3CC23

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cc2300
2QEX3 1W2B2 1YIT3 3CCM3 1N8R4 1K9M4 1YIJ3 3CMA3 1K734 3I553 3OW22 3CCE3 1VQM3 3CC23 3CCU3 3CCV3 3CPW2 1VQP3 2OTL3 1VQ43 1K8A4 1YJ93 1NJI4 1S723 1YJN3 1KD14 1VQL3 3CCQ3 3CC43 1JJ22 3G4S3 1QVF2 3CCS3 2OTJ3 1M1K4 3CME3 1VQN3 1VQ53 1KQS2 1VQ83 1Q7Y4 1YI23 3I563 1Q824 3CC73 1VQ73 1M904 3CCJ3 3CD63 1VQ63 1QVG2 1VQO3 3G6E3 3CCL3 1VQK3 3G713 1Q814 1KC84 1Q864 1YHQ3 1VQ93 3CXC2 2QA43 1YJW3 3CCR3
chains in the Genus database with same CATH superfamily
1W2B2 5BU4A 4HZ9B 2KF5A 1AVLA 1AVKA 1W2ZA 3D79A 1RCKA 1N8R4 4XBXA 3EF8A 5G2GA 2XF3A 5JPUA 1EEJA 1O7HB 1TUHA 1VQQA 3CC23 1OPYA 1BSEA 4LGQA 1ZS7A 3X42A 2OOVC 2OTL3 1D6YA 3U97A 3NHXA 1HZ1A 2HMNB 2GEYA 4BL3A 2O9UX 3EX9A 3GZYB 4NHFA 1JJ22 7STDA 4ILFA 3CNMA 2BMQB 2B24B 1B20A 2Q07A 4HM3B 1IDPA 3ALAA 4KT3B 4HM2B 1STDA 3DMCA 3SXXA 5IEOA 1VQK3 3JUMA 3G713 3WDGB 1TIJA 2R4IA 3GSPA 3CCR3 1A2KA 3FKAA 2ML6A 3KCHA 3CCM3 7RNTA 1YIJ3 3FF2A 1K734 2CG1A 3G0KA 1I2EA 2BO9B 1V58A 1DETA 3A5EA 4X2OA 1DVCA 2KXGA 2J8XB 1JZDA 2BIRA 3ECFA 1GOVA 3L0RA 4FMBA 2IMJA 7GSPA 1BRKA 4J9AA 2RFRA 1LXEA 1I2FA 1SIIA 1SJWA 1GY5A 2F56A 3LMLA 3RDEA 3B7CA 3EN8A 3J7Yd 1C54A 1GD3A 3G16A 1A90A 4J5KA 5IG4A 1VQO3 1T3BA 2HOHA 6STDA 1KC84 2QIYA 4HM4B 2F99A 5IG0A 3CXC2 3NBJA 3F8HA 1G02A 3DGMA 1JB5A 3VGNA 3FH1A 4N6MA 3QK9A 1B2UA 3WR2A 3LTDA 4OUQA 4HM8B 4FMDA 1UUWB 3TDGA 5EEOA 1J2BA 1AY7A 1RGGA 1JNQA 4MMZB 2WOHA 2ZL8A 1NU3A 5EVHA 1JBSA 3DGNA 5AI1A 1M9GA 3E99A 1IV9A 3BNCA 1I8VA 1GOUA 5IEPA 4O8SA 5FW5A 1I2GA 1BIRA 3NX0A 2WGOA 3LTBA 1RHLA 1RGCA 3HZPA 2M7OA 1LQGC 2RBIA 4K1VA 1S5AA 4WYKB 5CF1A 2HMMB 1BNJA 2Z77A 1HU9A 4CJNA 1UUGB 1IT7A 1UI8A 2KF4A 4FCZA 4HVNA 5EQLA 5D82A 3HI7A 1E97A 1NB3I 2IUJA 2CFGA 1RRHA 1E3VA 1T5YA 2GBXB 1MWSA 1YGEA 2OWPA 1N5HA 3UL5A 3URPA 1YIT3 2CFKA 1OHPA 1UCJA 4K90B 1O7PB 3OW22 1VQM3 1D6ZA 2HMJB 3LT9A 4O2HA 2OQEA 3RGRA 1GSPA 1VQP3 2CK3H 4R4KA 2P05A 4LYLB 1LOWA 3S67A 4ORLA 1NJI4 4K61A 2UX0A 3B4OA 3DY5A 3X3YA 4N6LA 1JKGB 2BMOB 3MG3A 1O7WB 3CC73 4EV5A 3CCJ3 1K28A 1RSNA 4FCMA 2IYJA 1JB4A 1VQ63 3HK4A 3AHWA 1RGKA 3SOYA 3N9HA 3AHSA 4ZM8A 3FSDA 5JBSA 4N6TA 3Q1CA 3SYUA 2GSPA 3CU3A 4HM5B 1AQZA 3GZXB 1JRQA 3Q90A 4I5QA 4RZMA 1RNTA 3VSYA 2B1XB 1JB2A 3MG1A 1BRHA 2RGQA 4TX4A 3DGOA 1Z1SA 1BAOA 4NPBA 5IG5A 1K8A4 3FG1A 2W9PA 2WO0A 1PYLA 1WMPA 2OQEC 1NNVA 2IA7A 1W4NA 2A15A 1NB5I 3AGNA 3A76A 2I9WA 3EN1B 4EYCA 3FCSB 1UW1A 2CFLA 3FF0A 1BNIA 3GZBA 3PCRA 4KFDA 4MMXB 1FW7A 2W2CA 3WMDA 5IERA 1IT8A 2CC3A 4JF8A 2BT3A 1B2SA 2W56B 4R80A 1RNBA 1LNHA 5LC7A 3F7XA 1BOXA 2GEXA 1I0VA 4H61A 1N5PA 1Q9EA 5D83A 2QA43 4KFEA 4GB5A 5D81A 2FXTA 4HM7B 3DGYA 1FGQA 2XSOB 3B4PA 5JPPA 1BUQA 3MSOA 1T2IA 3D9RA 4EBGA 3CCE3 2F5WA 1BNRA 2Z76A 2E2UA 3SEDA 2HMLB 1TFOA 1ZGXA 2K54A 1YJN3 4HAAA 4WHAA 3IJEB 2ZDJA 3KSED 3NM7A 4WYKA 3EB8A 3OWYA 1BNEA 6GSPA 2O3OA 1DVDA 5RNTA 5CK6A 1NDOB 1A67A 2H0GA 3LTAA 4CDLA 1WMOA 1EKMA 3SVAA 4OK0A 4FR9A 1PY3A 4QWTA 1EUIC 3H51A 1R4CA 3K0ZA 1K9M4 3BU4A 1O7MB 3DUKA 9RNTA 1JZOA 2H0HA 2ZA4A 1IVUA 1RLSA 3KKGA 1Y4KA 3NM2A 1B2ZA 1MNLA 3K9MC 4H3UA 1Q40B 4IIAA 2IY2A 2XFTA 2IUKA 3N54B 3EBYA 5CXOA 2AADA 2CH9A 5HGRA 1GY6A 3EE1A 1VQL3 1UUVB 1JKGA 2BHMA 4HOHA 1ZO2A 4XBTA 1BRJA 5DREA 3T8NA 3CCS3 1FUSA 2BNGA 3FZWA 5DRVA 1IVWA 3DH2A 1HKXA 3FG4A 3NUVA 5LC6A 1DE3A 3OWSA 2BU4A 1C7HA 2WOFA 3IPTA 2OCTA 1D6UA 3G8ZA 4XDWA 3K7CA 3T8UA 1W6GA 3V99A 3JVCA 1RTUA 1PFPA 3BNBA 1TJDA 4GHOA 1CYVA 1IQYA 1OACA 3LH4A 3MWZA 1B3SA 4AKZA 2RNTA 4RNZA 4L8OA 1BUJA 3KE7A 3LT8A 3LOYA 1M1XB 1OGXA 3MG2A 3AMOB 2LQVA 3F7SA 1BRGA 5AIGA 3U1WA 1A2VA 3G4S3 2AAEA 2HMOB 1ISKA 1V57A 1A2PA 2XRXB 1RN4A 1SIHA 3SLUA 2KRTA 3RNTA 1ROVA 4EV2A 2W56A 3NBBA 3PYJA 5STDA 3MPHA 1GMQA 2W0QA 3F9SA 1FA3A 1WMNA 3D4AA 3HIGA 1Q864 5G1LA 1WTHA 4GL6A 1TU5A 2CX1A 2W03A 1NO3A 4MEIA 1NWWA 2UUGC 2YFIB 3QRDA 1OGZA 4R1KA 1IK3A 1IVVA 1BSBA 1EG9B 1T2HA 1I70A 2MC8A 4N3VA 1OF5B 1VQ43 2UGIA 3MKIA 1BSCA 1EA2A 3OXAA 3D5GA 5G1KA 2OTJ3 1DMNA 1LOYA 1I3FA 2RSXA 4K1UA 4LMIA 1TP6A 3CME3 3UNLA 3I0YA 1Q824 1WQLB 3LTCA 1RGLA 1UDII 3UJMA 4HJLB 3CCL3 3OWUA 3IMAB 3FGYA 1YHQ3 3K5TA 3Q2PA 3KN4A 1YJW3 4BTWA 1KSIA 2JQ5A 3EQQB 1QJGA 2C11A 3GWRA 1W6CA 3F14A 4BIRA 1TTOA 1BNFA 2D1WA 3JUQA 1FGMA 2CX0A 3BLZA 2FNQA 3CPW2 1Q40A 3WA3A 4EW5A 3GZRA 5M18A 1BU4A 3S5CA 1MWUA 3LYGA 2SARA 4O3VA 2KAAA 3LZAA 3DZLA 1MWTA 4RNTA 2CG0A 4X2HA 1TFKA 5AYRB 1DYUA 2Y73A 2KCDA 4LSOA 1VQN3 1VQ53 2WGQA 1R4YA 2C4BA 2RCDA 4HM0B 5ELJA 1FUTA 4HM1B 4AKYA 1M904 2CFWA 1SPUA 1G0TA 3MHEA 3G6E3 3FLJA 5AIHA 1CH0A 5HOHA 3PXMA 1RKYA 1FGTA 2V1LA 1YVSA 4XM4A 1K41A 1JN5B 2CWVA 4Q53A 1OHSA 5IENA 1BRIA 5A0OB 1ASKA 8CHOA 1FUWA 3EC9A 2PNCA 2PZVA 1X1XA 1YVBI 3AMOA 3NQYA 1U5OA 5AEUB 3JUOA 3N8BA 1U8CB 1RJOA 1UCIA 2FGTA 4BTYA 1ZX2A 1B2XA 3BNEA 4XBYA 1GOYA 2Y74A 2F5MA 5IF6A 3LXUX 1Q7Y4 1IV7A 3DGLA 3NV0B 3WODG 1VQ73 1O7NB 3D3LA 2Z6BA 5TGNA 3WOFB 4IT7A 1AV4A 4HM6B 1W01A 1Q7HA 1L5GB 1BVIA 1OHOA 2P38A 1ROAA 2QEX3 3ER7A 5CF2A 1W7CA 2P09A 3JUNA 1G96A 3KZTA 4MMYB 3CMA3 4BL2A 8RNTA 5KP1A 2GBWB 4FCJA 1OF5A 3CCU3 4WP5A 4KFFA 1N9JA 1W5ZA 1RDSA 2H0IA 3EHCA 4JRFA 1BSDA 2W04A 4PEJA 2E2TA 4FMCA 4IPBA 1W02A 1GMPA 4CCVA 1BANA 1QMAA 4CPKA 2F98A 1BNGA 1RN7A 2R41A 2GU1A 4FMAA 5ELUA 5FGOA 1IVXA 2GU3A 1STFI 1MGRA 2BMRB 4AEQA 4EXRA 5IW9A 1RGFA 4BTXA 3HIIA 3KIIA 5BIRA 1YI23 1LRAA 1X1YA 3ROBA 3T0UA 1GYBA 2HMKB 1GD4A 2INXA 4XB5A 2STDA 1VZZA 5I97A 4I4KA 2YFJB 1N8QA 1Q814 2W6JH 1BRNL 3OV4A 3HOHA 3WOEB 2CKFB 5AIFA 3UL6A 4XDVA 2P0XA 2K3DA 4DKIA 3NQZA 1QAKA 3S29A 3EJVA 3I553 5M1AA 3AGOA 3CCV3 1GY7A 2CFDA 5AIIA 3F40A 1RRLA 3PS8A 1B27A 5AYSC 1YJ93 3O8YA 3ZG0A 3X40A 4OVMA 1ULJB 1KD14 1QAFA 3D5IA 3CCQ3 1B21A 5CLKA 1US1A 2LYXA 3Q3FA 3S27A 3ZFZA 1UGHI 4STDA 3V98A 3UB1A 1RGHA 4HKVB 1RGEA 3GRDA 4N6OB 4GSPA 1ULIB 1GMRA 1IQ8A 4R9LA 2CW9A 3BIRA 1RMSA 1FZUA 1I0XA 1W00A 1KWIA 1SQWA 3CNXA 1YNVX 1LVNA 1JN5A 2XGLA 4WFOA 3X41A 1FGOA 3BNDA 4NREA 6RNTA 4G1MB 2XR8B 3V92A 2CWTA 1MWRA 4HZBB 1RGAA 3VF1A 1GS3A 3PGBA 3JUPA 3BB9A 1RN1A 3DXOA 3ZG5A 5GSPA 3H3HA 3CPOA 3CC43 1QVF2 4WWUC 3STDA 5M19A 1CEWI 1OH0A 1LNIA 4LEHA 2P0MA 1WNHA 3KSPA 3NV0A 3RGAA 1MGWA 2Z7AA 3F8XA 3X3XA 3I563 1JBTA 4N6UA 3NBRA 1BRSA 3EBTA 1BGSA 3NXJA 2L1SA 1LOVA 5BXQA 4HYZA 5BVBA 2SBLA 4U13A 1JBRA 4BU4A 1FGRA 2JDIH 2L4VA 2XEPA 1BNSA 2F86B 2KF6A 2ZHXB 1W6YA 4J5GA 5KP4A 1B2MA 1OCVA 3HX8A 3K63A 2YFLB 3S28A 2F4YA 4LZIA 2XFSA 1UCKA 2XH9A 1IYYA 1CQSA 2CHCA 4HBRA 3M8CA 1UI7A 5AEWB 2CWUA 2ML5A 4L7KA 5KP3A 1OUNA 1UCLA 2XSHB 3PZWA 4RBNA 5IG3A 1M1K4 1KQS2 2E2VA 1VQ83 1SARA 2D42A 4MJDA 3WA2X 3WHOA 2C10A 3B8LA 3GAXA 1TRQA 1QVG2 3DM8A 4EC6A 1LQMB 1VQ93 4O02B 1O7GB 2YX9A 1RCLA 4L8PA 4N6NB 2OOVA 1DMMA 1PU4A 1IQXA 1LOXA 2MF7A 3MYTA 4J8TA 3KFQC 1Q42A 1AR0A 4R9KA 2CIUA 1JV2B 1N9EA 1I3IA 4KVHA 1S723 3SOAA 3FG3A 1X1WA 2KF3A 3SX1A 1IU7A 2QGUA 1V74A 1UGIA 1QALA 2K0MA 1EQKA 2GXFA 4KZ1A 3OX9A 1F8NA 3PCSA 4N6V0 1BSAA 3CD63 1FYSA 3X3ZA 1DMQA 2W9QA 4RNYA 2XGNA 1E3RA 1MOLA 1HYFA 1CYUA 1TRPA 1X1UA 1YGWA
chains in the Genus database with same CATH topology
1W2B2 4HZ9B 1AVLA 1AVKA 1W2ZA 1N8R4 4XBXA 3EF8A 5G2GA 2XF3A 5JPUA 1O7HB 1TUHA 3CC23 1OPYA 4LGQA 3X42A 2OOVC 2OTL3 1D6YA 3U97A 3NHXA 2HMNB 2GEYA 2O9UX 3EX9A 3GZYB 4NHFA 1JJ22 7STDA 3CNMA 2BMQB 2B24B 4HM3B 2Q07A 1IDPA 3ALAA 4HM2B 1STDA 3DMCA 3SXXA 5IEOA 1VQK3 3JUMA 3G713 3WDGB 1TIJA 2R4IA 3CCR3 1A2KA 3FKAA 2ML6A 3CCM3 1YIJ3 3FF2A 1K734 2CG1A 3G0KA 2BO9B 4X2OA 1DVCA 2KXGA 3ECFA 3L0RA 4FMBA 2IMJA 4J9AA 2RFRA 1LXEA 1SIIA 1SJWA 1GY5A 3J7Yd 3LMLA 3RDEA 3B7CA 3EN8A 1GD3A 3G16A 1A90A 1VQO3 5IG4A 6STDA 1KC84 2QIYA 4HM4B 2F99A 5IG0A 3CXC2 3NBJA 3F8HA 3DGMA 1JB5A 3VGNA 3FH1A 4N6MA 3QK9A 3LTDA 4OUQA 4HM8B 4FMDA 1UUWB 3TDGA 5EEOA 1J2BA 1JNQA 4MMZB 2WOHA 2ZL8A 1NU3A 5EVHA 3DGNA 5AI1A 1M9GA 3E99A 1IV9A 3BNCA 5IEPA 4O8SA 5FW5A 3NX0A 2WGOA 3LTBA 3HZPA 4K1VA 2M7OA 5CF1A 4WYKB 1S5AA 2HMMB 2Z77A 1HU9A 1IT7A 1UI8A 4FCZA 4HVNA 5EQLA 5D82A 3HI7A 1E97A 1NB3I 2IUJA 2CFGA 1RRHA 1E3VA 1T5YA 2GBXB 1YGEA 2OWPA 1N5HA 3UL5A 1YIT3 2CFKA 1OHPA 4K90B 1O7PB 3OW22 1VQM3 1D6ZA 2HMJB 3LT9A 4O2HA 2OQEA 3RGRA 1VQP3 2CK3H 4R4KA 2P05A 3S67A 4ORLA 1NJI4 4K61A 2UX0A 3B4OA 3DY5A 3X3YA 4N6LA 1JKGB 2BMOB 3MG3A 1O7WB 3CC73 4EV5A 3CCJ3 1K28A 4FCMA 1JB4A 1VQ63 3HK4A 3SOYA 3N9HA 4ZM8A 3FSDA 5JBSA 4N6TA 3Q1CA 3CU3A 4HM5B 3GZXB 1JRQA 3Q90A 4RZMA 3VSYA 2B1XB 1JB2A 3MG1A 2RGQA 4TX4A 3DGOA 1Z1SA 5IG5A 1K8A4 3FG1A 2W9PA 2WO0A 1WMPA 2OQEC 2IA7A 1W4NA 2A15A 1NB5I 3A76A 2I9WA 3EN1B 4EYCA 3FCSB 1UW1A 2CFLA 3FF0A 3GZBA 3PCRA 4KFDA 4MMXB 2W2CA 3WMDA 5IERA 1IT8A 2CC3A 4JF8A 2BT3A 2W56B 4R80A 1LNHA 5LC7A 3F7XA 2GEXA 4H61A 1N5PA 2QA43 5D83A 4KFEA 4GB5A 5D81A 2FXTA 4HM7B 1FGQA 2XSOB 3B4PA 5JPPA 1BUQA 3MSOA 3D9RA 4EBGA 3CCE3 2Z76A 2E2UA 3SEDA 2HMLB 1TFOA 2K54A 1YJN3 4WHAA 3IJEB 2ZDJA 3KSED 3NM7A 4WYKA 3EB8A 3OWYA 2O3OA 1DVDA 5CK6A 1NDOB 1A67A 3LTAA 4CDLA 1WMOA 1EKMA 3SVAA 4OK0A 4FR9A 4QWTA 3H51A 1R4CA 3K0ZA 1K9M4 1O7MB 3DUKA 1IVUA 3KKGA 1Y4KA 3NM2A 4H3UA 1MNLA 3K9MC 1Q40B 4IIAA 2XFTA 2IUKA 3N54B 3EBYA 5CXOA 2CH9A 5HGRA 1VQL3 1GY6A 3EE1A 1UUVB 1JKGA 2BHMA 4XBTA 1ZO2A 5DREA 3T8NA 3CCS3 2BNGA 3FZWA 5DRVA 1IVWA 3NUVA 1HKXA 3FG4A 5LC6A 3OWSA 2WOFA 1C7HA 3IPTA 2OCTA 1D6UA 3G8ZA 4XDWA 3K7CA 3T8UA 1W6GA 3V99A 3JVCA 1PFPA 3BNBA 1CYVA 1IQYA 1OACA 3LH4A 3MWZA 4AKZA 4RNZA 4L8OA 3KE7A 3LT8A 3LOYA 1M1XB 1OGXA 3MG2A 3AMOB 2LQVA 3F7SA 5AIGA 1A2VA 3G4S3 2HMOB 1ISKA 2XRXB 1SIHA 3SLUA 2KRTA 1ROVA 4EV2A 2W56A 3NBBA 3PYJA 5STDA 3MPHA 3F9SA 2W0QA 1FA3A 1WMNA 3HIGA 1Q864 1WTHA 4GL6A 1TU5A 2W03A 1NO3A 4MEIA 1NWWA 2YFIB 3QRDA 1OGZA 4R1KA 1IK3A 1IVVA 1EG9B 2MC8A 4N3VA 1OF5B 1VQ43 3MKIA 1EA2A 3OXAA 2OTJ3 1DMNA 3CME3 2RSXA 4K1UA 4LMIA 1TP6A 3UNLA 3I0YA 1Q824 1WQLB 3LTCA 3UJMA 4HJLB 3CCL3 3OWUA 3IMAB 3FGYA 1YHQ3 3K5TA 3Q2PA 3KN4A 1YJW3 4BTWA 1KSIA 2JQ5A 3EQQB 1QJGA 2C11A 3GWRA 1W6CA 3F14A 2D1WA 3JUQA 1FGMA 3BLZA 2FNQA 3CPW2 1Q40A 3WA3A 3GZRA 3S5CA 3LYGA 4O3VA 3LZAA 3DZLA 5AYRB 2CG0A 4X2HA 1TFKA 1DYUA 2Y73A 2KCDA 4LSOA 1VQN3 1VQ53 2WGQA 2RCDA 5ELJA 4HM0B 4HM1B 4AKYA 1M904 2CFWA 1SPUA 3MHEA 3G6E3 3FLJA 5AIHA 3PXMA 1RKYA 1FGTA 2V1LA 4XM4A 1K41A 1JN5B 2CWVA 4Q53A 1OHSA 5IENA 5A0OB 1ASKA 8CHOA 1FUWA 3EC9A 2PNCA 2PZVA 1YVBI 3AMOA 3NQYA 1U5OA 5AEUB 3JUOA 3N8BA 1U8CB 1RJOA 2FGTA 4BTYA 1ZX2A 3BNEA 4XBYA 5IF6A 2Y74A 3LXUX 1Q7Y4 1IV7A 3DGLA 3NV0B 3WODG 1VQ73 1O7NB 3D3LA 2Z6BA 5TGNA 3WOFB 4IT7A 1AV4A 4HM6B 1W01A 1L5GB 1OHOA 2P38A 1ROAA 2QEX3 3ER7A 5CF2A 1W7CA 2P09A 3JUNA 1G96A 3KZTA 4MMYB 3CMA3 5KP1A 2GBWB 4FCJA 1OF5A 3CCU3 4WP5A 4KFFA 1N9JA 1W5ZA 3EHCA 4JRFA 2W04A 4PEJA 2E2TA 4FMCA 4IPBA 1W02A 4CCVA 1QMAA 2F98A 1RN7A 5ELUA 3RGAA 2GU1A 4FMAA 5FGOA 1IVXA 2GU3A 1STFI 2BMRB 4AEQA 4EXRA 5IW9A 4BTXA 3HIIA 3KIIA 1YI23 3ROBA 3T0UA 1GYBA 2HMKB 1GD4A 2INXA 4XB5A 2STDA 1VZZA 5I97A 4I4KA 2YFJB 1N8QA 1Q814 2W6JH 3OV4A 3WOEB 2CKFB 5AIFA 3UL6A 4XDVA 2P0XA 3NQZA 1QAKA 3S29A 3EJVA 3I553 3CCV3 1GY7A 2CFDA 5AIIA 3F40A 1RRLA 3PS8A 5AYSC 1YJ93 3O8YA 3X40A 4OVMA 1ULJB 1KD14 1QAFA 3CCQ3 5CLKA 1US1A 2LYXA 3S27A 4STDA 3V98A 3UB1A 4HKVB 3GRDA 4N6OB 1ULIB 4R9LA 1IQ8A 2CW9A 1W00A 1KWIA 1SQWA 3CNXA 1LVNA 1JN5A 2XGLA 4WFOA 3X41A 1FGOA 3BNDA 4NREA 4G1MB 2XR8B 3V92A 2CWTA 4HZBB 3VF1A 1GS3A 3PGBA 3JUPA 3BB9A 3DXOA 3H3HA 3CPOA 3CC43 1QVF2 4WWUC 3STDA 1CEWI 1OH0A 4LEHA 2P0MA 1WNHA 3KSPA 3NV0A 2Z7AA 3F8XA 3X3XA 3I563 4N6UA 3NBRA 3EBTA 3NXJA 5BXQA 4HYZA 5BVBA 2SBLA 4U13A 1FGRA 2JDIH 2L4VA 2XEPA 2F86B 5KP4A 1W6YA 1OCVA 3HX8A 3K63A 2YFLB 3S28A 4LZIA 2XFSA 2XH9A 1CQSA 2CHCA 4HBRA 3M8CA 1UI7A 5AEWB 2CWUA 2ML5A 4L7KA 5KP3A 1OUNA 2XSHB 4RBNA 3PZWA 5IG3A 1M1K4 1KQS2 2E2VA 1VQ83 2D42A 4MJDA 3WA2X 2C10A 3B8LA 3GAXA 1QVG2 3DM8A 4EC6A 1VQ93 4O02B 1O7GB 2YX9A 4L8PA 4N6NB 2OOVA 1DMMA 1PU4A 1IQXA 1LOXA 2MF7A 3MYTA 4J8TA 3KFQC 1Q42A 1AR0A 2CIUA 1JV2B 1N9EA 4KVHA 1S723 3SOAA 3FG3A 3SX1A 1IU7A 2QGUA 1V74A 1QALA 2K0MA 1EQKA 2GXFA 4KZ1A 3OX9A 1F8NA 3PCSA 4N6V0 3CD63 3X3ZA 1DMQA 2W9QA 4RNYA 2XGNA 1E3RA 1MOLA 1CYUA 4R9KA 3U1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 3;  1W2B 2;  1YIT 3;  3CCM 3;  1N8R 4;  1K9M 4;  1YIJ 3;  3CMA 3;  1K73 4;  3I55 3;  3OW2 2;  3CCE 3;  1VQM 3;  3CC2 3;  3CCU 3;  3CCV 3;  3CPW 2;  1VQP 3;  2OTL 3;  1VQ4 3;  1K8A 4;  1YJ9 3;  1NJI 4;  1S72 3;  1YJN 3;  1KD1 4;  1VQL 3;  3CCQ 3;  3CC4 3;  1JJ2 2;  3G4S 3;  1QVF 2;  3CCS 3;  2OTJ 3;  1M1K 4;  3CME 3;  1VQN 3;  1VQ5 3;  1KQS 2;  1VQ8 3;  1Q7Y 4;  1YI2 3;  3I56 3;  1Q82 4;  3CC7 3;  1VQ7 3;  1M90 4;  3CCJ 3;  3CD6 3;  1VQ6 3;  1QVG 2;  1VQO 3;  3G6E 3;  3CCL 3;  1VQK 3;  3G71 3;  1Q81 4;  1KC8 4;  1Q86 4;  1YHQ 3;  1VQ9 3;  3CXC 2;  2QA4 3;  1YJW 3;  3CCR 3; 
#chains in the Genus database with same CATH topology
 1W2B 2;  5BU4 A;  4HZ9 B;  2KF5 A;  1AVL A;  1AVK A;  1W2Z A;  3D79 A;  1RCK A;  1N8R 4;  4XBX A;  3EF8 A;  5G2G A;  2XF3 A;  5JPU A;  1EEJ A;  1O7H B;  1TUH A;  1VQQ A;  3CC2 3;  1OPY A;  1BSE A;  4LGQ A;  1ZS7 A;  3X42 A;  2OOV C;  2OTL 3;  1D6Y A;  3U97 A;  3NHX A;  1HZ1 A;  2HMN B;  2GEY A;  4BL3 A;  2O9U X;  3EX9 A;  3GZY B;  4NHF A;  1JJ2 2;  7STD A;  4ILF A;  3CNM A;  2BMQ B;  2B24 B;  1B20 A;  2Q07 A;  4HM3 B;  1IDP A;  3ALA A;  4KT3 B;  4HM2 B;  1STD A;  3DMC A;  3SXX A;  5IEO A;  1VQK 3;  3JUM A;  3G71 3;  3WDG B;  1TIJ A;  2R4I A;  3GSP A;  3CCR 3;  1A2K A;  3FKA A;  2ML6 A;  3KCH A;  3CCM 3;  7RNT A;  1YIJ 3;  3FF2 A;  1K73 4;  2CG1 A;  3G0K A;  1I2E A;  2BO9 B;  1V58 A;  1DET A;  3A5E A;  4X2O A;  1DVC A;  2KXG A;  2J8X B;  1JZD A;  2BIR A;  3ECF A;  1GOV A;  3L0R A;  4FMB A;  2IMJ A;  7GSP A;  1BRK A;  4J9A A;  2RFR A;  1LXE A;  1I2F A;  1SII A;  1SJW A;  1GY5 A;  2F56 A;  3LML A;  3RDE A;  3B7C A;  3EN8 A;  3J7Y d;  1C54 A;  1GD3 A;  3G16 A;  1A90 A;  4J5K A;  5IG4 A;  1VQO 3;  1T3B A;  2HOH A;  6STD A;  1KC8 4;  2QIY A;  4HM4 B;  2F99 A;  5IG0 A;  3CXC 2;  3NBJ A;  3F8H A;  1G02 A;  3DGM A;  1JB5 A;  3VGN A;  3FH1 A;  4N6M A;  3QK9 A;  1B2U A;  3WR2 A;  3LTD A;  4OUQ A;  4HM8 B;  4FMD A;  1UUW B;  3TDG A;  5EEO A;  1J2B A;  1AY7 A;  1RGG A;  1JNQ A;  4MMZ B;  2WOH A;  2ZL8 A;  1NU3 A;  5EVH A;  1JBS A;  3DGN A;  5AI1 A;  1M9G A;  3E99 A;  1IV9 A;  3BNC A;  1I8V A;  1GOU A;  5IEP A;  4O8S A;  5FW5 A;  1I2G A;  1BIR A;  3NX0 A;  2WGO A;  3LTB A;  1RHL A;  1RGC A;  3HZP A;  2M7O A;  1LQG C;  2RBI A;  4K1V A;  1S5A A;  4WYK B;  5CF1 A;  2HMM B;  1BNJ A;  2Z77 A;  1HU9 A;  4CJN A;  1UUG B;  1IT7 A;  1UI8 A;  2KF4 A;  4FCZ A;  4HVN A;  5EQL A;  5D82 A;  3HI7 A;  1E97 A;  1NB3 I;  2IUJ A;  2CFG A;  1RRH A;  1E3V A;  1T5Y A;  2GBX B;  1MWS A;  1YGE A;  2OWP A;  1N5H A;  3UL5 A;  3URP A;  1YIT 3;  2CFK A;  1OHP A;  1UCJ A;  4K90 B;  1O7P B;  3OW2 2;  1VQM 3;  1D6Z A;  2HMJ B;  3LT9 A;  4O2H A;  2OQE A;  3RGR A;  1GSP A;  1VQP 3;  2CK3 H;  4R4K A;  2P05 A;  4LYL B;  1LOW A;  3S67 A;  4ORL A;  1NJI 4;  4K61 A;  2UX0 A;  3B4O A;  3DY5 A;  3X3Y A;  4N6L A;  1JKG B;  2BMO B;  3MG3 A;  1O7W B;  3CC7 3;  4EV5 A;  3CCJ 3;  1K28 A;  1RSN A;  4FCM A;  2IYJ A;  1JB4 A;  1VQ6 3;  3HK4 A;  3AHW A;  1RGK A;  3SOY A;  3N9H A;  3AHS A;  4ZM8 A;  3FSD A;  5JBS A;  4N6T A;  3Q1C A;  3SYU A;  2GSP A;  3CU3 A;  4HM5 B;  1AQZ A;  3GZX B;  1JRQ A;  3Q90 A;  4I5Q A;  4RZM A;  1RNT A;  3VSY A;  2B1X B;  1JB2 A;  3MG1 A;  1BRH A;  2RGQ A;  4TX4 A;  3DGO A;  1Z1S A;  1BAO A;  4NPB A;  5IG5 A;  1K8A 4;  3FG1 A;  2W9P A;  2WO0 A;  1PYL A;  1WMP A;  2OQE C;  1NNV A;  2IA7 A;  1W4N A;  2A15 A;  1NB5 I;  3AGN A;  3A76 A;  2I9W A;  3EN1 B;  4EYC A;  3FCS B;  1UW1 A;  2CFL A;  3FF0 A;  1BNI A;  3GZB A;  3PCR A;  4KFD A;  4MMX B;  1FW7 A;  2W2C A;  3WMD A;  5IER A;  1IT8 A;  2CC3 A;  4JF8 A;  2BT3 A;  1B2S A;  2W56 B;  4R80 A;  1RNB A;  1LNH A;  5LC7 A;  3F7X A;  1BOX A;  2GEX A;  1I0V A;  4H61 A;  1N5P A;  1Q9E A;  5D83 A;  2QA4 3;  4KFE A;  4GB5 A;  5D81 A;  2FXT A;  4HM7 B;  3DGY A;  1FGQ A;  2XSO B;  3B4P A;  5JPP A;  1BUQ A;  3MSO A;  1T2I A;  3D9R A;  4EBG A;  3CCE 3;  2F5W A;  1BNR A;  2Z76 A;  2E2U A;  3SED A;  2HML B;  1TFO A;  1ZGX A;  2K54 A;  1YJN 3;  4HAA A;  4WHA A;  3IJE B;  2ZDJ A;  3KSE D;  3NM7 A;  4WYK A;  3EB8 A;  3OWY A;  1BNE A;  6GSP A;  2O3O A;  1DVD A;  5RNT A;  5CK6 A;  1NDO B;  1A67 A;  2H0G A;  3LTA A;  4CDL A;  1WMO A;  1EKM A;  3SVA A;  4OK0 A;  4FR9 A;  1PY3 A;  4QWT A;  1EUI C;  3H51 A;  1R4C A;  3K0Z A;  1K9M 4;  3BU4 A;  1O7M B;  3DUK A;  9RNT A;  1JZO A;  2H0H A;  2ZA4 A;  1IVU A;  1RLS A;  3KKG A;  1Y4K A;  3NM2 A;  1B2Z A;  1MNL A;  3K9M C;  4H3U A;  1Q40 B;  4IIA A;  2IY2 A;  2XFT A;  2IUK A;  3N54 B;  3EBY A;  5CXO A;  2AAD A;  2CH9 A;  5HGR A;  1GY6 A;  3EE1 A;  1VQL 3;  1UUV B;  1JKG A;  2BHM A;  4HOH A;  1ZO2 A;  4XBT A;  1BRJ A;  5DRE A;  3T8N A;  3CCS 3;  1FUS A;  2BNG A;  3FZW A;  5DRV A;  1IVW A;  3DH2 A;  1HKX A;  3FG4 A;  3NUV A;  5LC6 A;  1DE3 A;  3OWS A;  2BU4 A;  1C7H A;  2WOF A;  3IPT A;  2OCT A;  1D6U A;  3G8Z A;  4XDW A;  3K7C A;  3T8U A;  1W6G A;  3V99 A;  3JVC A;  1RTU A;  1PFP A;  3BNB A;  1TJD A;  4GHO A;  1CYV A;  1IQY A;  1OAC A;  3LH4 A;  3MWZ A;  1B3S A;  4AKZ A;  2RNT A;  4RNZ A;  4L8O A;  1BUJ A;  3KE7 A;  3LT8 A;  3LOY A;  1M1X B;  1OGX A;  3MG2 A;  3AMO B;  2LQV A;  3F7S A;  1BRG A;  5AIG A;  3U1W A;  1A2V A;  3G4S 3;  2AAE A;  2HMO B;  1ISK A;  1V57 A;  1A2P A;  2XRX B;  1RN4 A;  1SIH A;  3SLU A;  2KRT A;  3RNT A;  1ROV A;  4EV2 A;  2W56 A;  3NBB A;  3PYJ A;  5STD A;  3MPH A;  1GMQ A;  2W0Q A;  3F9S A;  1FA3 A;  1WMN A;  3D4A A;  3HIG A;  1Q86 4;  5G1L A;  1WTH A;  4GL6 A;  1TU5 A;  2CX1 A;  2W03 A;  1NO3 A;  4MEI A;  1NWW A;  2UUG C;  2YFI B;  3QRD A;  1OGZ A;  4R1K A;  1IK3 A;  1IVV A;  1BSB A;  1EG9 B;  1T2H A;  1I70 A;  2MC8 A;  4N3V A;  1OF5 B;  1VQ4 3;  2UGI A;  3MKI A;  1BSC A;  1EA2 A;  3OXA A;  3D5G A;  5G1K A;  2OTJ 3;  1DMN A;  1LOY A;  1I3F A;  2RSX A;  4K1U A;  4LMI A;  1TP6 A;  3CME 3;  3UNL A;  3I0Y A;  1Q82 4;  1WQL B;  3LTC A;  1RGL A;  1UDI I;  3UJM A;  4HJL B;  3CCL 3;  3OWU A;  3IMA B;  3FGY A;  1YHQ 3;  3K5T A;  3Q2P A;  3KN4 A;  1YJW 3;  4BTW A;  1KSI A;  2JQ5 A;  3EQQ B;  1QJG A;  2C11 A;  3GWR A;  1W6C A;  3F14 A;  4BIR A;  1TTO A;  1BNF A;  2D1W A;  3JUQ A;  1FGM A;  2CX0 A;  3BLZ A;  2FNQ A;  3CPW 2;  1Q40 A;  3WA3 A;  4EW5 A;  3GZR A;  5M18 A;  1BU4 A;  3S5C A;  1MWU A;  3LYG A;  2SAR A;  4O3V A;  2KAA A;  3LZA A;  3DZL A;  1MWT A;  4RNT A;  2CG0 A;  4X2H A;  1TFK A;  5AYR B;  1DYU A;  2Y73 A;  2KCD A;  4LSO A;  1VQN 3;  1VQ5 3;  2WGQ A;  1R4Y A;  2C4B A;  2RCD A;  4HM0 B;  5ELJ A;  1FUT A;  4HM1 B;  4AKY A;  1M90 4;  2CFW A;  1SPU A;  1G0T A;  3MHE A;  3G6E 3;  3FLJ A;  5AIH A;  1CH0 A;  5HOH A;  3PXM A;  1RKY A;  1FGT A;  2V1L A;  1YVS A;  4XM4 A;  1K41 A;  1JN5 B;  2CWV A;  4Q53 A;  1OHS A;  5IEN A;  1BRI A;  5A0O B;  1ASK A;  8CHO A;  1FUW A;  3EC9 A;  2PNC A;  2PZV A;  1X1X A;  1YVB I;  3AMO A;  3NQY A;  1U5O A;  5AEU B;  3JUO A;  3N8B A;  1U8C B;  1RJO A;  1UCI A;  2FGT A;  4BTY A;  1ZX2 A;  1B2X A;  3BNE A;  4XBY A;  1GOY A;  2Y74 A;  2F5M A;  5IF6 A;  3LXU X;  1Q7Y 4;  1IV7 A;  3DGL A;  3NV0 B;  3WOD G;  1VQ7 3;  1O7N B;  3D3L A;  2Z6B A;  5TGN A;  3WOF B;  4IT7 A;  1AV4 A;  4HM6 B;  1W01 A;  1Q7H A;  1L5G B;  1BVI A;  1OHO A;  2P38 A;  1ROA A;  2QEX 3;  3ER7 A;  5CF2 A;  1W7C A;  2P09 A;  3JUN A;  1G96 A;  3KZT A;  4MMY B;  3CMA 3;  4BL2 A;  8RNT A;  5KP1 A;  2GBW B;  4FCJ A;  1OF5 A;  3CCU 3;  4WP5 A;  4KFF A;  1N9J A;  1W5Z A;  1RDS A;  2H0I A;  3EHC A;  4JRF A;  1BSD A;  2W04 A;  4PEJ A;  2E2T A;  4FMC A;  4IPB A;  1W02 A;  1GMP A;  4CCV A;  1BAN A;  1QMA A;  4CPK A;  2F98 A;  1BNG A;  1RN7 A;  2R41 A;  2GU1 A;  4FMA A;  5ELU A;  5FGO A;  1IVX A;  2GU3 A;  1STF I;  1MGR A;  2BMR B;  4AEQ A;  4EXR A;  5IW9 A;  1RGF A;  4BTX A;  3HII A;  3KII A;  5BIR A;  1YI2 3;  1LRA A;  1X1Y A;  3ROB A;  3T0U A;  1GYB A;  2HMK B;  1GD4 A;  2INX A;  4XB5 A;  2STD A;  1VZZ A;  5I97 A;  4I4K A;  2YFJ B;  1N8Q A;  1Q81 4;  2W6J H;  1BRN L;  3OV4 A;  3HOH A;  3WOE B;  2CKF B;  5AIF A;  3UL6 A;  4XDV A;  2P0X A;  2K3D A;  4DKI A;  3NQZ A;  1QAK A;  3S29 A;  3EJV A;  3I55 3;  5M1A A;  3AGO A;  3CCV 3;  1GY7 A;  2CFD A;  5AII A;  3F40 A;  1RRL A;  3PS8 A;  1B27 A;  5AYS C;  1YJ9 3;  3O8Y A;  3ZG0 A;  3X40 A;  4OVM A;  1ULJ B;  1KD1 4;  1QAF A;  3D5I A;  3CCQ 3;  1B21 A;  5CLK A;  1US1 A;  2LYX A;  3Q3F A;  3S27 A;  3ZFZ A;  1UGH I;  4STD A;  3V98 A;  3UB1 A;  1RGH A;  4HKV B;  1RGE A;  3GRD A;  4N6O B;  4GSP A;  1ULI B;  1GMR A;  1IQ8 A;  4R9L A;  2CW9 A;  3BIR A;  1RMS A;  1FZU A;  1I0X A;  1W00 A;  1KWI A;  1SQW A;  3CNX A;  1YNV X;  1LVN A;  1JN5 A;  2XGL A;  4WFO A;  3X41 A;  1FGO A;  3BND A;  4NRE A;  6RNT A;  4G1M B;  2XR8 B;  3V92 A;  2CWT A;  1MWR A;  4HZB B;  1RGA A;  3VF1 A;  1GS3 A;  3PGB A;  3JUP A;  3BB9 A;  1RN1 A;  3DXO A;  3ZG5 A;  5GSP A;  3H3H A;  3CPO A;  3CC4 3;  1QVF 2;  4WWU C;  3STD A;  5M19 A;  1CEW I;  1OH0 A;  1LNI A;  4LEH A;  2P0M A;  1WNH A;  3KSP A;  3NV0 A;  3RGA A;  1MGW A;  2Z7A A;  3F8X A;  3X3X A;  3I56 3;  1JBT A;  4N6U A;  3NBR A;  1BRS A;  3EBT A;  1BGS A;  3NXJ A;  2L1S A;  1LOV A;  5BXQ A;  4HYZ A;  5BVB A;  2SBL A;  4U13 A;  1JBR A;  4BU4 A;  1FGR A;  2JDI H;  2L4V A;  2XEP A;  1BNS A;  2F86 B;  2KF6 A;  2ZHX B;  1W6Y A;  4J5G A;  5KP4 A;  1B2M A;  1OCV A;  3HX8 A;  3K63 A;  2YFL B;  3S28 A;  2F4Y A;  4LZI A;  2XFS A;  1UCK A;  2XH9 A;  1IYY A;  1CQS A;  2CHC A;  4HBR A;  3M8C A;  1UI7 A;  5AEW B;  2CWU A;  2ML5 A;  4L7K A;  5KP3 A;  1OUN A;  1UCL A;  2XSH B;  3PZW A;  4RBN A;  5IG3 A;  1M1K 4;  1KQS 2;  2E2V A;  1VQ8 3;  1SAR A;  2D42 A;  4MJD A;  3WA2 X;  3WHO A;  2C10 A;  3B8L A;  3GAX A;  1TRQ A;  1QVG 2;  3DM8 A;  4EC6 A;  1LQM B;  1VQ9 3;  4O02 B;  1O7G B;  2YX9 A;  1RCL A;  4L8P A;  4N6N B;  2OOV A;  1DMM A;  1PU4 A;  1IQX A;  1LOX A;  2MF7 A;  3MYT A;  4J8T A;  3KFQ C;  1Q42 A;  1AR0 A;  4R9K A;  2CIU A;  1JV2 B;  1N9E A;  1I3I A;  4KVH A;  1S72 3;  3SOA A;  3FG3 A;  1X1W A;  2KF3 A;  3SX1 A;  1IU7 A;  2QGU A;  1V74 A;  1UGI A;  1QAL A;  2K0M A;  1EQK A;  2GXF A;  4KZ1 A;  3OX9 A;  1F8N A;  3PCS A;  4N6V 0;  1BSA A;  3CD6 3;  1FYS A;  3X3Z A;  1DMQ A;  2W9Q A;  4RNY A;  2XGN A;  1E3R A;  1MOL A;  1HYF A;  1CYU A;  1TRP A;  1X1U A;  1YGW A; 
#chains in the Genus database with same CATH homology
 1W2B 2;  4HZ9 B;  1AVL A;  1AVK A;  1W2Z A;  1N8R 4;  4XBX A;  3EF8 A;  5G2G A;  2XF3 A;  5JPU A;  1O7H B;  1TUH A;  3CC2 3;  1OPY A;  4LGQ A;  3X42 A;  2OOV C;  2OTL 3;  1D6Y A;  3U97 A;  3NHX A;  2HMN B;  2GEY A;  2O9U X;  3EX9 A;  3GZY B;  4NHF A;  1JJ2 2;  7STD A;  3CNM A;  2BMQ B;  2B24 B;  4HM3 B;  2Q07 A;  1IDP A;  3ALA A;  4HM2 B;  1STD A;  3DMC A;  3SXX A;  5IEO A;  1VQK 3;  3JUM A;  3G71 3;  3WDG B;  1TIJ A;  2R4I A;  3CCR 3;  1A2K A;  3FKA A;  2ML6 A;  3CCM 3;  1YIJ 3;  3FF2 A;  1K73 4;  2CG1 A;  3G0K A;  2BO9 B;  4X2O A;  1DVC A;  2KXG A;  3ECF A;  3L0R A;  4FMB A;  2IMJ A;  4J9A A;  2RFR A;  1LXE A;  1SII A;  1SJW A;  1GY5 A;  3J7Y d;  3LML A;  3RDE A;  3B7C A;  3EN8 A;  1GD3 A;  3G16 A;  1A90 A;  1VQO 3;  5IG4 A;  6STD A;  1KC8 4;  2QIY A;  4HM4 B;  2F99 A;  5IG0 A;  3CXC 2;  3NBJ A;  3F8H A;  3DGM A;  1JB5 A;  3VGN A;  3FH1 A;  4N6M A;  3QK9 A;  3LTD A;  4OUQ A;  4HM8 B;  4FMD A;  1UUW B;  3TDG A;  5EEO A;  1J2B A;  1JNQ A;  4MMZ B;  2WOH A;  2ZL8 A;  1NU3 A;  5EVH A;  3DGN A;  5AI1 A;  1M9G A;  3E99 A;  1IV9 A;  3BNC A;  5IEP A;  4O8S A;  5FW5 A;  3NX0 A;  2WGO A;  3LTB A;  3HZP A;  4K1V A;  2M7O A;  5CF1 A;  4WYK B;  1S5A A;  2HMM B;  2Z77 A;  1HU9 A;  1IT7 A;  1UI8 A;  4FCZ A;  4HVN A;  5EQL A;  5D82 A;  3HI7 A;  1E97 A;  1NB3 I;  2IUJ A;  2CFG A;  1RRH A;  1E3V A;  1T5Y A;  2GBX B;  1YGE A;  2OWP A;  1N5H A;  3UL5 A;  1YIT 3;  2CFK A;  1OHP A;  4K90 B;  1O7P B;  3OW2 2;  1VQM 3;  1D6Z A;  2HMJ B;  3LT9 A;  4O2H A;  2OQE A;  3RGR A;  1VQP 3;  2CK3 H;  4R4K A;  2P05 A;  3S67 A;  4ORL A;  1NJI 4;  4K61 A;  2UX0 A;  3B4O A;  3DY5 A;  3X3Y A;  4N6L A;  1JKG B;  2BMO B;  3MG3 A;  1O7W B;  3CC7 3;  4EV5 A;  3CCJ 3;  1K28 A;  4FCM A;  1JB4 A;  1VQ6 3;  3HK4 A;  3SOY A;  3N9H A;  4ZM8 A;  3FSD A;  5JBS A;  4N6T A;  3Q1C A;  3CU3 A;  4HM5 B;  3GZX B;  1JRQ A;  3Q90 A;  4RZM A;  3VSY A;  2B1X B;  1JB2 A;  3MG1 A;  2RGQ A;  4TX4 A;  3DGO A;  1Z1S A;  5IG5 A;  1K8A 4;  3FG1 A;  2W9P A;  2WO0 A;  1WMP A;  2OQE C;  2IA7 A;  1W4N A;  2A15 A;  1NB5 I;  3A76 A;  2I9W A;  3EN1 B;  4EYC A;  3FCS B;  1UW1 A;  2CFL A;  3FF0 A;  3GZB A;  3PCR A;  4KFD A;  4MMX B;  2W2C A;  3WMD A;  5IER A;  1IT8 A;  2CC3 A;  4JF8 A;  2BT3 A;  2W56 B;  4R80 A;  1LNH A;  5LC7 A;  3F7X A;  2GEX A;  4H61 A;  1N5P A;  2QA4 3;  5D83 A;  4KFE A;  4GB5 A;  5D81 A;  2FXT A;  4HM7 B;  1FGQ A;  2XSO B;  3B4P A;  5JPP A;  1BUQ A;  3MSO A;  3D9R A;  4EBG A;  3CCE 3;  2Z76 A;  2E2U A;  3SED A;  2HML B;  1TFO A;  2K54 A;  1YJN 3;  4WHA A;  3IJE B;  2ZDJ A;  3KSE D;  3NM7 A;  4WYK A;  3EB8 A;  3OWY A;  2O3O A;  1DVD A;  5CK6 A;  1NDO B;  1A67 A;  3LTA A;  4CDL A;  1WMO A;  1EKM A;  3SVA A;  4OK0 A;  4FR9 A;  4QWT A;  3H51 A;  1R4C A;  3K0Z A;  1K9M 4;  1O7M B;  3DUK A;  1IVU A;  3KKG A;  1Y4K A;  3NM2 A;  4H3U A;  1MNL A;  3K9M C;  1Q40 B;  4IIA A;  2XFT A;  2IUK A;  3N54 B;  3EBY A;  5CXO A;  2CH9 A;  5HGR A;  1VQL 3;  1GY6 A;  3EE1 A;  1UUV B;  1JKG A;  2BHM A;  4XBT A;  1ZO2 A;  5DRE A;  3T8N A;  3CCS 3;  2BNG A;  3FZW A;  5DRV A;  1IVW A;  3NUV A;  1HKX A;  3FG4 A;  5LC6 A;  3OWS A;  2WOF A;  1C7H A;  3IPT A;  2OCT A;  1D6U A;  3G8Z A;  4XDW A;  3K7C A;  3T8U A;  1W6G A;  3V99 A;  3JVC A;  1PFP A;  3BNB A;  1CYV A;  1IQY A;  1OAC A;  3LH4 A;  3MWZ A;  4AKZ A;  4RNZ A;  4L8O A;  3KE7 A;  3LT8 A;  3LOY A;  1M1X B;  1OGX A;  3MG2 A;  3AMO B;  2LQV A;  3F7S A;  5AIG A;  1A2V A;  3G4S 3;  2HMO B;  1ISK A;  2XRX B;  1SIH A;  3SLU A;  2KRT A;  1ROV A;  4EV2 A;  2W56 A;  3NBB A;  3PYJ A;  5STD A;  3MPH A;  3F9S A;  2W0Q A;  1FA3 A;  1WMN A;  3HIG A;  1Q86 4;  1WTH A;  4GL6 A;  1TU5 A;  2W03 A;  1NO3 A;  4MEI A;  1NWW A;  2YFI B;  3QRD A;  1OGZ A;  4R1K A;  1IK3 A;  1IVV A;  1EG9 B;  2MC8 A;  4N3V A;  1OF5 B;  1VQ4 3;  3MKI A;  1EA2 A;  3OXA A;  2OTJ 3;  1DMN A;  3CME 3;  2RSX A;  4K1U A;  4LMI A;  1TP6 A;  3UNL A;  3I0Y A;  1Q82 4;  1WQL B;  3LTC A;  3UJM A;  4HJL B;  3CCL 3;  3OWU A;  3IMA B;  3FGY A;  1YHQ 3;  3K5T A;  3Q2P A;  3KN4 A;  1YJW 3;  4BTW A;  1KSI A;  2JQ5 A;  3EQQ B;  1QJG A;  2C11 A;  3GWR A;  1W6C A;  3F14 A;  2D1W A;  3JUQ A;  1FGM A;  3BLZ A;  2FNQ A;  3CPW 2;  1Q40 A;  3WA3 A;  3GZR A;  3S5C A;  3LYG A;  4O3V A;  3LZA A;  3DZL A;  5AYR B;  2CG0 A;  4X2H A;  1TFK A;  1DYU A;  2Y73 A;  2KCD A;  4LSO A;  1VQN 3;  1VQ5 3;  2WGQ A;  2RCD A;  5ELJ A;  4HM0 B;  4HM1 B;  4AKY A;  1M90 4;  2CFW A;  1SPU A;  3MHE A;  3G6E 3;  3FLJ A;  5AIH A;  3PXM A;  1RKY A;  1FGT A;  2V1L A;  4XM4 A;  1K41 A;  1JN5 B;  2CWV A;  4Q53 A;  1OHS A;  5IEN A;  5A0O B;  1ASK A;  8CHO A;  1FUW A;  3EC9 A;  2PNC A;  2PZV A;  1YVB I;  3AMO A;  3NQY A;  1U5O A;  5AEU B;  3JUO A;  3N8B A;  1U8C B;  1RJO A;  2FGT A;  4BTY A;  1ZX2 A;  3BNE A;  4XBY A;  5IF6 A;  2Y74 A;  3LXU X;  1Q7Y 4;  1IV7 A;  3DGL A;  3NV0 B;  3WOD G;  1VQ7 3;  1O7N B;  3D3L A;  2Z6B A;  5TGN A;  3WOF B;  4IT7 A;  1AV4 A;  4HM6 B;  1W01 A;  1L5G B;  1OHO A;  2P38 A;  1ROA A;  2QEX 3;  3ER7 A;  5CF2 A;  1W7C A;  2P09 A;  3JUN A;  1G96 A;  3KZT A;  4MMY B;  3CMA 3;  5KP1 A;  2GBW B;  4FCJ A;  1OF5 A;  3CCU 3;  4WP5 A;  4KFF A;  1N9J A;  1W5Z A;  3EHC A;  4JRF A;  2W04 A;  4PEJ A;  2E2T A;  4FMC A;  4IPB A;  1W02 A;  4CCV A;  1QMA A;  2F98 A;  1RN7 A;  5ELU A;  3RGA A;  2GU1 A;  4FMA A;  5FGO A;  1IVX A;  2GU3 A;  1STF I;  2BMR B;  4AEQ A;  4EXR A;  5IW9 A;  4BTX A;  3HII A;  3KII A;  1YI2 3;  3ROB A;  3T0U A;  1GYB A;  2HMK B;  1GD4 A;  2INX A;  4XB5 A;  2STD A;  1VZZ A;  5I97 A;  4I4K A;  2YFJ B;  1N8Q A;  1Q81 4;  2W6J H;  3OV4 A;  3WOE B;  2CKF B;  5AIF A;  3UL6 A;  4XDV A;  2P0X A;  3NQZ A;  1QAK A;  3S29 A;  3EJV A;  3I55 3;  3CCV 3;  1GY7 A;  2CFD A;  5AII A;  3F40 A;  1RRL A;  3PS8 A;  5AYS C;  1YJ9 3;  3O8Y A;  3X40 A;  4OVM A;  1ULJ B;  1KD1 4;  1QAF A;  3CCQ 3;  5CLK A;  1US1 A;  2LYX A;  3S27 A;  4STD A;  3V98 A;  3UB1 A;  4HKV B;  3GRD A;  4N6O B;  1ULI B;  4R9L A;  1IQ8 A;  2CW9 A;  1W00 A;  1KWI A;  1SQW A;  3CNX A;  1LVN A;  1JN5 A;  2XGL A;  4WFO A;  3X41 A;  1FGO A;  3BND A;  4NRE A;  4G1M B;  2XR8 B;  3V92 A;  2CWT A;  4HZB B;  3VF1 A;  1GS3 A;  3PGB A;  3JUP A;  3BB9 A;  3DXO A;  3H3H A;  3CPO A;  3CC4 3;  1QVF 2;  4WWU C;  3STD A;  1CEW I;  1OH0 A;  4LEH A;  2P0M A;  1WNH A;  3KSP A;  3NV0 A;  2Z7A A;  3F8X A;  3X3X A;  3I56 3;  4N6U A;  3NBR A;  3EBT A;  3NXJ A;  5BXQ A;  4HYZ A;  5BVB A;  2SBL A;  4U13 A;  1FGR A;  2JDI H;  2L4V A;  2XEP A;  2F86 B;  5KP4 A;  1W6Y A;  1OCV A;  3HX8 A;  3K63 A;  2YFL B;  3S28 A;  4LZI A;  2XFS A;  2XH9 A;  1CQS A;  2CHC A;  4HBR A;  3M8C A;  1UI7 A;  5AEW B;  2CWU A;  2ML5 A;  4L7K A;  5KP3 A;  1OUN A;  2XSH B;  4RBN A;  3PZW A;  5IG3 A;  1M1K 4;  1KQS 2;  2E2V A;  1VQ8 3;  2D42 A;  4MJD A;  3WA2 X;  2C10 A;  3B8L A;  3GAX A;  1QVG 2;  3DM8 A;  4EC6 A;  1VQ9 3;  4O02 B;  1O7G B;  2YX9 A;  4L8P A;  4N6N B;  2OOV A;  1DMM A;  1PU4 A;  1IQX A;  1LOX A;  2MF7 A;  3MYT A;  4J8T A;  3KFQ C;  1Q42 A;  1AR0 A;  2CIU A;  1JV2 B;  1N9E A;  4KVH A;  1S72 3;  3SOA A;  3FG3 A;  3SX1 A;  1IU7 A;  2QGU A;  1V74 A;  1QAL A;  2K0M A;  1EQK A;  2GXF A;  4KZ1 A;  3OX9 A;  1F8N A;  3PCS A;  4N6V 0;  3CD6 3;  3X3Z A;  1DMQ A;  2W9Q A;  4RNY A;  2XGN A;  1E3R A;  1MOL A;  1CYU A;  4R9K A;  3U1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...