3CC2E

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cc2E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cc2E01
1YI2E 1Q81G 1VQ9E 3CXCE 4WFBE 3CPWE 4IOCE 5DM7E 5JVGE 3J7ZG 3CCJE 3CCUE 3I55E 5HL7E 1NJIG 1VQLE 3CCRE 5GAHG 3CF5E 1KQSE 1Q86G 3CMAE 5AN9B 3I56E 1YJWE 1RL6A 4UY8G 3OW2E 2CQLA 3CCVE 2ZJPE 4WFAE 4U67E 1W2BE 1QVFE 1VQPE 1VQ4E 3PIPE 1K9MG 1VQ5E 2QA4E 3CCLE 3CCME 3CC7E 3G4SE 4WF9E 1VQ7E 3CC4E 1VQ8E 3PIOE 4IO9E 3CCEE 4WFNE 1YHQE 1VQOE 3CCSE 1YITE 1K73G 1VQKE 1N8RG 2ZJRE 3CCQE 1Q82G 5GAGG 1YJNE 2QEXE 3CMEE 1KD1G 1JJ2E 3G6EE 3DLLE 1VQME 1YJ9E 5DM6E 1YIJE 1QVGE 4IOAE 4WCEE 1VQ6E 5JVHE 5H1SI 5GADG 1S72E 5GAEG 1VQNE 3CD6E 1M1KG 1K8AG 1KC8G 2OTJE 2ZJQE 1M90G 3CC2E 2OTLE 3G71E 5MLCH 1Q7YG
chains in the Genus database with same CATH superfamily
1YI2E 1Q81G 1RJLC 1VQ9E 3CXCE 4WFBE 3CPWE 5B2AO 2OY8A 4IOCE 5DM7E 5JVGE 3J7ZG 3CCJE 3CCUE 3I55E 1OSPO 5HL7E 1NJIG 1VQLE 3CCRE 3AUMO 5GAHG 3CF5E 1KQSE 1Q86G 3CMAE 5AN9B 3I56E 1YJWE 1RL6A 4UY8G 3OW2E 3CCVE 2CQLA 2I5ZO 2ZJPE 4WFAE 4U67E 1W2BE 1QVFE 2OL6O 1VQPE 1VQ4E 3PIPE 1K9MG 1VQ5E 2QA4E 2OYBO 3CCLE 3CCME 3CC7E 2OY7A 3G4SE 4WF9E 5B3MO 1VQ7E 3CC4E 5B10O 1VQ8E 2HKDA 3PIOE 4IO9E 2OL7A 3IGEA 4WFNE 2I5VO 3CCEE 1YHQE 2AF5A 1VQOE 3CKFA 2OY1O 3CCSE 1YITE 1K73G 1VQKE 3EC5A 1N8RG 2ZJRE 3CCQE 1Q82G 5GAGG 1YJNE 2QEXE 3CMEE 1KD1G 1JJ2E 3G6EE 3DLLE 3CKGA 1VQME 1YJ9E 5DM6E 2FKJA 1YIJE 5B11O 1QVGE 4IOAE 4WCEE 1VQ6E 2FKGA 5JVHE 5H1SI 5GADG 1S72E 5GAEG 1VQNE 1P4PA 2OY5O 3CD6E 1M1KG 1K8AG 3IG9A 1FJ1E 1KC8G 2G8CO 2OTJE 2ZJQE 1M90G 3CC2E 2PI3O 2OTLE 2OL8O 3G71E 5MLCH 1Q7YG
chains in the Genus database with same CATH topology
1YI2E 1Q81G 1VQ9E 3CXCE 4WFBE 3CPWE 4IOCE 5DM7E 5JVGE 3J7ZG 3CCJE 3CCUE 3I55E 5HL7E 1NJIG 1VQLE 3CCRE 5GAHG 3CF5E 1KQSE 1Q86G 3CMAE 5AN9B 3I56E 1YJWE 1RL6A 4UY8G 3OW2E 2CQLA 3CCVE 2ZJPE 4WFAE 4U67E 1W2BE 1QVFE 1VQPE 1VQ4E 3PIPE 1K9MG 1VQ5E 2QA4E 3CCLE 3CCME 3CC7E 3G4SE 4WF9E 1VQ7E 3CC4E 1VQ8E 3PIOE 4IO9E 3CCEE 4WFNE 1YHQE 1VQOE 3CCSE 1YITE 1K73G 1VQKE 1N8RG 2ZJRE 3CCQE 1Q82G 5GAGG 1YJNE 2QEXE 3CMEE 1KD1G 1JJ2E 3G6EE 3DLLE 1VQME 1YJ9E 5DM6E 1YIJE 1QVGE 4IOAE 4WCEE 1VQ6E 5JVHE 5H1SI 5GADG 1S72E 5GAEG 1VQNE 3CD6E 1M1KG 1K8AG 1KC8G 2OTJE 2ZJQE 1M90G 3CC2E 2OTLE 3G71E 5MLCH 1Q7YG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 E;  1Q81 G;  1VQ9 E;  3CXC E;  4WFB E;  3CPW E;  4IOC E;  5DM7 E;  5JVG E;  3J7Z G;  3CCJ E;  3CCU E;  3I55 E;  5HL7 E;  1NJI G;  1VQL E;  3CCR E;  5GAH G;  3CF5 E;  1KQS E;  1Q86 G;  3CMA E;  5AN9 B;  3I56 E;  1YJW E;  1RL6 A;  4UY8 G;  3OW2 E;  2CQL A;  3CCV E;  2ZJP E;  4WFA E;  4U67 E;  1W2B E;  1QVF E;  1VQP E;  1VQ4 E;  3PIP E;  1K9M G;  1VQ5 E;  2QA4 E;  3CCL E;  3CCM E;  3CC7 E;  3G4S E;  4WF9 E;  1VQ7 E;  3CC4 E;  1VQ8 E;  3PIO E;  4IO9 E;  3CCE E;  4WFN E;  1YHQ E;  1VQO E;  3CCS E;  1YIT E;  1K73 G;  1VQK E;  1N8R G;  2ZJR E;  3CCQ E;  1Q82 G;  5GAG G;  1YJN E;  2QEX E;  3CME E;  1KD1 G;  1JJ2 E;  3G6E E;  3DLL E;  1VQM E;  1YJ9 E;  5DM6 E;  1YIJ E;  1QVG E;  4IOA E;  4WCE E;  1VQ6 E;  5JVH E;  5H1S I;  5GAD G;  1S72 E;  5GAE G;  1VQN E;  3CD6 E;  1M1K G;  1K8A G;  1KC8 G;  2OTJ E;  2ZJQ E;  1M90 G;  3CC2 E;  2OTL E;  3G71 E;  5MLC H;  1Q7Y G; 
#chains in the Genus database with same CATH topology
 1YI2 E;  1Q81 G;  1RJL C;  1VQ9 E;  3CXC E;  4WFB E;  3CPW E;  5B2A O;  2OY8 A;  4IOC E;  5DM7 E;  5JVG E;  3J7Z G;  3CCJ E;  3CCU E;  3I55 E;  1OSP O;  5HL7 E;  1NJI G;  1VQL E;  3CCR E;  3AUM O;  5GAH G;  3CF5 E;  1KQS E;  1Q86 G;  3CMA E;  5AN9 B;  3I56 E;  1YJW E;  1RL6 A;  4UY8 G;  3OW2 E;  3CCV E;  2CQL A;  2I5Z O;  2ZJP E;  4WFA E;  4U67 E;  1W2B E;  1QVF E;  2OL6 O;  1VQP E;  1VQ4 E;  3PIP E;  1K9M G;  1VQ5 E;  2QA4 E;  2OYB O;  3CCL E;  3CCM E;  3CC7 E;  2OY7 A;  3G4S E;  4WF9 E;  5B3M O;  1VQ7 E;  3CC4 E;  5B10 O;  1VQ8 E;  2HKD A;  3PIO E;  4IO9 E;  2OL7 A;  3IGE A;  4WFN E;  2I5V O;  3CCE E;  1YHQ E;  2AF5 A;  1VQO E;  3CKF A;  2OY1 O;  3CCS E;  1YIT E;  1K73 G;  1VQK E;  3EC5 A;  1N8R G;  2ZJR E;  3CCQ E;  1Q82 G;  5GAG G;  1YJN E;  2QEX E;  3CME E;  1KD1 G;  1JJ2 E;  3G6E E;  3DLL E;  3CKG A;  1VQM E;  1YJ9 E;  5DM6 E;  2FKJ A;  1YIJ E;  5B11 O;  1QVG E;  4IOA E;  4WCE E;  1VQ6 E;  2FKG A;  5JVH E;  5H1S I;  5GAD G;  1S72 E;  5GAE G;  1VQN E;  1P4P A;  2OY5 O;  3CD6 E;  1M1K G;  1K8A G;  3IG9 A;  1FJ1 E;  1KC8 G;  2G8C O;  2OTJ E;  2ZJQ E;  1M90 G;  3CC2 E;  2PI3 O;  2OTL E;  2OL8 O;  3G71 E;  5MLC H;  1Q7Y G; 
#chains in the Genus database with same CATH homology
 1YI2 E;  1Q81 G;  1VQ9 E;  3CXC E;  4WFB E;  3CPW E;  4IOC E;  5DM7 E;  5JVG E;  3J7Z G;  3CCJ E;  3CCU E;  3I55 E;  5HL7 E;  1NJI G;  1VQL E;  3CCR E;  5GAH G;  3CF5 E;  1KQS E;  1Q86 G;  3CMA E;  5AN9 B;  3I56 E;  1YJW E;  1RL6 A;  4UY8 G;  3OW2 E;  2CQL A;  3CCV E;  2ZJP E;  4WFA E;  4U67 E;  1W2B E;  1QVF E;  1VQP E;  1VQ4 E;  3PIP E;  1K9M G;  1VQ5 E;  2QA4 E;  3CCL E;  3CCM E;  3CC7 E;  3G4S E;  4WF9 E;  1VQ7 E;  3CC4 E;  1VQ8 E;  3PIO E;  4IO9 E;  3CCE E;  4WFN E;  1YHQ E;  1VQO E;  3CCS E;  1YIT E;  1K73 G;  1VQK E;  1N8R G;  2ZJR E;  3CCQ E;  1Q82 G;  5GAG G;  1YJN E;  2QEX E;  3CME E;  1KD1 G;  1JJ2 E;  3G6E E;  3DLL E;  1VQM E;  1YJ9 E;  5DM6 E;  1YIJ E;  1QVG E;  4IOA E;  4WCE E;  1VQ6 E;  5JVH E;  5H1S I;  5GAD G;  1S72 E;  5GAE G;  1VQN E;  3CD6 E;  1M1K G;  1K8A G;  1KC8 G;  2OTJ E;  2ZJQ E;  1M90 G;  3CC2 E;  2OTL E;  3G71 E;  5MLC H;  1Q7Y G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...