3CAGA

Crystal structure of the oligomerization domain hexamer of the arginine repressor protein from mycobacterium tuberculosis in complex with 9 arginines.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
TDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine repressor
publication title Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 22
structure length 77
sequence length 77
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3cagA00
1EH1A 3FOEA 5CJ9A 3OREA 4G0WA 1XXBA 1ZVUA 3MMLB 3BUEA 4KAWX 1GE9A 1BJTA 2P5MA 3LPXA 3LAJA 4G0VA 3L4KA 1DD5A 1ISEA 1F9NA 2XCOA 4DDQA 3VA7A 3OEPA 4J3NA 1B4AA 1WQFA 3CAGA 4KB4A 1BGWA 1AB4A 3OPFA 1EK8A 1XXAA 4KC6A 3ERED 4GFQA 3NUHA 2XCRB 4KB2A 2PHCB 1WQGA 3LAPA 1WQHA 1B4BA 3QX3A 3L4JA 2XCQA 4KDDA 2RGRA 2Y3PA 1XXCA 3V4GA 2KWAA 1IS1A 2ZFZA 5JVOA 4FM9A 4G0UA 3FHZA 3FOFA 1WIHA
chains in the Genus database with same CATH superfamily
1TWGA 3S1RC 3FOEA 4C2MC 3GTGK 1J6WA 3HOVC 1TWAC 1O29A 4AYBD 3H0GC 5CHPA 1Y1WA 3CQZC 3GEHA 3PO3C 1F9NA 4Y52C 4O2DA 1B4AA 2V6SA 4Q5SA 4M1XA 4OIQA 3I4MC 4Y7NK 4BLAA 2CFAB 3A8JA 3TFJA 4P5BA 5IYCK 2RGRA 2V6UA 3S1RK 4KN7A 5IP7C 3GTJA 4C2MK 1TWFC 3HOVK 1I50K 3AD9C 2JH3A 1TWAK 2D6FC 1HI9A 3H0GK 1WOOA 3CQZK 2P5MA 3PO3K 1K83A 3M3YC 2R7ZA 4Y52K 4BLBA 2P8TA 1WOPA 1DD5A 3AD7C 5TMFA 5L46A 4MEXA 3RZOC 1AB4A 3I4MK 2JA6C 3HOXC 4BXXC 2VUMC 1USOA 4C3JC 1J6VA 1TWFK 3L4JA 3GSIA 3WODA 1YX2A 3M3YK 3MMLB 4BY1C 2NVQC 4GTEA 3N0BA 3RZOK 4WJ3M 2JA6K 2YU9C 4XLNA 3HOXK 2JA8C 3H3VL 3HOYC 4BXXK 2VUMK 3ERED 1XZPA 4BKWA 4KB2A 4C3JK 2EBBA 5FLMC 1B4BA 2WB1L 4FM9A 2Y0SD 4G0UA 4GZYA 1BDFA 5IYDC 3AQOA 4BY1K 2NVQK 3BP8C 1BJTA 2WB1D 1X31C 3LAJA 1F7UA 2YU9K 1JQWA 2JA8K 3HOYK 2GSUA 2NVYA 3T00A 3AQPA 1EQRA 3NUHA 4GFQA 5FLMK 2NVTC 4A3FK 4A3BK 3HOWC 3S16C 4BBRC 1VRQC 3GTPC 1R9TA 1WSRA 4C3HC 3GTQC 5IYDK 4RMFA 1ZBSA 3GEEA 4GTCA 2JA7C 1Y1VK 1USMA 4ZH4A 1I6HC 3S0XA 4KATA 3GEIA 2NVTK 4KC6A 4OIRA 3Q3QA 3HOWK 3GTMC 3S16K 4BBRK 2E2IA 3GTPK 2PHCB 1WQGA 3GTKC 5TMCA 3HKZD 5IP9C 3QX3A 3GTQK 3BP3A 3HOZC 3N3YA 1O2BA 1XZPB 2NVXA 3RZDC 3GTOA 4C45A 4KAWX 2JA7K 1ZQ1C 1SFOA 3AD8C 3S2HC 2PMZL 2XCOA 3GIRA 5EGHA 4A3CC 3GTMK 1EK8A 4MEYA 3GTKK 5IOQA 5IP9K 4GTFA 2R93A 2JA5C 5EGEA 3HOZK 3GTGA 2ZFZA 4YFKA 2E2HA 1WSVA 1J98A 3DXJA 3RZDK 4OIPA 4KASA 4G0WA 5FJ8K 3S2HK 4KARA 4LR2A 5JFEA 1I3QC 1O24A 2A6HA 4A3CK 5C44C 1BS2A 4P9SA 4KB4A 3CAGA 4LJZA 2PA8L 3PO2C 4G7HA 3S14C 4YFXA 5M3MK 4LK1A 2JA5K 4WJ4A 4A93C 5D4DA 3GTLA 1I50A 1TWAA 1XPPA 1WOSA 1ZXOA 2PA8D 4GTDA 4XLPA 5JVOA 3H0GA 5IP7K 3CQZA 1ZYRA 1EH1A 2PPBA 4QIWL 2O5JA 2BE5A 2GSNA 2A68A 1ZVUA 1XZQA 1I3QK 1GE9A 4GTBA 4JK1A 1DCPA 4QJVA 4XCHA 1G51A 5HL8A 4X6AC 4XSZA 3PO2K 3S14K 4QIWD 5C3EC 4A93K 1TWHC 1TWFA 4GTAA 3N0CA 1PJ6A 3SZZA 4C3IC 2R92C 2KWAA 3T01A 3TFHA 3H3VD 1TWCC 5IOTA 2FQTA 4A3GC 1WCMC 2JA6A 1O27A 1XXBA 3BUEA 3T02A 1KQ4A 3FKIC 4BY7C 3LPXA 4A3EC 2VUMA 2ZUFA 3L4KA 4X6AK 3SZYA 4DDQA 4GT9A 5C3EK 4LLGA 1I6VA 2B63C 1BGWA 1TWHK 4ILDA 4KMHA 1RU0A 2GAHC 2XCRB 4C3IK 2R92K 3JSTA 1IQ0A 2XCQA 1TWCK 3HOUC 4BBSC 3K7AC 5TJ3A 3TTGA 1VLOA 4A3GK 1WCMK 1V5VA 2YU9A 1YCLA 4BY7K 3FKIK 4YFNA 4A3EK 4Q4ZA 4G7ZA 2B63K 2R7ZC 1TWGC 1IE0A 3GTOC 3OPFA 1YNJA 3I4NC 1Y1WC 1HQMA 4KN4A 4LK0A 3HOUK 4BBSK 5C4XC 4C3HK 1IS1A 1EI6A 3A8KA 4P5AA 4NOIA 1Y1VA 2A69A 5CJ9A 1JVIA 2R7ZK 2E2HC 4A3IC 1TWGK 1JOEA 1DCOA 2WAQL 1I6HK 3GTJC 3OEPA 4J3NA 3S17C 3GTPA 3GTQA 3I4NK 1O2FB 1XXAA 3ADAC 1Y1WK 3S1QC 1K83C 2FQOA 5C4XK 2WAQD 4PABA 2PMZD 4AYBL 4FZBA 5M3FK 1VGXA 2JA7A 3GTLC 3EQLA 1I50C 4PAAA 4A3MC 2E2HK 4A3IK 2W7VA 3A8IA 1VJEA 3GTJK 3GTMA 3S2DC 3S17K 3GTKA 3GDZA 1WQFA 1O28A 1K83K 3S1QK 1L0WA 5IORA 5M5YK 4WILA 4LOWA 1UV7A 3GTLK 3FHZA 2A6EA 1IBAA 4GTLA 3HXAA 4A3MK 3OREA 3S2DK 1PJ5A 4A3DC 1DCHA 2GAGC 4OIOA 5C44K 2JA5A 3VA7A 5M5XK 2V6TA 3TFIA 3IPJA 4KMDA 4A3LC 1EFWA 4XSXA 1O2AA 4A3KC 2NVYC 3S1MC 1SMYA 4KM9A 1I3QA 3FOFA 5IYBC 4A3DK 1R9TC 4G0VA 2CW0A 2O5IA 1ISEA 1F93A 4A3LK 2Y0SL 3M4OC 5C4JC 2RH6A 5E68A 1J6XA 1O25A 2NVYK 4A3JC 4A3KK 3S1MK 4A3FC 4A3BC 4KDDA 2Y3PA 1XXCA 3V4GA 5IYBK 1WORA 1WIHA 2GSOA 2E2IC 1R9TK 4YG2A 1TWHA 2CFAA 1Y1VC 3M4OK 1IL2A 5C4JK 2R92A 2NVXC 4A3JK 1TWCA 1O26A 1F7VA 1SFOC 3S15C 1XZQB 3G4AA 1WQHA 1WCMA 3S1NC 4KMUA 4QJVB 3FKIA 3K7AK 4MQ9A 2E2IK 2E2JC 5IOSA 5M5WK 2B63A 1VH2A 4AH6A 2R93C 4G7OA 3GTGC 4KM8A 3G4CA 3HKZL 2NVXK 1C0AA 2ZUEA 1PJ7A 3GTOK 1SFOK 3S15K 4LQYA 3S1NK 4KMAA 1IW7A 3LAPA 4Y7NC 1INNA 3AH5A 4OINA 2E2JK 5IYCC 2R93K 1YNNA
chains in the Genus database with same CATH topology
1TWGA 1ZBSA 3FOEA 4GTCA 4C2MC 3OREA 2JA6A 1O27A 1XXBA 1O29A 3BUEA 1KQ4A 3LPXA 2VUMA 5CHPA 1Y1WA 3L4KA 2JA5A 3VA7A 1F9NA 4DDQA 4GT9A 3S0XA 1B4AA 4KATA 1BGWA 4ILDA 4KMDA 4M1XA 4KC6A 4KMHA 3Q3QA 2XCRB 2E2IA 4BLAA 2PHCB 1WQGA 2CFAB 1O2AA 3QX3A 4P5BA 2XCQA 2RGRA 4KM9A 5TJ3A 3N3YA 1I3QA 3FOFA 1O2BA 3GTJA 2JH3A 2YU9A 2NVXA 3GTOA 4KAWX 2P5MA 1SFOA 1K83A 4BLBA 4G0VA 1DD5A 1ISEA 2XCOA 5EGHA 1AB4A 3OPFA 1EK8A 2RH6A 1O25A 5IOQA 4GTFA 2R93A 5EGEA 4C3JC 4KDDA 3GTGA 2Y3PA 1XXCA 3V4GA 1IS1A 2ZFZA 4P5AA 2E2HA 1WIHA 3L4JA 2GSOA 1Y1VA 4KASA 5CJ9A 4G0WA 3MMLB 1TWHA 4KARA 4LR2A 5JFEA 2CFAA 4GTEA 3N0BA 1O24A 3OEPA 4J3NA 3GTPA 4KB4A 3CAGA 2R92A 3GTQA 1XXAA 1TWCA 1O26A 3ERED 4BKWA 4KB2A 3GTLA 3G4AA 1WQHA 1WCMA 1B4BA 1I50A 1TWAA 4FZBA 1ZXOA 3FKIA 4GTDA 5JVOA 3H0GA 4FM9A 4G0UA 3CQZA 2JA7A 5IOSA 1EH1A 2B63A 3AQOA 2GSNA 1ZVUA 1GE9A 1BJTA 4GTBA 3GTMA 3LAJA 4KM8A 3GTKA 3G4CA 2GSUA 2NVYA 1WQFA 1O28A 4LQYA 1TWFA 3AQPA 3NUHA 4GFQA 4KMAA 4GTAA 5IORA 3N0CA 3LAPA 1R9TA 3AH5A 4C3IC 4C3HC 2KWAA 3FHZA 2R7ZA 5IOTA 4GTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH1 A;  3FOE A;  5CJ9 A;  3ORE A;  4G0W A;  1XXB A;  1ZVU A;  3MML B;  3BUE A;  4KAW X;  1GE9 A;  1BJT A;  2P5M A;  3LPX A;  3LAJ A;  4G0V A;  3L4K A;  1DD5 A;  1ISE A;  1F9N A;  2XCO A;  4DDQ A;  3VA7 A;  3OEP A;  4J3N A;  1B4A A;  1WQF A;  3CAG A;  4KB4 A;  1BGW A;  1AB4 A;  3OPF A;  1EK8 A;  1XXA A;  4KC6 A;  3ERE D;  4GFQ A;  3NUH A;  2XCR B;  4KB2 A;  2PHC B;  1WQG A;  3LAP A;  1WQH A;  1B4B A;  3QX3 A;  3L4J A;  2XCQ A;  4KDD A;  2RGR A;  2Y3P A;  1XXC A;  3V4G A;  2KWA A;  1IS1 A;  2ZFZ A;  5JVO A;  4FM9 A;  4G0U A;  3FHZ A;  3FOF A;  1WIH A; 
#chains in the Genus database with same CATH topology
 1TWG A;  3S1R C;  3FOE A;  4C2M C;  3GTG K;  1J6W A;  3HOV C;  1TWA C;  1O29 A;  4AYB D;  3H0G C;  5CHP A;  1Y1W A;  3CQZ C;  3GEH A;  3PO3 C;  1F9N A;  4Y52 C;  4O2D A;  1B4A A;  2V6S A;  4Q5S A;  4M1X A;  4OIQ A;  3I4M C;  4Y7N K;  4BLA A;  2CFA B;  3A8J A;  3TFJ A;  4P5B A;  5IYC K;  2RGR A;  2V6U A;  3S1R K;  4KN7 A;  5IP7 C;  3GTJ A;  4C2M K;  1TWF C;  3HOV K;  1I50 K;  3AD9 C;  2JH3 A;  1TWA K;  2D6F C;  1HI9 A;  3H0G K;  1WOO A;  3CQZ K;  2P5M A;  3PO3 K;  1K83 A;  3M3Y C;  2R7Z A;  4Y52 K;  4BLB A;  2P8T A;  1WOP A;  1DD5 A;  3AD7 C;  5TMF A;  5L46 A;  4MEX A;  3RZO C;  1AB4 A;  3I4M K;  2JA6 C;  3HOX C;  4BXX C;  2VUM C;  1USO A;  4C3J C;  1J6V A;  1TWF K;  3L4J A;  3GSI A;  3WOD A;  1YX2 A;  3M3Y K;  3MML B;  4BY1 C;  2NVQ C;  4GTE A;  3N0B A;  3RZO K;  4WJ3 M;  2JA6 K;  2YU9 C;  4XLN A;  3HOX K;  2JA8 C;  3H3V L;  3HOY C;  4BXX K;  2VUM K;  3ERE D;  1XZP A;  4BKW A;  4KB2 A;  4C3J K;  2EBB A;  5FLM C;  1B4B A;  2WB1 L;  4FM9 A;  2Y0S D;  4G0U A;  4GZY A;  1BDF A;  5IYD C;  3AQO A;  4BY1 K;  2NVQ K;  3BP8 C;  1BJT A;  2WB1 D;  1X31 C;  3LAJ A;  1F7U A;  2YU9 K;  1JQW A;  2JA8 K;  3HOY K;  2GSU A;  2NVY A;  3T00 A;  3AQP A;  1EQR A;  3NUH A;  4GFQ A;  5FLM K;  2NVT C;  4A3F K;  4A3B K;  3HOW C;  3S16 C;  4BBR C;  1VRQ C;  3GTP C;  1R9T A;  1WSR A;  4C3H C;  3GTQ C;  5IYD K;  4RMF A;  1ZBS A;  3GEE A;  4GTC A;  2JA7 C;  1Y1V K;  1USM A;  4ZH4 A;  1I6H C;  3S0X A;  4KAT A;  3GEI A;  2NVT K;  4KC6 A;  4OIR A;  3Q3Q A;  3HOW K;  3GTM C;  3S16 K;  4BBR K;  2E2I A;  3GTP K;  2PHC B;  1WQG A;  3GTK C;  5TMC A;  3HKZ D;  5IP9 C;  3QX3 A;  3GTQ K;  3BP3 A;  3HOZ C;  3N3Y A;  1O2B A;  1XZP B;  2NVX A;  3RZD C;  3GTO A;  4C45 A;  4KAW X;  2JA7 K;  1ZQ1 C;  1SFO A;  3AD8 C;  3S2H C;  2PMZ L;  2XCO A;  3GIR A;  5EGH A;  4A3C C;  3GTM K;  1EK8 A;  4MEY A;  3GTK K;  5IOQ A;  5IP9 K;  4GTF A;  2R93 A;  2JA5 C;  5EGE A;  3HOZ K;  3GTG A;  2ZFZ A;  4YFK A;  2E2H A;  1WSV A;  1J98 A;  3DXJ A;  3RZD K;  4OIP A;  4KAS A;  4G0W A;  5FJ8 K;  3S2H K;  4KAR A;  4LR2 A;  5JFE A;  1I3Q C;  1O24 A;  2A6H A;  4A3C K;  5C44 C;  1BS2 A;  4P9S A;  4KB4 A;  3CAG A;  4LJZ A;  2PA8 L;  3PO2 C;  4G7H A;  3S14 C;  4YFX A;  5M3M K;  4LK1 A;  2JA5 K;  4WJ4 A;  4A93 C;  5D4D A;  3GTL A;  1I50 A;  1TWA A;  1XPP A;  1WOS A;  1ZXO A;  2PA8 D;  4GTD A;  4XLP A;  5JVO A;  3H0G A;  5IP7 K;  3CQZ A;  1ZYR A;  1EH1 A;  2PPB A;  4QIW L;  2O5J A;  2BE5 A;  2GSN A;  2A68 A;  1ZVU A;  1XZQ A;  1I3Q K;  1GE9 A;  4GTB A;  4JK1 A;  1DCP A;  4QJV A;  4XCH A;  1G51 A;  5HL8 A;  4X6A C;  4XSZ A;  3PO2 K;  3S14 K;  4QIW D;  5C3E C;  4A93 K;  1TWH C;  1TWF A;  4GTA A;  3N0C A;  1PJ6 A;  3SZZ A;  4C3I C;  2R92 C;  2KWA A;  3T01 A;  3TFH A;  3H3V D;  1TWC C;  5IOT A;  2FQT A;  4A3G C;  1WCM C;  2JA6 A;  1O27 A;  1XXB A;  3BUE A;  3T02 A;  1KQ4 A;  3FKI C;  4BY7 C;  3LPX A;  4A3E C;  2VUM A;  2ZUF A;  3L4K A;  4X6A K;  3SZY A;  4DDQ A;  4GT9 A;  5C3E K;  4LLG A;  1I6V A;  2B63 C;  1BGW A;  1TWH K;  4ILD A;  4KMH A;  1RU0 A;  2GAH C;  2XCR B;  4C3I K;  2R92 K;  3JST A;  1IQ0 A;  2XCQ A;  1TWC K;  3HOU C;  4BBS C;  3K7A C;  5TJ3 A;  3TTG A;  1VLO A;  4A3G K;  1WCM K;  1V5V A;  2YU9 A;  1YCL A;  4BY7 K;  3FKI K;  4YFN A;  4A3E K;  4Q4Z A;  4G7Z A;  2B63 K;  2R7Z C;  1TWG C;  1IE0 A;  3GTO C;  3OPF A;  1YNJ A;  3I4N C;  1Y1W C;  1HQM A;  4KN4 A;  4LK0 A;  3HOU K;  4BBS K;  5C4X C;  4C3H K;  1IS1 A;  1EI6 A;  3A8K A;  4P5A A;  4NOI A;  1Y1V A;  2A69 A;  5CJ9 A;  1JVI A;  2R7Z K;  2E2H C;  4A3I C;  1TWG K;  1JOE A;  1DCO A;  2WAQ L;  1I6H K;  3GTJ C;  3OEP A;  4J3N A;  3S17 C;  3GTP A;  3GTQ A;  3I4N K;  1O2F B;  1XXA A;  3ADA C;  1Y1W K;  3S1Q C;  1K83 C;  2FQO A;  5C4X K;  2WAQ D;  4PAB A;  2PMZ D;  4AYB L;  4FZB A;  5M3F K;  1VGX A;  2JA7 A;  3GTL C;  3EQL A;  1I50 C;  4PAA A;  4A3M C;  2E2H K;  4A3I K;  2W7V A;  3A8I A;  1VJE A;  3GTJ K;  3GTM A;  3S2D C;  3S17 K;  3GTK A;  3GDZ A;  1WQF A;  1O28 A;  1K83 K;  3S1Q K;  1L0W A;  5IOR A;  5M5Y K;  4WIL A;  4LOW A;  1UV7 A;  3GTL K;  3FHZ A;  2A6E A;  1IBA A;  4GTL A;  3HXA A;  4A3M K;  3ORE A;  3S2D K;  1PJ5 A;  4A3D C;  1DCH A;  2GAG C;  4OIO A;  5C44 K;  2JA5 A;  3VA7 A;  5M5X K;  2V6T A;  3TFI A;  3IPJ A;  4KMD A;  4A3L C;  1EFW A;  4XSX A;  1O2A A;  4A3K C;  2NVY C;  3S1M C;  1SMY A;  4KM9 A;  1I3Q A;  3FOF A;  5IYB C;  4A3D K;  1R9T C;  4G0V A;  2CW0 A;  2O5I A;  1ISE A;  1F93 A;  4A3L K;  2Y0S L;  3M4O C;  5C4J C;  2RH6 A;  5E68 A;  1J6X A;  1O25 A;  2NVY K;  4A3J C;  4A3K K;  3S1M K;  4A3F C;  4A3B C;  4KDD A;  2Y3P A;  1XXC A;  3V4G A;  5IYB K;  1WOR A;  1WIH A;  2GSO A;  2E2I C;  1R9T K;  4YG2 A;  1TWH A;  2CFA A;  1Y1V C;  3M4O K;  1IL2 A;  5C4J K;  2R92 A;  2NVX C;  4A3J K;  1TWC A;  1O26 A;  1F7V A;  1SFO C;  3S15 C;  1XZQ B;  3G4A A;  1WQH A;  1WCM A;  3S1N C;  4KMU A;  4QJV B;  3FKI A;  3K7A K;  4MQ9 A;  2E2I K;  2E2J C;  5IOS A;  5M5W K;  2B63 A;  1VH2 A;  4AH6 A;  2R93 C;  4G7O A;  3GTG C;  4KM8 A;  3G4C A;  3HKZ L;  2NVX K;  1C0A A;  2ZUE A;  1PJ7 A;  3GTO K;  1SFO K;  3S15 K;  4LQY A;  3S1N K;  4KMA A;  1IW7 A;  3LAP A;  4Y7N C;  1INN A;  3AH5 A;  4OIN A;  2E2J K;  5IYC C;  2R93 K;  1YNN A; 
#chains in the Genus database with same CATH homology
 1TWG A;  1ZBS A;  3FOE A;  4GTC A;  4C2M C;  3ORE A;  2JA6 A;  1O27 A;  1XXB A;  1O29 A;  3BUE A;  1KQ4 A;  3LPX A;  2VUM A;  5CHP A;  1Y1W A;  3L4K A;  2JA5 A;  3VA7 A;  1F9N A;  4DDQ A;  4GT9 A;  3S0X A;  1B4A A;  4KAT A;  1BGW A;  4ILD A;  4KMD A;  4M1X A;  4KC6 A;  4KMH A;  3Q3Q A;  2XCR B;  2E2I A;  4BLA A;  2PHC B;  1WQG A;  2CFA B;  1O2A A;  3QX3 A;  4P5B A;  2XCQ A;  2RGR A;  4KM9 A;  5TJ3 A;  3N3Y A;  1I3Q A;  3FOF A;  1O2B A;  3GTJ A;  2JH3 A;  2YU9 A;  2NVX A;  3GTO A;  4KAW X;  2P5M A;  1SFO A;  1K83 A;  4BLB A;  4G0V A;  1DD5 A;  1ISE A;  2XCO A;  5EGH A;  1AB4 A;  3OPF A;  1EK8 A;  2RH6 A;  1O25 A;  5IOQ A;  4GTF A;  2R93 A;  5EGE A;  4C3J C;  4KDD A;  3GTG A;  2Y3P A;  1XXC A;  3V4G A;  1IS1 A;  2ZFZ A;  4P5A A;  2E2H A;  1WIH A;  3L4J A;  2GSO A;  1Y1V A;  4KAS A;  5CJ9 A;  4G0W A;  3MML B;  1TWH A;  4KAR A;  4LR2 A;  5JFE A;  2CFA A;  4GTE A;  3N0B A;  1O24 A;  3OEP A;  4J3N A;  3GTP A;  4KB4 A;  3CAG A;  2R92 A;  3GTQ A;  1XXA A;  1TWC A;  1O26 A;  3ERE D;  4BKW A;  4KB2 A;  3GTL A;  3G4A A;  1WQH A;  1WCM A;  1B4B A;  1I50 A;  1TWA A;  4FZB A;  1ZXO A;  3FKI A;  4GTD A;  5JVO A;  3H0G A;  4FM9 A;  4G0U A;  3CQZ A;  2JA7 A;  5IOS A;  1EH1 A;  2B63 A;  3AQO A;  2GSN A;  1ZVU A;  1GE9 A;  1BJT A;  4GTB A;  3GTM A;  3LAJ A;  4KM8 A;  3GTK A;  3G4C A;  2GSU A;  2NVY A;  1WQF A;  1O28 A;  4LQY A;  1TWF A;  3AQP A;  3NUH A;  4GFQ A;  4KMA A;  4GTA A;  5IOR A;  3N0C A;  3LAP A;  1R9T A;  3AH5 A;  4C3I C;  4C3H C;  2KWA A;  3FHZ A;  2R7Z A;  5IOT A;  4GTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...