3CAGA

Crystal structure of the oligomerization domain hexamer of the arginine repressor protein from mycobacterium tuberculosis in complex with 9 arginines.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
b'TDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine repressor
publication title Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 22
structure length 77
sequence length 77
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3cagA00
1DD5A 3LPXA 3L4KA 1EK8A 1WQGA 3NUHA 3OPFA 3ERED 4KAWX 3LAPA 3MMLB 3QX3A 3OREA 4KB2A 1XXAA 2XCQA 5JVOA 3V4GA 1WQFA 1XXBA 2RGRA 4G0UA 3VA7A 4DDQA 1B4BA 1BGWA 1AB4A 4KC6A 3FOFA 4GFQA 4KDDA 3CAGA 2P5MA 1ISEA 2XCOA 2Y3PA 1BJTA 3FOEA 1B4AA 3BUEA 3LAJA 3OEPA 4FM9A 1WIHA 4G0VA 2KWAA 2ZFZA 2XCRB 3FHZA 1GE9A 1IS1A 1F9NA 1WQHA 1EH1A 1XXCA 4G0WA 4KB4A 4J3NA 2PHCB 5CJ9A 3L4JA 1ZVUA
chains in the Genus database with same CATH superfamily
1K83K 4G7ZA 3L4KA 4A3LC 1WQGA 1YCLA 3HOZC 2WB1L 2E2HA 1ZBSA 3M4OK 4KB2A 4MQ9A 4A3FK 3GSIA 1F93A 3S1NK 1TWCK 1WOOA 3PO2K 1WORA 3GTGK 4Q5SA 3BUEA 4GTLA 5M5WK 5IYBK 1J6WA 5C44C 4GTFA 3JSTA 5IYCK 2YU9K 1I50K 2PA8L 3S1MC 3CQZC 1TWAA 4A3GK 1IW7A 3ADAC 2R92C 1Y1VA 4KMDA 1Y1WA 3DXJA 5IORA 4A3JK 1VRQC 1K83A 4PABA 2JH3A 3S14K 3SZZA 4A3CK 4WILA 2VUMC 4KARA 3RZDC 5FLMC 1TWHC 1X31C 3AD9C 4ILDA 5JFEA 1XXBA 2B63A 1TWCA 5IP9K 4OIPA 4GFQA 3GTGA 1R9TK 1EQRA 1VLOA 4M1XA 4G0VA 4YG2A 3FHZA 1GE9A 2GSNA 4C3HK 1I50A 1ZXOA 4KN4A 3IPJA 4KMUA 4A3MC 1KQ4A 3WODA 4KAWX 3S1QC 4A3EC 1Y1VC 2CFAB 2Y0SL 5EGEA 1SFOC 2E2IC 1K83C 3FOEA 1JOEA 4MEXA 3M3YK 2GSOA 3M4OC 3H3VL 4A3FC 1F9NA 3GDZA 1TWCC 5C4XK 4J3NA 2PHCB 3PO2C 3GTGC 3GTMA 1DD5A 3GTKK 1JQWA 5IYBC 5IYCC 2YU9C 1I50C 1WCMK 4LJZA 4A3GC 1B4BA 3PO3K 4KC6A 4A3JC 4C3JK 4BY1K 3S14C 2R93K 4FM9A 4A3CC 5IOSA 5TMCA 4KATA 4GZYA 3HXAA 1INNA 1XZPA 3T02A 1PJ5A 4A3IK 3I4NK 1XPPA 5IP9C 5CJ9A 4QIWD 4KMHA 3AD7C 1R9TC 3GTKA 1ZYRA 4OIRA 4C3HC 1WCMA 2CW0A 1BGWA 1IQ0A 4KM9A 2JA8K 1V5VA 2NVXK 4KASA 2O5JA 2D6FC 3GEIA 3TFIA 1O2FB 1TWHA 2E2IK 4AYBL 2JA5K 4KB4A 2RGRA 3ERED 1J98A 2GAGC 3HOVK 2V6SA 3QX3A 3M3YC 5JVOA 4LQYA 1I6VA 5C4XC 3GTOK 3HOWK 2FQTA 4KN7A 3GTKC 2NVXA 1O26A 1O2BA 4A3KK 3HKZD 2NVYK 5IYDK 3GTPK 5TMFA 1WCMC 5M3MK 5M5XK 3PO3C 2R7ZK 4KMAA 4GTBA 1SFOA 1BDFA 3TFHA 1HQMA 2E2IA 3OPFA 4C3JC 2A68A 1PJ6A 4BY1C 2R93C 4Y7NK 4X6AC 1YX2A 4A3IC 1YNNA 2O5IA 3I4NC 1O24A 3GTOA 4KDDA 1BJTA 1YNJA 3S0XA 4G7HA 2EBBA 4XLPA 2ZFZA 2GSUA 2YU9A 5FJ8K 3AH5A 2ZUFA 3GEHA 1VJEA 2JA8C 4MEYA 3GTLK 2NVXC 4A93K 3RZOK 4YFNA 4G7OA 4QIWL 4A3BK 3T01A 5EGHA 3EQLA 2JA5C 3A8KA 3H0GK 4NOIA 2P5MA 1ISEA 3FKIK 1IL2A 1B4AA 1G51A 3LAJA 5L46A 1R9TA 3HOVC 1XZQA 4P5BA 1IS1A 1WQHA 3GTJK 3AQPA 3S1NC 3GTOC 3HOWC 4AH6A 2RH6A 4YFKA 3GTQK 3AD8C 3GTLA 3AQOA 4A3KC 2NVYC 3LAPA 4BBSK 5IYDC 3GTPC 1I3QK 2R7ZC 3A8IA 4ZH4A 2XCOA 3FKIA 1L0WA 4BY7K 1WSVA 4Y7NC 2JA6K 3TFJA 1XZPB 1ZQ1C 3G4AA 3GTJA 3HKZL 4GTDA 3HOXK 1XXAA 2XCQA 2JA7K 3FOFA 2V6TA 3GTLC 5C3EK 3RZDK 4P9SA 3K7AK 3RZOC 4A93C 2BE5A 1C0AA 2R93A 2FQOA 1TWFK 4Q4ZA 2JA6A 5IP7K 3S2DK 1HI9A 3H0GC 5D4DA 1ZVUA 3FKIC 3LPXA 2E2HK 3S2HK 3SZYA 1IE0A 5C4JK 5CHPA 4QJVA 3GTJC 4KM8A 1J6XA 1O2AA 5E68A 1VH2A 1O28A 1I6HK 1USOA 4C2MK 3S15K 1O27A 1O29A 3G4CA 2V6UA 2NVTK 3BP8C 1TWAK 2XCRB 4BBSC 4BBRK 1Y1WK 4BXXK 1I3QC 1SMYA 2WAQD 1DCPA 2JA5A 2PPBA 4OIQA 4BY7C 1F7VA 2JA6C 3OREA 2B63K 3V4GA 4GT9A 4A3DK 4G0UA 3VA7A 4XCHA 4Y52K 3HOUK 4GTEA 2NVQK 4GTCA 3GIRA 3OEPA 3HOXC 2P8TA 2KWAA 4WJ3M 2NVYA 1XXCA 3GTPA 4GTAA 3S17K 2JA7C 3BP3A 2R7ZA 4JK1A 4O2DA 1EI6A 3HOYK 1EK8A 3NUHA 2A6HA 5C3EC 3K7AC 4LR2A 4YFXA 1TWFC 1WQFA 5IP7C 3S2DC 2PMZD 3TTGA 1DCOA 1JVIA 3N3YA 2E2HC 3S2HC 1O25A 4AYBD 1TWGK 3S16K 5IOQA 5C4JC 1WIHA 1XZQB 4LOWA 1EH1A 2E2JK 5TJ3A 2WB1D 3GEEA 3GTMK 4C3IK 4XSZA 1I6HC 4C2MC 3S15C 4LLGA 2NVTC 3I4MK 1TWAC 4BBRC 1J6VA 1F7UA 1Y1WC 4BXXC 4WJ4A 2CFAA 5M5YK 3S1RK 4PAAA 3H0GA 4A3LK 2PA8D 3HOZK 1RU0A 1TWGA 5M3FK 1EFWA 1UV7A 2B63C 4P5AA 4A3DC 4Y52C 4XLNA 3HOUC 2NVQC 4OINA 1WOSA 3N0BA 1BS2A 2WAQL 3GTQA 5C44K 3MMLB 3S1MK 3CQZK 3T00A 2R92K 5HL8A 5IOTA 3S17C 1I3QA 4XSXA 3CAGA 1WSRA 2A69A 4OIOA 3HOYC 1USMA 4X6AK 2VUMK 5FLMK 1TWHK 2A6EA 3A8JA 4A3BC 4G0WA 4FZBA 3L4JA 1TWGC 4C45A 3S16C 2Y0SD 1PJ7A 1DCHA 3CQZA 4BLAA 4QJVB 2R92A 4DDQA 2E2JC 3GTMC 3N0CA 4C3IC 1WOPA 2ZUEA 1IBAA 2Y3PA 4BKWA 4LK0A 2JA7A 3H3VD 4A3MK 3GTQC 1VGXA 2PMZL 3S1QK 2VUMA 4A3EK 3I4MC 4LK1A 3Q3QA 1TWFA 1Y1VK 4RMFA 4BLBA 1SFOK 2GAHC 3S1RC 2W7VA 1AB4A
chains in the Genus database with same CATH topology
2RH6A 3L4KA 1EK8A 1WQGA 3NUHA 3GTKA 3GTLA 3AQOA 2E2HA 1ZBSA 3LAPA 4LR2A 4KB2A 4C3HC 1WQFA 1WCMA 1BGWA 3N3YA 4KM9A 2XCOA 3FKIA 1O25A 3BUEA 5IOQA 4GTLA 4KASA 1WIHA 4GTFA 1TWHA 1TWAA 1EH1A 3G4AA 1Y1VA 3GTJA 4KMDA 5TJ3A 1Y1WA 4KB4A 2RGRA 5IORA 4GTDA 1K83A 2JH3A 3ERED 4C2MC 4KARA 3QX3A 1XXAA 2XCQA 5JVOA 5JFEA 4ILDA 1XXBA 4LQYA 2B63A 1TWCA 2CFAA 3FOFA 4GFQA 3GTGA 3H0GA 2NVXA 1TWGA 1O26A 4M1XA 1O2BA 4G0VA 2R93A 3FHZA 2JA6A 1GE9A 2GSNA 4P5AA 1I50A 1ZXOA 4KMAA 4GTBA 1SFOA 1ZVUA 3LPXA 2E2IA 3N0BA 3OPFA 4C3JC 3GTQA 1KQ4A 4KAWX 3MMLB 5CHPA 4KM8A 5IOTA 2CFAB 5EGEA 1O24A 1I3QA 3GTOA 4KDDA 3CAGA 1O2AA 1BJTA 1O28A 3FOEA 3S0XA 1O27A 1O29A 3G4CA 2ZFZA 2XCRB 2GSOA 1F9NA 2GSUA 2YU9A 3AH5A 4G0WA 4J3NA 2PHCB 2JA5A 4FZBA 3L4JA 3GTMA 1DD5A 3OREA 3V4GA 3CQZA 4GT9A 4BLAA 5EGHA 4G0UA 3VA7A 4DDQA 1B4BA 2R92A 3N0CA 4C3IC 4GTEA 4KC6A 2P5MA 1ISEA 2Y3PA 4GTCA 4BKWA 2JA7A 1B4AA 3LAJA 3OEPA 4FM9A 1R9TA 5IOSA 2VUMA 4P5BA 2KWAA 4KATA 1IS1A 2NVYA 1WQHA 3Q3QA 1TWFA 1XXCA 3GTPA 3AQPA 4GTAA 4BLBA 5CJ9A 2R7ZA 1AB4A 4KMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DD5 A;  3LPX A;  3L4K A;  1EK8 A;  1WQG A;  3NUH A;  3OPF A;  3ERE D;  4KAW X;  3LAP A;  3MML B;  3QX3 A;  3ORE A;  4KB2 A;  1XXA A;  2XCQ A;  5JVO A;  3V4G A;  1WQF A;  1XXB A;  2RGR A;  4G0U A;  3VA7 A;  4DDQ A;  1B4B A;  1BGW A;  1AB4 A;  4KC6 A;  3FOF A;  4GFQ A;  4KDD A;  3CAG A;  2P5M A;  1ISE A;  2XCO A;  2Y3P A;  1BJT A;  3FOE A;  1B4A A;  3BUE A;  3LAJ A;  3OEP A;  4FM9 A;  1WIH A;  4G0V A;  2KWA A;  2ZFZ A;  2XCR B;  3FHZ A;  1GE9 A;  1IS1 A;  1F9N A;  1WQH A;  1EH1 A;  1XXC A;  4G0W A;  4KB4 A;  4J3N A;  2PHC B;  5CJ9 A;  3L4J A;  1ZVU A; 
#chains in the Genus database with same CATH topology
 1K83 K;  4G7Z A;  3L4K A;  4A3L C;  1WQG A;  1YCL A;  3HOZ C;  2WB1 L;  2E2H A;  1ZBS A;  3M4O K;  4KB2 A;  4MQ9 A;  4A3F K;  3GSI A;  1F93 A;  3S1N K;  1TWC K;  1WOO A;  3PO2 K;  1WOR A;  3GTG K;  4Q5S A;  3BUE A;  4GTL A;  5M5W K;  5IYB K;  1J6W A;  5C44 C;  4GTF A;  3JST A;  5IYC K;  2YU9 K;  1I50 K;  2PA8 L;  3S1M C;  3CQZ C;  1TWA A;  4A3G K;  1IW7 A;  3ADA C;  2R92 C;  1Y1V A;  4KMD A;  1Y1W A;  3DXJ A;  5IOR A;  4A3J K;  1VRQ C;  1K83 A;  4PAB A;  2JH3 A;  3S14 K;  3SZZ A;  4A3C K;  4WIL A;  2VUM C;  4KAR A;  3RZD C;  5FLM C;  1TWH C;  1X31 C;  3AD9 C;  4ILD A;  5JFE A;  1XXB A;  2B63 A;  1TWC A;  5IP9 K;  4OIP A;  4GFQ A;  3GTG A;  1R9T K;  1EQR A;  1VLO A;  4M1X A;  4G0V A;  4YG2 A;  3FHZ A;  1GE9 A;  2GSN A;  4C3H K;  1I50 A;  1ZXO A;  4KN4 A;  3IPJ A;  4KMU A;  4A3M C;  1KQ4 A;  3WOD A;  4KAW X;  3S1Q C;  4A3E C;  1Y1V C;  2CFA B;  2Y0S L;  5EGE A;  1SFO C;  2E2I C;  1K83 C;  3FOE A;  1JOE A;  4MEX A;  3M3Y K;  2GSO A;  3M4O C;  3H3V L;  4A3F C;  1F9N A;  3GDZ A;  1TWC C;  5C4X K;  4J3N A;  2PHC B;  3PO2 C;  3GTG C;  3GTM A;  1DD5 A;  3GTK K;  1JQW A;  5IYB C;  5IYC C;  2YU9 C;  1I50 C;  1WCM K;  4LJZ A;  4A3G C;  1B4B A;  3PO3 K;  4KC6 A;  4A3J C;  4C3J K;  4BY1 K;  3S14 C;  2R93 K;  4FM9 A;  4A3C C;  5IOS A;  5TMC A;  4KAT A;  4GZY A;  3HXA A;  1INN A;  1XZP A;  3T02 A;  1PJ5 A;  4A3I K;  3I4N K;  1XPP A;  5IP9 C;  5CJ9 A;  4QIW D;  4KMH A;  3AD7 C;  1R9T C;  3GTK A;  1ZYR A;  4OIR A;  4C3H C;  1WCM A;  2CW0 A;  1BGW A;  1IQ0 A;  4KM9 A;  2JA8 K;  1V5V A;  2NVX K;  4KAS A;  2O5J A;  2D6F C;  3GEI A;  3TFI A;  1O2F B;  1TWH A;  2E2I K;  4AYB L;  2JA5 K;  4KB4 A;  2RGR A;  3ERE D;  1J98 A;  2GAG C;  3HOV K;  2V6S A;  3QX3 A;  3M3Y C;  5JVO A;  4LQY A;  1I6V A;  5C4X C;  3GTO K;  3HOW K;  2FQT A;  4KN7 A;  3GTK C;  2NVX A;  1O26 A;  1O2B A;  4A3K K;  3HKZ D;  2NVY K;  5IYD K;  3GTP K;  5TMF A;  1WCM C;  5M3M K;  5M5X K;  3PO3 C;  2R7Z K;  4KMA A;  4GTB A;  1SFO A;  1BDF A;  3TFH A;  1HQM A;  2E2I A;  3OPF A;  4C3J C;  2A68 A;  1PJ6 A;  4BY1 C;  2R93 C;  4Y7N K;  4X6A C;  1YX2 A;  4A3I C;  1YNN A;  2O5I A;  3I4N C;  1O24 A;  3GTO A;  4KDD A;  1BJT A;  1YNJ A;  3S0X A;  4G7H A;  2EBB A;  4XLP A;  2ZFZ A;  2GSU A;  2YU9 A;  5FJ8 K;  3AH5 A;  2ZUF A;  3GEH A;  1VJE A;  2JA8 C;  4MEY A;  3GTL K;  2NVX C;  4A93 K;  3RZO K;  4YFN A;  4G7O A;  4QIW L;  4A3B K;  3T01 A;  5EGH A;  3EQL A;  2JA5 C;  3A8K A;  3H0G K;  4NOI A;  2P5M A;  1ISE A;  3FKI K;  1IL2 A;  1B4A A;  1G51 A;  3LAJ A;  5L46 A;  1R9T A;  3HOV C;  1XZQ A;  4P5B A;  1IS1 A;  1WQH A;  3GTJ K;  3AQP A;  3S1N C;  3GTO C;  3HOW C;  4AH6 A;  2RH6 A;  4YFK A;  3GTQ K;  3AD8 C;  3GTL A;  3AQO A;  4A3K C;  2NVY C;  3LAP A;  4BBS K;  5IYD C;  3GTP C;  1I3Q K;  2R7Z C;  3A8I A;  4ZH4 A;  2XCO A;  3FKI A;  1L0W A;  4BY7 K;  1WSV A;  4Y7N C;  2JA6 K;  3TFJ A;  1XZP B;  1ZQ1 C;  3G4A A;  3GTJ A;  3HKZ L;  4GTD A;  3HOX K;  1XXA A;  2XCQ A;  2JA7 K;  3FOF A;  2V6T A;  3GTL C;  5C3E K;  3RZD K;  4P9S A;  3K7A K;  3RZO C;  4A93 C;  2BE5 A;  1C0A A;  2R93 A;  2FQO A;  1TWF K;  4Q4Z A;  2JA6 A;  5IP7 K;  3S2D K;  1HI9 A;  3H0G C;  5D4D A;  1ZVU A;  3FKI C;  3LPX A;  2E2H K;  3S2H K;  3SZY A;  1IE0 A;  5C4J K;  5CHP A;  4QJV A;  3GTJ C;  4KM8 A;  1J6X A;  1O2A A;  5E68 A;  1VH2 A;  1O28 A;  1I6H K;  1USO A;  4C2M K;  3S15 K;  1O27 A;  1O29 A;  3G4C A;  2V6U A;  2NVT K;  3BP8 C;  1TWA K;  2XCR B;  4BBS C;  4BBR K;  1Y1W K;  4BXX K;  1I3Q C;  1SMY A;  2WAQ D;  1DCP A;  2JA5 A;  2PPB A;  4OIQ A;  4BY7 C;  1F7V A;  2JA6 C;  3ORE A;  2B63 K;  3V4G A;  4GT9 A;  4A3D K;  4G0U A;  3VA7 A;  4XCH A;  4Y52 K;  3HOU K;  4GTE A;  2NVQ K;  4GTC A;  3GIR A;  3OEP A;  3HOX C;  2P8T A;  2KWA A;  4WJ3 M;  2NVY A;  1XXC A;  3GTP A;  4GTA A;  3S17 K;  2JA7 C;  3BP3 A;  2R7Z A;  4JK1 A;  4O2D A;  1EI6 A;  3HOY K;  1EK8 A;  3NUH A;  2A6H A;  5C3E C;  3K7A C;  4LR2 A;  4YFX A;  1TWF C;  1WQF A;  5IP7 C;  3S2D C;  2PMZ D;  3TTG A;  1DCO A;  1JVI A;  3N3Y A;  2E2H C;  3S2H C;  1O25 A;  4AYB D;  1TWG K;  3S16 K;  5IOQ A;  5C4J C;  1WIH A;  1XZQ B;  4LOW A;  1EH1 A;  2E2J K;  5TJ3 A;  2WB1 D;  3GEE A;  3GTM K;  4C3I K;  4XSZ A;  1I6H C;  4C2M C;  3S15 C;  4LLG A;  2NVT C;  3I4M K;  1TWA C;  4BBR C;  1J6V A;  1F7U A;  1Y1W C;  4BXX C;  4WJ4 A;  2CFA A;  5M5Y K;  3S1R K;  4PAA A;  3H0G A;  4A3L K;  2PA8 D;  3HOZ K;  1RU0 A;  1TWG A;  5M3F K;  1EFW A;  1UV7 A;  2B63 C;  4P5A A;  4A3D C;  4Y52 C;  4XLN A;  3HOU C;  2NVQ C;  4OIN A;  1WOS A;  3N0B A;  1BS2 A;  2WAQ L;  3GTQ A;  5C44 K;  3MML B;  3S1M K;  3CQZ K;  3T00 A;  2R92 K;  5HL8 A;  5IOT A;  3S17 C;  1I3Q A;  4XSX A;  3CAG A;  1WSR A;  2A69 A;  4OIO A;  3HOY C;  1USM A;  4X6A K;  2VUM K;  5FLM K;  1TWH K;  2A6E A;  3A8J A;  4A3B C;  4G0W A;  4FZB A;  3L4J A;  1TWG C;  4C45 A;  3S16 C;  2Y0S D;  1PJ7 A;  1DCH A;  3CQZ A;  4BLA A;  4QJV B;  2R92 A;  4DDQ A;  2E2J C;  3GTM C;  3N0C A;  4C3I C;  1WOP A;  2ZUE A;  1IBA A;  2Y3P A;  4BKW A;  4LK0 A;  2JA7 A;  3H3V D;  4A3M K;  3GTQ C;  1VGX A;  2PMZ L;  3S1Q K;  2VUM A;  4A3E K;  3I4M C;  4LK1 A;  3Q3Q A;  1TWF A;  1Y1V K;  4RMF A;  4BLB A;  1SFO K;  2GAH C;  3S1R C;  2W7V A;  1AB4 A; 
#chains in the Genus database with same CATH homology
 2RH6 A;  3L4K A;  1EK8 A;  1WQG A;  3NUH A;  3GTK A;  3GTL A;  3AQO A;  2E2H A;  1ZBS A;  3LAP A;  4LR2 A;  4KB2 A;  4C3H C;  1WQF A;  1WCM A;  1BGW A;  3N3Y A;  4KM9 A;  2XCO A;  3FKI A;  1O25 A;  3BUE A;  5IOQ A;  4GTL A;  4KAS A;  1WIH A;  4GTF A;  1TWH A;  1TWA A;  1EH1 A;  3G4A A;  1Y1V A;  3GTJ A;  4KMD A;  5TJ3 A;  1Y1W A;  4KB4 A;  2RGR A;  5IOR A;  4GTD A;  1K83 A;  2JH3 A;  3ERE D;  4C2M C;  4KAR A;  3QX3 A;  1XXA A;  2XCQ A;  5JVO A;  5JFE A;  4ILD A;  1XXB A;  4LQY A;  2B63 A;  1TWC A;  2CFA A;  3FOF A;  4GFQ A;  3GTG A;  3H0G A;  2NVX A;  1TWG A;  1O26 A;  4M1X A;  1O2B A;  4G0V A;  2R93 A;  3FHZ A;  2JA6 A;  1GE9 A;  2GSN A;  4P5A A;  1I50 A;  1ZXO A;  4KMA A;  4GTB A;  1SFO A;  1ZVU A;  3LPX A;  2E2I A;  3N0B A;  3OPF A;  4C3J C;  3GTQ A;  1KQ4 A;  4KAW X;  3MML B;  5CHP A;  4KM8 A;  5IOT A;  2CFA B;  5EGE A;  1O24 A;  1I3Q A;  3GTO A;  4KDD A;  3CAG A;  1O2A A;  1BJT A;  1O28 A;  3FOE A;  3S0X A;  1O27 A;  1O29 A;  3G4C A;  2ZFZ A;  2XCR B;  2GSO A;  1F9N A;  2GSU A;  2YU9 A;  3AH5 A;  4G0W A;  4J3N A;  2PHC B;  2JA5 A;  4FZB A;  3L4J A;  3GTM A;  1DD5 A;  3ORE A;  3V4G A;  3CQZ A;  4GT9 A;  4BLA A;  5EGH A;  4G0U A;  3VA7 A;  4DDQ A;  1B4B A;  2R92 A;  3N0C A;  4C3I C;  4GTE A;  4KC6 A;  2P5M A;  1ISE A;  2Y3P A;  4GTC A;  4BKW A;  2JA7 A;  1B4A A;  3LAJ A;  3OEP A;  4FM9 A;  1R9T A;  5IOS A;  2VUM A;  4P5B A;  2KWA A;  4KAT A;  1IS1 A;  2NVY A;  1WQH A;  3Q3Q A;  1TWF A;  1XXC A;  3GTP A;  3AQP A;  4GTA A;  4BLB A;  5CJ9 A;  2R7Z A;  1AB4 A;  4KMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...