3CC2I

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cc2I00
2E34A 3CCQI 1QA6A 3CF5F 1YHQI 3PIOF 5GADJ 3PIPF 1FOXA 1FOYA 2QEXI 3CMAI 2K3FA 1S72I 3G6EI 1VQLI 3CCJI 3J7YJ 2NXNB 1VQ9I 3CCMI 2H8WA 1VQ6I 1Y39A 2ZJPF 4IOCF 3I56I 1HC8A 3CC2I 3CMEI 1YJ9I 4UY8I 5GAGJ 3CD6I 2JQ7A 3CCUI 1VQ5I 2ZJQF 5DM7F 1MMSA 3J7ZI 1VQPI 4IO9F 3CCSI 2OTJI 3G4SI 1VQMI 3DLLF 1YIJI 2E35A 2OTLI 2QA4I 3I55I 5JVGF 2FOWA 2ZJRF 1VQ8I 3CCEI 3CCVI 1VQ4I 1VQKI 3G71I 1YJNI 1YI2I 1YJWI 1FOWA 3CCLI 1VQOI 2E36A 3CC7I 5GAEJ 5DM6F 1ACIA 4V19K 4IOAF 1VQ7I 3CC4I 3CCRI 1VQNI 1YITI 3CJTB 5GAHJ
chains in the Genus database with same CATH superfamily
2VODA 2O3FA 2KZVA 4PJLA 2R7WA 1A35A 4RAZA 1IN5A 1JGGA 2X85A 2GLOA 3PL8A 2CQQA 3U1DA 3FXOA 1SD7A 2L9RA 2OPTA 2EA2A 2X4HA 5BS6A 3AFHA 5FJ8J 3I53A 3K1NA 4MEYF 1QQIA 5FLMJ 1S7AA 3CZ6A 2JRMA 3HZJA 1JHHA 2M0MA 5ERIA 1PP8F 3MKYB 1YQAA 1EJ9A 3FZVA 3SDBA 1HOMA 2M34A 1ORKA 2P4WA 1JI8A 3GFIA 1FBUA 1EV7A 4BS9A 2LSOA 4Q47A 2K4BA 3NARA 2W25A 4EJOA 2X6OA 4NC6A 2MBFA 1X3UA 1FSHA 4IQJA 1V5EA 2V6CA 3H9JA 2OA4A 4M3DA 2Y0MA 3CCUI 2VQCA 4Q4ZF 2ZXWH 4HDUA 1KYWA 4XR6A 4KN7X 1ZHFA 2M87A 2PEXA 2AHQA 2MYSA 5K7HA 1XSXA 3R0JA 3BC8A 3FIWA 2CWEA 2R5ZB 3CJNA 4UUTA 5CKTA 3O8HA 1ETWA 3KPHA 1T0FC 2XB0X 2K5CA 2ECCA 3DLAA 5EGOA 2P0WA 4ZYAA 4DIQA 3TDZC 2ZXJA 2P6SA 2E35A 2VOPA 2FNPA 2ESNA 2XF7A 4IHYA 3FHZA 5C44J 2Q1ZB 3ASNH 3FXRA 4RAGA 4B1RA 5F6FA 5K5OA 2VL8A 2COMA 2W85A 3I4NJ 5M5YJ 1MBEA 2FBHA 4UNOA 2ESHA 2KDOA 3GLXA 1Y6IA 3FXKA 4BH9A 3GTJJ 4G7OF 1QZYA 2D5VA 1B59A 4IRHA 2QM3A 5KK1A 5FB2A 1UJ8A 4MQ9F 2ID6A 2N8GA 4H0EA 3MD2A 2ZBKA 4HX7A 1TL8A 1QU3A 3ZXSA 4OIOF 5DUKA 2MH2A 3BTIA 2BY0A 1FBSA 1WJ5A 1FZPB 3HGYA 3K1MA 2GXGA 1TP4A 1I1SA 4XOPA 2BXYA 5ICEA 4EVIA 1F9NA 3ECHA 3IV5A 1XPXA 1B1BA 3T5XA 1DGWY 2X0LA 3UKGA 5JLXA 2PG4A 1O7FA 4P9FA 3D5RC 3SXYA 4A93J 1AKHA 2IXSA 2NS7A 1QBJA 2AXLA 1MNDA 3BTJA 2A05A 1X1AA 3FF5A 1KQ0A 1BI1A 2OU2A 2M30A 1Z7LA 2HXOA 2NXNB 1K61A 5KAFC 2XDVA 2OZ6A 3LSPA 3G1LA 3GTMJ 5K7ZA 1PUEE 4C3IJ 3BZCA 1WGXA 4KMUX 3FKJA 3I5UA 4EJWA 5JVTA 4Z2YA 2HQNA 4ZTFA 1GV2A 4CXFA 2ZFUA 3HBLA 3OIQA 1XMAA 2NYXA 1FX7A 4AWXB 1O3TA 4KICA 1UB9A 2D1HA 3FX3A 1IRXA 5E3OA 4KNYA 1H89C 2CW8A 4RAFA 3LSJA 5LD2C 4JQFA 1JUSA 1FP2A 2ICWG 2ZCWA 3V8JA 3WHCA 4PSWA 1IXRC 2LF8A 2FE3A 1O3SA 4HBLA 4ENKA 2MW8A 3DTKA 3KYCB 4FHTA 1G3SA 3BR6A 2PLYA 1AU7A 2DMTA 1OR7A 1OQYA 4OINF 3ZMVA 5IYCJ 4UUSB 2W82A 2HOAA 2ZMEB 2CW0F 4EEFG 1TC3C 1WSUA 2M4KA 4C9YA 1XSVA 2QA4I 2OQRA 4M9ZA 5ICFA 3JRBA 2HTSA 1G59A 1MH3A 2QQ8A 5D5XB 1CF7A 4L9NA 2HKOA 4CH7A 3JSPA 1OCCH 2CUEA 2ELKA 3E5UA 2Z1DA 3KCCA 1Y8RB 2VKHA 3LA7A 2LH9A 1Y8QB 2CMPA 5K1YA 1BC8C 4Y15A 3L09A 2BXZA 2MABA 1LE8A 4E7IA 1K7AA 2K85A 5HNFA 2GBYA 2BOLA 2W00A 5J6XA 2JSCA 3SJMA 1BR4A 4HW0A 1J09A 2EFPA 2O5RA 3R4KA 3KP5A 1VQNI 2BY3A 3DEUA 3P9KA 1SFXA 2STTA 5HLTA 3QP6A 4C30A 4U0WA 4CGZA 2ECBA 2UXXA 4E7ZA 5L3FA 1MZBA 5EJCA 2O6GE 4KT6A 3HKZN 2H6CA 4J00A 1N75A 2CSOA 2FRHA 4PSXA 2EZLA 1RPWA 3R61A 3NWTA 1WH7A 5E1ZB 3V7RA 1GHCA 5E8IA 3CCQI 5K5RA 4LFUA 3WU1B 2FBKA 1YIOA 1JTYA 3QYBA 2RQPA 4BEHA 2PJPA 1REPC 1ZR4A 2F5VA 1R22A 2VI6A 4G7ZF 2K3FA 2IW5A 2K27A 4QLCU 1RUNA 2CFXA 3G6EI 1VQLI 2WWYA 1JHFA 5TJJA 2FMYA 1I3QJ 1A6IA 2VN2A 3IAM2 5E3MA 2TRTA 2H8WA 1WJAA 4BE1A 3OYNA 2DFFA 2O9LA 2DFIA 1ETOA 1IDZA 1R1TA 5A2QK 4HQEA 3CJRB 2IGKA 5K5QA 2XAJA 3N05A 3U2RA 4JX6A 1W0TA 1T38A 2FNAA 1Z9CA 3PSIA 2K3PA 2F5EA 1MMDA 2XB5A 2KJBA 3IP4B 4D7MA 2VKDA 2DQRA 4PZJA 2HDWA 2X6WA 2XUBA 2CH0A 4RDUA 2I8DA 4P96A 1OCOH 2GA1A 5F0CA 4E7HA 2IA0A 3MCZA 2RN7A 1QNTA 2JUGA 4D7NA 3WTYC 3E6CC 3A2KA 3K9TA 3FXLA 4NQWA 3LQRA 5FLVA 1ZGWA 2F6CA 3G4SI 2BV6A 1O57A 5E17F 5CVIA 1DPUA 1LEBA 3SQNA 3K4LA 2HQ5A 2VPRA 4L0ZB 2VONA 1YW9A 1UG2A 1XB4A 4WXDA 3ZQCA 3ISPA 5GPAA 3K4BA 2UZKA 1QPMA 2QBYB 4N9IA 1BOBA 1MSEC 1EKEA 1U3EM 2L02A 2DU9A 3L7WA 5K7FA 1H8AC 1UHSA 3FXQA 2FUG2 2MLGA 3HSFA 1MJBA 3G73A 1G8XA 3HSRA 3H5RA 3D5SC 2CGPA 4CCLA 2KRCA 3SFZA 4GCVA 5IT3A 1VQKI 4YFXF 4CDGA 2IP2A 2F48A 1QRYA 3C7JA 1K6OA 2WB1N 3BJAA 4DZPA 3DPTA 3H35A 4HAMA 2DJIA 3LSIA 4IL6C 3LMMA 4PGGA 1YFHA 2ZO4A 1LKXA 5CJ9A 3ERED 1IGNA 4ASNA 2L7KA 3ZQLA 2YU9J 2UWMA 1U8RA 1FEXA 1R7JA 3MZ8A 3C1DA 3CLOA 1BR2A 2M7BA 3DCFA 4J01A 3ZP5A 2DXIA 3DP7A 4M9SA 3E5QA 1UELB 1TNSA 2L7ZA 4XMYA 3WTVC 1B9NA 1T0FA 5JR3A 2QQ9A 2NVYJ 3M1CA 1MKMA 3DU5A 6PAXA 3D5LA 3OYCA 3PIOF 4E7JA 3PFYA 3FMSA 5L3BA 3W6KB 1FYMA 2DPUA 5FKNA 2VC1A 1ETYA 5FKOA 3G1OA 2Z5UA 4UHTA 3L9FA 1VNDA 2HPMA 1E2XA 2P5KA 3RPUD 1VQ9I 4II3A 1S9HA 3DWLE 2OCEA 2WTEA 1TT0A 2L4MA 4RS8A 4XKCA 5IT9K 3JCUC 4L9VA 1YS7A 3HXLA 2XVCA 3RYPA 1IN4A 3KP3A 3S2WA 1S5LC 2LF7A 2R7RA 4NBQA 2WC2A 3S17J 3TEDA 1NG6A 2K9QA 4B3AA 3E0JB 1O7LA 3OYFA 1D1AA 1ZG3A 2XAFA 3NQOA 4EM2A 2DDAA 2DBBA 4U88A 1T2KA 2ZJQF 1MMNA 2KRHA 4IEJA 3BQZA 1YRNA 2L7MP 3PFIA 2IT0A 2ETHA 3JRIA 1MW7A 4P1WA 3OS0A 4G9YA 1T8IA 2B63J 1YW8A 5ICGA 5FROA 3GO5A 2FBIA 2QSFX 4GDFA 3IWZA 3AKZA 1VQMI 2A69F 2FD5A 1PUFB 1XGOA 2LKXA 2YUSA 3JRFA 2PJRB 3BPXA 4BE2A 1MH4A 2E1OA 3HTUA 2BY2A 3DF8A 4CA0A 3LA2A 5M3FJ 4EGZA 2HZDA 2DPDA 3LAJA 1T39A 1TQMA 3OSFA 4NHJA 4EMSA 4XNFA 5LGNA 5GTHC 3JAMK 3LNQA 3Q0UA 4LIVA 3MKLA 3MWMA 3TO7A 1S7OA 2EILH 5BPDA 3F8BA 4B43A 4DYRA 1X1PA 4DJAA 4PDKA 5F08A 2BGCA 3G3ZA 4XLEA 4IHVA 4UB8C 2IGOA 4BGDA 1ZRDA 3HRTA 2WAQN 1V3FA 5LGUA 5D5UB 1R5ID 4KA4A 4BUPA 1SMYF 1YX5A 2W7NA 3CC4I 1EA3A 4F7ZA 3FWEA 3BG5A 3OYMA 4ABZA 5J1UA 3X2QH 1TWFJ 4NC7A 4J19A 2VUMJ 3EUAA 1N78A 2H27A 3C3WA 4MFEA 1EF4A 4HNVA 1SAUA 3E6MA 5E20A 4HF1A 4B3XA 1Z1DA 2QQAA 4R79A 4JOMA 2CQKA 4Q48A 5LBQA 4ZJZA 5DD8A 2F4MB 3FMRA 1G2HA 3GUDA 5CVRA 2V26A 3V42A 3E6BA 4RM2A 3S2HJ 2CQNA 4XSZF 3S93A 5FRMA 3TW7A 4KIBA 4I6ZA 2L0KA 5HODA 2Y2ZA 3BR2A 1QVUA 5B5EC 3JRGA 3E3VA 2L54A 3KX2A 9ANTA 4V2FA 3BTLA 4IKFA 4A3CJ 3BR1A 3CESA 3UNGC 2IS1A 5DTDA 2XAHA 1J2XA 5B66C 2UV1A 2FXAA 2G7UA 2ISYA 2GA2A 4I76A 4CCNA 1G6NA 1QO0D 2IGMA 3I54A 3ONQA 5HDGA 4ZDLA 1TLHB 2L01A 3MKWB 4G8XA 4ZYDA 1JKOC 1F43A 1UHMA 5LRSA 1J9IA 1K4SA 4NC8A 4KIFA 1ENHA 1F1ZA 5J40A 5HS8A 2XAUA 1IXCA 2DA6A 3BJ6A 4FX4A 3GTQJ 3VYSB 2OTJI 1WKMA 4G6TB 1BI2A 3M8FA 4WXCA 5F0FA 2DA7A 2DJNA 1QZZA 1W36C 1HSTA 1Z3YA 3BG3A 1W7PD 4HNUA 1P4WA 3ROUA 1I6XA 4XKWA 4MTDA 1LVKA 1MJ9A 2LFBA 1MD0A 2ZSIB 4L18B 1LDJA 4CUGA 5HLGA 2JWTA 3EYIA 1R23A 4AUXA 3CCVI 3CCYA 4IRIA 2XSDC 4RM3A 2K9LA 2XKPA 1OPCA 5HS9A 1BL0A 3ZCOA 4BHPA 2ID3A 3CO6C 1RIOH 4M73A 4PGHA 1SD6A 4AYBN 3CUOA 2BHYA 5IPAA 3EDPA 2HZTA 3KYDB 5TRDA 3TGNA 1USSA 2P81A 3S1RJ 3CDIA 2NOGA 3VEPA 3HTSB 5IYBJ 1ZGAA 3DKYA 1OYYA 1RUOA 4P9UA 3WE2A 3ABKH 4V2GA 4Y13A 2IVMA 4JX5A 3FM5A 3S1QJ 1F5TA 2ZJ2A 2L3DA 3CJQB 1FOXA 1FOYA 4Y7NJ 4UVCA 3BG6A 3BDDA 2Y0SA 1FYKA 1AWCA 3LWFA 1WWXA 2MG4A 2XHKA 2EJRA 5F1JA 5DS9A 1PDNC 1P7JA 4MFDA 4OIRF 1QHHD 1IDYA 1C0WA 2ZJPF 3REOA 5L3GA 1IN8A 3A02A 3I59A 1LVAA 1T56A 2O61A 3ZMDA 2W4SA 4UUSA 4JK1X 2W24A 3BZKA 3K2AA 3RKQA 2ELJA 2IJLA 2QF7A 4RB3C 2LREA 2M7AA 4LJZF 3GTKJ 4M6XA 3E97A 2O7OA 2OCCH 4BQAA 2CG4A 4IHXA 1S29A 1SD4A 2JPBA 4IHWA 4M3EA 1FYLA 3OR2C 1S7EA 3M07A 2GOXB 4AIHA 1ZG5A 1FNNA 5BNGA 2L4AA 5EDNA 2XV4S 2DT5A 2CUJA 3OYDA 3L2WA 5HLHA 1P92A 3QPTA 2E7XA 3EUHC 4M9XA 4EJVA 1SFEA 1XTAA 4B47A 4YIFA 3HL2A 1V4RA 4ESBA 3KP2A 2K86A 5E3NA 1RKTA 4PUSA 4GO1A 2XKOA 1IC8A 4GGGA 3O3KA 1CGPA 4UXNA 2E1NA 4C2TA 1CQTA 3PM1A 2NVQJ 2K40A 1I27A 4ZTJA 5BOXA 1OCZH 4IXAA 1YE9A 4KT5C 5FRNA 1Y1WJ 2ADUA 2Y75A 3W6VA 4PK4A 1L3LA 4CYCA 3DBHB 3RJPA 1FTTA 2P5LC 1LPQA 5CPRB 5LHIA 2GM4A 1Y56A 1S8NA 1T6SA 4X1EA 1WVRA 1TWHJ 5HNHA 3NAUA 2IAIA 1KU9A 1R49A 3IH2A 4LLLA 5CYVA 3ZR8X 2A6TA 4AIKA 2QCOA 3G2BA 3ZQ7A 3CDHA 3GZ6A 4KDPA 3CJTB 3QRFF 1U5TB 1ON1A 4M3GA 1EH6A 2XGCA 4IRGA 4A5NA 4K2EA 4XLNF 3GCMA 3BJOA 3HOXJ 1JKQC 1KU7A 2HYGD 4DBQA 2HGCA 2Z16A 5GADJ 3KIOA 1ETXA 1TTYA 2TCTA 4ESJA 5F1RA 3MZHA 3BR3A 2VJJA 2A61A 2NVTJ 1FWZA 4N4NB 4OIQF 3KZIC 1SFUA 2Z99A 5IP7J 1FPQA 4LB5A 2K4JA 2GXAA 2DMNA 2FQ3A 2L9VA 1FIAA 4HV6A 1ZKGA 1FLIA 1ZLKA 3DPLC 2Q0OA 5HDKA 3PQJA 5M5XJ 2FEZA 2V6EA 1TWAJ 4YEJA 4D9JA 5ILVA 4A69C 5A2QZ 2ME6A 3M9AA 3AL0B 4HPQA 2OQGA 3QOEA 3ML6A 3VB2A 2G9WA 5CVUA 1TZLA 2KLOA 3K4MA 1XSDA 2LMDA 3BR5A 4IQ4A 2E2IJ 2XAQA 3QPHA 1BN5A 4I01A 4S04A 1XCBA 5CVJA 2LY9A 2MLKA 3QP5A 1UCRA 4DYCA 1LEAA 1BC7C 1FMWA 2NVXJ 3Q9SA 1MDMB 3E7LA 3K69A 4HYEA 4I02A 1Z67A 2ZXHA 2GOMA 4RB0A 4A6EA 1Y1VJ 1BI0A 1UMQA 4H4KC 1YLFA 2FQ4A 2RNGA 3K6GA 5EEHA 2LBFA 2MGQA 5FD5A 3RPUA 4YFNF 4RB2C 2KIUA 2X1EA 1JJ6C 4HOBA 5HS7A 4XRFA 3H0DA 3BZ6A 3CUQB 2OTLI 2IGNA 4BHBA 4XM3A 3EPZA 1ON2A 4M6YA 4AIJA 2DYSH 2VOOA 1O4XA 3PQKA 2LP0A 2BW3A 2Q2EB 1D3YA 3P9IA 4MEXF 3EQLF 3ZN0A 1D0YA 3J81K 3OIPA 3M7GA 1WJDA 4A3MJ 4FTHA 1POGA 2EZIA 2Y9YA 3FK6A 1MNEA 4DNCA 5GPCA 3ZOBA 2MH9A 3SHFA 3A01B 2LYCA 4BJTA 4WCGA 4XLHA 4BXUA 2NAZA 5ED4A 1K78B 2HOEA 3ZQFA 2R5YB 3OSGA 1X4PA 3I71A 3DKWA 3KYLA 5EZGA 1Z77A 1IZ1A 3RZDJ 2HYJA 2WY7Q 2VB6A 4A3IJ 4NB5A 4RA2A 1AHDP 5D5VB 2OD5A 3FDYA 4JYKA 2KIFA 1YW7A 1FOKA 2QYOA 4EGYA 4LGWA 3OYGA 4BYYA 2HQAA 1IV8A 2XSJC 3QPLA 1D5VA 2ZNYA 4BBRJ 1IRGA 3ZGKA 2MC3A 1WRJA 2X6YA 3VDXA 3PNVA 4E4HA 1BBYA 3SEQA 1D1BA 4I98B 4PJ0C 3ABLH 1ONVA 5KCMA 1J5YA 2LG4A 4IF4A 2EB7A 1V5FA 3GTLJ 3KLOA 2V1DA 5BQTA 1TWCJ 3I0TA 4DW6A 2M5WA 5LGTA 2FJ1A 1PUFA 3HOYJ 1E3PA 2LK2A 2CO5A 4LG3A 1OMIA 4ON0A 1DPRA 3CD6I 4HNTA 2JVHA 4BQOA 4II2A 3FKIJ 3LFUA 5TGTA 1IRZA 3N4MA 4MO7A 3OYJA 2K02A 5BPIA 3QOPA 2CV2A 1GLNA 2GZWA 2DA5A 4CCJA 3BT9A 4YIRX 4P55A 3CO7C 2H94A 2LDUA 4WX9A 4XKVA 3MQ0A 3A0BC 3F8NA 2IS6A 1N77A 2I5UA 3PSFA 4HZFA 5D4SA 4A3KJ 4IPAA 1K79A 2R92J 1OYWA 2Y30A 3AL0C 3HRUA 4FCYA 3ZMSA 3T8TA 3C18A 4HDVA 4ENMA 3I55I 1U9NA 2M1BA 2BYVE 2Q8KA 1VQ8I 3JAMZ 4FX0A 1XDSA 3RCOA 2HNHA 1BR1A 5CQGA 2Z33A 2OC6A 1R4MB 3LA3A 2R7UA 4PJNA 2PI0A 1RI7A 5J1RA 2B0LA 5CLSA 1W5TA 1WJCA 3MFKA 2V9PA 2DDBA 3PO2J 1AOYA 4UVAA 1ETQA 3K7AJ 2JA2A 2R3SA 3E6DA 4B48A 3ASOH 1I5ZA 1ZK8A 4BDZA 2R7QA 3RKYA 2COBA 1IRFA 1X1BA 1STZA 1SFKA 2AS5F 3HDDA 3CUQC 3OS1A 1VI0A 4QPQA 5D8LB 1B8IA 3EUHA 1X1DA 2DMUA 1U9OA 3SZPA 2ACJA 1HDPA 1V55H 2Z9OA 4HRIA 4B8XA 3W2VA 2O03A 4ENJA 4FISA 1MBKA 2VQGA 3HPHA 5ILUA 5HDNA 1FBQA 1MMAA 2BHZA 2GIVA 2B9SA 2LR8A 3DPUA 2ZMEC 3P5JA 1JKPC 4XSXF 3J80K 3I4PA 4PCQA 3GF2A 1NH3A 2WY8Q 3QAHA 1U0JA 4RAYA 2M2EA 1KONA 2JJ7A 1FMVA 5DCFA 4YG2F 4OAYA 4XOTA 4HF2A 2JA5J 2Y48A 3H3UA 2GXBA 1SVLA 4GXOA 4UY8I 2P8TA 5GAGJ 3GZNB 2DO7A 1WZ2A 2R7TA 2CV1A 3GXOA 2FMLA 5EF6A 4XLCA 2EFQA 1P9QC 2QENA 2X9DA 3HRSA 4MNUA 5D4RA 2HS5A 1Z3XA 3E1SA 3HEFA 4RGUA 2MD5A 2HWVA 4X0GA 4L5JA 2HI3A 3KEYA 5ILSA 5LLQA 3H36A 4IO9F 3KEOA 3KP7A 4X6AJ 2X1DA 2Y31A 1B72B 2PFBA 3F9KA 1XG1A 4L0YB 4CZZA 3FBIB 4HSRA 1WQ2A 3Q0VA 4EJTA 2E19A 1W5SA 4U87A 1X19A 3WTZA 1Q1HA 4B09A 1NHAA 3LSTA 2LTPA 4L9TA 1GVJA 4RLQA 2V1XA 2CYYA 2DTZA 1RETA 4I99C 4MGRA 3HOTA 1CF7B 1VZ0A 2V1UA 4BQQA 1P2FA 2KHMA 1YTYA 3CP2A 3IAS2 1H0MA 3M1EA 1VQ4I 4KUMA 3U21A 1UG0A 3M3YJ 4E70A 4DZJA 1LE8B 2STWA 3F21A 2XIGA 5C3EJ 4IHSA 3WGHA 3QU3A 3F6VA 3LSGA 1FOWA 1MJAA 4HEA2 1APLC 2AQEA 1X4OA 3BR0A 3QPSA 4BDYA 3WG9A 1ULYA 4IOAF 1A04A 3VFZA 4BJ5C 3O6BB 4BAYA 3L2VA 2FU4A 4ZZDA 4M6VA 2A07F 1I3AA 2HKXA 1AA7A 1KQ8A 2E34A 2VPLA 3F6OA 2F5FA 3I3LA 1MSFC 1R4NB 4AIDA 4AVPA 4BEHB 4C3HJ 4D0PA 2K9MA 2X1CA 2D1VA 2NRAC 1UHWA 4PJJA 1PVEA 1T33A 5FLXZ 3CMAI 2JA6J 1ZELA 2DK5A 2E71A 2KMUA 4XN3A 1S72I 1A31A 3W6JB 4N4OB 4Z6YA 1LQ1A 2EFNA 1FC3A 4MLOA 1ETVA 4I2OA 1R36A 2CV0A 1BA5A 1FTZA 2EIMH 2Y69H 4CCKA 2HVRA 1FJLA 2P7VB 2GIZA 2EV0A 3TL4X 2I10A 1P4AA 4IVNA 3WTSC 1Y39A 1MBHA 2P5VA 2XROA 1TW2A 3K70D 1R5GA 1YS6A 1KYZA 3VSKA 3QQAA 4MIMA 1PJRA 1QZEA 2EZHA 2OAZA 3WGGA 2BE5F 1WI3A 3MZYA 4MTEA 1BW6A 4BJ6C 4HX4A 1OCTC 2PMZA 3H5AA 3RI4A 3HOUJ 1F36A 1IO2A 2JQ7A 1OLTA 2IRFG 5LEKA 4CCOA 2V4JC 2VJIA 2OV7A 4FQGA 2M3AA 3F8MA 1Q1VA 4E7KA 1WI9A 2JT1A 3R60A 1H9TA 1ZN2A 3DV8A 4NQWB 3VSLA 2R5ZA 2ISZA 3MVPA 5M3MJ 4YRVA 3B73A 2R7XA 2GQQA 1W7PB 1TQIA 1ZR2A 2A5WA 4A0XA 4OMZA 1HDDC 4S05A 2O8XA 3HM5A 2X6XA 2ZXIA 4E7SA 1LDKB 2XPVA 3BROA 4CZCA 5IOYA 3HSEA 2J5OA 4Y3OA 2JRTA 3DFGA 5DCMB 4WK8F 1ITYA 1WPKA 2YX7A 4M72A 3TDUC 3F22A 3LSKA 3CCEI 3PUFA 1HQCA 1R9TJ 4CYDA 1R71A 1KGSA 2J5PA 2VT2A 2VIXA 3SZTA 3M8JA 1WH5A 3H3ZA 2RNJA 3CMYA 3OS2A 3S2DJ 2VXZA 3G71I 1YJNI 3RIRA 4LOCA 4XN0A 1IJWC 4PFOA 2XC7A 2E1MB 2E36A 2QUFA 5E8GA 3DBRB 3FISA 2A6HF 3PJRA 1Z6TA 2E5ZA 1VF9A 3HRMA 4RB1A 3PUBA 4G7HF 4HV5A 1IN7A 4MQVA 2VT3A 1Y0NA 4U0VA 1PP7U 3G1MA 1F4KA 3LQQA 3PNTA 4AD9A 4UV9A 2UUZA 5D6FA 2H1KA 2IA2A 2M0CA 3FMQA 1USTA 3Q5FA 3DKXA 4A0YA 3GMEA 3UR3C 1NK3P 2HYFA 1SFOJ 3SFIA 3AG3H 1J7KA 5L3CA 3F8FA 3GZ5A 2L5QA 2E5NA 4UV8A 2QQBA 3GBGA 2Y9ZA 4HG2A 4L5EA 3J7YJ 2R7VA 3GEZA 5E1WA 1LB2A 1WJFA 4QWQA 4HQMA 3L2CA 4OAZA 2CQXA 2CUFA 4M3FA 4AU7A 1IW7F 2RVCA 3OR1C 4ZYGA 1P4XA 4BXXJ 5JHFA 3CMEI 2YS9A 4F92B 4O3MA 1SD5A 3HPGA 4G6DA 3GTOJ 2RC4A 2JN6A 1W0UA 4XRSG 4OOIA 2JA7J 4CICA 5KAIC 3MMYB 4UUVA 2WBMA 1YRNB 3CUQA 5LFAA 2DCEA 2H8RA 4BE0A 3KE2A 2RV8A 2DOEA 3HYIA 1G3YA 1ZARA 1XMKA 3K2ZA 4FE4A 1WJBA 4KN4X 4G6QA 5LEJA 3OOPA 2EZKA 2Q2EA 3L2RA 4UVBA 2ZKZA 1P7IA 3S15J 1OISA 2RREA 2WAFA 1JUMA 3TOBA 1DDNA 4ZDOA 4U0YA 1XCVA 3TW6A 2VJ4A 3TQNA 3HUGB 1HW1A 1E3OC 2DQLA 2ZMEA 2JA8J 2HFHA 3IC7A 3E5XA 1I1GA 1NTCA 3A01A 2XRNA 2KFDA 3JRAA 1R5HA 2TDXA 1D0ZA 1JTXA 3ABUA 1W1WE 2NS0A 2G0EA 1ZAOA 4U7DA 4XQFA 1I50J 2WA0A 4EATA 2LNBA 2R0QC 2IS4A 2Z3YA 5F64A 2PQ8A 4G94A 2F2EA 3IL2A 2KIQA 3A0HC 3VOEA 4XIDA 3QWLA 2L9NA 4ZDPA 5IY5H 2XAGA 1YJWI 3CCLI 3DTIA 2XGDA 3J81Z 3OYEA 1TWGJ 1X58A 4S0HB 1MBFA 3C2HA 1RESA 3RDIA 2V9VA 3COAC 2Y0SN 1W5CC 3RSNA 1YITI 3BCAA 4GRIA 3MAJA 4M74A 4WF2A 3IHUA 3VODA 3KFWX 5E18F 1D8KA 3AG1H 2VKEA 3HG9A 5GTIC 2W84A 5GAHJ 3SDGA 2DW4A 4Y4RA 2CUZA 2BEOA 4A3BJ 2H6BA 5FO5A 2VBYA 2R93J 1N25A 3BQYA 3B6AA 2XGEA 1KQ9A 2V1NA 3FXMA 2XPWA 1XC5A 3GFMA 2NVUB 3R0AA 5J47A 2M8GX 4JP0A 1TNTA 2VE8A 3GWZA 2JZYA 1RKWA 3H5NA 1SMTA 2F4IA 2KISA 2A68F 1ZRFA 3LOCA 2E1MC 3F8CA 4EM1A 3C2GA 5D6EA 1K4TA 3R6SA 1D0XA 5AONA 1ZTRA 2QSGX 2ZC2A 3ZPLA 4C2MJ 3GYHX 1HC8A 3IH3A 4QPOA 2PBIA 4D5CA 2QGUA 1X3ZB 4UB6C 4ENNA 1RZ4A 4JBAA 1DQUA 4BY7J 3BPVA 4C2UA 3ZRGA 4CO8A 1FT9A 1G3WA 4RMNA 1SEUA 3L00A 4LG0B 3QYEA 2W48A 5FKKA 1XS9A 5DDGA 5BMZA 1E0EA 4BACA 1HXDA 1TW3A 3D0SA 3T8RA 4LMYA 3KP4A 3JW4A 3TP0A 5D8KB 5FD6A 2HVQA 3IKVA 1MBJA 3KZYA 3H3VK 2QLZA 1H9GA 1IG7A 2PX9A 5JI6A 2ZFWA 3QYFA 3W2WA 2EFOA 4E6KG 1EH7A 1HSJA 2VJ5A 2XRLA 4GYIA 4B44A 3NRVA 3S3NA 2DA2A 3CP8A 4A3EJ 4NUBA 1HCRA 4DGWB 3VYUB 1YIJI 1EH8A 1DGRM 2DK8A 4JX4A 2QVOA 3WTXC 5DYMA 3ZMTA 3ZN1A 4EM0B 3V4GA 3V7SA 2KPMA 1I39A 1HKQA 5LRRA 3P9CA 5H6QA 2QBYA 4XK4A 4L9JA 3M4OJ 2HU9A 4LD5A 4RGRA 3WODF 3DEEA 4WXHA 5B1AH 1HW2A 3SEZA 2NNYA 1ZGJA 4F52A 3HHGA 1LDDA 4G12A 3JTGA 1P6RA 3K4NA 4D1QA 3KLNA 1E3HA 3BWGA 3S3MA 3H9QA 4HSTA 3Q0WA 1VFCA 4W97A 4I7HA 1BI3A 1NK2P 3QODA 2VASA 3IH4A 3OYAA 4E7LA 5EG0B 4A3JJ 2CU7A 2EIKH 2MD0A 2V9KA 2F5DA 2WAEA 3MN2A 3I58A 2BVMA 2AXTC 3DU6A 3CTAA 1ZQ3P 4LK1F 3GFJA 1RNLA 4W1UA 4A2UA 3TOAA 4D5FA 3CF2A 5FKLA 3OY9A 4L5IA 1O3RA 3CDLA 1YX3A 3C2BA 5FKMA 1QA6A 1G4DA 3A03A 4KYWA 4CSWA 2DMQA 1HKSA 1A5JA 1GUUA 1OCRH 1X3WB 2VBZA 1R1VA 4F3QA 3OYBA 2LD5A 2DA4A 3H0GJ 3OYLA 3EETA 3CCJI 2HEOA 2JK3A 1ODDA 1Z21A 2XGXA 3HKZA 2HQRA 1LNWA 1VTNC 2P7CB 3I59B 3IRQA 1SVOA 2X51A 2EH3A 5DEQA 1B72A 3WU0A 4KITB 3J80Z 1XD7A 2YPRA 5J3LA 4YELA 5F0HA 4A12A 1R58A 3TP3A 4EJUA 1YJ9I 2BBYA 2KDZA 2YSRA 2V7FA 3O8GA 3HOVJ 3ABTA 1RC9A 2WV1A 4FE7A 4A3FJ 3BLYA 3ZQQA 2EFWA 3FHNA 1VQPI 2JUCA 2DMPA 1J59A 3WTTC 1HBXG 1DU0A 2IBDA 2DA3A 3HOWJ 1XN7A 4Y33A 2V79A 2CFOA 3ESWB 1DU6A 4ESFA 1KU2A 3B6CA 5IT9Z 1NG7A 4N0BA 2F5CA 3DLLF 1U5TC 2BZTA 5L3DA 1XGNA 3VPRA 4F91B 2PJRA 4A3GJ 3GFLA 4IX7A 2NNNA 2JSPA 2GWRA 5IYDJ 3GTPJ 1O3QA 2VQLA 2HDCA 2LLKA 4O6JA 1IUFA 2DOAA 3ZMZA 3CLQA 3V8KA 2MA3A 5JVGF 4BNCA 4QIWN 4ZYEA 1FIPA 3O2PE 3AG2H 3RQIA 1U8BA 4P5OA 2DTRA 1MIJA 4Y52J 1K6YA 3MEXA 4XKBA 2CW7A 3OOUA 3WHBA 3ECOA 3TBIA 1X2MA 4CYCB 4I09A 4A6DA 2HOTA 3WTUC 3KETA 2ELHA 4IZZA 3GTGJ 2EK5A 3W3CA 2FF4A 4FETA 1S3JA 4FASD 4EV0A 5EGOB 2E7WA 1MGTA 1ERDA 4BU2A 2DI3A 3U1KA 3DBLB 3OWTA 3H92A 4KMFA 5GAEJ 2XF6A 1ACIA 2IA1A 4V19K 5F27A 4ITVA 3VYRB 3CCRI 3BOQA 1HA8A 4R8HA 3GLLA 2EA4A 3RKWA 1JJ8C 3CMMA 1D1CA 3OYIA 4AC0A 2CJJA 1J0RA 4F55A 1QVTA 2DT6A 2R4GA 2WB1A 4M71A 1KU3A 4KISA 2BY1A 3I4MJ 1K83J 5LHHA 3F23A 3CF5F 1OKRA 2LOOA 1HLVA 3S1NJ 2KP6A 1FY7A 1Z7UA 2KQRA 3V8LA 1R6RA 4XBFA 2QKLB 3JRDA 4BQNA 2KT0A 4GFBA 2RKHA 4HLXA 2QZ8A 4XORA 3L2QA 3S3OA 3IRRA 4FT8A 5H20A 1A36A 1T08B 3LAPA 4OWRB 5EEAA 5L3EA 3Q3SA 2NOJB 2B7EA 1ZRCA 5DUIA 3BG9A 5CQEA 2EQRA 3ELKA 4PJMA 2PMUA 4LB6B 4BY1J 3FK7A 3CC2I 1OJLA 1UFMA 3JR9A 3L2UA 1BOAA 3HHHA 4GYGA 1AKHB 1W7PA 2R7FA 2HOSA 2L2OA 4IHTA 1ZG1A 5EYRA 1J75A 2CRGA 4XONA 3BCBA 1YG2A 2L9SA 2VBXA 2VQHA 3ULQB 3KP6A 5C4JJ 1VQ5I 5GP9A 4TV7A 3WTWC 1ZREA 1GXPA 3M8EA 4XLFA 5AIQA 5DCMA 1JT6A 3W2AA 2L7FP 4N9HA 3DTEA 3T0YA 3EYYA 4B4CA 2H09A 2VE9A 1X2NA 2RDPA 2HPIA 2DAOA 4U7BA 4AVZA 3LSMA 5E3LA 2M4GA 2WV0A 2R7OA 2XPUA 2LBFB 4LIUA 1R00A 2KJCA 2YU3A 4BKXA 4BBSJ 2E2HJ 2MC4A 2OJED 1WFXA 2RGVA 3GW2A 3LFKA 4RGSA 3HOSA 1LFBA 4QSHA 5KHDA 4R1HA 1JKRC 2D2WA 5HVQC 1MNMC 2EINH 5HLIA 2QKMB 3QU6A 1BJAA 3LSHA 1SC7A 1QGPA 2FOWA 3ZQGA 4YIIA 1U6GA 2BW3B 5ICCA 5IP9J 2ME0A 5E1XA 5IP6A 1RRJA 3DEWA 1JUPA 4XRMA 4BXFA 5J8FA 2DN0A 2H1LA 4ZYHA 4ZH4F 2M8EA 2PN6A 4XRSA 2LY2A 4XLAA 3MKZA 3A4CA 1D8JA 2E2JJ 3HJEA 3RPQA 1YOVB 1BM9A 4RGXA 2HTJA 4A3LJ 1L0OC 1IAWA 3U9GA 5DM6F 4WWCA 3IKTA 1MMGA 2G7HA 2X48A 1B6AA 5EEGA 3H9GA 4DBRA 2LC2A 2EBIA 5J4VA 1ZH5A 2K9NA 3HIFA 1XDUA 2DODA 3F72A 1SANA 1TBXA 1B4AA 1Y0UA 2E60A 5FFZA 4M3BA 1DUXC 2AO9A 3SYTA 2WAQA 2OZUA 4HF0A 3WGIA 1KZHA 1XGSA 3PIPF 1YHQI 3N97A 3J7AO 5J8CA 5D5WB 2O0YA 3S1MJ 2OUMA 4A0ZA 2LVSA 2R7DA 2XF5A 3P7NA 4ZZLA 2DLLA 2K9SA 2QWWA 1B9MA 2VBWA 3KZZA 5JHUA 1M1EB 4ZC3A 1HF0A 1ZYRF 1VQ6I 4CCMA 1G3TA 2R7SA 2OF7A 4IOCF 2R7ZJ 3TMOA 3BY6A 4HLYA 1GVDA 2W1OA 3BG7A 5KVRA 4PFPA 3JTHA 3OYKA 4OIPF 2A6EF 1X1CA 1WJEA 3OV8A 2MFZA 1W36D 2YX4A 3BTCA 3JRHA 1YO5C 5JFRA 3J7AY 2D45A 1FSEA 3DXJF 3GX4X 3HUGA 4NNJA 1HKTA 2M9HA 1RR8C 1Z91A 1MBGA 3CQZJ 5TISC 4HA8A 1LFPA 4ANJA 4C3JJ 1UAAA 3BP8A 1Z0XA 5B3SH 5IOZA 2C6YA 2PMHA 4LITA 1PYVA 2IPQX 2VC0A 1DP7P 1MMSA 1JE8A 1BIAA 5B1BH 3ZQIA 4DOZA 3I9V2 3S8PA 1IN6A 3S14J 5CVVA 3CCSI 3DQVC 3RTRA 1JGSA 3OL3A 3TO9A 1YYVA 2KZGA 4XL9A 2AQFA 2JVGA 3TO6A 1GT0C 1JT0A 3AAFA 1E17A 5EZHA 2LRDA 2CS3A 2NS8A 2EV5A 5F04A 1WCMJ 1ZLJA 2A5YB 1JXSA 4MHGA 2EIJH 3B02A 1XMXA 2JMWA 1IF1A 3HB9A 3OIOA 1H88C 1OCPA 1WHUA 1T98A 2IS2A 2IEKA 1BW5A 2BVLA 1UZCA 1Z05A 3ZMUA 3HC7A 3JSOA 1IV6A 1VQOI 1Z6RA 5H2FC 1ETKA 3CC7I 3A1YA 2CQ7A 2FA5A 3ABMH 2QSHX 3VYTB 4LLNA 2HVSA 4Y17A 4BHCA 2LKSA 1OYIA 2UXNA 3VWBA 4O5VA 2JTVA 4IJAA 2A3SA 3K4CA 5AIPA 3S16J 2E1CA 4LK0F 5M5WJ 1GDTA 1B8IB 3JRCA 3GVAA 3TKYA 3F0CA 3F3XA 3K4JA 3LL7A 4KFCA 1U5TA 3PO3J 2HR3A 1QHGA 3RYRA 4AYBA 2EPFA 1RR7A 5DD4A 5E79C 4LG0A 3OYHA 4QTRA 1U2WA 4I0BA 4AM3A 2K7LA 1OR7C 2XASA 2Z2SB 2EV6A 2QEXI 1DP3A 3IUOA 4RLFA 5KNLA 2DFEA 3K4KA 2DA1A 2PMZN 1GXQA 3D1NI 1D5YA 1IXSB 2OBPA 3HGGA 2F4OB 4LLGF 2VXDA 3NWSA 1QPIA 3CCMI 3WG7H 2FSWA 5HOOA 4DQ2A 5J1YA 2HXIA 3OL4A 3I56I 1V54H 3WU2C 1V5GA 2P6TA 5C4XJ 2KIMA 3V7CA 2KKOA 2VLAA 3AG4H 3WE3A 4XICA 3KEQA 3ERMA 3RKXA 2GAUA 2RQQA 4BL0B 1S6LA 5H6RA 3Q9VA 2ZSHB 3I64A 4XLPF 5LHGA 2MSYA 5JLWA 3IWFA 4NDLA 2DOFA 2FOKA 1LJ9A 5DM7F 4CHUA 3S32A 1TQPA 2LKPA 1XGMA 2DFHA 2O8KA 5FFXA 2HDDA 3J7ZI 3ZQHA 2VKVA 4OMYA 3NEUA 3LSRA 3K0LA 4Q5SF 1MDMA 3HOZJ 1IUYA 2ZB9A 3K70C 2YR2A 1KA8A 1A6QA 3JREA 2LY1A 3H1CA 3T1BA 1GV5A 1LFUP 1R1UA 4A3DJ 4YFKF 4HX8A 5EG0A 2WADA 3FM3A 1LUJB 3PNYA 4A5MA 2W57A 4OU0A 2ZNZA 3FXUA 2ZJRF 4KIGA 1TT5B 2RAEA 3K10A 3L1PA 2EWNA 2FX0A 3FBNB 1SAXA 1XX5A 3SZGA 5DV5A 2JPCA 4F93B 5FLXK 1SVMA 1YI2I 2M45A 1BJZA 3FXJA 1HW5A 5FGMA 2DYRH 4EQQA 1VQ7I 3EUKL 4ETSA 3RZOJ 1I6HJ 1OFCX 2KL4A 3K1PA 1W4MA 4RBOA 5J4YA 1FP1D 4I0AA 4KJZA 1T95A 1K78A 2DT7B 4DYQA 2R5YA 3RQ4A 2KRFA 1BIBA 1U78A 3OMYA
chains in the Genus database with same CATH topology
2E34A 3CCQI 1QA6A 3CF5F 1YHQI 3PIOF 5GADJ 3PIPF 1FOXA 1FOYA 2QEXI 3CMAI 2K3FA 1S72I 3G6EI 1VQLI 3CCJI 3J7YJ 2NXNB 1VQ9I 3CCMI 2H8WA 1VQ6I 1Y39A 2ZJPF 4IOCF 3I56I 1HC8A 3CC2I 3CMEI 1YJ9I 4UY8I 5GAGJ 3CD6I 2JQ7A 3CCUI 1VQ5I 2ZJQF 5DM7F 1MMSA 3J7ZI 1VQPI 4IO9F 3CCSI 2OTJI 3G4SI 1VQMI 3DLLF 1YIJI 2E35A 2OTLI 2QA4I 3I55I 5JVGF 2FOWA 2ZJRF 1VQ8I 3CCEI 3CCVI 1VQ4I 1VQKI 3G71I 1YJNI 1YI2I 1YJWI 1FOWA 3CCLI 1VQOI 2E36A 3CC7I 5GAEJ 5DM6F 1ACIA 4V19K 4IOAF 1VQ7I 3CC4I 3CCRI 1VQNI 1YITI 3CJTB 5GAHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E34 A;  3CCQ I;  1QA6 A;  3CF5 F;  1YHQ I;  3PIO F;  5GAD J;  3PIP F;  1FOX A;  1FOY A;  2QEX I;  3CMA I;  2K3F A;  1S72 I;  3G6E I;  1VQL I;  3CCJ I;  3J7Y J;  2NXN B;  1VQ9 I;  3CCM I;  2H8W A;  1VQ6 I;  1Y39 A;  2ZJP F;  4IOC F;  3I56 I;  1HC8 A;  3CC2 I;  3CME I;  1YJ9 I;  4UY8 I;  5GAG J;  3CD6 I;  2JQ7 A;  3CCU I;  1VQ5 I;  2ZJQ F;  5DM7 F;  1MMS A;  3J7Z I;  1VQP I;  4IO9 F;  3CCS I;  2OTJ I;  3G4S I;  1VQM I;  3DLL F;  1YIJ I;  2E35 A;  2OTL I;  2QA4 I;  3I55 I;  5JVG F;  2FOW A;  2ZJR F;  1VQ8 I;  3CCE I;  3CCV I;  1VQ4 I;  1VQK I;  3G71 I;  1YJN I;  1YI2 I;  1YJW I;  1FOW A;  3CCL I;  1VQO I;  2E36 A;  3CC7 I;  5GAE J;  5DM6 F;  1ACI A;  4V19 K;  4IOA F;  1VQ7 I;  3CC4 I;  3CCR I;  1VQN I;  1YIT I;  3CJT B;  5GAH J; 
#chains in the Genus database with same CATH topology
 2VOD A;  2O3F A;  2KZV A;  4PJL A;  2R7W A;  1A35 A;  4RAZ A;  1IN5 A;  1JGG A;  2X85 A;  2GLO A;  3PL8 A;  2CQQ A;  3U1D A;  3FXO A;  1SD7 A;  2L9R A;  2OPT A;  2EA2 A;  2X4H A;  5BS6 A;  3AFH A;  5FJ8 J;  3I53 A;  3K1N A;  4MEY F;  1QQI A;  5FLM J;  1S7A A;  3CZ6 A;  2JRM A;  3HZJ A;  1JHH A;  2M0M A;  5ERI A;  1PP8 F;  3MKY B;  1YQA A;  1EJ9 A;  3FZV A;  3SDB A;  1HOM A;  2M34 A;  1ORK A;  2P4W A;  1JI8 A;  3GFI A;  1FBU A;  1EV7 A;  4BS9 A;  2LSO A;  4Q47 A;  2K4B A;  3NAR A;  2W25 A;  4EJO A;  2X6O A;  4NC6 A;  2MBF A;  1X3U A;  1FSH A;  4IQJ A;  1V5E A;  2V6C A;  3H9J A;  2OA4 A;  4M3D A;  2Y0M A;  3CCU I;  2VQC A;  4Q4Z F;  2ZXW H;  4HDU A;  1KYW A;  4XR6 A;  4KN7 X;  1ZHF A;  2M87 A;  2PEX A;  2AHQ A;  2MYS A;  5K7H A;  1XSX A;  3R0J A;  3BC8 A;  3FIW A;  2CWE A;  2R5Z B;  3CJN A;  4UUT A;  5CKT A;  3O8H A;  1ETW A;  3KPH A;  1T0F C;  2XB0 X;  2K5C A;  2ECC A;  3DLA A;  5EGO A;  2P0W A;  4ZYA A;  4DIQ A;  3TDZ C;  2ZXJ A;  2P6S A;  2E35 A;  2VOP A;  2FNP A;  2ESN A;  2XF7 A;  4IHY A;  3FHZ A;  5C44 J;  2Q1Z B;  3ASN H;  3FXR A;  4RAG A;  4B1R A;  5F6F A;  5K5O A;  2VL8 A;  2COM A;  2W85 A;  3I4N J;  5M5Y J;  1MBE A;  2FBH A;  4UNO A;  2ESH A;  2KDO A;  3GLX A;  1Y6I A;  3FXK A;  4BH9 A;  3GTJ J;  4G7O F;  1QZY A;  2D5V A;  1B59 A;  4IRH A;  2QM3 A;  5KK1 A;  5FB2 A;  1UJ8 A;  4MQ9 F;  2ID6 A;  2N8G A;  4H0E A;  3MD2 A;  2ZBK A;  4HX7 A;  1TL8 A;  1QU3 A;  3ZXS A;  4OIO F;  5DUK A;  2MH2 A;  3BTI A;  2BY0 A;  1FBS A;  1WJ5 A;  1FZP B;  3HGY A;  3K1M A;  2GXG A;  1TP4 A;  1I1S A;  4XOP A;  2BXY A;  5ICE A;  4EVI A;  1F9N A;  3ECH A;  3IV5 A;  1XPX A;  1B1B A;  3T5X A;  1DGW Y;  2X0L A;  3UKG A;  5JLX A;  2PG4 A;  1O7F A;  4P9F A;  3D5R C;  3SXY A;  4A93 J;  1AKH A;  2IXS A;  2NS7 A;  1QBJ A;  2AXL A;  1MND A;  3BTJ A;  2A05 A;  1X1A A;  3FF5 A;  1KQ0 A;  1BI1 A;  2OU2 A;  2M30 A;  1Z7L A;  2HXO A;  2NXN B;  1K61 A;  5KAF C;  2XDV A;  2OZ6 A;  3LSP A;  3G1L A;  3GTM J;  5K7Z A;  1PUE E;  4C3I J;  3BZC A;  1WGX A;  4KMU X;  3FKJ A;  3I5U A;  4EJW A;  5JVT A;  4Z2Y A;  2HQN A;  4ZTF A;  1GV2 A;  4CXF A;  2ZFU A;  3HBL A;  3OIQ A;  1XMA A;  2NYX A;  1FX7 A;  4AWX B;  1O3T A;  4KIC A;  1UB9 A;  2D1H A;  3FX3 A;  1IRX A;  5E3O A;  4KNY A;  1H89 C;  2CW8 A;  4RAF A;  3LSJ A;  5LD2 C;  4JQF A;  1JUS A;  1FP2 A;  2ICW G;  2ZCW A;  3V8J A;  3WHC A;  4PSW A;  1IXR C;  2LF8 A;  2FE3 A;  1O3S A;  4HBL A;  4ENK A;  2MW8 A;  3DTK A;  3KYC B;  4FHT A;  1G3S A;  3BR6 A;  2PLY A;  1AU7 A;  2DMT A;  1OR7 A;  1OQY A;  4OIN F;  3ZMV A;  5IYC J;  4UUS B;  2W82 A;  2HOA A;  2ZME B;  2CW0 F;  4EEF G;  1TC3 C;  1WSU A;  2M4K A;  4C9Y A;  1XSV A;  2QA4 I;  2OQR A;  4M9Z A;  5ICF A;  3JRB A;  2HTS A;  1G59 A;  1MH3 A;  2QQ8 A;  5D5X B;  1CF7 A;  4L9N A;  2HKO A;  4CH7 A;  3JSP A;  1OCC H;  2CUE A;  2ELK A;  3E5U A;  2Z1D A;  3KCC A;  1Y8R B;  2VKH A;  3LA7 A;  2LH9 A;  1Y8Q B;  2CMP A;  5K1Y A;  1BC8 C;  4Y15 A;  3L09 A;  2BXZ A;  2MAB A;  1LE8 A;  4E7I A;  1K7A A;  2K85 A;  5HNF A;  2GBY A;  2BOL A;  2W00 A;  5J6X A;  2JSC A;  3SJM A;  1BR4 A;  4HW0 A;  1J09 A;  2EFP A;  2O5R A;  3R4K A;  3KP5 A;  1VQN I;  2BY3 A;  3DEU A;  3P9K A;  1SFX A;  2STT A;  5HLT A;  3QP6 A;  4C30 A;  4U0W A;  4CGZ A;  2ECB A;  2UXX A;  4E7Z A;  5L3F A;  1MZB A;  5EJC A;  2O6G E;  4KT6 A;  3HKZ N;  2H6C A;  4J00 A;  1N75 A;  2CSO A;  2FRH A;  4PSX A;  2EZL A;  1RPW A;  3R61 A;  3NWT A;  1WH7 A;  5E1Z B;  3V7R A;  1GHC A;  5E8I A;  3CCQ I;  5K5R A;  4LFU A;  3WU1 B;  2FBK A;  1YIO A;  1JTY A;  3QYB A;  2RQP A;  4BEH A;  2PJP A;  1REP C;  1ZR4 A;  2F5V A;  1R22 A;  2VI6 A;  4G7Z F;  2K3F A;  2IW5 A;  2K27 A;  4QLC U;  1RUN A;  2CFX A;  3G6E I;  1VQL I;  2WWY A;  1JHF A;  5TJJ A;  2FMY A;  1I3Q J;  1A6I A;  2VN2 A;  3IAM 2;  5E3M A;  2TRT A;  2H8W A;  1WJA A;  4BE1 A;  3OYN A;  2DFF A;  2O9L A;  2DFI A;  1ETO A;  1IDZ A;  1R1T A;  5A2Q K;  4HQE A;  3CJR B;  2IGK A;  5K5Q A;  2XAJ A;  3N05 A;  3U2R A;  4JX6 A;  1W0T A;  1T38 A;  2FNA A;  1Z9C A;  3PSI A;  2K3P A;  2F5E A;  1MMD A;  2XB5 A;  2KJB A;  3IP4 B;  4D7M A;  2VKD A;  2DQR A;  4PZJ A;  2HDW A;  2X6W A;  2XUB A;  2CH0 A;  4RDU A;  2I8D A;  4P96 A;  1OCO H;  2GA1 A;  5F0C A;  4E7H A;  2IA0 A;  3MCZ A;  2RN7 A;  1QNT A;  2JUG A;  4D7N A;  3WTY C;  3E6C C;  3A2K A;  3K9T A;  3FXL A;  4NQW A;  3LQR A;  5FLV A;  1ZGW A;  2F6C A;  3G4S I;  2BV6 A;  1O57 A;  5E17 F;  5CVI A;  1DPU A;  1LEB A;  3SQN A;  3K4L A;  2HQ5 A;  2VPR A;  4L0Z B;  2VON A;  1YW9 A;  1UG2 A;  1XB4 A;  4WXD A;  3ZQC A;  3ISP A;  5GPA A;  3K4B A;  2UZK A;  1QPM A;  2QBY B;  4N9I A;  1BOB A;  1MSE C;  1EKE A;  1U3E M;  2L02 A;  2DU9 A;  3L7W A;  5K7F A;  1H8A C;  1UHS A;  3FXQ A;  2FUG 2;  2MLG A;  3HSF A;  1MJB A;  3G73 A;  1G8X A;  3HSR A;  3H5R A;  3D5S C;  2CGP A;  4CCL A;  2KRC A;  3SFZ A;  4GCV A;  5IT3 A;  1VQK I;  4YFX F;  4CDG A;  2IP2 A;  2F48 A;  1QRY A;  3C7J A;  1K6O A;  2WB1 N;  3BJA A;  4DZP A;  3DPT A;  3H35 A;  4HAM A;  2DJI A;  3LSI A;  4IL6 C;  3LMM A;  4PGG A;  1YFH A;  2ZO4 A;  1LKX A;  5CJ9 A;  3ERE D;  1IGN A;  4ASN A;  2L7K A;  3ZQL A;  2YU9 J;  2UWM A;  1U8R A;  1FEX A;  1R7J A;  3MZ8 A;  3C1D A;  3CLO A;  1BR2 A;  2M7B A;  3DCF A;  4J01 A;  3ZP5 A;  2DXI A;  3DP7 A;  4M9S A;  3E5Q A;  1UEL B;  1TNS A;  2L7Z A;  4XMY A;  3WTV C;  1B9N A;  1T0F A;  5JR3 A;  2QQ9 A;  2NVY J;  3M1C A;  1MKM A;  3DU5 A;  6PAX A;  3D5L A;  3OYC A;  3PIO F;  4E7J A;  3PFY A;  3FMS A;  5L3B A;  3W6K B;  1FYM A;  2DPU A;  5FKN A;  2VC1 A;  1ETY A;  5FKO A;  3G1O A;  2Z5U A;  4UHT A;  3L9F A;  1VND A;  2HPM A;  1E2X A;  2P5K A;  3RPU D;  1VQ9 I;  4II3 A;  1S9H A;  3DWL E;  2OCE A;  2WTE A;  1TT0 A;  2L4M A;  4RS8 A;  4XKC A;  5IT9 K;  3JCU C;  4L9V A;  1YS7 A;  3HXL A;  2XVC A;  3RYP A;  1IN4 A;  3KP3 A;  3S2W A;  1S5L C;  2LF7 A;  2R7R A;  4NBQ A;  2WC2 A;  3S17 J;  3TED A;  1NG6 A;  2K9Q A;  4B3A A;  3E0J B;  1O7L A;  3OYF A;  1D1A A;  1ZG3 A;  2XAF A;  3NQO A;  4EM2 A;  2DDA A;  2DBB A;  4U88 A;  1T2K A;  2ZJQ F;  1MMN A;  2KRH A;  4IEJ A;  3BQZ A;  1YRN A;  2L7M P;  3PFI A;  2IT0 A;  2ETH A;  3JRI A;  1MW7 A;  4P1W A;  3OS0 A;  4G9Y A;  1T8I A;  2B63 J;  1YW8 A;  5ICG A;  5FRO A;  3GO5 A;  2FBI A;  2QSF X;  4GDF A;  3IWZ A;  3AKZ A;  1VQM I;  2A69 F;  2FD5 A;  1PUF B;  1XGO A;  2LKX A;  2YUS A;  3JRF A;  2PJR B;  3BPX A;  4BE2 A;  1MH4 A;  2E1O A;  3HTU A;  2BY2 A;  3DF8 A;  4CA0 A;  3LA2 A;  5M3F J;  4EGZ A;  2HZD A;  2DPD A;  3LAJ A;  1T39 A;  1TQM A;  3OSF A;  4NHJ A;  4EMS A;  4XNF A;  5LGN A;  5GTH C;  3JAM K;  3LNQ A;  3Q0U A;  4LIV A;  3MKL A;  3MWM A;  3TO7 A;  1S7O A;  2EIL H;  5BPD A;  3F8B A;  4B43 A;  4DYR A;  1X1P A;  4DJA A;  4PDK A;  5F08 A;  2BGC A;  3G3Z A;  4XLE A;  4IHV A;  4UB8 C;  2IGO A;  4BGD A;  1ZRD A;  3HRT A;  2WAQ N;  1V3F A;  5LGU A;  5D5U B;  1R5I D;  4KA4 A;  4BUP A;  1SMY F;  1YX5 A;  2W7N A;  3CC4 I;  1EA3 A;  4F7Z A;  3FWE A;  3BG5 A;  3OYM A;  4ABZ A;  5J1U A;  3X2Q H;  1TWF J;  4NC7 A;  4J19 A;  2VUM J;  3EUA A;  1N78 A;  2H27 A;  3C3W A;  4MFE A;  1EF4 A;  4HNV A;  1SAU A;  3E6M A;  5E20 A;  4HF1 A;  4B3X A;  1Z1D A;  2QQA A;  4R79 A;  4JOM A;  2CQK A;  4Q48 A;  5LBQ A;  4ZJZ A;  5DD8 A;  2F4M B;  3FMR A;  1G2H A;  3GUD A;  5CVR A;  2V26 A;  3V42 A;  3E6B A;  4RM2 A;  3S2H J;  2CQN A;  4XSZ F;  3S93 A;  5FRM A;  3TW7 A;  4KIB A;  4I6Z A;  2L0K A;  5HOD A;  2Y2Z A;  3BR2 A;  1QVU A;  5B5E C;  3JRG A;  3E3V A;  2L54 A;  3KX2 A;  9ANT A;  4V2F A;  3BTL A;  4IKF A;  4A3C J;  3BR1 A;  3CES A;  3UNG C;  2IS1 A;  5DTD A;  2XAH A;  1J2X A;  5B66 C;  2UV1 A;  2FXA A;  2G7U A;  2ISY A;  2GA2 A;  4I76 A;  4CCN A;  1G6N A;  1QO0 D;  2IGM A;  3I54 A;  3ONQ A;  5HDG A;  4ZDL A;  1TLH B;  2L01 A;  3MKW B;  4G8X A;  4ZYD A;  1JKO C;  1F43 A;  1UHM A;  5LRS A;  1J9I A;  1K4S A;  4NC8 A;  4KIF A;  1ENH A;  1F1Z A;  5J40 A;  5HS8 A;  2XAU A;  1IXC A;  2DA6 A;  3BJ6 A;  4FX4 A;  3GTQ J;  3VYS B;  2OTJ I;  1WKM A;  4G6T B;  1BI2 A;  3M8F A;  4WXC A;  5F0F A;  2DA7 A;  2DJN A;  1QZZ A;  1W36 C;  1HST A;  1Z3Y A;  3BG3 A;  1W7P D;  4HNU A;  1P4W A;  3ROU A;  1I6X A;  4XKW A;  4MTD A;  1LVK A;  1MJ9 A;  2LFB A;  1MD0 A;  2ZSI B;  4L18 B;  1LDJ A;  4CUG A;  5HLG A;  2JWT A;  3EYI A;  1R23 A;  4AUX A;  3CCV I;  3CCY A;  4IRI A;  2XSD C;  4RM3 A;  2K9L A;  2XKP A;  1OPC A;  5HS9 A;  1BL0 A;  3ZCO A;  4BHP A;  2ID3 A;  3CO6 C;  1RIO H;  4M73 A;  4PGH A;  1SD6 A;  4AYB N;  3CUO A;  2BHY A;  5IPA A;  3EDP A;  2HZT A;  3KYD B;  5TRD A;  3TGN A;  1USS A;  2P81 A;  3S1R J;  3CDI A;  2NOG A;  3VEP A;  3HTS B;  5IYB J;  1ZGA A;  3DKY A;  1OYY A;  1RUO A;  4P9U A;  3WE2 A;  3ABK H;  4V2G A;  4Y13 A;  2IVM A;  4JX5 A;  3FM5 A;  3S1Q J;  1F5T A;  2ZJ2 A;  2L3D A;  3CJQ B;  1FOX A;  1FOY A;  4Y7N J;  4UVC A;  3BG6 A;  3BDD A;  2Y0S A;  1FYK A;  1AWC A;  3LWF A;  1WWX A;  2MG4 A;  2XHK A;  2EJR A;  5F1J A;  5DS9 A;  1PDN C;  1P7J A;  4MFD A;  4OIR F;  1QHH D;  1IDY A;  1C0W A;  2ZJP F;  3REO A;  5L3G A;  1IN8 A;  3A02 A;  3I59 A;  1LVA A;  1T56 A;  2O61 A;  3ZMD A;  2W4S A;  4UUS A;  4JK1 X;  2W24 A;  3BZK A;  3K2A A;  3RKQ A;  2ELJ A;  2IJL A;  2QF7 A;  4RB3 C;  2LRE A;  2M7A A;  4LJZ F;  3GTK J;  4M6X A;  3E97 A;  2O7O A;  2OCC H;  4BQA A;  2CG4 A;  4IHX A;  1S29 A;  1SD4 A;  2JPB A;  4IHW A;  4M3E A;  1FYL A;  3OR2 C;  1S7E A;  3M07 A;  2GOX B;  4AIH A;  1ZG5 A;  1FNN A;  5BNG A;  2L4A A;  5EDN A;  2XV4 S;  2DT5 A;  2CUJ A;  3OYD A;  3L2W A;  5HLH A;  1P92 A;  3QPT A;  2E7X A;  3EUH C;  4M9X A;  4EJV A;  1SFE A;  1XTA A;  4B47 A;  4YIF A;  3HL2 A;  1V4R A;  4ESB A;  3KP2 A;  2K86 A;  5E3N A;  1RKT A;  4PUS A;  4GO1 A;  2XKO A;  1IC8 A;  4GGG A;  3O3K A;  1CGP A;  4UXN A;  2E1N A;  4C2T A;  1CQT A;  3PM1 A;  2NVQ J;  2K40 A;  1I27 A;  4ZTJ A;  5BOX A;  1OCZ H;  4IXA A;  1YE9 A;  4KT5 C;  5FRN A;  1Y1W J;  2ADU A;  2Y75 A;  3W6V A;  4PK4 A;  1L3L A;  4CYC A;  3DBH B;  3RJP A;  1FTT A;  2P5L C;  1LPQ A;  5CPR B;  5LHI A;  2GM4 A;  1Y56 A;  1S8N A;  1T6S A;  4X1E A;  1WVR A;  1TWH J;  5HNH A;  3NAU A;  2IAI A;  1KU9 A;  1R49 A;  3IH2 A;  4LLL A;  5CYV A;  3ZR8 X;  2A6T A;  4AIK A;  2QCO A;  3G2B A;  3ZQ7 A;  3CDH A;  3GZ6 A;  4KDP A;  3CJT B;  3QRF F;  1U5T B;  1ON1 A;  4M3G A;  1EH6 A;  2XGC A;  4IRG A;  4A5N A;  4K2E A;  4XLN F;  3GCM A;  3BJO A;  3HOX J;  1JKQ C;  1KU7 A;  2HYG D;  4DBQ A;  2HGC A;  2Z16 A;  5GAD J;  3KIO A;  1ETX A;  1TTY A;  2TCT A;  4ESJ A;  5F1R A;  3MZH A;  3BR3 A;  2VJJ A;  2A61 A;  2NVT J;  1FWZ A;  4N4N B;  4OIQ F;  3KZI C;  1SFU A;  2Z99 A;  5IP7 J;  1FPQ A;  4LB5 A;  2K4J A;  2GXA A;  2DMN A;  2FQ3 A;  2L9V A;  1FIA A;  4HV6 A;  1ZKG A;  1FLI A;  1ZLK A;  3DPL C;  2Q0O A;  5HDK A;  3PQJ A;  5M5X J;  2FEZ A;  2V6E A;  1TWA J;  4YEJ A;  4D9J A;  5ILV A;  4A69 C;  5A2Q Z;  2ME6 A;  3M9A A;  3AL0 B;  4HPQ A;  2OQG A;  3QOE A;  3ML6 A;  3VB2 A;  2G9W A;  5CVU A;  1TZL A;  2KLO A;  3K4M A;  1XSD A;  2LMD A;  3BR5 A;  4IQ4 A;  2E2I J;  2XAQ A;  3QPH A;  1BN5 A;  4I01 A;  4S04 A;  1XCB A;  5CVJ A;  2LY9 A;  2MLK A;  3QP5 A;  1UCR A;  4DYC A;  1LEA A;  1BC7 C;  1FMW A;  2NVX J;  3Q9S A;  1MDM B;  3E7L A;  3K69 A;  4HYE A;  4I02 A;  1Z67 A;  2ZXH A;  2GOM A;  4RB0 A;  4A6E A;  1Y1V J;  1BI0 A;  1UMQ A;  4H4K C;  1YLF A;  2FQ4 A;  2RNG A;  3K6G A;  5EEH A;  2LBF A;  2MGQ A;  5FD5 A;  3RPU A;  4YFN F;  4RB2 C;  2KIU A;  2X1E A;  1JJ6 C;  4HOB A;  5HS7 A;  4XRF A;  3H0D A;  3BZ6 A;  3CUQ B;  2OTL I;  2IGN A;  4BHB A;  4XM3 A;  3EPZ A;  1ON2 A;  4M6Y A;  4AIJ A;  2DYS H;  2VOO A;  1O4X A;  3PQK A;  2LP0 A;  2BW3 A;  2Q2E B;  1D3Y A;  3P9I A;  4MEX F;  3EQL F;  3ZN0 A;  1D0Y A;  3J81 K;  3OIP A;  3M7G A;  1WJD A;  4A3M J;  4FTH A;  1POG A;  2EZI A;  2Y9Y A;  3FK6 A;  1MNE A;  4DNC A;  5GPC A;  3ZOB A;  2MH9 A;  3SHF A;  3A01 B;  2LYC A;  4BJT A;  4WCG A;  4XLH A;  4BXU A;  2NAZ A;  5ED4 A;  1K78 B;  2HOE A;  3ZQF A;  2R5Y B;  3OSG A;  1X4P A;  3I71 A;  3DKW A;  3KYL A;  5EZG A;  1Z77 A;  1IZ1 A;  3RZD J;  2HYJ A;  2WY7 Q;  2VB6 A;  4A3I J;  4NB5 A;  4RA2 A;  1AHD P;  5D5V B;  2OD5 A;  3FDY A;  4JYK A;  2KIF A;  1YW7 A;  1FOK A;  2QYO A;  4EGY A;  4LGW A;  3OYG A;  4BYY A;  2HQA A;  1IV8 A;  2XSJ C;  3QPL A;  1D5V A;  2ZNY A;  4BBR J;  1IRG A;  3ZGK A;  2MC3 A;  1WRJ A;  2X6Y A;  3VDX A;  3PNV A;  4E4H A;  1BBY A;  3SEQ A;  1D1B A;  4I98 B;  4PJ0 C;  3ABL H;  1ONV A;  5KCM A;  1J5Y A;  2LG4 A;  4IF4 A;  2EB7 A;  1V5F A;  3GTL J;  3KLO A;  2V1D A;  5BQT A;  1TWC J;  3I0T A;  4DW6 A;  2M5W A;  5LGT A;  2FJ1 A;  1PUF A;  3HOY J;  1E3P A;  2LK2 A;  2CO5 A;  4LG3 A;  1OMI A;  4ON0 A;  1DPR A;  3CD6 I;  4HNT A;  2JVH A;  4BQO A;  4II2 A;  3FKI J;  3LFU A;  5TGT A;  1IRZ A;  3N4M A;  4MO7 A;  3OYJ A;  2K02 A;  5BPI A;  3QOP A;  2CV2 A;  1GLN A;  2GZW A;  2DA5 A;  4CCJ A;  3BT9 A;  4YIR X;  4P55 A;  3CO7 C;  2H94 A;  2LDU A;  4WX9 A;  4XKV A;  3MQ0 A;  3A0B C;  3F8N A;  2IS6 A;  1N77 A;  2I5U A;  3PSF A;  4HZF A;  5D4S A;  4A3K J;  4IPA A;  1K79 A;  2R92 J;  1OYW A;  2Y30 A;  3AL0 C;  3HRU A;  4FCY A;  3ZMS A;  3T8T A;  3C18 A;  4HDV A;  4ENM A;  3I55 I;  1U9N A;  2M1B A;  2BYV E;  2Q8K A;  1VQ8 I;  3JAM Z;  4FX0 A;  1XDS A;  3RCO A;  2HNH A;  1BR1 A;  5CQG A;  2Z33 A;  2OC6 A;  1R4M B;  3LA3 A;  2R7U A;  4PJN A;  2PI0 A;  1RI7 A;  5J1R A;  2B0L A;  5CLS A;  1W5T A;  1WJC A;  3MFK A;  2V9P A;  2DDB A;  3PO2 J;  1AOY A;  4UVA A;  1ETQ A;  3K7A J;  2JA2 A;  2R3S A;  3E6D A;  4B48 A;  3ASO H;  1I5Z A;  1ZK8 A;  4BDZ A;  2R7Q A;  3RKY A;  2COB A;  1IRF A;  1X1B A;  1STZ A;  1SFK A;  2AS5 F;  3HDD A;  3CUQ C;  3OS1 A;  1VI0 A;  4QPQ A;  5D8L B;  1B8I A;  3EUH A;  1X1D A;  2DMU A;  1U9O A;  3SZP A;  2ACJ A;  1HDP A;  1V55 H;  2Z9O A;  4HRI A;  4B8X A;  3W2V A;  2O03 A;  4ENJ A;  4FIS A;  1MBK A;  2VQG A;  3HPH A;  5ILU A;  5HDN A;  1FBQ A;  1MMA A;  2BHZ A;  2GIV A;  2B9S A;  2LR8 A;  3DPU A;  2ZME C;  3P5J A;  1JKP C;  4XSX F;  3J80 K;  3I4P A;  4PCQ A;  3GF2 A;  1NH3 A;  2WY8 Q;  3QAH A;  1U0J A;  4RAY A;  2M2E A;  1KON A;  2JJ7 A;  1FMV A;  5DCF A;  4YG2 F;  4OAY A;  4XOT A;  4HF2 A;  2JA5 J;  2Y48 A;  3H3U A;  2GXB A;  1SVL A;  4GXO A;  4UY8 I;  2P8T A;  5GAG J;  3GZN B;  2DO7 A;  1WZ2 A;  2R7T A;  2CV1 A;  3GXO A;  2FML A;  5EF6 A;  4XLC A;  2EFQ A;  1P9Q C;  2QEN A;  2X9D A;  3HRS A;  4MNU A;  5D4R A;  2HS5 A;  1Z3X A;  3E1S A;  3HEF A;  4RGU A;  2MD5 A;  2HWV A;  4X0G A;  4L5J A;  2HI3 A;  3KEY A;  5ILS A;  5LLQ A;  3H36 A;  4IO9 F;  3KEO A;  3KP7 A;  4X6A J;  2X1D A;  2Y31 A;  1B72 B;  2PFB A;  3F9K A;  1XG1 A;  4L0Y B;  4CZZ A;  3FBI B;  4HSR A;  1WQ2 A;  3Q0V A;  4EJT A;  2E19 A;  1W5S A;  4U87 A;  1X19 A;  3WTZ A;  1Q1H A;  4B09 A;  1NHA A;  3LST A;  2LTP A;  4L9T A;  1GVJ A;  4RLQ A;  2V1X A;  2CYY A;  2DTZ A;  1RET A;  4I99 C;  4MGR A;  3HOT A;  1CF7 B;  1VZ0 A;  2V1U A;  4BQQ A;  1P2F A;  2KHM A;  1YTY A;  3CP2 A;  3IAS 2;  1H0M A;  3M1E A;  1VQ4 I;  4KUM A;  3U21 A;  1UG0 A;  3M3Y J;  4E70 A;  4DZJ A;  1LE8 B;  2STW A;  3F21 A;  2XIG A;  5C3E J;  4IHS A;  3WGH A;  3QU3 A;  3F6V A;  3LSG A;  1FOW A;  1MJA A;  4HEA 2;  1APL C;  2AQE A;  1X4O A;  3BR0 A;  3QPS A;  4BDY A;  3WG9 A;  1ULY A;  4IOA F;  1A04 A;  3VFZ A;  4BJ5 C;  3O6B B;  4BAY A;  3L2V A;  2FU4 A;  4ZZD A;  4M6V A;  2A07 F;  1I3A A;  2HKX A;  1AA7 A;  1KQ8 A;  2E34 A;  2VPL A;  3F6O A;  2F5F A;  3I3L A;  1MSF C;  1R4N B;  4AID A;  4AVP A;  4BEH B;  4C3H J;  4D0P A;  2K9M A;  2X1C A;  2D1V A;  2NRA C;  1UHW A;  4PJJ A;  1PVE A;  1T33 A;  5FLX Z;  3CMA I;  2JA6 J;  1ZEL A;  2DK5 A;  2E71 A;  2KMU A;  4XN3 A;  1S72 I;  1A31 A;  3W6J B;  4N4O B;  4Z6Y A;  1LQ1 A;  2EFN A;  1FC3 A;  4MLO A;  1ETV A;  4I2O A;  1R36 A;  2CV0 A;  1BA5 A;  1FTZ A;  2EIM H;  2Y69 H;  4CCK A;  2HVR A;  1FJL A;  2P7V B;  2GIZ A;  2EV0 A;  3TL4 X;  2I10 A;  1P4A A;  4IVN A;  3WTS C;  1Y39 A;  1MBH A;  2P5V A;  2XRO A;  1TW2 A;  3K70 D;  1R5G A;  1YS6 A;  1KYZ A;  3VSK A;  3QQA A;  4MIM A;  1PJR A;  1QZE A;  2EZH A;  2OAZ A;  3WGG A;  2BE5 F;  1WI3 A;  3MZY A;  4MTE A;  1BW6 A;  4BJ6 C;  4HX4 A;  1OCT C;  2PMZ A;  3H5A A;  3RI4 A;  3HOU J;  1F36 A;  1IO2 A;  2JQ7 A;  1OLT A;  2IRF G;  5LEK A;  4CCO A;  2V4J C;  2VJI A;  2OV7 A;  4FQG A;  2M3A A;  3F8M A;  1Q1V A;  4E7K A;  1WI9 A;  2JT1 A;  3R60 A;  1H9T A;  1ZN2 A;  3DV8 A;  4NQW B;  3VSL A;  2R5Z A;  2ISZ A;  3MVP A;  5M3M J;  4YRV A;  3B73 A;  2R7X A;  2GQQ A;  1W7P B;  1TQI A;  1ZR2 A;  2A5W A;  4A0X A;  4OMZ A;  1HDD C;  4S05 A;  2O8X A;  3HM5 A;  2X6X A;  2ZXI A;  4E7S A;  1LDK B;  2XPV A;  3BRO A;  4CZC A;  5IOY A;  3HSE A;  2J5O A;  4Y3O A;  2JRT A;  3DFG A;  5DCM B;  4WK8 F;  1ITY A;  1WPK A;  2YX7 A;  4M72 A;  3TDU C;  3F22 A;  3LSK A;  3CCE I;  3PUF A;  1HQC A;  1R9T J;  4CYD A;  1R71 A;  1KGS A;  2J5P A;  2VT2 A;  2VIX A;  3SZT A;  3M8J A;  1WH5 A;  3H3Z A;  2RNJ A;  3CMY A;  3OS2 A;  3S2D J;  2VXZ A;  3G71 I;  1YJN I;  3RIR A;  4LOC A;  4XN0 A;  1IJW C;  4PFO A;  2XC7 A;  2E1M B;  2E36 A;  2QUF A;  5E8G A;  3DBR B;  3FIS A;  2A6H F;  3PJR A;  1Z6T A;  2E5Z A;  1VF9 A;  3HRM A;  4RB1 A;  3PUB A;  4G7H F;  4HV5 A;  1IN7 A;  4MQV A;  2VT3 A;  1Y0N A;  4U0V A;  1PP7 U;  3G1M A;  1F4K A;  3LQQ A;  3PNT A;  4AD9 A;  4UV9 A;  2UUZ A;  5D6F A;  2H1K A;  2IA2 A;  2M0C A;  3FMQ A;  1UST A;  3Q5F A;  3DKX A;  4A0Y A;  3GME A;  3UR3 C;  1NK3 P;  2HYF A;  1SFO J;  3SFI A;  3AG3 H;  1J7K A;  5L3C A;  3F8F A;  3GZ5 A;  2L5Q A;  2E5N A;  4UV8 A;  2QQB A;  3GBG A;  2Y9Z A;  4HG2 A;  4L5E A;  3J7Y J;  2R7V A;  3GEZ A;  5E1W A;  1LB2 A;  1WJF A;  4QWQ A;  4HQM A;  3L2C A;  4OAZ A;  2CQX A;  2CUF A;  4M3F A;  4AU7 A;  1IW7 F;  2RVC A;  3OR1 C;  4ZYG A;  1P4X A;  4BXX J;  5JHF A;  3CME I;  2YS9 A;  4F92 B;  4O3M A;  1SD5 A;  3HPG A;  4G6D A;  3GTO J;  2RC4 A;  2JN6 A;  1W0U A;  4XRS G;  4OOI A;  2JA7 J;  4CIC A;  5KAI C;  3MMY B;  4UUV A;  2WBM A;  1YRN B;  3CUQ A;  5LFA A;  2DCE A;  2H8R A;  4BE0 A;  3KE2 A;  2RV8 A;  2DOE A;  3HYI A;  1G3Y A;  1ZAR A;  1XMK A;  3K2Z A;  4FE4 A;  1WJB A;  4KN4 X;  4G6Q A;  5LEJ A;  3OOP A;  2EZK A;  2Q2E A;  3L2R A;  4UVB A;  2ZKZ A;  1P7I A;  3S15 J;  1OIS A;  2RRE A;  2WAF A;  1JUM A;  3TOB A;  1DDN A;  4ZDO A;  4U0Y A;  1XCV A;  3TW6 A;  2VJ4 A;  3TQN A;  3HUG B;  1HW1 A;  1E3O C;  2DQL A;  2ZME A;  2JA8 J;  2HFH A;  3IC7 A;  3E5X A;  1I1G A;  1NTC A;  3A01 A;  2XRN A;  2KFD A;  3JRA A;  1R5H A;  2TDX A;  1D0Z A;  1JTX A;  3ABU A;  1W1W E;  2NS0 A;  2G0E A;  1ZAO A;  4U7D A;  4XQF A;  1I50 J;  2WA0 A;  4EAT A;  2LNB A;  2R0Q C;  2IS4 A;  2Z3Y A;  5F64 A;  2PQ8 A;  4G94 A;  2F2E A;  3IL2 A;  2KIQ A;  3A0H C;  3VOE A;  4XID A;  3QWL A;  2L9N A;  4ZDP A;  5IY5 H;  2XAG A;  1YJW I;  3CCL I;  3DTI A;  2XGD A;  3J81 Z;  3OYE A;  1TWG J;  1X58 A;  4S0H B;  1MBF A;  3C2H A;  1RES A;  3RDI A;  2V9V A;  3COA C;  2Y0S N;  1W5C C;  3RSN A;  1YIT I;  3BCA A;  4GRI A;  3MAJ A;  4M74 A;  4WF2 A;  3IHU A;  3VOD A;  3KFW X;  5E18 F;  1D8K A;  3AG1 H;  2VKE A;  3HG9 A;  5GTI C;  2W84 A;  5GAH J;  3SDG A;  2DW4 A;  4Y4R A;  2CUZ A;  2BEO A;  4A3B J;  2H6B A;  5FO5 A;  2VBY A;  2R93 J;  1N25 A;  3BQY A;  3B6A A;  2XGE A;  1KQ9 A;  2V1N A;  3FXM A;  2XPW A;  1XC5 A;  3GFM A;  2NVU B;  3R0A A;  5J47 A;  2M8G X;  4JP0 A;  1TNT A;  2VE8 A;  3GWZ A;  2JZY A;  1RKW A;  3H5N A;  1SMT A;  2F4I A;  2KIS A;  2A68 F;  1ZRF A;  3LOC A;  2E1M C;  3F8C A;  4EM1 A;  3C2G A;  5D6E A;  1K4T A;  3R6S A;  1D0X A;  5AON A;  1ZTR A;  2QSG X;  2ZC2 A;  3ZPL A;  4C2M J;  3GYH X;  1HC8 A;  3IH3 A;  4QPO A;  2PBI A;  4D5C A;  2QGU A;  1X3Z B;  4UB6 C;  4ENN A;  1RZ4 A;  4JBA A;  1DQU A;  4BY7 J;  3BPV A;  4C2U A;  3ZRG A;  4CO8 A;  1FT9 A;  1G3W A;  4RMN A;  1SEU A;  3L00 A;  4LG0 B;  3QYE A;  2W48 A;  5FKK A;  1XS9 A;  5DDG A;  5BMZ A;  1E0E A;  4BAC A;  1HXD A;  1TW3 A;  3D0S A;  3T8R A;  4LMY A;  3KP4 A;  3JW4 A;  3TP0 A;  5D8K B;  5FD6 A;  2HVQ A;  3IKV A;  1MBJ A;  3KZY A;  3H3V K;  2QLZ A;  1H9G A;  1IG7 A;  2PX9 A;  5JI6 A;  2ZFW A;  3QYF A;  3W2W A;  2EFO A;  4E6K G;  1EH7 A;  1HSJ A;  2VJ5 A;  2XRL A;  4GYI A;  4B44 A;  3NRV A;  3S3N A;  2DA2 A;  3CP8 A;  4A3E J;  4NUB A;  1HCR A;  4DGW B;  3VYU B;  1YIJ I;  1EH8 A;  1DGR M;  2DK8 A;  4JX4 A;  2QVO A;  3WTX C;  5DYM A;  3ZMT A;  3ZN1 A;  4EM0 B;  3V4G A;  3V7S A;  2KPM A;  1I39 A;  1HKQ A;  5LRR A;  3P9C A;  5H6Q A;  2QBY A;  4XK4 A;  4L9J A;  3M4O J;  2HU9 A;  4LD5 A;  4RGR A;  3WOD F;  3DEE A;  4WXH A;  5B1A H;  1HW2 A;  3SEZ A;  2NNY A;  1ZGJ A;  4F52 A;  3HHG A;  1LDD A;  4G12 A;  3JTG A;  1P6R A;  3K4N A;  4D1Q A;  3KLN A;  1E3H A;  3BWG A;  3S3M A;  3H9Q A;  4HST A;  3Q0W A;  1VFC A;  4W97 A;  4I7H A;  1BI3 A;  1NK2 P;  3QOD A;  2VAS A;  3IH4 A;  3OYA A;  4E7L A;  5EG0 B;  4A3J J;  2CU7 A;  2EIK H;  2MD0 A;  2V9K A;  2F5D A;  2WAE A;  3MN2 A;  3I58 A;  2BVM A;  2AXT C;  3DU6 A;  3CTA A;  1ZQ3 P;  4LK1 F;  3GFJ A;  1RNL A;  4W1U A;  4A2U A;  3TOA A;  4D5F A;  3CF2 A;  5FKL A;  3OY9 A;  4L5I A;  1O3R A;  3CDL A;  1YX3 A;  3C2B A;  5FKM A;  1QA6 A;  1G4D A;  3A03 A;  4KYW A;  4CSW A;  2DMQ A;  1HKS A;  1A5J A;  1GUU A;  1OCR H;  1X3W B;  2VBZ A;  1R1V A;  4F3Q A;  3OYB A;  2LD5 A;  2DA4 A;  3H0G J;  3OYL A;  3EET A;  3CCJ I;  2HEO A;  2JK3 A;  1ODD A;  1Z21 A;  2XGX A;  3HKZ A;  2HQR A;  1LNW A;  1VTN C;  2P7C B;  3I59 B;  3IRQ A;  1SVO A;  2X51 A;  2EH3 A;  5DEQ A;  1B72 A;  3WU0 A;  4KIT B;  3J80 Z;  1XD7 A;  2YPR A;  5J3L A;  4YEL A;  5F0H A;  4A12 A;  1R58 A;  3TP3 A;  4EJU A;  1YJ9 I;  2BBY A;  2KDZ A;  2YSR A;  2V7F A;  3O8G A;  3HOV J;  3ABT A;  1RC9 A;  2WV1 A;  4FE7 A;  4A3F J;  3BLY A;  3ZQQ A;  2EFW A;  3FHN A;  1VQP I;  2JUC A;  2DMP A;  1J59 A;  3WTT C;  1HBX G;  1DU0 A;  2IBD A;  2DA3 A;  3HOW J;  1XN7 A;  4Y33 A;  2V79 A;  2CFO A;  3ESW B;  1DU6 A;  4ESF A;  1KU2 A;  3B6C A;  5IT9 Z;  1NG7 A;  4N0B A;  2F5C A;  3DLL F;  1U5T C;  2BZT A;  5L3D A;  1XGN A;  3VPR A;  4F91 B;  2PJR A;  4A3G J;  3GFL A;  4IX7 A;  2NNN A;  2JSP A;  2GWR A;  5IYD J;  3GTP J;  1O3Q A;  2VQL A;  2HDC A;  2LLK A;  4O6J A;  1IUF A;  2DOA A;  3ZMZ A;  3CLQ A;  3V8K A;  2MA3 A;  5JVG F;  4BNC A;  4QIW N;  4ZYE A;  1FIP A;  3O2P E;  3AG2 H;  3RQI A;  1U8B A;  4P5O A;  2DTR A;  1MIJ A;  4Y52 J;  1K6Y A;  3MEX A;  4XKB A;  2CW7 A;  3OOU A;  3WHB A;  3ECO A;  3TBI A;  1X2M A;  4CYC B;  4I09 A;  4A6D A;  2HOT A;  3WTU C;  3KET A;  2ELH A;  4IZZ A;  3GTG J;  2EK5 A;  3W3C A;  2FF4 A;  4FET A;  1S3J A;  4FAS D;  4EV0 A;  5EGO B;  2E7W A;  1MGT A;  1ERD A;  4BU2 A;  2DI3 A;  3U1K A;  3DBL B;  3OWT A;  3H92 A;  4KMF A;  5GAE J;  2XF6 A;  1ACI A;  2IA1 A;  4V19 K;  5F27 A;  4ITV A;  3VYR B;  3CCR I;  3BOQ A;  1HA8 A;  4R8H A;  3GLL A;  2EA4 A;  3RKW A;  1JJ8 C;  3CMM A;  1D1C A;  3OYI A;  4AC0 A;  2CJJ A;  1J0R A;  4F55 A;  1QVT A;  2DT6 A;  2R4G A;  2WB1 A;  4M71 A;  1KU3 A;  4KIS A;  2BY1 A;  3I4M J;  1K83 J;  5LHH A;  3F23 A;  3CF5 F;  1OKR A;  2LOO A;  1HLV A;  3S1N J;  2KP6 A;  1FY7 A;  1Z7U A;  2KQR A;  3V8L A;  1R6R A;  4XBF A;  2QKL B;  3JRD A;  4BQN A;  2KT0 A;  4GFB A;  2RKH A;  4HLX A;  2QZ8 A;  4XOR A;  3L2Q A;  3S3O A;  3IRR A;  4FT8 A;  5H20 A;  1A36 A;  1T08 B;  3LAP A;  4OWR B;  5EEA A;  5L3E A;  3Q3S A;  2NOJ B;  2B7E A;  1ZRC A;  5DUI A;  3BG9 A;  5CQE A;  2EQR A;  3ELK A;  4PJM A;  2PMU A;  4LB6 B;  4BY1 J;  3FK7 A;  3CC2 I;  1OJL A;  1UFM A;  3JR9 A;  3L2U A;  1BOA A;  3HHH A;  4GYG A;  1AKH B;  1W7P A;  2R7F A;  2HOS A;  2L2O A;  4IHT A;  1ZG1 A;  5EYR A;  1J75 A;  2CRG A;  4XON A;  3BCB A;  1YG2 A;  2L9S A;  2VBX A;  2VQH A;  3ULQ B;  3KP6 A;  5C4J J;  1VQ5 I;  5GP9 A;  4TV7 A;  3WTW C;  1ZRE A;  1GXP A;  3M8E A;  4XLF A;  5AIQ A;  5DCM A;  1JT6 A;  3W2A A;  2L7F P;  4N9H A;  3DTE A;  3T0Y A;  3EYY A;  4B4C A;  2H09 A;  2VE9 A;  1X2N A;  2RDP A;  2HPI A;  2DAO A;  4U7B A;  4AVZ A;  3LSM A;  5E3L A;  2M4G A;  2WV0 A;  2R7O A;  2XPU A;  2LBF B;  4LIU A;  1R00 A;  2KJC A;  2YU3 A;  4BKX A;  4BBS J;  2E2H J;  2MC4 A;  2OJE D;  1WFX A;  2RGV A;  3GW2 A;  3LFK A;  4RGS A;  3HOS A;  1LFB A;  4QSH A;  5KHD A;  4R1H A;  1JKR C;  2D2W A;  5HVQ C;  1MNM C;  2EIN H;  5HLI A;  2QKM B;  3QU6 A;  1BJA A;  3LSH A;  1SC7 A;  1QGP A;  2FOW A;  3ZQG A;  4YII A;  1U6G A;  2BW3 B;  5ICC A;  5IP9 J;  2ME0 A;  5E1X A;  5IP6 A;  1RRJ A;  3DEW A;  1JUP A;  4XRM A;  4BXF A;  5J8F A;  2DN0 A;  2H1L A;  4ZYH A;  4ZH4 F;  2M8E A;  2PN6 A;  4XRS A;  2LY2 A;  4XLA A;  3MKZ A;  3A4C A;  1D8J A;  2E2J J;  3HJE A;  3RPQ A;  1YOV B;  1BM9 A;  4RGX A;  2HTJ A;  4A3L J;  1L0O C;  1IAW A;  3U9G A;  5DM6 F;  4WWC A;  3IKT A;  1MMG A;  2G7H A;  2X48 A;  1B6A A;  5EEG A;  3H9G A;  4DBR A;  2LC2 A;  2EBI A;  5J4V A;  1ZH5 A;  2K9N A;  3HIF A;  1XDU A;  2DOD A;  3F72 A;  1SAN A;  1TBX A;  1B4A A;  1Y0U A;  2E60 A;  5FFZ A;  4M3B A;  1DUX C;  2AO9 A;  3SYT A;  2WAQ A;  2OZU A;  4HF0 A;  3WGI A;  1KZH A;  1XGS A;  3PIP F;  1YHQ I;  3N97 A;  3J7A O;  5J8C A;  5D5W B;  2O0Y A;  3S1M J;  2OUM A;  4A0Z A;  2LVS A;  2R7D A;  2XF5 A;  3P7N A;  4ZZL A;  2DLL A;  2K9S A;  2QWW A;  1B9M A;  2VBW A;  3KZZ A;  5JHU A;  1M1E B;  4ZC3 A;  1HF0 A;  1ZYR F;  1VQ6 I;  4CCM A;  1G3T A;  2R7S A;  2OF7 A;  4IOC F;  2R7Z J;  3TMO A;  3BY6 A;  4HLY A;  1GVD A;  2W1O A;  3BG7 A;  5KVR A;  4PFP A;  3JTH A;  3OYK A;  4OIP F;  2A6E F;  1X1C A;  1WJE A;  3OV8 A;  2MFZ A;  1W36 D;  2YX4 A;  3BTC A;  3JRH A;  1YO5 C;  5JFR A;  3J7A Y;  2D45 A;  1FSE A;  3DXJ F;  3GX4 X;  3HUG A;  4NNJ A;  1HKT A;  2M9H A;  1RR8 C;  1Z91 A;  1MBG A;  3CQZ J;  5TIS C;  4HA8 A;  1LFP A;  4ANJ A;  4C3J J;  1UAA A;  3BP8 A;  1Z0X A;  5B3S H;  5IOZ A;  2C6Y A;  2PMH A;  4LIT A;  1PYV A;  2IPQ X;  2VC0 A;  1DP7 P;  1MMS A;  1JE8 A;  1BIA A;  5B1B H;  3ZQI A;  4DOZ A;  3I9V 2;  3S8P A;  1IN6 A;  3S14 J;  5CVV A;  3CCS I;  3DQV C;  3RTR A;  1JGS A;  3OL3 A;  3TO9 A;  1YYV A;  2KZG A;  4XL9 A;  2AQF A;  2JVG A;  3TO6 A;  1GT0 C;  1JT0 A;  3AAF A;  1E17 A;  5EZH A;  2LRD A;  2CS3 A;  2NS8 A;  2EV5 A;  5F04 A;  1WCM J;  1ZLJ A;  2A5Y B;  1JXS A;  4MHG A;  2EIJ H;  3B02 A;  1XMX A;  2JMW A;  1IF1 A;  3HB9 A;  3OIO A;  1H88 C;  1OCP A;  1WHU A;  1T98 A;  2IS2 A;  2IEK A;  1BW5 A;  2BVL A;  1UZC A;  1Z05 A;  3ZMU A;  3HC7 A;  3JSO A;  1IV6 A;  1VQO I;  1Z6R A;  5H2F C;  1ETK A;  3CC7 I;  3A1Y A;  2CQ7 A;  2FA5 A;  3ABM H;  2QSH X;  3VYT B;  4LLN A;  2HVS A;  4Y17 A;  4BHC A;  2LKS A;  1OYI A;  2UXN A;  3VWB A;  4O5V A;  2JTV A;  4IJA A;  2A3S A;  3K4C A;  5AIP A;  3S16 J;  2E1C A;  4LK0 F;  5M5W J;  1GDT A;  1B8I B;  3JRC A;  3GVA A;  3TKY A;  3F0C A;  3F3X A;  3K4J A;  3LL7 A;  4KFC A;  1U5T A;  3PO3 J;  2HR3 A;  1QHG A;  3RYR A;  4AYB A;  2EPF A;  1RR7 A;  5DD4 A;  5E79 C;  4LG0 A;  3OYH A;  4QTR A;  1U2W A;  4I0B A;  4AM3 A;  2K7L A;  1OR7 C;  2XAS A;  2Z2S B;  2EV6 A;  2QEX I;  1DP3 A;  3IUO A;  4RLF A;  5KNL A;  2DFE A;  3K4K A;  2DA1 A;  2PMZ N;  1GXQ A;  3D1N I;  1D5Y A;  1IXS B;  2OBP A;  3HGG A;  2F4O B;  4LLG F;  2VXD A;  3NWS A;  1QPI A;  3CCM I;  3WG7 H;  2FSW A;  5HOO A;  4DQ2 A;  5J1Y A;  2HXI A;  3OL4 A;  3I56 I;  1V54 H;  3WU2 C;  1V5G A;  2P6T A;  5C4X J;  2KIM A;  3V7C A;  2KKO A;  2VLA A;  3AG4 H;  3WE3 A;  4XIC A;  3KEQ A;  3ERM A;  3RKX A;  2GAU A;  2RQQ A;  4BL0 B;  1S6L A;  5H6R A;  3Q9V A;  2ZSH B;  3I64 A;  4XLP F;  5LHG A;  2MSY A;  5JLW A;  3IWF A;  4NDL A;  2DOF A;  2FOK A;  1LJ9 A;  5DM7 F;  4CHU A;  3S32 A;  1TQP A;  2LKP A;  1XGM A;  2DFH A;  2O8K A;  5FFX A;  2HDD A;  3J7Z I;  3ZQH A;  2VKV A;  4OMY A;  3NEU A;  3LSR A;  3K0L A;  4Q5S F;  1MDM A;  3HOZ J;  1IUY A;  2ZB9 A;  3K70 C;  2YR2 A;  1KA8 A;  1A6Q A;  3JRE A;  2LY1 A;  3H1C A;  3T1B A;  1GV5 A;  1LFU P;  1R1U A;  4A3D J;  4YFK F;  4HX8 A;  5EG0 A;  2WAD A;  3FM3 A;  1LUJ B;  3PNY A;  4A5M A;  2W57 A;  4OU0 A;  2ZNZ A;  3FXU A;  2ZJR F;  4KIG A;  1TT5 B;  2RAE A;  3K10 A;  3L1P A;  2EWN A;  2FX0 A;  3FBN B;  1SAX A;  1XX5 A;  3SZG A;  5DV5 A;  2JPC A;  4F93 B;  5FLX K;  1SVM A;  1YI2 I;  2M45 A;  1BJZ A;  3FXJ A;  1HW5 A;  5FGM A;  2DYR H;  4EQQ A;  1VQ7 I;  3EUK L;  4ETS A;  3RZO J;  1I6H J;  1OFC X;  2KL4 A;  3K1P A;  1W4M A;  4RBO A;  5J4Y A;  1FP1 D;  4I0A A;  4KJZ A;  1T95 A;  1K78 A;  2DT7 B;  4DYQ A;  2R5Y A;  3RQ4 A;  2KRF A;  1BIB A;  1U78 A;  3OMY A; 
#chains in the Genus database with same CATH homology
 2E34 A;  3CCQ I;  1QA6 A;  3CF5 F;  1YHQ I;  3PIO F;  5GAD J;  3PIP F;  1FOX A;  1FOY A;  2QEX I;  3CMA I;  2K3F A;  1S72 I;  3G6E I;  1VQL I;  3CCJ I;  3J7Y J;  2NXN B;  1VQ9 I;  3CCM I;  2H8W A;  1VQ6 I;  1Y39 A;  2ZJP F;  4IOC F;  3I56 I;  1HC8 A;  3CC2 I;  3CME I;  1YJ9 I;  4UY8 I;  5GAG J;  3CD6 I;  2JQ7 A;  3CCU I;  1VQ5 I;  2ZJQ F;  5DM7 F;  1MMS A;  3J7Z I;  1VQP I;  4IO9 F;  3CCS I;  2OTJ I;  3G4S I;  1VQM I;  3DLL F;  1YIJ I;  2E35 A;  2OTL I;  2QA4 I;  3I55 I;  5JVG F;  2FOW A;  2ZJR F;  1VQ8 I;  3CCE I;  3CCV I;  1VQ4 I;  1VQK I;  3G71 I;  1YJN I;  1YI2 I;  1YJW I;  1FOW A;  3CCL I;  1VQO I;  2E36 A;  3CC7 I;  5GAE J;  5DM6 F;  1ACI A;  4V19 K;  4IOA F;  1VQ7 I;  3CC4 I;  3CCR I;  1VQN I;  1YIT I;  3CJT B;  5GAH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...