3CAMA

Crystal structure of the cold shock domain protein from neisseria meningitidis
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
MATGIVKWFNDAKGFGFITPDEGGEDLFAHFSAINMEGFKTLKEGQRVSFDVTTGPKGKQAANIQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold-shock domain family protein
publication title Structure of the cold-shock domain protein from Neisseria meningitidis reveals a strand-exchanged dimer.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Gene regulation
total genus 5
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3camA00
1XTDA 4NXNL 2OTLA 4C3IH 1AH9A 3CC2A 4LF7L 2ATWA 1SROA 3E9HA 3F2BA 5M3MH 1OXUA 1D8LA 1V9PA 1E7ZA 1S3OA 4GOPA 1PH5A 4GKKQ 4LF9Q 3HOYG 2A1AA 4DR6L 3MEFA 2YV5A 4R4IA 4BBRH 1EIYB 4JI2L 1HH2P 4A75A 2UUAL 1YBYA 3HOUG 1WCMG 1U5KA 5FJ8H 4OX9Q 3BU2A 1A63A 2C35B 1VQJA 4HIMA 4IOAA 1MKHA 3S1RH 3CCRA 1OXXK 3GD7A 1E22A 4HJ9A 1XNQQ 1VQ8A 1QUQA 1QUQB 2QEXA 5C4XH 4DK6C 4DUZL 3S14H 1K0RA 1TWAH 4YHHL 2BH8A 2JQOA 2LXKA 1IZ6A 5IYBG 3GTLH 4GLVB 3CQZH 2R7ZG 2QA4A 3H0GG 4GN5A 3KDFA 1GD7A 2JE6I 3PF4A 5IWAQ 1BBWA 1VQ9A 3T1HQ 2KHJA 2HHHL 4R4TA 2Z6KA 4DR5L 3GDEA 2ZTCA 4OONA 5IE8A 4DAMA 2JA7G 4DR7L 2NN6G 3GTQH 2UU9Q 3E9IA 1LTLA 2VZAA 3DLLA 1R9TH 1L1OA 1L1OB 1Q12A 2N8NA 3F1ZA 1HZAA 4L5QA 4QJFA 1VCIA 3U50C 4DPGA 3DM3A 3HOUH 1JT8A 3M85A 3ER0A 5E7NA 3HOVH 4IPGA 1KHIA 4JI4L 1G6PA 2RHSB 1TWGH 3PGZA 1NMGA 2OQ0A 4GN3B 5GADC 4OWWB 1PVOA 1VQHA 1K8AC 4XIGS 1HNXQ 3HOXH 2EIFA 1VQEA 4LF8Q 4BY1G 1MJEA 3CCLA 2R92G 1B70B 3PUYA 5LMNW 3KFUA 4OO1I 1Y1VG 4A3JH 3GTGH 4DK3C 4BA1I 3W5OA 3TQYA 3H0GH 1PH8A 1X54A 3K7UC 1PH3A 1FGUA 4A3FH 3K8AA 1G291 4IPHA 4POFA 1Y1WH 1HZ9A 1KAWA 1WFQA 2MNAA 3RN2A 1IBMQ 1NY4A 5FLXc 1EUJA 4ME3A 3CCUA 5JEAJ 2CQOA 4X66L 4YWLA 3F2DA 1IBKQ 2JA7H 2R93H 1HR0L 3WWVA 4X62L 4DR1Q 3J81c 2UXCL 2UUBQ 3BJUA 3JAMc 4XTCS 2JA8H 2L15A 4LUOA 5HGQA 3S24A 4A3GG 2PI2A 1VQ6A 4DV3L 3FHWA 1SMXA 3J7ZC 4GLXA 2A8VA 2D0PA 1CUKA 3M4PA 1YHQA 4UY8C 1E1TA 5C3EG 3RZOH 4A3DG 4A76A 5IP7G 3TS0A 3HOZH 1XJVA 2IX1A 3S1NH 5JJIA 3A0JA 1Q1BA 5M3FH 1X6OA 3I2ZA 5LMNQ 4GKKL 1A8VA 1O7IA 4GLAC 2JA9A 5GAGC 4LF9L 4JOIA 4Y7NH 3S15H 5JJLA 1UEBA 2LSSA 2E2HH 4JI0Q 1RIPA 1D7QA 1K9MC 3PIOA 4K0KQ 2AHOB 1XMQQ 3B6YA 3S17H 4QY7A 4PG3A 3PUZA 4QL5A 2HT1A 2JA6G 4X65Q 4OX9L 4BY7G 3PSIA 1OTCA 1YEZA 4EQ5A 2KENA 1V1QA 2Q2IA 3NENA 4LW1A 4P75A 3KF6A 3KF6B 1XNQL 3PF5A 1XPUA 1WOCA 3UE1A 3ICEA 4BA2I 2A19A 5J3BA 1VQKA 1VQFA 4PMWA 1VQ7A 3M4QA 1PA6A 1YHAA 1A62A 1JJCB 2RCNA 2Z0SA 1QZGA 1FVIA 4JI6Q 3HOWH 2CFMA 1E1OA 1X3GA 1VQLA 1J6QA 5IWAL 1YZ6A 2MQHA 4NXMQ 1TWCH 3D0FA 4A3DH 1SFOH 4UP9A 3W1GA 3T1HL 4YWMA 3GTOH 2WAQG 2CWAA 4BXXH 3UDFA 4FDBA 1Q82C 1N8RC 4DV0Q 1CSPA 1G51A 1YI2A 1VQ4A 1I94Q 2UU9L 2RF4A 4GKJQ 2N78A 3S1MH 1UE1A 2K5NA 2OTJA 3CPFA 1E24A 1QVFA 4A3BH 5FLMH 5GAHC 4IJHA 4A3KH 4DR2Q 4C2MH 1NE3A 4PZ8A 1ASYA 3CC4A 5IYCG 1GM5A 1HNWQ 4OWXB 4NPSA 4GNXC 3JC66 4C3JH 3I4MH 3K7AH 3UDGA 1QVGA 2E8GA 2IX0A 2ZM6Q 5C0XI 4JI7Q 1IXRA 1HNXL 5EAYA 4GOPB 2E2JH 4WJ4A 5HY6A 2OQKA 4LF8L 2HIVA 1LM0A 4DV6Q 1JMCA 2R7FA 2MFIA 3CMAA 2NVXH 1NMFA 1SRUA 3CP0A 3J81i 4LFCQ 3S2DH 4DNIA 4UP7A 2YTXA 1H95A 3JAMi 1LUZA 3UDIA 2ZTEA 4QGUA 3J81j 3CAMA 5C0XJ 1K73C 1XPOA 3RLNA 3CCQA 1J5EQ 2VUMH 3S2HH 4KI0A 1OXTA 3CW2C 1BBUA 2F52A 1IBML 5BR8Q 2AMCB 3TS2A 2E2IH 3CF5A 1IBKL 2R7DA 1V43A 3S1QH 4DR1L 1GKHA 3TEHB 2UUBL 4A3MG 1QVCA 1B7YB 1I5FA 3LGJA 3J80c 1HNZQ 4IFDG 3RR5A 3KDFB 3L0OA 1VQMA 3PO2H 1KIXA 5IYDG 2CKZB 4KLKA 4YY3Q 4B3TQ 3ZJYC 2PQAA 2PI2E 2N3SA 4KHZA 4HJAA 4HIOA 3BZKA 2HQLA 1YHBA 2KCTA 1C7YA 3HOYH 4P71A 5LMNL 3A5ZB 2ZTDA 1GO3E 2WB1G 3E0EA 2OWOA 4BBSG 3UDXA 5IT9c 1L0WA 1FJGQ 4JI0L 3STBC 1K8GA 4P72A 1WCMH 3CC7A 2I0QA 4K0KL 1K83H 3FP9A 1XMQL 5JJKA 1PYBA 2MO1A 1N34Q 4LWCA 3OYYA 4X65L 5ELOA 1XMOQ 4YCWA 4R4QA 2I5HA 5AJ3Q 2NZHA 4GS3A 3PV0A 5IYBH 2R7ZH 4L5TA 4DAYB 5IY0A 1X9NA 1UE5A 2VQFQ 2ES2A 4JI6L 4LFAQ 1X56A 4JI3Q 1PH9A 3GTPH 1E3PA 2FXQA 2B63G 1PYSB 3M9BA 4P73A 4DV5Q 2JEBI 4P74A 1L2FA 4NXML 3CXCA 2JEAI 1JJGA 5LMUQ 2JK8A 3HKZG 2YTYA 1NBWA 4DV2Q 4A93G 1VQNA 4JBKA 1KRTA 4DV0L 3U4ZA 1I94L 4GKJL 4JYAQ 3W1BA 1N36Q 3ULJA 4AQYQ 1S72A 3GTKH 1PH4A 4DR2L 5C0XG 4PZ6A 1VQAA 4DV7Q 1PH7A 1Z47A 5GQOA 1PH2A 1SR3A 1NJIC 4B3MQ 1HNWL 2UXBQ 1C9OA 3K81C 1CSQA 2V1CC 2D62A 4RG1A 4POGA 2ZM6L 3I4NG 4QQBX 4JI7L 4A3CG 4DUYQ 1XPRA 1PFSA 4BY1H 2R92H 1T9HA 1KXLA 1Y1VH 4X64Q 2VY3A 3U58A 2IY5B 4O2DA 2DUDA 4RMFA 4DV6L 1M90C 3OW2A 2NVTH 3FKIG 3H3VH 3K0XA 4LUVA 4LFCL 1YJNA 2QGQA 4A3IG 4DKAC 5C44G 2CCZA 3EBEA 1MJCA 3J80i 4MNOA 4JI1Q 2VQEQ 4X6AH 2B63H 1J5EL 1Q1EA 1YITA 1P16A 3SGIA 3PO3G 1IBLQ 2YTVA 3T1YQ 1VQGA 5BR8L 4JBMA 1I3QH 2Y0SG 2ALYB 1OXSC 3VDYA 3BZCA 4LUZA 2VW9A 4H02A 3CCEA 4B3RQ 4AYBG 1HR0W 4A3GH 3I55A 1N9WA 4GNXA 4GNXB 2UUCQ 4IPCA 1EFWA 4O0AA 3RLFA 1Z9FA 4L5SA 5IP9G 2NN6I 5C3EH 1VQCA 5IP7H 4JI8Q 3U4VA 4YY3L 2JA5G 4B3TL 2ZJPA 1JJ2A 1WJJA 3RLOA 5M5XH 3HKSA 1VQDA 3RZDH 1VQBA 2XTIA 3L7ZC 3ULLA 1HZCA 5M3MG 4LF6Q 1LYLA 4JV5Q 4DR3Q 1FJGL 4MZ9A 1KQSA 3RN5A 3A5UA 4BBRG 2JA6H 5GAEC 4BY7H 4HJ8A 1ASZA 4Y52H 4OO1G 4C3HH 5JEAG 3Q8DA 2LXJA 2R6GA 5M5YH 5FJ8G 1XMOL 1N34L 2E5LQ 4JI5Q 2VL6A 3AFPA 5AJ3L 4DV1Q 1M1KC 4LFBQ 1SLJA 5C4JH 1X65A 2AKWB 2ASBA 2GVBA 4HIDA 1XNRQ 2BH2A 3TREA 2DGYA 1TWFH 1EQQA 3L2PA 1HZBA 1YJ9A 5C4XG 3EIVA 3IRBA 3CCMA 4DV4Q 2VQFL 4DR4Q 1MIUA 2AWOA 4LFAL 4JI3L 3AYHB 1TWHH 1RL2A 2D0OA 3KF8B 4DV5L 3K80C 3I4OA 4PZ7A 1VQOA 2HIXA 5H1SE 5LMUL 4IO9A 4DV2L 1UWVA 2K4KA 1AE3A 3D31A 4HJ5A 1IL2A 1GVPA 3AEVA 1HJPA 4JYAL 4B3SQ 2IHEA 1N36L 2WAQE 4EX5A 3KJOA 4AQYL 5IYCH 4HJ7A 2KHIA 3OTOQ 1VQPA 4DV7L 1HNZL 4B3ML 2KCMA 2UXBL 2PQAB 4TVAB 1PV4A 4LF4Q 2UXDQ 3HOVG 3AFQA 2RHQB 1X3FA 4JBJA 4L5RC 1Q46A 4DUYL 2B3GA 1TXYA 3KJPA 1BKBA 2VNUD 2ZJQA 5DLQE 1JB7A 4X64L 3HOXG 1VQ5A 3PO2G 3F8TA 3M7NA 1N32Q 2K75A 2GVAA 3GTMH 1BVSA 4A4IA 4KHPQ 4A3JG 4GOPC 4JI1L 4R4CA 2VQEL 5K36G 2F3IA 2WP8J 1UE7A 2H5XA 2K50A 4ALPA 4A3FG 2PMZE 1I6HH 4LF5Q 1IBLL 3A74A 1JE5A 3G48A 3T1YL 1Y1WG 2PNHA 4OWTB 1N33Q 4A3EG 3F2CA 3CCJA 1VS0A 3I56A 3CCSA 4A3MH 1UE6A 4B3RL 2R93G 2Q2UA 1CKOA 2F4VQ 1YVCA 2UUCL 1YNXA 2JA8G 3J7A5 1K3RA 2K5VA 2YYZA 4YCVA 5IYDH 2VS1A 2BA1A 4A3LG 1YIJA 4R1JA 2CWPA 4JI8L 1EYGA 4NXNQ 1U0LA 3PUXA 3STBD 4LF7Q 2NVYH 3NBHB 3HOZG 5M5WH 2Q2TA 1IYJB 2IHFA 4R4OA 3G6EA 4BBSH 3KLWA 1EQRA 2Z6KC 1Y14B 5M3FG 4LF6L 4JV5L 3MXNB 4DR6Q 2Q2HA 1P8LA 4MTNA 4DR3L 4JCVE 4TQUS 4IPDA 4JI2Q 2EQSA 1Q8KA 3CPWA 1L1OC 4JG2A 1Q81C 2UUAQ 3NEMA 2NZOA 2WB1E 1DGSA 4IJLA 4AH6A 1KC8C 3GO5A 1Q86C 2E5LL 1Q7YC 4JI5L 5ELNA 3CCVA 4OXPA 3ULPA 4A3EH 4DV1L 1CKNA 1CKNB 4LFBL 2ZJRA 1PH1A 4DUZQ 3NELA 3G4SA 1XNRL 4YHHQ 3KOJA 3PCOB 3ERSX 3CD6A 2I5MX 4WJ3M 1SE8A 4DV4L 4HIKA 4A3LH 1OXVA 4QIWE 4DR4L 1AE2A 2AWNA 3HOWG 1CKMA 1NTGA 3UE0A 1X55A 1YJWA 4UP8A 2HHHQ 4NB3A 3TRZA 4IFDI 4DR5Q 3PUWA 1EIFA 4APVA 2N49A 1S40A 4A93H 4UPAA 4GN4B 3G71A 1PHJA 4DR7Q 4BXXG 2K52A 2KBNA 3CMEA 2K5HA 1X3EA 1SN8A 4B3SL 2GN5A 3I7FA 2MO0A 4LNQA 2K14A 1EOVA 3HKZE 4J15A 3M3YH 4IFDJ 3OTOL 4A3BG 5FLMG 1B8AA 4A3KG 2ID0A 2IT1A 3I4NH 4JI4Q 4LF4L 4A3CH 2UXDL 1WI5A 3I4MG 3AQQA 2OCEA 2NVQH 2XGTA 2BA0A 3S16H 3FKIH 3PIPA 1QZHA 1FL0A 4A3IH 4JBWA 1EWIA 3KYHC 1KRSA 5C44H 3GTJH 3H15A 1N32L 4KHPL 1WYDA 4JC0A 2WFWA 3PO3H 4YWKA 2YU9H 1A0IA 4JOIC 2I5LX 1VQIA 3PUVA 2VUMG 4LF5L 2EXDA 3H3VI 1KD1C 4IOCA 3EN2A 1W2BA 4X66Q 1N33L 1HR0Q 5GROA 4X62Q 3M4OH 2UXCQ 1I50H 1W3SA 4AIMA 2F4VL 1PH6A 2JJQA 1C0AA 3RNUA 5IP9H 2Y0SE 4DV3Q 2JA5H 2B29A 3HFZB 4YCUA 1KL9A 4AYBE
chains in the Genus database with same CATH superfamily
2AQ2B 1WTXA 4A93B 2ATWA 1SROA 4GOPA 1V9PA 4GKKQ 3QB3A 2YV5A 4R4IA 1CQFA 1PLFA 3M3YB 3NHHA 5DEHA 3HOUG 1YBYA 1WCMG 3I4NB 1A63A 1MKHA 2WINB 4DFAA 5IGCA 1Y8OB 3T13A 1QNKA 1QUQB 4DK6C 3FKIB 1K0RA 4YHHL 2LXKA 3GTJB 4ZUIA 2B2UA 3PO3B 3PF4A 1B9MA 5IWAQ 1BBWA 4ME5A 1PFNA 2JA7G 2NN6G 4AYBB 2KUMA 5ELDA 1LTLA 3DLLA 1R9TH 4L5QA 1HZAA 4DPGA 3U50C 5E3FA 3X3NA 4OEMB 3IL8A 2EYMA 4IPGA 3TZUA 1PVOA 1HNXQ 4C3IB 4KN4C 2G5DA 1B70B 4A3JH 3MXPA 3FVQA 4DK3C 3TQYA 1SDFA 3OWEB 1X54A 1SYDA 3K7UC 1PH3A 4A3FH 3K8AA 3MFYA 4IUNA 4IPHA 1Y1WH 4JW0A 4ME3A 2A5HA 5JEAJ 3F2DA 2EXZA 1IBKQ 5KRUA 3NXWA 1HR0L 4J1MA 5C6AA 5C4XB 3V96A 3JAMc 3S14B 5HGQA 2Z4IA 3AB9A 2A8VA 5G3LF 3HP3A 1YHQA 4UY8C 3J81E 5ISRA 4R8NA 3OMCA 4A76A 1DXMA 3HOZH 5KNBA 4FP5D 5M3FH 4GKKL 1O7YA 3I2ZA 1O7IA 2KHSA 2JA9A 4ZKCB 4JOIA 1STEA 3DUZA 1CM9A 3BYYB 1HUMA 3PIOA 4QL5A 3EROA 2FINB 1TWGB 2KENA 4LW1A 4C3HG 5T1IA 3KF6A 1TVXA 4K8IA 3PF5A 2Q8TA 1FGBD 1S5ED 4PMWA 1VQ7A 1PA6A 1TY2A 1A62A 2Z0SA 3NE5B 3H0GB 4RAUC 5IWAL 2JXMB 1TWCH 3D0FA 4A3DH 1JWMD 1AP0A 2CWAA 1LTAD 4KHVA 2O5IC 1DZ1A 1G51A 1SMYC 3BDCA 2N78A 3S1MH 1LTSD 1QVFA 4A3BH 5GAHC 1EOTA 4A3KH 2Z1CA 5IYCG 1GM5A 1HNWQ 4GNXC 5JVG3 3I4MH 2A73B 3K7AH 1HNXL 5LL6X 3S1NB 3SE0A 1JMCA 1SRUA 4R9WA 4LFCQ 4DNIA 4UP7A 4CHTB 3JAMi 2E2HB 3UDIA 2ZTEA 1K8OA 5C0XJ 4CJ0B 2VUMH 3CCQA 4IZ8A 3S2HH 1QB5D 3KF8A 5I4DA 4TKOB 1PZJD 3TS2A 1IBKL 3D4RA 1V43A 2WV6D 5EKLA 1QVCA 5L37A 3J80c 3L0OA 3MVVA 3HOWB 5IYDG 4FYDA 1V8QA 4YY3Q 2WKDA 4FXKC 2PQAA 4HJAA 4HIOA 2K7VA 3A5ZB 1LTBD 1NSNS 1CFMA 1UEAB 3G7LA 4F88A 3UDXA 5IT9c 3BG3A 1K8GA 5CGKA 3LNNA 4C2MB 1U4MA 1D5ZC 2K05A 1N34Q 5ELBA 4EVOA 1XMOQ 2CH4W 4YCWA 5AJ3Q 5JPNC 1WTWA 1E2VA 4F8MA 2R7ZH 2NVXB 2GA4B 2ES2A 1RJTA 4LFAQ 3GTPH 2B63G 2RSOA 2DJFC 1PYSB 2B8FA 4DV5Q 2JEBI 3CXCA 1JJGA 1BCPD 3Q24A 4WJWA 5LMUQ 2JK8A 4DV2Q 4A93G 1VQNA 3JAML 1KRTA 3NBHA 1SJED 1B3AA 3ULJA 1ZEQX 1Z47A 1PH2A 4MTKA 4DXGA 1HNWL 4K5VA 2B2TA 1C9OA 3BS1A 3IAYA 2D62A 3I4NG 5EBCA 3NK9A 2R92H 4DA2A 1WTRA 3A8JE 2DUDA 1RTNA 3FKIG 3K0XA 4LUVA 4LFCL 1ICWA 2QGQA 3I8ZA 4DKAC 3J80i 4MNOA 4X6AH 3I4LA 1W6KA 1Q1EA 3PO3G 1IBLQ 1D1KA 4O1NA 4DAPA 5I2XA 2E75C 2WIIB 2N55A 3CCEA 1C48A 1ET9A 2F0GA 4AYBG 3LX0A 1X32A 2AUJD 2BDOA 4O0AA 4L5SA 2K5DA 2B2YA 2JN4A 3VR3A 4F7XA 2EYJA 1VQCA 2K1BA 4JI8Q 3U4VA 2RDGA 5IP7H 4K5XA 4YY3L 3EVQA 1G91A 1QNUA 2M00A 4C3IG 2XTIA 3L7ZC 4ZLTF 1B9NA 5DNFA 4CGYB 4L63B 4DR3Q 3GTKB 3RN5A 2KJXA 4BY7H 1ASZA 1N34L 2R6GA 5M5YH 3BVGA 5FJ8G 1XMOL 1I4QA 5AJ3L 4DV1Q 3GV6A 4HMJA 4BY1B 5C4JH 1X65A 4HIDA 1TR5A 3TBIB 1CHPD 3TREA 1A3VA 1TWFH 1EQQA 5C4XG 2AWOA 3QIAA 4LFAL 1RL2A 4HR7B 2EYHA 3HRZC 4DV5L 4K6LA 3V05A 2HIXA 5LMUL 1ENFA 1S5BD 4DV2L 1IL2A 4B3SQ 2WAQE 5IODA 2KHIA 2HDMA 2B2VA 2QDLA 5EKKA 4DK1A 2L12A 5M5XB 2B3GA 2OXPA 2QKIC 3RZDB 1FNWA 1Z6HA 5IT9L 4A4IA 4KHPQ 1CTMA 3H94A 2WP8J 4QB4A 2LY7A 1PRTF 3F2UA 3A74A 1IBLL 3G48A 3QG1A 2PNHA 1K8MA 3KUPA 1J9OA 2HD3A 1KLUD 3I56A 3CCSA 4A3MH 1EYAA 2Q2UA 5JOBA 1YVCA 3EJIA 3J7A5 1KDCA 1K3RA 2K5VA 4PMBA 2BA1A 3C2PA 2H1EA 3OPOA 4JI8L 1XX8A 1KNEA 1HTLD 3P75A 3PUXA 2CW0C 3L3OC 1DJRD 4O42A 3STBD 1F2YA 1IW7C 5M5WH 1IYJB 1EY9A 2R61A 3KLWA 2Z6KC 3IFTA 3MXNA 1P8LA 4DR3L 4JCVE 1EIGA 4K6DA 2EQSA 5CC4A 3CPWA 2UUAQ 3NEMA 3I3CA 1ILQA 3SHLA 3KLSX 1SJHD 3CCVA 2FMCA 4OXPA 1I4RA 4DV1L 1M8AA 2PMZB 2PQEA 3E6ZX 2QCPX 2NB0A 5CYUA 3GTMB 4WJ3M 1A15A 2BCOA 1OXVA 3G6JB 4QIWE 2EPBA 1AE2A 2AWNA 1PFBA 1CKMA 1NTGA 2J0TD 5E4WC 1WVLA 3HOWG 3A7LA 4ZRZA 1S40A 2VB3X 4UPAA 4GN4B 1PHJA 4BXXG 4DGZA 1SNDA 1X3EA 4B3SL 1KNAA 2PW7A 3I7FA 4LJZC 4J15A 3TP5A 2EJFC 2F0EA 1B8AA 2IT1A 2IWHA 2NVQH 5LL6S 1QZHA 1FL0A 4JBWA 2MHVA 3KYHC 5C44H 2XRSD 4KHPL 2WFWA 3DM1A 2YU9H 1A0IA 1EY8A 4I7AA 1KD1C 3H3VI 1TS3A 2D5DA 1EWCA 2G9DA 1PTOB 3RD4A 4QUCA 1NR4A 1WTVA 2B29A 1IHZA 1XTDA 3NPPA 5EPJA 4YIJA 2EJMA 3I72A 1D8LA 1PH5A 2G9HD 2A6HC 4Q0FA 3NQIA 3P7JA 3MEFA 2A6ED 3C1EA 1H9RA 4OO1H 3RMHA 2UUAL 3PIO3 3DHQA 3K5LA 1CI3M 1B44D 3S1RH 2AQ1B 3CCRA 4IUVA 3GD7A 2IJ0A 1E22A 3C1FA 4PNYA 2EYPA 2QEXA 1GOZA 2D9UA 1IZ6A 5IYBG 3GTLH 3CQZH 2QA4A 2BE5C 4GN5A 1F2LA 1GD7A 4ODGA 5TSSA 3T1HQ 4R4TA 3OOCA 5IE8A 4F87A 1S5DD 3GTQH 2UU9Q 3E9IA 4LNQA 2ICEC 1I50B 1VCIA 4RHRA 4G7OC 2K5QA 3HOUH 1JT8A 2R3ZA 4KMUC 3ER0A 5E7NA 3HOVH 1KHIA 1BCPF 1DOLA 4GN3B 5GADC 1K8AC 4XIGS 1VQEA 4BY1G 1SEBD 4OO1I 5C4ZA 3GTGH 1BOSA 3BZDB 1GUTA 2F3VA 2F0LA 3FMCA 1G291 1HZ9A 1WFQA 3RN2A 1SE2A 4CBVA 2KEEA 5FLXc 5KEEA 2FFKB 1C4QA 2JA7H 1SBBB 3WWVA 3BJUA 4XTCS 2L15A 1VQ6A 3K57A 4NP5A 3P20A 2MGSA 3RZOH 1JC7A 4HMIA 3TS0A 3JAME 1EFID 1Q90A 3A0JA 2CH4A 5T1GA 1A8VA 2F0WA 5CBEE 4Y7NH 1R9TB 4WORA 1UEBA 4JI0Q 3Q22A 1RIPA 3B6YA 3S17H 3PUZA 2HT1A 4X65Q 1YEZA 4EQ5A 3NENA 4FVMA 3KF6B 1WOCA 3UE1A 3ICEA 2A19A 4RWSC 1VQKA 3M4QA 4A3JB 2RCNA 1JJCB 2RQXA 4X3KA 4A3FB 1J6QA 2MQHA 1DCZA 3T53B 3U9SA 4UP9A 1Y1WB 3T1HL 2EJGC 3UDFA 1Q82C 1N8RC 4C56C 1YI2A 1I94Q 1VQ4A 2UU9L 2RF4A 3J7YW 2K5NA 4IURA 2A69D 5FLMH 4IJHA 4DK0A 2JYOA 1RODA 3A7AB 2E8GA 2IX0A 3PQIA 5C0XI 3HOZB 2E2JH 2NBFA 4WJ4A 5HY6A 2OQKA 2HIVA 4CDFC 1KDBA 5M3FB 2MFIA 3S2DH 3CP0A 4OIJA 2KQ3A 1H95A 5IGDA 2F4IA 1K73C 1JWSD 1TIID 1BBUA 5KYLA 2F52A 2M2LA 3N52A 2E2IH 3CF5A 1H9SA 1GKHA 3TEHB 1JICA 4IFDG 3KDFB 5F2DA 3H3VC 2XWJB 4A3DB 1TWCB 3BZKA 2KCTA 1C7YA 2F1MA 3HOYH 1GO3E 3E0EA 3S1MB 4JI0L 4A3BB 1PRTC 3CC7A 4A3KB 2CHBD 2ZT9C 5JJKA 4U673 2MO1A 4LWCA 4X65L 5D14A 5ELOA 3I4MB 2B2WA 3K7AB 4R4QA 5AFWA 4KKSA 1PXUA 1HQMC 1WD1A 3PV0A 1EY6A 4DAYB 2A74C 5IY0A 1X9NA 5EBDA 4Q5VA 4JI3Q 2KECA 4ABNA 1PH9A 1E3PA 2VUMB 5FLXL 4RGOS 3S2HB 4P74A 1EL0A 2JEAI 3U4ZA 1I94L 4JYAQ 2K33A 1F77A 1PH4A 4I65A 5C0XG 4FNFA 4PZ6A 1NJIC 4M1UB 1SR3A 1HRJA 3SEBA 1QOHA 3HS0C 4A3CG 1XPRA 1QILA 1RDPD 3QOJA 1T9HA 2D2CC 4B08A 1Y1VH 3U58A 2VY3A 4RMFA 4G4KA 3OW2A 2NVTH 4ZKBB 1YJNA 2CCZA 3EBEA 1EZ8A 1MJCA 2NZ1D 2VQEQ 4MHEA 2B63H 1YITA 1JCKB 3T1YQ 1VQGA 4JBMA 4H44C 1SYEA 3LWUA 4H02A 5COYA 4B3RQ 1HR0W 4A3GH 1KAAA 4KTAA 2UUCQ 2R7ZB 4IPCA 4OELB 2ZXOA 2F0DA 3RLFA 5C3EH 3DWQA 5JVH3 3W2DA 3GTPB 1A2UA 5DAUA 3X3MA 2IW3A 4NDXA 2F0NA 1CQVA 4BWGB 2K5WA 4DAVA 2F3WA 3ND9A 1Q8IA 5DM63 4LF6Q 2RVLA 4JV5Q 2F0IA 4MZ9A 3QOLA 3A5UA 1PDQA 3QJYA 2JA6H 5GAEC 3DWPA 3VYSA 4HJ8A 2PPBC 4IUQA 1QJOA 1MI2A 4JI5Q 3AFPA 4JPBW 1M1KC 3MXGA 2R92B 1SLJA 2F0KA 2AKWB 1Y8PB 4PV1C 5CORA 3L2PA 1YJ9A 3IRBA 3R93A 3E0JA 4IALA 3VR5A 1II3A 3DWAA 4JI3L 1K3BC 1SMYD 5I6WA 2KCNA 4HSVA 4PZ7A 2X6LA 1PYWD 3HKZB 4IO9A 2K4KA 2TSSA 3D31A 5C4HA 4JYAL 3S9WA 4HJ7A 1PTOC 3OTOQ 1VQPA 1A6XA 1G8ZD 4XXEA 5C5MA 4RCNA 2UXDQ 3VYRA 4KJNA 5J1ZA 1Y8NB 1CA5A 2RDHA 3KJPA 4NMZA 1BKBA 2ZJQA 1YNNC 1VQ5A 1FYCA 2GVAA 1BVSA 4A3JG 4GOPC 1R4PB 1TS5A 2VQEL 3UI2A 2F3IA 4DU9A 1UE7A 3MAQA 4BY7B 4A3FG 3H6MA 4KY6A 3CKIB 3T1YL 5E1FA 1Y1WG 5M5YB 4A3EG 3CCJA 1PTOD 5FK9C 3TP8A 4B3RL 4FXDA 5EJWA 5C4JB 1CKOA 2F4VQ 5FO8B 1TWFB 4KN7C 2UUCL 1OO9B 4A3LG 3C46A 4UAIA 1EYGA 1YNND 4C1NK 2WAQB 2B2UC 2NVYH 2O4XA 3HOZG 2OF1A 1EY7A 5IIFA 4BBSH 3ONAB 1GXDC 2L4NA 5C3WA 5M3FG 4LF6L 4JV5L 3MXNB 4HTHA 5J22A 4JI2Q 4RFBA 3PMFA 3I90A 1Q81C 1JOKA 3R3OA 4X3SA 2WB1E 1DGSA 4AH6A 2F0SA 5M9OA 4JI5L 2MUYA 1CKNA 2I07B 1SYBA 2ZJRA 1NCVA 4DUZQ 1BQQT 2F0PA 3TSSA 2L5TA 1SE8A 4HIKA 1EEFD 1M4VA 1ENAA 2TMPA 2F0HA 1GUGA 3OHXC 3HZXA 1HA6A 2HHHQ 1B4OA 4NB3A 4DR5Q 4APVA 1EIFA 4DR7Q 1LO5D 3NP8A 4A3MB 1HXYD 3VA7A 5LHY1 1BO0A 2GN5A 3VYTA 3HKZE 3OTOL 4A3BG 4A3KG 1HPCA 2HDLA 3KK7A 2UXDL 1STBA 3I4MG 2OCEA 4ILWA 2BA0A 3S16H 1U4PA 5M5WB 4A3IH 1EWIA 1SYCA 2E76C 4UHVA 1PMRA 2I5LX 4JOIC 3PUVA 3WOEA 2P5ZX 2VUMG 2ICIA 2EVBA 2EDGA 1XYIA 4X66Q 4QIWB 3M4OH 2UXCQ 2NTSA 2EYLA 1W3SA 2RDFA 4AIMA 2F4VL 5IP9H 2Y0SE 5KNDA 2JA5H 4H7BA 3HFZB 1VF7A 1B53A 2LS01 1AH9A 3CC2A 3F2BA 3J80L 2DY7A 1PRTB 5M3MH 1S3OA 1MSHA 1EIHA 5CV5A 1BR9A 4BBRH 1I4GA 2PNRC 4JI2L 2XRQD 3VA5A 1LTGD 4A75A 1JWUD 3SVMA 2PW5A 1U5KA 1TS2A 5IGBA 2C35B 4XT1B 5ELEA 5A2QL 3EFXD 4HJ9A 2NVQB 4C1NI 4DUZL 1TWAH 2BH8A 1O80A 3K6OA 5C44B 3DEPA 1D6EC 2R7ZG 4X3TA 3H0GG 3T51B 2JE6I 2RA4A 2YU9B 1GUOA 4B9WA 1VQ9A 1GUWA 2HHHL 3VR6A 4DR5L 3GDEA 4OONA 2PZUA 4DR7L 1L1OA 1Q12A 4QJFA 5CBAE 1STYA 3MFGA 5FO9B 2FMMA 3DM3A 3M85A 1J8IA 2EY2A 3PGZA 1GJXA 4IUUA 3Q23A 3HOXH 4N9TA 2EIFA 1WTOA 2R92G 3CCLA 4KD4A 3PUYA 1BDOA 5LMNW 1NNXA 1FR3A 5CV8A 5K36H 1EY4A 1PH8A 4RHSA 3HG9A 4H0LC 4FF2A 1WTPA 1KAWA 1G6ZA 1NY4A 4X66L 4YWLA 2R93H 3S1RB 1UNSA 3OIQA 2UXCL 2JA8H 1PZKD 3S24A 1QG7A 2CW0D 2PI2A 4N8FA 4K2LA 5FLXE 4GLXA 3GTLB 3J7ZC 3CQZB 1IW7D 1LT6D 3H91A 1CUKA 3M4PA 3K59A 5IP7G 1XJVA 3A8IE 1A3TA 5JJIA 1F9QA 4OIKA 1H9KA 3GTQB 3S15H 1EEID 2K28A 1TY0A 4I7ZC 1YNJC 3NTKA 4K0KQ 4RH6A 2AHOB 4ZQ3A 1K0SA 3HOUB 3HOVB 4BY7G 3OW7A 5G3LD 1OTCA 1V1QA 2Q2IA 4P75A 2HUGA 2B2TC 2IX3A 1JORA 1VQFA 1YHAA 3GTGB 3GQBA 1QZGA 4K14A 4JI6Q 1RD9D 2CFMA 1E1OA 2AUKA 1X3GA 3Q0AA 4N8X1 4NXMQ 1SFOH 3GTOH 2WAQG 2BDNA 2SDFA 2JA7B 1VDZA 1CSPA 2OTJA 1E24A 4FF1A 1EYCA 5KIXA 4DR2Q 4M8AA 1NE3A 4PZ8A 1ASYA 3CC4A 3K0YA 4NPSA 2A68C 2EY1A 4C3JH 2L1BA 3UDGA 1QVGA 3RZOB 1ESFA 2B2YC 1IXRA 5EAYA 5HURA 4GOPB 1LM0A 2HCIA 4DV6Q 3CMAA 2EOTA 4Y7NB 1WD0A 2YTXA 3ZYYX 4ZYSA 4QGUA 3CAMA 1J5EQ 4KI0A 1STAA 3S17B 2KVMA 3CW2C 4K5WA 1RHPA 4B9XA 1BCPB 4FF4A 2R7DA 3S1QH 1H9SB 1H9MA 4A3MG 3MEHA 1B7YB 1I5FA 3LGJA 5ELCA 3RR5A 3PO2H 1KIXA 2CKZB 4KLKA 3FRPB 5FO7B 2L11A 4B3TQ 2A6HD 4KK7A 3FPPA 3RUZA 3ND8A 4KHZA 2LKVA 2HQLA 2I46A 2XVSA 2DNEA 3TZDA 4P71A 3A54A 1IL8A 3TP7A 2ZTDA 2JSOA 2OWOA 1JOQA 5BN5A 1KTKA 1FJGQ 3KBXA 4P72A 1WCMH 4K0KL 5KYIA 4XQNA 1AZPA 1B50A 1K83H 3FP9A 1H9JA 4R8IA 2F0MA 1NUCA 3OYYA 1EWHA 2QEJC 1CT1D 2I5HA 2EZVA 2BE5D 2B2VC 2E2JB 1RCVD 4GS3A 3S2DB 4L5TA 1E0BA 3BDLA 1T5EA 2VQFQ 4JI6L 2FXQA 2E2DC 1RTOA 3M9BA 4P73A 1AEXA 4NXML 1L2FA 4MN3A 2NN6H 4JBKA 2E2IB 4XYOA 1ML0D 2HCCA 1N36Q 1F9RA 3NSWA 4AQYQ 1S72A 4EQNA 1W6JA 4DR2L 1PZID 1HNZQ 2ZXRA 4B3MQ 1V1PA 3M4YA 1L0XB 3FEWX 3D3RA 3DMUA 1CSQA 2V1CC 1AW7A 4RG1A 4QQBX 1FNUA 3A56A 4DUYQ 1EZ6A 3MTSA 4EQPA 1KXLA 4O2DA 4DV6L 3HOYB 2KCCA 5C44G 4H13C 4JI1Q 1J5EL 1P16A 4CKCA 1QE6A 5FKAC 2YTVA 3NQTA 1I3QH 3U9OA 2ALYB 3VDYA 4LUZA 2HQEA 4ZAIA 3TMEA 1JR0D 3TN2A 3I55A 1N9WA 4GNXA 1HUNA 1CHQD 1Z9FA 1SNQA 2NN6I 4OHJA 2ZXPA 4B3TL 1JJ2A 1WJJA 3RLOA 2Q8RE 4KY7A 3CRLC 1HA5A 3ULLA 5IOCA 1HZCA 1F9SA 1LYLA 1BNZA 1SNPA 2N88A 1FJGL 2Q8IB 1KQSA 2Z4HA 3ITPA 2VXWA 4OO1G 4C3HH 5JEAG 4ZUJA 1MSGA 1TU2B 1XNRQ 1Y1VB 2BH2A 2DGYA 1HZBA 1MHWC 2DJGC 4QMGA 1D5MC 2NVTB 1HCZA 2VQFL 1MIUA 3AYHB 1TWHH 3IFDA 3KF8B 2B63B 1IKLA 3I4OA 1VQOA 1I4XA 1LT4D 2QILA 5H1SE 3NTIA 5CV9A 2KEDA 1GVPA 4Z9CB 3AEVA 4A3GB 2IHEA 1N36L 3NTHA 4AQYL 5IYCH 1HNZL 4B3ML 2DY8A 2KA7A 5C3EB 2PQAB 3BVMA 4TVAB 1PV4A 4LF4Q 3J80E 3AFQA 2H4OA 3HOVG 2MPMA 2PZTA 2RHQB 2SNSA 1Q46A 4DUYL 4JK1C 3MWYW 3GV3A 4L8JA 5DLQE 1JB7A 3F8TA 5BN3A 3M7NA 1N32Q 2PZWA 1DYQA 5EGTA 4JI1L 4R4CA 2NYZD 1UAPA 2JA6B 2L55A 5A2QE 4ALPA 1I6HH 4LF5Q 1KABA 1JE5A 5IT9E 2O2LD 2RBMA 2MP1A 1N33Q 1HHVA 5IGFA 4EGVA 4E6IA 1U4RA 4CDCC 5J39A 1YNXA 5IYDH 1FNVA 1TT2A 2YYZA 4YCVA 2VS1A 5FOBB 3BYTB 3P1HA 4R1JA 4NXNQ 1U0LA 2EY6A 4WFN3 4G7HC 4LF7Q 1SNCA 1PRTD 3NBHB 1SE3A 5ELFA 4QUFA 1PFMA 2IHFA 4R4OA 1ZYRC 1EQRA 4DR6Q 3SK5A 3A55A 1Q8KA 2NZOA 4IJLA 1Q86C 1XXGA 1Q7YC 3ULPA 4A3EH 1CKNB 3CHBD 4IUPA 1PH1A 3NELA 3G4SA 1XNRL 1DD2A 2PCFB 3KOJA 3ERSX 1B2TA 2I5MX 1SE4A 5KNCA 2XIWA 4A3LH 1TQOA 4FXGC 2OEOA 3UE0A 1ZYRD 4UP8A 3PUWA 4A93H 2AQ3B 2N49A 1ONLA 2Z8LA 1MD2D 2KBNA 4HN7A 2F0VA 3TDQA 1O7LA 2MO0A 2K14A 1EOVA 3D6WA 4RCOA 1SYGA 3M3YH 4IFDJ 5FLMG 3K58A 4WRDA 3I4NH 4JI4Q 4N9PA 4LF4L 2QF7A 3EQLC 1CK1A 2XGTA 4J8QA 2NVYB 3FKIH 2WB1B 4BBSB 1N32L 4NW2A 3GTJH 4JC0A 3PO3H 3L9AX 2O5JC 2K6AA 4LF5L 4IOCA 1NAPA 3EN2A 1VMCA 1N33L 5GROA 4X62Q 1HFNA 2SOBA 5NUCA 3D4DA 2J7ZA 5I9PA 1PH6A 3RNUA 1KLGD 1VF5C 4DV3Q 4BS9A 2WKCA 1KL9A 1SNMA 1DOKA 4AYBE 3GP7A 2SEBD 4NXNL 2OTLA 3SR1A 4C3IH 1SSOA 4LF7L 3E9HA 3V2TA 1OXUA 1E7ZA 3CU7A 2FHTA 5D3IB 4LF9Q 3HOYG 2A1AA 1ENCA 4DR6L 5JPMC 1EIYB 3BDOA 4U68A 1HH2P 1O7ZA 3WDNA 5FJ8H 4OX9Q 1A3UA 3BU2A 1VQJA 4HIMA 5EKIA 4IOAA 3I73A 2K03A 1OXXK 1XNQQ 1EQTA 1VQ8A 1QUQA 3S16B 5C4XH 3S14H 1ESRA 1STGA 3EA6A 2K01A 4A3IB 2JQOA 2NUCA 1U4LA 1NR2A 4GLVB 3MA2B 3KDFA 5E4XA 4KD3A 3OSOA 1JQYD 2XWBB 1RKNA 2F0QA 2KHJA 2Y0SB 2Z6KA 2EY5A 2ZTCA 4DAMA 5JJZA 4HSPA 1L0YB 3M4OB 2VZAA 2N8NA 1L1OB 5EQ0A 3F1ZA 1BCPC 2C5CA 3I70A 1GUNA 4FF3A 2QDBA 1DONA 2JA5B 4JI4L 1G6PA 2RHSB 1TWGH 4XDXA 1NMGA 2OQ0A 4OWWB 1VQHA 5I6YA 4JVZA 4DF7A 1RF2D 2NTTA 4LF8Q 3SK4A 5M3MB 1MJEA 3KFUA 1Y1VG 3R2IA 4BA1I 3R8BA 3W5OA 1FD7D 3H0GH 4DAYA 4DNRB 4BBRB 3WOFA 1C8CA 1FGUA 4HCSA 1XWEA 4POFA 1IBMQ 2MNAA 1EUJA 3CCUA 2RSNA 2CQOA 1G2TA 1S5FD 2DNCA 4RKLA 4X62L 4DR1Q 1O78A 3J81c 2UUBQ 2B2WC 4LUOA 1TWAB 1LTID 2PO4A 4FO2A 4A3GG 4DV3L 1EU3A 2V4DA 1JE4A 1SMXA 3FHWA 4RGTA 3NWTA 5IGGA 2D0PA 2PYKA 5DM73 1E1TA 5C3EG 4A3DG 2XNAC 2IX1A 1R4QB 3T4AC 2ENBA 3S1NH 3AMUA 1Q1BA 1X6OA 5LMNQ 2B39A 1CA6A 5K5PA 4GLAC 1CZGA 2WACA 5GAGC 4LF9L 5JJLA 2LSSA 2E2HH 1F2MA 1D7QA 3OIPA 1K9MC 3OMGA 2RKSA 1XMQQ 4QY7A 2Z9HA 1LABA 4PG3A 2M9VA 5CMDA 2JA6G 4OX9L 3PSIA 1AFPA 1XNQL 4CDDC 2CVRA 3HOXB 1XPUA 3FDTA 4BA2I 5J3BA 3FPUB 5D3DA 3NBIA 1WTHA 3HEJA 3HOWH 1FVIA 4KJOA 1VQLA 1YZ6A 1E2ZA 4RGMA 1A2TA 3W1GA 4YWMA 4BXXH 2VB2X 1JOOA 1LTTD 4FDBA 4K8JA 1WTQA 4DV0Q 2R93B 3N6RA 4GKJQ 4DXFA 1UE1A 4TRDA 3CPFA 2JA8B 3MC0B 4C2MH 3CRKC 4OWXB 3JC66 1LTRD 3MZ5A 1Z7TA 1G2SA 2ZM6Q 4JI7Q 2SNMA 1EY0A 4QCLA 2F0UA 2MJ8A 5CV7A 3SK8A 4LF8L 3D6CA 2R7FA 4HCEA 3VR4A 5IGEA 2NVXH 1NMFA 3J81i 1GUSA 3S15B 2L0CA 1LUZA 2E74C 4TSSA 4QF4A 3T56B 4HEDA 1XPOA 3RLNA 5C3XA 1OXTA 4X3UA 1IBML 5BR8Q 2AMCB 3E3XA 4DR1L 4LMQD 1I4PA 3DEOA 4IQZA 2UUBL 1STNA 4RGNA 1LACA 1VQMA 1IYVA 1V1OA 1D2BA 3K5OA 3ZJYC 2PI2E 2N3SA 1SFOB 3NUCA 3GTOB 1YHBA 1TKWB 5LMNL 5C5LA 2WB1G 4BBSG 1L0WA 3PIP3 3STBC 5EPLA 3T16A 2I0QA 1XMQL 1E2WA 2K32A 3E5SA 1PYBA 1SAPA 4C3JB 3MXUA 1ZKOA 4RA8A 2RCFA 4MIUA 2NZHA 1Q3LA 4KKTA 4J6HA 5IYBH 4L6TB 5A35A 1UE5A 2J4XA 2X69A 4DNTB 1SNOA 1X56A 3QO2A 1T5XD 1MBYA 4UDUC 3HKZG 4CJ2C 2YTYA 1B3QA 5BN4A 1NBWA 2Z6BA 3J81L 1GHJA 1EU4A 4DV0L 2C9OA 3S1QB 2L9HA 4GKJL 3W1BA 1I6VC 2X6GA 4ZK9B 3GTKH 2QW7A 4DV7Q 1VQAA 1PH7A 5GQOA 3PO2B 1V1PB 1F2ZA 3K5MA 2EYOA 2UXBQ 3K81C 2K04A 3SDZA 4POGA 2ZM6L 1BBXC 5CV6A 4JI7L 2IL8A 3VR2A 1PFSA 4BY1H 5CR3A 4X64Q 2IY5B 1M90C 3H3VH 4A3IG 4XYQA 3QR8A 2F0FA 1WCMB 2DN8A 4GZYC 3SGIA 1K83B 4XQQA 5BR8L 2F0JA 4XT3B 1EY5A 2Y0SG 1OXSC 4KKUA 3BZCA 2VW9A 3A8KE 4S3SA 1UUPA 3KLSA 4GNXB 3AU7A 2IPKD 1EFWA 1VMPA 5IP9G 1ILPA 2JA5G 1D1IA 1EYDA 2ZJPA 5M5XH 3HKSA 1YNJD 1VQDA 3RZDH 3M7GA 1VQBA 2CQAA 4K2KA 5M3MG 3W3AA 2F0OA 3HGBA 3URYA 3D4WA 1BUVT 2FJ2A 4BBRG 4PMCA 2NWGA 1BXTA 4Y52H 1IYUA 3Q8DA 2LXJA 2E5LQ 2A6EC 2VL6A 4LFBQ 4OGQC 2OT2A 2ASBA 2GVBA 4KV6A 4P2CB 3I91A 1B1ZA 5I9OA 1S4ZA 3EIVA 2B8GA 3CCMA 4DV4Q 4DR4Q 2D0OA 1TS4A 2LMCB 3K80C 4RKBA 1S5CD 1JB3A 1I3QB 1UWVA 1AE3A 4HJ5A 3QWNA 2A68D 1HJPA 4CDEC 1AZQA 4EX5A 3KJOA 4DV7L 2KCMA 1SYFA 1QWYA 5JEAH 3C3LA 2UXBL 1K28A 4ID6A 1ICFB 1PTOF 4JBJA 1X3FA 4L5RC 1TXYA 5EPKA 4PQXA 2VNUD 1X3QA 1QCBD 3DXJC 4X64L 3HOXG 3BVZA 2K75A 3O13A 1DM0B 3GTMH 3SXHA 5JAVA 5K36G 3VYUA 2H5XA 1HTPA 2K50A 3MHBA 1BF4A 2PMZE 3KLRA 4ULLA 4OL7A 4C3HB 2KOLA 3SK6A 4OWTB 3LWEA 1SXTA 3F2CA 2XSCA 1VS0A 1UE6A 2JP1A 3J7AF 3ERQA 4IFDH 2R93G 2JA8G 4V190 1YIJA 2BOSA 2CWPA 4LAAA 1TWHB 1F9PA 1HFGA 1ZXTA 5D65A 4KY5A 4HAEA 1CZWA 3G6EA 2Q2TA 4DN4M 1Y14B 3Q6SA 3KBGA 1D5XC 2Q2HA 4MTNA 4TQUS 4IPDA 1MGSA 1L1OC 4JG2A 3D8GA 2XN9C 4XQJA 1KC8C 2F03A 3GO5A 2E5LL 2EE1A 5ELNA 3NWSA 4LFBL 1PTOH 3IKJA 5CV4A 1AN8A 3H09A 4YHHQ 5HGTA 3PCOB 3CD6A 4CKBA 4DV4L 4DR4L 4LK1C 4IUTA 1STHA 3J7AV 1X55A 4V0BA 1YJWA 1I6HB 4IFDI 3TRZA 1XTCD 1GHKA 3G71A 1HQRD 4CKEA 4G7ZC 2K52A 1DOMA 1LLRD 3CMEA 2K5HA 1SN8A 5C0XH 3K5NA 1I4HA 1EQVA 4G57A 4CJ1B 1IKMA 2EYFA 2ID0A 1LT5D 4A3CH 4ZCKA 1WI5A 2A69C 3AQQA 4C3JG 1ET6A 3TP6A 3PIPA 4NKLA 1KRSA 3H15A 1U9RA 1WYDA 4YWKA 2LFNA 4EQOA 1LT3D 4IN3A 1VQIA 2F0TA 2EXDA 1KDAA 5I2YA 1W2BA 3R2TA 4A3EB 1HR0Q 1X3PA 1LV9A 1I50H 3OWFA 1C0AA 2JJQA 4YCUA 3J81j 1Y69U 3PO2G 5KGUA
chains in the Genus database with same CATH topology
1XTDA 4NXNL 2OTLA 4C3IH 1AH9A 3CC2A 4LF7L 2ATWA 1SROA 3E9HA 3F2BA 5M3MH 1OXUA 1D8LA 1V9PA 1E7ZA 1S3OA 4GOPA 1PH5A 4GKKQ 4LF9Q 3HOYG 2A1AA 4DR6L 3MEFA 2YV5A 4R4IA 4BBRH 1EIYB 4JI2L 1HH2P 4A75A 2UUAL 1YBYA 3HOUG 1WCMG 1U5KA 5FJ8H 4OX9Q 3BU2A 1A63A 2C35B 1VQJA 4HIMA 4IOAA 1MKHA 3S1RH 3CCRA 1OXXK 3GD7A 1E22A 4HJ9A 1XNQQ 1VQ8A 1QUQA 1QUQB 2QEXA 5C4XH 4DK6C 4DUZL 3S14H 1K0RA 1TWAH 4YHHL 2BH8A 2JQOA 2LXKA 1IZ6A 5IYBG 3GTLH 4GLVB 3CQZH 2R7ZG 2QA4A 3H0GG 4GN5A 3KDFA 1GD7A 2JE6I 3PF4A 5IWAQ 1BBWA 1VQ9A 3T1HQ 2KHJA 2HHHL 4R4TA 2Z6KA 4DR5L 3GDEA 2ZTCA 4OONA 5IE8A 4DAMA 2JA7G 4DR7L 2NN6G 3GTQH 2UU9Q 3E9IA 1LTLA 2VZAA 3DLLA 1R9TH 1L1OA 1L1OB 1Q12A 2N8NA 3F1ZA 1HZAA 4L5QA 4QJFA 1VCIA 3U50C 4DPGA 3DM3A 3HOUH 1JT8A 3M85A 3ER0A 5E7NA 3HOVH 4IPGA 1KHIA 4JI4L 1G6PA 2RHSB 1TWGH 3PGZA 1NMGA 2OQ0A 4GN3B 5GADC 4OWWB 1PVOA 1VQHA 1K8AC 4XIGS 1HNXQ 3HOXH 2EIFA 1VQEA 4LF8Q 4BY1G 1MJEA 3CCLA 2R92G 1B70B 3PUYA 5LMNW 3KFUA 4OO1I 1Y1VG 4A3JH 3GTGH 4DK3C 4BA1I 3W5OA 3TQYA 3H0GH 1PH8A 1X54A 3K7UC 1PH3A 1FGUA 4A3FH 3K8AA 1G291 4IPHA 4POFA 1Y1WH 1HZ9A 1KAWA 1WFQA 2MNAA 3RN2A 1IBMQ 1NY4A 5FLXc 1EUJA 4ME3A 3CCUA 5JEAJ 2CQOA 4X66L 4YWLA 3F2DA 1IBKQ 2JA7H 2R93H 1HR0L 3WWVA 4X62L 4DR1Q 3J81c 2UXCL 2UUBQ 3BJUA 3JAMc 4XTCS 2JA8H 2L15A 4LUOA 5HGQA 3S24A 4A3GG 2PI2A 1VQ6A 4DV3L 3FHWA 1SMXA 3J7ZC 4GLXA 2A8VA 2D0PA 1CUKA 3M4PA 1YHQA 4UY8C 1E1TA 5C3EG 3RZOH 4A3DG 4A76A 5IP7G 3TS0A 3HOZH 1XJVA 2IX1A 3S1NH 5JJIA 3A0JA 1Q1BA 5M3FH 1X6OA 3I2ZA 5LMNQ 4GKKL 1A8VA 1O7IA 4GLAC 2JA9A 5GAGC 4LF9L 4JOIA 4Y7NH 3S15H 5JJLA 1UEBA 2LSSA 2E2HH 4JI0Q 1RIPA 1D7QA 1K9MC 3PIOA 4K0KQ 2AHOB 1XMQQ 3B6YA 3S17H 4QY7A 4PG3A 3PUZA 4QL5A 2HT1A 2JA6G 4X65Q 4OX9L 4BY7G 3PSIA 1OTCA 1YEZA 4EQ5A 2KENA 1V1QA 2Q2IA 3NENA 4LW1A 4P75A 3KF6A 3KF6B 1XNQL 3PF5A 1XPUA 1WOCA 3UE1A 3ICEA 4BA2I 2A19A 5J3BA 1VQKA 1VQFA 4PMWA 1VQ7A 3M4QA 1PA6A 1YHAA 1A62A 1JJCB 2RCNA 2Z0SA 1QZGA 1FVIA 4JI6Q 3HOWH 2CFMA 1E1OA 1X3GA 1VQLA 1J6QA 5IWAL 1YZ6A 2MQHA 4NXMQ 1TWCH 3D0FA 4A3DH 1SFOH 4UP9A 3W1GA 3T1HL 4YWMA 3GTOH 2WAQG 2CWAA 4BXXH 3UDFA 4FDBA 1Q82C 1N8RC 4DV0Q 1CSPA 1G51A 1YI2A 1VQ4A 1I94Q 2UU9L 2RF4A 4GKJQ 2N78A 3S1MH 1UE1A 2K5NA 2OTJA 3CPFA 1E24A 1QVFA 4A3BH 5FLMH 5GAHC 4IJHA 4A3KH 4DR2Q 4C2MH 1NE3A 4PZ8A 1ASYA 3CC4A 5IYCG 1GM5A 1HNWQ 4OWXB 4NPSA 4GNXC 3JC66 4C3JH 3I4MH 3K7AH 3UDGA 1QVGA 2E8GA 2IX0A 2ZM6Q 5C0XI 4JI7Q 1IXRA 1HNXL 5EAYA 4GOPB 2E2JH 4WJ4A 5HY6A 2OQKA 4LF8L 2HIVA 1LM0A 4DV6Q 1JMCA 2R7FA 2MFIA 3CMAA 2NVXH 1NMFA 1SRUA 3CP0A 3J81i 4LFCQ 3S2DH 4DNIA 4UP7A 2YTXA 1H95A 3JAMi 1LUZA 3UDIA 2ZTEA 4QGUA 3J81j 3CAMA 5C0XJ 1K73C 1XPOA 3RLNA 3CCQA 1J5EQ 2VUMH 3S2HH 4KI0A 1OXTA 3CW2C 1BBUA 2F52A 1IBML 5BR8Q 2AMCB 3TS2A 2E2IH 3CF5A 1IBKL 2R7DA 1V43A 3S1QH 4DR1L 1GKHA 3TEHB 2UUBL 4A3MG 1QVCA 1B7YB 1I5FA 3LGJA 3J80c 1HNZQ 4IFDG 3RR5A 3KDFB 3L0OA 1VQMA 3PO2H 1KIXA 5IYDG 2CKZB 4KLKA 4YY3Q 4B3TQ 3ZJYC 2PQAA 2PI2E 2N3SA 4KHZA 4HJAA 4HIOA 3BZKA 2HQLA 1YHBA 2KCTA 1C7YA 3HOYH 4P71A 5LMNL 3A5ZB 2ZTDA 1GO3E 2WB1G 3E0EA 2OWOA 4BBSG 3UDXA 5IT9c 1L0WA 1FJGQ 4JI0L 3STBC 1K8GA 4P72A 1WCMH 3CC7A 2I0QA 4K0KL 1K83H 3FP9A 1XMQL 5JJKA 1PYBA 2MO1A 1N34Q 4LWCA 3OYYA 4X65L 5ELOA 1XMOQ 4YCWA 4R4QA 2I5HA 5AJ3Q 2NZHA 4GS3A 3PV0A 5IYBH 2R7ZH 4L5TA 4DAYB 5IY0A 1X9NA 1UE5A 2VQFQ 2ES2A 4JI6L 4LFAQ 1X56A 4JI3Q 1PH9A 3GTPH 1E3PA 2FXQA 2B63G 1PYSB 3M9BA 4P73A 4DV5Q 2JEBI 4P74A 1L2FA 4NXML 3CXCA 2JEAI 1JJGA 5LMUQ 2JK8A 3HKZG 2YTYA 1NBWA 4DV2Q 4A93G 1VQNA 4JBKA 1KRTA 4DV0L 3U4ZA 1I94L 4GKJL 4JYAQ 3W1BA 1N36Q 3ULJA 4AQYQ 1S72A 3GTKH 1PH4A 4DR2L 5C0XG 4PZ6A 1VQAA 4DV7Q 1PH7A 1Z47A 5GQOA 1PH2A 1SR3A 1NJIC 4B3MQ 1HNWL 2UXBQ 1C9OA 3K81C 1CSQA 2V1CC 2D62A 4RG1A 4POGA 2ZM6L 3I4NG 4QQBX 4JI7L 4A3CG 4DUYQ 1XPRA 1PFSA 4BY1H 2R92H 1T9HA 1KXLA 1Y1VH 4X64Q 2VY3A 3U58A 2IY5B 4O2DA 2DUDA 4RMFA 4DV6L 1M90C 3OW2A 2NVTH 3FKIG 3H3VH 3K0XA 4LUVA 4LFCL 1YJNA 2QGQA 4A3IG 4DKAC 5C44G 2CCZA 3EBEA 1MJCA 3J80i 4MNOA 4JI1Q 2VQEQ 4X6AH 2B63H 1J5EL 1Q1EA 1YITA 1P16A 3SGIA 3PO3G 1IBLQ 2YTVA 3T1YQ 1VQGA 5BR8L 4JBMA 1I3QH 2Y0SG 2ALYB 1OXSC 3VDYA 3BZCA 4LUZA 2VW9A 4H02A 3CCEA 4B3RQ 4AYBG 1HR0W 4A3GH 3I55A 1N9WA 4GNXA 4GNXB 2UUCQ 4IPCA 1EFWA 4O0AA 3RLFA 1Z9FA 4L5SA 5IP9G 2NN6I 5C3EH 1VQCA 5IP7H 4JI8Q 3U4VA 4YY3L 2JA5G 4B3TL 2ZJPA 1JJ2A 1WJJA 3RLOA 5M5XH 3HKSA 1VQDA 3RZDH 1VQBA 2XTIA 3L7ZC 3ULLA 1HZCA 5M3MG 4LF6Q 1LYLA 4JV5Q 4DR3Q 1FJGL 4MZ9A 1KQSA 3RN5A 3A5UA 4BBRG 2JA6H 5GAEC 4BY7H 4HJ8A 1ASZA 4Y52H 4OO1G 4C3HH 5JEAG 3Q8DA 2LXJA 2R6GA 5M5YH 5FJ8G 1XMOL 1N34L 2E5LQ 4JI5Q 2VL6A 3AFPA 5AJ3L 4DV1Q 1M1KC 4LFBQ 1SLJA 5C4JH 1X65A 2AKWB 2ASBA 2GVBA 4HIDA 1XNRQ 2BH2A 3TREA 2DGYA 1TWFH 1EQQA 3L2PA 1HZBA 1YJ9A 5C4XG 3EIVA 3IRBA 3CCMA 4DV4Q 2VQFL 4DR4Q 1MIUA 2AWOA 4LFAL 4JI3L 3AYHB 1TWHH 1RL2A 2D0OA 3KF8B 4DV5L 3K80C 3I4OA 4PZ7A 1VQOA 2HIXA 5H1SE 5LMUL 4IO9A 4DV2L 1UWVA 2K4KA 1AE3A 3D31A 4HJ5A 1IL2A 1GVPA 3AEVA 1HJPA 4JYAL 4B3SQ 2IHEA 1N36L 2WAQE 4EX5A 3KJOA 4AQYL 5IYCH 4HJ7A 2KHIA 3OTOQ 1VQPA 4DV7L 1HNZL 4B3ML 2KCMA 2UXBL 2PQAB 4TVAB 1PV4A 4LF4Q 2UXDQ 3HOVG 3AFQA 2RHQB 1X3FA 4JBJA 4L5RC 1Q46A 4DUYL 2B3GA 1TXYA 3KJPA 1BKBA 2VNUD 2ZJQA 5DLQE 1JB7A 4X64L 3HOXG 1VQ5A 3PO2G 3F8TA 3M7NA 1N32Q 2K75A 2GVAA 3GTMH 1BVSA 4A4IA 4KHPQ 4A3JG 4GOPC 4JI1L 4R4CA 2VQEL 5K36G 2F3IA 2WP8J 1UE7A 2H5XA 2K50A 4ALPA 4A3FG 2PMZE 1I6HH 4LF5Q 1IBLL 3A74A 1JE5A 3G48A 3T1YL 1Y1WG 2PNHA 4OWTB 1N33Q 4A3EG 3F2CA 3CCJA 1VS0A 3I56A 3CCSA 4A3MH 1UE6A 4B3RL 2R93G 2Q2UA 1CKOA 2F4VQ 1YVCA 2UUCL 1YNXA 2JA8G 3J7A5 1K3RA 2K5VA 2YYZA 4YCVA 5IYDH 2VS1A 2BA1A 4A3LG 1YIJA 4R1JA 2CWPA 4JI8L 1EYGA 4NXNQ 1U0LA 3PUXA 3STBD 4LF7Q 2NVYH 3NBHB 3HOZG 5M5WH 2Q2TA 1IYJB 2IHFA 4R4OA 3G6EA 4BBSH 3KLWA 1EQRA 2Z6KC 1Y14B 5M3FG 4LF6L 4JV5L 3MXNB 4DR6Q 2Q2HA 1P8LA 4MTNA 4DR3L 4JCVE 4TQUS 4IPDA 4JI2Q 2EQSA 1Q8KA 3CPWA 1L1OC 4JG2A 1Q81C 2UUAQ 3NEMA 2NZOA 2WB1E 1DGSA 4IJLA 4AH6A 1KC8C 3GO5A 1Q86C 2E5LL 1Q7YC 4JI5L 5ELNA 3CCVA 4OXPA 3ULPA 4A3EH 4DV1L 1CKNA 1CKNB 4LFBL 2ZJRA 1PH1A 4DUZQ 3NELA 3G4SA 1XNRL 4YHHQ 3KOJA 3PCOB 3ERSX 3CD6A 2I5MX 4WJ3M 1SE8A 4DV4L 4HIKA 4A3LH 1OXVA 4QIWE 4DR4L 1AE2A 2AWNA 3HOWG 1CKMA 1NTGA 3UE0A 1X55A 1YJWA 4UP8A 2HHHQ 4NB3A 3TRZA 4IFDI 4DR5Q 3PUWA 1EIFA 4APVA 2N49A 1S40A 4A93H 4UPAA 4GN4B 3G71A 1PHJA 4DR7Q 4BXXG 2K52A 2KBNA 3CMEA 2K5HA 1X3EA 1SN8A 4B3SL 2GN5A 3I7FA 2MO0A 4LNQA 2K14A 1EOVA 3HKZE 4J15A 3M3YH 4IFDJ 3OTOL 4A3BG 5FLMG 1B8AA 4A3KG 2ID0A 2IT1A 3I4NH 4JI4Q 4LF4L 4A3CH 2UXDL 1WI5A 3I4MG 3AQQA 2OCEA 2NVQH 2XGTA 2BA0A 3S16H 3FKIH 3PIPA 1QZHA 1FL0A 4A3IH 4JBWA 1EWIA 3KYHC 1KRSA 5C44H 3GTJH 3H15A 1N32L 4KHPL 1WYDA 4JC0A 2WFWA 3PO3H 4YWKA 2YU9H 1A0IA 4JOIC 2I5LX 1VQIA 3PUVA 2VUMG 4LF5L 2EXDA 3H3VI 1KD1C 4IOCA 3EN2A 1W2BA 4X66Q 1N33L 1HR0Q 5GROA 4X62Q 3M4OH 2UXCQ 1I50H 1W3SA 4AIMA 2F4VL 1PH6A 2JJQA 1C0AA 3RNUA 5IP9H 2Y0SE 4DV3Q 2JA5H 2B29A 3HFZB 4YCUA 1KL9A 4AYBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTD A;  4NXN L;  2OTL A;  4C3I H;  1AH9 A;  3CC2 A;  4LF7 L;  2ATW A;  1SRO A;  3E9H A;  3F2B A;  5M3M H;  1OXU A;  1D8L A;  1V9P A;  1E7Z A;  1S3O A;  4GOP A;  1PH5 A;  4GKK Q;  4LF9 Q;  3HOY G;  2A1A A;  4DR6 L;  3MEF A;  2YV5 A;  4R4I A;  4BBR H;  1EIY B;  4JI2 L;  1HH2 P;  4A75 A;  2UUA L;  1YBY A;  3HOU G;  1WCM G;  1U5K A;  5FJ8 H;  4OX9 Q;  3BU2 A;  1A63 A;  2C35 B;  1VQJ A;  4HIM A;  4IOA A;  1MKH A;  3S1R H;  3CCR A;  1OXX K;  3GD7 A;  1E22 A;  4HJ9 A;  1XNQ Q;  1VQ8 A;  1QUQ A;  1QUQ B;  2QEX A;  5C4X H;  4DK6 C;  4DUZ L;  3S14 H;  1K0R A;  1TWA H;  4YHH L;  2BH8 A;  2JQO A;  2LXK A;  1IZ6 A;  5IYB G;  3GTL H;  4GLV B;  3CQZ H;  2R7Z G;  2QA4 A;  3H0G G;  4GN5 A;  3KDF A;  1GD7 A;  2JE6 I;  3PF4 A;  5IWA Q;  1BBW A;  1VQ9 A;  3T1H Q;  2KHJ A;  2HHH L;  4R4T A;  2Z6K A;  4DR5 L;  3GDE A;  2ZTC A;  4OON A;  5IE8 A;  4DAM A;  2JA7 G;  4DR7 L;  2NN6 G;  3GTQ H;  2UU9 Q;  3E9I A;  1LTL A;  2VZA A;  3DLL A;  1R9T H;  1L1O A;  1L1O B;  1Q12 A;  2N8N A;  3F1Z A;  1HZA A;  4L5Q A;  4QJF A;  1VCI A;  3U50 C;  4DPG A;  3DM3 A;  3HOU H;  1JT8 A;  3M85 A;  3ER0 A;  5E7N A;  3HOV H;  4IPG A;  1KHI A;  4JI4 L;  1G6P A;  2RHS B;  1TWG H;  3PGZ A;  1NMG A;  2OQ0 A;  4GN3 B;  5GAD C;  4OWW B;  1PVO A;  1VQH A;  1K8A C;  4XIG S;  1HNX Q;  3HOX H;  2EIF A;  1VQE A;  4LF8 Q;  4BY1 G;  1MJE A;  3CCL A;  2R92 G;  1B70 B;  3PUY A;  5LMN W;  3KFU A;  4OO1 I;  1Y1V G;  4A3J H;  3GTG H;  4DK3 C;  4BA1 I;  3W5O A;  3TQY A;  3H0G H;  1PH8 A;  1X54 A;  3K7U C;  1PH3 A;  1FGU A;  4A3F H;  3K8A A;  1G29 1;  4IPH A;  4POF A;  1Y1W H;  1HZ9 A;  1KAW A;  1WFQ A;  2MNA A;  3RN2 A;  1IBM Q;  1NY4 A;  5FLX c;  1EUJ A;  4ME3 A;  3CCU A;  5JEA J;  2CQO A;  4X66 L;  4YWL A;  3F2D A;  1IBK Q;  2JA7 H;  2R93 H;  1HR0 L;  3WWV A;  4X62 L;  4DR1 Q;  3J81 c;  2UXC L;  2UUB Q;  3BJU A;  3JAM c;  4XTC S;  2JA8 H;  2L15 A;  4LUO A;  5HGQ A;  3S24 A;  4A3G G;  2PI2 A;  1VQ6 A;  4DV3 L;  3FHW A;  1SMX A;  3J7Z C;  4GLX A;  2A8V A;  2D0P A;  1CUK A;  3M4P A;  1YHQ A;  4UY8 C;  1E1T A;  5C3E G;  3RZO H;  4A3D G;  4A76 A;  5IP7 G;  3TS0 A;  3HOZ H;  1XJV A;  2IX1 A;  3S1N H;  5JJI A;  3A0J A;  1Q1B A;  5M3F H;  1X6O A;  3I2Z A;  5LMN Q;  4GKK L;  1A8V A;  1O7I A;  4GLA C;  2JA9 A;  5GAG C;  4LF9 L;  4JOI A;  4Y7N H;  3S15 H;  5JJL A;  1UEB A;  2LSS A;  2E2H H;  4JI0 Q;  1RIP A;  1D7Q A;  1K9M C;  3PIO A;  4K0K Q;  2AHO B;  1XMQ Q;  3B6Y A;  3S17 H;  4QY7 A;  4PG3 A;  3PUZ A;  4QL5 A;  2HT1 A;  2JA6 G;  4X65 Q;  4OX9 L;  4BY7 G;  3PSI A;  1OTC A;  1YEZ A;  4EQ5 A;  2KEN A;  1V1Q A;  2Q2I A;  3NEN A;  4LW1 A;  4P75 A;  3KF6 A;  3KF6 B;  1XNQ L;  3PF5 A;  1XPU A;  1WOC A;  3UE1 A;  3ICE A;  4BA2 I;  2A19 A;  5J3B A;  1VQK A;  1VQF A;  4PMW A;  1VQ7 A;  3M4Q A;  1PA6 A;  1YHA A;  1A62 A;  1JJC B;  2RCN A;  2Z0S A;  1QZG A;  1FVI A;  4JI6 Q;  3HOW H;  2CFM A;  1E1O A;  1X3G A;  1VQL A;  1J6Q A;  5IWA L;  1YZ6 A;  2MQH A;  4NXM Q;  1TWC H;  3D0F A;  4A3D H;  1SFO H;  4UP9 A;  3W1G A;  3T1H L;  4YWM A;  3GTO H;  2WAQ G;  2CWA A;  4BXX H;  3UDF A;  4FDB A;  1Q82 C;  1N8R C;  4DV0 Q;  1CSP A;  1G51 A;  1YI2 A;  1VQ4 A;  1I94 Q;  2UU9 L;  2RF4 A;  4GKJ Q;  2N78 A;  3S1M H;  1UE1 A;  2K5N A;  2OTJ A;  3CPF A;  1E24 A;  1QVF A;  4A3B H;  5FLM H;  5GAH C;  4IJH A;  4A3K H;  4DR2 Q;  4C2M H;  1NE3 A;  4PZ8 A;  1ASY A;  3CC4 A;  5IYC G;  1GM5 A;  1HNW Q;  4OWX B;  4NPS A;  4GNX C;  3JC6 6;  4C3J H;  3I4M H;  3K7A H;  3UDG A;  1QVG A;  2E8G A;  2IX0 A;  2ZM6 Q;  5C0X I;  4JI7 Q;  1IXR A;  1HNX L;  5EAY A;  4GOP B;  2E2J H;  4WJ4 A;  5HY6 A;  2OQK A;  4LF8 L;  2HIV A;  1LM0 A;  4DV6 Q;  1JMC A;  2R7F A;  2MFI A;  3CMA A;  2NVX H;  1NMF A;  1SRU A;  3CP0 A;  3J81 i;  4LFC Q;  3S2D H;  4DNI A;  4UP7 A;  2YTX A;  1H95 A;  3JAM i;  1LUZ A;  3UDI A;  2ZTE A;  4QGU A;  3J81 j;  3CAM A;  5C0X J;  1K73 C;  1XPO A;  3RLN A;  3CCQ A;  1J5E Q;  2VUM H;  3S2H H;  4KI0 A;  1OXT A;  3CW2 C;  1BBU A;  2F52 A;  1IBM L;  5BR8 Q;  2AMC B;  3TS2 A;  2E2I H;  3CF5 A;  1IBK L;  2R7D A;  1V43 A;  3S1Q H;  4DR1 L;  1GKH A;  3TEH B;  2UUB L;  4A3M G;  1QVC A;  1B7Y B;  1I5F A;  3LGJ A;  3J80 c;  1HNZ Q;  4IFD G;  3RR5 A;  3KDF B;  3L0O A;  1VQM A;  3PO2 H;  1KIX A;  5IYD G;  2CKZ B;  4KLK A;  4YY3 Q;  4B3T Q;  3ZJY C;  2PQA A;  2PI2 E;  2N3S A;  4KHZ A;  4HJA A;  4HIO A;  3BZK A;  2HQL A;  1YHB A;  2KCT A;  1C7Y A;  3HOY H;  4P71 A;  5LMN L;  3A5Z B;  2ZTD A;  1GO3 E;  2WB1 G;  3E0E A;  2OWO A;  4BBS G;  3UDX A;  5IT9 c;  1L0W A;  1FJG Q;  4JI0 L;  3STB C;  1K8G A;  4P72 A;  1WCM H;  3CC7 A;  2I0Q A;  4K0K L;  1K83 H;  3FP9 A;  1XMQ L;  5JJK A;  1PYB A;  2MO1 A;  1N34 Q;  4LWC A;  3OYY A;  4X65 L;  5ELO A;  1XMO Q;  4YCW A;  4R4Q A;  2I5H A;  5AJ3 Q;  2NZH A;  4GS3 A;  3PV0 A;  5IYB H;  2R7Z H;  4L5T A;  4DAY B;  5IY0 A;  1X9N A;  1UE5 A;  2VQF Q;  2ES2 A;  4JI6 L;  4LFA Q;  1X56 A;  4JI3 Q;  1PH9 A;  3GTP H;  1E3P A;  2FXQ A;  2B63 G;  1PYS B;  3M9B A;  4P73 A;  4DV5 Q;  2JEB I;  4P74 A;  1L2F A;  4NXM L;  3CXC A;  2JEA I;  1JJG A;  5LMU Q;  2JK8 A;  3HKZ G;  2YTY A;  1NBW A;  4DV2 Q;  4A93 G;  1VQN A;  4JBK A;  1KRT A;  4DV0 L;  3U4Z A;  1I94 L;  4GKJ L;  4JYA Q;  3W1B A;  1N36 Q;  3ULJ A;  4AQY Q;  1S72 A;  3GTK H;  1PH4 A;  4DR2 L;  5C0X G;  4PZ6 A;  1VQA A;  4DV7 Q;  1PH7 A;  1Z47 A;  5GQO A;  1PH2 A;  1SR3 A;  1NJI C;  4B3M Q;  1HNW L;  2UXB Q;  1C9O A;  3K81 C;  1CSQ A;  2V1C C;  2D62 A;  4RG1 A;  4POG A;  2ZM6 L;  3I4N G;  4QQB X;  4JI7 L;  4A3C G;  4DUY Q;  1XPR A;  1PFS A;  4BY1 H;  2R92 H;  1T9H A;  1KXL A;  1Y1V H;  4X64 Q;  2VY3 A;  3U58 A;  2IY5 B;  4O2D A;  2DUD A;  4RMF A;  4DV6 L;  1M90 C;  3OW2 A;  2NVT H;  3FKI G;  3H3V H;  3K0X A;  4LUV A;  4LFC L;  1YJN A;  2QGQ A;  4A3I G;  4DKA C;  5C44 G;  2CCZ A;  3EBE A;  1MJC A;  3J80 i;  4MNO A;  4JI1 Q;  2VQE Q;  4X6A H;  2B63 H;  1J5E L;  1Q1E A;  1YIT A;  1P16 A;  3SGI A;  3PO3 G;  1IBL Q;  2YTV A;  3T1Y Q;  1VQG A;  5BR8 L;  4JBM A;  1I3Q H;  2Y0S G;  2ALY B;  1OXS C;  3VDY A;  3BZC A;  4LUZ A;  2VW9 A;  4H02 A;  3CCE A;  4B3R Q;  4AYB G;  1HR0 W;  4A3G H;  3I55 A;  1N9W A;  4GNX A;  4GNX B;  2UUC Q;  4IPC A;  1EFW A;  4O0A A;  3RLF A;  1Z9F A;  4L5S A;  5IP9 G;  2NN6 I;  5C3E H;  1VQC A;  5IP7 H;  4JI8 Q;  3U4V A;  4YY3 L;  2JA5 G;  4B3T L;  2ZJP A;  1JJ2 A;  1WJJ A;  3RLO A;  5M5X H;  3HKS A;  1VQD A;  3RZD H;  1VQB A;  2XTI A;  3L7Z C;  3ULL A;  1HZC A;  5M3M G;  4LF6 Q;  1LYL A;  4JV5 Q;  4DR3 Q;  1FJG L;  4MZ9 A;  1KQS A;  3RN5 A;  3A5U A;  4BBR G;  2JA6 H;  5GAE C;  4BY7 H;  4HJ8 A;  1ASZ A;  4Y52 H;  4OO1 G;  4C3H H;  5JEA G;  3Q8D A;  2LXJ A;  2R6G A;  5M5Y H;  5FJ8 G;  1XMO L;  1N34 L;  2E5L Q;  4JI5 Q;  2VL6 A;  3AFP A;  5AJ3 L;  4DV1 Q;  1M1K C;  4LFB Q;  1SLJ A;  5C4J H;  1X65 A;  2AKW B;  2ASB A;  2GVB A;  4HID A;  1XNR Q;  2BH2 A;  3TRE A;  2DGY A;  1TWF H;  1EQQ A;  3L2P A;  1HZB A;  1YJ9 A;  5C4X G;  3EIV A;  3IRB A;  3CCM A;  4DV4 Q;  2VQF L;  4DR4 Q;  1MIU A;  2AWO A;  4LFA L;  4JI3 L;  3AYH B;  1TWH H;  1RL2 A;  2D0O A;  3KF8 B;  4DV5 L;  3K80 C;  3I4O A;  4PZ7 A;  1VQO A;  2HIX A;  5H1S E;  5LMU L;  4IO9 A;  4DV2 L;  1UWV A;  2K4K A;  1AE3 A;  3D31 A;  4HJ5 A;  1IL2 A;  1GVP A;  3AEV A;  1HJP A;  4JYA L;  4B3S Q;  2IHE A;  1N36 L;  2WAQ E;  4EX5 A;  3KJO A;  4AQY L;  5IYC H;  4HJ7 A;  2KHI A;  3OTO Q;  1VQP A;  4DV7 L;  1HNZ L;  4B3M L;  2KCM A;  2UXB L;  2PQA B;  4TVA B;  1PV4 A;  4LF4 Q;  2UXD Q;  3HOV G;  3AFQ A;  2RHQ B;  1X3F A;  4JBJ A;  4L5R C;  1Q46 A;  4DUY L;  2B3G A;  1TXY A;  3KJP A;  1BKB A;  2VNU D;  2ZJQ A;  5DLQ E;  1JB7 A;  4X64 L;  3HOX G;  1VQ5 A;  3PO2 G;  3F8T A;  3M7N A;  1N32 Q;  2K75 A;  2GVA A;  3GTM H;  1BVS A;  4A4I A;  4KHP Q;  4A3J G;  4GOP C;  4JI1 L;  4R4C A;  2VQE L;  5K36 G;  2F3I A;  2WP8 J;  1UE7 A;  2H5X A;  2K50 A;  4ALP A;  4A3F G;  2PMZ E;  1I6H H;  4LF5 Q;  1IBL L;  3A74 A;  1JE5 A;  3G48 A;  3T1Y L;  1Y1W G;  2PNH A;  4OWT B;  1N33 Q;  4A3E G;  3F2C A;  3CCJ A;  1VS0 A;  3I56 A;  3CCS A;  4A3M H;  1UE6 A;  4B3R L;  2R93 G;  2Q2U A;  1CKO A;  2F4V Q;  1YVC A;  2UUC L;  1YNX A;  2JA8 G;  3J7A 5;  1K3R A;  2K5V A;  2YYZ A;  4YCV A;  5IYD H;  2VS1 A;  2BA1 A;  4A3L G;  1YIJ A;  4R1J A;  2CWP A;  4JI8 L;  1EYG A;  4NXN Q;  1U0L A;  3PUX A;  3STB D;  4LF7 Q;  2NVY H;  3NBH B;  3HOZ G;  5M5W H;  2Q2T A;  1IYJ B;  2IHF A;  4R4O A;  3G6E A;  4BBS H;  3KLW A;  1EQR A;  2Z6K C;  1Y14 B;  5M3F G;  4LF6 L;  4JV5 L;  3MXN B;  4DR6 Q;  2Q2H A;  1P8L A;  4MTN A;  4DR3 L;  4JCV E;  4TQU S;  4IPD A;  4JI2 Q;  2EQS A;  1Q8K A;  3CPW A;  1L1O C;  4JG2 A;  1Q81 C;  2UUA Q;  3NEM A;  2NZO A;  2WB1 E;  1DGS A;  4IJL A;  4AH6 A;  1KC8 C;  3GO5 A;  1Q86 C;  2E5L L;  1Q7Y C;  4JI5 L;  5ELN A;  3CCV A;  4OXP A;  3ULP A;  4A3E H;  4DV1 L;  1CKN A;  1CKN B;  4LFB L;  2ZJR A;  1PH1 A;  4DUZ Q;  3NEL A;  3G4S A;  1XNR L;  4YHH Q;  3KOJ A;  3PCO B;  3ERS X;  3CD6 A;  2I5M X;  4WJ3 M;  1SE8 A;  4DV4 L;  4HIK A;  4A3L H;  1OXV A;  4QIW E;  4DR4 L;  1AE2 A;  2AWN A;  3HOW G;  1CKM A;  1NTG A;  3UE0 A;  1X55 A;  1YJW A;  4UP8 A;  2HHH Q;  4NB3 A;  3TRZ A;  4IFD I;  4DR5 Q;  3PUW A;  1EIF A;  4APV A;  2N49 A;  1S40 A;  4A93 H;  4UPA A;  4GN4 B;  3G71 A;  1PHJ A;  4DR7 Q;  4BXX G;  2K52 A;  2KBN A;  3CME A;  2K5H A;  1X3E A;  1SN8 A;  4B3S L;  2GN5 A;  3I7F A;  2MO0 A;  4LNQ A;  2K14 A;  1EOV A;  3HKZ E;  4J15 A;  3M3Y H;  4IFD J;  3OTO L;  4A3B G;  5FLM G;  1B8A A;  4A3K G;  2ID0 A;  2IT1 A;  3I4N H;  4JI4 Q;  4LF4 L;  4A3C H;  2UXD L;  1WI5 A;  3I4M G;  3AQQ A;  2OCE A;  2NVQ H;  2XGT A;  2BA0 A;  3S16 H;  3FKI H;  3PIP A;  1QZH A;  1FL0 A;  4A3I H;  4JBW A;  1EWI A;  3KYH C;  1KRS A;  5C44 H;  3GTJ H;  3H15 A;  1N32 L;  4KHP L;  1WYD A;  4JC0 A;  2WFW A;  3PO3 H;  4YWK A;  2YU9 H;  1A0I A;  4JOI C;  2I5L X;  1VQI A;  3PUV A;  2VUM G;  4LF5 L;  2EXD A;  3H3V I;  1KD1 C;  4IOC A;  3EN2 A;  1W2B A;  4X66 Q;  1N33 L;  1HR0 Q;  5GRO A;  4X62 Q;  3M4O H;  2UXC Q;  1I50 H;  1W3S A;  4AIM A;  2F4V L;  1PH6 A;  2JJQ A;  1C0A A;  3RNU A;  5IP9 H;  2Y0S E;  4DV3 Q;  2JA5 H;  2B29 A;  3HFZ B;  4YCU A;  1KL9 A;  4AYB E; 
#chains in the Genus database with same CATH topology
 2AQ2 B;  1WTX A;  4A93 B;  2ATW A;  1SRO A;  4GOP A;  1V9P A;  4GKK Q;  3QB3 A;  2YV5 A;  4R4I A;  1CQF A;  1PLF A;  3M3Y B;  3NHH A;  5DEH A;  3HOU G;  1YBY A;  1WCM G;  3I4N B;  1A63 A;  1MKH A;  2WIN B;  4DFA A;  5IGC A;  1Y8O B;  3T13 A;  1QNK A;  1QUQ B;  4DK6 C;  3FKI B;  1K0R A;  4YHH L;  2LXK A;  3GTJ B;  4ZUI A;  2B2U A;  3PO3 B;  3PF4 A;  1B9M A;  5IWA Q;  1BBW A;  4ME5 A;  1PFN A;  2JA7 G;  2NN6 G;  4AYB B;  2KUM A;  5ELD A;  1LTL A;  3DLL A;  1R9T H;  4L5Q A;  1HZA A;  4DPG A;  3U50 C;  5E3F A;  3X3N A;  4OEM B;  3IL8 A;  2EYM A;  4IPG A;  3TZU A;  1PVO A;  1HNX Q;  4C3I B;  4KN4 C;  2G5D A;  1B70 B;  4A3J H;  3MXP A;  3FVQ A;  4DK3 C;  3TQY A;  1SDF A;  3OWE B;  1X54 A;  1SYD A;  3K7U C;  1PH3 A;  4A3F H;  3K8A A;  3MFY A;  4IUN A;  4IPH A;  1Y1W H;  4JW0 A;  4ME3 A;  2A5H A;  5JEA J;  3F2D A;  2EXZ A;  1IBK Q;  5KRU A;  3NXW A;  1HR0 L;  4J1M A;  5C6A A;  5C4X B;  3V96 A;  3JAM c;  3S14 B;  5HGQ A;  2Z4I A;  3AB9 A;  2A8V A;  5G3L F;  3HP3 A;  1YHQ A;  4UY8 C;  3J81 E;  5ISR A;  4R8N A;  3OMC A;  4A76 A;  1DXM A;  3HOZ H;  5KNB A;  4FP5 D;  5M3F H;  4GKK L;  1O7Y A;  3I2Z A;  1O7I A;  2KHS A;  2JA9 A;  4ZKC B;  4JOI A;  1STE A;  3DUZ A;  1CM9 A;  3BYY B;  1HUM A;  3PIO A;  4QL5 A;  3ERO A;  2FIN B;  1TWG B;  2KEN A;  4LW1 A;  4C3H G;  5T1I A;  3KF6 A;  1TVX A;  4K8I A;  3PF5 A;  2Q8T A;  1FGB D;  1S5E D;  4PMW A;  1VQ7 A;  1PA6 A;  1TY2 A;  1A62 A;  2Z0S A;  3NE5 B;  3H0G B;  4RAU C;  5IWA L;  2JXM B;  1TWC H;  3D0F A;  4A3D H;  1JWM D;  1AP0 A;  2CWA A;  1LTA D;  4KHV A;  2O5I C;  1DZ1 A;  1G51 A;  1SMY C;  3BDC A;  2N78 A;  3S1M H;  1LTS D;  1QVF A;  4A3B H;  5GAH C;  1EOT A;  4A3K H;  2Z1C A;  5IYC G;  1GM5 A;  1HNW Q;  4GNX C;  5JVG 3;  3I4M H;  2A73 B;  3K7A H;  1HNX L;  5LL6 X;  3S1N B;  3SE0 A;  1JMC A;  1SRU A;  4R9W A;  4LFC Q;  4DNI A;  4UP7 A;  4CHT B;  3JAM i;  2E2H B;  3UDI A;  2ZTE A;  1K8O A;  5C0X J;  4CJ0 B;  2VUM H;  3CCQ A;  4IZ8 A;  3S2H H;  1QB5 D;  3KF8 A;  5I4D A;  4TKO B;  1PZJ D;  3TS2 A;  1IBK L;  3D4R A;  1V43 A;  2WV6 D;  5EKL A;  1QVC A;  5L37 A;  3J80 c;  3L0O A;  3MVV A;  3HOW B;  5IYD G;  4FYD A;  1V8Q A;  4YY3 Q;  2WKD A;  4FXK C;  2PQA A;  4HJA A;  4HIO A;  2K7V A;  3A5Z B;  1LTB D;  1NSN S;  1CFM A;  1UEA B;  3G7L A;  4F88 A;  3UDX A;  5IT9 c;  3BG3 A;  1K8G A;  5CGK A;  3LNN A;  4C2M B;  1U4M A;  1D5Z C;  2K05 A;  1N34 Q;  5ELB A;  4EVO A;  1XMO Q;  2CH4 W;  4YCW A;  5AJ3 Q;  5JPN C;  1WTW A;  1E2V A;  4F8M A;  2R7Z H;  2NVX B;  2GA4 B;  2ES2 A;  1RJT A;  4LFA Q;  3GTP H;  2B63 G;  2RSO A;  2DJF C;  1PYS B;  2B8F A;  4DV5 Q;  2JEB I;  3CXC A;  1JJG A;  1BCP D;  3Q24 A;  4WJW A;  5LMU Q;  2JK8 A;  4DV2 Q;  4A93 G;  1VQN A;  3JAM L;  1KRT A;  3NBH A;  1SJE D;  1B3A A;  3ULJ A;  1ZEQ X;  1Z47 A;  1PH2 A;  4MTK A;  4DXG A;  1HNW L;  4K5V A;  2B2T A;  1C9O A;  3BS1 A;  3IAY A;  2D62 A;  3I4N G;  5EBC A;  3NK9 A;  2R92 H;  4DA2 A;  1WTR A;  3A8J E;  2DUD A;  1RTN A;  3FKI G;  3K0X A;  4LUV A;  4LFC L;  1ICW A;  2QGQ A;  3I8Z A;  4DKA C;  3J80 i;  4MNO A;  4X6A H;  3I4L A;  1W6K A;  1Q1E A;  3PO3 G;  1IBL Q;  1D1K A;  4O1N A;  4DAP A;  5I2X A;  2E75 C;  2WII B;  2N55 A;  3CCE A;  1C48 A;  1ET9 A;  2F0G A;  4AYB G;  3LX0 A;  1X32 A;  2AUJ D;  2BDO A;  4O0A A;  4L5S A;  2K5D A;  2B2Y A;  2JN4 A;  3VR3 A;  4F7X A;  2EYJ A;  1VQC A;  2K1B A;  4JI8 Q;  3U4V A;  2RDG A;  5IP7 H;  4K5X A;  4YY3 L;  3EVQ A;  1G91 A;  1QNU A;  2M00 A;  4C3I G;  2XTI A;  3L7Z C;  4ZLT F;  1B9N A;  5DNF A;  4CGY B;  4L63 B;  4DR3 Q;  3GTK B;  3RN5 A;  2KJX A;  4BY7 H;  1ASZ A;  1N34 L;  2R6G A;  5M5Y H;  3BVG A;  5FJ8 G;  1XMO L;  1I4Q A;  5AJ3 L;  4DV1 Q;  3GV6 A;  4HMJ A;  4BY1 B;  5C4J H;  1X65 A;  4HID A;  1TR5 A;  3TBI B;  1CHP D;  3TRE A;  1A3V A;  1TWF H;  1EQQ A;  5C4X G;  2AWO A;  3QIA A;  4LFA L;  1RL2 A;  4HR7 B;  2EYH A;  3HRZ C;  4DV5 L;  4K6L A;  3V05 A;  2HIX A;  5LMU L;  1ENF A;  1S5B D;  4DV2 L;  1IL2 A;  4B3S Q;  2WAQ E;  5IOD A;  2KHI A;  2HDM A;  2B2V A;  2QDL A;  5EKK A;  4DK1 A;  2L12 A;  5M5X B;  2B3G A;  2OXP A;  2QKI C;  3RZD B;  1FNW A;  1Z6H A;  5IT9 L;  4A4I A;  4KHP Q;  1CTM A;  3H94 A;  2WP8 J;  4QB4 A;  2LY7 A;  1PRT F;  3F2U A;  3A74 A;  1IBL L;  3G48 A;  3QG1 A;  2PNH A;  1K8M A;  3KUP A;  1J9O A;  2HD3 A;  1KLU D;  3I56 A;  3CCS A;  4A3M H;  1EYA A;  2Q2U A;  5JOB A;  1YVC A;  3EJI A;  3J7A 5;  1KDC A;  1K3R A;  2K5V A;  4PMB A;  2BA1 A;  3C2P A;  2H1E A;  3OPO A;  4JI8 L;  1XX8 A;  1KNE A;  1HTL D;  3P75 A;  3PUX A;  2CW0 C;  3L3O C;  1DJR D;  4O42 A;  3STB D;  1F2Y A;  1IW7 C;  5M5W H;  1IYJ B;  1EY9 A;  2R61 A;  3KLW A;  2Z6K C;  3IFT A;  3MXN A;  1P8L A;  4DR3 L;  4JCV E;  1EIG A;  4K6D A;  2EQS A;  5CC4 A;  3CPW A;  2UUA Q;  3NEM A;  3I3C A;  1ILQ A;  3SHL A;  3KLS X;  1SJH D;  3CCV A;  2FMC A;  4OXP A;  1I4R A;  4DV1 L;  1M8A A;  2PMZ B;  2PQE A;  3E6Z X;  2QCP X;  2NB0 A;  5CYU A;  3GTM B;  4WJ3 M;  1A15 A;  2BCO A;  1OXV A;  3G6J B;  4QIW E;  2EPB A;  1AE2 A;  2AWN A;  1PFB A;  1CKM A;  1NTG A;  2J0T D;  5E4W C;  1WVL A;  3HOW G;  3A7L A;  4ZRZ A;  1S40 A;  2VB3 X;  4UPA A;  4GN4 B;  1PHJ A;  4BXX G;  4DGZ A;  1SND A;  1X3E A;  4B3S L;  1KNA A;  2PW7 A;  3I7F A;  4LJZ C;  4J15 A;  3TP5 A;  2EJF C;  2F0E A;  1B8A A;  2IT1 A;  2IWH A;  2NVQ H;  5LL6 S;  1QZH A;  1FL0 A;  4JBW A;  2MHV A;  3KYH C;  5C44 H;  2XRS D;  4KHP L;  2WFW A;  3DM1 A;  2YU9 H;  1A0I A;  1EY8 A;  4I7A A;  1KD1 C;  3H3V I;  1TS3 A;  2D5D A;  1EWC A;  2G9D A;  1PTO B;  3RD4 A;  4QUC A;  1NR4 A;  1WTV A;  2B29 A;  1IHZ A;  1XTD A;  3NPP A;  5EPJ A;  4YIJ A;  2EJM A;  3I72 A;  1D8L A;  1PH5 A;  2G9H D;  2A6H C;  4Q0F A;  3NQI A;  3P7J A;  3MEF A;  2A6E D;  3C1E A;  1H9R A;  4OO1 H;  3RMH A;  2UUA L;  3PIO 3;  3DHQ A;  3K5L A;  1CI3 M;  1B44 D;  3S1R H;  2AQ1 B;  3CCR A;  4IUV A;  3GD7 A;  2IJ0 A;  1E22 A;  3C1F A;  4PNY A;  2EYP A;  2QEX A;  1GOZ A;  2D9U A;  1IZ6 A;  5IYB G;  3GTL H;  3CQZ H;  2QA4 A;  2BE5 C;  4GN5 A;  1F2L A;  1GD7 A;  4ODG A;  5TSS A;  3T1H Q;  4R4T A;  3OOC A;  5IE8 A;  4F87 A;  1S5D D;  3GTQ H;  2UU9 Q;  3E9I A;  4LNQ A;  2ICE C;  1I50 B;  1VCI A;  4RHR A;  4G7O C;  2K5Q A;  3HOU H;  1JT8 A;  2R3Z A;  4KMU C;  3ER0 A;  5E7N A;  3HOV H;  1KHI A;  1BCP F;  1DOL A;  4GN3 B;  5GAD C;  1K8A C;  4XIG S;  1VQE A;  4BY1 G;  1SEB D;  4OO1 I;  5C4Z A;  3GTG H;  1BOS A;  3BZD B;  1GUT A;  2F3V A;  2F0L A;  3FMC A;  1G29 1;  1HZ9 A;  1WFQ A;  3RN2 A;  1SE2 A;  4CBV A;  2KEE A;  5FLX c;  5KEE A;  2FFK B;  1C4Q A;  2JA7 H;  1SBB B;  3WWV A;  3BJU A;  4XTC S;  2L15 A;  1VQ6 A;  3K57 A;  4NP5 A;  3P20 A;  2MGS A;  3RZO H;  1JC7 A;  4HMI A;  3TS0 A;  3JAM E;  1EFI D;  1Q90 A;  3A0J A;  2CH4 A;  5T1G A;  1A8V A;  2F0W A;  5CBE E;  4Y7N H;  1R9T B;  4WOR A;  1UEB A;  4JI0 Q;  3Q22 A;  1RIP A;  3B6Y A;  3S17 H;  3PUZ A;  2HT1 A;  4X65 Q;  1YEZ A;  4EQ5 A;  3NEN A;  4FVM A;  3KF6 B;  1WOC A;  3UE1 A;  3ICE A;  2A19 A;  4RWS C;  1VQK A;  3M4Q A;  4A3J B;  2RCN A;  1JJC B;  2RQX A;  4X3K A;  4A3F B;  1J6Q A;  2MQH A;  1DCZ A;  3T53 B;  3U9S A;  4UP9 A;  1Y1W B;  3T1H L;  2EJG C;  3UDF A;  1Q82 C;  1N8R C;  4C56 C;  1YI2 A;  1I94 Q;  1VQ4 A;  2UU9 L;  2RF4 A;  3J7Y W;  2K5N A;  4IUR A;  2A69 D;  5FLM H;  4IJH A;  4DK0 A;  2JYO A;  1ROD A;  3A7A B;  2E8G A;  2IX0 A;  3PQI A;  5C0X I;  3HOZ B;  2E2J H;  2NBF A;  4WJ4 A;  5HY6 A;  2OQK A;  2HIV A;  4CDF C;  1KDB A;  5M3F B;  2MFI A;  3S2D H;  3CP0 A;  4OIJ A;  2KQ3 A;  1H95 A;  5IGD A;  2F4I A;  1K73 C;  1JWS D;  1TII D;  1BBU A;  5KYL A;  2F52 A;  2M2L A;  3N52 A;  2E2I H;  3CF5 A;  1H9S A;  1GKH A;  3TEH B;  1JIC A;  4IFD G;  3KDF B;  5F2D A;  3H3V C;  2XWJ B;  4A3D B;  1TWC B;  3BZK A;  2KCT A;  1C7Y A;  2F1M A;  3HOY H;  1GO3 E;  3E0E A;  3S1M B;  4JI0 L;  4A3B B;  1PRT C;  3CC7 A;  4A3K B;  2CHB D;  2ZT9 C;  5JJK A;  4U67 3;  2MO1 A;  4LWC A;  4X65 L;  5D14 A;  5ELO A;  3I4M B;  2B2W A;  3K7A B;  4R4Q A;  5AFW A;  4KKS A;  1PXU A;  1HQM C;  1WD1 A;  3PV0 A;  1EY6 A;  4DAY B;  2A74 C;  5IY0 A;  1X9N A;  5EBD A;  4Q5V A;  4JI3 Q;  2KEC A;  4ABN A;  1PH9 A;  1E3P A;  2VUM B;  5FLX L;  4RGO S;  3S2H B;  4P74 A;  1EL0 A;  2JEA I;  3U4Z A;  1I94 L;  4JYA Q;  2K33 A;  1F77 A;  1PH4 A;  4I65 A;  5C0X G;  4FNF A;  4PZ6 A;  1NJI C;  4M1U B;  1SR3 A;  1HRJ A;  3SEB A;  1QOH A;  3HS0 C;  4A3C G;  1XPR A;  1QIL A;  1RDP D;  3QOJ A;  1T9H A;  2D2C C;  4B08 A;  1Y1V H;  3U58 A;  2VY3 A;  4RMF A;  4G4K A;  3OW2 A;  2NVT H;  4ZKB B;  1YJN A;  2CCZ A;  3EBE A;  1EZ8 A;  1MJC A;  2NZ1 D;  2VQE Q;  4MHE A;  2B63 H;  1YIT A;  1JCK B;  3T1Y Q;  1VQG A;  4JBM A;  4H44 C;  1SYE A;  3LWU A;  4H02 A;  5COY A;  4B3R Q;  1HR0 W;  4A3G H;  1KAA A;  4KTA A;  2UUC Q;  2R7Z B;  4IPC A;  4OEL B;  2ZXO A;  2F0D A;  3RLF A;  5C3E H;  3DWQ A;  5JVH 3;  3W2D A;  3GTP B;  1A2U A;  5DAU A;  3X3M A;  2IW3 A;  4NDX A;  2F0N A;  1CQV A;  4BWG B;  2K5W A;  4DAV A;  2F3W A;  3ND9 A;  1Q8I A;  5DM6 3;  4LF6 Q;  2RVL A;  4JV5 Q;  2F0I A;  4MZ9 A;  3QOL A;  3A5U A;  1PDQ A;  3QJY A;  2JA6 H;  5GAE C;  3DWP A;  3VYS A;  4HJ8 A;  2PPB C;  4IUQ A;  1QJO A;  1MI2 A;  4JI5 Q;  3AFP A;  4JPB W;  1M1K C;  3MXG A;  2R92 B;  1SLJ A;  2F0K A;  2AKW B;  1Y8P B;  4PV1 C;  5COR A;  3L2P A;  1YJ9 A;  3IRB A;  3R93 A;  3E0J A;  4IAL A;  3VR5 A;  1II3 A;  3DWA A;  4JI3 L;  1K3B C;  1SMY D;  5I6W A;  2KCN A;  4HSV A;  4PZ7 A;  2X6L A;  1PYW D;  3HKZ B;  4IO9 A;  2K4K A;  2TSS A;  3D31 A;  5C4H A;  4JYA L;  3S9W A;  4HJ7 A;  1PTO C;  3OTO Q;  1VQP A;  1A6X A;  1G8Z D;  4XXE A;  5C5M A;  4RCN A;  2UXD Q;  3VYR A;  4KJN A;  5J1Z A;  1Y8N B;  1CA5 A;  2RDH A;  3KJP A;  4NMZ A;  1BKB A;  2ZJQ A;  1YNN C;  1VQ5 A;  1FYC A;  2GVA A;  1BVS A;  4A3J G;  4GOP C;  1R4P B;  1TS5 A;  2VQE L;  3UI2 A;  2F3I A;  4DU9 A;  1UE7 A;  3MAQ A;  4BY7 B;  4A3F G;  3H6M A;  4KY6 A;  3CKI B;  3T1Y L;  5E1F A;  1Y1W G;  5M5Y B;  4A3E G;  3CCJ A;  1PTO D;  5FK9 C;  3TP8 A;  4B3R L;  4FXD A;  5EJW A;  5C4J B;  1CKO A;  2F4V Q;  5FO8 B;  1TWF B;  4KN7 C;  2UUC L;  1OO9 B;  4A3L G;  3C46 A;  4UAI A;  1EYG A;  1YNN D;  4C1N K;  2WAQ B;  2B2U C;  2NVY H;  2O4X A;  3HOZ G;  2OF1 A;  1EY7 A;  5IIF A;  4BBS H;  3ONA B;  1GXD C;  2L4N A;  5C3W A;  5M3F G;  4LF6 L;  4JV5 L;  3MXN B;  4HTH A;  5J22 A;  4JI2 Q;  4RFB A;  3PMF A;  3I90 A;  1Q81 C;  1JOK A;  3R3O A;  4X3S A;  2WB1 E;  1DGS A;  4AH6 A;  2F0S A;  5M9O A;  4JI5 L;  2MUY A;  1CKN A;  2I07 B;  1SYB A;  2ZJR A;  1NCV A;  4DUZ Q;  1BQQ T;  2F0P A;  3TSS A;  2L5T A;  1SE8 A;  4HIK A;  1EEF D;  1M4V A;  1ENA A;  2TMP A;  2F0H A;  1GUG A;  3OHX C;  3HZX A;  1HA6 A;  2HHH Q;  1B4O A;  4NB3 A;  4DR5 Q;  4APV A;  1EIF A;  4DR7 Q;  1LO5 D;  3NP8 A;  4A3M B;  1HXY D;  3VA7 A;  5LHY 1;  1BO0 A;  2GN5 A;  3VYT A;  3HKZ E;  3OTO L;  4A3B G;  4A3K G;  1HPC A;  2HDL A;  3KK7 A;  2UXD L;  1STB A;  3I4M G;  2OCE A;  4ILW A;  2BA0 A;  3S16 H;  1U4P A;  5M5W B;  4A3I H;  1EWI A;  1SYC A;  2E76 C;  4UHV A;  1PMR A;  2I5L X;  4JOI C;  3PUV A;  3WOE A;  2P5Z X;  2VUM G;  2ICI A;  2EVB A;  2EDG A;  1XYI A;  4X66 Q;  4QIW B;  3M4O H;  2UXC Q;  2NTS A;  2EYL A;  1W3S A;  2RDF A;  4AIM A;  2F4V L;  5IP9 H;  2Y0S E;  5KND A;  2JA5 H;  4H7B A;  3HFZ B;  1VF7 A;  1B53 A;  2LS0 1;  1AH9 A;  3CC2 A;  3F2B A;  3J80 L;  2DY7 A;  1PRT B;  5M3M H;  1S3O A;  1MSH A;  1EIH A;  5CV5 A;  1BR9 A;  4BBR H;  1I4G A;  2PNR C;  4JI2 L;  2XRQ D;  3VA5 A;  1LTG D;  4A75 A;  1JWU D;  3SVM A;  2PW5 A;  1U5K A;  1TS2 A;  5IGB A;  2C35 B;  4XT1 B;  5ELE A;  5A2Q L;  3EFX D;  4HJ9 A;  2NVQ B;  4C1N I;  4DUZ L;  1TWA H;  2BH8 A;  1O80 A;  3K6O A;  5C44 B;  3DEP A;  1D6E C;  2R7Z G;  4X3T A;  3H0G G;  3T51 B;  2JE6 I;  2RA4 A;  2YU9 B;  1GUO A;  4B9W A;  1VQ9 A;  1GUW A;  2HHH L;  3VR6 A;  4DR5 L;  3GDE A;  4OON A;  2PZU A;  4DR7 L;  1L1O A;  1Q12 A;  4QJF A;  5CBA E;  1STY A;  3MFG A;  5FO9 B;  2FMM A;  3DM3 A;  3M85 A;  1J8I A;  2EY2 A;  3PGZ A;  1GJX A;  4IUU A;  3Q23 A;  3HOX H;  4N9T A;  2EIF A;  1WTO A;  2R92 G;  3CCL A;  4KD4 A;  3PUY A;  1BDO A;  5LMN W;  1NNX A;  1FR3 A;  5CV8 A;  5K36 H;  1EY4 A;  1PH8 A;  4RHS A;  3HG9 A;  4H0L C;  4FF2 A;  1WTP A;  1KAW A;  1G6Z A;  1NY4 A;  4X66 L;  4YWL A;  2R93 H;  3S1R B;  1UNS A;  3OIQ A;  2UXC L;  2JA8 H;  1PZK D;  3S24 A;  1QG7 A;  2CW0 D;  2PI2 A;  4N8F A;  4K2L A;  5FLX E;  4GLX A;  3GTL B;  3J7Z C;  3CQZ B;  1IW7 D;  1LT6 D;  3H91 A;  1CUK A;  3M4P A;  3K59 A;  5IP7 G;  1XJV A;  3A8I E;  1A3T A;  5JJI A;  1F9Q A;  4OIK A;  1H9K A;  3GTQ B;  3S15 H;  1EEI D;  2K28 A;  1TY0 A;  4I7Z C;  1YNJ C;  3NTK A;  4K0K Q;  4RH6 A;  2AHO B;  4ZQ3 A;  1K0S A;  3HOU B;  3HOV B;  4BY7 G;  3OW7 A;  5G3L D;  1OTC A;  1V1Q A;  2Q2I A;  4P75 A;  2HUG A;  2B2T C;  2IX3 A;  1JOR A;  1VQF A;  1YHA A;  3GTG B;  3GQB A;  1QZG A;  4K14 A;  4JI6 Q;  1RD9 D;  2CFM A;  1E1O A;  2AUK A;  1X3G A;  3Q0A A;  4N8X 1;  4NXM Q;  1SFO H;  3GTO H;  2WAQ G;  2BDN A;  2SDF A;  2JA7 B;  1VDZ A;  1CSP A;  2OTJ A;  1E24 A;  4FF1 A;  1EYC A;  5KIX A;  4DR2 Q;  4M8A A;  1NE3 A;  4PZ8 A;  1ASY A;  3CC4 A;  3K0Y A;  4NPS A;  2A68 C;  2EY1 A;  4C3J H;  2L1B A;  3UDG A;  1QVG A;  3RZO B;  1ESF A;  2B2Y C;  1IXR A;  5EAY A;  5HUR A;  4GOP B;  1LM0 A;  2HCI A;  4DV6 Q;  3CMA A;  2EOT A;  4Y7N B;  1WD0 A;  2YTX A;  3ZYY X;  4ZYS A;  4QGU A;  3CAM A;  1J5E Q;  4KI0 A;  1STA A;  3S17 B;  2KVM A;  3CW2 C;  4K5W A;  1RHP A;  4B9X A;  1BCP B;  4FF4 A;  2R7D A;  3S1Q H;  1H9S B;  1H9M A;  4A3M G;  3MEH A;  1B7Y B;  1I5F A;  3LGJ A;  5ELC A;  3RR5 A;  3PO2 H;  1KIX A;  2CKZ B;  4KLK A;  3FRP B;  5FO7 B;  2L11 A;  4B3T Q;  2A6H D;  4KK7 A;  3FPP A;  3RUZ A;  3ND8 A;  4KHZ A;  2LKV A;  2HQL A;  2I46 A;  2XVS A;  2DNE A;  3TZD A;  4P71 A;  3A54 A;  1IL8 A;  3TP7 A;  2ZTD A;  2JSO A;  2OWO A;  1JOQ A;  5BN5 A;  1KTK A;  1FJG Q;  3KBX A;  4P72 A;  1WCM H;  4K0K L;  5KYI A;  4XQN A;  1AZP A;  1B50 A;  1K83 H;  3FP9 A;  1H9J A;  4R8I A;  2F0M A;  1NUC A;  3OYY A;  1EWH A;  2QEJ C;  1CT1 D;  2I5H A;  2EZV A;  2BE5 D;  2B2V C;  2E2J B;  1RCV D;  4GS3 A;  3S2D B;  4L5T A;  1E0B A;  3BDL A;  1T5E A;  2VQF Q;  4JI6 L;  2FXQ A;  2E2D C;  1RTO A;  3M9B A;  4P73 A;  1AEX A;  4NXM L;  1L2F A;  4MN3 A;  2NN6 H;  4JBK A;  2E2I B;  4XYO A;  1ML0 D;  2HCC A;  1N36 Q;  1F9R A;  3NSW A;  4AQY Q;  1S72 A;  4EQN A;  1W6J A;  4DR2 L;  1PZI D;  1HNZ Q;  2ZXR A;  4B3M Q;  1V1P A;  3M4Y A;  1L0X B;  3FEW X;  3D3R A;  3DMU A;  1CSQ A;  2V1C C;  1AW7 A;  4RG1 A;  4QQB X;  1FNU A;  3A56 A;  4DUY Q;  1EZ6 A;  3MTS A;  4EQP A;  1KXL A;  4O2D A;  4DV6 L;  3HOY B;  2KCC A;  5C44 G;  4H13 C;  4JI1 Q;  1J5E L;  1P16 A;  4CKC A;  1QE6 A;  5FKA C;  2YTV A;  3NQT A;  1I3Q H;  3U9O A;  2ALY B;  3VDY A;  4LUZ A;  2HQE A;  4ZAI A;  3TME A;  1JR0 D;  3TN2 A;  3I55 A;  1N9W A;  4GNX A;  1HUN A;  1CHQ D;  1Z9F A;  1SNQ A;  2NN6 I;  4OHJ A;  2ZXP A;  4B3T L;  1JJ2 A;  1WJJ A;  3RLO A;  2Q8R E;  4KY7 A;  3CRL C;  1HA5 A;  3ULL A;  5IOC A;  1HZC A;  1F9S A;  1LYL A;  1BNZ A;  1SNP A;  2N88 A;  1FJG L;  2Q8I B;  1KQS A;  2Z4H A;  3ITP A;  2VXW A;  4OO1 G;  4C3H H;  5JEA G;  4ZUJ A;  1MSG A;  1TU2 B;  1XNR Q;  1Y1V B;  2BH2 A;  2DGY A;  1HZB A;  1MHW C;  2DJG C;  4QMG A;  1D5M C;  2NVT B;  1HCZ A;  2VQF L;  1MIU A;  3AYH B;  1TWH H;  3IFD A;  3KF8 B;  2B63 B;  1IKL A;  3I4O A;  1VQO A;  1I4X A;  1LT4 D;  2QIL A;  5H1S E;  3NTI A;  5CV9 A;  2KED A;  1GVP A;  4Z9C B;  3AEV A;  4A3G B;  2IHE A;  1N36 L;  3NTH A;  4AQY L;  5IYC H;  1HNZ L;  4B3M L;  2DY8 A;  2KA7 A;  5C3E B;  2PQA B;  3BVM A;  4TVA B;  1PV4 A;  4LF4 Q;  3J80 E;  3AFQ A;  2H4O A;  3HOV G;  2MPM A;  2PZT A;  2RHQ B;  2SNS A;  1Q46 A;  4DUY L;  4JK1 C;  3MWY W;  3GV3 A;  4L8J A;  5DLQ E;  1JB7 A;  3F8T A;  5BN3 A;  3M7N A;  1N32 Q;  2PZW A;  1DYQ A;  5EGT A;  4JI1 L;  4R4C A;  2NYZ D;  1UAP A;  2JA6 B;  2L55 A;  5A2Q E;  4ALP A;  1I6H H;  4LF5 Q;  1KAB A;  1JE5 A;  5IT9 E;  2O2L D;  2RBM A;  2MP1 A;  1N33 Q;  1HHV A;  5IGF A;  4EGV A;  4E6I A;  1U4R A;  4CDC C;  5J39 A;  1YNX A;  5IYD H;  1FNV A;  1TT2 A;  2YYZ A;  4YCV A;  2VS1 A;  5FOB B;  3BYT B;  3P1H A;  4R1J A;  4NXN Q;  1U0L A;  2EY6 A;  4WFN 3;  4G7H C;  4LF7 Q;  1SNC A;  1PRT D;  3NBH B;  1SE3 A;  5ELF A;  4QUF A;  1PFM A;  2IHF A;  4R4O A;  1ZYR C;  1EQR A;  4DR6 Q;  3SK5 A;  3A55 A;  1Q8K A;  2NZO A;  4IJL A;  1Q86 C;  1XXG A;  1Q7Y C;  3ULP A;  4A3E H;  1CKN B;  3CHB D;  4IUP A;  1PH1 A;  3NEL A;  3G4S A;  1XNR L;  1DD2 A;  2PCF B;  3KOJ A;  3ERS X;  1B2T A;  2I5M X;  1SE4 A;  5KNC A;  2XIW A;  4A3L H;  1TQO A;  4FXG C;  2OEO A;  3UE0 A;  1ZYR D;  4UP8 A;  3PUW A;  4A93 H;  2AQ3 B;  2N49 A;  1ONL A;  2Z8L A;  1MD2 D;  2KBN A;  4HN7 A;  2F0V A;  3TDQ A;  1O7L A;  2MO0 A;  2K14 A;  1EOV A;  3D6W A;  4RCO A;  1SYG A;  3M3Y H;  4IFD J;  5FLM G;  3K58 A;  4WRD A;  3I4N H;  4JI4 Q;  4N9P A;  4LF4 L;  2QF7 A;  3EQL C;  1CK1 A;  2XGT A;  4J8Q A;  2NVY B;  3FKI H;  2WB1 B;  4BBS B;  1N32 L;  4NW2 A;  3GTJ H;  4JC0 A;  3PO3 H;  3L9A X;  2O5J C;  2K6A A;  4LF5 L;  4IOC A;  1NAP A;  3EN2 A;  1VMC A;  1N33 L;  5GRO A;  4X62 Q;  1HFN A;  2SOB A;  5NUC A;  3D4D A;  2J7Z A;  5I9P A;  1PH6 A;  3RNU A;  1KLG D;  1VF5 C;  4DV3 Q;  4BS9 A;  2WKC A;  1KL9 A;  1SNM A;  1DOK A;  4AYB E;  3GP7 A;  2SEB D;  4NXN L;  2OTL A;  3SR1 A;  4C3I H;  1SSO A;  4LF7 L;  3E9H A;  3V2T A;  1OXU A;  1E7Z A;  3CU7 A;  2FHT A;  5D3I B;  4LF9 Q;  3HOY G;  2A1A A;  1ENC A;  4DR6 L;  5JPM C;  1EIY B;  3BDO A;  4U68 A;  1HH2 P;  1O7Z A;  3WDN A;  5FJ8 H;  4OX9 Q;  1A3U A;  3BU2 A;  1VQJ A;  4HIM A;  5EKI A;  4IOA A;  3I73 A;  2K03 A;  1OXX K;  1XNQ Q;  1EQT A;  1VQ8 A;  1QUQ A;  3S16 B;  5C4X H;  3S14 H;  1ESR A;  1STG A;  3EA6 A;  2K01 A;  4A3I B;  2JQO A;  2NUC A;  1U4L A;  1NR2 A;  4GLV B;  3MA2 B;  3KDF A;  5E4X A;  4KD3 A;  3OSO A;  1JQY D;  2XWB B;  1RKN A;  2F0Q A;  2KHJ A;  2Y0S B;  2Z6K A;  2EY5 A;  2ZTC A;  4DAM A;  5JJZ A;  4HSP A;  1L0Y B;  3M4O B;  2VZA A;  2N8N A;  1L1O B;  5EQ0 A;  3F1Z A;  1BCP C;  2C5C A;  3I70 A;  1GUN A;  4FF3 A;  2QDB A;  1DON A;  2JA5 B;  4JI4 L;  1G6P A;  2RHS B;  1TWG H;  4XDX A;  1NMG A;  2OQ0 A;  4OWW B;  1VQH A;  5I6Y A;  4JVZ A;  4DF7 A;  1RF2 D;  2NTT A;  4LF8 Q;  3SK4 A;  5M3M B;  1MJE A;  3KFU A;  1Y1V G;  3R2I A;  4BA1 I;  3R8B A;  3W5O A;  1FD7 D;  3H0G H;  4DAY A;  4DNR B;  4BBR B;  3WOF A;  1C8C A;  1FGU A;  4HCS A;  1XWE A;  4POF A;  1IBM Q;  2MNA A;  1EUJ A;  3CCU A;  2RSN A;  2CQO A;  1G2T A;  1S5F D;  2DNC A;  4RKL A;  4X62 L;  4DR1 Q;  1O78 A;  3J81 c;  2UUB Q;  2B2W C;  4LUO A;  1TWA B;  1LTI D;  2PO4 A;  4FO2 A;  4A3G G;  4DV3 L;  1EU3 A;  2V4D A;  1JE4 A;  1SMX A;  3FHW A;  4RGT A;  3NWT A;  5IGG A;  2D0P A;  2PYK A;  5DM7 3;  1E1T A;  5C3E G;  4A3D G;  2XNA C;  2IX1 A;  1R4Q B;  3T4A C;  2ENB A;  3S1N H;  3AMU A;  1Q1B A;  1X6O A;  5LMN Q;  2B39 A;  1CA6 A;  5K5P A;  4GLA C;  1CZG A;  2WAC A;  5GAG C;  4LF9 L;  5JJL A;  2LSS A;  2E2H H;  1F2M A;  1D7Q A;  3OIP A;  1K9M C;  3OMG A;  2RKS A;  1XMQ Q;  4QY7 A;  2Z9H A;  1LAB A;  4PG3 A;  2M9V A;  5CMD A;  2JA6 G;  4OX9 L;  3PSI A;  1AFP A;  1XNQ L;  4CDD C;  2CVR A;  3HOX B;  1XPU A;  3FDT A;  4BA2 I;  5J3B A;  3FPU B;  5D3D A;  3NBI A;  1WTH A;  3HEJ A;  3HOW H;  1FVI A;  4KJO A;  1VQL A;  1YZ6 A;  1E2Z A;  4RGM A;  1A2T A;  3W1G A;  4YWM A;  4BXX H;  2VB2 X;  1JOO A;  1LTT D;  4FDB A;  4K8J A;  1WTQ A;  4DV0 Q;  2R93 B;  3N6R A;  4GKJ Q;  4DXF A;  1UE1 A;  4TRD A;  3CPF A;  2JA8 B;  3MC0 B;  4C2M H;  3CRK C;  4OWX B;  3JC6 6;  1LTR D;  3MZ5 A;  1Z7T A;  1G2S A;  2ZM6 Q;  4JI7 Q;  2SNM A;  1EY0 A;  4QCL A;  2F0U A;  2MJ8 A;  5CV7 A;  3SK8 A;  4LF8 L;  3D6C A;  2R7F A;  4HCE A;  3VR4 A;  5IGE A;  2NVX H;  1NMF A;  3J81 i;  1GUS A;  3S15 B;  2L0C A;  1LUZ A;  2E74 C;  4TSS A;  4QF4 A;  3T56 B;  4HED A;  1XPO A;  3RLN A;  5C3X A;  1OXT A;  4X3U A;  1IBM L;  5BR8 Q;  2AMC B;  3E3X A;  4DR1 L;  4LMQ D;  1I4P A;  3DEO A;  4IQZ A;  2UUB L;  1STN A;  4RGN A;  1LAC A;  1VQM A;  1IYV A;  1V1O A;  1D2B A;  3K5O A;  3ZJY C;  2PI2 E;  2N3S A;  1SFO B;  3NUC A;  3GTO B;  1YHB A;  1TKW B;  5LMN L;  5C5L A;  2WB1 G;  4BBS G;  1L0W A;  3PIP 3;  3STB C;  5EPL A;  3T16 A;  2I0Q A;  1XMQ L;  1E2W A;  2K32 A;  3E5S A;  1PYB A;  1SAP A;  4C3J B;  3MXU A;  1ZKO A;  4RA8 A;  2RCF A;  4MIU A;  2NZH A;  1Q3L A;  4KKT A;  4J6H A;  5IYB H;  4L6T B;  5A35 A;  1UE5 A;  2J4X A;  2X69 A;  4DNT B;  1SNO A;  1X56 A;  3QO2 A;  1T5X D;  1MBY A;  4UDU C;  3HKZ G;  4CJ2 C;  2YTY A;  1B3Q A;  5BN4 A;  1NBW A;  2Z6B A;  3J81 L;  1GHJ A;  1EU4 A;  4DV0 L;  2C9O A;  3S1Q B;  2L9H A;  4GKJ L;  3W1B A;  1I6V C;  2X6G A;  4ZK9 B;  3GTK H;  2QW7 A;  4DV7 Q;  1VQA A;  1PH7 A;  5GQO A;  3PO2 B;  1V1P B;  1F2Z A;  3K5M A;  2EYO A;  2UXB Q;  3K81 C;  2K04 A;  3SDZ A;  4POG A;  2ZM6 L;  1BBX C;  5CV6 A;  4JI7 L;  2IL8 A;  3VR2 A;  1PFS A;  4BY1 H;  5CR3 A;  4X64 Q;  2IY5 B;  1M90 C;  3H3V H;  4A3I G;  4XYQ A;  3QR8 A;  2F0F A;  1WCM B;  2DN8 A;  4GZY C;  3SGI A;  1K83 B;  4XQQ A;  5BR8 L;  2F0J A;  4XT3 B;  1EY5 A;  2Y0S G;  1OXS C;  4KKU A;  3BZC A;  2VW9 A;  3A8K E;  4S3S A;  1UUP A;  3KLS A;  4GNX B;  3AU7 A;  2IPK D;  1EFW A;  1VMP A;  5IP9 G;  1ILP A;  2JA5 G;  1D1I A;  1EYD A;  2ZJP A;  5M5X H;  3HKS A;  1YNJ D;  1VQD A;  3RZD H;  3M7G A;  1VQB A;  2CQA A;  4K2K A;  5M3M G;  3W3A A;  2F0O A;  3HGB A;  3URY A;  3D4W A;  1BUV T;  2FJ2 A;  4BBR G;  4PMC A;  2NWG A;  1BXT A;  4Y52 H;  1IYU A;  3Q8D A;  2LXJ A;  2E5L Q;  2A6E C;  2VL6 A;  4LFB Q;  4OGQ C;  2OT2 A;  2ASB A;  2GVB A;  4KV6 A;  4P2C B;  3I91 A;  1B1Z A;  5I9O A;  1S4Z A;  3EIV A;  2B8G A;  3CCM A;  4DV4 Q;  4DR4 Q;  2D0O A;  1TS4 A;  2LMC B;  3K80 C;  4RKB A;  1S5C D;  1JB3 A;  1I3Q B;  1UWV A;  1AE3 A;  4HJ5 A;  3QWN A;  2A68 D;  1HJP A;  4CDE C;  1AZQ A;  4EX5 A;  3KJO A;  4DV7 L;  2KCM A;  1SYF A;  1QWY A;  5JEA H;  3C3L A;  2UXB L;  1K28 A;  4ID6 A;  1ICF B;  1PTO F;  4JBJ A;  1X3F A;  4L5R C;  1TXY A;  5EPK A;  4PQX A;  2VNU D;  1X3Q A;  1QCB D;  3DXJ C;  4X64 L;  3HOX G;  3BVZ A;  2K75 A;  3O13 A;  1DM0 B;  3GTM H;  3SXH A;  5JAV A;  5K36 G;  3VYU A;  2H5X A;  1HTP A;  2K50 A;  3MHB A;  1BF4 A;  2PMZ E;  3KLR A;  4ULL A;  4OL7 A;  4C3H B;  2KOL A;  3SK6 A;  4OWT B;  3LWE A;  1SXT A;  3F2C A;  2XSC A;  1VS0 A;  1UE6 A;  2JP1 A;  3J7A F;  3ERQ A;  4IFD H;  2R93 G;  2JA8 G;  4V19 0;  1YIJ A;  2BOS A;  2CWP A;  4LAA A;  1TWH B;  1F9P A;  1HFG A;  1ZXT A;  5D65 A;  4KY5 A;  4HAE A;  1CZW A;  3G6E A;  2Q2T A;  4DN4 M;  1Y14 B;  3Q6S A;  3KBG A;  1D5X C;  2Q2H A;  4MTN A;  4TQU S;  4IPD A;  1MGS A;  1L1O C;  4JG2 A;  3D8G A;  2XN9 C;  4XQJ A;  1KC8 C;  2F03 A;  3GO5 A;  2E5L L;  2EE1 A;  5ELN A;  3NWS A;  4LFB L;  1PTO H;  3IKJ A;  5CV4 A;  1AN8 A;  3H09 A;  4YHH Q;  5HGT A;  3PCO B;  3CD6 A;  4CKB A;  4DV4 L;  4DR4 L;  4LK1 C;  4IUT A;  1STH A;  3J7A V;  1X55 A;  4V0B A;  1YJW A;  1I6H B;  4IFD I;  3TRZ A;  1XTC D;  1GHK A;  3G71 A;  1HQR D;  4CKE A;  4G7Z C;  2K52 A;  1DOM A;  1LLR D;  3CME A;  2K5H A;  1SN8 A;  5C0X H;  3K5N A;  1I4H A;  1EQV A;  4G57 A;  4CJ1 B;  1IKM A;  2EYF A;  2ID0 A;  1LT5 D;  4A3C H;  4ZCK A;  1WI5 A;  2A69 C;  3AQQ A;  4C3J G;  1ET6 A;  3TP6 A;  3PIP A;  4NKL A;  1KRS A;  3H15 A;  1U9R A;  1WYD A;  4YWK A;  2LFN A;  4EQO A;  1LT3 D;  4IN3 A;  1VQI A;  2F0T A;  2EXD A;  1KDA A;  5I2Y A;  1W2B A;  3R2T A;  4A3E B;  1HR0 Q;  1X3P A;  1LV9 A;  1I50 H;  3OWF A;  1C0A A;  2JJQ A;  4YCU A;  3J81 j;  1Y69 U;  3PO2 G;  5KGU A; 
#chains in the Genus database with same CATH homology
 1XTD A;  4NXN L;  2OTL A;  4C3I H;  1AH9 A;  3CC2 A;  4LF7 L;  2ATW A;  1SRO A;  3E9H A;  3F2B A;  5M3M H;  1OXU A;  1D8L A;  1V9P A;  1E7Z A;  1S3O A;  4GOP A;  1PH5 A;  4GKK Q;  4LF9 Q;  3HOY G;  2A1A A;  4DR6 L;  3MEF A;  2YV5 A;  4R4I A;  4BBR H;  1EIY B;  4JI2 L;  1HH2 P;  4A75 A;  2UUA L;  1YBY A;  3HOU G;  1WCM G;  1U5K A;  5FJ8 H;  4OX9 Q;  3BU2 A;  1A63 A;  2C35 B;  1VQJ A;  4HIM A;  4IOA A;  1MKH A;  3S1R H;  3CCR A;  1OXX K;  3GD7 A;  1E22 A;  4HJ9 A;  1XNQ Q;  1VQ8 A;  1QUQ A;  1QUQ B;  2QEX A;  5C4X H;  4DK6 C;  4DUZ L;  3S14 H;  1K0R A;  1TWA H;  4YHH L;  2BH8 A;  2JQO A;  2LXK A;  1IZ6 A;  5IYB G;  3GTL H;  4GLV B;  3CQZ H;  2R7Z G;  2QA4 A;  3H0G G;  4GN5 A;  3KDF A;  1GD7 A;  2JE6 I;  3PF4 A;  5IWA Q;  1BBW A;  1VQ9 A;  3T1H Q;  2KHJ A;  2HHH L;  4R4T A;  2Z6K A;  4DR5 L;  3GDE A;  2ZTC A;  4OON A;  5IE8 A;  4DAM A;  2JA7 G;  4DR7 L;  2NN6 G;  3GTQ H;  2UU9 Q;  3E9I A;  1LTL A;  2VZA A;  3DLL A;  1R9T H;  1L1O A;  1L1O B;  1Q12 A;  2N8N A;  3F1Z A;  1HZA A;  4L5Q A;  4QJF A;  1VCI A;  3U50 C;  4DPG A;  3DM3 A;  3HOU H;  1JT8 A;  3M85 A;  3ER0 A;  5E7N A;  3HOV H;  4IPG A;  1KHI A;  4JI4 L;  1G6P A;  2RHS B;  1TWG H;  3PGZ A;  1NMG A;  2OQ0 A;  4GN3 B;  5GAD C;  4OWW B;  1PVO A;  1VQH A;  1K8A C;  4XIG S;  1HNX Q;  3HOX H;  2EIF A;  1VQE A;  4LF8 Q;  4BY1 G;  1MJE A;  3CCL A;  2R92 G;  1B70 B;  3PUY A;  5LMN W;  3KFU A;  4OO1 I;  1Y1V G;  4A3J H;  3GTG H;  4DK3 C;  4BA1 I;  3W5O A;  3TQY A;  3H0G H;  1PH8 A;  1X54 A;  3K7U C;  1PH3 A;  1FGU A;  4A3F H;  3K8A A;  1G29 1;  4IPH A;  4POF A;  1Y1W H;  1HZ9 A;  1KAW A;  1WFQ A;  2MNA A;  3RN2 A;  1IBM Q;  1NY4 A;  5FLX c;  1EUJ A;  4ME3 A;  3CCU A;  5JEA J;  2CQO A;  4X66 L;  4YWL A;  3F2D A;  1IBK Q;  2JA7 H;  2R93 H;  1HR0 L;  3WWV A;  4X62 L;  4DR1 Q;  3J81 c;  2UXC L;  2UUB Q;  3BJU A;  3JAM c;  4XTC S;  2JA8 H;  2L15 A;  4LUO A;  5HGQ A;  3S24 A;  4A3G G;  2PI2 A;  1VQ6 A;  4DV3 L;  3FHW A;  1SMX A;  3J7Z C;  4GLX A;  2A8V A;  2D0P A;  1CUK A;  3M4P A;  1YHQ A;  4UY8 C;  1E1T A;  5C3E G;  3RZO H;  4A3D G;  4A76 A;  5IP7 G;  3TS0 A;  3HOZ H;  1XJV A;  2IX1 A;  3S1N H;  5JJI A;  3A0J A;  1Q1B A;  5M3F H;  1X6O A;  3I2Z A;  5LMN Q;  4GKK L;  1A8V A;  1O7I A;  4GLA C;  2JA9 A;  5GAG C;  4LF9 L;  4JOI A;  4Y7N H;  3S15 H;  5JJL A;  1UEB A;  2LSS A;  2E2H H;  4JI0 Q;  1RIP A;  1D7Q A;  1K9M C;  3PIO A;  4K0K Q;  2AHO B;  1XMQ Q;  3B6Y A;  3S17 H;  4QY7 A;  4PG3 A;  3PUZ A;  4QL5 A;  2HT1 A;  2JA6 G;  4X65 Q;  4OX9 L;  4BY7 G;  3PSI A;  1OTC A;  1YEZ A;  4EQ5 A;  2KEN A;  1V1Q A;  2Q2I A;  3NEN A;  4LW1 A;  4P75 A;  3KF6 A;  3KF6 B;  1XNQ L;  3PF5 A;  1XPU A;  1WOC A;  3UE1 A;  3ICE A;  4BA2 I;  2A19 A;  5J3B A;  1VQK A;  1VQF A;  4PMW A;  1VQ7 A;  3M4Q A;  1PA6 A;  1YHA A;  1A62 A;  1JJC B;  2RCN A;  2Z0S A;  1QZG A;  1FVI A;  4JI6 Q;  3HOW H;  2CFM A;  1E1O A;  1X3G A;  1VQL A;  1J6Q A;  5IWA L;  1YZ6 A;  2MQH A;  4NXM Q;  1TWC H;  3D0F A;  4A3D H;  1SFO H;  4UP9 A;  3W1G A;  3T1H L;  4YWM A;  3GTO H;  2WAQ G;  2CWA A;  4BXX H;  3UDF A;  4FDB A;  1Q82 C;  1N8R C;  4DV0 Q;  1CSP A;  1G51 A;  1YI2 A;  1VQ4 A;  1I94 Q;  2UU9 L;  2RF4 A;  4GKJ Q;  2N78 A;  3S1M H;  1UE1 A;  2K5N A;  2OTJ A;  3CPF A;  1E24 A;  1QVF A;  4A3B H;  5FLM H;  5GAH C;  4IJH A;  4A3K H;  4DR2 Q;  4C2M H;  1NE3 A;  4PZ8 A;  1ASY A;  3CC4 A;  5IYC G;  1GM5 A;  1HNW Q;  4OWX B;  4NPS A;  4GNX C;  3JC6 6;  4C3J H;  3I4M H;  3K7A H;  3UDG A;  1QVG A;  2E8G A;  2IX0 A;  2ZM6 Q;  5C0X I;  4JI7 Q;  1IXR A;  1HNX L;  5EAY A;  4GOP B;  2E2J H;  4WJ4 A;  5HY6 A;  2OQK A;  4LF8 L;  2HIV A;  1LM0 A;  4DV6 Q;  1JMC A;  2R7F A;  2MFI A;  3CMA A;  2NVX H;  1NMF A;  1SRU A;  3CP0 A;  3J81 i;  4LFC Q;  3S2D H;  4DNI A;  4UP7 A;  2YTX A;  1H95 A;  3JAM i;  1LUZ A;  3UDI A;  2ZTE A;  4QGU A;  3J81 j;  3CAM A;  5C0X J;  1K73 C;  1XPO A;  3RLN A;  3CCQ A;  1J5E Q;  2VUM H;  3S2H H;  4KI0 A;  1OXT A;  3CW2 C;  1BBU A;  2F52 A;  1IBM L;  5BR8 Q;  2AMC B;  3TS2 A;  2E2I H;  3CF5 A;  1IBK L;  2R7D A;  1V43 A;  3S1Q H;  4DR1 L;  1GKH A;  3TEH B;  2UUB L;  4A3M G;  1QVC A;  1B7Y B;  1I5F A;  3LGJ A;  3J80 c;  1HNZ Q;  4IFD G;  3RR5 A;  3KDF B;  3L0O A;  1VQM A;  3PO2 H;  1KIX A;  5IYD G;  2CKZ B;  4KLK A;  4YY3 Q;  4B3T Q;  3ZJY C;  2PQA A;  2PI2 E;  2N3S A;  4KHZ A;  4HJA A;  4HIO A;  3BZK A;  2HQL A;  1YHB A;  2KCT A;  1C7Y A;  3HOY H;  4P71 A;  5LMN L;  3A5Z B;  2ZTD A;  1GO3 E;  2WB1 G;  3E0E A;  2OWO A;  4BBS G;  3UDX A;  5IT9 c;  1L0W A;  1FJG Q;  4JI0 L;  3STB C;  1K8G A;  4P72 A;  1WCM H;  3CC7 A;  2I0Q A;  4K0K L;  1K83 H;  3FP9 A;  1XMQ L;  5JJK A;  1PYB A;  2MO1 A;  1N34 Q;  4LWC A;  3OYY A;  4X65 L;  5ELO A;  1XMO Q;  4YCW A;  4R4Q A;  2I5H A;  5AJ3 Q;  2NZH A;  4GS3 A;  3PV0 A;  5IYB H;  2R7Z H;  4L5T A;  4DAY B;  5IY0 A;  1X9N A;  1UE5 A;  2VQF Q;  2ES2 A;  4JI6 L;  4LFA Q;  1X56 A;  4JI3 Q;  1PH9 A;  3GTP H;  1E3P A;  2FXQ A;  2B63 G;  1PYS B;  3M9B A;  4P73 A;  4DV5 Q;  2JEB I;  4P74 A;  1L2F A;  4NXM L;  3CXC A;  2JEA I;  1JJG A;  5LMU Q;  2JK8 A;  3HKZ G;  2YTY A;  1NBW A;  4DV2 Q;  4A93 G;  1VQN A;  4JBK A;  1KRT A;  4DV0 L;  3U4Z A;  1I94 L;  4GKJ L;  4JYA Q;  3W1B A;  1N36 Q;  3ULJ A;  4AQY Q;  1S72 A;  3GTK H;  1PH4 A;  4DR2 L;  5C0X G;  4PZ6 A;  1VQA A;  4DV7 Q;  1PH7 A;  1Z47 A;  5GQO A;  1PH2 A;  1SR3 A;  1NJI C;  4B3M Q;  1HNW L;  2UXB Q;  1C9O A;  3K81 C;  1CSQ A;  2V1C C;  2D62 A;  4RG1 A;  4POG A;  2ZM6 L;  3I4N G;  4QQB X;  4JI7 L;  4A3C G;  4DUY Q;  1XPR A;  1PFS A;  4BY1 H;  2R92 H;  1T9H A;  1KXL A;  1Y1V H;  4X64 Q;  2VY3 A;  3U58 A;  2IY5 B;  4O2D A;  2DUD A;  4RMF A;  4DV6 L;  1M90 C;  3OW2 A;  2NVT H;  3FKI G;  3H3V H;  3K0X A;  4LUV A;  4LFC L;  1YJN A;  2QGQ A;  4A3I G;  4DKA C;  5C44 G;  2CCZ A;  3EBE A;  1MJC A;  3J80 i;  4MNO A;  4JI1 Q;  2VQE Q;  4X6A H;  2B63 H;  1J5E L;  1Q1E A;  1YIT A;  1P16 A;  3SGI A;  3PO3 G;  1IBL Q;  2YTV A;  3T1Y Q;  1VQG A;  5BR8 L;  4JBM A;  1I3Q H;  2Y0S G;  2ALY B;  1OXS C;  3VDY A;  3BZC A;  4LUZ A;  2VW9 A;  4H02 A;  3CCE A;  4B3R Q;  4AYB G;  1HR0 W;  4A3G H;  3I55 A;  1N9W A;  4GNX A;  4GNX B;  2UUC Q;  4IPC A;  1EFW A;  4O0A A;  3RLF A;  1Z9F A;  4L5S A;  5IP9 G;  2NN6 I;  5C3E H;  1VQC A;  5IP7 H;  4JI8 Q;  3U4V A;  4YY3 L;  2JA5 G;  4B3T L;  2ZJP A;  1JJ2 A;  1WJJ A;  3RLO A;  5M5X H;  3HKS A;  1VQD A;  3RZD H;  1VQB A;  2XTI A;  3L7Z C;  3ULL A;  1HZC A;  5M3M G;  4LF6 Q;  1LYL A;  4JV5 Q;  4DR3 Q;  1FJG L;  4MZ9 A;  1KQS A;  3RN5 A;  3A5U A;  4BBR G;  2JA6 H;  5GAE C;  4BY7 H;  4HJ8 A;  1ASZ A;  4Y52 H;  4OO1 G;  4C3H H;  5JEA G;  3Q8D A;  2LXJ A;  2R6G A;  5M5Y H;  5FJ8 G;  1XMO L;  1N34 L;  2E5L Q;  4JI5 Q;  2VL6 A;  3AFP A;  5AJ3 L;  4DV1 Q;  1M1K C;  4LFB Q;  1SLJ A;  5C4J H;  1X65 A;  2AKW B;  2ASB A;  2GVB A;  4HID A;  1XNR Q;  2BH2 A;  3TRE A;  2DGY A;  1TWF H;  1EQQ A;  3L2P A;  1HZB A;  1YJ9 A;  5C4X G;  3EIV A;  3IRB A;  3CCM A;  4DV4 Q;  2VQF L;  4DR4 Q;  1MIU A;  2AWO A;  4LFA L;  4JI3 L;  3AYH B;  1TWH H;  1RL2 A;  2D0O A;  3KF8 B;  4DV5 L;  3K80 C;  3I4O A;  4PZ7 A;  1VQO A;  2HIX A;  5H1S E;  5LMU L;  4IO9 A;  4DV2 L;  1UWV A;  2K4K A;  1AE3 A;  3D31 A;  4HJ5 A;  1IL2 A;  1GVP A;  3AEV A;  1HJP A;  4JYA L;  4B3S Q;  2IHE A;  1N36 L;  2WAQ E;  4EX5 A;  3KJO A;  4AQY L;  5IYC H;  4HJ7 A;  2KHI A;  3OTO Q;  1VQP A;  4DV7 L;  1HNZ L;  4B3M L;  2KCM A;  2UXB L;  2PQA B;  4TVA B;  1PV4 A;  4LF4 Q;  2UXD Q;  3HOV G;  3AFQ A;  2RHQ B;  1X3F A;  4JBJ A;  4L5R C;  1Q46 A;  4DUY L;  2B3G A;  1TXY A;  3KJP A;  1BKB A;  2VNU D;  2ZJQ A;  5DLQ E;  1JB7 A;  4X64 L;  3HOX G;  1VQ5 A;  3PO2 G;  3F8T A;  3M7N A;  1N32 Q;  2K75 A;  2GVA A;  3GTM H;  1BVS A;  4A4I A;  4KHP Q;  4A3J G;  4GOP C;  4JI1 L;  4R4C A;  2VQE L;  5K36 G;  2F3I A;  2WP8 J;  1UE7 A;  2H5X A;  2K50 A;  4ALP A;  4A3F G;  2PMZ E;  1I6H H;  4LF5 Q;  1IBL L;  3A74 A;  1JE5 A;  3G48 A;  3T1Y L;  1Y1W G;  2PNH A;  4OWT B;  1N33 Q;  4A3E G;  3F2C A;  3CCJ A;  1VS0 A;  3I56 A;  3CCS A;  4A3M H;  1UE6 A;  4B3R L;  2R93 G;  2Q2U A;  1CKO A;  2F4V Q;  1YVC A;  2UUC L;  1YNX A;  2JA8 G;  3J7A 5;  1K3R A;  2K5V A;  2YYZ A;  4YCV A;  5IYD H;  2VS1 A;  2BA1 A;  4A3L G;  1YIJ A;  4R1J A;  2CWP A;  4JI8 L;  1EYG A;  4NXN Q;  1U0L A;  3PUX A;  3STB D;  4LF7 Q;  2NVY H;  3NBH B;  3HOZ G;  5M5W H;  2Q2T A;  1IYJ B;  2IHF A;  4R4O A;  3G6E A;  4BBS H;  3KLW A;  1EQR A;  2Z6K C;  1Y14 B;  5M3F G;  4LF6 L;  4JV5 L;  3MXN B;  4DR6 Q;  2Q2H A;  1P8L A;  4MTN A;  4DR3 L;  4JCV E;  4TQU S;  4IPD A;  4JI2 Q;  2EQS A;  1Q8K A;  3CPW A;  1L1O C;  4JG2 A;  1Q81 C;  2UUA Q;  3NEM A;  2NZO A;  2WB1 E;  1DGS A;  4IJL A;  4AH6 A;  1KC8 C;  3GO5 A;  1Q86 C;  2E5L L;  1Q7Y C;  4JI5 L;  5ELN A;  3CCV A;  4OXP A;  3ULP A;  4A3E H;  4DV1 L;  1CKN A;  1CKN B;  4LFB L;  2ZJR A;  1PH1 A;  4DUZ Q;  3NEL A;  3G4S A;  1XNR L;  4YHH Q;  3KOJ A;  3PCO B;  3ERS X;  3CD6 A;  2I5M X;  4WJ3 M;  1SE8 A;  4DV4 L;  4HIK A;  4A3L H;  1OXV A;  4QIW E;  4DR4 L;  1AE2 A;  2AWN A;  3HOW G;  1CKM A;  1NTG A;  3UE0 A;  1X55 A;  1YJW A;  4UP8 A;  2HHH Q;  4NB3 A;  3TRZ A;  4IFD I;  4DR5 Q;  3PUW A;  1EIF A;  4APV A;  2N49 A;  1S40 A;  4A93 H;  4UPA A;  4GN4 B;  3G71 A;  1PHJ A;  4DR7 Q;  4BXX G;  2K52 A;  2KBN A;  3CME A;  2K5H A;  1X3E A;  1SN8 A;  4B3S L;  2GN5 A;  3I7F A;  2MO0 A;  4LNQ A;  2K14 A;  1EOV A;  3HKZ E;  4J15 A;  3M3Y H;  4IFD J;  3OTO L;  4A3B G;  5FLM G;  1B8A A;  4A3K G;  2ID0 A;  2IT1 A;  3I4N H;  4JI4 Q;  4LF4 L;  4A3C H;  2UXD L;  1WI5 A;  3I4M G;  3AQQ A;  2OCE A;  2NVQ H;  2XGT A;  2BA0 A;  3S16 H;  3FKI H;  3PIP A;  1QZH A;  1FL0 A;  4A3I H;  4JBW A;  1EWI A;  3KYH C;  1KRS A;  5C44 H;  3GTJ H;  3H15 A;  1N32 L;  4KHP L;  1WYD A;  4JC0 A;  2WFW A;  3PO3 H;  4YWK A;  2YU9 H;  1A0I A;  4JOI C;  2I5L X;  1VQI A;  3PUV A;  2VUM G;  4LF5 L;  2EXD A;  3H3V I;  1KD1 C;  4IOC A;  3EN2 A;  1W2B A;  4X66 Q;  1N33 L;  1HR0 Q;  5GRO A;  4X62 Q;  3M4O H;  2UXC Q;  1I50 H;  1W3S A;  4AIM A;  2F4V L;  1PH6 A;  2JJQ A;  1C0A A;  3RNU A;  5IP9 H;  2Y0S E;  4DV3 Q;  2JA5 H;  2B29 A;  3HFZ B;  4YCU A;  1KL9 A;  4AYB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...