3IJOB 2ABHA 1SW5A 2CZHA 2V3UA 4N13A 3SEYA 2ONRA 4Q5TA 3N6TA 4OZ9A 3MP1A 4BLAA 3FVGA 3ECRA 4GWYA 1KA1A 3K6WA 4PGNA 1RDXA 1B3HA 4PAIA 4GX4A 4MAGA 1ZBMA 3FVOA 3K6XA 4P56A 1ZTYA 1PBQA 3RUMA 1YYZA 1II5A 4HE0A 2QJEA 2X7QA 2Z8DA 1SI0A 2I49A 3C4MA 5HBCA 4QSCA 2OJTA 2XWOA 1IXHA 5ESYA 2DXYA 3IFCA 3B8BA 2M8CA 1S7YA 3VDFA 2DQVA 4U4XA 3OEKA 4QFPA 1A7LA 1DTZA 4N8GA 2XXKA 1B5IA 4PFRA 3B6QA 2XHDA 1XC1A 1IMCA 1D3KA 4OVSA 5I3SA 1TFAA 3G7WA 2D5WA 4PFIA 3H3GA 5ITPA 1US4A 3KC0A 2Q88A 3W9VA 2B65A 4JVIA 5TU0A 4GVOA 3HCQA 1Q1KA 4IGRA 2B4LA 3O28A 4H67A 3KFMA 1FBDA 4R75A 4NF0A 5K2YA 1FTJA 1ZMGA 3V5AA 4ELPA 1B51A 4P8BA 4PAFA 4YAHX 4ZEBA 2Q2CA 2RCBA 3QYTA 3FJ7A 5L9MA 4MNCA 1LCFA 3THIA 5AA4B 2ANJA 2CEYA 3G3KA 2XXYA 2QPQA 4ZEIA 3KOTA 2H99A 2Q74A 1P99A 2D21A 1ELJA 3IORA 1FQDA 3CI8A 1AH5A 1NV7A 2F97A 1B05A 2QVVA 1FTOA 4PE3A 2NWJA 4OFOA 1MS7A 1MXYA 1D9QA 2YJPA 4KR5A 1SW1A 3PUXE 4NG7A 1DTGA 3O6IA 4M4GA 4UACA 2HZKA 3GXAA 4RYAA 1EZOA 4FJPA 5BWJA 5DYHA 3SZPA 1QKAA 3CG1A 1FPBA 2B4MA 2Z8FA 3VXBA 4OANA 2Q8JA 4E0XA 4GBVA 3G3JA 3U1OA 2I58A 2OZZA 3GBBA 5LTCA 2Y7KA 3M3KA 2LAOA 1BLFA 4DE8A 1TWYA 2R8TA 2F7CA 1HSJA 4LZ8A 1AIVA 3VVFA 3TQLA 2ZYOA 1I6QA 3FASA 1FCKA 4GRKA 3CIJA 1NNFA 4I62A 4P0IA 3C34A 1Y4CA 2QRYA 2UVJA 2ALUA 1GV8A 3K00A 4IO5A 2HXRA 5CMMA 4NN3A 1Y3QA 3VVEA 2QVRA 2VHAA 2XXUA 3PPNA 4QHQA 2ZZVA 4JXIA 4OVRA 3K01A 2F6PA 1D4NA 5KDTB 3C33A 5ISUA 1FW0A 4YKIA 4NTLA 2ZNTA 4IO2A 3Q29A 1IZ1A 2DVZA 4EQ7A 3VLWA 1S50A 1B40A 4PFWA 4LZ7A 2GFEA 4NF8B 4NF4B 1B58A 2WYKA 5ET5A 1FQCA 1OQHA 5J1DA 1NV5A 5ET7A 3S9EA 4KQPA 4RXLA 5IM2A 2PFYA 1B1XA 2FHYA 1FBGA 1N0TA 4GWZA 3OELA 3ISPA 4DCXA 4RK9A 2DWAA 1RYXA 3KOSA 4LZ5A 2NVUB 4NWCA 5L9SA 1SI1A 5EYGA 2Y7IA 4MLVA 4ZECA 4ECFA 1EYJA 1LBXA 1PBPA 4Q0CA 2XXIA 3E79A 2UYFA 2Z22A 3RPLB 1K9YA 4OQOA 1LAFE 3RTWB 3KJ7A 4KD5A 1JEVA 2D3IA 5FHOA 2XD3A 4PFUA 2Y7WA 3MQ9A 2Q2AA 5H8HA 5AA2D 5I57A 4OFLA 4JWOA 2PYYA 4WEDA 4EQBA 5DVJA 4HTGA 4QBAA 1LBBA 1B7ZA 2Y84A 1GGGA 1FBHA 5I56A 2CZKA 2REJA 1MDQA 4U4SA 5I58B 5CBSA 4MIJA 3DP4A 4R9FA 1FQEA 3N6UA 1JVYA 3O9PA 2PVUA 2O6AA 2IA4A 4HXVA 1VR5A 4H5FA 3L6HA 3BIGA 4EDPA 5LOMA 3MWBA 4HCYA 2OK2A 4DI4B 1DK4A 1N84A 3PPRA 2A5TA 1FRPA 4IO3A 2I4CA 3BBRA 3G3IA 2BJIA 2X7PA 3PUZE 1XI6A 1AL3A 1EU8A 1LAHE 4DLDA 3LSLA 5T3JA 4NF5A 3ILUB 1Q9DA 3KJTA 1LBWA 4DXCA 2W7YA 4GWXA 3K02A 3MJNA 1G0IA 4R9GA 3K2DA 1PEBA 3LSXA 3K6UA 1MQHA 3CG3A 4F2OA 1B9JA 4KI0E 5IZ1A 4Q8RA 1M5CA 1Q35A 3DLNA 2DYXA 3VE1B 3U94A 3I3VA 4QFLA 1LFIA 3FJMA 1B0HA 3D1RA 1FBFA 5LDZA 4ELQA 2THIA 1B52A 4NGUA 3DELB 3PUWE 3RLFE 3RT6B 3KN3A 2FBPA 3IX1A 3FD3A 2P0SA 4KYSA 1FQAA 4OEUA 1FQFA 4GIZA 1MQGA 3T0JA 3K6VA 2XD2A 4FIMA 2XWIA 5DVFA 2DS9A 1NH7A 2OLBA 4FATA 1Y3NA 4MBPA 2XA5A 4TQUQ 1LGBC 3MVWA 2Z8EA 1Y3PA 5JK4A 3SEVA 3MZBA 4EF2A 1PB9A 4X8RA 2B3BA 1FTLA 1H45A 3OSQA 5EHSA 4YB7A 2H9BA 1LEVA 3C32A 4GXSB 1P1QA 1QW0A 4G8HA 4GFRA 1QVSA 2QMWA 3B6TA 2F78A 1OVTA 3LUZA 1D9VA 2ZNUA 3C35A 2KR0A 3PUVE 5EQ8A 3KG2A 2O1MA 4KFQA 3SEXA 4O3CA 4RPOA 1NV6A 1VFDA 4RA1A 3USDA 2QS1A 5K2XA 3LBSA 4ELOA 1Z7ME 4P3LA 1EYKA 3RPWA 1POTA 3LSFB 3O6HA 1FQBA 5CC2A 1M5EA 2O69A 1FTAA 4PETA 1IUDA 1N7WA 3A3CA 3EKIA 3FV2A 1KZ8A 3T9UA 3OD7A 1NUYA 1B1HA 3V89B 2QS4A 4NF8A 3L6GA 3PUYE 1EH3A 1IITA 1ATGA 2O7IA 5I59A 4YU0A 1NL5A 4IO6A 1JEUA 4LQ5A 4ZZEA 2Y7PA 3UN6A 4BDNA 3KBRA 1LFHA 4PFBA 4MHFA 2V4CA 1R9QA 1CNQA 4PFTA 2ONSA 1NI9A 4DI3D 1YXIA 1VE4A 2CEXA 3MUQA 1YAEA 3O66A 4RJZA 2A5SA 4BDLA 1JNFA 3IB2A 3MZ9A 3TQWA 4DDDA 3PD8A 2VOZA 1O64A 1P1OA 5A5XB 1NNPA 4N17A 1URGA 1DPPA 4OENA 2RINA 2JJKA 4DZ1A 4WEPA 1IEJA 4JBZA 5CRYA 1MPDA 3FZVA 3UP9A 4H6DA 2DE4A 3HPIA 3EHTA 4H8JA 2XX7A 5H8FA 5F1QA 2V84A 4GD5A 4IY5A 2Y5LA 3TCGA 4G8MA 4HW8A 4OVPA 1MXUA 1ANFA 4NHBA 1NKXA 1QULA 4PAKA 2VP1A 2DE3A 3M3FA 3QMFA 4NF6B 1UIUA 3IOTA 4N4UA 4F31B 4LN5A 1MG1A 3EQ1A 4G68B 4GXAA 3VLUA 1G0HA 5JTYA 2RF1A 3MAMA 3LUYA 3MZ1A 2DWHA 4POXA 1NUXA 2DWJA 1NMUA 1M5FA 1B7HA 3QK6A 2BJJX 3E3KA 3VV5A 3TCHA 3ZSFA 1DBZA 4JVCA 4QFKA 2E0SA 3RGYA 2P3NA 5IAIA 1H3DA 4HCWA 2Y7RA 4JSOA 3N94A 2DSFA 3ZKKA 1N3WA 3OXNA 2REGA 3SESA 1UQWA 1WDNA 1YCJA 4LP2B 1N7XA 3RTFB 5A5XA 2E1SA 2QVUA 4NQ8A 3K1PA 3IB0A 4Q30B 1DSNA 2O68A 1RYOA 4KXPA 2V25A 4M1VA 4OA4A 1DPEA 4N6PA 3MVXA 4H5GA 3FXBA 5ITOA 2FA7A 4EXKA 3OENA 5EHMA 3HSTA 1FPEA 1NNKA 4TLLB 4OHNA 3LV0A 2P3VA 1EZ9A 1LAGE 3PU5A 2ZYNA 4OVJA 1MY2A 1QGXA 3PV0E 4XKQA 2YPNA 3O2AA 4THIA 4YKJA 2XXRA 1FBEA 4RK2A 1MRPA 5F7VA 1IMBA 3IO6A 3CR9A 2CZIA 3HN0A 3F11A 3PPQA 3LSWA 2XXQA 4FAJA 2F36A 2H4IA 3KGCA 5EYFA 3T66A 1LCTA 1NV1A 3EHUA 4O8MA 2I0CA 1NNTA 2AL5A 1A54A 4G68A 3GLBA 1T0KA 5KCJB 4U22A
chains in the Genus database with same CATH topology
5TPAB 3TTKA 5HPQA 2PVUA 3R26A 2O6AA 4I9DA 1N76A 3OO7A 4F1UA 2IA4A 3PMWA 4YKKA 5ICQA 2HCAA 3H6TA 1LBCA 1VR5A 4GF8A 4XXUA 4KHZE 1MH4A 1A40A 4H5FA 3L6HA 4JB7A 4OETA 4ZS9A 2ESNA 3IB1A 4F3BA 5B7DA 1AOVA 4EDPA 1AMFA 3EN3A 5LOMA 4PE5B 3MWBA 4HCYA 1N04A 4JDFA 2ZMBA 2OK2A 1XVYA 4YB6A 3H6UA 5CMKA 3DP8A 1JW5A 3FXUA 1F9BA 1N84A 2F6GA 2A5TA 3IOVA 2OWSA 3PPRA 4H8IA 3HHGA 4IO3A 3QSLA 4G68C 2DWIA 4OERA 4F3SA 2NXOA 1HSEA 3GBAA 3A09A 2I4CA 3BBRA 1MH3A 4XKNA 3D4GA 3G3IA 3G3GA 1B3LA 1MM7A 4BDRA 5H8NB 2X7PA 5TP9B 2Q89A 5H8FB 1FTKA 2ONKE 2UVGA 1J1NA 3OEMA 3PUZE 4IO7A 3H6VA 1MQDA 3S9NC 4R6YA 4IGTA 3BFTA 5KCJA 1UTHB 1AL3A 1H76A 2XXPA 3PMVA 1EU8A 2NUVA 1PC3A 1D9YA 4GL8A 4YICA 2XXVA 3JV9A 1LAHE 3HO7A 4KPTA 4DLDA 3LSLA 3FXQA 4WKMA 2QMXA 4I8CA 5DEXB 3ZS6A 3VVDA 4X1DA 1UIVA 4NF5A 3ILUB 4NF6A 3KJTA 3MVYA 5I2KB 3FVNA 4G8NA 2W7YA 3Q28A 4GQOA 3ONMA 3K02A 4DXCA 5I2NB 5ICTA 4U1OA 2G93A 3MJNA 3Q25A 4R9GA 4RY1A 3K2DA 1GVCA 1PEBA 3TYHA 4Z7EA 5H8QA 3LSXA 5AE4A 1B6HA 2UVIA 2RC8A 3TTLA 3CFLA 3K6UA 1SBPA 5KCJB 4YKPA 4HS7A 1ZJLA 2ZNSA 1MQHA 4KYDA 2H5YA 3TUSA 3CG3A 4F2OA 1B9JA 1MDP1 4XIGQ 4KI0E 3MBPA 3W9WA 1IXCA 4PQJA 4QSEA 1NFTA 1Y1ZA 3T96B 1M5CA 3U93A 4Q8RA 1Q35A 1WODA 1WVJA 4PFYA 3OO6A 3FV1A 2ZYKA 1CB6A 2XX8A 3DLNA 2DYXA 3VE1B 1ZLQA 3VFJA 3CSBA 3BFUA 3EF7A 1QKBA 3IK6B 4POWA 3U94A 4C0RA 3I3VA 4ZE8A 1MPCA 2DXRA 2F7AA 3Q26A 3WAFA 5AA2B 4R74A 4QFLA 5I2NA 2R71A 1LFIA 1FTMA 3KN7A 3FJMA 3FUZA 1ZU0A 3OO8A 1B0HA 3TCFA 1I6BA 3CFXA 4P0GA 4R72A 5CI5A 4O3AA 2PMSA 2GHAA 2I3VA 1SW4A 4GWOA 3H6WA 1L5TA 3MP6A 4F1YA 2CMOA 5I59B 4ELQA 2THIA 1B52A 2I0BA 4JWYA 3PD9A 4DIGA 2OWTA 3OO9A 3ODBA 4BDMA 4U23A 3RT8A 1ZIUA 3SERA 3DELB 3T22A 3TTNA 3PUWE 3RLFE 3KSJA 2G29A 3IOWA 4LVQA 3RT6B 1UTBB 4MFIA 5IAIA 3KN3A 2Q9TA 3TELA 2V3QA 1MY3A 4EUOA 1MY4A 4TOZA 2KLFA 4YB5A 3IX1A 4OWDA 1A8FA 3FD3A 2P0SA 2QL3A 4KYSA 1FQAA 4OEUA 3MPKA 5AA3A 4F1VA 1URSA 1FQFA 1US5A 4GIZA 4QSDA 1MQGA 1IXGA 1MQJA 1CE2A 3OMBA 4O3BA 3K6VA 2DP8A 2XD2A 4FIMA 3ILTB 1B4ZA 1PB8A 3MPLA 1JW1A 3OSRA 2O1LA 3I6VA 3H03A 4MH5A 3RN8A 3VXCA 5TPAA 4ESWA 3IJOB 1OLAA 2ABHA 5DVFA 1SW5A 1NH7A 1MQIA 2DS9A 2R6GE 2V3UA 2HAUA 3RY3A 2OLBA 3E13X 4FORA 4FATA 4N13A 3SEYA 2ONRA 1Y3NA 4MBPA 4Q5TA 1LB9A 3N6TA 4NF4A 5I2KA 5JEIA 4OZ9A 3MP1A 4TQUQ 4BLAA 3FVGA 3H06B 3ECRA 3G3FA 4R6KA 3SEUA 1LGBC 3MVWA 2Z8EA 3K1MA 3K6WA 4AB5A 1XT8A 1Y3PA 5JK4A 3SEVA 3MZBA 4JSDA 1PB9A 4EF2A 2V93A 4F29A 2B3BA 4NE4A 5CMBA 1B3GA 1B3HA 1FTLA 3O97A 2ZYMA 4ZDMA 1H45A 1ZBMA 2GHBA 2VGQA 3FVOA 1ZTYA 1MY1A 3K6XA 1PBQA 1MXZA 3OSQA 4LUBA 3RUMA 1II5A 3IR1A 4F39A 5EHSA 2QJEA 2X7QA 4YB7A 1BIYA 2Z8DA 4OEVA 3TDJA 1SI0A 1Y4TA 2F8DA 2I49A 2H9BA 3C4MA 2XXHA 2OJTA 3C32A 3M8UA 4QSCA 4GXSB 1P1QA 4U1ZA 1IXHA 1QW0A 2DXYA 4G8HA 4RNSA 4GFRA 3T9HB 3TEPA 1QVSA 2QMWA 4F2QA 3B6TA 3D4CA 2F78A 5DTBA 1OVTA 2M8CA 1LSTA 1S7YA 1D9VA 2ZNUA 3C35A 3VDFA 3QUJA 4KCDA 2PT2A 3PUVE 2DQVA 2B3FA 4LONB 3KG2A 3OEKA 2O1MA 4LQ2A 1A7LA 1DTZA 4KFQA 4ONYA 4QFPA 5JTYB 3U92A 3UORA 3SEXA 1B5IA 1B5JA 3CVGA 5H8SA 3KSXA 4O3CA 4RPOA 3S9MC 3SKPA 1VFDA 4RA1A 3USDA 3B6QA 2QS1A 3FJGA 5K2XA 2XHDA 1IIWA 1XC1A 3LBSA 4XKPA 1D3KA 3H4ZA 3MW0A 4ELOA 1Z7ME 1TFAA 3FXRA 3RPWA 4FEDA 2H98A 3G7WA 2D5WA 2HFBA 3FATA 3IL1B 1POTA 3QIMA 4I1DA 3LSFB 3O6HA 1FQBA 5HBCA 3H3GA 4AQ4A 5CC2A 5ITPA 1M5EA 2O69A 5CMCA 2O7UA 4OESA 1TT1A 3B6WA 1US4A 1MXVA 2Q88A 2RC9A 3W9VA 4PETA 3TPAA 3KN8A 2B65A 1IUDA 1N7WA 3A3CA 4H65A 5I84A 3A3UA 4ESXA 5TU0A 4GVOA 3TODA 3FV2A 3CFZA 3HCQA 1Q1KA 4IGRA 1B4HA 3T9UA 1MXWA 3OD7A 1B3EA 3O28A 1LB8A 1B1HA 4H67A 5L8DA 2VD2A 3KFMA 3V89B 3UK4A 4R75A 2QS4A 4NF8A 5K2YA 3SEWA 3H7MA 4NWDA 1FTJA 4NF5B 3L6GA 1JQFA 3T93B 4FEBA 4RPNA 1ZMGA 3V5AA 4ELPA 1B51A 5I56B 3PUYE 1EH3A 1IITA 1ATGA 2O7IA 4G4PA 4X1BA 2Q2CA 1Y9UA 2XXTA 4YAHX 2RC7A 2RCBA 4YU0A 4ZEBA 4NMYA 1NL5A 1M5DA 1QUJA 1JEUA 1MM6A 2HQ0A 2UXAA 1Y20A 2Y7PA 3KBRA 3QYTA 4LQ5A 3FJ7A 3UN6A 4BDNA 1BTJA 1LFHA 5FTIA 1R6ZA 3UA8A 5L9MA 1R9QA 1VSOA 1R9LA 1T0KA 1GTKA 4PFTA 3E9XA 1LCFA 2ONSA 1JW4A 3ZKLA 2O84X 1VE4A 3THIA 1DMBA 2NOOA 5AA4B 1TXFA 4ND9A 3S9LC 2ANJA 5BUUA 3MUQA 1YAEA 3G3KA 5L9OA 2XXYA 2F7BA 2A5TB 2QPQA 4ZEIA 1SW2A 3KOTA 3MP8A 2H99A 4LATA 4R2BA 3R6UA 1P99A 3O66A 1VFEA 4C1TA 1I6AA 4G77A 1JVXA 2D21A 1ELJA 3IORA 3UIFA 1FQDA 4RJZA 2A5SA 4KCCA 1MY0A 3R7XA 4BDLA 1XVXA 1JNFA 2GRVA 1SD3A 3CI8A 3IB2A 1B5HA 1AH5A 3MZ9A 3KEIA 2F97A 2PBWA 3TQWA 1B05A 4DDDA 3T9XB 5DEXA 1FTOA 1ZKBA 2NWJA 3PD8A 4XKRA 4OFOA 1RKMA 1KWHA 1MS7A 1NH8A 2VOZA 1O64A 1P1OA 3AXFA 1MXYA 3UGWA 4L17A 3CSGA 5A5XB 4FECA 1NNPA 1A55A 2YJPA 4KR5A 1SW1A 3PUXE 3K4UA 1SYHA 1DTGA 3O6IA 4M4GA 1URGA 1DPPA 2VD3A 2RINA 4OENA 4ZZEA 4DCYA 4DZ1A 4UACA 2HZKA 3GXAA 4RYAA 1EZOA 4WEPA 4FJPA 4NEDA 2FYIA 5BWJA 1IEJA 4JBZA 4QRZA 3S4UA 2HAVA 5CRYA 5DYHA 4ISUA 4R6HA 1QKAA 3CG1A 3IJXB 1MPDA 4EQ9A 1OVBA 5FHMA 2Z8FA 4ZEKA 3FZVA 1LAXA 3QAXA 2WKYA 4H6DA 3TTMA 2DE4A 3PGFA 3UP9A 3HPIA 3VXBA 3EHTA 4G2ZA 2Q8JA 1TFDA 2QSXA 1OIBA 1R1NA 4H8JA 3G3JA 4U21A 4E0XA 3U1OA 2I58A 2XX7A 3C31A 2OZZA 3GBBA 4OMBA 5H8FA 2Y7KA 1B7UA 3M3KA 2LAOA 3M3LA 5F1QA 2V84A 1YTVA 3Q27A 1BLFA 4GD5A 3FIRA 4DE8A 2PT1A 4IY5A 2I3WA 1SVXB 5DVIA 3VLVA 3TKDA 4C1UA 1TWYA 3KZGA 2PX1A 4IO4A 3TCGA 4G8MA 3C36A 2F7CA 4HW8A 1HSJA 1MXUA 4TLMB 4LZ8A 2I4BA 1AIVA 2DOJA 3VVFA 3DP6A 4AB6A 2OCUA 4F19A 1ANFA 4YMBA 3TQLA 2ZYOA 1NKXA 1QULA 2VP1A 2DE3A 1I6QA 3FASA 3M3FA 5CBRA 1FCKA 4NF6B 4GRKA 4N07A 3RNNA 3CIJA 4QF9A 4ZEFA 1NNFA 4U4XA 4I62A 1UIUA 3GZGA 4MLQA 3IOTA 4P0IA 2V3TA 2XXWA 3C34A 4F31B 1MG1A 1Y4CA 2QRYA 2UVJA 3EQ1A 2ALUA 5I59A 4G68B 3LC8A 1A8EA 3K00A 1P1NA 4GXAA 1GV8A 3VLUA 5JTYA 4IO5A 2RF1A 3MAMA 1A99A 1OMPA 4BDOA 3LUYA 3MZ1A 2DWHA 4POXA 5CMMA 3T9VA 2DWJA 1PB7A 2UYEA 1Y3QA 3VVEA 4E0WA 1NMUA 1SDXA 3PPOA 1M5FA 2FNCA 1B7HA 2I6EA 2VHAA 2XXUA 3QK6A 5M2VA 3PPNA 4QHQA 2F5XA 4JXIA 2BJJX 3E3KA 3RQTA 3TCHA 3VV5A 5KZTA 3ZSFA 1XOCA 3K01A 2F6PA 1D4NA 3EPEA 4KYEA 2Z23A 4OXVA 5ELVA 5KDTB 4QFKA 3C33A 2GH9A 4H0WA 1FW0A 3O29A 4NTLA 4OYVA 4YKIA 4EXLA 5ISUA 2DVCA 2HZLA 5DT6A 2ZNTA 3HHFA 2XXXA 2E0SA 4IO2A 4P11A 3W15C 3RGYA 5HM4B 2AYSA 4EF1A 3IO4A 3FGSA 3Q29A 4OTEA 1IZ1A 2DVZA 3LR1A 3MVZA 1H3DA 4HCWA 2Y7RA 4JSOA 3VLWA 3N94A 2DSFA 3ZKKA 1S50A 1N3WA 1B40A 1XHYA 2P1SA 2QS2A 4GOTA 5AA1A 4PFWA 4LZ7A 3E4RA 3OXNA 2GFEA 2REGA 3SESA 4NF8B 4NF4B 2YLNA 1B58A 1UQWA 1IQ7A 1B3FA 1B46A 1WDNA 1YCJA 4LP2B 4MF3A 2DE2A 5I58A 1N7XA 4K3FA 3RTFB 3G3HA 1FQCA 1OQHA 3O6GA 5A5XA 1O63A 2E1SA 4YZZA 4R2FA 2AIXA 5J1DA 1H44A 3K1PA 3IB0A 4Q30B 1DSNA 2O68A 4PP0A 1RYOA 3JZJA 3S9EA 4KQPA 4RXLA 1HSLA 1Z7NE 2V25A 2XX9A 4U2RA 1O7TA 3EHSA 1P1WA 4M1VA 4ELRA 4EQ7A 4R73A 1DPEA 1B1XA 5H8NA 3BKIB 3N26A 4N6PA 3MVXA 5I57B 4IO6A 1BP5A 4BDQA 1N0TA 2H25A 3MC2A 3IOUA 3QXMA 4H5GA 5H8HB 1YPNA 1B2HA 5ITOA 4EXKA 2FA7A 4LA9A 3OENA 1JETA 2F34A 4GLIA 1GR2A 3OELA 4DXBA 5EHMA 4DCXA 3TZAA 3HSTA 1SYIA 4RK9A 2DWAA 1BKAA 3V83A 1RYXA 4QFNA 4Z0IA 3KOSA 4YMAA 3QUFA 2I48A 4LZ5A 2NVUB 3FVKA 4NWCA 1SI1A 5L9SA 1NNKA 4TLLB 1EZPA 3TAJA 3V8XB 2HXWA 3DM0A 4OHNA 2Y7IA 2R9JA 2RKMA 3K1NA 4MLVA 1UTHA 2AL4A 3TMGA 4ECFA 4F3PA 4ZECA 3I5OA 1EZ9A 2ZXTA 1PBPA 1M5BA 1LAGE 4Q0CA 1PDAA 3PU5A 2ZYNA 3CRBA 2XXIA 1USYE 4GL0A 1POY1 1QJMA 4IB2A 4OVJA 5TP9A 3SETA 4F22A 1MY2A 3C9HA 2UYFA 5KDTA 2Z22A 2RCAA 2F35A 5FTHA 1OQGA 1SQYA 2OBGA 4FE8A 2IEEA 4OQOA 1LAFE 3PV0E 3RTWB 3KJ7A 3JYRA 5FHNA 4F18A 1MPBA 4XKQA 4DXUA 4KD5A 1H43A 2P2AA 2YPNA 4OFJA 1URDA 3OOAA 3O2AA 4THIA 1JEVA 2D3IA 3K0VA 5FHOA 3U72A 2XD3A 4QFOA 5B70A 1P1UA 4YKJA 2HEUA 4PFUA 2Y7WA 3MQ9A 2Q2AA 3P7IA 4WXJA 4X9TA 3B7DA 5H8HA 4ZZAA 3WAEA 3U8QA 5AA2D 5AA4A 5CM6A 5I57A 1LLSA 4OFLA 4JWOA 5IKBA 2XXRA 2PYYA 4WEDA 4EQBA 5DVJA 2QS3A 4RK2A 1MRPA 1MXXA 4HTGA 5F7VA 3TTRA 4IY6A 3PMXA 3TFLA 1USYH 1LBBA 1B7ZA 3CR9A 3IO6A 3HN0A 2X26A 2UVHA 1DOTA 2Y84A 3F11A 3HV1A 3PPQA 4H1XA 1GGGA 3LSWA 1I69A 5I56A 2XXQA 1B32A 1UTBA 2REJA 1MDQA 1S9TA 1XS5A 2CZLA 3IAZA 3N5LA 4U4SA 2F36A 5H8QB 2H4IA 4X48A 1Y1MA 3KGCA 1IXIA 5EYFA 4FAJA 3T66A 4ZEDA 1LFGA 1LCTA 1N3XA 1QUKA 5CBSA 5I58B 3EHUA 3DP4A 3SDFA 5AA2A 4F3GA 1QUIA 2I0CA 4R9FA 1FQEA 4ZE9A 1NNTA 4UA8A 1B0LA 1OLCA 2AL5A 1A54A 3N6UA 4G68A 3S2VA 1JVYA 3O9PA 4XTCQ 2O51A 3GLBA 3PPPA 4JWXA 4U22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TPA B;  3TTK A;  5HPQ A;  2PVU A;  3R26 A;  2O6A A;  4I9D A;  1N76 A;  3OO7 A;  4F1U A;  2IA4 A;  3PMW A;  4YKK A;  5ICQ A;  2HCA A;  3H6T A;  1LBC A;  1VR5 A;  4GF8 A;  4XXU A;  4KHZ E;  1MH4 A;  1A40 A;  4H5F A;  3L6H A;  4JB7 A;  4OET A;  4ZS9 A;  2ESN A;  3IB1 A;  4F3B A;  5B7D A;  1AOV A;  4EDP A;  1AMF A;  3EN3 A;  5LOM A;  4PE5 B;  3MWB A;  4HCY A;  1N04 A;  4JDF A;  2ZMB A;  2OK2 A;  1XVY A;  4YB6 A;  3H6U A;  5CMK A;  3DP8 A;  1JW5 A;  3FXU A;  1F9B A;  1N84 A;  2F6G A;  2A5T A;  3IOV A;  2OWS A;  3PPR A;  4H8I A;  3HHG A;  4IO3 A;  3QSL A;  4G68 C;  2DWI A;  4OER A;  4F3S A;  2NXO A;  1HSE A;  3GBA A;  3A09 A;  2I4C A;  3BBR A;  1MH3 A;  4XKN A;  3D4G A;  3G3I A;  3G3G A;  1B3L A;  1MM7 A;  4BDR A;  5H8N B;  2X7P A;  5TP9 B;  2Q89 A;  5H8F B;  1FTK A;  2ONK E;  2UVG A;  1J1N A;  3OEM A;  3PUZ E;  4IO7 A;  3H6V A;  1MQD A;  3S9N C;  4R6Y A;  4IGT A;  3BFT A;  5KCJ A;  1UTH B;  1AL3 A;  1H76 A;  2XXP A;  3PMV A;  1EU8 A;  2NUV A;  1PC3 A;  1D9Y A;  4GL8 A;  4YIC A;  2XXV A;  3JV9 A;  1LAH E;  3HO7 A;  4KPT A;  4DLD A;  3LSL A;  3FXQ A;  4WKM A;  2QMX A;  4I8C A;  5DEX B;  3ZS6 A;  3VVD A;  4X1D A;  1UIV A;  4NF5 A;  3ILU B;  4NF6 A;  3KJT A;  3MVY A;  5I2K B;  3FVN A;  4G8N A;  2W7Y A;  3Q28 A;  4GQO A;  3ONM A;  3K02 A;  4DXC A;  5I2N B;  5ICT A;  4U1O A;  2G93 A;  3MJN A;  3Q25 A;  4R9G A;  4RY1 A;  3K2D A;  1GVC A;  1PEB A;  3TYH A;  4Z7E A;  5H8Q A;  3LSX A;  5AE4 A;  1B6H A;  2UVI A;  2RC8 A;  3TTL A;  3CFL A;  3K6U A;  1SBP A;  5KCJ B;  4YKP A;  4HS7 A;  1ZJL A;  2ZNS A;  1MQH A;  4KYD A;  2H5Y A;  3TUS A;  3CG3 A;  4F2O A;  1B9J A;  1MDP 1;  4XIG Q;  4KI0 E;  3MBP A;  3W9W A;  1IXC A;  4PQJ A;  4QSE A;  1NFT A;  1Y1Z A;  3T96 B;  1M5C A;  3U93 A;  4Q8R A;  1Q35 A;  1WOD A;  1WVJ A;  4PFY A;  3OO6 A;  3FV1 A;  2ZYK A;  1CB6 A;  2XX8 A;  3DLN A;  2DYX A;  3VE1 B;  1ZLQ A;  3VFJ A;  3CSB A;  3BFU A;  3EF7 A;  1QKB A;  3IK6 B;  4POW A;  3U94 A;  4C0R A;  3I3V A;  4ZE8 A;  1MPC A;  2DXR A;  2F7A A;  3Q26 A;  3WAF A;  5AA2 B;  4R74 A;  4QFL A;  5I2N A;  2R71 A;  1LFI A;  1FTM A;  3KN7 A;  3FJM A;  3FUZ A;  1ZU0 A;  3OO8 A;  1B0H A;  3TCF A;  1I6B A;  3CFX A;  4P0G A;  4R72 A;  5CI5 A;  4O3A A;  2PMS A;  2GHA A;  2I3V A;  1SW4 A;  4GWO A;  3H6W A;  1L5T A;  3MP6 A;  4F1Y A;  2CMO A;  5I59 B;  4ELQ A;  2THI A;  1B52 A;  2I0B A;  4JWY A;  3PD9 A;  4DIG A;  2OWT A;  3OO9 A;  3ODB A;  4BDM A;  4U23 A;  3RT8 A;  1ZIU A;  3SER A;  3DEL B;  3T22 A;  3TTN A;  3PUW E;  3RLF E;  3KSJ A;  2G29 A;  3IOW A;  4LVQ A;  3RT6 B;  1UTB B;  4MFI A;  5IAI A;  3KN3 A;  2Q9T A;  3TEL A;  2V3Q A;  1MY3 A;  4EUO A;  1MY4 A;  4TOZ A;  2KLF A;  4YB5 A;  3IX1 A;  4OWD A;  1A8F A;  3FD3 A;  2P0S A;  2QL3 A;  4KYS A;  1FQA A;  4OEU A;  3MPK A;  5AA3 A;  4F1V A;  1URS A;  1FQF A;  1US5 A;  4GIZ A;  4QSD A;  1MQG A;  1IXG A;  1MQJ A;  1CE2 A;  3OMB A;  4O3B A;  3K6V A;  2DP8 A;  2XD2 A;  4FIM A;  3ILT B;  1B4Z A;  1PB8 A;  3MPL A;  1JW1 A;  3OSR A;  2O1L A;  3I6V A;  3H03 A;  4MH5 A;  3RN8 A;  3VXC A;  5TPA A;  4ESW A;  3IJO B;  1OLA A;  2ABH A;  5DVF A;  1SW5 A;  1NH7 A;  1MQI A;  2DS9 A;  2R6G E;  2V3U A;  2HAU A;  3RY3 A;  2OLB A;  3E13 X;  4FOR A;  4FAT A;  4N13 A;  3SEY A;  2ONR A;  1Y3N A;  4MBP A;  4Q5T A;  1LB9 A;  3N6T A;  4NF4 A;  5I2K A;  5JEI A;  4OZ9 A;  3MP1 A;  4TQU Q;  4BLA A;  3FVG A;  3H06 B;  3ECR A;  3G3F A;  4R6K A;  3SEU A;  1LGB C;  3MVW A;  2Z8E A;  3K1M A;  3K6W A;  4AB5 A;  1XT8 A;  1Y3P A;  5JK4 A;  3SEV A;  3MZB A;  4JSD A;  1PB9 A;  4EF2 A;  2V93 A;  4F29 A;  2B3B A;  4NE4 A;  5CMB A;  1B3G A;  1B3H A;  1FTL A;  3O97 A;  2ZYM A;  4ZDM A;  1H45 A;  1ZBM A;  2GHB A;  2VGQ A;  3FVO A;  1ZTY A;  1MY1 A;  3K6X A;  1PBQ A;  1MXZ A;  3OSQ A;  4LUB A;  3RUM A;  1II5 A;  3IR1 A;  4F39 A;  5EHS A;  2QJE A;  2X7Q A;  4YB7 A;  1BIY A;  2Z8D A;  4OEV A;  3TDJ A;  1SI0 A;  1Y4T A;  2F8D A;  2I49 A;  2H9B A;  3C4M A;  2XXH A;  2OJT A;  3C32 A;  3M8U A;  4QSC A;  4GXS B;  1P1Q A;  4U1Z A;  1IXH A;  1QW0 A;  2DXY A;  4G8H A;  4RNS A;  4GFR A;  3T9H B;  3TEP A;  1QVS A;  2QMW A;  4F2Q A;  3B6T A;  3D4C A;  2F78 A;  5DTB A;  1OVT A;  2M8C A;  1LST A;  1S7Y A;  1D9V A;  2ZNU A;  3C35 A;  3VDF A;  3QUJ A;  4KCD A;  2PT2 A;  3PUV E;  2DQV A;  2B3F A;  4LON B;  3KG2 A;  3OEK A;  2O1M A;  4LQ2 A;  1A7L A;  1DTZ A;  4KFQ A;  4ONY A;  4QFP A;  5JTY B;  3U92 A;  3UOR A;  3SEX A;  1B5I A;  1B5J A;  3CVG A;  5H8S A;  3KSX A;  4O3C A;  4RPO A;  3S9M C;  3SKP A;  1VFD A;  4RA1 A;  3USD A;  3B6Q A;  2QS1 A;  3FJG A;  5K2X A;  2XHD A;  1IIW A;  1XC1 A;  3LBS A;  4XKP A;  1D3K A;  3H4Z A;  3MW0 A;  4ELO A;  1Z7M E;  1TFA A;  3FXR A;  3RPW A;  4FED A;  2H98 A;  3G7W A;  2D5W A;  2HFB A;  3FAT A;  3IL1 B;  1POT A;  3QIM A;  4I1D A;  3LSF B;  3O6H A;  1FQB A;  5HBC A;  3H3G A;  4AQ4 A;  5CC2 A;  5ITP A;  1M5E A;  2O69 A;  5CMC A;  2O7U A;  4OES A;  1TT1 A;  3B6W A;  1US4 A;  1MXV A;  2Q88 A;  2RC9 A;  3W9V A;  4PET A;  3TPA A;  3KN8 A;  2B65 A;  1IUD A;  1N7W A;  3A3C A;  4H65 A;  5I84 A;  3A3U A;  4ESX A;  5TU0 A;  4GVO A;  3TOD A;  3FV2 A;  3CFZ A;  3HCQ A;  1Q1K A;  4IGR A;  1B4H A;  3T9U A;  1MXW A;  3OD7 A;  1B3E A;  3O28 A;  1LB8 A;  1B1H A;  4H67 A;  5L8D A;  2VD2 A;  3KFM A;  3V89 B;  3UK4 A;  4R75 A;  2QS4 A;  4NF8 A;  5K2Y A;  3SEW A;  3H7M A;  4NWD A;  1FTJ A;  4NF5 B;  3L6G A;  1JQF A;  3T93 B;  4FEB A;  4RPN A;  1ZMG A;  3V5A A;  4ELP A;  1B51 A;  5I56 B;  3PUY E;  1EH3 A;  1IIT A;  1ATG A;  2O7I A;  4G4P A;  4X1B A;  2Q2C A;  1Y9U A;  2XXT A;  4YAH X;  2RC7 A;  2RCB A;  4YU0 A;  4ZEB A;  4NMY A;  1NL5 A;  1M5D A;  1QUJ A;  1JEU A;  1MM6 A;  2HQ0 A;  2UXA A;  1Y20 A;  2Y7P A;  3KBR A;  3QYT A;  4LQ5 A;  3FJ7 A;  3UN6 A;  4BDN A;  1BTJ A;  1LFH A;  5FTI A;  1R6Z A;  3UA8 A;  5L9M A;  1R9Q A;  1VSO A;  1R9L A;  1T0K A;  1GTK A;  4PFT A;  3E9X A;  1LCF A;  2ONS A;  1JW4 A;  3ZKL A;  2O84 X;  1VE4 A;  3THI A;  1DMB A;  2NOO A;  5AA4 B;  1TXF A;  4ND9 A;  3S9L C;  2ANJ A;  5BUU A;  3MUQ A;  1YAE A;  3G3K A;  5L9O A;  2XXY A;  2F7B A;  2A5T B;  2QPQ A;  4ZEI A;  1SW2 A;  3KOT A;  3MP8 A;  2H99 A;  4LAT A;  4R2B A;  3R6U A;  1P99 A;  3O66 A;  1VFE A;  4C1T A;  1I6A A;  4G77 A;  1JVX A;  2D21 A;  1ELJ A;  3IOR A;  3UIF A;  1FQD A;  4RJZ A;  2A5S A;  4KCC A;  1MY0 A;  3R7X A;  4BDL A;  1XVX A;  1JNF A;  2GRV A;  1SD3 A;  3CI8 A;  3IB2 A;  1B5H A;  1AH5 A;  3MZ9 A;  3KEI A;  2F97 A;  2PBW A;  3TQW A;  1B05 A;  4DDD A;  3T9X B;  5DEX A;  1FTO A;  1ZKB A;  2NWJ A;  3PD8 A;  4XKR A;  4OFO A;  1RKM A;  1KWH A;  1MS7 A;  1NH8 A;  2VOZ A;  1O64 A;  1P1O A;  3AXF A;  1MXY A;  3UGW A;  4L17 A;  3CSG A;  5A5X B;  4FEC A;  1NNP A;  1A55 A;  2YJP A;  4KR5 A;  1SW1 A;  3PUX E;  3K4U A;  1SYH A;  1DTG A;  3O6I A;  4M4G A;  1URG A;  1DPP A;  2VD3 A;  2RIN A;  4OEN A;  4ZZE A;  4DCY A;  4DZ1 A;  4UAC A;  2HZK A;  3GXA A;  4RYA A;  1EZO A;  4WEP A;  4FJP A;  4NED A;  2FYI A;  5BWJ A;  1IEJ A;  4JBZ A;  4QRZ A;  3S4U A;  2HAV A;  5CRY A;  5DYH A;  4ISU A;  4R6H A;  1QKA A;  3CG1 A;  3IJX B;  1MPD A;  4EQ9 A;  1OVB A;  5FHM A;  2Z8F A;  4ZEK A;  3FZV A;  1LAX A;  3QAX A;  2WKY A;  4H6D A;  3TTM A;  2DE4 A;  3PGF A;  3UP9 A;  3HPI A;  3VXB A;  3EHT A;  4G2Z A;  2Q8J A;  1TFD A;  2QSX A;  1OIB A;  1R1N A;  4H8J A;  3G3J A;  4U21 A;  4E0X A;  3U1O A;  2I58 A;  2XX7 A;  3C31 A;  2OZZ A;  3GBB A;  4OMB A;  5H8F A;  2Y7K A;  1B7U A;  3M3K A;  2LAO A;  3M3L A;  5F1Q A;  2V84 A;  1YTV A;  3Q27 A;  1BLF A;  4GD5 A;  3FIR A;  4DE8 A;  2PT1 A;  4IY5 A;  2I3W A;  1SVX B;  5DVI A;  3VLV A;  3TKD A;  4C1U A;  1TWY A;  3KZG A;  2PX1 A;  4IO4 A;  3TCG A;  4G8M A;  3C36 A;  2F7C A;  4HW8 A;  1HSJ A;  1MXU A;  4TLM B;  4LZ8 A;  2I4B A;  1AIV A;  2DOJ A;  3VVF A;  3DP6 A;  4AB6 A;  2OCU A;  4F19 A;  1ANF A;  4YMB A;  3TQL A;  2ZYO A;  1NKX A;  1QUL A;  2VP1 A;  2DE3 A;  1I6Q A;  3FAS A;  3M3F A;  5CBR A;  1FCK A;  4NF6 B;  4GRK A;  4N07 A;  3RNN A;  3CIJ A;  4QF9 A;  4ZEF A;  1NNF A;  4U4X A;  4I62 A;  1UIU A;  3GZG A;  4MLQ A;  3IOT A;  4P0I A;  2V3T A;  2XXW A;  3C34 A;  4F31 B;  1MG1 A;  1Y4C A;  2QRY A;  2UVJ A;  3EQ1 A;  2ALU A;  5I59 A;  4G68 B;  3LC8 A;  1A8E A;  3K00 A;  1P1N A;  4GXA A;  1GV8 A;  3VLU A;  5JTY A;  4IO5 A;  2RF1 A;  3MAM A;  1A99 A;  1OMP A;  4BDO A;  3LUY A;  3MZ1 A;  2DWH A;  4POX A;  5CMM A;  3T9V A;  2DWJ A;  1PB7 A;  2UYE A;  1Y3Q A;  3VVE A;  4E0W A;  1NMU A;  1SDX A;  3PPO A;  1M5F A;  2FNC A;  1B7H A;  2I6E A;  2VHA A;  2XXU A;  3QK6 A;  5M2V A;  3PPN A;  4QHQ A;  2F5X A;  4JXI A;  2BJJ X;  3E3K A;  3RQT A;  3TCH A;  3VV5 A;  5KZT A;  3ZSF A;  1XOC A;  3K01 A;  2F6P A;  1D4N A;  3EPE A;  4KYE A;  2Z23 A;  4OXV A;  5ELV A;  5KDT B;  4QFK A;  3C33 A;  2GH9 A;  4H0W A;  1FW0 A;  3O29 A;  4NTL A;  4OYV A;  4YKI A;  4EXL A;  5ISU A;  2DVC A;  2HZL A;  5DT6 A;  2ZNT A;  3HHF A;  2XXX A;  2E0S A;  4IO2 A;  4P11 A;  3W15 C;  3RGY A;  5HM4 B;  2AYS A;  4EF1 A;  3IO4 A;  3FGS A;  3Q29 A;  4OTE A;  1IZ1 A;  2DVZ A;  3LR1 A;  3MVZ A;  1H3D A;  4HCW A;  2Y7R A;  4JSO A;  3VLW A;  3N94 A;  2DSF A;  3ZKK A;  1S50 A;  1N3W A;  1B40 A;  1XHY A;  2P1S A;  2QS2 A;  4GOT A;  5AA1 A;  4PFW A;  4LZ7 A;  3E4R A;  3OXN A;  2GFE A;  2REG A;  3SES A;  4NF8 B;  4NF4 B;  2YLN A;  1B58 A;  1UQW A;  1IQ7 A;  1B3F A;  1B46 A;  1WDN A;  1YCJ A;  4LP2 B;  4MF3 A;  2DE2 A;  5I58 A;  1N7X A;  4K3F A;  3RTF B;  3G3H A;  1FQC A;  1OQH A;  3O6G A;  5A5X A;  1O63 A;  2E1S A;  4YZZ A;  4R2F A;  2AIX A;  5J1D A;  1H44 A;  3K1P A;  3IB0 A;  4Q30 B;  1DSN A;  2O68 A;  4PP0 A;  1RYO A;  3JZJ A;  3S9E A;  4KQP A;  4RXL A;  1HSL A;  1Z7N E;  2V25 A;  2XX9 A;  4U2R A;  1O7T A;  3EHS A;  1P1W A;  4M1V A;  4ELR A;  4EQ7 A;  4R73 A;  1DPE A;  1B1X A;  5H8N A;  3BKI B;  3N26 A;  4N6P A;  3MVX A;  5I57 B;  4IO6 A;  1BP5 A;  4BDQ A;  1N0T A;  2H25 A;  3MC2 A;  3IOU A;  3QXM A;  4H5G A;  5H8H B;  1YPN A;  1B2H A;  5ITO A;  4EXK A;  2FA7 A;  4LA9 A;  3OEN A;  1JET A;  2F34 A;  4GLI A;  1GR2 A;  3OEL A;  4DXB A;  5EHM A;  4DCX A;  3TZA A;  3HST A;  1SYI A;  4RK9 A;  2DWA A;  1BKA A;  3V83 A;  1RYX A;  4QFN A;  4Z0I A;  3KOS A;  4YMA A;  3QUF A;  2I48 A;  4LZ5 A;  2NVU B;  3FVK A;  4NWC A;  1SI1 A;  5L9S A;  1NNK A;  4TLL B;  1EZP A;  3TAJ A;  3V8X B;  2HXW A;  3DM0 A;  4OHN A;  2Y7I A;  2R9J A;  2RKM A;  3K1N A;  4MLV A;  1UTH A;  2AL4 A;  3TMG A;  4ECF A;  4F3P A;  4ZEC A;  3I5O A;  1EZ9 A;  2ZXT A;  1PBP A;  1M5B A;  1LAG E;  4Q0C A;  1PDA A;  3PU5 A;  2ZYN A;  3CRB A;  2XXI A;  1USY E;  4GL0 A;  1POY 1;  1QJM A;  4IB2 A;  4OVJ A;  5TP9 A;  3SET A;  4F22 A;  1MY2 A;  3C9H A;  2UYF A;  5KDT A;  2Z22 A;  2RCA A;  2F35 A;  5FTH A;  1OQG A;  1SQY A;  2OBG A;  4FE8 A;  2IEE A;  4OQO A;  1LAF E;  3PV0 E;  3RTW B;  3KJ7 A;  3JYR A;  5FHN A;  4F18 A;  1MPB A;  4XKQ A;  4DXU A;  4KD5 A;  1H43 A;  2P2A A;  2YPN A;  4OFJ A;  1URD A;  3OOA A;  3O2A A;  4THI A;  1JEV A;  2D3I A;  3K0V A;  5FHO A;  3U72 A;  2XD3 A;  4QFO A;  5B70 A;  1P1U A;  4YKJ A;  2HEU A;  4PFU A;  2Y7W A;  3MQ9 A;  2Q2A A;  3P7I A;  4WXJ A;  4X9T A;  3B7D A;  5H8H A;  4ZZA A;  3WAE A;  3U8Q A;  5AA2 D;  5AA4 A;  5CM6 A;  5I57 A;  1LLS A;  4OFL A;  4JWO A;  5IKB A;  2XXR A;  2PYY A;  4WED A;  4EQB A;  5DVJ A;  2QS3 A;  4RK2 A;  1MRP A;  1MXX A;  4HTG A;  5F7V A;  3TTR A;  4IY6 A;  3PMX A;  3TFL A;  1USY H;  1LBB A;  1B7Z A;  3CR9 A;  3IO6 A;  3HN0 A;  2X26 A;  2UVH A;  1DOT A;  2Y84 A;  3F11 A;  3HV1 A;  3PPQ A;  4H1X A;  1GGG A;  3LSW A;  1I69 A;  5I56 A;  2XXQ A;  1B32 A;  1UTB A;  2REJ A;  1MDQ A;  1S9T A;  1XS5 A;  2CZL A;  3IAZ A;  3N5L A;  4U4S A;  2F36 A;  5H8Q B;  2H4I A;  4X48 A;  1Y1M A;  3KGC A;  1IXI A;  5EYF A;  4FAJ A;  3T66 A;  4ZED A;  1LFG A;  1LCT A;  1N3X A;  1QUK A;  5CBS A;  5I58 B;  3EHU A;  3DP4 A;  3SDF A;  5AA2 A;  4F3G A;  1QUI A;  2I0C A;  4R9F A;  1FQE A;  4ZE9 A;  1NNT A;  4UA8 A;  1B0L A;  1OLC A;  2AL5 A;  1A54 A;  3N6U A;  4G68 A;  3S2V A;  1JVY A;  3O9P A;  4XTC Q;  2O51 A;  3GLB A;  3PPP A;  4JWX A;  4U22 A; 
#chains in the Genus database with same CATH topology
 4I9D A;  3R26 A;  4F1U A;  2L5V A;  4KHZ E;  1MH4 A;  4JB7 A;  2ESN A;  5B7D A;  4PCD A;  3EN3 A;  4PE5 B;  4JDF A;  5ET6 A;  1N04 A;  2ZMB A;  3MYU A;  3DP8 A;  1JW5 A;  1F9B A;  5ET8 A;  2F6G A;  2FIX A;  3IOV A;  4H8I A;  4OER A;  4O7I A;  3GBA A;  4GBW A;  1MM7 A;  5TP9 B;  2ONK E;  1J1N A;  4IO7 A;  1MQD A;  3BFT A;  2XXP A;  2NUV A;  1D9Y A;  4GL8 A;  5DEX B;  2QMX A;  3ZS6 A;  3VVD A;  1UIV A;  3MVY A;  1NUW A;  5I2K B;  5I2N B;  3ONM A;  1FPI A;  5AE4 A;  4I3E A;  3CFL A;  1SBP A;  1ZJL A;  4KYD A;  3TUS A;  2H5Y A;  1MDP 1;  3KBZ A;  1NFT A;  3T96 B;  2ZYK A;  1CB6 A;  2PFZ A;  1ZLQ A;  3CSB A;  4PTK A;  3IK6 B;  4POW A;  3WAF A;  4ZE8 A;  3Q26 A;  2Q8M A;  4R74 A;  1DCU A;  2DDK A;  1ZU0 A;  3TCF A;  4P0G A;  4R72 A;  5CI5 A;  2PMS A;  2I3V A;  3H6W A;  3MP6 A;  3KC1 A;  4XF5 A;  5I59 B;  3PD9 A;  2OWT A;  3OO9 A;  4BDM A;  4G61 A;  3RT8 A;  2KQZ A;  2G29 A;  3IOW A;  5F24 A;  2WBD A;  4JVD A;  1MY3 A;  4MEV A;  1A8F A;  2QL3 A;  4P1L A;  1IMA A;  4F1V A;  2OX3 A;  1RDZ A;  1MQJ A;  4O3B A;  2DP8 A;  3ILT B;  1IME A;  1OLA A;  1MQI A;  3RY3 A;  4FOR A;  4P47 A;  1LB9 A;  4NF4 A;  3SEU A;  3H06 B;  4R6K A;  3K1M A;  1XT8 A;  2ZZX A;  4JSD A;  4F29 A;  4NE4 A;  5CMB A;  3MST A;  3O97 A;  2ZYM A;  2GHB A;  3W15 C;  4GX3 A;  5H8S A;  1MY1 A;  1MXZ A;  4MMP A;  4OEV A;  3TDJ A;  2F8D A;  5EQA A;  2XXH A;  3BIH A;  3T9H B;  4RNS A;  3TEP A;  3D4C A;  3QUJ A;  2PT2 A;  2B3F A;  4LON B;  4MNP A;  3U65 A;  3U92 A;  3UOR A;  1B5J A;  3KSX A;  3FJG A;  2WX9 A;  4XKP A;  3H4Z A;  3MW0 A;  3FXR A;  4FED A;  2HFB A;  3IL1 B;  4I1D A;  2VPO A;  5CMC A;  3B6W A;  1MXV A;  2WBB A;  5I84 A;  4GWU A;  4H65 A;  4HE1 A;  3A3U A;  4ESX A;  1MXW A;  1LB8 A;  3UK4 A;  4PBH A;  2HPG A;  3H7M A;  1INP A;  4NWD A;  3T93 B;  5I56 B;  2XXT A;  2RC7 A;  4NMY A;  4YMA A;  2UXA A;  1MM6 A;  2HQ0 A;  1FJ9 A;  1R9L A;  1GTK A;  2O84 X;  2XWV A;  1DMB A;  2NOO A;  5L9O A;  3MP8 A;  4N8Y A;  4R2B A;  1VFE A;  5EYH A;  1LBV A;  3UIF A;  5IZZ A;  1XVX A;  1ZKB A;  1RKM A;  1NH8 A;  3UGW A;  4L17 A;  1A55 A;  1NV0 A;  3K4U A;  1NV3 A;  4NED A;  2FYI A;  4QRZ A;  1AWB A;  4ISU A;  4I40 A;  4MNI A;  3IJX B;  4FBP A;  1LAX A;  4G2Z A;  1TFD A;  1R1N A;  4UAB A;  4NAP A;  3C31 A;  4OMB A;  1B7U A;  3FIR A;  2PT1 A;  5DVI A;  3KZG A;  2PX1 A;  4TLM B;  5EQ9 A;  2I4B A;  4YMB A;  4AS4 A;  5CBR A;  3RNN A;  3LC8 A;  1A8E A;  1FBC A;  1NUZ A;  4GWS A;  1PB7 A;  2UYE A;  4GX6 A;  1SDX A;  3PPO A;  5M2V A;  2I6E A;  2F5X A;  5KZT A;  2F3D A;  4KYE A;  5ELV A;  4OXV A;  2Z23 A;  4H0W A;  2DVC A;  5DT6 A;  2XXX A;  4P11 A;  4EF1 A;  3IO4 A;  3T1B A;  3MVZ A;  3LR1 A;  1XHY A;  2P1S A;  1AOV A;  4GOT A;  5AA1 A;  3TPA A;  2OWZ A;  4N81 A;  2YLN A;  1B46 A;  1B3F A;  4MF3 A;  4K3F A;  3HFU A;  2QFL A;  2AIX A;  4N15 A;  4PP0 A;  2XX9 A;  4U2R A;  1P1W A;  4R73 A;  5H8N A;  4PC9 A;  4LA9 A;  1GR2 A;  3TZA A;  4Z0I A;  1FPF A;  2VPN A;  3V8X B;  2HXW A;  3DM0 A;  2RKM A;  3TMG A;  4F3P A;  2AL4 A;  3I5O A;  2ZXT A;  1PDA A;  1USY E;  1POY 1;  3SET A;  5KDT A;  3C9H A;  2RCA A;  2F35 A;  3NOH A;  1OQG A;  1SQY A;  4FE8 A;  2IEE A;  4F18 A;  1MPB A;  1H43 A;  4OFJ A;  1URD A;  3U72 A;  3K0V A;  1P1U A;  4X9T A;  4ZZA A;  3P7I A;  5AA4 A;  5CM6 A;  3WAE A;  5DW8 A;  1LLS A;  1KA0 A;  1MXX A;  2MKZ A;  3TTR A;  3PMX A;  3TFL A;  4JWY A;  2X26 A;  2UVH A;  1DOT A;  1LBY A;  1I69 A;  1S9T A;  1XS5 A;  2CZL A;  3IAZ A;  3N5L A;  5ICQ A;  4X48 A;  1Y1M A;  1LFG A;  1FJ6 A;  5AA2 A;  1QUI A;  1B0L A;  1OLC A;  3S2V A;  4XTC Q;  3PPP A;  4JWX A;  5TPA B;  3TTK A;  5HPQ A;  1N76 A;  3OO7 A;  3PMW A;  4YKK A;  1LBC A;  4GF8 A;  4XXU A;  4F3B A;  4PF6 A;  1AMF A;  5CMK A;  3H6U A;  3HHG A;  3QSL A;  4G68 C;  2DWI A;  3A09 A;  3CHG A;  1MH3 A;  3D4G A;  5H8N B;  1FTK A;  3S9N C;  3H6V A;  3GYY A;  4R6Y A;  4IGT A;  1PC3 A;  2XXV A;  3JV9 A;  1EYI A;  4KPT A;  4WKM A;  4I8C A;  4GWW A;  4X1D A;  4NF6 A;  4G8N A;  1FBP A;  3Q25 A;  4Z7E A;  4RY1 A;  1LBZ A;  3TYH A;  5H8Q A;  2UVI A;  4YKP A;  4XIG Q;  3MBP A;  1IXC A;  3B50 A;  4QSE A;  1Y1Z A;  1WOD A;  1WVJ A;  1QKB A;  4C0R A;  1MPC A;  2DXR A;  2F7A A;  2R71 A;  4MCO A;  1FTM A;  3KN7 A;  2XWK A;  3FUZ A;  4O3A A;  4PDD A;  1RDY A;  4GWO A;  1L5T A;  4XFE A;  2HHM A;  3ODB A;  3T22 A;  3TTN A;  4LVQ A;  2Q9T A;  2KLF A;  4PDH A;  3MPK A;  5AA3 A;  1US5 A;  3OMB A;  4O94 A;  1B4Z A;  1PB8 A;  3MPL A;  1JW1 A;  3OSR A;  2O1L A;  4MH5 A;  3H03 A;  2R6G E;  2HAU A;  3A29 A;  3E13 X;  2WEF A;  5I2K A;  5JEI A;  2ZZW A;  3G3F A;  4AB5 A;  4QXD A;  2V93 A;  1B3G A;  1IMF A;  4ZDM A;  2VGQ A;  4LUB A;  3IR1 A;  4F39 A;  1BIY A;  1Y4T A;  3M8U A;  4U1Z A;  2VT5 A;  4F2Q A;  5DTB A;  1LST A;  2FIE A;  4KCD A;  4LQ2 A;  4DXU A;  4ONY A;  5JTY B;  3CVG A;  4PF8 A;  3S9M C;  3SKP A;  1IIW A;  1VDW A;  1FPL A;  1K9Z A;  2H98 A;  3FAT A;  3QIM A;  4AQ4 A;  2O7U A;  4OES A;  1TT1 A;  2RC9 A;  3KN8 A;  2PCR A;  3TOD A;  3CFZ A;  1B4H A;  1B3E A;  5L8D A;  2VD2 A;  2WYP A;  3SEW A;  4NF5 B;  1JQF A;  4FEB A;  4RPN A;  1NV4 A;  4X1B A;  4G4P A;  1Y9U A;  4YB6 A;  1M5D A;  1QUJ A;  4F22 A;  1Y20 A;  1BTJ A;  5FTI A;  1R6Z A;  3UA8 A;  1VSO A;  3E9X A;  1JW4 A;  3ZKL A;  4X04 A;  1TXF A;  4ND9 A;  3S9L C;  5BUU A;  2F7B A;  2A5T B;  1SW2 A;  4LAT A;  4H45 A;  3FBP A;  3R6U A;  4C1T A;  1I6A A;  4G77 A;  1JVX A;  4I3Y A;  4KCC A;  3R7X A;  1MY0 A;  5A5L A;  2GRV A;  1SD3 A;  1B5H A;  3KEI A;  2PBW A;  3T9X B;  5DEX A;  4XKR A;  1KWH A;  3AXF A;  3CSG A;  4FEC A;  1SYH A;  2VD3 A;  3ROJ A;  4DCY A;  2HAV A;  4R6H A;  4EQ9 A;  1OVB A;  5FHM A;  4ZEK A;  3QAX A;  2WKY A;  3TTM A;  3PGF A;  2QSX A;  1OIB A;  4U21 A;  3M3L A;  1YTV A;  3Q27 A;  3VLV A;  2I3W A;  1SVX B;  4C1U A;  3TKD A;  1SPI A;  4IO4 A;  1FPD A;  3C36 A;  3RPL A;  4N6K A;  2DOJ A;  5EQ7 A;  3DP6 A;  4AB6 A;  2OCU A;  4F19 A;  4N07 A;  4QF9 A;  4ZEF A;  4MLQ A;  3GZG A;  2V3T A;  2XXW A;  1P1N A;  4MX6 A;  1A99 A;  1OMP A;  4BDO A;  3T9V A;  4E0W A;  2FNC A;  3RQT A;  1XOC A;  3EPE A;  2GH9 A;  3O29 A;  4OYV A;  4EXL A;  2HZL A;  3HHF A;  5HM4 B;  2AYS A;  1FPG A;  3FGS A;  4OTE A;  2QS2 A;  3E4R A;  1IQ7 A;  2DE2 A;  5I58 A;  3G3H A;  4XEQ A;  3IFA A;  3O6G A;  1O63 A;  4YZZ A;  4R2F A;  1H44 A;  3JZJ A;  1HSL A;  1Z7N E;  1O7T A;  3EHS A;  4ELR A;  3BKI B;  3N26 A;  5I57 B;  1BP5 A;  4BDQ A;  3QXM A;  2H25 A;  3MC2 A;  3IOU A;  5H8H B;  5IZ3 B;  1YPN A;  1B2H A;  5J16 A;  1JET A;  2F34 A;  4GLI A;  4DXB A;  4P9K A;  1NV2 A;  1SYI A;  1BKA A;  3V83 A;  4QFN A;  3E78 A;  5I5P A;  4PBQ A;  3QUF A;  2I48 A;  3FVK A;  1EZP A;  3TAJ A;  2R9J A;  3K1N A;  1UTH A;  1M5B A;  3CRB A;  4IB2 A;  5TP9 A;  4GL0 A;  1QJM A;  5FTH A;  2OBG A;  3PTY A;  3JYR A;  5FHN A;  3RYD A;  2P2A A;  3OOA A;  5B70 A;  2HEU A;  4WXJ A;  3B7D A;  3U8Q A;  5IKB A;  4IR8 A;  2QS3 A;  4IY6 A;  1USY H;  4HE2 A;  1FPK A;  4F3G A;  3HV1 A;  4H1X A;  4AS5 A;  1B32 A;  1UTB A;  3VFJ A;  5H8Q B;  4F3S A;  4ZED A;  1BK4 A;  1IXI A;  1YZ0 A;  1N3X A;  4MJO A;  1QUK A;  3SDF A;  4ZE9 A;  4UA8 A;  1FPJ A;  2O51 A;  4QFO A;  2HCA A;  3H6T A;  3S4U A;  1A40 A;  4OET A;  4ZS9 A;  3IB1 A;  4P1E A;  1XVY A;  3FXU A;  4NX1 A;  2OWS A;  2NXO A;  1HSE A;  4XKN A;  3G3G A;  1B3L A;  4BDR A;  2Q89 A;  5H8F B;  2UVG A;  3OEM A;  1FSA A;  5KCJ A;  1UTH B;  1H76 A;  3PMV A;  4YIC A;  3HO7 A;  3FXQ A;  1IMD A;  3FVN A;  3Q28 A;  4GQO A;  4OVQ A;  5ICT A;  4U1O A;  2G93 A;  4PGP A;  4O7M A;  1GVC A;  1B6H A;  2RC8 A;  3TTL A;  4HS7 A;  2ZNS A;  3W9W A;  4PQJ A;  3U93 A;  4PFY A;  3OO6 A;  3FV1 A;  2XX8 A;  3BFU A;  3EF7 A;  5I2N A;  5AA2 B;  1JP4 A;  4OVT A;  3OO8 A;  1I6B A;  3CFX A;  4N6D A;  2GHA A;  1SW4 A;  2F3B A;  4F1Y A;  2CMO A;  2GQ1 A;  5IGA A;  2I0B A;  2Y5K A;  4DIG A;  4U23 A;  5I7I A;  1ZIU A;  3SER A;  2FVZ A;  3KSJ A;  1UTB B;  4MFI A;  5IZ3 A;  3TEL A;  2V3Q A;  4EUO A;  1MY4 A;  4TOZ A;  4YB5 A;  4OWD A;  5FBP A;  1URS A;  4QSD A;  4H46 A;  1IXG A;  1CE2 A;  3I6V A;  4N91 A;  3RN8 A;  4ESW A;  3VXC A;  5TPA A;  3IJO B;  2ABH A;  1SW5 A;  2CZH A;  2V3U A;  4N13 A;  3SEY A;  2ONR A;  4Q5T A;  3N6T A;  4OZ9 A;  3MP1 A;  4BLA A;  3FVG A;  3ECR A;  4GWY A;  1KA1 A;  3K6W A;  4PGN A;  1RDX A;  1B3H A;  4PAI A;  4GX4 A;  4MAG A;  1ZBM A;  3FVO A;  3K6X A;  4P56 A;  1ZTY A;  1PBQ A;  3RUM A;  1YYZ A;  1II5 A;  4HE0 A;  2QJE A;  2X7Q A;  2Z8D A;  1SI0 A;  2I49 A;  3C4M A;  5HBC A;  4QSC A;  2OJT A;  2XWO A;  1IXH A;  5ESY A;  2DXY A;  3IFC A;  3B8B A;  2M8C A;  1S7Y A;  3VDF A;  2DQV A;  4U4X A;  3OEK A;  4QFP A;  1A7L A;  1DTZ A;  4N8G A;  2XXK A;  1B5I A;  4PFR A;  3B6Q A;  2XHD A;  1XC1 A;  1IMC A;  1D3K A;  4OVS A;  5I3S A;  1TFA A;  3G7W A;  2D5W A;  4PFI A;  3H3G A;  5ITP A;  1US4 A;  3KC0 A;  2Q88 A;  3W9V A;  2B65 A;  4JVI A;  5TU0 A;  4GVO A;  3HCQ A;  1Q1K A;  4IGR A;  2B4L A;  3O28 A;  4H67 A;  3KFM A;  1FBD A;  4R75 A;  4NF0 A;  5K2Y A;  1FTJ A;  1ZMG A;  3V5A A;  4ELP A;  1B51 A;  4P8B A;  4PAF A;  4YAH X;  4ZEB A;  2Q2C A;  2RCB A;  3QYT A;  3FJ7 A;  5L9M A;  4MNC A;  1LCF A;  3THI A;  5AA4 B;  2ANJ A;  2CEY A;  3G3K A;  2XXY A;  2QPQ A;  4ZEI A;  3KOT A;  2H99 A;  2Q74 A;  1P99 A;  2D21 A;  1ELJ A;  3IOR A;  1FQD A;  3CI8 A;  1AH5 A;  1NV7 A;  2F97 A;  1B05 A;  2QVV A;  1FTO A;  4PE3 A;  2NWJ A;  4OFO A;  1MS7 A;  1MXY A;  1D9Q A;  2YJP A;  4KR5 A;  1SW1 A;  3PUX E;  4NG7 A;  1DTG A;  3O6I A;  4M4G A;  4UAC A;  2HZK A;  3GXA A;  4RYA A;  1EZO A;  4FJP A;  5BWJ A;  5DYH A;  3SZP A;  1QKA A;  3CG1 A;  1FPB A;  2B4M A;  2Z8F A;  3VXB A;  4OAN A;  2Q8J A;  4E0X A;  4GBV A;  3G3J A;  3U1O A;  2I58 A;  2OZZ A;  3GBB A;  5LTC A;  2Y7K A;  3M3K A;  2LAO A;  1BLF A;  4DE8 A;  1TWY A;  2R8T A;  2F7C A;  1HSJ A;  4LZ8 A;  1AIV A;  3VVF A;  3TQL A;  2ZYO A;  1I6Q A;  3FAS A;  1FCK A;  4GRK A;  3CIJ A;  1NNF A;  4I62 A;  4P0I A;  3C34 A;  1Y4C A;  2QRY A;  2UVJ A;  2ALU A;  1GV8 A;  3K00 A;  4IO5 A;  2HXR A;  5CMM A;  4NN3 A;  1Y3Q A;  3VVE A;  2QVR A;  2VHA A;  2XXU A;  3PPN A;  4QHQ A;  2ZZV A;  4JXI A;  4OVR A;  3K01 A;  2F6P A;  1D4N A;  5KDT B;  3C33 A;  5ISU A;  1FW0 A;  4YKI A;  4NTL A;  2ZNT A;  4IO2 A;  3Q29 A;  1IZ1 A;  2DVZ A;  4EQ7 A;  3VLW A;  1S50 A;  1B40 A;  4PFW A;  4LZ7 A;  2GFE A;  4NF8 B;  4NF4 B;  1B58 A;  2WYK A;  5ET5 A;  1FQC A;  1OQH A;  5J1D A;  1NV5 A;  5ET7 A;  3S9E A;  4KQP A;  4RXL A;  5IM2 A;  2PFY A;  1B1X A;  2FHY A;  1FBG A;  1N0T A;  4GWZ A;  3OEL A;  3ISP A;  4DCX A;  4RK9 A;  2DWA A;  1RYX A;  3KOS A;  4LZ5 A;  2NVU B;  4NWC A;  5L9S A;  1SI1 A;  5EYG A;  2Y7I A;  4MLV A;  4ZEC A;  4ECF A;  1EYJ A;  1LBX A;  1PBP A;  4Q0C A;  2XXI A;  3E79 A;  2UYF A;  2Z22 A;  3RPL B;  1K9Y A;  4OQO A;  1LAF E;  3RTW B;  3KJ7 A;  4KD5 A;  1JEV A;  2D3I A;  5FHO A;  2XD3 A;  4PFU A;  2Y7W A;  3MQ9 A;  2Q2A A;  5H8H A;  5AA2 D;  5I57 A;  4OFL A;  4JWO A;  2PYY A;  4WED A;  4EQB A;  5DVJ A;  4HTG A;  4QBA A;  1LBB A;  1B7Z A;  2Y84 A;  1GGG A;  1FBH A;  5I56 A;  2CZK A;  2REJ A;  1MDQ A;  4U4S A;  5I58 B;  5CBS A;  4MIJ A;  3DP4 A;  4R9F A;  1FQE A;  3N6U A;  1JVY A;  3O9P A;  2PVU A;  2O6A A;  2IA4 A;  4HXV A;  1VR5 A;  4H5F A;  3L6H A;  3BIG A;  4EDP A;  5LOM A;  3MWB A;  4HCY A;  2OK2 A;  4DI4 B;  1DK4 A;  1N84 A;  3PPR A;  2A5T A;  1FRP A;  4IO3 A;  2I4C A;  3BBR A;  3G3I A;  2BJI A;  2X7P A;  3PUZ E;  1XI6 A;  1AL3 A;  1EU8 A;  1LAH E;  4DLD A;  3LSL A;  5T3J A;  4NF5 A;  3ILU B;  1Q9D A;  3KJT A;  1LBW A;  4DXC A;  2W7Y A;  4GWX A;  3K02 A;  3MJN A;  1G0I A;  4R9G A;  3K2D A;  1PEB A;  3LSX A;  3K6U A;  1MQH A;  3CG3 A;  4F2O A;  1B9J A;  4KI0 E;  5IZ1 A;  4Q8R A;  1M5C A;  1Q35 A;  3DLN A;  2DYX A;  3VE1 B;  3U94 A;  3I3V A;  4QFL A;  1LFI A;  3FJM A;  1B0H A;  3D1R A;  1FBF A;  5LDZ A;  4ELQ A;  2THI A;  1B52 A;  4NGU A;  3DEL B;  3PUW E;  3RLF E;  3RT6 B;  3KN3 A;  2FBP A;  3IX1 A;  3FD3 A;  2P0S A;  4KYS A;  1FQA A;  4OEU A;  1FQF A;  4GIZ A;  1MQG A;  3T0J A;  3K6V A;  2XD2 A;  4FIM A;  2XWI A;  5DVF A;  2DS9 A;  1NH7 A;  2OLB A;  4FAT A;  1Y3N A;  4MBP A;  2XA5 A;  4TQU Q;  1LGB C;  3MVW A;  2Z8E A;  1Y3P A;  5JK4 A;  3SEV A;  3MZB A;  4EF2 A;  1PB9 A;  4X8R A;  2B3B A;  1FTL A;  1H45 A;  3OSQ A;  5EHS A;  4YB7 A;  2H9B A;  1LEV A;  3C32 A;  4GXS B;  1P1Q A;  1QW0 A;  4G8H A;  4GFR A;  1QVS A;  2QMW A;  3B6T A;  2F78 A;  1OVT A;  3LUZ A;  1D9V A;  2ZNU A;  3C35 A;  2KR0 A;  3PUV E;  5EQ8 A;  3KG2 A;  2O1M A;  4KFQ A;  3SEX A;  4O3C A;  4RPO A;  1NV6 A;  1VFD A;  4RA1 A;  3USD A;  2QS1 A;  5K2X A;  3LBS A;  4ELO A;  1Z7M E;  4P3L A;  1EYK A;  3RPW A;  1POT A;  3LSF B;  3O6H A;  1FQB A;  5CC2 A;  1M5E A;  2O69 A;  1FTA A;  4PET A;  1IUD A;  1N7W A;  3A3C A;  3EKI A;  3FV2 A;  1KZ8 A;  3T9U A;  3OD7 A;  1NUY A;  1B1H A;  3V89 B;  2QS4 A;  4NF8 A;  3L6G A;  3PUY E;  1EH3 A;  1IIT A;  1ATG A;  2O7I A;  5I59 A;  4YU0 A;  1NL5 A;  4IO6 A;  1JEU A;  4LQ5 A;  4ZZE A;  2Y7P A;  3UN6 A;  4BDN A;  3KBR A;  1LFH A;  4PFB A;  4MHF A;  2V4C A;  1R9Q A;  1CNQ A;  4PFT A;  2ONS A;  1NI9 A;  4DI3 D;  1YXI A;  1VE4 A;  2CEX A;  3MUQ A;  1YAE A;  3O66 A;  4RJZ A;  2A5S A;  4BDL A;  1JNF A;  3IB2 A;  3MZ9 A;  3TQW A;  4DDD A;  3PD8 A;  2VOZ A;  1O64 A;  1P1O A;  5A5X B;  1NNP A;  4N17 A;  1URG A;  1DPP A;  4OEN A;  2RIN A;  2JJK A;  4DZ1 A;  4WEP A;  1IEJ A;  4JBZ A;  5CRY A;  1MPD A;  3FZV A;  3UP9 A;  4H6D A;  2DE4 A;  3HPI A;  3EHT A;  4H8J A;  2XX7 A;  5H8F A;  5F1Q A;  2V84 A;  4GD5 A;  4IY5 A;  2Y5L A;  3TCG A;  4G8M A;  4HW8 A;  4OVP A;  1MXU A;  1ANF A;  4NHB A;  1NKX A;  1QUL A;  4PAK A;  2VP1 A;  2DE3 A;  3M3F A;  3QMF A;  4NF6 B;  1UIU A;  3IOT A;  4N4U A;  4F31 B;  4LN5 A;  1MG1 A;  3EQ1 A;  4G68 B;  4GXA A;  3VLU A;  1G0H A;  5JTY A;  2RF1 A;  3MAM A;  3LUY A;  3MZ1 A;  2DWH A;  4POX A;  1NUX A;  2DWJ A;  1NMU A;  1M5F A;  1B7H A;  3QK6 A;  2BJJ X;  3E3K A;  3VV5 A;  3TCH A;  3ZSF A;  1DBZ A;  4JVC A;  4QFK A;  2E0S A;  3RGY A;  2P3N A;  5IAI A;  1H3D A;  4HCW A;  2Y7R A;  4JSO A;  3N94 A;  2DSF A;  3ZKK A;  1N3W A;  3OXN A;  2REG A;  3SES A;  1UQW A;  1WDN A;  1YCJ A;  4LP2 B;  1N7X A;  3RTF B;  5A5X A;  2E1S A;  2QVU A;  4NQ8 A;  3K1P A;  3IB0 A;  4Q30 B;  1DSN A;  2O68 A;  1RYO A;  4KXP A;  2V25 A;  4M1V A;  4OA4 A;  1DPE A;  4N6P A;  3MVX A;  4H5G A;  3FXB A;  5ITO A;  2FA7 A;  4EXK A;  3OEN A;  5EHM A;  3HST A;  1FPE A;  1NNK A;  4TLL B;  4OHN A;  3LV0 A;  2P3V A;  1EZ9 A;  1LAG E;  3PU5 A;  2ZYN A;  4OVJ A;  1MY2 A;  1QGX A;  3PV0 E;  4XKQ A;  2YPN A;  3O2A A;  4THI A;  4YKJ A;  2XXR A;  1FBE A;  4RK2 A;  1MRP A;  5F7V A;  1IMB A;  3IO6 A;  3CR9 A;  2CZI A;  3HN0 A;  3F11 A;  3PPQ A;  3LSW A;  2XXQ A;  4FAJ A;  2F36 A;  2H4I A;  3KGC A;  5EYF A;  3T66 A;  1LCT A;  1NV1 A;  3EHU A;  4O8M A;  2I0C A;  1NNT A;  2AL5 A;  1A54 A;  4G68 A;  3GLB A;  1T0K A;  5KCJ B;  4U22 A; 
#chains in the Genus database with same CATH homology
 5TPA B;  3TTK A;  5HPQ A;  2PVU A;  3R26 A;  2O6A A;  4I9D A;  1N76 A;  3OO7 A;  4F1U A;  2IA4 A;  3PMW A;  4YKK A;  5ICQ A;  2HCA A;  3H6T A;  1LBC A;  1VR5 A;  4GF8 A;  4XXU A;  4KHZ E;  1MH4 A;  1A40 A;  4H5F A;  3L6H A;  4JB7 A;  4OET A;  4ZS9 A;  2ESN A;  3IB1 A;  4F3B A;  5B7D A;  1AOV A;  4EDP A;  1AMF A;  3EN3 A;  5LOM A;  4PE5 B;  3MWB A;  4HCY A;  1N04 A;  4JDF A;  2ZMB A;  2OK2 A;  1XVY A;  4YB6 A;  3H6U A;  5CMK A;  3DP8 A;  1JW5 A;  3FXU A;  1F9B A;  1N84 A;  2F6G A;  2A5T A;  3IOV A;  2OWS A;  3PPR A;  4H8I A;  3HHG A;  4IO3 A;  3QSL A;  4G68 C;  2DWI A;  4OER A;  4F3S A;  2NXO A;  1HSE A;  3GBA A;  3A09 A;  2I4C A;  3BBR A;  1MH3 A;  4XKN A;  3D4G A;  3G3I A;  3G3G A;  1B3L A;  1MM7 A;  4BDR A;  5H8N B;  2X7P A;  5TP9 B;  2Q89 A;  5H8F B;  1FTK A;  2ONK E;  2UVG A;  1J1N A;  3OEM A;  3PUZ E;  4IO7 A;  3H6V A;  1MQD A;  3S9N C;  4R6Y A;  4IGT A;  3BFT A;  5KCJ A;  1UTH B;  1AL3 A;  1H76 A;  2XXP A;  3PMV A;  1EU8 A;  2NUV A;  1PC3 A;  1D9Y A;  4GL8 A;  4YIC A;  2XXV A;  3JV9 A;  1LAH E;  3HO7 A;  4KPT A;  4DLD A;  3LSL A;  3FXQ A;  4WKM A;  2QMX A;  4I8C A;  5DEX B;  3ZS6 A;  3VVD A;  4X1D A;  1UIV A;  4NF5 A;  3ILU B;  4NF6 A;  3KJT A;  3MVY A;  5I2K B;  3FVN A;  4G8N A;  2W7Y A;  3Q28 A;  4GQO A;  3ONM A;  3K02 A;  4DXC A;  5I2N B;  5ICT A;  4U1O A;  2G93 A;  3MJN A;  3Q25 A;  4R9G A;  4RY1 A;  3K2D A;  1GVC A;  1PEB A;  3TYH A;  4Z7E A;  5H8Q A;  3LSX A;  5AE4 A;  1B6H A;  2UVI A;  2RC8 A;  3TTL A;  3CFL A;  3K6U A;  1SBP A;  5KCJ B;  4YKP A;  4HS7 A;  1ZJL A;  2ZNS A;  1MQH A;  4KYD A;  2H5Y A;  3TUS A;  3CG3 A;  4F2O A;  1B9J A;  1MDP 1;  4XIG Q;  4KI0 E;  3MBP A;  3W9W A;  1IXC A;  4PQJ A;  4QSE A;  1NFT A;  1Y1Z A;  3T96 B;  1M5C A;  3U93 A;  4Q8R A;  1Q35 A;  1WOD A;  1WVJ A;  4PFY A;  3OO6 A;  3FV1 A;  2ZYK A;  1CB6 A;  2XX8 A;  3DLN A;  2DYX A;  3VE1 B;  1ZLQ A;  3VFJ A;  3CSB A;  3BFU A;  3EF7 A;  1QKB A;  3IK6 B;  4POW A;  3U94 A;  4C0R A;  3I3V A;  4ZE8 A;  1MPC A;  2DXR A;  2F7A A;  3Q26 A;  3WAF A;  5AA2 B;  4R74 A;  4QFL A;  5I2N A;  2R71 A;  1LFI A;  1FTM A;  3KN7 A;  3FJM A;  3FUZ A;  1ZU0 A;  3OO8 A;  1B0H A;  3TCF A;  1I6B A;  3CFX A;  4P0G A;  4R72 A;  5CI5 A;  4O3A A;  2PMS A;  2GHA A;  2I3V A;  1SW4 A;  4GWO A;  3H6W A;  1L5T A;  3MP6 A;  4F1Y A;  2CMO A;  5I59 B;  4ELQ A;  2THI A;  1B52 A;  2I0B A;  4JWY A;  3PD9 A;  4DIG A;  2OWT A;  3OO9 A;  3ODB A;  4BDM A;  4U23 A;  3RT8 A;  1ZIU A;  3SER A;  3DEL B;  3T22 A;  3TTN A;  3PUW E;  3RLF E;  3KSJ A;  2G29 A;  3IOW A;  4LVQ A;  3RT6 B;  1UTB B;  4MFI A;  5IAI A;  3KN3 A;  2Q9T A;  3TEL A;  2V3Q A;  1MY3 A;  4EUO A;  1MY4 A;  4TOZ A;  2KLF A;  4YB5 A;  3IX1 A;  4OWD A;  1A8F A;  3FD3 A;  2P0S A;  2QL3 A;  4KYS A;  1FQA A;  4OEU A;  3MPK A;  5AA3 A;  4F1V A;  1URS A;  1FQF A;  1US5 A;  4GIZ A;  4QSD A;  1MQG A;  1IXG A;  1MQJ A;  1CE2 A;  3OMB A;  4O3B A;  3K6V A;  2DP8 A;  2XD2 A;  4FIM A;  3ILT B;  1B4Z A;  1PB8 A;  3MPL A;  1JW1 A;  3OSR A;  2O1L A;  3I6V A;  3H03 A;  4MH5 A;  3RN8 A;  3VXC A;  5TPA A;  4ESW A;  3IJO B;  1OLA A;  2ABH A;  5DVF A;  1SW5 A;  1NH7 A;  1MQI A;  2DS9 A;  2R6G E;  2V3U A;  2HAU A;  3RY3 A;  2OLB A;  3E13 X;  4FOR A;  4FAT A;  4N13 A;  3SEY A;  2ONR A;  1Y3N A;  4MBP A;  4Q5T A;  1LB9 A;  3N6T A;  4NF4 A;  5I2K A;  5JEI A;  4OZ9 A;  3MP1 A;  4TQU Q;  4BLA A;  3FVG A;  3H06 B;  3ECR A;  3G3F A;  4R6K A;  3SEU A;  1LGB C;  3MVW A;  2Z8E A;  3K1M A;  3K6W A;  4AB5 A;  1XT8 A;  1Y3P A;  5JK4 A;  3SEV A;  3MZB A;  4JSD A;  1PB9 A;  4EF2 A;  2V93 A;  4F29 A;  2B3B A;  4NE4 A;  5CMB A;  1B3G A;  1B3H A;  1FTL A;  3O97 A;  2ZYM A;  4ZDM A;  1H45 A;  1ZBM A;  2GHB A;  2VGQ A;  3FVO A;  1ZTY A;  1MY1 A;  3K6X A;  1PBQ A;  1MXZ A;  3OSQ A;  4LUB A;  3RUM A;  1II5 A;  3IR1 A;  4F39 A;  5EHS A;  2QJE A;  2X7Q A;  4YB7 A;  1BIY A;  2Z8D A;  4OEV A;  3TDJ A;  1SI0 A;  1Y4T A;  2F8D A;  2I49 A;  2H9B A;  3C4M A;  2XXH A;  2OJT A;  3C32 A;  3M8U A;  4QSC A;  4GXS B;  1P1Q A;  4U1Z A;  1IXH A;  1QW0 A;  2DXY A;  4G8H A;  4RNS A;  4GFR A;  3T9H B;  3TEP A;  1QVS A;  2QMW A;  4F2Q A;  3B6T A;  3D4C A;  2F78 A;  5DTB A;  1OVT A;  2M8C A;  1LST A;  1S7Y A;  1D9V A;  2ZNU A;  3C35 A;  3VDF A;  3QUJ A;  4KCD A;  2PT2 A;  3PUV E;  2DQV A;  2B3F A;  4LON B;  3KG2 A;  3OEK A;  2O1M A;  4LQ2 A;  1A7L A;  1DTZ A;  4KFQ A;  4ONY A;  4QFP A;  5JTY B;  3U92 A;  3UOR A;  3SEX A;  1B5I A;  1B5J A;  3CVG A;  5H8S A;  3KSX A;  4O3C A;  4RPO A;  3S9M C;  3SKP A;  1VFD A;  4RA1 A;  3USD A;  3B6Q A;  2QS1 A;  3FJG A;  5K2X A;  2XHD A;  1IIW A;  1XC1 A;  3LBS A;  4XKP A;  1D3K A;  3H4Z A;  3MW0 A;  4ELO A;  1Z7M E;  1TFA A;  3FXR A;  3RPW A;  4FED A;  2H98 A;  3G7W A;  2D5W A;  2HFB A;  3FAT A;  3IL1 B;  1POT A;  3QIM A;  4I1D A;  3LSF B;  3O6H A;  1FQB A;  5HBC A;  3H3G A;  4AQ4 A;  5CC2 A;  5ITP A;  1M5E A;  2O69 A;  5CMC A;  2O7U A;  4OES A;  1TT1 A;  3B6W A;  1US4 A;  1MXV A;  2Q88 A;  2RC9 A;  3W9V A;  4PET A;  3TPA A;  3KN8 A;  2B65 A;  1IUD A;  1N7W A;  3A3C A;  4H65 A;  5I84 A;  3A3U A;  4ESX A;  5TU0 A;  4GVO A;  3TOD A;  3FV2 A;  3CFZ A;  3HCQ A;  1Q1K A;  4IGR A;  1B4H A;  3T9U A;  1MXW A;  3OD7 A;  1B3E A;  3O28 A;  1LB8 A;  1B1H A;  4H67 A;  5L8D A;  2VD2 A;  3KFM A;  3V89 B;  3UK4 A;  4R75 A;  2QS4 A;  4NF8 A;  5K2Y A;  3SEW A;  3H7M A;  4NWD A;  1FTJ A;  4NF5 B;  3L6G A;  1JQF A;  3T93 B;  4FEB A;  4RPN A;  1ZMG A;  3V5A A;  4ELP A;  1B51 A;  5I56 B;  3PUY E;  1EH3 A;  1IIT A;  1ATG A;  2O7I A;  4G4P A;  4X1B A;  2Q2C A;  1Y9U A;  2XXT A;  4YAH X;  2RC7 A;  2RCB A;  4YU0 A;  4ZEB A;  4NMY A;  1NL5 A;  1M5D A;  1QUJ A;  1JEU A;  1MM6 A;  2HQ0 A;  2UXA A;  1Y20 A;  2Y7P A;  3KBR A;  3QYT A;  4LQ5 A;  3FJ7 A;  3UN6 A;  4BDN A;  1BTJ A;  1LFH A;  5FTI A;  1R6Z A;  3UA8 A;  5L9M A;  1R9Q A;  1VSO A;  1R9L A;  1T0K A;  1GTK A;  4PFT A;  3E9X A;  1LCF A;  2ONS A;  1JW4 A;  3ZKL A;  2O84 X;  1VE4 A;  3THI A;  1DMB A;  2NOO A;  5AA4 B;  1TXF A;  4ND9 A;  3S9L C;  2ANJ A;  5BUU A;  3MUQ A;  1YAE A;  3G3K A;  5L9O A;  2XXY A;  2F7B A;  2A5T B;  2QPQ A;  4ZEI A;  1SW2 A;  3KOT A;  3MP8 A;  2H99 A;  4LAT A;  4R2B A;  3R6U A;  1P99 A;  3O66 A;  1VFE A;  4C1T A;  1I6A A;  4G77 A;  1JVX A;  2D21 A;  1ELJ A;  3IOR A;  3UIF A;  1FQD A;  4RJZ A;  2A5S A;  4KCC A;  1MY0 A;  3R7X A;  4BDL A;  1XVX A;  1JNF A;  2GRV A;  1SD3 A;  3CI8 A;  3IB2 A;  1B5H A;  1AH5 A;  3MZ9 A;  3KEI A;  2F97 A;  2PBW A;  3TQW A;  1B05 A;  4DDD A;  3T9X B;  5DEX A;  1FTO A;  1ZKB A;  2NWJ A;  3PD8 A;  4XKR A;  4OFO A;  1RKM A;  1KWH A;  1MS7 A;  1NH8 A;  2VOZ A;  1O64 A;  1P1O A;  3AXF A;  1MXY A;  3UGW A;  4L17 A;  3CSG A;  5A5X B;  4FEC A;  1NNP A;  1A55 A;  2YJP A;  4KR5 A;  1SW1 A;  3PUX E;  3K4U A;  1SYH A;  1DTG A;  3O6I A;  4M4G A;  1URG A;  1DPP A;  2VD3 A;  2RIN A;  4OEN A;  4ZZE A;  4DCY A;  4DZ1 A;  4UAC A;  2HZK A;  3GXA A;  4RYA A;  1EZO A;  4WEP A;  4FJP A;  4NED A;  2FYI A;  5BWJ A;  1IEJ A;  4JBZ A;  4QRZ A;  3S4U A;  2HAV A;  5CRY A;  5DYH A;  4ISU A;  4R6H A;  1QKA A;  3CG1 A;  3IJX B;  1MPD A;  4EQ9 A;  1OVB A;  5FHM A;  2Z8F A;  4ZEK A;  3FZV A;  1LAX A;  3QAX A;  2WKY A;  4H6D A;  3TTM A;  2DE4 A;  3PGF A;  3UP9 A;  3HPI A;  3VXB A;  3EHT A;  4G2Z A;  2Q8J A;  1TFD A;  2QSX A;  1OIB A;  1R1N A;  4H8J A;  3G3J A;  4U21 A;  4E0X A;  3U1O A;  2I58 A;  2XX7 A;  3C31 A;  2OZZ A;  3GBB A;  4OMB A;  5H8F A;  2Y7K A;  1B7U A;  3M3K A;  2LAO A;  3M3L A;  5F1Q A;  2V84 A;  1YTV A;  3Q27 A;  1BLF A;  4GD5 A;  3FIR A;  4DE8 A;  2PT1 A;  4IY5 A;  2I3W A;  1SVX B;  5DVI A;  3VLV A;  3TKD A;  4C1U A;  1TWY A;  3KZG A;  2PX1 A;  4IO4 A;  3TCG A;  4G8M A;  3C36 A;  2F7C A;  4HW8 A;  1HSJ A;  1MXU A;  4TLM B;  4LZ8 A;  2I4B A;  1AIV A;  2DOJ A;  3VVF A;  3DP6 A;  4AB6 A;  2OCU A;  4F19 A;  1ANF A;  4YMB A;  3TQL A;  2ZYO A;  1NKX A;  1QUL A;  2VP1 A;  2DE3 A;  1I6Q A;  3FAS A;  3M3F A;  5CBR A;  1FCK A;  4NF6 B;  4GRK A;  4N07 A;  3RNN A;  3CIJ A;  4QF9 A;  4ZEF A;  1NNF A;  4U4X A;  4I62 A;  1UIU A;  3GZG A;  4MLQ A;  3IOT A;  4P0I A;  2V3T A;  2XXW A;  3C34 A;  4F31 B;  1MG1 A;  1Y4C A;  2QRY A;  2UVJ A;  3EQ1 A;  2ALU A;  5I59 A;  4G68 B;  3LC8 A;  1A8E A;  3K00 A;  1P1N A;  4GXA A;  1GV8 A;  3VLU A;  5JTY A;  4IO5 A;  2RF1 A;  3MAM A;  1A99 A;  1OMP A;  4BDO A;  3LUY A;  3MZ1 A;  2DWH A;  4POX A;  5CMM A;  3T9V A;  2DWJ A;  1PB7 A;  2UYE A;  1Y3Q A;  3VVE A;  4E0W A;  1NMU A;  1SDX A;  3PPO A;  1M5F A;  2FNC A;  1B7H A;  2I6E A;  2VHA A;  2XXU A;  3QK6 A;  5M2V A;  3PPN A;  4QHQ A;  2F5X A;  4JXI A;  2BJJ X;  3E3K A;  3RQT A;  3TCH A;  3VV5 A;  5KZT A;  3ZSF A;  1XOC A;  3K01 A;  2F6P A;  1D4N A;  3EPE A;  4KYE A;  2Z23 A;  4OXV A;  5ELV A;  5KDT B;  4QFK A;  3C33 A;  2GH9 A;  4H0W A;  1FW0 A;  3O29 A;  4NTL A;  4OYV A;  4YKI A;  4EXL A;  5ISU A;  2DVC A;  2HZL A;  5DT6 A;  2ZNT A;  3HHF A;  2XXX A;  2E0S A;  4IO2 A;  4P11 A;  3W15 C;  3RGY A;  5HM4 B;  2AYS A;  4EF1 A;  3IO4 A;  3FGS A;  3Q29 A;  4OTE A;  1IZ1 A;  2DVZ A;  3LR1 A;  3MVZ A;  1H3D A;  4HCW A;  2Y7R A;  4JSO A;  3VLW A;  3N94 A;  2DSF A;  3ZKK A;  1S50 A;  1N3W A;  1B40 A;  1XHY A;  2P1S A;  2QS2 A;  4GOT A;  5AA1 A;  4PFW A;  4LZ7 A;  3E4R A;  3OXN A;  2GFE A;  2REG A;  3SES A;  4NF8 B;  4NF4 B;  2YLN A;  1B58 A;  1UQW A;  1IQ7 A;  1B3F A;  1B46 A;  1WDN A;  1YCJ A;  4LP2 B;  4MF3 A;  2DE2 A;  5I58 A;  1N7X A;  4K3F A;  3RTF B;  3G3H A;  1FQC A;  1OQH A;  3O6G A;  5A5X A;  1O63 A;  2E1S A;  4YZZ A;  4R2F A;  2AIX A;  5J1D A;  1H44 A;  3K1P A;  3IB0 A;  4Q30 B;  1DSN A;  2O68 A;  4PP0 A;  1RYO A;  3JZJ A;  3S9E A;  4KQP A;  4RXL A;  1HSL A;  1Z7N E;  2V25 A;  2XX9 A;  4U2R A;  1O7T A;  3EHS A;  1P1W A;  4M1V A;  4ELR A;  4EQ7 A;  4R73 A;  1DPE A;  1B1X A;  5H8N A;  3BKI B;  3N26 A;  4N6P A;  3MVX A;  5I57 B;  4IO6 A;  1BP5 A;  4BDQ A;  1N0T A;  2H25 A;  3MC2 A;  3IOU A;  3QXM A;  4H5G A;  5H8H B;  1YPN A;  1B2H A;  5ITO A;  4EXK A;  2FA7 A;  4LA9 A;  3OEN A;  1JET A;  2F34 A;  4GLI A;  1GR2 A;  3OEL A;  4DXB A;  5EHM A;  4DCX A;  3TZA A;  3HST A;  1SYI A;  4RK9 A;  2DWA A;  1BKA A;  3V83 A;  1RYX A;  4QFN A;  4Z0I A;  3KOS A;  4YMA A;  3QUF A;  2I48 A;  4LZ5 A;  2NVU B;  3FVK A;  4NWC A;  1SI1 A;  5L9S A;  1NNK A;  4TLL B;  1EZP A;  3TAJ A;  3V8X B;  2HXW A;  3DM0 A;  4OHN A;  2Y7I A;  2R9J A;  2RKM A;  3K1N A;  4MLV A;  1UTH A;  2AL4 A;  3TMG A;  4ECF A;  4F3P A;  4ZEC A;  3I5O A;  1EZ9 A;  2ZXT A;  1PBP A;  1M5B A;  1LAG E;  4Q0C A;  1PDA A;  3PU5 A;  2ZYN A;  3CRB A;  2XXI A;  1USY E;  4GL0 A;  1POY 1;  1QJM A;  4IB2 A;  4OVJ A;  5TP9 A;  3SET A;  4F22 A;  1MY2 A;  3C9H A;  2UYF A;  5KDT A;  2Z22 A;  2RCA A;  2F35 A;  5FTH A;  1OQG A;  1SQY A;  2OBG A;  4FE8 A;  2IEE A;  4OQO A;  1LAF E;  3PV0 E;  3RTW B;  3KJ7 A;  3JYR A;  5FHN A;  4F18 A;  1MPB A;  4XKQ A;  4DXU A;  4KD5 A;  1H43 A;  2P2A A;  2YPN A;  4OFJ A;  1URD A;  3OOA A;  3O2A A;  4THI A;  1JEV A;  2D3I A;  3K0V A;  5FHO A;  3U72 A;  2XD3 A;  4QFO A;  5B70 A;  1P1U A;  4YKJ A;  2HEU A;  4PFU A;  2Y7W A;  3MQ9 A;  2Q2A A;  3P7I A;  4WXJ A;  4X9T A;  3B7D A;  5H8H A;  4ZZA A;  3WAE A;  3U8Q A;  5AA2 D;  5AA4 A;  5CM6 A;  5I57 A;  1LLS A;  4OFL A;  4JWO A;  5IKB A;  2XXR A;  2PYY A;  4WED A;  4EQB A;  5DVJ A;  2QS3 A;  4RK2 A;  1MRP A;  1MXX A;  4HTG A;  5F7V A;  3TTR A;  4IY6 A;  3PMX A;  3TFL A;  1USY H;  1LBB A;  1B7Z A;  3CR9 A;  3IO6 A;  3HN0 A;  2X26 A;  2UVH A;  1DOT A;  2Y84 A;  3F11 A;  3HV1 A;  3PPQ A;  4H1X A;  1GGG A;  3LSW A;  1I69 A;  5I56 A;  2XXQ A;  1B32 A;  1UTB A;  2REJ A;  1MDQ A;  1S9T A;  1XS5 A;  2CZL A;  3IAZ A;  3N5L A;  4U4S A;  2F36 A;  5H8Q B;  2H4I A;  4X48 A;  1Y1M A;  3KGC A;  1IXI A;  5EYF A;  4FAJ A;  3T66 A;  4ZED A;  1LFG A;  1LCT A;  1N3X A;  1QUK A;  5CBS A;  5I58 B;  3EHU A;  3DP4 A;  3SDF A;  5AA2 A;  4F3G A;  1QUI A;  2I0C A;  4R9F A;  1FQE A;  4ZE9 A;  1NNT A;  4UA8 A;  1B0L A;  1OLC A;  2AL5 A;  1A54 A;  3N6U A;  4G68 A;  3S2V A;  1JVY A;  3O9P A;  4XTC Q;  2O51 A;  3GLB A;  3PPP A;  4JWX A;  4U22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...