3CAMA

Crystal structure of the cold shock domain protein from neisseria meningitidis
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
b'MATGIVKWFNDAKGFGFITPDEGGEDLFAHFSAINMEGFKTLKEGQRVSFDVTTGPKGKQAANIQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold-shock domain family protein
publication title Structure of the cold-shock domain protein from Neisseria meningitidis reveals a strand-exchanged dimer.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Gene regulation
total genus 5
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3camA00
1H95A 4UP7A 1SN8A 3PO3H 4A93G 4HIKA 2Q2UA 4NXMQ 2PI2E 4JBWA 1VQMA 1QVCA 5JEAG 4LUZA 1TWHH 4KHPL 4BA1I 4X62Q 1N36Q 2HHHL 3U4ZA 1WCMG 1Q81C 5C4XG 5FLMH 1Q86C 2ZM6Q 1KRTA 4H02A 5HY6A 1WFQA 4X64Q 2R92H 2WB1E 1J6QA 4PZ8A 5C44G 4DR6Q 3KF6A 2RHQB 2RF4A 1M90C 2JA7H 3DLLA 4A3IH 3B6YA 4YWKA 4JYAQ 4IFDJ 1X55A 1CKNB 4OONA 5C0XJ 5LMUL 5JJIA 4LUVA 4JOIC 3A5UA 1PH4A 2UUAL 1SRUA 4YWLA 1HR0L 3KLWA 4R4OA 1PH3A 1IZ6A 3U4VA 1XPUA 1CSPA 1I3QH 2VQEQ 3HOVH 1HNWQ 1PYSB 4GLVB 1PH2A 1CSQA 4RMFA 1EQRA 3F2DA 3ZJYC 2R7ZH 4A3BH 2EQSA 4DR1Q 3CCUA 4DR5Q 4BBSH 1T9HA 3S15H 3A5ZB 2OQ0A 3E0EA 2UU9L 1L1OC 3DM3A 4L5TA 1VQKA 1V9PA 1UE6A 3PF5A 4LF4L 3J7A5 3T1YL 5IP7G 5BR8L 2H5XA 2ZTDA 4A4IA 1Z9FA 1A62A 1S3OA 1XMQQ 4JI7L 3S2DH 2OTJA 2V1CC 3CCJA 1SE8A 3PUZA 5FJ8H 3G4SA 4DV2L 1VQ8A 4JBKA 4GKKL 3M85A 4GOPB 4JCVE 4A3DH 2UUCL 4HIOA 1FGUA 2GVBA 1VQJA 3J81i 4DUYQ 4OWTB 4DUZQ 4A3FG 1YNXA 4GS3A 4POGA 3KDFB 5HGQA 4A3MH 3HOYH 1W2BA 4X66Q 3GTPH 4A3LG 4B3MQ 3H3VH 4JI0Q 4AYBG 5IY0A 1BBWA 1KAWA 3STBC 2Q2TA 5IYDH 3OYYA 3NENA 1B7YB 1G291 3PUWA 2DGYA 2K5HA 2IX0A 3HOWG 4A3JH 4DKAC 4L5SA 4GKJL 1OXXK 3HOXH 3K7UC 4K0KQ 4OWXB 4A3GH 4BBRH 2NVYH 3I56A 1VQHA 2ZM6L 3UDIA 1P16A 4LWCA 2R93G 1X56A 4HJ7A 4DV6Q 4LW1A 1K83H 3CC4A 2BH8A 4RG1A 1N33L 4KI0A 2AWNA 3OTOL 1C7YA 1HNZL 2YYZA 5IE8A 4JI8Q 3M7NA 1VQ7A 1YZ6A 1XJVA 1X3EA 3PSIA 1SROA 3GTJH 4KHPQ 4B3SQ 3CC2A 4YY3L 4EQ5A 1HNWL 5JJLA 4QL5A 1XPOA 2JA8H 2HHHQ 4GLAC 1QVFA 3I2ZA 4JBMA 4JBJA 4DK3C 4JOIA 3RZDH 1VQLA 3HKZG 1K8GA 3KFUA 1OXSC 1Q46A 1SR3A 1VQ6A 1E3PA 1KHIA 2IX1A 1FJGQ 1X6OA 5LMUQ 1B70B 1KD1C 3I4NG 1JJ2A 1I6HH 1HR0Q 1KQSA 3I4OA 3S14H 1JJGA 3AYHB 1E1TA 5C3EG 4DV5L 1L1OA 3W1BA 1MIUA 1S40A 3M4OH 4A3CH 1DGSA 1PH1A 4BY1H 1YHBA 4PZ6A 3S1MH 2QGQA 4DUZL 2B63H 2K5VA 1PFSA 1Y1WG 1JMCA 1YHAA 1VQGA 1YHQA 4WJ3M 3ULLA 4LF4Q 2VS1A 3T1YQ 4DV0L 3G6EA 4JG2A 4FDBA 5BR8Q 4Y7NH 5LMNW 1RL2A 3I4NH 3PV0A 4JI7Q 4Y52H 4DV2Q 1B8AA 5M5XH 3WWVA 3PGZA 4A3EH 3KJOA 2ATWA 3PF4A 2R6GA 2OQKA 2ZJQA 3KJPA 3I4MH 3J80c 2CCZA 3KYHC 3MEFA 2UUCQ 4DR7L 1A8VA 1PH7A 3L7ZC 1Y1VG 2A19A 2YTXA 4YCWA 4YWMA 5IT9c 1VQOA 1M1KC 1ASZA 2RCNA 3GTKH 4BY7G 1K3RA 3HKSA 2CWAA 5EAYA 2BA1A 2CQOA 5AJ3Q 2DUDA 3HOUH 3BU2A 4IJHA 4TVAB 1KIXA 2NZOA 2K52A 3TEHB 2OTLA 2D0OA 4C2MH 2Q2IA 5E7NA 1PYBA 2PMZE 1CKNA 4YCUA 4P71A 2KCMA 3IRBA 4DR3L 3BZCA 4AIMA 4JI8L 1KXLA 2R7FA 2N78A 5JEAJ 2JA5H 2IHFA 4GKJQ 2VQFL 3CCRA 1J5EL 3CMAA 1YBYA 4YCVA 4B3SL 4A3KH 1TWGH 3F2BA 1VQPA 1TWCH 4UP8A 2CKZB 5IYCH 4YHHL 3CXCA 4DR2L 1VQ9A 2EIFA 2HQLA 4BY7H 3GTMH 3HOZG 3J80i 1YIJA 2OCEA 1VQDA 1N33Q 2VUMG 3TRZA 1HNZQ 3EIVA 3OTOQ 4HJAA 1YJNA 1GM5A 2NVQH 1FJGL 4JI5L 1N9WA 1X54A 5M3FG 4LF6Q 4A93H 1HJPA 2B29A 3J81c 2IY5B 3PIPA 4YY3Q 1UEBA 5GAEC 4PMWA 4JC0A 1HH2P 4GNXB 3VDYA 1Z47A 2Y0SE 1LYLA 4LFCL 2PQAA 4QY7A 1WCMH 4R4TA 5C4XH 4P72A 3ICEA 2XGTA 3KDFA 5C44H 2I0QA 4JI2L 1L0WA 1S72A 1UE5A 4OXPA 4A76A 1XNRL 2YTVA 4IPDA 3KF8B 4GN4B 1WOCA 1KL9A 5IP9G 2WAQG 4GN5A 3J81j 2KCTA 5M3FH 2B3GA 1IBLL 4DV5Q 1WI5A 3TS2A 1EFWA 4JI1L 1CKOA 1L2FA 2K14A 3RN2A 3PUYA 2MFIA 2MO0A 3BZKA 1EWIA 2NVXH 3CPWA 4XIGS 4OX9L 2K4KA 1ASYA 4L5RC 5AJ3L 3CP0A 4DV0Q 1QVGA 4JI6Q 1X3GA 1G51A 2PI2A 3UDFA 2NN6G 4DV7L 1QZHA 2NVTH 5IP7H 5M5YH 2Z0SA 4GN3B 3RLOA 5GADC 5LMNL 3S17H 3FKIG 4LF5L 3M4PA 1N32L 1VQIA 2NN6I 3FP9A 4DR7Q 2Z6KC 1SMXA 2C35B 3L2PA 2KHIA 1XMOL 4KLKA 2MQHA 2ZTCA 4A3FH 4MTNA 1D8LA 3CCMA 2JK8A 4GLXA 4A3LH 1C0AA 1VQEA 1V1QA 3ERSX 4EX5A 3J7ZC 4DR3Q 4AQYL 3I55A 5IWAL 3PO2G 1NMGA 1NE3A 3S1RH 1EOVA 4IOCA 3CCVA 1X3FA 4PZ7A 4LF6L 2VQFQ 4BXXG 1J5EQ 3HOWH 4DV3L 1AH9A 3W5OA 3CCLA 3G71A 4X65Q 2UXDQ 5M3MG 2ASBA 4DR2Q 4YHHQ 1JJCB 4LFAQ 1YI2A 2E2IH 4O2DA 2UXCL 1QUQA 5H1SE 1BVSA 4AYBE 1MJCA 1JE5A 4POFA 1A63A 3NBHB 2R93H 1Y14B 1MJEA 2VNUD 4UY8C 4GOPC 3H15A 4QJFA 1VS0A 2AMCB 1IBKL 4JI5Q 4PG3A 4LF8L 1CKMA 3L0OA 1EUJA 1FVIA 2BH2A 1K9MC 2JJQA 2GN5A 4DNIA 2KHJA 1UE1A 4LFCQ 1IL2A 5M3MH 3K81C 3CD6A 1LUZA 4UPAA 3LGJA 4IOAA 1U5KA 3AQQA 2UXBQ 2JA6G 1Q7YC 1V43A 3AFQA 1KRSA 3CCQA 4JI2Q 1XNRQ 1K0RA 2E2HH 4DPGA 5GQOA 3U58A 1XNQQ 3H0GG 1WJJA 2I5LX 4JI6L 1TWAH 3E9IA 5IYBG 4TQUS 3CMEA 2JEAI 3D0FA 1IBLQ 1PH6A 4R4IA 3M9BA 3K7AH 5DLQE 5GROA 4NXNL 4JI1Q 3JAMi 4DV4L 1VQ5A 4B3TQ 5C3EH 2QEXA 1OXUA 3HKZE 4P75A 2JQOA 3S24A 3UE1A 4OX9Q 4R1JA 2RHSB 3Q8DA 1Y1WH 1K8AC 4MNOA 4O0AA 2Z6KA 4DV7Q 1HNXL 3S16H 1HZAA 2KENA 5LMNQ 5M5WH 4DR4Q 4LF5Q 1VQ4A 3K80C 1N32Q 4DV1L 2WB1G 2XTIA 2R7DA 1OXTA 3PO3G 1PVOA 4NB3A 1CUKA 1AE3A 1LM0A 1EQQA 1EYGA 3S1NH 5JJKA 1XMOQ 4X65L 1L1OB 2UXDL 1NTGA 1VQAA 1Y1VH 3NEMA 3W1GA 4C3HH 5FLXc 3S2HH 4XTCS 4LFAL 4UP9A 3A0JA 1NBWA 1UWVA 1I5FA 2VL6A 4APVA 5FLMG 2VW9A 4ALPA 3OW2A 1YJ9A 3CCEA 1R9TH 4DK6C 1C9OA 2GVAA 4AQYQ 4JI4L 4WJ4A 5IWAQ 2LSSA 2YV5A 2EXDA 3AFPA 4LFBL 1E24A 4A3IG 2JA7G 2I5HA 1VQNA 1I94L 1OTCA 4DV3Q 4JI3Q 1TXYA 4HJ9A 1LTLA 3HOVG 4GOPA 3CF5A 3PUXA 1I50H 1YITA 2N49A 3F2CA 1NJIC 2R7ZG 4A3BG 2UXBL 1XTDA 1IXRA 1U0LA 3GD7A 3PIOA 3HOZH 4BBSG 4LF7Q 3A74A 3MXNB 2QA4A 1X9NA 2K50A 3TREA 3CC7A 1IBKQ 4LF8Q 2VUMH 4JV5Q 4QQBX 2PNHA 4LF9L 1XNQL 3F1ZA 1MKHA 2LXKA 3ULPA 2UUBQ 1BKBA 4IPHA 2ZJRA 4IFDG 5C0XG 2JA5G 3GO5A 5FJ8G 4B3TL 4OWWB 2F4VQ 1X65A 1A0IA 4KHZA 5ELOA 3RN5A 2BA0A 4B3RL 4IFDI 4A3DG 1W3SA 3D31A 5C0XI 3RLFA 1G6PA 2AHOB 1SLJA 2WFWA 4DAMA 5J3BA 1N8RC 3T1HL 4P74A 4A3MG 4LNQA 1FL0A 3UDXA 3KF6B 3HOYG 2YU9H 2JEBI 4K0KL 3CW2C 2HIXA 5IP9H 5IYDG 2YTYA 4P73A 4DV4Q 4HIMA 4NXNQ 4DR4L 1E7ZA 3H3VI 1GKHA 2CWPA 3CCSA 1E1OA 3FHWA 4DAYB 1GO3E 4A3JG 4R4QA 1HZCA 3K8AA 1VQFA 2JA9A 2A8VA 3HOXG 1HZ9A 2N8NA 2PQAB 4IJLA 1PV4A 1IBML 1N34Q 4A3GG 1PA6A 4BBRG 2E5LL 1XPRA 1KC8C 4BA2I 4C3IH 2WAQE 1Q8KA 4LUOA 1VQCA 3K0XA 3M4QA 4GNXC 3UDGA 1HNXQ 2ALYB 2F52A 3SGIA 4DV1Q 3RZOH 2OWOA 3FKIH 1Q1BA 1JT8A 4JI3L 5K36G 1EIYB 4NXML 1YJWA 2L15A 1O7IA 2VY3A 4IO9A 1SFOH 2IHEA 2JA8G 2HT1A 3EN2A 2ZJPA 1RIPA 1AE2A 4X62L 3TS0A 1N36L 1GD7A 3RR5A 3STBD 3JAMc 4HJ8A 4JI4Q 4OO1G 2D0PA 1PH8A 4X64L 1JB7A 1NY4A 4LF7L 1VCIA 4LFBQ 2MO1A 4HIDA 4JV5L 3HFZB 2UXCQ 1I94Q 4DR6L 1P8LA 1BBUA 2WP8J 3PO2H 4OO1I 3TQYA 2N3SA 4DV6L 1HR0W 4JYAL 4X6AH 3RNUA 2UUBL 4BXXH 1TWFH 3GTOH 3PCOB 4ME3A 2LXJA 2F4VL 2VQEL 1K73C 4A3CG 4QIWE 4BY1G 2ZTEA 1YVCA 1D7QA 1GVPA 3UE0A 2VZAA 4DR1L 3BJUA 2B63G 4L5QA 4DR5L 4LF9Q 3CAMA 2K5NA 2ID0A 2UUAQ 1YEZA 3I7FA 4R4CA 1XMQL 3G48A 3F8TA 4A3EG 1EIFA 1UE7A 4B3RQ 2AKWB 3GTGH 3U50C 3I4MG 1PHJA 1NMFA 2I5MX 3NELA 2KBNA 1QUQB 3EBEA 2JA6H 1N34L 3CQZH 3T1HQ 3HOUG 2JE6I 4DUYL 2UU9Q 4QGUA 2K75A 2FXQA 3H0GH 1PH9A 4X66L 3ER0A 5IYBH 4B3ML 2IT1A 4JI0L 1Q12A 2D62A 2NZHA 4AH6A 4NPSA 4HJ5A 4A75A 4IPCA 4MZ9A 1HZBA 3AEVA 2E8GA 1IYJB 1E22A 2AWOA 3E9HA 3GDEA 4IPGA 5ELNA 5C4JH 2MNAA 4GNXA 3GTQH 4GKKQ 1IBMQ 1Q1EA 2HIVA 4A3KG 2Q2HA 3PUVA 1Q82C 2CFMA 1QZGA 2E5LQ 1PH5A 3CPFA 5IYCG 1WYDA 3KOJA 5GAHC 2E2JH 2Y0SG 2A1AA 3ULJA 5GAGC 3M3YH 3RLNA 4C3JH 2R92G 1VQBA 2F3IA 3S1QH 1OXVA 3JC66 3GTLH 2ES2A 4J15A
chains in the Genus database with same CATH superfamily
1PZID 1SN8A 1Q3LA 1AEXA 4A93G 4A3MB 1WTQA 1D1IA 2PI2E 3Q6SA 3NHHA 5JEAG 3OHXC 4BA1I 3FKIB 5ELFA 5FOBB 1N36Q 3U4ZA 1Q86C 2ZM6Q 2PW7A 4H02A 5HY6A 1WFQA 2B8GA 3VYSA 1SFOB 4DR6Q 2RF4A 2F0PA 3CKIB 3CRLC 4A3GB 2B2WA 5C0XJ 5LMUL 2UUAL 4YWLA 2F0KA 2PPBC 1PH3A 3U4VA 3E5SA 1CSPA 1I3QH 1EWCA 4KJNA 4RMFA 1EQRA 3F2DA 3ZJYC 4FP5D 2R7ZH 3GTOB 4A3BH 3CCUA 1T9HA 3S15H 4NMZA 2NZ1D 4I65A 1L1OC 4O1NA 3T1YL 2ZTDA 3K6OA 4EGVA 1XMQQ 4MTKA 1S3OA 1DOKA 2F03A 1NSNS 1VMPA 4V190 3S2DH 4GKKL 1ZEQX 3M85A 4GOPB 4JCVE 4G57A 1TVXA 2UUCL 5T1IA 5A2QL 2RVLA 3BYTB 1VQJA 4A3FG 3ONAB 4OWTB 1YNXA 3NQIA 4C1NK 1EY4A 3M4OB 4JI0Q 5CV5A 1KAWA 3S1MB 1LTTD 3PUWA 2DNCA 4MN3A 3NBIA 2K5HA 3RUZA 4DKAC 5I4DA 4JVZA 1OXXK 3HOXH 4F88A 2LY7A 3QWNA 4OWXB 3GP7A 2B2YA 3NSWA 1VQHA 2ZM6L 3UDIA 2YYZA 1AP0A 2K05A 1E2VA 4KKUA 5IE8A 3M3YB 4IURA 5D3DA 1XJVA 3GTJH 4B3SQ 2JA8H 2HHHQ 4GLAC 3I2ZA 4JBMA 2XN9C 1CHPD 3RZDH 1DZ1A 1VQLA 1D1KA 5C4HA 3HKZG 1XYIA 3FRPB 1Q46A 4RKLA 1IHZA 2IX1A 4B9WA 2FJ2A 1B9NA 1JJ2A 1I6HH 1HR0Q 2CH4W 3I4OA 4DA2A 4FO2A 4WRDA 4HCSA 4IFDH 5C3EG 3W1BA 1MIUA 1DGSA 4BY1H 3KLSX 3ERQA 1BCPC 4PZ6A 2QGQA 3MA2B 1I3QB 1Y1WG 1YHAA 4LF4Q 3G6EA 4Y7NH 2R7ZB 1CA5A 3QOJA 3S15B 4DV2Q 3N52A 3PGZA 2PZWA 1VDZA 1SNMA 1Y8NB 3J80c 2XWBB 3KYHC 4C3HG 2A19A 2YTXA 4YCWA 3S2DB 2R3ZA 1K28A 3HOUH 2BA1A 2FMCA 5C4ZA 3TEHB 4C2MH 2B2YC 2PMZE 3QB3A 4DN4M 2LS01 2R7FA 2JA5H 5JEAJ 3G6JB 4EQOA 3CCRA 3A8JE 1YBYA 4B3SL 1TWGH 1I4QA 2CKZB 1H9RA 3BS1A 2KCCA 2PQEA 1YIJA 3HOXB 2XRQD 3TRZA 1JORA 2XIWA 2WKCA 2EOTA 4LF6Q 1HJPA 3J81c 2IY5B 4YY3Q 1HH2P 1Q90A 4AYBB 5E1FA 1W6JA 4QY7A 5EBCA 2NWGA 4R4TA 2JA8B 5C44H 4CDEC 4JI2L 1XNRL 1G91A 5IP9G 2EXZA 2WAQG 4GN5A 5COYA 1EEFD 1JOOA 3SHLA 2R93B 1AW7A 3SR1A 5IIFA 5FO9B 1I6HB 3V05A 3DEPA 3CPWA 1ZXTA 4XIGS 2K4KA 2L5TA 3CP0A 4DGZA 4DV0Q 3T51B 4TSSA 3I72A 2O2LD 2F0WA 4PNYA 5M5YH 5LMNL 3FKIG 3I73A 1MD2D 1WTWA 2C35B 4Y7NB 4IUQA 1XMOL 4KLKA 2ZTCA 4FF2A 3V2TA 1C8CA 3NK9A 4CKBA 2A69D 2A6EC 1D5MC 1B3AA 3J80E 2TMPA 2F0FA 2F3VA 3GQBA 4KD4A 5IWAL 3HOUB 1X3FA 4LF6L 5JAVA 4BXXG 1AH9A 4DV3L 3CCLA 2N88A 2E2IH 1WVLA 1YI2A 1EL0A 2NYZD 3IKJA 5FK9C 3NBHB 4JPBW 4GOPC 4QJFA 2Y0SB 3BDLA 1C4QA 1EUJA 1FVIA 1FYCA 1LACA 4N8FA 1K9MC 1STEA 2G9DA 2K33A 1PLFA 1IL2A 1CM9A 2QEJC 2TSSA 3LGJA 4IOAA 1FNUA 2UXBQ 3J81E 4FVMA 2PNRC 4DU9A 4DPGA 1I50B 1A15A 3CMEA 3NP8A 1PH6A 1SYDA 5C6AA 5C44B 4B3TQ 1TQOA 1FGBD 2BDOA 2QEXA 3HKZE 2Z4HA 4P75A 4ZRZA 2EYLA 4RGNA 4OX9Q 4L6TB 4CJ2C 1QCBD 1WD0A 2DY7A 3Q8DA 4MNOA 2Z6KA 4DV7Q 4B9XA 5M5WH 4LF5Q 1VQ4A 3K80C 1AN8A 1JWMD 1SYFA 4RH6A 3QO2A 1Q8IA 1CUKA 1AE3A 1LTAD 1EQQA 1EYGA 1TY0A 1DJRD 1NTGA 1Y1VH 3VR6A 1EIHA 1B2TA 1I5FA 4APVA 1M4VA 1YJ9A 3CCEA 1R9TH 4DK6C 2GVAA 4WJ4A 1EZ8A 4LFBL 1E24A 1PRTD 2I5HA 1A3TA 4HN7A 3KBGA 1I94L 3BYYB 4JI3Q 4HJ9A 2A6HD 1A6XA 2BDNA 1TR5A 2R7ZG 4A3BG 2UXBL 1IXRA 3GD7A 4LF7Q 1U4LA 3MXNB 3CC7A 4LF8Q 2G5DA 1SNOA 2PNHA 1SNDA 4LF9L 3ULPA 1BKBA 4E6IA 2HQEA 4IFDG 2BE5D 4B3TL 2F4VQ 1CT1D 3LX0A 4B3RL 5C0XI 1G6PA 1QNKA 1NAPA 4DAMA 2WIIB 5J3BA 4CKEA 2PW5A 3T1HL 4P74A 4F7XA 3KF6B 1STBA 4ZYSA 5CYUA 2JP1A 1ONLA 1QE6A 4DV4Q 2JXMB 5D14A 4J8QA 1E7ZA 3H3VI 1GKHA 3MHBA 3FHWA 4DAYB 3MAQA 1HUMA 2JA9A 3HOXG 1HZ9A 2N8NA 4JW0A 1F2MA 1JQYD 5I9PA 1PA6A 2E5LL 1CTMA 2OEOA 3NBHA 2WAQE 1Q8KA 3OIPA 3K0XA 3M4QA 5CGKA 2F0NA 2SDFA 2ALYB 2F52A 4Z9CB 4DV1Q 4K5VA 1Q1BA 1JT8A 4JI3L 2ZXRA 5M5WB 2VY3A 4OGQC 2JA8G 1RIPA 3JAMc 3OIQA 2D0PA 4LF7L 4NW2A 2UXCQ 1BUVT 4DAPA 1P8LA 2WP8J 3PO2H 1YNNC 3TQYA 4JYAL 1R9TB 5DNFA 1EYCA 1TWFH 3PCOB 2LXJA 2F4VL 3NWSA 4BY1G 1U4MA 1DOMA 4V0BA 4TRDA 4K2KA 3UE0A 2VZAA 4DR5L 4KY6A 3C2PA 3Q23A 4WJWA 4OIKA 2O4XA 2VXWA 4R4CA 2A73B 3GTGH 3VYUA 2JA7B 3PMFA 1QUQB 3NE5B 1MBYA 4ZUJA 4RWSC 4DUYL 3HOUG 2F0HA 3TZUA 2UU9Q 1HFNA 1PTOD 1GOZA 4HSVA 1CZWA 3H0GH 4X66L 2EDGA 4AH6A 3FPUB 2RBMA 2AUKA 5G3LD 3IFTA 4IPCA 3AEVA 2MNAA 2JA5G 5ELNA 5CR3A 2B2UA 1CZGA 2HIVA 5IGCA 5JPMC 3QR8A 1STHA 1KLGD 1WYDA 1BO0A 2E2JH 2Y0SG 4MHEA 5GAGC 1I4PA 2R92G 3MXNA 2F3IA 3S1QH 4ILWA 3NUCA 2ES2A 3GTLH 2UXCL 1H95A 5I6YA 1EY0A 1AZQA 3HGBA 1VQMA 2KCNA 4LUZA 4KHPL 1ET9A 3I4LA 1Q81C 5FLMH 1KRTA 2WACA 2WV6D 4X64Q 3NPPA 1J6QA 5C44G 3KF6A 1M90C 4A3IH 3CHBD 3B6YA 4IFDJ 4DF7A 1IW7C 1H9SB 4LUVA 3A5UA 1PH4A 4CKCA 1V1PA 3JAME 1XPUA 2VQEQ 3HOVH 4DAYA 4FXKC 1PYSB 3PO2B 1CSQA 5ELCA 4RGOS 2EQSA 4DR1Q 3A5ZB 2OQ0A 2UU9L 3DM3A 1VQKA 4XQJA 1UE6A 3PF5A 5DM63 3J7A5 5EKKA 1Z9FA 3BDCA 5FLXL 2V1CC 4JBKA 5FJ8H 3AB9A 3G4SA 1VQ8A 1SMYD 2FFKB 4FYDA 2GVBA 1JWUD 3DXJC 4FF3A 4GS3A 3GTGB 1RODA 1RF2D 1EFID 5HGQA 4A3MH 2B2UC 3DEOA 4F87A 3STBC 2EE1A 2RDGA 1G291 1R4QB 2F0UA 2DGYA 3NENA 1LT6D 2B63B 1EIGA 4ULLA 1LTRD 3H0GB 1LO5D 4S3SA 5D3IB 4K0KQ 1DD2A 4J6HA 4A3GH 1ESFA 4OIJA 1SE3A 1E2ZA 3I56A 1WTXA 1P16A 2K5QA 4DV6Q 4LW1A 1K83H 3GTKB 3CC4A 2BH8A 2AWNA 2E2JB 4QCLA 1VQ7A 3GTLB 1SROA 1RD9D 1XPOA 2I07B 4XDXA 4JBJA 3DWPA 3T56B 4EQNA 4OO1H 3F2UA 1KHIA 1X6OA 5LMUQ 3HS0C 3X3MA 2D9UA 1JJGA 2PZUA 2OXPA 4DV5L 5E3FA 4A3IB 1J9OA 1L1OA 2NVQB 3ZYYX 1S40A 3M4OH 1MI2A 2ZT9C 4C56C 2EYHA 3S1MH 4LMQD 3MXPA 5I6WA 2RDHA 1HQRD 1HFGA 4WJ3M 1VQGA 3ULLA 3T1YQ 5LL6X 4OEMB 5BN4A 2F0TA 1ML0D 3PIP3 3I4NH 3N6RA 5IOCA 5IGEA 1HUNA 1ENCA 1XWEA 1XX8A 2ATWA 3BVGA 2R6GA 2OQKA 4G4KA 2CCZA 2UUCQ 1A8VA 1PH7A 4K0KL 1Y1VG 2HCIA 5IT9c 1ASZA 1D5ZC 2RCNA 1I4HA 2M00A 4BY7G 4IJHA 5EKIA 3ND8A 1KIXA 2A74C 2D0OA 2Q2IA 5E7NA 2CW0C 3VA7A 3BZCA 1S5CD 1NR4A 2CHBD 4CGYB 2F0VA 2VQFL 2HDLA 1J5EL 2WINB 5ELBA 3F2BA 1VQPA 1TWCH 1VQ9A 4DR2L 4YHHL 4X3KA 2MHVA 1JICA 1GUOA 1VQDA 2OCEA 1B44D 2I46A 4HJAA 1YJNA 1F2LA 4JI5L 1ET6A 1N9WA 3PIPA 2XWJB 1K83B 3VDYA 4GNXB 2Y0SE 1WCMH 1SJHD 5C4XH 5LL6S 1HA5A 1L0WA 3WDNA 3KF8B 4GN4B 4R8NA 4ZUIA 3J81j 5M3FH 2B3GA 1IBLL 2B2TA 1J8IA 1JWSD 1CKOA 1F9RA 3PUYA 2MFIA 3BZKA 3R93A 4L5RC 2GA4B 4PQXA 1AFPA 2EY5A 2XNAC 1QVGA 3S9WA 2C9OA 2Z0SA 3RLOA 1RTOA 4I7AA 1N32L 4WORA 1NCVA 1ENAA 2KHIA 2DNEA 3I4NB 1TS2A 1F9SA 1KDCA 4MTNA 4ZAIA 1B50A 4A3LH 3P1HA 1QNUA 2XSCA 4UHVA 1V1QA 4EX5A 1C0AA 4U68A 5IT9E 3PO2G 1NE3A 3C3LA 1B9MA 1F9QA 3CCVA 1LT5D 2RCFA 3HOWH 1ZYRD 5M3MG 1K3BC 2ASBA 1CK1A 4LFAQ 1BVSA 5FO7B 1MJCA 4P2CB 1F9PA 1QOHA 1RDPD 3I8ZA 3WOEA 2R93H 4UY8C 2E74C 1TWCB 1VS0A 4PG3A 1CQVA 2VB3X 3NTKA 3TBIB 4DNIA 2KHJA 3KUPA 4ZQ3A 3CD6A 1LUZA 1GUNA 3AQQA 2F0OA 2B2TC 4JI2Q 4CHTB 1XNRQ 1K0RA 2F0IA 3K5LA 2EY1A 3H0GG 2I5LX 1WCMB 1TWAH 1EZ6A 5C4XB 4G7OC 2MPMA 2JEAI 1E0BA 4R4IA 3HOZB 5DAUA 1VQ5A 5GROA 4NXNL 2VUMB 4KKTA 3H94A 4X3SA 1PRTF 1LTID 1S4ZA 5M3FB 1I4RA 2HDMA 1PDQA 2RHSB 3DUZA 1K8AC 3MEHA 1HZAA 2KENA 4BS9A 5LMNQ 1ESRA 1FD7D 2R7DA 1PVOA 4NB3A 2O5JC 4EQPA 5JJKA 1XMOQ 1VQAA 3W1GA 2OT2A 4FF1A 2A6HC 3AU7A 4XTCS 4UP9A 3EVQA 4U673 4OL7A 2VL6A 4LFAL 5IGBA 5FLMG 3GTPH 4JI4L 1G2TA 5IWAQ 2LSSA 4A3IG 3KF8A 1OTCA 4DV3Q 1II3A 1TXYA 5E4XA 3HOVG 4GOPA 3CF5A 1I50H 2QW7A 3VR4A 5CBAE 3HOWB 4N9PA 1U0LA 3PIOA 1JR0D 3DWAA 5I9OA 1X9NA 3TREA 1MKHA 2MGSA 2LXKA 2UUBQ 5JOBA 3J80L 2ZJRA 2ZXOA 1CHQD 1AZPA 3GO5A 5FJ8G 3BZDB 4OWWB 3R3OA 1A0IA 4KHZA 5ELOA 3LWEA 4IFDI 4ABNA 1DOLA 2H4OA 5E4WC 2F4IA 4KTAA 1N8RC 4A3MG 4R8IA 5KIXA 3CW2C 3A8KE 4HIMA 3MXUA 1DONA 1EYAA 2KEEA 1KDBA 1TWAB 3A56A 1GO3E 1VQFA 2PQAB 1PV4A 1IBML 1N34Q 4A3GG 1PXUA 4CDCC 2EJMA 3HZXA 4C3IH 2Z8LA 4LUOA 4GNXC 1VQCA 3J81L 3BG3A 1FR3A 2VB2X 2NN6H 3D3RA 2F0EA 1EIYB 5CBEE 4NXML 2IHEA 2HT1A 4DNTB 3IAYA 1AE2A 4X62L 4OO1G 4KMUC 1JB7A 4LFBQ 1NY4A 1PFBA 2ICIA 4JK1C 1I94Q 3GTPB 2N3SA 5CC4A 1HR0W 4X6AH 2UUBL 2Q8IB 1PTOF 5JJZA 5G3LF 3PO3B 1M8AA 1KABA 1D7QA 1K0SA 1GVPA 3OPOA 4LF9Q 3QJYA 4OELB 3A55A 1BR9A 1PTOC 5HURA 2BOSA 1EIFA 1WTOA 3IFDA 4B3RQ 1DM0B 2K5DA 2CVRA 2JA6H 1N34L 3K5NA 3NXWA 3T1HQ 5C3WA 2Q8RE 1PH9A 1O7LA 4B3ML 3D4WA 3VYRA 1KNAA 2D62A 2NZHA 4HJ5A 2E8GA 1IYJB 1E22A 3ICEA 5C4JH 2Z6BA 1BCPD 4HCEA 1EEID 2KVMA 2E5LQ 2CFMA 3KOJA 3BVZA 5BN3A 1VQBA 1F2YA 3OWFA 1S5DD 4J15A 3MVVA 1GUSA 4C3IB 1O7ZA 3HOYB 4HIKA 2Q2UA 1D5XC 4PMBA 4JBWA 1QVCA 4RGMA 5ELEA 3P20A 2F1MA 1WCMG 1LT4D 5C4XG 3EFXD 2RHQB 4BWGB 2JA7H 3DLLA 4JYAQ 4YWKA 1X55A 4JOIC 4DAVA 4QIWB 3KLWA 4R4OA 4DNRB 3RD4A 3CU7A 1HNWQ 2IX3A 1ILQA 2SNSA 5AFWA 4FXDA 2JSOA 4DR5Q 4BBSH 1GUWA 1V9PA 4HEDA 4X3TA 2KEDA 3LNNA 5BR8L 2H5XA 1A62A 2KECA 4JI7L 2WKDA 1SE8A 1PZKD 3PUZA 2EJGC 2N55A 4IUPA 3R8BA 4HIOA 2FINB 1FGUA 3J81i 4DUYQ 4DUZQ 1YNJC 3D4DA 1W2BA 4X66Q 4A3LG 4RGTA 4AYBG 1LTGD 2JA6B 5IYDH 2KHSA 3OYYA 1B7YB 4UDUC 1GJXA 1SXTA 2IX0A 1DYQA 3DM1A 3EJIA 3HOWG 1GUGA 4GKJL 2IJ0A 3K7UC 3I90A 4A3EB 5C4JB 1HTPA 4OHJA 2R93G 1BQQT 1X56A 4IQZA 5KGUA 1HHVA 1N33L 4RG1A 4KI0A 1C7YA 3OTOL 1HNZL 1IKMA 4JI8Q 3Q22A 1TY2A 1YZ6A 4HMIA 3PSIA 3SXHA 4KHPQ 1XTCD 3CC2A 1HNWL 5JJLA 2K32A 5I2YA 2A6ED 2WB1B 1K8OA 5J39A 2KJXA 3MXGA 3E6ZX 1OXSC 1VQ6A 2G9HD 1JB3A 5CV8A 1FJGQ 2F0SA 3TMEA 3DMUA 1KQSA 1G8ZD 5DEHA 3RMHA 1E1TA 2L9HA 4A3CH 4A93B 4K6DA 4DUZL 2B63H 1SYCA 4KN4C 1JMCA 2L12A 4CBVA 2Z4IA 3MWYW 4RCOA 4JG2A 4FDBA 1RL2A 5NUCA 4BBSB 1B8AA 5M5XH 3WWVA 1PMRA 3KJOA 3PF4A 3KJPA 4DR7L 3HRZC 3GTKH 3L7ZC 1M1KC 3JAML 1W6KA 1K3RA 3HKSA 2CWAA 2X69A 4ODGA 1S5BD 2NZOA 2OTLA 4YCUA 2P5ZX 4DR3L 2KCMA 3IRBA 3D4RA 4AIMA 2M9VA 4JI8L 1KXLA 4ID6A 1XXGA 1TIID 3DHQA 2IHFA 1EY8A 2NUCA 1IYVA 1SYGA 4M8AA 1VF5C 3S17B 5IYCH 3CXCA 1SNCA 3GTMH 2AQ3B 1LT3D 1RTNA 2NVQH 1FJGL 1X54A 5KNBA 2EZVA 3C46A 1ENFA 3ITPA 5GAEC 3D8GA 3D6CA 2K04A 1Z47A 1LYLA 2R61A 3QOLA 5CV9A 4LFCL 5C5MA 3S1RB 3L3OC 1GXDC 4Q5VA 5EQ0A 2K6AA 4P72A 1LV9A 2XGTA 2D2CC 3CRKC 1HTLD 1UE5A 1WTPA 3TP5A 2RA4A 2YTVA 2K7VA 1WOCA 1KL9A 3A8IE 2KCTA 1JC7A 4DV5Q 1WI5A 3TS2A 4JI1L 3KLSA 2K14A 2MO0A 2EYMA 2NVXH 4LJZC 1U4PA 4HTHA 4C3IG 1CA6A 1SYEA 1ILPA 3J7AV 2NN6G 1QZHA 5IP7H 3P7JA 4GN3B 5GADC 1BBXC 2L0CA 3M4PA 4H7BA 3FP9A 4KN7C 5T1GA 2MQHA 4RHRA 1TS4A 5M5XB 2K28A 1ZYRC 1EY9A 1PZJD 3OOCA 2JK8A 4GLXA 2EYJA 1RCVD 3ERSX 4NP5A 4AQYL 3BVMA 1NMGA 2V4DA 4H13C 1Y1WB 2VQFQ 1Z7TA 2B2VC 1J5EQ 3W5OA 3G71A 4FXGC 2UXDQ 3S16B 1MSHA 4YHHQ 1JJCB 4XYQA 4DR2Q 4NKLA 1QUQA 2IPKD 3SK8A 5H1SE 4AYBE 3H91A 4I7ZC 1A63A 5DM73 3FMCA 4XQQA 1Y14B 1PRTB 2LFNA 1MJEA 2VNUD 1IBKL 4JI5Q 5CMDA 1CKMA 1IKLA 3L0OA 1BNZA 1OO9B 2BH2A 3GTMB 3PQIA 1MSGA 2H1EA 2QILA 1EYDA 2JJQA 5IGFA 2GN5A 2IWHA 2DJFC 3M4YA 1E2WA 3MFYA 2DY8A 3K81C 2IW3A 4UPAA 1U5KA 4KKSA 4FNFA 2JA6G 5BN5A 1VMCA 2QF7A 1V43A 3AFQA 1KRSA 2E75C 2ENBA 3CCQA 2E2HH 3UI2A 3U58A 1EY7A 4TQUS 2RKSA 3D0FA 1IBLQ 3JAMi 1JCKB 1PTOH 4H44C 2QDLA 2EYFA 2NTTA 1X32A 4IN3A 3A7AB 4R1JA 1SJED 4O0AA 2D5DA 5EJWA 1WTHA 3NTHA 1HNXL 2NVXB 1I4GA 1H9SA 4DR4Q 1N32Q 2WB1G 2XTIA 1OXTA 2A68D 3KLRA 1SE2A 3I3CA 3S1NH 1JOKA 2SEBD 5CV6A 4KK7A 2UXDL 3S2HH 3NEMA 3A0JA 1NBWA 5IGDA 3K5MA 5FKAC 3AFPA 1TS3A 2JA7G 4ME5A 2RSNA 3ND9A 2Z9HA 4N9TA 2N49A 4G7HC 1NJIC 4CJ0B 5IODA 3HOZH 3VR3A 4BBSG 5IGGA 2VUMH 2K50A 1PFMA 1UNSA 4ZK9B 4QQBX 1S5ED 4DFAA 4J1MA 2L11A 1Y8OB 2NBFA 1C48A 5IT9L 1I6VC 1U4RA 1W3SA 3D31A 1TS5A 2WFWA 1NNXA 1IW7D 4LNQA 3QIAA 3UDXA 2F0DA 2K03A 2KUMA 2YU9H 2A69C 1EQTA 5IYDG 5CV7A 2YTYA 3D6WA 4NXNQ 4DR4L 2E2HB 5M9OA 3R2TA 4GZYC 1E1OA 1H9JA 3FEWX 4R4QA 1HZCA 5KRUA 4XYOA 2A8VA 3MZ5A 1STGA 5EPJA 4CDDC 2EVBA 1PTOB 1CI3M 1XPRA 4BA2I 2J4XA 3UDGA 5KYIA 3RZOH 2OWOA 4IO9A 4G7ZC 1D6EC 1L0YB 1EWHA 2CQAA 3TS0A 1N36L 3S1NB 1GD7A 3STBD 4JI4Q 3S2HB 1VCIA 4F8MA 4HIDA 3HFZB 4KD3A 4DR6L 1BBUA 4OO1I 2HCCA 3RNUA 3TDQA 4QB4A 4IUNA 4K14A 1BXTA 4ME3A 5A2QE 4B08A 1KLUD 1K73C 4A3CG 4QIWE 5D65A 1WTRA 2B2WC 2L1BA 4QF4A 1BCPF 5L37A 3HEJA 3BJUA 2B63G 4L5QA 3CAMA 4ZKBB 2K5NA 3MC0B 2ID0A 2FMMA 4L63B 3I7FA 1XMQL 3F8TA 2HUGA 1UE7A 2AKWB 2QCPX 3PIO3 5A35A 3NELA 1NR2A 3CQZH 5LHY1 3U9OA 2JE6I 1WTVA 5EGTA 4N8X1 2K75A 2FXQA 1QILA 4DK1A 5IYBH 3V96A 1EQVA 2IT1A 4JI0L 4EVOA 4A3BB 1Q12A 4A75A 4RFBA 4NPSA 4RAUC 2F0MA 1HZBA 1PRTC 3E9HA 2YU9B 4GNXA 3GTQH 1QB5D 1IBMQ 1K8MA 5IYCG 1LABA 2F3WA 3ULJA 1STYA 1V1OA 3RLNA 4C3JH 2OTJA 3O13A 1OXVA 3JC66 2O5IC 4UP7A 4XT1B 3DWQA 3SEBA 3PO3H 1BF4A 4NXMQ 1F2ZA 1KAAA 1EOTA 3RZOB 1TWHH 1O80A 4X62Q 2BE5C 2HHHL 3W2DA 1PYWD 3G7LA 3MFGA 3QG1A 1LTBD 1SDFA 2F0QA 5KNDA 4H0LC 3C1FA 2CW0D 2WB1E 4PZ8A 2R92H 4HMJA 3FDTA 1MGSA 5JJIA 1CKNB 4OONA 1JE4A 1SRUA 1HR0L 4R9WA 1IZ6A 4LAAA 4YIJA 3OWEB 4GLVB 3KK7A 1PH2A 1T5XD 3H09A 3GTJB 3E0EA 4L5TA 2C5CA 2ICEC 4K6LA 4LF4L 3RZDB 5IP7G 2E76C 4A4IA 4MIUA 5C0XH 3CCJA 4DV2L 2B8FA 1X3QA 1KNEA 4A3DH 3BDOA 3M7GA 2FHTA 4POGA 3KDFB 2NTSA 3HOYH 3A7LA 4HSPA 4HAEA 4B3MQ 3H3VH 5IY0A 1BBWA 4BY1B 3HG9A 2EYPA 2Q2TA 3CQZB 3A54A 4RCNA 5ELDA 3U9SA 1RHPA 4A3JH 4L5SA 5HGTA 4QUCA 2AQ1B 4BBRH 4PMCA 3GTQB 2NVYH 4Q0FA 4ZCKA 4LWCA 1UUPA 4K5XA 3SK5A 4QMGA 4HJ7A 5EBDA 2K5WA 1TT2A 1SBBB 3M7NA 4C3JB 1X3EA 2EY2A 5K36H 4YY3L 4EQ5A 4C2MB 4QL5A 1GUTA 3GV3A 1QVFA 4IUVA 4DK3C 2F0GA 4JOIA 2JA5B 1K8GA 2DN8A 3KFUA 1SR3A 1TWHB 1E3PA 1TWGB 5KYLA 1HPCA 1KD1C 1B70B 3K58A 3I4NG 4KHVA 3EROA 3GV6A 4K2LA 3TP8A 3S14H 2R92B 3AYHB 2PO4A 4DXFA 1LLRD 1PH1A 4XQNA 1NUCA 1B1ZA 4M1UB 1YHBA 1Y69U 1EU4A 3IL8A 2K5VA 1PFSA 1YHQA 2VS1A 4DV0L 3TP7A 5BR8Q 5LMNW 3PV0A 5JPNC 2KQ3A 4JI7Q 4WFN3 4Y52H 4NDXA 4A3EH 2F0JA 1RKNA 1TU2B 2ZJQA 3I4MH 3MEFA 1H9MA 1VQOA 4YWMA 3VA5A 1ZKOA 5KEEA 5EAYA 5AJ3Q 2CQOA 2DUDA 4IALA 3BU2A 4A3DB 4TVAB 2SNMA 2K52A 2LKVA 5C5LA 4K5WA 1PYBA 1CKNA 1JOQA 4P71A 1A2TA 1ICWA 2N78A 4GKJQ 3CMAA 4YCVA 1CFMA 4A3KH 3TZDA 1G2SA 1SNPA 5M5YB 4KV6A 4UP8A 4IUTA 3E0JA 2EIFA 2HQLA 4BY7H 4A3JB 3HOZG 3J80i 2Q8TA 1N33Q 2VUMG 1HNZQ 3EIVA 3OTOQ 4IUUA 1GM5A 4BBRB 3X3NA 2F0LA 1VF7A 2NVYB 5M3FG 4A93H 2B29A 4HR7B 3T4AC 1GHKA 1UEBA 4PMWA 4JC0A 2JYOA 5JEAH 2QDBA 1QJOA 2PQAA 2KOLA 5J22A 1U9RA 1SMYC 1Y8PB 3FVQA 1UEAB 3KDFA 3WOFA 2I0QA 3TSSA 1S72A 4A76A 4OXPA 2E2IB 2HD3A 4IPDA 4LK1C 1BDOA 2XVSA 1V8QA 5J1ZA 1RJTA 3NWTA 1X3PA 1EFWA 4L8JA 4TKOB 3K59A 1L2FA 3I91A 3RN2A 2EPBA 2B39A 2KA7A 1EWIA 2MUYA 3S14B 1A2UA 4PV1C 1O7YA 4OX9L 1ASYA 5AJ3L 1PFNA 4JI6Q 1X3GA 1G51A 2PI2A 1SEBD 3UDFA 4DV7L 2NVTH 1F77A 3S17H 2PCFB 4LF5L 2EY6A 1V1PB 1VQIA 2NN6I 4DR7Q 1B4OA 2Z6KC 1SMXA 4O42A 3L2PA 2DJGC 2RSOA 2E2DC 4KJOA 4A3FH 1D8LA 2PMZB 3CCMA 4RHSA 3I4MB 4RA8A 5JVH3 1A3VA 1VQEA 2J7ZA 3J7ZC 4DR3Q 2OF1A 3I55A 3S1RH 3SDZA 4DK0A 1EOVA 4IOCA 4PZ7A 1SAPA 3R2IA 2X6LA 3J7AF 3EQLC 4CDFC 4X65Q 3P75A 4ZLTF 5FO8B 4KY5A 1I4XA 1H9KA 2MJ8A 1SSOA 4O2DA 1BOSA 4CJ1B 1JE5A 4POFA 1UAPA 4A3KB 3H15A 1Y1VB 2AMCB 4LF8L 4BY7B 3AMUA 1UE1A 4LFCQ 4C1NI 4DXGA 1FNWA 5M3MH 3SVMA 3OMCA 1Q7YC 3TN2A 5GQOA 1XNQQ 1WJJA 4JI6L 3E9IA 5IYBG 2PZTA 3M9BA 1SE4A 3K7AH 5DLQE 4JI1Q 3NTIA 4DV4L 5C3EH 1IL8A 1OXUA 2PYKA 2A68C 2JQOA 3W3AA 3S24A 3UE1A 5EKLA 1SYBA 1TKWB 2CH4A 2IL8A 1Y1WH 2X6GA 4C3JG 2RDFA 5EPLA 2NB0A 3S16H 1QG7A 2SOBA 4DV1L 3PO3G 2RQXA 1LM0A 1R4PB 2NVTB 4X65L 1L1OB 3URYA 4C3HH 5FLXc 1DXMA 3VR5A 1UWVA 5TSSA 2VW9A 4ALPA 3OW2A 2K1BA 2B2VA 1C9OA 2EYOA 4K8JA 3J7YW 4AQYQ 1HA6A 2EXDA 2YV5A 4A3FB 1VQNA 1GHJA 1T5EA 5K5PA 3FPPA 1LTLA 5ISRA 3PUXA 1YITA 3F2CA 1DCZA 5F2DA 1XTDA 5EPKA 3A74A 2QA4A 1IBKQ 4JV5Q 1STAA 2A5HA 2AQ2B 1XNQL 3F1ZA 4IPHA 5C0XG 1MHWC 1X65A 3RN5A 2BA0A 3LWUA 4A3DG 2XRSD 3RLFA 2AHOB 1SLJA 1TWFB 2ZXPA 3H3VC 5M3MB 1G6ZA 3HOYG 1FL0A 2JEBI 1HRJA 2J0TD 2HIXA 3C1EA 5IP9H 3HKZB 4P73A 1B3QA 3Q24A 3VR2A 2CWPA 3CCSA 2L55A 4A3JG 3K8AA 4IJLA 3K7AB 4BBRG 5C3EB 1S5FD 3NQTA 2M2LA 1KC8C 2EJFC 2QKIC 1HNXQ 3SGIA 4XXEA 3FKIH 1BCPB 1EY6A 1HCZA 5K36G 5I2XA 1YJWA 1YNJD 2L15A 1O7IA 1SFOH 3EN2A 5CORA 2ZJPA 1HQMC 4HJ8A 3RR5A 3K57A 1PH8A 4C3HB 4X64L 4JV5L 2MO1A 3MTSA 3I70A 3H6MA 3T53B 1B53A 5FLXE 3T13A 2JN4A 4BXXH 2BCOA 3GTOH 3S1QB 3OSOA 1IYUA 1O78A 2VQEL 5KNCA 2LMCB 4UAIA 1L0XB 2ZTEA 3T16A 1YVCA 1D2BA 3VYTA 1STNA 1YNND 3SE0A 4ZKCB 4DR1L 5CV4A 1ICFB 2Z1CA 3K5OA 1EU3A 2MP1A 3KBXA 5C3XA 2UUAQ 1YEZA 3G48A 3OMGA 4A3EG 1SNQA 3K0YA 3U50C 3I4MG 4X3UA 1PHJA 1NMFA 2I5MX 2KBNA 3EBEA 1WD1A 3HOVB 4RKBA 3E3XA 1A3UA 4QUFA 4QGUA 3SK4A 3ER0A 3Q0AA 1Z6HA 1FNVA 4MZ9A 3EA6A 1KTKA 4K8IA 3GDEA 4XT3B 2AWOA 3HP3A 4GKKQ 1EY5A 4IPGA 3SK6A 1HXYD 2AUJD 3OW7A 3L9AX 4FF4A 1Q1EA 2WAQB 2K01A 2Q2HA 3PUVA 4A3KG 1Q82C 3TP6A 1QZGA 1PH5A 3CPFA 5GAHC 1LTSD 2L4NA 4IZ8A 2A1AA 5JVG3 3M3YH 4KY7A 1CQFA 1QWYA 1KDAA 4DV6L
chains in the Genus database with same CATH topology
1H95A 4UP7A 1SN8A 3PO3H 4A93G 4HIKA 2Q2UA 4NXMQ 2PI2E 4JBWA 1VQMA 1QVCA 5JEAG 4LUZA 1TWHH 4KHPL 4BA1I 4X62Q 1N36Q 2HHHL 3U4ZA 1WCMG 1Q81C 5C4XG 5FLMH 1Q86C 2ZM6Q 1KRTA 4H02A 5HY6A 1WFQA 4X64Q 2R92H 2WB1E 1J6QA 4PZ8A 5C44G 4DR6Q 3KF6A 2RHQB 2RF4A 1M90C 2JA7H 3DLLA 4A3IH 3B6YA 4YWKA 4JYAQ 4IFDJ 1X55A 1CKNB 4OONA 5C0XJ 5LMUL 5JJIA 4LUVA 4JOIC 3A5UA 1PH4A 2UUAL 1SRUA 4YWLA 1HR0L 3KLWA 4R4OA 1PH3A 1IZ6A 3U4VA 1XPUA 1CSPA 1I3QH 2VQEQ 3HOVH 1HNWQ 1PYSB 4GLVB 1PH2A 1CSQA 4RMFA 1EQRA 3F2DA 3ZJYC 2R7ZH 4A3BH 2EQSA 4DR1Q 3CCUA 4DR5Q 4BBSH 1T9HA 3S15H 3A5ZB 2OQ0A 3E0EA 2UU9L 1L1OC 3DM3A 4L5TA 1VQKA 1V9PA 1UE6A 3PF5A 4LF4L 3J7A5 3T1YL 5IP7G 5BR8L 2H5XA 2ZTDA 4A4IA 1Z9FA 1A62A 1S3OA 1XMQQ 4JI7L 3S2DH 2OTJA 2V1CC 3CCJA 1SE8A 3PUZA 5FJ8H 3G4SA 4DV2L 1VQ8A 4JBKA 4GKKL 3M85A 4GOPB 4JCVE 4A3DH 2UUCL 4HIOA 1FGUA 2GVBA 1VQJA 3J81i 4DUYQ 4OWTB 4DUZQ 4A3FG 1YNXA 4GS3A 4POGA 3KDFB 5HGQA 4A3MH 3HOYH 1W2BA 4X66Q 3GTPH 4A3LG 4B3MQ 3H3VH 4JI0Q 4AYBG 5IY0A 1BBWA 1KAWA 3STBC 2Q2TA 5IYDH 3OYYA 3NENA 1B7YB 1G291 3PUWA 2DGYA 2K5HA 2IX0A 3HOWG 4A3JH 4DKAC 4L5SA 4GKJL 1OXXK 3HOXH 3K7UC 4K0KQ 4OWXB 4A3GH 4BBRH 2NVYH 3I56A 1VQHA 2ZM6L 3UDIA 1P16A 4LWCA 2R93G 1X56A 4HJ7A 4DV6Q 4LW1A 1K83H 3CC4A 2BH8A 4RG1A 1N33L 4KI0A 2AWNA 3OTOL 1C7YA 1HNZL 2YYZA 5IE8A 4JI8Q 3M7NA 1VQ7A 1YZ6A 1XJVA 1X3EA 3PSIA 1SROA 3GTJH 4KHPQ 4B3SQ 3CC2A 4YY3L 4EQ5A 1HNWL 5JJLA 4QL5A 1XPOA 2JA8H 2HHHQ 4GLAC 1QVFA 3I2ZA 4JBMA 4JBJA 4DK3C 4JOIA 3RZDH 1VQLA 3HKZG 1K8GA 3KFUA 1OXSC 1Q46A 1SR3A 1VQ6A 1E3PA 1KHIA 2IX1A 1FJGQ 1X6OA 5LMUQ 1B70B 1KD1C 3I4NG 1JJ2A 1I6HH 1HR0Q 1KQSA 3I4OA 3S14H 1JJGA 3AYHB 1E1TA 5C3EG 4DV5L 1L1OA 3W1BA 1MIUA 1S40A 3M4OH 4A3CH 1DGSA 1PH1A 4BY1H 1YHBA 4PZ6A 3S1MH 2QGQA 4DUZL 2B63H 2K5VA 1PFSA 1Y1WG 1JMCA 1YHAA 1VQGA 1YHQA 4WJ3M 3ULLA 4LF4Q 2VS1A 3T1YQ 4DV0L 3G6EA 4JG2A 4FDBA 5BR8Q 4Y7NH 5LMNW 1RL2A 3I4NH 3PV0A 4JI7Q 4Y52H 4DV2Q 1B8AA 5M5XH 3WWVA 3PGZA 4A3EH 3KJOA 2ATWA 3PF4A 2R6GA 2OQKA 2ZJQA 3KJPA 3I4MH 3J80c 2CCZA 3KYHC 3MEFA 2UUCQ 4DR7L 1A8VA 1PH7A 3L7ZC 1Y1VG 2A19A 2YTXA 4YCWA 4YWMA 5IT9c 1VQOA 1M1KC 1ASZA 2RCNA 3GTKH 4BY7G 1K3RA 3HKSA 2CWAA 5EAYA 2BA1A 2CQOA 5AJ3Q 2DUDA 3HOUH 3BU2A 4IJHA 4TVAB 1KIXA 2NZOA 2K52A 3TEHB 2OTLA 2D0OA 4C2MH 2Q2IA 5E7NA 1PYBA 2PMZE 1CKNA 4YCUA 4P71A 2KCMA 3IRBA 4DR3L 3BZCA 4AIMA 4JI8L 1KXLA 2R7FA 2N78A 5JEAJ 2JA5H 2IHFA 4GKJQ 2VQFL 3CCRA 1J5EL 3CMAA 1YBYA 4YCVA 4B3SL 4A3KH 1TWGH 3F2BA 1VQPA 1TWCH 4UP8A 2CKZB 5IYCH 4YHHL 3CXCA 4DR2L 1VQ9A 2EIFA 2HQLA 4BY7H 3GTMH 3HOZG 3J80i 1YIJA 2OCEA 1VQDA 1N33Q 2VUMG 3TRZA 1HNZQ 3EIVA 3OTOQ 4HJAA 1YJNA 1GM5A 2NVQH 1FJGL 4JI5L 1N9WA 1X54A 5M3FG 4LF6Q 4A93H 1HJPA 2B29A 3J81c 2IY5B 3PIPA 4YY3Q 1UEBA 5GAEC 4PMWA 4JC0A 1HH2P 4GNXB 3VDYA 1Z47A 2Y0SE 1LYLA 4LFCL 2PQAA 4QY7A 1WCMH 4R4TA 5C4XH 4P72A 3ICEA 2XGTA 3KDFA 5C44H 2I0QA 4JI2L 1L0WA 1S72A 1UE5A 4OXPA 4A76A 1XNRL 2YTVA 4IPDA 3KF8B 4GN4B 1WOCA 1KL9A 5IP9G 2WAQG 4GN5A 3J81j 2KCTA 5M3FH 2B3GA 1IBLL 4DV5Q 1WI5A 3TS2A 1EFWA 4JI1L 1CKOA 1L2FA 2K14A 3RN2A 3PUYA 2MFIA 2MO0A 3BZKA 1EWIA 2NVXH 3CPWA 4XIGS 4OX9L 2K4KA 1ASYA 4L5RC 5AJ3L 3CP0A 4DV0Q 1QVGA 4JI6Q 1X3GA 1G51A 2PI2A 3UDFA 2NN6G 4DV7L 1QZHA 2NVTH 5IP7H 5M5YH 2Z0SA 4GN3B 3RLOA 5GADC 5LMNL 3S17H 3FKIG 4LF5L 3M4PA 1N32L 1VQIA 2NN6I 3FP9A 4DR7Q 2Z6KC 1SMXA 2C35B 3L2PA 2KHIA 1XMOL 4KLKA 2MQHA 2ZTCA 4A3FH 4MTNA 1D8LA 3CCMA 2JK8A 4GLXA 4A3LH 1C0AA 1VQEA 1V1QA 3ERSX 4EX5A 3J7ZC 4DR3Q 4AQYL 3I55A 5IWAL 3PO2G 1NMGA 1NE3A 3S1RH 1EOVA 4IOCA 3CCVA 1X3FA 4PZ7A 4LF6L 2VQFQ 4BXXG 1J5EQ 3HOWH 4DV3L 1AH9A 3W5OA 3CCLA 3G71A 4X65Q 2UXDQ 5M3MG 2ASBA 4DR2Q 4YHHQ 1JJCB 4LFAQ 1YI2A 2E2IH 4O2DA 2UXCL 1QUQA 5H1SE 1BVSA 4AYBE 1MJCA 1JE5A 4POFA 1A63A 3NBHB 2R93H 1Y14B 1MJEA 2VNUD 4UY8C 4GOPC 3H15A 4QJFA 1VS0A 2AMCB 1IBKL 4JI5Q 4PG3A 4LF8L 1CKMA 3L0OA 1EUJA 1FVIA 2BH2A 1K9MC 2JJQA 2GN5A 4DNIA 2KHJA 1UE1A 4LFCQ 1IL2A 5M3MH 3K81C 3CD6A 1LUZA 4UPAA 3LGJA 4IOAA 1U5KA 3AQQA 2UXBQ 2JA6G 1Q7YC 1V43A 3AFQA 1KRSA 3CCQA 4JI2Q 1XNRQ 1K0RA 2E2HH 4DPGA 5GQOA 3U58A 1XNQQ 3H0GG 1WJJA 2I5LX 4JI6L 1TWAH 3E9IA 5IYBG 4TQUS 3CMEA 2JEAI 3D0FA 1IBLQ 1PH6A 4R4IA 3M9BA 3K7AH 5DLQE 5GROA 4NXNL 4JI1Q 3JAMi 4DV4L 1VQ5A 4B3TQ 5C3EH 2QEXA 1OXUA 3HKZE 4P75A 2JQOA 3S24A 3UE1A 4OX9Q 4R1JA 2RHSB 3Q8DA 1Y1WH 1K8AC 4MNOA 4O0AA 2Z6KA 4DV7Q 1HNXL 3S16H 1HZAA 2KENA 5LMNQ 5M5WH 4DR4Q 4LF5Q 1VQ4A 3K80C 1N32Q 4DV1L 2WB1G 2XTIA 2R7DA 1OXTA 3PO3G 1PVOA 4NB3A 1CUKA 1AE3A 1LM0A 1EQQA 1EYGA 3S1NH 5JJKA 1XMOQ 4X65L 1L1OB 2UXDL 1NTGA 1VQAA 1Y1VH 3NEMA 3W1GA 4C3HH 5FLXc 3S2HH 4XTCS 4LFAL 4UP9A 3A0JA 1NBWA 1UWVA 1I5FA 2VL6A 4APVA 5FLMG 2VW9A 4ALPA 3OW2A 1YJ9A 3CCEA 1R9TH 4DK6C 1C9OA 2GVAA 4AQYQ 4JI4L 4WJ4A 5IWAQ 2LSSA 2YV5A 2EXDA 3AFPA 4LFBL 1E24A 4A3IG 2JA7G 2I5HA 1VQNA 1I94L 1OTCA 4DV3Q 4JI3Q 1TXYA 4HJ9A 1LTLA 3HOVG 4GOPA 3CF5A 3PUXA 1I50H 1YITA 2N49A 3F2CA 1NJIC 2R7ZG 4A3BG 2UXBL 1XTDA 1IXRA 1U0LA 3GD7A 3PIOA 3HOZH 4BBSG 4LF7Q 3A74A 3MXNB 2QA4A 1X9NA 2K50A 3TREA 3CC7A 1IBKQ 4LF8Q 2VUMH 4JV5Q 4QQBX 2PNHA 4LF9L 1XNQL 3F1ZA 1MKHA 2LXKA 3ULPA 2UUBQ 1BKBA 4IPHA 2ZJRA 4IFDG 5C0XG 2JA5G 3GO5A 5FJ8G 4B3TL 4OWWB 2F4VQ 1X65A 1A0IA 4KHZA 5ELOA 3RN5A 2BA0A 4B3RL 4IFDI 4A3DG 1W3SA 3D31A 5C0XI 3RLFA 1G6PA 2AHOB 1SLJA 2WFWA 4DAMA 5J3BA 1N8RC 3T1HL 4P74A 4A3MG 4LNQA 1FL0A 3UDXA 3KF6B 3HOYG 2YU9H 2JEBI 4K0KL 3CW2C 2HIXA 5IP9H 5IYDG 2YTYA 4P73A 4DV4Q 4HIMA 4NXNQ 4DR4L 1E7ZA 3H3VI 1GKHA 2CWPA 3CCSA 1E1OA 3FHWA 4DAYB 1GO3E 4A3JG 4R4QA 1HZCA 3K8AA 1VQFA 2JA9A 2A8VA 3HOXG 1HZ9A 2N8NA 2PQAB 4IJLA 1PV4A 1IBML 1N34Q 4A3GG 1PA6A 4BBRG 2E5LL 1XPRA 1KC8C 4BA2I 4C3IH 2WAQE 1Q8KA 4LUOA 1VQCA 3K0XA 3M4QA 4GNXC 3UDGA 1HNXQ 2ALYB 2F52A 3SGIA 4DV1Q 3RZOH 2OWOA 3FKIH 1Q1BA 1JT8A 4JI3L 5K36G 1EIYB 4NXML 1YJWA 2L15A 1O7IA 2VY3A 4IO9A 1SFOH 2IHEA 2JA8G 2HT1A 3EN2A 2ZJPA 1RIPA 1AE2A 4X62L 3TS0A 1N36L 1GD7A 3RR5A 3STBD 3JAMc 4HJ8A 4JI4Q 4OO1G 2D0PA 1PH8A 4X64L 1JB7A 1NY4A 4LF7L 1VCIA 4LFBQ 2MO1A 4HIDA 4JV5L 3HFZB 2UXCQ 1I94Q 4DR6L 1P8LA 1BBUA 2WP8J 3PO2H 4OO1I 3TQYA 2N3SA 4DV6L 1HR0W 4JYAL 4X6AH 3RNUA 2UUBL 4BXXH 1TWFH 3GTOH 3PCOB 4ME3A 2LXJA 2F4VL 2VQEL 1K73C 4A3CG 4QIWE 4BY1G 2ZTEA 1YVCA 1D7QA 1GVPA 3UE0A 2VZAA 4DR1L 3BJUA 2B63G 4L5QA 4DR5L 4LF9Q 3CAMA 2K5NA 2ID0A 2UUAQ 1YEZA 3I7FA 4R4CA 1XMQL 3G48A 3F8TA 4A3EG 1EIFA 1UE7A 4B3RQ 2AKWB 3GTGH 3U50C 3I4MG 1PHJA 1NMFA 2I5MX 3NELA 2KBNA 1QUQB 3EBEA 2JA6H 1N34L 3CQZH 3T1HQ 3HOUG 2JE6I 4DUYL 2UU9Q 4QGUA 2K75A 2FXQA 3H0GH 1PH9A 4X66L 3ER0A 5IYBH 4B3ML 2IT1A 4JI0L 1Q12A 2D62A 2NZHA 4AH6A 4NPSA 4HJ5A 4A75A 4IPCA 4MZ9A 1HZBA 3AEVA 2E8GA 1IYJB 1E22A 2AWOA 3E9HA 3GDEA 4IPGA 5ELNA 5C4JH 2MNAA 4GNXA 3GTQH 4GKKQ 1IBMQ 1Q1EA 2HIVA 4A3KG 2Q2HA 3PUVA 1Q82C 2CFMA 1QZGA 2E5LQ 1PH5A 3CPFA 5IYCG 1WYDA 3KOJA 5GAHC 2E2JH 2Y0SG 2A1AA 3ULJA 5GAGC 3M3YH 3RLNA 4C3JH 2R92G 1VQBA 2F3IA 3S1QH 1OXVA 3JC66 3GTLH 2ES2A 4J15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H95 A;  4UP7 A;  1SN8 A;  3PO3 H;  4A93 G;  4HIK A;  2Q2U A;  4NXM Q;  2PI2 E;  4JBW A;  1VQM A;  1QVC A;  5JEA G;  4LUZ A;  1TWH H;  4KHP L;  4BA1 I;  4X62 Q;  1N36 Q;  2HHH L;  3U4Z A;  1WCM G;  1Q81 C;  5C4X G;  5FLM H;  1Q86 C;  2ZM6 Q;  1KRT A;  4H02 A;  5HY6 A;  1WFQ A;  4X64 Q;  2R92 H;  2WB1 E;  1J6Q A;  4PZ8 A;  5C44 G;  4DR6 Q;  3KF6 A;  2RHQ B;  2RF4 A;  1M90 C;  2JA7 H;  3DLL A;  4A3I H;  3B6Y A;  4YWK A;  4JYA Q;  4IFD J;  1X55 A;  1CKN B;  4OON A;  5C0X J;  5LMU L;  5JJI A;  4LUV A;  4JOI C;  3A5U A;  1PH4 A;  2UUA L;  1SRU A;  4YWL A;  1HR0 L;  3KLW A;  4R4O A;  1PH3 A;  1IZ6 A;  3U4V A;  1XPU A;  1CSP A;  1I3Q H;  2VQE Q;  3HOV H;  1HNW Q;  1PYS B;  4GLV B;  1PH2 A;  1CSQ A;  4RMF A;  1EQR A;  3F2D A;  3ZJY C;  2R7Z H;  4A3B H;  2EQS A;  4DR1 Q;  3CCU A;  4DR5 Q;  4BBS H;  1T9H A;  3S15 H;  3A5Z B;  2OQ0 A;  3E0E A;  2UU9 L;  1L1O C;  3DM3 A;  4L5T A;  1VQK A;  1V9P A;  1UE6 A;  3PF5 A;  4LF4 L;  3J7A 5;  3T1Y L;  5IP7 G;  5BR8 L;  2H5X A;  2ZTD A;  4A4I A;  1Z9F A;  1A62 A;  1S3O A;  1XMQ Q;  4JI7 L;  3S2D H;  2OTJ A;  2V1C C;  3CCJ A;  1SE8 A;  3PUZ A;  5FJ8 H;  3G4S A;  4DV2 L;  1VQ8 A;  4JBK A;  4GKK L;  3M85 A;  4GOP B;  4JCV E;  4A3D H;  2UUC L;  4HIO A;  1FGU A;  2GVB A;  1VQJ A;  3J81 i;  4DUY Q;  4OWT B;  4DUZ Q;  4A3F G;  1YNX A;  4GS3 A;  4POG A;  3KDF B;  5HGQ A;  4A3M H;  3HOY H;  1W2B A;  4X66 Q;  3GTP H;  4A3L G;  4B3M Q;  3H3V H;  4JI0 Q;  4AYB G;  5IY0 A;  1BBW A;  1KAW A;  3STB C;  2Q2T A;  5IYD H;  3OYY A;  3NEN A;  1B7Y B;  1G29 1;  3PUW A;  2DGY A;  2K5H A;  2IX0 A;  3HOW G;  4A3J H;  4DKA C;  4L5S A;  4GKJ L;  1OXX K;  3HOX H;  3K7U C;  4K0K Q;  4OWX B;  4A3G H;  4BBR H;  2NVY H;  3I56 A;  1VQH A;  2ZM6 L;  3UDI A;  1P16 A;  4LWC A;  2R93 G;  1X56 A;  4HJ7 A;  4DV6 Q;  4LW1 A;  1K83 H;  3CC4 A;  2BH8 A;  4RG1 A;  1N33 L;  4KI0 A;  2AWN A;  3OTO L;  1C7Y A;  1HNZ L;  2YYZ A;  5IE8 A;  4JI8 Q;  3M7N A;  1VQ7 A;  1YZ6 A;  1XJV A;  1X3E A;  3PSI A;  1SRO A;  3GTJ H;  4KHP Q;  4B3S Q;  3CC2 A;  4YY3 L;  4EQ5 A;  1HNW L;  5JJL A;  4QL5 A;  1XPO A;  2JA8 H;  2HHH Q;  4GLA C;  1QVF A;  3I2Z A;  4JBM A;  4JBJ A;  4DK3 C;  4JOI A;  3RZD H;  1VQL A;  3HKZ G;  1K8G A;  3KFU A;  1OXS C;  1Q46 A;  1SR3 A;  1VQ6 A;  1E3P A;  1KHI A;  2IX1 A;  1FJG Q;  1X6O A;  5LMU Q;  1B70 B;  1KD1 C;  3I4N G;  1JJ2 A;  1I6H H;  1HR0 Q;  1KQS A;  3I4O A;  3S14 H;  1JJG A;  3AYH B;  1E1T A;  5C3E G;  4DV5 L;  1L1O A;  3W1B A;  1MIU A;  1S40 A;  3M4O H;  4A3C H;  1DGS A;  1PH1 A;  4BY1 H;  1YHB A;  4PZ6 A;  3S1M H;  2QGQ A;  4DUZ L;  2B63 H;  2K5V A;  1PFS A;  1Y1W G;  1JMC A;  1YHA A;  1VQG A;  1YHQ A;  4WJ3 M;  3ULL A;  4LF4 Q;  2VS1 A;  3T1Y Q;  4DV0 L;  3G6E A;  4JG2 A;  4FDB A;  5BR8 Q;  4Y7N H;  5LMN W;  1RL2 A;  3I4N H;  3PV0 A;  4JI7 Q;  4Y52 H;  4DV2 Q;  1B8A A;  5M5X H;  3WWV A;  3PGZ A;  4A3E H;  3KJO A;  2ATW A;  3PF4 A;  2R6G A;  2OQK A;  2ZJQ A;  3KJP A;  3I4M H;  3J80 c;  2CCZ A;  3KYH C;  3MEF A;  2UUC Q;  4DR7 L;  1A8V A;  1PH7 A;  3L7Z C;  1Y1V G;  2A19 A;  2YTX A;  4YCW A;  4YWM A;  5IT9 c;  1VQO A;  1M1K C;  1ASZ A;  2RCN A;  3GTK H;  4BY7 G;  1K3R A;  3HKS A;  2CWA A;  5EAY A;  2BA1 A;  2CQO A;  5AJ3 Q;  2DUD A;  3HOU H;  3BU2 A;  4IJH A;  4TVA B;  1KIX A;  2NZO A;  2K52 A;  3TEH B;  2OTL A;  2D0O A;  4C2M H;  2Q2I A;  5E7N A;  1PYB A;  2PMZ E;  1CKN A;  4YCU A;  4P71 A;  2KCM A;  3IRB A;  4DR3 L;  3BZC A;  4AIM A;  4JI8 L;  1KXL A;  2R7F A;  2N78 A;  5JEA J;  2JA5 H;  2IHF A;  4GKJ Q;  2VQF L;  3CCR A;  1J5E L;  3CMA A;  1YBY A;  4YCV A;  4B3S L;  4A3K H;  1TWG H;  3F2B A;  1VQP A;  1TWC H;  4UP8 A;  2CKZ B;  5IYC H;  4YHH L;  3CXC A;  4DR2 L;  1VQ9 A;  2EIF A;  2HQL A;  4BY7 H;  3GTM H;  3HOZ G;  3J80 i;  1YIJ A;  2OCE A;  1VQD A;  1N33 Q;  2VUM G;  3TRZ A;  1HNZ Q;  3EIV A;  3OTO Q;  4HJA A;  1YJN A;  1GM5 A;  2NVQ H;  1FJG L;  4JI5 L;  1N9W A;  1X54 A;  5M3F G;  4LF6 Q;  4A93 H;  1HJP A;  2B29 A;  3J81 c;  2IY5 B;  3PIP A;  4YY3 Q;  1UEB A;  5GAE C;  4PMW A;  4JC0 A;  1HH2 P;  4GNX B;  3VDY A;  1Z47 A;  2Y0S E;  1LYL A;  4LFC L;  2PQA A;  4QY7 A;  1WCM H;  4R4T A;  5C4X H;  4P72 A;  3ICE A;  2XGT A;  3KDF A;  5C44 H;  2I0Q A;  4JI2 L;  1L0W A;  1S72 A;  1UE5 A;  4OXP A;  4A76 A;  1XNR L;  2YTV A;  4IPD A;  3KF8 B;  4GN4 B;  1WOC A;  1KL9 A;  5IP9 G;  2WAQ G;  4GN5 A;  3J81 j;  2KCT A;  5M3F H;  2B3G A;  1IBL L;  4DV5 Q;  1WI5 A;  3TS2 A;  1EFW A;  4JI1 L;  1CKO A;  1L2F A;  2K14 A;  3RN2 A;  3PUY A;  2MFI A;  2MO0 A;  3BZK A;  1EWI A;  2NVX H;  3CPW A;  4XIG S;  4OX9 L;  2K4K A;  1ASY A;  4L5R C;  5AJ3 L;  3CP0 A;  4DV0 Q;  1QVG A;  4JI6 Q;  1X3G A;  1G51 A;  2PI2 A;  3UDF A;  2NN6 G;  4DV7 L;  1QZH A;  2NVT H;  5IP7 H;  5M5Y H;  2Z0S A;  4GN3 B;  3RLO A;  5GAD C;  5LMN L;  3S17 H;  3FKI G;  4LF5 L;  3M4P A;  1N32 L;  1VQI A;  2NN6 I;  3FP9 A;  4DR7 Q;  2Z6K C;  1SMX A;  2C35 B;  3L2P A;  2KHI A;  1XMO L;  4KLK A;  2MQH A;  2ZTC A;  4A3F H;  4MTN A;  1D8L A;  3CCM A;  2JK8 A;  4GLX A;  4A3L H;  1C0A A;  1VQE A;  1V1Q A;  3ERS X;  4EX5 A;  3J7Z C;  4DR3 Q;  4AQY L;  3I55 A;  5IWA L;  3PO2 G;  1NMG A;  1NE3 A;  3S1R H;  1EOV A;  4IOC A;  3CCV A;  1X3F A;  4PZ7 A;  4LF6 L;  2VQF Q;  4BXX G;  1J5E Q;  3HOW H;  4DV3 L;  1AH9 A;  3W5O A;  3CCL A;  3G71 A;  4X65 Q;  2UXD Q;  5M3M G;  2ASB A;  4DR2 Q;  4YHH Q;  1JJC B;  4LFA Q;  1YI2 A;  2E2I H;  4O2D A;  2UXC L;  1QUQ A;  5H1S E;  1BVS A;  4AYB E;  1MJC A;  1JE5 A;  4POF A;  1A63 A;  3NBH B;  2R93 H;  1Y14 B;  1MJE A;  2VNU D;  4UY8 C;  4GOP C;  3H15 A;  4QJF A;  1VS0 A;  2AMC B;  1IBK L;  4JI5 Q;  4PG3 A;  4LF8 L;  1CKM A;  3L0O A;  1EUJ A;  1FVI A;  2BH2 A;  1K9M C;  2JJQ A;  2GN5 A;  4DNI A;  2KHJ A;  1UE1 A;  4LFC Q;  1IL2 A;  5M3M H;  3K81 C;  3CD6 A;  1LUZ A;  4UPA A;  3LGJ A;  4IOA A;  1U5K A;  3AQQ A;  2UXB Q;  2JA6 G;  1Q7Y C;  1V43 A;  3AFQ A;  1KRS A;  3CCQ A;  4JI2 Q;  1XNR Q;  1K0R A;  2E2H H;  4DPG A;  5GQO A;  3U58 A;  1XNQ Q;  3H0G G;  1WJJ A;  2I5L X;  4JI6 L;  1TWA H;  3E9I A;  5IYB G;  4TQU S;  3CME A;  2JEA I;  3D0F A;  1IBL Q;  1PH6 A;  4R4I A;  3M9B A;  3K7A H;  5DLQ E;  5GRO A;  4NXN L;  4JI1 Q;  3JAM i;  4DV4 L;  1VQ5 A;  4B3T Q;  5C3E H;  2QEX A;  1OXU A;  3HKZ E;  4P75 A;  2JQO A;  3S24 A;  3UE1 A;  4OX9 Q;  4R1J A;  2RHS B;  3Q8D A;  1Y1W H;  1K8A C;  4MNO A;  4O0A A;  2Z6K A;  4DV7 Q;  1HNX L;  3S16 H;  1HZA A;  2KEN A;  5LMN Q;  5M5W H;  4DR4 Q;  4LF5 Q;  1VQ4 A;  3K80 C;  1N32 Q;  4DV1 L;  2WB1 G;  2XTI A;  2R7D A;  1OXT A;  3PO3 G;  1PVO A;  4NB3 A;  1CUK A;  1AE3 A;  1LM0 A;  1EQQ A;  1EYG A;  3S1N H;  5JJK A;  1XMO Q;  4X65 L;  1L1O B;  2UXD L;  1NTG A;  1VQA A;  1Y1V H;  3NEM A;  3W1G A;  4C3H H;  5FLX c;  3S2H H;  4XTC S;  4LFA L;  4UP9 A;  3A0J A;  1NBW A;  1UWV A;  1I5F A;  2VL6 A;  4APV A;  5FLM G;  2VW9 A;  4ALP A;  3OW2 A;  1YJ9 A;  3CCE A;  1R9T H;  4DK6 C;  1C9O A;  2GVA A;  4AQY Q;  4JI4 L;  4WJ4 A;  5IWA Q;  2LSS A;  2YV5 A;  2EXD A;  3AFP A;  4LFB L;  1E24 A;  4A3I G;  2JA7 G;  2I5H A;  1VQN A;  1I94 L;  1OTC A;  4DV3 Q;  4JI3 Q;  1TXY A;  4HJ9 A;  1LTL A;  3HOV G;  4GOP A;  3CF5 A;  3PUX A;  1I50 H;  1YIT A;  2N49 A;  3F2C A;  1NJI C;  2R7Z G;  4A3B G;  2UXB L;  1XTD A;  1IXR A;  1U0L A;  3GD7 A;  3PIO A;  3HOZ H;  4BBS G;  4LF7 Q;  3A74 A;  3MXN B;  2QA4 A;  1X9N A;  2K50 A;  3TRE A;  3CC7 A;  1IBK Q;  4LF8 Q;  2VUM H;  4JV5 Q;  4QQB X;  2PNH A;  4LF9 L;  1XNQ L;  3F1Z A;  1MKH A;  2LXK A;  3ULP A;  2UUB Q;  1BKB A;  4IPH A;  2ZJR A;  4IFD G;  5C0X G;  2JA5 G;  3GO5 A;  5FJ8 G;  4B3T L;  4OWW B;  2F4V Q;  1X65 A;  1A0I A;  4KHZ A;  5ELO A;  3RN5 A;  2BA0 A;  4B3R L;  4IFD I;  4A3D G;  1W3S A;  3D31 A;  5C0X I;  3RLF A;  1G6P A;  2AHO B;  1SLJ A;  2WFW A;  4DAM A;  5J3B A;  1N8R C;  3T1H L;  4P74 A;  4A3M G;  4LNQ A;  1FL0 A;  3UDX A;  3KF6 B;  3HOY G;  2YU9 H;  2JEB I;  4K0K L;  3CW2 C;  2HIX A;  5IP9 H;  5IYD G;  2YTY A;  4P73 A;  4DV4 Q;  4HIM A;  4NXN Q;  4DR4 L;  1E7Z A;  3H3V I;  1GKH A;  2CWP A;  3CCS A;  1E1O A;  3FHW A;  4DAY B;  1GO3 E;  4A3J G;  4R4Q A;  1HZC A;  3K8A A;  1VQF A;  2JA9 A;  2A8V A;  3HOX G;  1HZ9 A;  2N8N A;  2PQA B;  4IJL A;  1PV4 A;  1IBM L;  1N34 Q;  4A3G G;  1PA6 A;  4BBR G;  2E5L L;  1XPR A;  1KC8 C;  4BA2 I;  4C3I H;  2WAQ E;  1Q8K A;  4LUO A;  1VQC A;  3K0X A;  3M4Q A;  4GNX C;  3UDG A;  1HNX Q;  2ALY B;  2F52 A;  3SGI A;  4DV1 Q;  3RZO H;  2OWO A;  3FKI H;  1Q1B A;  1JT8 A;  4JI3 L;  5K36 G;  1EIY B;  4NXM L;  1YJW A;  2L15 A;  1O7I A;  2VY3 A;  4IO9 A;  1SFO H;  2IHE A;  2JA8 G;  2HT1 A;  3EN2 A;  2ZJP A;  1RIP A;  1AE2 A;  4X62 L;  3TS0 A;  1N36 L;  1GD7 A;  3RR5 A;  3STB D;  3JAM c;  4HJ8 A;  4JI4 Q;  4OO1 G;  2D0P A;  1PH8 A;  4X64 L;  1JB7 A;  1NY4 A;  4LF7 L;  1VCI A;  4LFB Q;  2MO1 A;  4HID A;  4JV5 L;  3HFZ B;  2UXC Q;  1I94 Q;  4DR6 L;  1P8L A;  1BBU A;  2WP8 J;  3PO2 H;  4OO1 I;  3TQY A;  2N3S A;  4DV6 L;  1HR0 W;  4JYA L;  4X6A H;  3RNU A;  2UUB L;  4BXX H;  1TWF H;  3GTO H;  3PCO B;  4ME3 A;  2LXJ A;  2F4V L;  2VQE L;  1K73 C;  4A3C G;  4QIW E;  4BY1 G;  2ZTE A;  1YVC A;  1D7Q A;  1GVP A;  3UE0 A;  2VZA A;  4DR1 L;  3BJU A;  2B63 G;  4L5Q A;  4DR5 L;  4LF9 Q;  3CAM A;  2K5N A;  2ID0 A;  2UUA Q;  1YEZ A;  3I7F A;  4R4C A;  1XMQ L;  3G48 A;  3F8T A;  4A3E G;  1EIF A;  1UE7 A;  4B3R Q;  2AKW B;  3GTG H;  3U50 C;  3I4M G;  1PHJ A;  1NMF A;  2I5M X;  3NEL A;  2KBN A;  1QUQ B;  3EBE A;  2JA6 H;  1N34 L;  3CQZ H;  3T1H Q;  3HOU G;  2JE6 I;  4DUY L;  2UU9 Q;  4QGU A;  2K75 A;  2FXQ A;  3H0G H;  1PH9 A;  4X66 L;  3ER0 A;  5IYB H;  4B3M L;  2IT1 A;  4JI0 L;  1Q12 A;  2D62 A;  2NZH A;  4AH6 A;  4NPS A;  4HJ5 A;  4A75 A;  4IPC A;  4MZ9 A;  1HZB A;  3AEV A;  2E8G A;  1IYJ B;  1E22 A;  2AWO A;  3E9H A;  3GDE A;  4IPG A;  5ELN A;  5C4J H;  2MNA A;  4GNX A;  3GTQ H;  4GKK Q;  1IBM Q;  1Q1E A;  2HIV A;  4A3K G;  2Q2H A;  3PUV A;  1Q82 C;  2CFM A;  1QZG A;  2E5L Q;  1PH5 A;  3CPF A;  5IYC G;  1WYD A;  3KOJ A;  5GAH C;  2E2J H;  2Y0S G;  2A1A A;  3ULJ A;  5GAG C;  3M3Y H;  3RLN A;  4C3J H;  2R92 G;  1VQB A;  2F3I A;  3S1Q H;  1OXV A;  3JC6 6;  3GTL H;  2ES2 A;  4J15 A; 
#chains in the Genus database with same CATH topology
 1PZI D;  1SN8 A;  1Q3L A;  1AEX A;  4A93 G;  4A3M B;  1WTQ A;  1D1I A;  2PI2 E;  3Q6S A;  3NHH A;  5JEA G;  3OHX C;  4BA1 I;  3FKI B;  5ELF A;  5FOB B;  1N36 Q;  3U4Z A;  1Q86 C;  2ZM6 Q;  2PW7 A;  4H02 A;  5HY6 A;  1WFQ A;  2B8G A;  3VYS A;  1SFO B;  4DR6 Q;  2RF4 A;  2F0P A;  3CKI B;  3CRL C;  4A3G B;  2B2W A;  5C0X J;  5LMU L;  2UUA L;  4YWL A;  2F0K A;  2PPB C;  1PH3 A;  3U4V A;  3E5S A;  1CSP A;  1I3Q H;  1EWC A;  4KJN A;  4RMF A;  1EQR A;  3F2D A;  3ZJY C;  4FP5 D;  2R7Z H;  3GTO B;  4A3B H;  3CCU A;  1T9H A;  3S15 H;  4NMZ A;  2NZ1 D;  4I65 A;  1L1O C;  4O1N A;  3T1Y L;  2ZTD A;  3K6O A;  4EGV A;  1XMQ Q;  4MTK A;  1S3O A;  1DOK A;  2F03 A;  1NSN S;  1VMP A;  4V19 0;  3S2D H;  4GKK L;  1ZEQ X;  3M85 A;  4GOP B;  4JCV E;  4G57 A;  1TVX A;  2UUC L;  5T1I A;  5A2Q L;  2RVL A;  3BYT B;  1VQJ A;  4A3F G;  3ONA B;  4OWT B;  1YNX A;  3NQI A;  4C1N K;  1EY4 A;  3M4O B;  4JI0 Q;  5CV5 A;  1KAW A;  3S1M B;  1LTT D;  3PUW A;  2DNC A;  4MN3 A;  3NBI A;  2K5H A;  3RUZ A;  4DKA C;  5I4D A;  4JVZ A;  1OXX K;  3HOX H;  4F88 A;  2LY7 A;  3QWN A;  4OWX B;  3GP7 A;  2B2Y A;  3NSW A;  1VQH A;  2ZM6 L;  3UDI A;  2YYZ A;  1AP0 A;  2K05 A;  1E2V A;  4KKU A;  5IE8 A;  3M3Y B;  4IUR A;  5D3D A;  1XJV A;  3GTJ H;  4B3S Q;  2JA8 H;  2HHH Q;  4GLA C;  3I2Z A;  4JBM A;  2XN9 C;  1CHP D;  3RZD H;  1DZ1 A;  1VQL A;  1D1K A;  5C4H A;  3HKZ G;  1XYI A;  3FRP B;  1Q46 A;  4RKL A;  1IHZ A;  2IX1 A;  4B9W A;  2FJ2 A;  1B9N A;  1JJ2 A;  1I6H H;  1HR0 Q;  2CH4 W;  3I4O A;  4DA2 A;  4FO2 A;  4WRD A;  4HCS A;  4IFD H;  5C3E G;  3W1B A;  1MIU A;  1DGS A;  4BY1 H;  3KLS X;  3ERQ A;  1BCP C;  4PZ6 A;  2QGQ A;  3MA2 B;  1I3Q B;  1Y1W G;  1YHA A;  4LF4 Q;  3G6E A;  4Y7N H;  2R7Z B;  1CA5 A;  3QOJ A;  3S15 B;  4DV2 Q;  3N52 A;  3PGZ A;  2PZW A;  1VDZ A;  1SNM A;  1Y8N B;  3J80 c;  2XWB B;  3KYH C;  4C3H G;  2A19 A;  2YTX A;  4YCW A;  3S2D B;  2R3Z A;  1K28 A;  3HOU H;  2BA1 A;  2FMC A;  5C4Z A;  3TEH B;  4C2M H;  2B2Y C;  2PMZ E;  3QB3 A;  4DN4 M;  2LS0 1;  2R7F A;  2JA5 H;  5JEA J;  3G6J B;  4EQO A;  3CCR A;  3A8J E;  1YBY A;  4B3S L;  1TWG H;  1I4Q A;  2CKZ B;  1H9R A;  3BS1 A;  2KCC A;  2PQE A;  1YIJ A;  3HOX B;  2XRQ D;  3TRZ A;  1JOR A;  2XIW A;  2WKC A;  2EOT A;  4LF6 Q;  1HJP A;  3J81 c;  2IY5 B;  4YY3 Q;  1HH2 P;  1Q90 A;  4AYB B;  5E1F A;  1W6J A;  4QY7 A;  5EBC A;  2NWG A;  4R4T A;  2JA8 B;  5C44 H;  4CDE C;  4JI2 L;  1XNR L;  1G91 A;  5IP9 G;  2EXZ A;  2WAQ G;  4GN5 A;  5COY A;  1EEF D;  1JOO A;  3SHL A;  2R93 B;  1AW7 A;  3SR1 A;  5IIF A;  5FO9 B;  1I6H B;  3V05 A;  3DEP A;  3CPW A;  1ZXT A;  4XIG S;  2K4K A;  2L5T A;  3CP0 A;  4DGZ A;  4DV0 Q;  3T51 B;  4TSS A;  3I72 A;  2O2L D;  2F0W A;  4PNY A;  5M5Y H;  5LMN L;  3FKI G;  3I73 A;  1MD2 D;  1WTW A;  2C35 B;  4Y7N B;  4IUQ A;  1XMO L;  4KLK A;  2ZTC A;  4FF2 A;  3V2T A;  1C8C A;  3NK9 A;  4CKB A;  2A69 D;  2A6E C;  1D5M C;  1B3A A;  3J80 E;  2TMP A;  2F0F A;  2F3V A;  3GQB A;  4KD4 A;  5IWA L;  3HOU B;  1X3F A;  4LF6 L;  5JAV A;  4BXX G;  1AH9 A;  4DV3 L;  3CCL A;  2N88 A;  2E2I H;  1WVL A;  1YI2 A;  1EL0 A;  2NYZ D;  3IKJ A;  5FK9 C;  3NBH B;  4JPB W;  4GOP C;  4QJF A;  2Y0S B;  3BDL A;  1C4Q A;  1EUJ A;  1FVI A;  1FYC A;  1LAC A;  4N8F A;  1K9M C;  1STE A;  2G9D A;  2K33 A;  1PLF A;  1IL2 A;  1CM9 A;  2QEJ C;  2TSS A;  3LGJ A;  4IOA A;  1FNU A;  2UXB Q;  3J81 E;  4FVM A;  2PNR C;  4DU9 A;  4DPG A;  1I50 B;  1A15 A;  3CME A;  3NP8 A;  1PH6 A;  1SYD A;  5C6A A;  5C44 B;  4B3T Q;  1TQO A;  1FGB D;  2BDO A;  2QEX A;  3HKZ E;  2Z4H A;  4P75 A;  4ZRZ A;  2EYL A;  4RGN A;  4OX9 Q;  4L6T B;  4CJ2 C;  1QCB D;  1WD0 A;  2DY7 A;  3Q8D A;  4MNO A;  2Z6K A;  4DV7 Q;  4B9X A;  5M5W H;  4LF5 Q;  1VQ4 A;  3K80 C;  1AN8 A;  1JWM D;  1SYF A;  4RH6 A;  3QO2 A;  1Q8I A;  1CUK A;  1AE3 A;  1LTA D;  1EQQ A;  1EYG A;  1TY0 A;  1DJR D;  1NTG A;  1Y1V H;  3VR6 A;  1EIH A;  1B2T A;  1I5F A;  4APV A;  1M4V A;  1YJ9 A;  3CCE A;  1R9T H;  4DK6 C;  2GVA A;  4WJ4 A;  1EZ8 A;  4LFB L;  1E24 A;  1PRT D;  2I5H A;  1A3T A;  4HN7 A;  3KBG A;  1I94 L;  3BYY B;  4JI3 Q;  4HJ9 A;  2A6H D;  1A6X A;  2BDN A;  1TR5 A;  2R7Z G;  4A3B G;  2UXB L;  1IXR A;  3GD7 A;  4LF7 Q;  1U4L A;  3MXN B;  3CC7 A;  4LF8 Q;  2G5D A;  1SNO A;  2PNH A;  1SND A;  4LF9 L;  3ULP A;  1BKB A;  4E6I A;  2HQE A;  4IFD G;  2BE5 D;  4B3T L;  2F4V Q;  1CT1 D;  3LX0 A;  4B3R L;  5C0X I;  1G6P A;  1QNK A;  1NAP A;  4DAM A;  2WII B;  5J3B A;  4CKE A;  2PW5 A;  3T1H L;  4P74 A;  4F7X A;  3KF6 B;  1STB A;  4ZYS A;  5CYU A;  2JP1 A;  1ONL A;  1QE6 A;  4DV4 Q;  2JXM B;  5D14 A;  4J8Q A;  1E7Z A;  3H3V I;  1GKH A;  3MHB A;  3FHW A;  4DAY B;  3MAQ A;  1HUM A;  2JA9 A;  3HOX G;  1HZ9 A;  2N8N A;  4JW0 A;  1F2M A;  1JQY D;  5I9P A;  1PA6 A;  2E5L L;  1CTM A;  2OEO A;  3NBH A;  2WAQ E;  1Q8K A;  3OIP A;  3K0X A;  3M4Q A;  5CGK A;  2F0N A;  2SDF A;  2ALY B;  2F52 A;  4Z9C B;  4DV1 Q;  4K5V A;  1Q1B A;  1JT8 A;  4JI3 L;  2ZXR A;  5M5W B;  2VY3 A;  4OGQ C;  2JA8 G;  1RIP A;  3JAM c;  3OIQ A;  2D0P A;  4LF7 L;  4NW2 A;  2UXC Q;  1BUV T;  4DAP A;  1P8L A;  2WP8 J;  3PO2 H;  1YNN C;  3TQY A;  4JYA L;  1R9T B;  5DNF A;  1EYC A;  1TWF H;  3PCO B;  2LXJ A;  2F4V L;  3NWS A;  4BY1 G;  1U4M A;  1DOM A;  4V0B A;  4TRD A;  4K2K A;  3UE0 A;  2VZA A;  4DR5 L;  4KY6 A;  3C2P A;  3Q23 A;  4WJW A;  4OIK A;  2O4X A;  2VXW A;  4R4C A;  2A73 B;  3GTG H;  3VYU A;  2JA7 B;  3PMF A;  1QUQ B;  3NE5 B;  1MBY A;  4ZUJ A;  4RWS C;  4DUY L;  3HOU G;  2F0H A;  3TZU A;  2UU9 Q;  1HFN A;  1PTO D;  1GOZ A;  4HSV A;  1CZW A;  3H0G H;  4X66 L;  2EDG A;  4AH6 A;  3FPU B;  2RBM A;  2AUK A;  5G3L D;  3IFT A;  4IPC A;  3AEV A;  2MNA A;  2JA5 G;  5ELN A;  5CR3 A;  2B2U A;  1CZG A;  2HIV A;  5IGC A;  5JPM C;  3QR8 A;  1STH A;  1KLG D;  1WYD A;  1BO0 A;  2E2J H;  2Y0S G;  4MHE A;  5GAG C;  1I4P A;  2R92 G;  3MXN A;  2F3I A;  3S1Q H;  4ILW A;  3NUC A;  2ES2 A;  3GTL H;  2UXC L;  1H95 A;  5I6Y A;  1EY0 A;  1AZQ A;  3HGB A;  1VQM A;  2KCN A;  4LUZ A;  4KHP L;  1ET9 A;  3I4L A;  1Q81 C;  5FLM H;  1KRT A;  2WAC A;  2WV6 D;  4X64 Q;  3NPP A;  1J6Q A;  5C44 G;  3KF6 A;  1M90 C;  4A3I H;  3CHB D;  3B6Y A;  4IFD J;  4DF7 A;  1IW7 C;  1H9S B;  4LUV A;  3A5U A;  1PH4 A;  4CKC A;  1V1P A;  3JAM E;  1XPU A;  2VQE Q;  3HOV H;  4DAY A;  4FXK C;  1PYS B;  3PO2 B;  1CSQ A;  5ELC A;  4RGO S;  2EQS A;  4DR1 Q;  3A5Z B;  2OQ0 A;  2UU9 L;  3DM3 A;  1VQK A;  4XQJ A;  1UE6 A;  3PF5 A;  5DM6 3;  3J7A 5;  5EKK A;  1Z9F A;  3BDC A;  5FLX L;  2V1C C;  4JBK A;  5FJ8 H;  3AB9 A;  3G4S A;  1VQ8 A;  1SMY D;  2FFK B;  4FYD A;  2GVB A;  1JWU D;  3DXJ C;  4FF3 A;  4GS3 A;  3GTG B;  1ROD A;  1RF2 D;  1EFI D;  5HGQ A;  4A3M H;  2B2U C;  3DEO A;  4F87 A;  3STB C;  2EE1 A;  2RDG A;  1G29 1;  1R4Q B;  2F0U A;  2DGY A;  3NEN A;  1LT6 D;  2B63 B;  1EIG A;  4ULL A;  1LTR D;  3H0G B;  1LO5 D;  4S3S A;  5D3I B;  4K0K Q;  1DD2 A;  4J6H A;  4A3G H;  1ESF A;  4OIJ A;  1SE3 A;  1E2Z A;  3I56 A;  1WTX A;  1P16 A;  2K5Q A;  4DV6 Q;  4LW1 A;  1K83 H;  3GTK B;  3CC4 A;  2BH8 A;  2AWN A;  2E2J B;  4QCL A;  1VQ7 A;  3GTL B;  1SRO A;  1RD9 D;  1XPO A;  2I07 B;  4XDX A;  4JBJ A;  3DWP A;  3T56 B;  4EQN A;  4OO1 H;  3F2U A;  1KHI A;  1X6O A;  5LMU Q;  3HS0 C;  3X3M A;  2D9U A;  1JJG A;  2PZU A;  2OXP A;  4DV5 L;  5E3F A;  4A3I B;  1J9O A;  1L1O A;  2NVQ B;  3ZYY X;  1S40 A;  3M4O H;  1MI2 A;  2ZT9 C;  4C56 C;  2EYH A;  3S1M H;  4LMQ D;  3MXP A;  5I6W A;  2RDH A;  1HQR D;  1HFG A;  4WJ3 M;  1VQG A;  3ULL A;  3T1Y Q;  5LL6 X;  4OEM B;  5BN4 A;  2F0T A;  1ML0 D;  3PIP 3;  3I4N H;  3N6R A;  5IOC A;  5IGE A;  1HUN A;  1ENC A;  1XWE A;  1XX8 A;  2ATW A;  3BVG A;  2R6G A;  2OQK A;  4G4K A;  2CCZ A;  2UUC Q;  1A8V A;  1PH7 A;  4K0K L;  1Y1V G;  2HCI A;  5IT9 c;  1ASZ A;  1D5Z C;  2RCN A;  1I4H A;  2M00 A;  4BY7 G;  4IJH A;  5EKI A;  3ND8 A;  1KIX A;  2A74 C;  2D0O A;  2Q2I A;  5E7N A;  2CW0 C;  3VA7 A;  3BZC A;  1S5C D;  1NR4 A;  2CHB D;  4CGY B;  2F0V A;  2VQF L;  2HDL A;  1J5E L;  2WIN B;  5ELB A;  3F2B A;  1VQP A;  1TWC H;  1VQ9 A;  4DR2 L;  4YHH L;  4X3K A;  2MHV A;  1JIC A;  1GUO A;  1VQD A;  2OCE A;  1B44 D;  2I46 A;  4HJA A;  1YJN A;  1F2L A;  4JI5 L;  1ET6 A;  1N9W A;  3PIP A;  2XWJ B;  1K83 B;  3VDY A;  4GNX B;  2Y0S E;  1WCM H;  1SJH D;  5C4X H;  5LL6 S;  1HA5 A;  1L0W A;  3WDN A;  3KF8 B;  4GN4 B;  4R8N A;  4ZUI A;  3J81 j;  5M3F H;  2B3G A;  1IBL L;  2B2T A;  1J8I A;  1JWS D;  1CKO A;  1F9R A;  3PUY A;  2MFI A;  3BZK A;  3R93 A;  4L5R C;  2GA4 B;  4PQX A;  1AFP A;  2EY5 A;  2XNA C;  1QVG A;  3S9W A;  2C9O A;  2Z0S A;  3RLO A;  1RTO A;  4I7A A;  1N32 L;  4WOR A;  1NCV A;  1ENA A;  2KHI A;  2DNE A;  3I4N B;  1TS2 A;  1F9S A;  1KDC A;  4MTN A;  4ZAI A;  1B50 A;  4A3L H;  3P1H A;  1QNU A;  2XSC A;  4UHV A;  1V1Q A;  4EX5 A;  1C0A A;  4U68 A;  5IT9 E;  3PO2 G;  1NE3 A;  3C3L A;  1B9M A;  1F9Q A;  3CCV A;  1LT5 D;  2RCF A;  3HOW H;  1ZYR D;  5M3M G;  1K3B C;  2ASB A;  1CK1 A;  4LFA Q;  1BVS A;  5FO7 B;  1MJC A;  4P2C B;  1F9P A;  1QOH A;  1RDP D;  3I8Z A;  3WOE A;  2R93 H;  4UY8 C;  2E74 C;  1TWC B;  1VS0 A;  4PG3 A;  1CQV A;  2VB3 X;  3NTK A;  3TBI B;  4DNI A;  2KHJ A;  3KUP A;  4ZQ3 A;  3CD6 A;  1LUZ A;  1GUN A;  3AQQ A;  2F0O A;  2B2T C;  4JI2 Q;  4CHT B;  1XNR Q;  1K0R A;  2F0I A;  3K5L A;  2EY1 A;  3H0G G;  2I5L X;  1WCM B;  1TWA H;  1EZ6 A;  5C4X B;  4G7O C;  2MPM A;  2JEA I;  1E0B A;  4R4I A;  3HOZ B;  5DAU A;  1VQ5 A;  5GRO A;  4NXN L;  2VUM B;  4KKT A;  3H94 A;  4X3S A;  1PRT F;  1LTI D;  1S4Z A;  5M3F B;  1I4R A;  2HDM A;  1PDQ A;  2RHS B;  3DUZ A;  1K8A C;  3MEH A;  1HZA A;  2KEN A;  4BS9 A;  5LMN Q;  1ESR A;  1FD7 D;  2R7D A;  1PVO A;  4NB3 A;  2O5J C;  4EQP A;  5JJK A;  1XMO Q;  1VQA A;  3W1G A;  2OT2 A;  4FF1 A;  2A6H C;  3AU7 A;  4XTC S;  4UP9 A;  3EVQ A;  4U67 3;  4OL7 A;  2VL6 A;  4LFA L;  5IGB A;  5FLM G;  3GTP H;  4JI4 L;  1G2T A;  5IWA Q;  2LSS A;  4A3I G;  3KF8 A;  1OTC A;  4DV3 Q;  1II3 A;  1TXY A;  5E4X A;  3HOV G;  4GOP A;  3CF5 A;  1I50 H;  2QW7 A;  3VR4 A;  5CBA E;  3HOW B;  4N9P A;  1U0L A;  3PIO A;  1JR0 D;  3DWA A;  5I9O A;  1X9N A;  3TRE A;  1MKH A;  2MGS A;  2LXK A;  2UUB Q;  5JOB A;  3J80 L;  2ZJR A;  2ZXO A;  1CHQ D;  1AZP A;  3GO5 A;  5FJ8 G;  3BZD B;  4OWW B;  3R3O A;  1A0I A;  4KHZ A;  5ELO A;  3LWE A;  4IFD I;  4ABN A;  1DOL A;  2H4O A;  5E4W C;  2F4I A;  4KTA A;  1N8R C;  4A3M G;  4R8I A;  5KIX A;  3CW2 C;  3A8K E;  4HIM A;  3MXU A;  1DON A;  1EYA A;  2KEE A;  1KDB A;  1TWA B;  3A56 A;  1GO3 E;  1VQF A;  2PQA B;  1PV4 A;  1IBM L;  1N34 Q;  4A3G G;  1PXU A;  4CDC C;  2EJM A;  3HZX A;  4C3I H;  2Z8L A;  4LUO A;  4GNX C;  1VQC A;  3J81 L;  3BG3 A;  1FR3 A;  2VB2 X;  2NN6 H;  3D3R A;  2F0E A;  1EIY B;  5CBE E;  4NXM L;  2IHE A;  2HT1 A;  4DNT B;  3IAY A;  1AE2 A;  4X62 L;  4OO1 G;  4KMU C;  1JB7 A;  4LFB Q;  1NY4 A;  1PFB A;  2ICI A;  4JK1 C;  1I94 Q;  3GTP B;  2N3S A;  5CC4 A;  1HR0 W;  4X6A H;  2UUB L;  2Q8I B;  1PTO F;  5JJZ A;  5G3L F;  3PO3 B;  1M8A A;  1KAB A;  1D7Q A;  1K0S A;  1GVP A;  3OPO A;  4LF9 Q;  3QJY A;  4OEL B;  3A55 A;  1BR9 A;  1PTO C;  5HUR A;  2BOS A;  1EIF A;  1WTO A;  3IFD A;  4B3R Q;  1DM0 B;  2K5D A;  2CVR A;  2JA6 H;  1N34 L;  3K5N A;  3NXW A;  3T1H Q;  5C3W A;  2Q8R E;  1PH9 A;  1O7L A;  4B3M L;  3D4W A;  3VYR A;  1KNA A;  2D62 A;  2NZH A;  4HJ5 A;  2E8G A;  1IYJ B;  1E22 A;  3ICE A;  5C4J H;  2Z6B A;  1BCP D;  4HCE A;  1EEI D;  2KVM A;  2E5L Q;  2CFM A;  3KOJ A;  3BVZ A;  5BN3 A;  1VQB A;  1F2Y A;  3OWF A;  1S5D D;  4J15 A;  3MVV A;  1GUS A;  4C3I B;  1O7Z A;  3HOY B;  4HIK A;  2Q2U A;  1D5X C;  4PMB A;  4JBW A;  1QVC A;  4RGM A;  5ELE A;  3P20 A;  2F1M A;  1WCM G;  1LT4 D;  5C4X G;  3EFX D;  2RHQ B;  4BWG B;  2JA7 H;  3DLL A;  4JYA Q;  4YWK A;  1X55 A;  4JOI C;  4DAV A;  4QIW B;  3KLW A;  4R4O A;  4DNR B;  3RD4 A;  3CU7 A;  1HNW Q;  2IX3 A;  1ILQ A;  2SNS A;  5AFW A;  4FXD A;  2JSO A;  4DR5 Q;  4BBS H;  1GUW A;  1V9P A;  4HED A;  4X3T A;  2KED A;  3LNN A;  5BR8 L;  2H5X A;  1A62 A;  2KEC A;  4JI7 L;  2WKD A;  1SE8 A;  1PZK D;  3PUZ A;  2EJG C;  2N55 A;  4IUP A;  3R8B A;  4HIO A;  2FIN B;  1FGU A;  3J81 i;  4DUY Q;  4DUZ Q;  1YNJ C;  3D4D A;  1W2B A;  4X66 Q;  4A3L G;  4RGT A;  4AYB G;  1LTG D;  2JA6 B;  5IYD H;  2KHS A;  3OYY A;  1B7Y B;  4UDU C;  1GJX A;  1SXT A;  2IX0 A;  1DYQ A;  3DM1 A;  3EJI A;  3HOW G;  1GUG A;  4GKJ L;  2IJ0 A;  3K7U C;  3I90 A;  4A3E B;  5C4J B;  1HTP A;  4OHJ A;  2R93 G;  1BQQ T;  1X56 A;  4IQZ A;  5KGU A;  1HHV A;  1N33 L;  4RG1 A;  4KI0 A;  1C7Y A;  3OTO L;  1HNZ L;  1IKM A;  4JI8 Q;  3Q22 A;  1TY2 A;  1YZ6 A;  4HMI A;  3PSI A;  3SXH A;  4KHP Q;  1XTC D;  3CC2 A;  1HNW L;  5JJL A;  2K32 A;  5I2Y A;  2A6E D;  2WB1 B;  1K8O A;  5J39 A;  2KJX A;  3MXG A;  3E6Z X;  1OXS C;  1VQ6 A;  2G9H D;  1JB3 A;  5CV8 A;  1FJG Q;  2F0S A;  3TME A;  3DMU A;  1KQS A;  1G8Z D;  5DEH A;  3RMH A;  1E1T A;  2L9H A;  4A3C H;  4A93 B;  4K6D A;  4DUZ L;  2B63 H;  1SYC A;  4KN4 C;  1JMC A;  2L12 A;  4CBV A;  2Z4I A;  3MWY W;  4RCO A;  4JG2 A;  4FDB A;  1RL2 A;  5NUC A;  4BBS B;  1B8A A;  5M5X H;  3WWV A;  1PMR A;  3KJO A;  3PF4 A;  3KJP A;  4DR7 L;  3HRZ C;  3GTK H;  3L7Z C;  1M1K C;  3JAM L;  1W6K A;  1K3R A;  3HKS A;  2CWA A;  2X69 A;  4ODG A;  1S5B D;  2NZO A;  2OTL A;  4YCU A;  2P5Z X;  4DR3 L;  2KCM A;  3IRB A;  3D4R A;  4AIM A;  2M9V A;  4JI8 L;  1KXL A;  4ID6 A;  1XXG A;  1TII D;  3DHQ A;  2IHF A;  1EY8 A;  2NUC A;  1IYV A;  1SYG A;  4M8A A;  1VF5 C;  3S17 B;  5IYC H;  3CXC A;  1SNC A;  3GTM H;  2AQ3 B;  1LT3 D;  1RTN A;  2NVQ H;  1FJG L;  1X54 A;  5KNB A;  2EZV A;  3C46 A;  1ENF A;  3ITP A;  5GAE C;  3D8G A;  3D6C A;  2K04 A;  1Z47 A;  1LYL A;  2R61 A;  3QOL A;  5CV9 A;  4LFC L;  5C5M A;  3S1R B;  3L3O C;  1GXD C;  4Q5V A;  5EQ0 A;  2K6A A;  4P72 A;  1LV9 A;  2XGT A;  2D2C C;  3CRK C;  1HTL D;  1UE5 A;  1WTP A;  3TP5 A;  2RA4 A;  2YTV A;  2K7V A;  1WOC A;  1KL9 A;  3A8I E;  2KCT A;  1JC7 A;  4DV5 Q;  1WI5 A;  3TS2 A;  4JI1 L;  3KLS A;  2K14 A;  2MO0 A;  2EYM A;  2NVX H;  4LJZ C;  1U4P A;  4HTH A;  4C3I G;  1CA6 A;  1SYE A;  1ILP A;  3J7A V;  2NN6 G;  1QZH A;  5IP7 H;  3P7J A;  4GN3 B;  5GAD C;  1BBX C;  2L0C A;  3M4P A;  4H7B A;  3FP9 A;  4KN7 C;  5T1G A;  2MQH A;  4RHR A;  1TS4 A;  5M5X B;  2K28 A;  1ZYR C;  1EY9 A;  1PZJ D;  3OOC A;  2JK8 A;  4GLX A;  2EYJ A;  1RCV D;  3ERS X;  4NP5 A;  4AQY L;  3BVM A;  1NMG A;  2V4D A;  4H13 C;  1Y1W B;  2VQF Q;  1Z7T A;  2B2V C;  1J5E Q;  3W5O A;  3G71 A;  4FXG C;  2UXD Q;  3S16 B;  1MSH A;  4YHH Q;  1JJC B;  4XYQ A;  4DR2 Q;  4NKL A;  1QUQ A;  2IPK D;  3SK8 A;  5H1S E;  4AYB E;  3H91 A;  4I7Z C;  1A63 A;  5DM7 3;  3FMC A;  4XQQ A;  1Y14 B;  1PRT B;  2LFN A;  1MJE A;  2VNU D;  1IBK L;  4JI5 Q;  5CMD A;  1CKM A;  1IKL A;  3L0O A;  1BNZ A;  1OO9 B;  2BH2 A;  3GTM B;  3PQI A;  1MSG A;  2H1E A;  2QIL A;  1EYD A;  2JJQ A;  5IGF A;  2GN5 A;  2IWH A;  2DJF C;  3M4Y A;  1E2W A;  3MFY A;  2DY8 A;  3K81 C;  2IW3 A;  4UPA A;  1U5K A;  4KKS A;  4FNF A;  2JA6 G;  5BN5 A;  1VMC A;  2QF7 A;  1V43 A;  3AFQ A;  1KRS A;  2E75 C;  2ENB A;  3CCQ A;  2E2H H;  3UI2 A;  3U58 A;  1EY7 A;  4TQU S;  2RKS A;  3D0F A;  1IBL Q;  3JAM i;  1JCK B;  1PTO H;  4H44 C;  2QDL A;  2EYF A;  2NTT A;  1X32 A;  4IN3 A;  3A7A B;  4R1J A;  1SJE D;  4O0A A;  2D5D A;  5EJW A;  1WTH A;  3NTH A;  1HNX L;  2NVX B;  1I4G A;  1H9S A;  4DR4 Q;  1N32 Q;  2WB1 G;  2XTI A;  1OXT A;  2A68 D;  3KLR A;  1SE2 A;  3I3C A;  3S1N H;  1JOK A;  2SEB D;  5CV6 A;  4KK7 A;  2UXD L;  3S2H H;  3NEM A;  3A0J A;  1NBW A;  5IGD A;  3K5M A;  5FKA C;  3AFP A;  1TS3 A;  2JA7 G;  4ME5 A;  2RSN A;  3ND9 A;  2Z9H A;  4N9T A;  2N49 A;  4G7H C;  1NJI C;  4CJ0 B;  5IOD A;  3HOZ H;  3VR3 A;  4BBS G;  5IGG A;  2VUM H;  2K50 A;  1PFM A;  1UNS A;  4ZK9 B;  4QQB X;  1S5E D;  4DFA A;  4J1M A;  2L11 A;  1Y8O B;  2NBF A;  1C48 A;  5IT9 L;  1I6V C;  1U4R A;  1W3S A;  3D31 A;  1TS5 A;  2WFW A;  1NNX A;  1IW7 D;  4LNQ A;  3QIA A;  3UDX A;  2F0D A;  2K03 A;  2KUM A;  2YU9 H;  2A69 C;  1EQT A;  5IYD G;  5CV7 A;  2YTY A;  3D6W A;  4NXN Q;  4DR4 L;  2E2H B;  5M9O A;  3R2T A;  4GZY C;  1E1O A;  1H9J A;  3FEW X;  4R4Q A;  1HZC A;  5KRU A;  4XYO A;  2A8V A;  3MZ5 A;  1STG A;  5EPJ A;  4CDD C;  2EVB A;  1PTO B;  1CI3 M;  1XPR A;  4BA2 I;  2J4X A;  3UDG A;  5KYI A;  3RZO H;  2OWO A;  4IO9 A;  4G7Z C;  1D6E C;  1L0Y B;  1EWH A;  2CQA A;  3TS0 A;  1N36 L;  3S1N B;  1GD7 A;  3STB D;  4JI4 Q;  3S2H B;  1VCI A;  4F8M A;  4HID A;  3HFZ B;  4KD3 A;  4DR6 L;  1BBU A;  4OO1 I;  2HCC A;  3RNU A;  3TDQ A;  4QB4 A;  4IUN A;  4K14 A;  1BXT A;  4ME3 A;  5A2Q E;  4B08 A;  1KLU D;  1K73 C;  4A3C G;  4QIW E;  5D65 A;  1WTR A;  2B2W C;  2L1B A;  4QF4 A;  1BCP F;  5L37 A;  3HEJ A;  3BJU A;  2B63 G;  4L5Q A;  3CAM A;  4ZKB B;  2K5N A;  3MC0 B;  2ID0 A;  2FMM A;  4L63 B;  3I7F A;  1XMQ L;  3F8T A;  2HUG A;  1UE7 A;  2AKW B;  2QCP X;  3PIO 3;  5A35 A;  3NEL A;  1NR2 A;  3CQZ H;  5LHY 1;  3U9O A;  2JE6 I;  1WTV A;  5EGT A;  4N8X 1;  2K75 A;  2FXQ A;  1QIL A;  4DK1 A;  5IYB H;  3V96 A;  1EQV A;  2IT1 A;  4JI0 L;  4EVO A;  4A3B B;  1Q12 A;  4A75 A;  4RFB A;  4NPS A;  4RAU C;  2F0M A;  1HZB A;  1PRT C;  3E9H A;  2YU9 B;  4GNX A;  3GTQ H;  1QB5 D;  1IBM Q;  1K8M A;  5IYC G;  1LAB A;  2F3W A;  3ULJ A;  1STY A;  1V1O A;  3RLN A;  4C3J H;  2OTJ A;  3O13 A;  1OXV A;  3JC6 6;  2O5I C;  4UP7 A;  4XT1 B;  3DWQ A;  3SEB A;  3PO3 H;  1BF4 A;  4NXM Q;  1F2Z A;  1KAA A;  1EOT A;  3RZO B;  1TWH H;  1O80 A;  4X62 Q;  2BE5 C;  2HHH L;  3W2D A;  1PYW D;  3G7L A;  3MFG A;  3QG1 A;  1LTB D;  1SDF A;  2F0Q A;  5KND A;  4H0L C;  3C1F A;  2CW0 D;  2WB1 E;  4PZ8 A;  2R92 H;  4HMJ A;  3FDT A;  1MGS A;  5JJI A;  1CKN B;  4OON A;  1JE4 A;  1SRU A;  1HR0 L;  4R9W A;  1IZ6 A;  4LAA A;  4YIJ A;  3OWE B;  4GLV B;  3KK7 A;  1PH2 A;  1T5X D;  3H09 A;  3GTJ B;  3E0E A;  4L5T A;  2C5C A;  2ICE C;  4K6L A;  4LF4 L;  3RZD B;  5IP7 G;  2E76 C;  4A4I A;  4MIU A;  5C0X H;  3CCJ A;  4DV2 L;  2B8F A;  1X3Q A;  1KNE A;  4A3D H;  3BDO A;  3M7G A;  2FHT A;  4POG A;  3KDF B;  2NTS A;  3HOY H;  3A7L A;  4HSP A;  4HAE A;  4B3M Q;  3H3V H;  5IY0 A;  1BBW A;  4BY1 B;  3HG9 A;  2EYP A;  2Q2T A;  3CQZ B;  3A54 A;  4RCN A;  5ELD A;  3U9S A;  1RHP A;  4A3J H;  4L5S A;  5HGT A;  4QUC A;  2AQ1 B;  4BBR H;  4PMC A;  3GTQ B;  2NVY H;  4Q0F A;  4ZCK A;  4LWC A;  1UUP A;  4K5X A;  3SK5 A;  4QMG A;  4HJ7 A;  5EBD A;  2K5W A;  1TT2 A;  1SBB B;  3M7N A;  4C3J B;  1X3E A;  2EY2 A;  5K36 H;  4YY3 L;  4EQ5 A;  4C2M B;  4QL5 A;  1GUT A;  3GV3 A;  1QVF A;  4IUV A;  4DK3 C;  2F0G A;  4JOI A;  2JA5 B;  1K8G A;  2DN8 A;  3KFU A;  1SR3 A;  1TWH B;  1E3P A;  1TWG B;  5KYL A;  1HPC A;  1KD1 C;  1B70 B;  3K58 A;  3I4N G;  4KHV A;  3ERO A;  3GV6 A;  4K2L A;  3TP8 A;  3S14 H;  2R92 B;  3AYH B;  2PO4 A;  4DXF A;  1LLR D;  1PH1 A;  4XQN A;  1NUC A;  1B1Z A;  4M1U B;  1YHB A;  1Y69 U;  1EU4 A;  3IL8 A;  2K5V A;  1PFS A;  1YHQ A;  2VS1 A;  4DV0 L;  3TP7 A;  5BR8 Q;  5LMN W;  3PV0 A;  5JPN C;  2KQ3 A;  4JI7 Q;  4WFN 3;  4Y52 H;  4NDX A;  4A3E H;  2F0J A;  1RKN A;  1TU2 B;  2ZJQ A;  3I4M H;  3MEF A;  1H9M A;  1VQO A;  4YWM A;  3VA5 A;  1ZKO A;  5KEE A;  5EAY A;  5AJ3 Q;  2CQO A;  2DUD A;  4IAL A;  3BU2 A;  4A3D B;  4TVA B;  2SNM A;  2K52 A;  2LKV A;  5C5L A;  4K5W A;  1PYB A;  1CKN A;  1JOQ A;  4P71 A;  1A2T A;  1ICW A;  2N78 A;  4GKJ Q;  3CMA A;  4YCV A;  1CFM A;  4A3K H;  3TZD A;  1G2S A;  1SNP A;  5M5Y B;  4KV6 A;  4UP8 A;  4IUT A;  3E0J A;  2EIF A;  2HQL A;  4BY7 H;  4A3J B;  3HOZ G;  3J80 i;  2Q8T A;  1N33 Q;  2VUM G;  1HNZ Q;  3EIV A;  3OTO Q;  4IUU A;  1GM5 A;  4BBR B;  3X3N A;  2F0L A;  1VF7 A;  2NVY B;  5M3F G;  4A93 H;  2B29 A;  4HR7 B;  3T4A C;  1GHK A;  1UEB A;  4PMW A;  4JC0 A;  2JYO A;  5JEA H;  2QDB A;  1QJO A;  2PQA A;  2KOL A;  5J22 A;  1U9R A;  1SMY C;  1Y8P B;  3FVQ A;  1UEA B;  3KDF A;  3WOF A;  2I0Q A;  3TSS A;  1S72 A;  4A76 A;  4OXP A;  2E2I B;  2HD3 A;  4IPD A;  4LK1 C;  1BDO A;  2XVS A;  1V8Q A;  5J1Z A;  1RJT A;  3NWT A;  1X3P A;  1EFW A;  4L8J A;  4TKO B;  3K59 A;  1L2F A;  3I91 A;  3RN2 A;  2EPB A;  2B39 A;  2KA7 A;  1EWI A;  2MUY A;  3S14 B;  1A2U A;  4PV1 C;  1O7Y A;  4OX9 L;  1ASY A;  5AJ3 L;  1PFN A;  4JI6 Q;  1X3G A;  1G51 A;  2PI2 A;  1SEB D;  3UDF A;  4DV7 L;  2NVT H;  1F77 A;  3S17 H;  2PCF B;  4LF5 L;  2EY6 A;  1V1P B;  1VQI A;  2NN6 I;  4DR7 Q;  1B4O A;  2Z6K C;  1SMX A;  4O42 A;  3L2P A;  2DJG C;  2RSO A;  2E2D C;  4KJO A;  4A3F H;  1D8L A;  2PMZ B;  3CCM A;  4RHS A;  3I4M B;  4RA8 A;  5JVH 3;  1A3V A;  1VQE A;  2J7Z A;  3J7Z C;  4DR3 Q;  2OF1 A;  3I55 A;  3S1R H;  3SDZ A;  4DK0 A;  1EOV A;  4IOC A;  4PZ7 A;  1SAP A;  3R2I A;  2X6L A;  3J7A F;  3EQL C;  4CDF C;  4X65 Q;  3P75 A;  4ZLT F;  5FO8 B;  4KY5 A;  1I4X A;  1H9K A;  2MJ8 A;  1SSO A;  4O2D A;  1BOS A;  4CJ1 B;  1JE5 A;  4POF A;  1UAP A;  4A3K B;  3H15 A;  1Y1V B;  2AMC B;  4LF8 L;  4BY7 B;  3AMU A;  1UE1 A;  4LFC Q;  4C1N I;  4DXG A;  1FNW A;  5M3M H;  3SVM A;  3OMC A;  1Q7Y C;  3TN2 A;  5GQO A;  1XNQ Q;  1WJJ A;  4JI6 L;  3E9I A;  5IYB G;  2PZT A;  3M9B A;  1SE4 A;  3K7A H;  5DLQ E;  4JI1 Q;  3NTI A;  4DV4 L;  5C3E H;  1IL8 A;  1OXU A;  2PYK A;  2A68 C;  2JQO A;  3W3A A;  3S24 A;  3UE1 A;  5EKL A;  1SYB A;  1TKW B;  2CH4 A;  2IL8 A;  1Y1W H;  2X6G A;  4C3J G;  2RDF A;  5EPL A;  2NB0 A;  3S16 H;  1QG7 A;  2SOB A;  4DV1 L;  3PO3 G;  2RQX A;  1LM0 A;  1R4P B;  2NVT B;  4X65 L;  1L1O B;  3URY A;  4C3H H;  5FLX c;  1DXM A;  3VR5 A;  1UWV A;  5TSS A;  2VW9 A;  4ALP A;  3OW2 A;  2K1B A;  2B2V A;  1C9O A;  2EYO A;  4K8J A;  3J7Y W;  4AQY Q;  1HA6 A;  2EXD A;  2YV5 A;  4A3F B;  1VQN A;  1GHJ A;  1T5E A;  5K5P A;  3FPP A;  1LTL A;  5ISR A;  3PUX A;  1YIT A;  3F2C A;  1DCZ A;  5F2D A;  1XTD A;  5EPK A;  3A74 A;  2QA4 A;  1IBK Q;  4JV5 Q;  1STA A;  2A5H A;  2AQ2 B;  1XNQ L;  3F1Z A;  4IPH A;  5C0X G;  1MHW C;  1X65 A;  3RN5 A;  2BA0 A;  3LWU A;  4A3D G;  2XRS D;  3RLF A;  2AHO B;  1SLJ A;  1TWF B;  2ZXP A;  3H3V C;  5M3M B;  1G6Z A;  3HOY G;  1FL0 A;  2JEB I;  1HRJ A;  2J0T D;  2HIX A;  3C1E A;  5IP9 H;  3HKZ B;  4P73 A;  1B3Q A;  3Q24 A;  3VR2 A;  2CWP A;  3CCS A;  2L55 A;  4A3J G;  3K8A A;  4IJL A;  3K7A B;  4BBR G;  5C3E B;  1S5F D;  3NQT A;  2M2L A;  1KC8 C;  2EJF C;  2QKI C;  1HNX Q;  3SGI A;  4XXE A;  3FKI H;  1BCP B;  1EY6 A;  1HCZ A;  5K36 G;  5I2X A;  1YJW A;  1YNJ D;  2L15 A;  1O7I A;  1SFO H;  3EN2 A;  5COR A;  2ZJP A;  1HQM C;  4HJ8 A;  3RR5 A;  3K57 A;  1PH8 A;  4C3H B;  4X64 L;  4JV5 L;  2MO1 A;  3MTS A;  3I70 A;  3H6M A;  3T53 B;  1B53 A;  5FLX E;  3T13 A;  2JN4 A;  4BXX H;  2BCO A;  3GTO H;  3S1Q B;  3OSO A;  1IYU A;  1O78 A;  2VQE L;  5KNC A;  2LMC B;  4UAI A;  1L0X B;  2ZTE A;  3T16 A;  1YVC A;  1D2B A;  3VYT A;  1STN A;  1YNN D;  3SE0 A;  4ZKC B;  4DR1 L;  5CV4 A;  1ICF B;  2Z1C A;  3K5O A;  1EU3 A;  2MP1 A;  3KBX A;  5C3X A;  2UUA Q;  1YEZ A;  3G48 A;  3OMG A;  4A3E G;  1SNQ A;  3K0Y A;  3U50 C;  3I4M G;  4X3U A;  1PHJ A;  1NMF A;  2I5M X;  2KBN A;  3EBE A;  1WD1 A;  3HOV B;  4RKB A;  3E3X A;  1A3U A;  4QUF A;  4QGU A;  3SK4 A;  3ER0 A;  3Q0A A;  1Z6H A;  1FNV A;  4MZ9 A;  3EA6 A;  1KTK A;  4K8I A;  3GDE A;  4XT3 B;  2AWO A;  3HP3 A;  4GKK Q;  1EY5 A;  4IPG A;  3SK6 A;  1HXY D;  2AUJ D;  3OW7 A;  3L9A X;  4FF4 A;  1Q1E A;  2WAQ B;  2K01 A;  2Q2H A;  3PUV A;  4A3K G;  1Q82 C;  3TP6 A;  1QZG A;  1PH5 A;  3CPF A;  5GAH C;  1LTS D;  2L4N A;  4IZ8 A;  2A1A A;  5JVG 3;  3M3Y H;  4KY7 A;  1CQF A;  1QWY A;  1KDA A;  4DV6 L; 
#chains in the Genus database with same CATH homology
 1H95 A;  4UP7 A;  1SN8 A;  3PO3 H;  4A93 G;  4HIK A;  2Q2U A;  4NXM Q;  2PI2 E;  4JBW A;  1VQM A;  1QVC A;  5JEA G;  4LUZ A;  1TWH H;  4KHP L;  4BA1 I;  4X62 Q;  1N36 Q;  2HHH L;  3U4Z A;  1WCM G;  1Q81 C;  5C4X G;  5FLM H;  1Q86 C;  2ZM6 Q;  1KRT A;  4H02 A;  5HY6 A;  1WFQ A;  4X64 Q;  2R92 H;  2WB1 E;  1J6Q A;  4PZ8 A;  5C44 G;  4DR6 Q;  3KF6 A;  2RHQ B;  2RF4 A;  1M90 C;  2JA7 H;  3DLL A;  4A3I H;  3B6Y A;  4YWK A;  4JYA Q;  4IFD J;  1X55 A;  1CKN B;  4OON A;  5C0X J;  5LMU L;  5JJI A;  4LUV A;  4JOI C;  3A5U A;  1PH4 A;  2UUA L;  1SRU A;  4YWL A;  1HR0 L;  3KLW A;  4R4O A;  1PH3 A;  1IZ6 A;  3U4V A;  1XPU A;  1CSP A;  1I3Q H;  2VQE Q;  3HOV H;  1HNW Q;  1PYS B;  4GLV B;  1PH2 A;  1CSQ A;  4RMF A;  1EQR A;  3F2D A;  3ZJY C;  2R7Z H;  4A3B H;  2EQS A;  4DR1 Q;  3CCU A;  4DR5 Q;  4BBS H;  1T9H A;  3S15 H;  3A5Z B;  2OQ0 A;  3E0E A;  2UU9 L;  1L1O C;  3DM3 A;  4L5T A;  1VQK A;  1V9P A;  1UE6 A;  3PF5 A;  4LF4 L;  3J7A 5;  3T1Y L;  5IP7 G;  5BR8 L;  2H5X A;  2ZTD A;  4A4I A;  1Z9F A;  1A62 A;  1S3O A;  1XMQ Q;  4JI7 L;  3S2D H;  2OTJ A;  2V1C C;  3CCJ A;  1SE8 A;  3PUZ A;  5FJ8 H;  3G4S A;  4DV2 L;  1VQ8 A;  4JBK A;  4GKK L;  3M85 A;  4GOP B;  4JCV E;  4A3D H;  2UUC L;  4HIO A;  1FGU A;  2GVB A;  1VQJ A;  3J81 i;  4DUY Q;  4OWT B;  4DUZ Q;  4A3F G;  1YNX A;  4GS3 A;  4POG A;  3KDF B;  5HGQ A;  4A3M H;  3HOY H;  1W2B A;  4X66 Q;  3GTP H;  4A3L G;  4B3M Q;  3H3V H;  4JI0 Q;  4AYB G;  5IY0 A;  1BBW A;  1KAW A;  3STB C;  2Q2T A;  5IYD H;  3OYY A;  3NEN A;  1B7Y B;  1G29 1;  3PUW A;  2DGY A;  2K5H A;  2IX0 A;  3HOW G;  4A3J H;  4DKA C;  4L5S A;  4GKJ L;  1OXX K;  3HOX H;  3K7U C;  4K0K Q;  4OWX B;  4A3G H;  4BBR H;  2NVY H;  3I56 A;  1VQH A;  2ZM6 L;  3UDI A;  1P16 A;  4LWC A;  2R93 G;  1X56 A;  4HJ7 A;  4DV6 Q;  4LW1 A;  1K83 H;  3CC4 A;  2BH8 A;  4RG1 A;  1N33 L;  4KI0 A;  2AWN A;  3OTO L;  1C7Y A;  1HNZ L;  2YYZ A;  5IE8 A;  4JI8 Q;  3M7N A;  1VQ7 A;  1YZ6 A;  1XJV A;  1X3E A;  3PSI A;  1SRO A;  3GTJ H;  4KHP Q;  4B3S Q;  3CC2 A;  4YY3 L;  4EQ5 A;  1HNW L;  5JJL A;  4QL5 A;  1XPO A;  2JA8 H;  2HHH Q;  4GLA C;  1QVF A;  3I2Z A;  4JBM A;  4JBJ A;  4DK3 C;  4JOI A;  3RZD H;  1VQL A;  3HKZ G;  1K8G A;  3KFU A;  1OXS C;  1Q46 A;  1SR3 A;  1VQ6 A;  1E3P A;  1KHI A;  2IX1 A;  1FJG Q;  1X6O A;  5LMU Q;  1B70 B;  1KD1 C;  3I4N G;  1JJ2 A;  1I6H H;  1HR0 Q;  1KQS A;  3I4O A;  3S14 H;  1JJG A;  3AYH B;  1E1T A;  5C3E G;  4DV5 L;  1L1O A;  3W1B A;  1MIU A;  1S40 A;  3M4O H;  4A3C H;  1DGS A;  1PH1 A;  4BY1 H;  1YHB A;  4PZ6 A;  3S1M H;  2QGQ A;  4DUZ L;  2B63 H;  2K5V A;  1PFS A;  1Y1W G;  1JMC A;  1YHA A;  1VQG A;  1YHQ A;  4WJ3 M;  3ULL A;  4LF4 Q;  2VS1 A;  3T1Y Q;  4DV0 L;  3G6E A;  4JG2 A;  4FDB A;  5BR8 Q;  4Y7N H;  5LMN W;  1RL2 A;  3I4N H;  3PV0 A;  4JI7 Q;  4Y52 H;  4DV2 Q;  1B8A A;  5M5X H;  3WWV A;  3PGZ A;  4A3E H;  3KJO A;  2ATW A;  3PF4 A;  2R6G A;  2OQK A;  2ZJQ A;  3KJP A;  3I4M H;  3J80 c;  2CCZ A;  3KYH C;  3MEF A;  2UUC Q;  4DR7 L;  1A8V A;  1PH7 A;  3L7Z C;  1Y1V G;  2A19 A;  2YTX A;  4YCW A;  4YWM A;  5IT9 c;  1VQO A;  1M1K C;  1ASZ A;  2RCN A;  3GTK H;  4BY7 G;  1K3R A;  3HKS A;  2CWA A;  5EAY A;  2BA1 A;  2CQO A;  5AJ3 Q;  2DUD A;  3HOU H;  3BU2 A;  4IJH A;  4TVA B;  1KIX A;  2NZO A;  2K52 A;  3TEH B;  2OTL A;  2D0O A;  4C2M H;  2Q2I A;  5E7N A;  1PYB A;  2PMZ E;  1CKN A;  4YCU A;  4P71 A;  2KCM A;  3IRB A;  4DR3 L;  3BZC A;  4AIM A;  4JI8 L;  1KXL A;  2R7F A;  2N78 A;  5JEA J;  2JA5 H;  2IHF A;  4GKJ Q;  2VQF L;  3CCR A;  1J5E L;  3CMA A;  1YBY A;  4YCV A;  4B3S L;  4A3K H;  1TWG H;  3F2B A;  1VQP A;  1TWC H;  4UP8 A;  2CKZ B;  5IYC H;  4YHH L;  3CXC A;  4DR2 L;  1VQ9 A;  2EIF A;  2HQL A;  4BY7 H;  3GTM H;  3HOZ G;  3J80 i;  1YIJ A;  2OCE A;  1VQD A;  1N33 Q;  2VUM G;  3TRZ A;  1HNZ Q;  3EIV A;  3OTO Q;  4HJA A;  1YJN A;  1GM5 A;  2NVQ H;  1FJG L;  4JI5 L;  1N9W A;  1X54 A;  5M3F G;  4LF6 Q;  4A93 H;  1HJP A;  2B29 A;  3J81 c;  2IY5 B;  3PIP A;  4YY3 Q;  1UEB A;  5GAE C;  4PMW A;  4JC0 A;  1HH2 P;  4GNX B;  3VDY A;  1Z47 A;  2Y0S E;  1LYL A;  4LFC L;  2PQA A;  4QY7 A;  1WCM H;  4R4T A;  5C4X H;  4P72 A;  3ICE A;  2XGT A;  3KDF A;  5C44 H;  2I0Q A;  4JI2 L;  1L0W A;  1S72 A;  1UE5 A;  4OXP A;  4A76 A;  1XNR L;  2YTV A;  4IPD A;  3KF8 B;  4GN4 B;  1WOC A;  1KL9 A;  5IP9 G;  2WAQ G;  4GN5 A;  3J81 j;  2KCT A;  5M3F H;  2B3G A;  1IBL L;  4DV5 Q;  1WI5 A;  3TS2 A;  1EFW A;  4JI1 L;  1CKO A;  1L2F A;  2K14 A;  3RN2 A;  3PUY A;  2MFI A;  2MO0 A;  3BZK A;  1EWI A;  2NVX H;  3CPW A;  4XIG S;  4OX9 L;  2K4K A;  1ASY A;  4L5R C;  5AJ3 L;  3CP0 A;  4DV0 Q;  1QVG A;  4JI6 Q;  1X3G A;  1G51 A;  2PI2 A;  3UDF A;  2NN6 G;  4DV7 L;  1QZH A;  2NVT H;  5IP7 H;  5M5Y H;  2Z0S A;  4GN3 B;  3RLO A;  5GAD C;  5LMN L;  3S17 H;  3FKI G;  4LF5 L;  3M4P A;  1N32 L;  1VQI A;  2NN6 I;  3FP9 A;  4DR7 Q;  2Z6K C;  1SMX A;  2C35 B;  3L2P A;  2KHI A;  1XMO L;  4KLK A;  2MQH A;  2ZTC A;  4A3F H;  4MTN A;  1D8L A;  3CCM A;  2JK8 A;  4GLX A;  4A3L H;  1C0A A;  1VQE A;  1V1Q A;  3ERS X;  4EX5 A;  3J7Z C;  4DR3 Q;  4AQY L;  3I55 A;  5IWA L;  3PO2 G;  1NMG A;  1NE3 A;  3S1R H;  1EOV A;  4IOC A;  3CCV A;  1X3F A;  4PZ7 A;  4LF6 L;  2VQF Q;  4BXX G;  1J5E Q;  3HOW H;  4DV3 L;  1AH9 A;  3W5O A;  3CCL A;  3G71 A;  4X65 Q;  2UXD Q;  5M3M G;  2ASB A;  4DR2 Q;  4YHH Q;  1JJC B;  4LFA Q;  1YI2 A;  2E2I H;  4O2D A;  2UXC L;  1QUQ A;  5H1S E;  1BVS A;  4AYB E;  1MJC A;  1JE5 A;  4POF A;  1A63 A;  3NBH B;  2R93 H;  1Y14 B;  1MJE A;  2VNU D;  4UY8 C;  4GOP C;  3H15 A;  4QJF A;  1VS0 A;  2AMC B;  1IBK L;  4JI5 Q;  4PG3 A;  4LF8 L;  1CKM A;  3L0O A;  1EUJ A;  1FVI A;  2BH2 A;  1K9M C;  2JJQ A;  2GN5 A;  4DNI A;  2KHJ A;  1UE1 A;  4LFC Q;  1IL2 A;  5M3M H;  3K81 C;  3CD6 A;  1LUZ A;  4UPA A;  3LGJ A;  4IOA A;  1U5K A;  3AQQ A;  2UXB Q;  2JA6 G;  1Q7Y C;  1V43 A;  3AFQ A;  1KRS A;  3CCQ A;  4JI2 Q;  1XNR Q;  1K0R A;  2E2H H;  4DPG A;  5GQO A;  3U58 A;  1XNQ Q;  3H0G G;  1WJJ A;  2I5L X;  4JI6 L;  1TWA H;  3E9I A;  5IYB G;  4TQU S;  3CME A;  2JEA I;  3D0F A;  1IBL Q;  1PH6 A;  4R4I A;  3M9B A;  3K7A H;  5DLQ E;  5GRO A;  4NXN L;  4JI1 Q;  3JAM i;  4DV4 L;  1VQ5 A;  4B3T Q;  5C3E H;  2QEX A;  1OXU A;  3HKZ E;  4P75 A;  2JQO A;  3S24 A;  3UE1 A;  4OX9 Q;  4R1J A;  2RHS B;  3Q8D A;  1Y1W H;  1K8A C;  4MNO A;  4O0A A;  2Z6K A;  4DV7 Q;  1HNX L;  3S16 H;  1HZA A;  2KEN A;  5LMN Q;  5M5W H;  4DR4 Q;  4LF5 Q;  1VQ4 A;  3K80 C;  1N32 Q;  4DV1 L;  2WB1 G;  2XTI A;  2R7D A;  1OXT A;  3PO3 G;  1PVO A;  4NB3 A;  1CUK A;  1AE3 A;  1LM0 A;  1EQQ A;  1EYG A;  3S1N H;  5JJK A;  1XMO Q;  4X65 L;  1L1O B;  2UXD L;  1NTG A;  1VQA A;  1Y1V H;  3NEM A;  3W1G A;  4C3H H;  5FLX c;  3S2H H;  4XTC S;  4LFA L;  4UP9 A;  3A0J A;  1NBW A;  1UWV A;  1I5F A;  2VL6 A;  4APV A;  5FLM G;  2VW9 A;  4ALP A;  3OW2 A;  1YJ9 A;  3CCE A;  1R9T H;  4DK6 C;  1C9O A;  2GVA A;  4AQY Q;  4JI4 L;  4WJ4 A;  5IWA Q;  2LSS A;  2YV5 A;  2EXD A;  3AFP A;  4LFB L;  1E24 A;  4A3I G;  2JA7 G;  2I5H A;  1VQN A;  1I94 L;  1OTC A;  4DV3 Q;  4JI3 Q;  1TXY A;  4HJ9 A;  1LTL A;  3HOV G;  4GOP A;  3CF5 A;  3PUX A;  1I50 H;  1YIT A;  2N49 A;  3F2C A;  1NJI C;  2R7Z G;  4A3B G;  2UXB L;  1XTD A;  1IXR A;  1U0L A;  3GD7 A;  3PIO A;  3HOZ H;  4BBS G;  4LF7 Q;  3A74 A;  3MXN B;  2QA4 A;  1X9N A;  2K50 A;  3TRE A;  3CC7 A;  1IBK Q;  4LF8 Q;  2VUM H;  4JV5 Q;  4QQB X;  2PNH A;  4LF9 L;  1XNQ L;  3F1Z A;  1MKH A;  2LXK A;  3ULP A;  2UUB Q;  1BKB A;  4IPH A;  2ZJR A;  4IFD G;  5C0X G;  2JA5 G;  3GO5 A;  5FJ8 G;  4B3T L;  4OWW B;  2F4V Q;  1X65 A;  1A0I A;  4KHZ A;  5ELO A;  3RN5 A;  2BA0 A;  4B3R L;  4IFD I;  4A3D G;  1W3S A;  3D31 A;  5C0X I;  3RLF A;  1G6P A;  2AHO B;  1SLJ A;  2WFW A;  4DAM A;  5J3B A;  1N8R C;  3T1H L;  4P74 A;  4A3M G;  4LNQ A;  1FL0 A;  3UDX A;  3KF6 B;  3HOY G;  2YU9 H;  2JEB I;  4K0K L;  3CW2 C;  2HIX A;  5IP9 H;  5IYD G;  2YTY A;  4P73 A;  4DV4 Q;  4HIM A;  4NXN Q;  4DR4 L;  1E7Z A;  3H3V I;  1GKH A;  2CWP A;  3CCS A;  1E1O A;  3FHW A;  4DAY B;  1GO3 E;  4A3J G;  4R4Q A;  1HZC A;  3K8A A;  1VQF A;  2JA9 A;  2A8V A;  3HOX G;  1HZ9 A;  2N8N A;  2PQA B;  4IJL A;  1PV4 A;  1IBM L;  1N34 Q;  4A3G G;  1PA6 A;  4BBR G;  2E5L L;  1XPR A;  1KC8 C;  4BA2 I;  4C3I H;  2WAQ E;  1Q8K A;  4LUO A;  1VQC A;  3K0X A;  3M4Q A;  4GNX C;  3UDG A;  1HNX Q;  2ALY B;  2F52 A;  3SGI A;  4DV1 Q;  3RZO H;  2OWO A;  3FKI H;  1Q1B A;  1JT8 A;  4JI3 L;  5K36 G;  1EIY B;  4NXM L;  1YJW A;  2L15 A;  1O7I A;  2VY3 A;  4IO9 A;  1SFO H;  2IHE A;  2JA8 G;  2HT1 A;  3EN2 A;  2ZJP A;  1RIP A;  1AE2 A;  4X62 L;  3TS0 A;  1N36 L;  1GD7 A;  3RR5 A;  3STB D;  3JAM c;  4HJ8 A;  4JI4 Q;  4OO1 G;  2D0P A;  1PH8 A;  4X64 L;  1JB7 A;  1NY4 A;  4LF7 L;  1VCI A;  4LFB Q;  2MO1 A;  4HID A;  4JV5 L;  3HFZ B;  2UXC Q;  1I94 Q;  4DR6 L;  1P8L A;  1BBU A;  2WP8 J;  3PO2 H;  4OO1 I;  3TQY A;  2N3S A;  4DV6 L;  1HR0 W;  4JYA L;  4X6A H;  3RNU A;  2UUB L;  4BXX H;  1TWF H;  3GTO H;  3PCO B;  4ME3 A;  2LXJ A;  2F4V L;  2VQE L;  1K73 C;  4A3C G;  4QIW E;  4BY1 G;  2ZTE A;  1YVC A;  1D7Q A;  1GVP A;  3UE0 A;  2VZA A;  4DR1 L;  3BJU A;  2B63 G;  4L5Q A;  4DR5 L;  4LF9 Q;  3CAM A;  2K5N A;  2ID0 A;  2UUA Q;  1YEZ A;  3I7F A;  4R4C A;  1XMQ L;  3G48 A;  3F8T A;  4A3E G;  1EIF A;  1UE7 A;  4B3R Q;  2AKW B;  3GTG H;  3U50 C;  3I4M G;  1PHJ A;  1NMF A;  2I5M X;  3NEL A;  2KBN A;  1QUQ B;  3EBE A;  2JA6 H;  1N34 L;  3CQZ H;  3T1H Q;  3HOU G;  2JE6 I;  4DUY L;  2UU9 Q;  4QGU A;  2K75 A;  2FXQ A;  3H0G H;  1PH9 A;  4X66 L;  3ER0 A;  5IYB H;  4B3M L;  2IT1 A;  4JI0 L;  1Q12 A;  2D62 A;  2NZH A;  4AH6 A;  4NPS A;  4HJ5 A;  4A75 A;  4IPC A;  4MZ9 A;  1HZB A;  3AEV A;  2E8G A;  1IYJ B;  1E22 A;  2AWO A;  3E9H A;  3GDE A;  4IPG A;  5ELN A;  5C4J H;  2MNA A;  4GNX A;  3GTQ H;  4GKK Q;  1IBM Q;  1Q1E A;  2HIV A;  4A3K G;  2Q2H A;  3PUV A;  1Q82 C;  2CFM A;  1QZG A;  2E5L Q;  1PH5 A;  3CPF A;  5IYC G;  1WYD A;  3KOJ A;  5GAH C;  2E2J H;  2Y0S G;  2A1A A;  3ULJ A;  5GAG C;  3M3Y H;  3RLN A;  4C3J H;  2R92 G;  1VQB A;  2F3I A;  3S1Q H;  1OXV A;  3JC6 6;  3GTL H;  2ES2 A;  4J15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...