3CC2S

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cc2S00
3U1MA 3MDFA 3CXCR 1WWHA 1WF0A 2LMIA 2M70A 2M9KA 4IUFA 3CCLS 2M8DB 1UP1A 4CQ1A 1SJ3P 1WELA 2WBRA 2G0CA 1ZZNA 2KG0A 2HYIB 1WHXA 2DO4A 2VONA 2DNYA 2CPJA 2E5GA 3B4MA 5DM7Q 1K73T 4TLQA 1VQ4S 3MD1A 2DGOA 1U6BA 3CUNA 2X1AA 3UD4P 2XSFA 2LEAA 1M1KT 1JMTA 1P27B 2N3LA 1U1OA 2RRAA 1ZH5A 3G9CA 3CTRA 1U1KA 2DNLA 1X4GA 2MQMA 3R1HA 1RKJA 2OSQA 2E5IA 3S6EA 2DGTA 1X4DA 3K0JA 2DNOA 2DNGA 1WTBA 1K8AT 2DH9A 3G8TA 1YIJS 2XNRA 2LXUA 3CPWR 4QU7A 1HD0A 3LQVA 3UE2A 1YWXA 2MKSA 4IOCQ 5GADU 2M2BA 2BOPA 2MZ1A 1HL6A 3CC2S 2HGLA 1WHWA 2CJKA 1P1TA 2KH9A 2XS7A 2DH7A 2DNKA 3FEYB 1FXLA 3EGNA 1Q82T 1WHVA 1WI8A 2MGZA 4WIIA 5IM0A 2MJUA 3CMES 2MQPA 4FXVA 2YH1A 2RNEA 5DETA 4YUDA 1JJHA 2KT5A 2MYFA 2D9OA 1VQOS 1CVJA 2KM8C 1WG4A 2YTCA 1KC8T 1N88A 2CQGA 2KRRA 1X5PA 4QQBA 1WHYA 1VQ6S 4LIRA 3SMZA 3IRWP 5LXYA 2MPUA 3P3DA 3VAGA 2KHCA 3DLLQ 2I38A 2DITA 2L41A 1R8HA 1S72S 1SJRA 2KXHA 2U2FA 1D9AA 1X4CA 2XS5A 2B0GA 2E5JA 2CQBA 2XS2A 5CA5A 4Y00A 1FJ7A 1O0PA 2DGUA 2OIHA 3UD3P 1WEXA 5D78A 2ADBA 2FC8A 2MZQA 2LKZA 1W2BR 2U1AA 2CPDA 2DK2A 5LSLA 4CIOA 3L3CA 1PGZA 2YH0A 2OJ3A 2CQ4A 2EK6A 1QVFR 3P6YC 1IQTA 2MSTA 4F02A 3CCUS 2DNMA 1FO1A 1BY9A 2MZSA 3NNHA 2JVOA 1S79A 2HVZA 1UAWA 2JWNA 2LEBA 3BO4A 3CCQS 2MKKA 2DGQA 2RVJA 2YWKA 2DHXA 4WKRA 4PRFA 2DO0A 2MY8A 2RUGA 5DM6Q 1WG5A 1D8ZA 2RQ4A 2M4MA 3VAIA 1H2TZ 1X0FA 2EVZA 1X4EA 3TYTA 3D2WA 3U1LA 3CCRS 2KU7A 2DISA 2CPYA 2SXLA 4PR6A 2AD9A 2JRSA 4C0OC 2G4BA 5HO4A 4OZ1A 3TO8A 2UP1A 1VQLS 1QM9A 2GHPA 2X1GA 2CPEA 1YJ9S 4W92B 1Q86T 5CYJA 3OW2R 2DNNA 1U1NA 2DNHA 2MKJA 2CQDA 2MSSA 2M7SA 5JVHQ 1M5PC 1NJIT 1KOOA 2DGWA 4PKDB 2N7CA 2MZTA 1A7GE 2PE8A 3EX7B 2RS2A 1U1RA 3S8SA 1AUDA 3J7YU 3BO3A 1X4HA 2M52A 3CCSS 5FJ4A 1VQPS 2DGXA 2MXYA 2CPIA 1U1LA 2MMYA 3THPA 2L9WA 1N52B 4YOEA 5IQQA 4UY8T 3G96A 2AYGA 3MUMP 1HD1A 2DNRA 1SJQA 5GMKa 1M5OC 1PO6A 1A9NB 5ITHA 3ZZYA 5GVQA 3R1LA 1NU4A 3BS9A 4ZKAA 1URNA 2KI2A 1F9FA 4OZ0A 3SDEB 2DH8A 3NS5A 2HGMA 2KXFA 3PIOQ 1YJNS 2VOPA 1X4AA 4A8XA 2KYXA 2KG1A 3H2VE 5GAGU 3VAMA 2RQCA 3HI9A 1FJEB 2RRBA 1VBYA 1UFWA 1VQ5S 4IOAQ 1JJ4A 2QA4S 2AYMA 3VAFA 4C4WA 2E44A 5CXTA 1HA1A 3NS6A 2NZ4A 2FY1A 2AYEA 5IM0B 2DHSA 2HZCA 3EGZA 1Q81T 2MQLA 5IFMA 2L08A 1VC6A 2LXIA 1YTYA 1H2VZ 4WF9Q 1H6KX 3S7RA 2M8HA 5DDOC 2MZJA 2OSRA 1RK8A 4CH1A 2J0SD 3SXLA 3ZZZA 2MB0B 4M5DB 4EGLA 3CULA 1UW4A 1FJCA 2MJNA 3US5A 2DGVA 3VAKA 4LJMA 2CQIA 5DDQC 1VQ7S 5DDRC 1L3KA 1YITS 4P6QA 3CCJS 3FEXB 2CQ2A 2KFYA 3B4DA 3G71S 3CCVS 2J0QD 1U6FA 1G2EA 1DHMA 2CQPA 2MGZB 3UCGA 3NNAA 2MKCA 2QFJA 2AYBA 2CQ0A 2DGSA 1KOHA 4QPTA 1WI6A 1DRZA 1OWXA 2GO9A 3CC7S 2JVRA 2KN4A 2CPFA 1VC0A 3UCZP 3NNCA 2RU3A 2Q79A 3N9UC 1FNXH 2K3KA 3RW6A 1M5KC 3Q2TC 3PIPQ 1X5TA 1B7FA 2KRBA 2LYVA 4ED5A 2MKIA 2YKAA 3MD3A 1OO0B 2O3DA 4FXWA 3I55S 5HL7Q 2MQQA 3H2UB 1FHTA 3P49B 2FC9A 2EK1A 5LXRA 1M90T 1NO8A 1R8PA 2E5HA 2XB2D 3IWNC 2CPZA 2QEXS 2N3OA 2FPHX 3R27A 3MURP 4QU6A 2F9DA 2RT3A 2RS8A 2K8GA 5LJ3Y 2F9JA 3VAJA 5LSOA 1X4BA 1SJFA 2DHAA 3CF5Q 5DDPC 1WF1A 4F25A 1ZZFA 2LA6A 1OPIA 2JX2A 3BO2A 5D77A 3MI7X 4CH0S 5EN1A 3I56S 4UQTA 1Q7YT 3V4MA 3CCMS 1YJWS 1U2FA 2DNZA 1WEZA 4V19X 1KQSR 1YHQS 1M5VC 4LMZA 5H1SV 4W90B 2D3OR 3MXHP 1VQMS 2LECA 2DIVA 1U1PA 1OIAA 1K9MT 2ADCA 4C7QA 5JVGQ 2OTLS 4WCEQ 1WG1A 2D9PA 2MQNA 2PEHA 4J5OA 3NMRA 3VALA 1WF2A 4YB1P 2CQCA 2N82B 2KXNB 1DZ5A 1VQ9S 3P5TL 3G8SA 4IO9Q 2DNQA 3BEGB 2CPHA 3VAHA 2M0GB 2I2YA 2XNQA 3UCUP 3UWTA 1SXLA 2MKHA 3Q2SC 2F3JA 2J76E 2MHNA 4WFNQ 4Y0FA 3LPYA 3VF0B 2DIUA 1VC5A 1VQKS 3HHNB 1U1MA 2ERRA 4BS2A 3CD6S 1VBXA 2CQHA 2LQ5A 2M88A 5GAEU 3JB9k 3THTA 4ERDA 1KD1T 1X5OA 3CMAS 4TU8A 2VODA 2OTJS 2HGNA 4TU9A 3RW7A 4WFBQ 4RU2A 3S01A 2ZJRQ 1X5SA 4U67Q 5LJ5Y 3J7ZT 2MZRA 4F26A 4Z2XA 4WFAQ 3MUVP 2A3JA 3CC4S 1N8RT 2ZJQQ 1JJ2R 1N54B 2LA4A 4TU7A 1QVGR 1SJ4P 1FT8A 2MY7A 3MOJB 1VQNS 3G6ES 3CCES 2X1BA 1YI2S 1DBDA 2DHGA 1U1QA 2KM8B 1X4FA 2KVIA 5GAHU 1H2UX 1WEYA 2DB1A 2NLWA 3MUTP 1VQ8S 2ZJPQ 2G1DA 2LCWA 2VOOA 3ULHA 2CQ1A 1XN9A 5MLCV 1VBZA 2CPXA 2CQ3A 2V94A 2MQOA 2DNPA 2BZ2A 2X1FA 5BJRA 2FHOB 3TP2A 3SDEA 2J8AA 3DXBA 3G4SS
chains in the Genus database with same CATH superfamily
4NCGB 1JLQA 2XHWA 3OL9A 3SSSA 1R0CB 3BSCA 3RBXA 1FKPA 2LMIA 4M5LA 2M70A 2M9KA 4CO4A 2UVVA 4LSLA 2FLNA 2VG7B 3IBFB 4HH0A 3M32B 4X4UA 1HQ2A 2KB2A 2ZD1B 1CS4B 4LFBF 1WHXA 2HW3A 3NCQA 3HDSA 1CULB 1B0PA 2BOAA 2D1CA 2CPJA 2JHEA 1LWXA 3B4MA 1WC1A 3FC9A 4OYBA 4LF2A 3ISND 4JI8F 1EKSA 3UDEA 2PA3A 1VQ4S 1TTHB 1XWLA 2OMLA 1F3VA 1WDDA 3LGMA 4ZCIA 2XSFA 2X1AA 3CUNA 4ID5A 1LW0A 5BR8F 4DQRA 1N34J 4P71A 4IG0B 1BWEA 1NH8A 1Q16B 1S9GB 3E8OA 2EPIA 3RGIA 3SEOA 4CRJA 3G9CA 2APOA 2UXBJ 2CVEA 5IC4B 5CAAA 4Z7CA 2IFXA 5LMUJ 2MQMA 2X3GA 4ZVSB 4N47A 2UUBF 3UW1A 4X4VA 2XSJB 3TJ8A 2OAUA 4WZMA 4B9UA 4DL2A 4WK3A 4DV7J 1JLQB 2C3UA 1TL4A 3O1LA 2P8IA 3OHAA 1NK7A 3IBWA 5DG7A 1F1BB 1UKUA 1RKJA 2HVHA 1KSPA 1NB7A 4Q2LA 1O51A 1JLAA 1LXJA 2OSQA 3S6EA 4ZHRB 1NAQA 2E7WA 2DGTA 3IAM9 3MCOA 3N79A 4FVCA 2V4QA 2HAIA 1WTBA 1OYEA 2ZC3A 5ETVA 2FDNA 4HHHA 4J9QA 1K8AT 1N33J 4RUHA 3V6DB 3G6XA 4CLTA 2LXUA 5HP1B 1YVFA 3EZ5A 3LQVA 4USVA 5J2PB 1R8BA 2VG6B 1HWUA 4IOCQ 2M2BA 3GCXP 5K8OA 2AGPA 1FRXA 1RWUA 2Z58B 3LP0A 1IKYA 2Y8WA 2HGLA 5KFEA 2JNJA 1IKYB 3L7UA 1GX6A 3KHHA 4DV4F 4B9LA 5CHCB 1P1TA 1PJ5A 3C6TB 2CZ4A 3W8GA 1VFJA 1RT5B 2XS7A 2QT7A 5J2QA 2DNKA 4F36A 4ZITA 3VZHA 1Q82T 2CZ9A 3MEGA 3R97A 1CJTA 3BPDA 2MGZA 3N4WA 1U25A 4L76A 2B8QA 4O44A 3BGLA 3CJQA 2PSZA 2YH1A 2DRBA 4LFAF 3R2CJ 5IC6B 4FZVA 1JJHA 3K5MA 2HMIB 4DLGA 2YX1A 3MAAB 1A6LA 3UR0A 4EO6A 1CVJA 4K0KF 2AU0A 4DN0A 3SIPB 1YSJA 4CO5A 2DCLA 3M8SA 2CNOB 4TQRA 2CQGA 1MWYA 2W1BA 3G6YA 3W3SA 4DQSA 1VQ6S 4LIRA 5LXYA 2MPUA 3P3DA 2KHCA 4MKAA 2L48A 2W25A 4F0KA 4R8UB 3CEDA 1U2RA 4ILRA 4CLSA 2ATCB 2F65A 3DLGB 3OHBA 2IJNA 1S77D 2ZH4A 1D9AA 1WORA 3R7BB 4MIBA 3QRRA 3M2VB 3ZXWA 4AL5A 1PBAA 2G1HA 3OSPA 4I4BA 2B0GA 1ZM9A 1URRA 4GVBB 1B70B 5CA5A 1N33F 1AYEA 4QZVB 3H4DA 2L9DA 5IV4A 5E3PA 4H4MB 1RT5A 1H73A 5CYMB 2VDHA 3UD3P 3LWMA 2G2YA 5FJ4A 1APSA 1DTTB 2BW7A 2ZOGA 3MPYA 4PXBA 3CIZA 3T6JA 4X66J 3HHKA 4NMXA 1RHKB 3OPKA 4QJVA 3V6KA 3QJJA 4DJBA 1KKHA 1KVJA 1TZ0A 5E0OA 3L3CA 3H2LA 4HDGA 2O1PA 2OJ3A 2XMKA 3OFFA 1QVFR 3P6YC 2BM0A 1QDUB 2MSTA 4UOGA 1XMQF 4DX5A 3QYYA 3ETMA 1UVIA 3CCUS 2BKNA 1AB8A 2WTFA 1MMNA 2MZSA 3A1YG 2A10A 4Q0BB 4CLKA 2VFRA 3Q8QB 1VRTB 1FWLA 1S79A 2JVOA 1S6PA 1UAWA 2JWNA 2Q6BA 3KUGA 2DXDA 1QSLA 4MKVA 3BO4A 2QX0A 4FNHA 2XLIA 3GR1A 3BBCA 2LVWA 4IH5A 5H9FK 2VBZA 1VS3A 2RUGA 3H59A 3MPUB 1H38A 1WG5A 1D8ZA 5HROA 1FEEA 2B9XA 1Q8IA 4IG0A 4WP9A 4AD6A 5KT5A 3VAIA 3T5KA 2GMLA 4H4OA 4HTJA 3NWGA 3CJRA 3NMAA 1DARA 2VPYB 3E01B 3KG0A 3NOGA 2HNDB 5E33A 4R25A 4ZVRB 2BE9B 3GIIA 3CCRS 2JRSA 3CJ2A 4DPWA 1V5VA 2WVEA 2FJVA 1RBAA 2PGCA 4O4GB 4OX8A 4B02A 3HJFA 2A1BA 2XY5A 2HQDA 3BDEA 3PTWA 2D7SA 3FFIA 5FIIA 4ZP9A 1UVLA 2XWXA 1CC8A 3T1HJ 3ZZUA 1VIXA 3BGOP 4LF8F 1OJ4A 2E1CA 4NCGA 2DD8S 5JUMA 5KG0A 1JXVA 2CQDA 4DR7J 4F7VA 8ATCB 3MECA 3BQ0A 5HMWA 5HLFB 1M5PC 3H42A 1GNKA 1VGYA 2XLKA 3MEKA 3NGTA 1X9WA 1WACA 4HACB 1IJFB 2N7CA 2ACYA 1Y3KA 4ECTA 3I32A 3QT5A 3R7NB 3ZNUA 3N6MA 1SBRA 4CNZA 1LV5A 4LF6F 2PEBA 4NXNJ 3TZXA 4Q8FA 3EX7B 1X0PA 3I96A 3EZUA 4H4KA 4QWEA 4K4XA 2IAJA 2QLXA 1QAXA 1RAIB 1X4HA 1T03B 1S1WB 4YB5A 5L39A 3FQKA 1UZHA 3P5BP 2XGPA 1ROFA 2DGXA 2I9SA 2F8EX 4DV6J 2LDYA 1VQPS 3K5OA 1KEKA 4YOEA 4NASA 5IQQA 2V4RA 1IBMF 1FWPA 1HW9A 1U7LA 1QSSA 3DMJB 1EJ7L 1SJQA 3M1VB 4NMLA 1S0VA 1HD1A 3KJQB 3PEHA 4NYZA 1BMQB 2A18A 1SQGA 1ELOA 1NSPA 1UFKA 3CT9A 3W1YC 4DV5F 5M2UA 1WKJA 1AZSA 2UUAF 1S1VA 4U9RA 3OR1B 3MCMA 4O0NA 4CT8A 3BYRA 2ZHOA 5BYRA 3R1LA 2PT0A 2E5LF 1TUWA 1FKPB 4ATNA 3BS9A 3WBZA 1GQEA 4B17A 3BDPA 4O3OA 1IBCB 4C3MA 2LP4A 3Q8PB 2KI2A 2HRUA 4XDCA 2NXEA 1F9FA 4I2QA 4IRDA 2VOPA 1R89A 4ZVFA 2HIYA 3LH2S 4DL6A 3OT9A 2AX0A 2KG1A 4ECZA 4WXOA 5GAGU 3BM7A 3BQ2A 1YJTA 3VR1A 4MK8A 4X62F 4MK9A 4ICLB 4K2XA 2RRBA 2YKMB 3OJSA 3JYTB 1VBYA 3FKBA 2GGPA 1JJ4A 3D54A 2BW2A 1ZTTA 3VAFA 3RR7A 4C4WA 2HNZB 2CG4A 4F8RA 5CCMA 2QA1A 3GLJA 3DLBA 1Y5NB 1EB0A 5BYQA 3J7YI 4J9PA 5ETMA 4OI2A 4P74A 1TKDA 4QWBA 2ZHAA 2AYEA 5F8HA 2HVDA 1RWOB 5GAGI 1HNIB 3P45B 3GQCA 3EGZA 4DV0J 2CJYB 3IGVA 1HMVA 4J9MA 3RRGA 5D3GB 2MQLA 5IFMA 1VHFA 4C3KA 2QIFA 3LP1A 2UVWA 1WC6A 2OD4A 2DHHA 3LANA 2FJBB 1N5YB 2G13A 2LXIA 2X7IA 3LP2A 4H54A 4ED7A 1YTYA 3H0PA 4EU0A 4NCBA 2XY6A 1F9EB 2CFXA 3ISNC 3SFUA 3AD9C 3ILLA 3A8EA 5HBMB 2W9CB 3T1YF 3S7RA 1RBLA 4DDFA 5DDOC 1KLMA 4NOHA 4E98A 1KHVA 3TI0A 4FXDA 3FSXA 3OR2B 5DRKA 2Y0BB 2ZH9A 4DV5J 2J6SA 4X4TA 4J9OA 1UA1A 1TK0A 3EXCX 1UJ5A 2OHDA 3OVSA 2IJFA 4NLXA 2YWWA 3MMCA 1RT2B 4TLRA 5DQGA 1FJCA 3VAKA 2B5JA 2XI2A 1UEVA 5EWEA 2HNYA 4DV3J 3DN9A 2VBYA 3OR2A 1NJZA 3DLEB 4MIAA 3KK1A 2BV3A 3DLHA 2FZCB 2H4WB 3SQGB 4C9DA 3PNIA 4NRUA 4P2MA 4CLWA 4OZ2A 1UWBB 4YHHJ 3WIVA 3CCTA 5C5JA 4P6QA 3CDBA 4U8VA 3KLGB 2BANA 1YITS 3MPVA 2HG4A 4GRSA 1WSVA 2J9DA 4P7TA 5FLXU 4JV5F 4KIAA 4DUYJ 1B0TA 3A4TA 2CJXB 1NM2A 1U6ZA 4WE1A 3CJKA 3T5JA 2XZTB 1U6FA 4PQAA 1SC3B 2CQPA 3K58A 2ASJA 4EZ6A 4H4MA 4K4TA 3BR8A 4WYLA 2AYBA 2CQ0A 4ES3A 5JJBA 1KOHA 3ZTOA 1BUXA 4KHRA 1R31A 1WSRA 3M2RA 5HQMA 1SIZA 1RWWB 3H4BA 2GO9A 4N56A 2AZ3A 4ZPBA 1C4CA 3CC7S 4JI5F 2NXJA 1R0AB 2CYYA 2YKPA 4KO0A 3TZWA 3RTVA 3DRPA 1RTIA 3IAS9 3W2VB 5FD1A 2Q6CA 2B4VA 3MM5B 4EMDA 5B0GA 1XR7A 2PMZD 4USUA 4ZP6A 3FDSA 4LFBJ 2Q79A 4RNFA 2R7SA 4PCQA 3N9UC 1QJHA 2ZEJA 4RNMA 1XC9A 1FNXH 4JI5J 3RW6A 2BDPA 2ZE2B 3W5YA 1B7FA 2KRBA 3RUBL 4I0WA 2LYVA 1S6PB 5IT9Y 3KHLA 2B7CB 2ZWOA 3DOMA 3MD3A 3KXDA 1OO0B 3I4PA 1YLXA 2QA4G 4ED5A 4MKYA 2MQQA 1FHTA 1QY7A 1NNDA 3QO9B 1QE1B 1IBMJ 2IM3A 2V8HA 5K14B 1SC4B 1Z4UA 3OSNA 5E3CA 2FLPA 2BVZA 3QQCD 1RWPB 2AGOA 1X9MA 3D3CJ 3IWNC 2CPZA 4ZIVA 3NL0A 3AT1B 1Z2LA 2FPHX 2YNGB 3JS9A 5AXNA 1VQSA 4I6WA 2EBGA 2OUGA 2GJ2A 5KG7A 3PX4A 2KZMA 3M9NB 2VG5A 4E0DA 1DURA 2H5EA 2KJWA 4DUTA 2F9DA 2RT3A 5J1EA 1LWCA 3PVXA 3RB4A 2K8GA 3IWXA 1KP6A 1T9WA 5G0RA 3U27A 5LJ3Y 1PJ7A 3HZEA 3PKMA 1TVRA 3FRZA 2Z4PA 4H4OB 3TRGA 5DDPC 3RB0A 2KT3A 3CO9A 2K3IA 1ZZFA 2LA6A 4RBUA 4DL3A 4Y28C 3BO2A 3FGVA 4FF3A 2EC2A 4FF4A 2YKOA 3PHTA 3M8WA 1U45A 1VLYA 2DKOB 1FI4A 5I3UA 1XNQF 3V4MA 2HWHA 3CCMS 2VH7A 4LF5F 3CD0A 1AFJA 4JI8J 4FKYA 2DNZA 4JYAF 4IFVB 5KFXA 3KJNB 3C66A 4KE5A 3KMQA 1F5CA 3UN5A 1N34F 3R6LB 4JI3F 3ZTSA 5DLGA 3VVUA 2C28A 1KDNA 3GV7B 3SSRA 2B8PA 5H1SV 3JAMU 4ZPWR 4RW4A 3OR1A 4LF4J 3MGJA 4ZCMA 4QYRA 3BF4A 3HSGA 1F3FA 5C2GA 1Q53A 2MKYA 2W4CA 1UCNA 3FEZA 3HD2A 1BLUA 4F4YA 3GJQB 1XR5A 3BV8A 4ID5B 4KB7A 4XAKA 3LP2B 1TAQA 2BEFA 2QLJB 3IA0A 2LFVA 4I64A 4OHVA 5F8LA 4FYVB 2E5LJ 2GX8A 3QIPA 1PAUB 4A46A 3BEGB 3LO3A 5KFGA 1HMVB 2RD5C 2FVQA 1BQNA 2XNQA 2GZOA 3UCUP 3BJYA 2KTQA 3A8KA 2EG1A 3UWTA 5A8RB 1TMJA 3O8WA 3OL7A 2MKHA 3Q2SC 1S6OA 2MHNA 2IRYA 1HW8A 1EAYC 3TZZA 5IWAJ 3PY8A 4ZJQA 1W7WA 4AFFA 4NLOA 3PRVA 4GC7A 3N5BA 3KDNA 4CM0A 4ZIWA 1V3ZA 2EWHA 2K7JA 2XMTA 2YKMA 1FRKA 4IQMA 1LWFA 2BBEA 2LQ5A 2M88A 3BREA 3MECB 4ICLA 3HULA 1VBXA 1X7VA 4NXMJ 2GHWA 1R8CA 5HP1A 3MM9B 1T7PA 3LF0A 4JI7F 3QPIA 4J9VA 3C14B 3HHLD 4FPRA 1IBLF 4DSJA 3HK2A 1TKTB 4DCPB 1CPZA 2YQ0A 1Y3JA 4QR0A 1HBUB 2BUNA 4TU8A 3RAMA 2OTJS 2Z2MA 1RDRA 3GMGA 2FHJD 3AODA 3ISZA 3RW7A 4WFBQ 2AEFA 1X5SA 2B56A 2WCXA 4ELUA 4Q7AA 3T1AA 1JNZB 2HMIA 3J7ZT 2QLFB 4K4UA 4KHPJ 3CC4S 1NRKA 2UV8A 1S7IA 4L75A 2FVSA 2D3O1 1N54B 5BR8J 2ILYA 4W4MA 2CDRB 4WP3A 3TUZC 2AQ4A 1SJ4P 1QTNB 1D0EA 2UUCJ 1VQNS 2DR8A 1FKAF 1VK8A 3CCES 1OMSA 2VBXA 5LMUF 2R2TA 3KWMA 3ICLA 1DBDA 4JI4F 1U0HB 2R7WA 2K1RA 1T05A 1VBKA 1ZTWA 4ZVHA 4ANDA 3V4IB 4AXIA 1WEYA 2JJ4D 3PR4A 3MMBA 2NLWA 4IH7A 4CLZA 2ZJPQ 4Q0BA 2FYXA 2OMOA 1WDTA 2VG7A 3PHEA 2R2SA 2VOOA 2ROGA 3BR9A 4LQ9A 1KN6A 1BQMA 1YBUA 3CD5A 4GC6A 4LR7A 1VBZA 2CPXA 5KFIA 3F41A 5IOLA 1HBMA 1SB6A 2BZ2A 2QYGA 3AQPA 3MM9A 1VJQA 4KBIA 5KT4A 2RJZA 3NGKA 4X4NA 2FHOB 4EZ9A 3GJTB 2VIHA 4KQZA 2J8AA 2FHKA 1N0UA 4Y65A 2EFOA 1NKEA 2C1EB 2EFGA 3MZIA 4LSNB 4O3PA 3K5LA 1WWHA 1WF0A 4USJC 5ETQA 1T9UA 3RJMB 4GO7X 1HYSB 3I0SB 3AAWB 3M8ZA 1T95A 4ZVPB 3CCLS 1IBKJ 3ETOA 1G7CB 1I5OB 2BRLA 2CJ9A 2FZGB 2G0CA 4KHMA 4UZCA 1NZAA 3T6BA 5CD4H 1U49A 2HYIB 1TVRB 2D3UA 1RHQB 2RHQB 3GTYX 4LREA 1WOSA 3HP6A 1GT8A 4DR2J 2KFZA 5AXKA 2DNYA 2E5GA 4ED4A 1TL3B 3QFHA 1LNQA 1HNZF 3MD1A 2DGOA 3I9V9 3HMJG 4FYWB 2QGFB 2P6SA 4QR1A 2HFVA 4HDHA 3UD4P 2ZKTA 1KVIA 1XQIA 1M1KT 3AD7C 1P27B 2N3LA 2ATLA 1U1OA 2YKQA 3D5MA 1I94F 3OBIA 1GAOA 1WOOA 2AZ1A 3D6TB 1ZH5A 3SCJE 4YN3B 4N41A 4G1QA 2DNLA 4ANEA 2HHSA 3MR7A 4RUAA 5D4OA 4IFYB 4PG6A 1X8DA 1YGYA 2Z0GA 4D3HA 2QL9B 3PV8A 4N8OA 4KGVB 3C8YA 1DJ0A 3R1HA 4B3TJ 4M63A 3HXMA 2ZC4A 4ID8A 2K06A 2V68A 1U48A 5HMZA 2OI2A 3HD1A 1D9DA 5F3ZA 1K1QA 1AT1B 2VFVA 2DNGA 2F8MA 1S6UA 4LVNP 3TAMB 3HT3A 2AKWB 3CMQA 2OPQB 4FN5A 3PEJA 4NE9C 2QG9B 4M5DA 2OEJA 5KFTA 4BHQA 1O8BA 3IWLA 4CLYA 4CO0A 3T1HF 1HD0A 3LALA 3VV2B 3ILIA 3UE2A 4A4JA 2ZH2A 4Q43A 4OHYA 2MKSA 4V1Ak 1WKKA 5GADU 2A2DA 4Q8EA 2BJEA 2R7TA 1WD6A 1HL6A 4DR4J 4RBVA 4USHA 2WSFC 2WVBA 2YY3A 4ZLPA 3CC2S 1L3SA 4JI1F 3NXZA 1JLBA 1NHVA 1TAUA 2CJKA 4RW7A 2Y0SD 5F8GA 4RW7B 1FJGF 4Q45A 2DXEA 1HQUA 1RJJA 2XHCA 4G65A 5EUHA 2ZM6F 3TA1A 1KTVA 1LWEB 3KKFA 4H4KC 3NAIA 4J91A 4JI6F 5ADZA 2UXDJ 1P9YA 1K44A 1FRMA 1Y5IB 3V6DA 2O66A 2NR0A 5IM0A 1RTHA 2MJUA 1NPRA 5DGBA 3PFOA 3ILOA 3IBCB 4DLEA 4KAIA 3DLGA 4LF1A 3AA9A 4ZLNA 5KAKA 2AGQA 4QIWD 1HHQA 1IBLJ 4ETZA 2DPIA 4MFBB 1ZOTA 4KY3A 2E1AA 2KM8C 5ETTA 3EICA 4HH1A 2FHJA 3QT8A 4I69A 1KC8T 1S57A 4Y2IA 2ZDOA 4CLUA 2HBQB 1SIWB 3RZAA 2Y1RI 1X5PA 4QQBA 4BCAA 2ZOFA 1NB2A 3ILJA 1DTQB 2VJVA 4NA3A 3C6UA 1UW9A 4D3GA 3UNYA 1MU2B 3W64A 1MWZA 4F3OA 3QBCA 4Q44A 3DLLQ 1U09A 2ZH7A 3CDWA 1Q8LA 1C1CB 2I38A 2GJFA 3EXYA 3TUIC 1IKVB 2BJ1A 5AE2A 2PFDA 3J81Y 2L41A 1K1SA 3MOZA 5ETRA 1FRHA 4X4OA 5KFSA 2NUHA 4OL8A 5A8RA 5K20B 2E5JA 1M1GA 1T0TV 3KK3B 2Y1IA 1PJ6A 5E7OB 2XS2A 2CJQA 4Y00A 1FJ7A 5HK4A 4NI2A 5KG2A 3GU0A 1GXUA 2DXFA 5D78A 2XZWA 3T9ZA 4DR4F 1S1TA 2MZQA 3ZTRA 4CTAA 1O5JA 2LKZA 3LP0B 5HQ8A 3BYPA 4UT4A 1J5EF 2AEJA 2CPDA 2DK2A 2RKIB 3DCAA 4P10A 4CIOA 3H40A 4BC7A 1RWMB 2JEFA 1S9EA 1PGZA 1N5TA 1OY9A 3G82B 1SUQA 4DX7A 3SI8A 2CAJA 1FK9B 5EX3A 2Y8YA 1WC3A 3G2XA 2AW0A 1IQTA 4LF5J 3KLIB 4P75A 1UEUA 2J7WA 1MROB 4A47A 2DNMA 3MAHA 5E3RA 1HBMB 3PFEA 4KH0B 3QZ8A 3QGHA 3C46A 1GH8A 3AXKA 1AA1B 2XGQA 4CLFA 4B9SA 3Q8VA 1SI9A 3QJPA 3CCQS 4YP3A 1B4SA 3T1YJ 2D41A 2OPPA 4AL7A 2YWKA 2CNNB 3QSIA 3EZOA 5KT6A 5HBMA 2PI4A 5DS7A 3D1OA 3K57A 1HPZB 3HVTA 5DM6Q 4IR9A 2IIHA 1U0HA 3KHRA 2VPZB 2LU2A 2VFSA 2Z57B 3CVKA 2M4MA 1AZSB 1H2TZ 3L09A 9RUBA 3Q8RB 3A3OB 2XC9A 3QIPB 3OXFA 4FS1A 3J80Y 4F50A 2EVZA 1EIYB 1SH2A 3U1LA 3DLKA 3HVTB 2CPYA 1JLFA 1VRUA 1HPZA 4PR6A 2IM2A 4C0OC 1S0NA 4JOUA 2HWIA 4ZN3A 1CS4A 1KONA 4C6AA 1VQLS 4OYZA 1RSCA 1QM9A 2HBRB 2X1GA 2NREA 3RRKA 1IXKA 1NSKL 1I3OB 2BQUA 4MTPA 1NPKA 3IMQJ 4W92B 1HBNA 4C8NA 1YBAA 2P2CB 3L9ZA 4P52A 2Z2LA 2V50A 4NXMF 2DNNA 1U1NA 2DNHA 1HBUA 4DPYA 3FVYA 4DV1F 1MN7A 2MKJA 3ENWA 4RW9A 1MROA 2QMWA 3HZGA 1M5HA 3QNWB 4K2JA 2VV5A 2HHQA 1CEZA 2J9CA 3FCVA 2LLZA 4QWAA 4DUZF 1TUVA 8RUCA 1N0VC 4WXWA 1FVSA 5L46A 2V34A 2WRMA 2DGWA 2V67A 2YXLA 1JKHB 3M8YA 3OD2A 4LR9A 4PKDB 4TQSA 1QAIA 3MFIA 5EWFA 4JV5J 2MZTA 4F4ZA 2VFTA 1A7GE 1SV5A 1XERA 3M05A 3P8BB 3SCKE 1RKIA 3F0NA 2QN6B 3AJ1A 3GONA 5A8KA 3W2VA 3PJ9A 1AUDA 1C0UA 2H1YA 3K5PA 3BO3A 4M95A 2D69A 2GJIA 4JP8A 2M52A 1LWEA 3CCSS 2WB1D 4GVLA 3OTEA 4GVBA 1HWKA 2W9CA 3JAMY 5KFZA 2BRKA 4WWSA 3BBFA 2UUCF 5GMKa 2OO4A 3D28A 4ECXA 4NL5A 3M30B 4LF4F 2WONA 4EEYA 4U6PA 2JLGA 1PO6A 4EYHB 2HWTA 3IS9B 1SKRA 1A9NB 1F9HA 5KG4A 3PACA 1X60A 3DDIA 3NEKA 1T11A 3QO9A 4C0BA 5M2PA 1S10A 3Q22A 4ZKAA 4JV2A 3W7BA 4RNNA 1URNA 3HM9A 1N32F 4DV3F 1S99A 4P73A 3NS5A 2DH8A 4R5PA 1LEOA 1YJNS 3CWJA 2BM1A 1X4AA 3H5YA 4A8XA 5HVFA 2BE2A 3VAMA 1TL1B 5B7WA 4MYUA 3DI6A 3GSDA 3U7JA 4DSFA 1JK9B 2ASYA 4DR1J 1UEKA 1RAJA 4CO3A 2P9CA 2YX7A 2QJ3A 1WUUA 2V69A 4G1PA 1VQ5S 5CD4A 1YDLA 2H51B 1RTIB 2XM3A 3NBPB 2E9RX 1YX2A 1RAOA 3AH6A 4QPXA 1Y9OA 2PN6A 3AHPA 1UVNA 2DVIA 4NZ0A 2Y3YA 1HQUB 2E44A 3MCNA 4FYYB 2BKPA 2L9NA 4QIVA 3EM1A 5E3AA 4A48A 3NS6A 4K4WA 3K5NA 4B9VA 3NAHA 4M8LA 4U7CA 3Q8SB 4ECRA 2BXJA 5IM0B 3W65A 2FY1A 2DHSA 4UOHA 2JEGA 1KBRA 5J1PA 4QR2A 2JH3A 4X65J 3OQ2A 4RKUC 3TVKA 1UA0A 4TY8B 2G9OA 3OL6A 3BSAA 3Q86A 1XK8A 4MK7A 1YKWA 4XPCA 2C2NA 4UW2A 4OYXA 2BX6A 1H2VZ 4M5MA 8AT1B 2WVDA 1VRQC 1Q0NA 4DU7A 4BC9A 1VYAA 5C25A 1H6KX 4L6V3 2HQCA 1VQYA 1TUGB 3WDOA 2MZJA 2OSRA 3ZTPA 4G3IA 1S1WA 4CH1A 1Q78A 3SXLA 1MU2A 2XEXA 3KK2B 2MB0B 1QUPA 4M5DB 4EGLA 3QGGA 1TL7A 2FGCA 1ZM2A 5L9XA 4LF7F 3W60A 4MJKA 5KFOA 2R2UA 3A12A 3D7SB 3OFGA 4DG1B 4MIWA 4HACA 5DJBA 4I2QB 4IRKA 4UY85 5KG6A 2ZITA 4J7CA 4LR8A 1KFSA 3RG6A 1C1BB 1L3KA 1RADB 2Z30B 3CSKA 2JEIA 5HLFA 1PYTA 3CNQP 3DKDA 3ZO7A 3CCJS 2CWKA 1R0BG 4KH1B 4N7TA 3GV5B 1FX2A 4HL9A 3G71S 2YNHB 3FUYA 9ATCB 1N36F 3W5XA 4YS2A 1FNOA 1FRJA 3TQEA 1DHMA 2FVCA 3SCIE 4JI7J 3DOLA 1TK8A 1S1UB 2WW4A 4Y2AA 1EZZB 2KYZA 3TAPA 1WI6A 4P2XA 1UJ6A 3SCLE 2UXDF 4LSLB 1WC0A 2Z56B 5IWAF 2I1RA 4RJVA 4DV1J 5EX0A 5FDLB 3TEGA 2YNIB 2BE7D 1F0XA 1V9OA 2CPFA 2GGPB 4OYMA 5HMYA 1VC0A 2E7VA 1N36J 2C3PA 2EFNA 2B7BB 2W4PA 1PG5B 2X3DA 3AOAA 4NWBA 3UFCX 2AJ2A 3OUYB 3KJVA 1N4LA 2KFNA 5HVHA 2XZDB 3W2WB 2RU3A 3TA2A 4ILLA 3QWUA 5U47A 4DR5F 3HSDA 1Y4ZB 3AXMA 1RU1A 3OTBA 3I5BA 1XBWA 3V6HA 4NYPA 4OHWA 3PIPQ 1FXDA 1X5TA 1TL7B 1JLAB 3OUYA 3Q2TC 4Q2MA 3DRSA 2C3YA 4NLRA 3IXQA 3DDKA 4JI4J 2UVUA 3D0GE 4DQPA 1FWKA 4FBUA 4WU3A 1R27B 4FBTA 1GMWD 3Q8YA 2DTJA 3PRDA 4I1TA 3TEHB 1G4CA 5HL7Q 4X4RA 4NLWA 3PW4A 3P49B 2FC9A 2EK1A 5A2QY 5KFQA 1T05B 3GJRB 4WZQA 3PX0A 4NZ7A 3V5RA 2E5HA 3GYNA 2XTJP 4A8QA 3EDQB 1FFSB 2CJAA 4FVMA 2QO3A 4ZVUB 1BQNB 2QEXS 3CDAA 2GW8A 3MEGB 3OXGA 1N5YA 3LGHA 4OYPA 5M2RA 1QAJA 5IT0A 4F4AA 2AJ0A 3EDRB 2ZH5A 1IM4A 5DG8A 5L1JA 4QU6A 2DY1A 4OQJA 3GYGA 1TKXA 4P2SA 2JC0A 3R7SB 2CNLB 2F9JA 1DTTA 5B0CA 4O23A 5LSOA 3HX9A 1GEHA 1RLCL 1X4BA 3FBBA 2LDIA 2DHAA 1NHKL 4RLEA 4LFCF 3I6PA 2DEIA 4ZVTB 3QJLA 1ZS6A 1Q5YA 2XO6A 2JX2A 1C0UB 2HS3A 1TKTA 1HYSA 5D77A 3MI7X 2I8EA 3Q24A 4DFMA 4I2PB 1OYDA 2V4JB 4UQTA 2H54B 4NLYA 4NA2A 4LRCA 2CUYA 1TP7A 3BGFA 5C42B 1YJWS 1XMOF 4F4WA 3K89A 4CLLA 1Q5VA 4IDKA 4DWIA 3WQPA 3ELHA 1S48A 3MM6B 2C3OA 2GFFA 2C3MA 2V4JA 2H65B 4DR5J 4HT5A 2DR7A 5T7LB 4C3LA 4RW9B 4KGZB 1VQMS 2DIVA 3LWLA 1Y7PA 3EVMA 4OZJA 1R6VA 2GVZB 2RF2A 3IM9A 1ZBTA 1FA0A 4M5HA 1RTJA 4J9RA 4ZPDA 1HBNB 2D9PA 5F9LA 2MQNA 2PEHA 3MMBB 4LUBA 3TOQA 4ANCA 3OLAA 1XMOJ 1TELA 2XYHB 3CJ0A 3N5FA 1QTMA 3I31A 4WK1A 5I3PA 4M5NA 4RBTA 2CQCA 4YB1P 4UQGA 3MMAA 1DZ5A 1VQ9S 2WK4A 3QLHA 4C8OA 2FJXA 2CPHA 4LRAA 3VAHA 3KMSA 2AF6A 3PW2A 5KFBA 2I2YA 1N6QB 2ASDA 1NHUA 1GK8A 1R8AA 3N6NA 3RBZA 4EUVA 4U96A 3BSOA 1FE4A 3AY0A 2J76E 5K14A 1RWKB 2EKYA 4WFNQ 1QE1A 4Y0FA 3LPYA 3GIMA 3VF0B 4OYOA 1K47A 2VQEF 2FJWA 2GIFA 3DI6B 2DRAA 2V8DA 4CDIA 3M8PB 1U1MA 3DOMB 1OS5A 1TR0A 3CD6S 4KV8A 1CG2A 2FTRA 2HFUA 2AEMA 4Y3CA 3BSNA 2R7QA 4DBQA 3TAQA 3HJVA 4OV1A 1RE1B 2XULA 4DX6A 3P4UB 3QAEA 3R6GB 3BPSP 3PXGa 3THTA 4TN2A 3TWZA 4N77A 3CMAS 2NS1B 4MFBA 4USIA 1HBOA 4LBPA 1G3OA 5KT2A 3WX4A 1ACMB 3S01A 3OJUA 4U67Q 2LQ9A 5LJ5Y 1RT4B 2RDIA 5E2QA 4RUCA 1LWCB 1FDDA 2MZRA 4JYAJ 4UOFA 4XDDA 2A3JA 3WC0A 3THVA 3TZYA 1N8RT 4TU7A 3CD7A 3K8WA 2MY7A 4F3MA 1TFWA 3E01A 4DL4A 2R42A 2LXFA 2V2QA 3L95X 3HPOA 1W2IA 3M2VA 4GKKF 2ZBRA 4K4YA 4P9SA 2XMJA 3MPDA 1ICEB 2GHVC 2QTWA 1FKOB 1SH0A 1SC1B 2BMBA 3NBPA 3KNGA 4QBUA 5KOWA 5D6GA 3H25A 1CBKA 3N6LA 3MUTP 1IKVA 2J5AA 3NS7B 1VQ8S 3AA8A 4LF9J 2IJRA 1NMEB 2RAQA 2VQFF 1HARA 5HJXA 1XN9A 2CDQA 3GFHA 2MTLA 2XO7A 4ECVA 1NSQA 2PFFB 4C8KA 3TUJC 3OVBA 4LVOP 4I6YA 1JLGB 3SZ2A 3SDEA 2AX1A 3LAMA 4HTIA 5AXLA 4ILMA 3Q83A 2I5JB 5CH7B 1N48A 3MDFA 3M9MB 4AQYJ 1H74A 1JLCB 3GE9A 3I82A 5KFUA 2ZWPA 3D3BJ 1U8WA 3ZZOA 5JMNA 3IR6B 1S1XA 1QSYA 2G0JA 2M8DB 3DOKB 2ZKUA 4QYZK 3PYFA 4TY8A 1LW0B 3ZZPA 2NXCA 1SQFA 5G4DA 3FK4A 4GKJF 3MPWA 5KFYA 4C11B 3PZPA 3MM8A 1J5EJ 1KS2A 4DR3J 5B0AA 2QSFA 3QSYB 5B0FA 2GVDA 1K73T 3I4HX 3QWPA 1TKZB 4DPTA 3NG8A 1C2PA 1YJ7A 5D0RA 2GCFA 2EEYA 3KJFB 4OX7A 3FNNA 2NPIA 2V2ZA 1JMTA 2R3VA 3QGIA 1XNQJ 4FF1A 4OMFG 4C11A 3D67A 3DOLB 3C19A 5D0HA 4UOCA 3DRRB 2ZZNA 2ASLA 4I7FA 1U1KA 2GO8A 1T8EA 2CZVC 2KL8A 3D1QA 3NGRA 1X4GA 1IKXB 2AT1B 2F4FA 2FHMA 2ZNZA 2YNFB 2W7PA 5A6WA 1J5OB 1CJVA 1YRUA 3HFZB 4HR2A 4TY9A 3KLIA 2R8GA 3U1NA 4C8ZA 1DQ9A 4URSA 4A8FA 2GQQA 1IKWB 2QC3A 4LF9F 1S9EB 1TU0B 4WU2A 4U7UD 1KLMB 4B9TA 3K0JA 4YB6A 3NGDA 2DNOA 4OV6A 2HHWA 1L5UA 2D3ZA 1RYRA 3W5ZA 1UVJA 1ZA1B 2DH9A 1CSJA 2MLZA 3ENQA 1NZ8A 1REVB 3WIUA 1BQXA 4QU7A 3FSIA 1NPPA 3HLUA 3IS9A 2HSEB 2JDJA 1Q4RA 1RA7A 2GQCA 6FD1A 5DGAA 1JX4A 3C3LA 4B3OB 1WHWA 3NLCA 1UVMA 3V2UC 3FQLA 3TQ1A 2GVDB 2E9TA 5L9NA 2DH7A 5J2MB 1U0SA 3FEYB 3GWCA 2XCAA 2XMVA 2VZ9A 1VLOA 2M5YA 3EGNA 2DT9A 4PXCA 1WI8A 4ETXA 5KFMA 4X4QA 1HQEB 4WIIA 1RAFB 2OEKA 2ZBCA 3D6FB 1T02A 2NYHA 2R7XA 2MQPA 3SFGA 4C8MA 4JI1J 2GC8A 5DETA 3CE8A 1RTZA 2KT5A 2HNZA 1S12A 2MYFA 1JKHA 3C15B 3AQOA 2EFPA 4ZN1A 2R8KA 2PD1A 5L1LA 3WC2A 1VQOS 2PC6A 3A8JA 1WG4A 4P7VA 4OX9J 2YTCA 3BKTA 7AT1B 4DQQA 1XTZA 2OPSA 4DFPA 5EGYA 1FESA 1HI0P 1K0TA 3LOUA 1VIOA 4ZVQB 4CNYA 2B4OA 3BQ1A 4I2PA 1LK7A 4YDDB 2J9EA 3AJ2A 3EGWB 4ECUA 4USKA 2QLWA 4YFUA 1BQMB 4LQ3A 2DPJA 5B09A 3HKZD 4FNIA 2HKEA 2R8JA 4NLUA 3HHLC 3CJ8A 3MF5A 2RDDA 3AB2B 1ZETA 2DITA 5GMEA 4ER8A 3FZ2A 2R8IA 1S72S 1MG7A 2HHVA 1SJRA 2KXHA 4FDFA 3Q0AA 4DUYF 1X4CA 1ZM3A 4ELVA 1R3NA 1UTAA 4K59A 2XS5A 1IQZA 1D1UA 1HQEA 1KHWA 2CNKB 2XMMA 2CQBA 4IO1A 4ZMMA 3R3TA 4DX8H 2LQBA 1H98A 4PXDA 2F40A 2PO4A 4P2FA 4WKYA 3JSBA 3DLJA 4M5IA 3VHQA 2R7VA 2DR6A 2WONB 4X64J 2F63A 3PCOB 4DOZA 2ADBA 1NSAA 2FC8A 3MM7A 5AE3A 2OPQA 4IG3B 2DEJA 1W2BR 3TAMA 2O67A 5B0BA 1S4EA 4M5GA 2CIMA 3MEEB 5KFKA 4PQUA 3RU0A 2MQ8A 1KVKA 1N5QA 1RT4A 4P72A 3ZZTA 4URGA 2YH0A 4ZP7A 2MEWA 4NLQA 4ZOSA 5L8RC 1SPBP 1FD8A 1VRTA 4TYBA 3EPGA 2CQ4A 4DV2F 3R5DA 3M8QB 4FP9A 4K4SA 2CWXA 4HYKA 2PMHA 3PYDA 4KFBB 1L3VA 3D1HA 1SV5B 4NA1A 3SQOP 4X64F 1FTCA 4F02A 2UXCJ 5HAOA 5KFDA 3C16A 4ECWA 2F4VJ 2HZVA 1FO1A 2HVEA 4NLGA 2OPSB 4G1QB 3E51A 1RT6A 1BY9A 2B9EA 3B54A 2H48B 3I5AA 4OHXA 3FMBA 4HHJA 4TVAB 4WIQA 5I3UB 3R5CA 3Q89A 3A3NB 4DR2F 2W2MP 4Y2MA 2DCUB 2MKKA 4A8SA 2RVJA 3BGRA 2DHXA 4WKRA 4MAKA 2VDIA 3JTNA 1ZA2B 2DO0A 2MY8A 4PWDA 1T9TA 4ECQA 2LQJA 2V63A 1LW2B 2XG8A 1Y11A 4CO1A 2OPRA 1RU2A 5K8MA 4DFKA 2RQ4A 3M6VA 3KUEA 1RHJB 5K5MA 3OTOJ 2HAFA 1LFWA 5C24A 5HMXA 3D2WA 1X4EA 3TYTA 3WZ0A 4ZPAA 2KU7A 2DISA 3I0SA 2V9KA 4EK2A 2SXLA 3RBEA 2DYAA 4MT1A 2AD9A 4KYZA 3K2YA 2Y9HA 2QMUB 3J81U 3OFEA 5HO4A 3T3FA 3TO8A 2FVRA 1FNMA 2YQ3A 2XQCA 1XEZA 2BABA 2BA9A 2KO1A 3CJ5A 1MMDA 1S1XB 5A0YA 1Q86T 2R7UA 4QOTA 2HLTA 4J9UE 2VONA 3DGPB 4ZLLA 4X84A 4DR1F 2I5JA 2QZ8A 3IG1B 1S0OA 1I1GA 2Q3PA 4RU9A 2MSSA 4HKQA 2M7SA 2VICA 1CLFA 2B43A 3HFKA 5JVHQ 2ZE2A 4KRWA 5A8WA 1MLAA 2FJEB 2F5GA 2W7AA 1NLKL 2XLJA 3F73A 4LF7J 2XI3A 4DV6F 5D8HB 4L73A 2QSWA 2XCPA 1HNXF 4HLBA 2E66A 3IM8A 1FERA 2QA2A 3I0RA 1RTHB 1Z1ZA 4I7FB 2PE8A 4PUOA 2RS2A 2DRDA 3S8SA 4ZPVR 1U1RA 4ELTA 1M0SA 2RILA 1SUQB 2B4UA 1PSDA 1MWQA 2GA7A 2OH2A 3BN4A 1NK6A 1OSCA 2FGOA 2I6WA 2MMYA 3THPA 1BHNA 2FY8A 2RKIA 4YR2A 2YNIA 4DV7F 2XNRA 1N52B 3GZ7A 3NGSA 2NPFA 4DS5A 4UY8T 1MN9A 3G96A 2VD3A 1B7YB 2DNRA 2YWGA 3DFEA 2HQIA 3Q8UA 5E5NA 1Q1KA 1UVKA 2FD2A 2RU9A 5GMDA 3UVJB 1M5OC 4MYTA 4PPZA 2KJVA 1T9XA 5ITHA 5E41A 1P8GA 4WFZA 3ZZYA 1N5SA 1REGX 3KDOA 1GFWB 4K7QA 2OLWA 1E6VB 3KK3A 5GVQA 3RB6A 4TYAA 1RT3A 2RIJA 1NU4A 4DEZA 1IJEB 5IXUA 4DPOA 1J2VA 3PR5B 2KDOA 5LM7E 4DXLA 4OYWA 4DSLA 3DC2A 1Y0HA 2HQFA 4OZ0A 1LWFB 2LEPA 2KXFA 3SDEB 3B8HA 3PIOQ 2B9WA 1F2GA 3ITHA 3T5LA 3D68A 3NCPA 4KGMA 2HK3A 1OQ6A 3L4BC 3MMCB 3FBFA 3LA0A 1GMVA 4K5RA 5HI7A 4TNOA 3HVWA 4F67A 1P9QC 2R2RA 2FQQB 2W8KA 3R5AA 3BGUA 2G0IA 4RO0A 4AQYF 1M1HA 1XNRF 1UFWA 1UETA 2YKNB 4O44B 4IOAQ 4F4XA 1TQLA 2ZUGA 3MCSA 1RAAB 3VGSA 2QA4S 4ZPTR 5LSRA 3HHEA 3KJVB 2OFHX 1KNZA 3GFYA 3MR3A 3JSRA 1HHTP 5J2QB 2R4FA 4OX6A 3MMJA 2VU5A 2N4CA 1EP4A 5FDLA 4GKJJ 1AFIA 5ETPA 2ALZA 1KR4A 4A8MP 5HSPA 4ZK7M 5DZ7A 3IP0A 1HNIA 1YRXA 5KTQA 2OFGX 5ETSA 2VG6A 4C0HA 3KYLA 2POKA 4DL5A 1FDBA 5T14A 5DQIA 4CH7A 2GS8A 1SKUB 1VC6A 4E2FB 5KG1A 5A8KB 1CJUA 2B9YA 1IWGA 4LSNA 2W8LA 5L38A 3AD8C 4NRTA 4U7UK 4HI2A 4IDKB 1NH7A 3BKFA 4ZHRA 3DRSB 3F56A 4LRDA 2W01A 1RK8A 3VTIA 1IR2A 2ACMA 2IA6A 3JQMA 2XY7A 1RAHB 5J1NA 4NYOA 2AV5A 2YKNA 3AJDA 1RHUB 1SL2A 1NUEA 3GCWP 3EUNA 5DO2A 1BE4A 2OP5A 3W8PA 2BQRA 1N32J 3CULA 2DGVA 2HNYB 3US5A 2IMWP 1RB0A 5T41A 1HHSA 1SL0A 3W63A 4UTGA 3GJSB 3AOBA 2GMJA 3EE3A 4EBDA 2FVPA 2CQIA 3ZC4A 5DDQC 3DM2B 4LBHA 1SJ1A 3NOCA 3DYAB 4KGKA 4OZNA 3V4IA 3RB3A 4RPFA 3KLFA 4F2SA 4WTOB 1VK3A 2CQ2A 2DBBA 1B3TA 1JXEA 4QW8A 3PM9A 2HBYB 4USTA 1FTRA 2MHEA 3B4DA 3D9BA 3G87A 1R0AA 4LSZB 2ZH8A 3TX0A 2VJUA 1HFEL 2J0QD 2YNGA 3PO4A 4K4ZA 5KFVA 2MGZB 3UCGA 4DUZJ 1KWMA 2J7KA 3ZFVA 1PBUA 4FYXB 2QFJA 2NSBA 5F41A 3KFWX 4K5SA 2YX4A 3EPIA 4OZLA 4JB8B 3H20A 4FF2A 1S49A 4MKBA 4RR5A 2RUSA 1OWXA 3H7HB 3B78A 1VCTA 2VQEJ 3CJKB 2WSEC 4RW8B 1C1BA 1FE0A 3D6MB 1VHIA 4NX9A 4WTYA 1RAGB 5L1KA 3UO0A 1T3NA 2V9WA 2HRYA 1UL3A 1D09B 2AWZA 2W2PP 2YWHA 3UCZP 3NNCA 4LFCJ 1JQGA 1VMBA 3LTOA 2GNKA 3UDCA 2BYCA 2E1RA 4PWDB 3EWGA 4FPIA 1NK0A 3J81j 2HHHJ 2MLXA 2ZVSA 3QAUA 4NLPA 3V6JA 2VUGA 2J6TA 3H8YA 4F2RA 4ENOA 3MR6A 5KFPA 4XO0A 2O3DA 4FXWA 1ZAXA 3POTB 3PYGA 2EI5A 3L7PA 4YEAA 4PYDA 5F3TA 7FDRA 1DY3A 4R5PB 5LXRA 4RW6B 4TXSA 5CZVA 2HPUA 1M90T 4NPOA 3FFIB 4DSKA 4WBFA 3UD5A 5EDWA 2H9ZA 4B3MJ 2VHGA 4LBIA 1OY8A 3IFEA 2YVSA 4XTTA 4JBCA 1PC5A 2N3OA 3FRYA 1S1VB 2G2ZA 3HO1A 1C0TA 2RHSB 1KQKA 1EQMA 2RRNA 3R27A 3MURP 2JLEA 1UZDA 3ENVA 3MEEA 1FFGB 2VG5B 3E3XA 2V2KA 5D15A 5E3QA 1HNXJ 3D0IE 2HEKA 1SVDA 4WFYA 3VAJA 4LRBA 5CZXA 3CW2C 3GG0A 3MTKA 5LOQA 4PAAA 2QV6A 4DV0F 4FYDA 1SJFA 4PEOA 3OXLA 3QT7A 3IRXA 4I6AA 4J9LA 2VA2A 3I0RB 1SCJB 3GFXA 4YDXA 2EKNA 2IVMA 4AT1B 1D8YA 1OPIA 3CIMA 2GAHC 1IM6A 3QIDA 1IVZA 1PCAA 1OY6A 5EN1A 5I42B 3PO5A 1RTDB 4LF8J 4RX6A 2CADA 5F0WA 2NQPA 1Q7YT 4ALZA 1GMWA 3ITHB 3M9OB 4RWWA 1FDAA 1U2FA 4IFVA 4NLTA 2AP6A 1WEZA 2V8VA 2IHR1 7FD1A 1KQSR 5F8NA 3F44A 2VPWB 2XMUA 4PYAA 1JXLA 1DFDA 4ED6A 3DGPA 1M5VC 1F60B 4CP5A 5KFFA 1NDPA 1P1LA 3FMWA 3TR5A 3KLEB 3W2WA 2HHHF 1CJVB 5AJ3J 2WW8A 2LECA 3J7A1 1FRLA 3NKYA 1T9YA 1OIAA 4PG8A 5DG9A 5JVGQ 2ADCA 5LMNF 1K9MT 2Z2ZA 2IYGA 4G6VB 5C25B 2COLA 2I0XA 2DY9A 2OEMA 4J5OA 2H4YB 2IM0A 4OZ3A 5CYQA 4KC5A 4DMZA 3PW5A 4DS4A 2JZ5A 2IA0A 3KHGA 1KFDA 1BGXT 3OLBA 3N28A 3NWRA 4I56A 4O4GA 2N82B 2P5VA 2KXNB 3G8SA 2VC1A 1ULRA 2J0WA 1UWAA 3GG1A 2BR0A 5F8JA 2M0GB 2AJ4A 2F8HA 1F2HA 3DNCA 1PAEX 3J80U 1HR0F 2QLBB 4B3MF 2E7XA 4NZ6A 4M94A 5C2CA 1B64A 1V3RA 4HT7A 4QCLA 4USWA 1NK9A 2A2CA 3PYEA 2F3JA 3W61A 5KOXA 1S76D 3W9JA 1Q79A 1TV6A 2RE1A 1VC5A 1VQKS 1JLCA 1M5SA 4K8RA 5KFRA 4HEA9 2DR5A 2JC1A 4U8YA 2FIUA 5A8WB 4BS2A 3HHNB 1R6YA 1CQNA 3SQGA 3O6QA 5L1IA 4KTQA 1RHRB 1XR6A 4ZVEA 2NCKL 5GAEU 2ZVIA 3BKUA 4MH8A 4RW4B 3TJ9A 2W2NP 3JB9k 3KNAA 4NLVA 1RT2A 5ETKA 2BJ8A 2PA8D 1JLEA 1FEHA 2W2OP 3HSZA 4BBYA 4R0EA 4CWBA 4ERDA 2AJFE 4IYQA 2QYCA 1KD1T 2D74B 1X5OA 3FSYA 4DCJB 2NXNA 4IR1A 1FF2A 5IV3A 3NGUA 3MR5A 2VODA 3EGVA 2HGNA 3FCWA 2AHOB 3M6WA 3DRRA 4QYZJ 3BH6B 1S9FA 4PG5A 1QUVA 2QFIA 3UDLA 3BBBA 3G82A 2ZJRQ 4DF8A 2E1MC 4KSEB 4ES2A 1L3TA 1NJXA 1JLFB 2JFKA 4ES1A 2E9ZA 4WFAQ 1J5OA 3AFGA 1CJTB 1UPMB 1QD1A 4YQWA 1FJGJ 1JJ2R 5HJYA 3UN3A 1FT8A 1JB0C 5C7PA 1JWWA 1UJ4A 4PG7A 1X9SA 3UVJA 1YI2S 3R2DJ 1IR0A 4OJ3A 2M3DA 1HWLA 5J2MA 1SL1A 1KLNA 3V81B 5SZTA 2XMAA 1K0VA 1YG0A 2KVIA 2GIQA 5BYSA 4XPEA 3O3LA 5KFWA 4O3RA 2VBWA 4B3OA 4B3RJ 4DN9A 3L7OA 2BANB 2W24A 1NKCA 1ZPVA 3EYZA 4ZA1A 3R8YA 2J8SA 1RISA 4PXEA 2IPOB 3JSMB 1SKSA 1RT1A 1OQ3A 1NJWA 4CYUA 4ZPCA 3KK1B 4Y34A 1PKUA 1F6TA 2LCWA 3MTJA 1KQGB 4OI1A 3ULHA 2CQ1A 2HFNA 2V8PA 1REVA 3ADAC 2YQ1A 5MLCV 2MQOA 5GADI 4FKXA 1NK5A 1FXRA 1RUSA 3EJMA 2W7OA 2GV1A 2KVQE 5BJRA 2RMLA 1BWVA 2W2QP 3TP2A 1IBKF 4PZVA 4M5JA 3KTQA 2PDAA 3UPFA 2VQFJ 4DL7A 2WVFA 4UZBA 3U1MA 4OLOA 4IRCA 3UR3C 3GYXB 3HHDA 3UN2A 3CXCR 4DV4J 2A0FB 2HNDA 3RR8A 4DZDA 4IUFA 1HNZJ 5ETOA 1UP1A 3TX8A 4CQ1A 5K8NA 1WELA 3LP1B 2WBRA 3SYZA 1SJ3P 1XMBA 1ZZNA 3DRXA 2KG0A 1JIHA 1O6XA 1H7WA 2HK2A 2DO4A 2EW9A 3AB4B 3QT6A 5AT1B 2UZAA 2OELA 3D66A 5DM7Q 2EG2A 1VJWA 1X31C 3DU5A 3PX6A 1S97A 3DLKB 1V5IB 4TLQA 1B99A 3TVZA 1U6BA 2ZZTA 1YK9A 1FCAA 4ZP8A 4DPUA 5D0GA 2LEAA 3K7RA 1EX8A 2OPRB 2RRAA 1L3UA 1V6HA 2BJ3A 3DM2A 3DHXA 3I5CA 5LMNJ 4DV2J 4EYIB 4DR3F 1RTJB 4AUKA 4CI0B 3CTRA 3X1LB 2FLOA 3EVOA 1S0MA 3DOKA 2KKHA 5T7LA 4JI0J 3W62A 1GXTA 1XJWB 3OV7A 2ZDPA 3CJ3A 3HFVA 4NEZA 3G8QA 5J2NA 2CG8A 3CDEA 1LOUA 2C2OB 3LW5C 3NY0A 5J2NB 4EWTA 1H0HB 1RT6B 3P96A 2IYIA 2E5IA 1ZAVA 1PC4A 3K59A 3CCZA 1X4DA 1RT7A 2J9DE 1IWAA 3W9HA 3VZIA 4FS2A 4KFBA 3FZBA 2EBEA 5HATA 3G8TA 2PI5A 3PDNA 1YIJS 3CPWR 3MWBA 5DZ6A 2HS4A 3FJ2A 3VGVA 4IH6A 3QGPA 2JFDA 5CYMA 2FJDB 1YWXA 5D0EA 2MLYA 4PABA 2HVIA 2X51A 2BOPA 3VGUA 2MZ1A 2H5JB 5B08A 4RW8A 4LFAJ 4IG3A 2YPYA 3R5JB 4N8NA 4JUZA 3CB4A 1NCLA 4KR0B 3R9LA 3FCHA 2KH9A 4KHPF 2WVCA 1TL3A 2V6AA 2XYGB 4LIWA 4K4VA 1FRIA 2A6MA 3KLHA 2CRLA 3QRQA 2HBZB 1FXLA 4C8LA 1WHVA 5F9NA 4YY3J 5HROB 2IBKA 1AROP 1UMJA 2NSCA 2ZD1A 3EVWA 1V3SA 3HKWA 3JTPA 4OZ5A 4WFXA 3WHIA 5IZHA 3TANA 4WJBA 3QLHB 3CMES 4FXVA 2RNEA 2WOMB 4AYBD 3D6HB 3UI3A 2HHUA 5KFHA 2HFSA 4YUDA 4L74A 1D3WA 1RI7A 1ZPWX 1GTEA 5H9EJ 2D9OA 3IO1A 4JV1A 4V19J 1S5ZA 2JOQA 2VF3A 4KT0C 4F0MA 4ZJLA 1N88A 2AMCB 2H5IB 1T9VA 2EFQA 4BDPA 1QAYA 4OJGA 1RYSA 2KRRA 1IN0A 1S4FA 1Z2ZA 2ABYA 4RNOA 2B51A 1WHYA 4M1KA 3SMZA 1HWJA 3IRWP 4ED8A 1HNWJ 3RYLA 4LT6A 3VAGA 1HNVB 3OFHA 4ZVOB 4F4KA 1FKOA 1TV6B 1AUSL 1SC6A 1R8HA 1YZ7A 2FZKB 1G6BA 1YRTA 3GIRA 3PJXA 4ED2A 2U2FA 3HF5A 3PG9A 2IVFB 5G0RB 5HQLA 1RTDA 4MMOA 1KTQA 2C2ZB 4CTAB 2ZH6A 2VPXB 2BKOA 2K1RB 4QIGA 1Y5LB 4RL1A 2HURA 2HIQA 2LQ8A 3GPAA 5CQGA 2CVIA 2DGUA 2VC0A 3MR2A 3RAXA 5J2PA 2OIHA 4AXJA 4EBCA 2XWYA 2P9GA 1WEXA 3RRHA 2IBOA 3IGNA 4O3QA 1XNRJ 4QWDA 1EQ0A 4CO2A 4B9MA 4O3NA 3M32A 2U1AA 5LSLA 2ALYB 3N01A 1HI1A 2NZCA 1T3OA 1VDHA 2BJ9A 2RB7A 4ZDNA 1RWXB 2V8GA 5HVGA 4ED3A 2OD6A 1NBEB 2EK6A 3DGVA 1SKWA 3QFWA 3C6UB 2UXBF 4NLSA 2W9AA 2XSJA 3O44A 1CQMA 4Z7YA 1H7XA 1GX5A 2WB4A 4QW9A 1ITPA 3VGTA 2AJ1A 4Q5VA 2KHDA 2QMXA 4GKKJ 6FDRA 3PW7A 3BB5A 2ZUAA 3PJWA 3LPEA 3NNHA 1FX4A 2HVZA 2WSCC 4OX9F 4K0KJ 3ENAA 2LEBA 2H3EB 2OKQA 3OVAA 5H9EK 2BJ7A 1AW0A 3T41A 4J9SA 4F0HA 1CC7A 2DGQA 4NLDA 2ILZA 1I51B 2GIRA 4RUBA 4ED0A 3RAQA 4HHUA 1HNWF 2UU9J 2MDAA 4OJ1A 4PRFA 3EMTA 1U02A 1PIEA 1Q95G 4UUXA 2HFZA 4CM2A 2J6UA 2K2PA 4DL0C 3M2UA 2UUAJ 1X0FA 3MMAB 2J0XA 2WAQD 1RXOB 3C6TA 1DQ8A 2UUWA 4J9KA 4C48A 1I6JA 4IQXA 3FBCA 3FBEA 2G4BA 4OZ1A 3T9NA 3I87A 3HHLA 2UP1A 3SV3A 1XIQA 3M2UB 2GHPA 3HSJA 2CPEA 4PWWA 1YJ9S 5I4MA 1T94A 4JI6J 4DPXA 4JV0A 3LGNA 5CYJA 4N76A 3C14A 4KPYA 3OW2R 3DLEA 2ZBQA 3O5TB 4NXNF 3A13A 5A2QU 5KG5A 5BXIA 2VASA 1TL1A 5C42A 1JLEB 4ED1A 4X2BA 1NJIT 3M8PA 2ZBIA 1KOOA 1G1XA 2P6TA 4KPCA 2BQ3A 3QZ7A 3MEDB 4RWXA 3Q23A 1NDLA 2HQ3A 3KUHA 3GILA 4YR3A 4WYWA 4Y6IA 4YY3F 1NDCA 4XK8C 4DFJA 3DRYA 3GP9A 2Q43A 3I9ZA 3VWSA 1SQEA 3J7YU 4QWCA 4J9NA 3PW0A 4X4SA 1EKRA 3QRPA 1OPZA 1HWIA 3JTOA 3NCRA 3SSQA 2CPIA 3BN7A 1PYSB 5D4NA 2MXYA 1MMLA 1U1LA 4I68A 3DRPB 2HHPA 2L9WA 1S7HA 2GQ2A 3H98A 4LRFA 4B3TF 1CJUB 1MSWD 4ECSA 2AYGA 3MUMP 4W98A 5KFAA 3OL8A 1H3DA 1WJ9A 3M2RB 4USMA 5KFNA 2Q66A 2VKZG 2GVZA 2RF2B 2ZNYA 1RCOB 3CJ4A 3HT0A 4L72B 3WX8A 1I94J 1U47A 2O01C 4DR6J 2QRRA 4RW6A 1DLOB 3KLFB 4PUOB 1HKAA 5KG3A 4CT9A 3N0VA 4DCOB 3MHYA 1NDKA 2F1FA 1RT7B 3S1TA 4DU8A 5EWGA 2R9LA 4X4PA 3KLEA 4A8KA 1RGVA 4B08A 2HGMA 3UQSA 2DR9A 1UWBA 2UUTA 1IR1A 1GMUA 1RZMA 2B3TB 2KYXA 2RQKA 1EETA 2HQGA 1RCXB 3H2VE 4J37A 4F04B 2OGUA 5KFJA 2IDLA 4DG1A 3KLVA 2HLUA 2RQCA 3HI9A 1HR0J 4WPAA 5B0EA 3M7VA 2IDEA 2KT2A 1FJEB 3K8VA 4NEYA 3UNGC 1ZM4A 1D9FA 5IT4A 2BE2B 3KOAA 3VQTA 2AJQA 5A0YB 4C2MA 3ET6B 2AYMA 3O2IA 4HVZA 1FFWB 5F0UA 4LF6J 3KLHB 2JSXA 1YJRA 3JXOA 3D0HE 1N56A 1HA1A 5CXTA 1LK5A 2NZ4A 3PRBA 1TFYA 4KO0B 3M8RA 1RBOB 5GAHI 1S1UA 3DU6A 2HZCA 4N5SA 4Y2KA 1VR6A 5B0DA 2VFUA 4S0MA 5HANA 5KT7A 1Q81T 4B9NA 3M4XA 5A76A 4B3SF 1B0VA 2DJWA 2YNHA 1IUJA 1JNRB 2L08A 3TNVA 1T03A 1YBTA 4JI3J 3TUPA 3OTDA 3ZNJ1 4KJIA 3TJAA 3NP5A 4EFAC 4TKTA 1TL5A 3DYAA 3SV4A 1R43A 3TA0A 5FLXY 1A0OB 3BGRB 4R0JA 4A8YA 4WF9Q 1RHMB 2M8HA 4JI0F 4ITSA 3TVYA 3JQJA 5D4PA 1RLDA 2RH3A 1U2CA 3POTA 3CCWA 4OFZA 4OIXA 3G86A 2J0SD 1E6YA 1S59A 2F7VA 4UF4A 2JL9A 3ZZZA 4ZLJA 5HN0A 2V5HG 4JI2F 5F8IA 2UV8G 2Y1JA 1DAXA 5I3QA 1UW4A 1ZAWA 2MJNA 3AOCA 2YBVA 4KKOA 2YNFA 2Z2YB 4KKOB 5K9FA 1IKXA 4LJMA 2ZH3A 1RABB 3UDVA 3M8QA 1U8SA 2JEJA 2Q1LA 1E6YB 4YMEA 1VQ7S 5DDRC 1UFLA 2O5DA 1WNEA 4URQU 4O4RA 1NJYA 1KRPA 1FD2A 4ECYA 1RACB 1OSDA 3FEXB 5J1EB 3RBDA 1HLWA 2BJDA 4E8UA 2KFYA 1TKZA 3VVTA 4X66F 2G2OA 3H5XA 1VISA 4PWUA 5D4LA 4RNHA 1FDNA 2CJBA 5JXSA 3LUYA 2Y1LB 3CCVS 4A8WA 3CO0P 1PYOB 3KG4A 2NYIA 2W4DA 5IS2A 1G2EA 3NNAA 2Z8QA 1S9GA 2MKCA 3CDUA 4HI1A 3E2EA 4QIFA 3T5HA 2ROEA 3M6UA 4DR7F 1TKXB 2DGSA 3CJSA 4QPTA 4YB7A 2AIRB 1DRZA 3J7Z5 2QL7B 3QMQA 3TW0A 1NK4A 2JVRA 1WC4A 1H72C 1LQ9A 1CULA 5ETLA 2KN4A 3KLGA 1GXLA 4DZ6A 1U26A 2OPPB 3DHWC 5C24B 1NEEA 1C1CA 1F5BA 4C98A 2C2EA 3T19A 2YPZA 4ZS6A 2VA3A 1Q8BA 2IAJB 2BACA 4WP8A 2C42A 2EC0A 5MAOA 5GAEI 1EARA 5SUHA 2XBPA 3JYTA 2PIIA 2WZ1A 3KK2A 2ZBPA 2K3KA 2W9BB 1LFPA 1M5KC 2YWEA 3GV8B 2HHTA 3QATA 1NKBA 3JSYA 2FLLA 3JSMA 1FK9A 2MKIA 2YKAA 1RA6A 3I55S 3MAQA 3GB0A 4PPDA 3H2UB 4JI2J 2IMOA 1YJVA 2WBMA 2ZOMA 4O3SA 2N7YA 1RT3B 3VQSA 1NO8A 1R8PA 4QIEA 1E6VA 4Y2CA 2VL1A 2ZHBA 2KZZA 1GTHA 5DLFA 3MM5A 2XB2D 3V81A 5AE1A 1YJUA 3CJTA 4CYUB 5D3GA 5KT3A 1RT1B 2IRXA 4AE5A 1S1TB 2QE5A 5RUBA 2C22A 2ZZMA 3U02A 3OTOF 2RDJA 2C2DA 1Y00A 3HCXA 4NI2B 2YWFA 4IOBA 2XYPB 1CJKA 2B6AA 3CGIA 3JQKA 4YHHF 1CJKB 2B6AB 2HZAA 3BZQA 2C2KB 4DR6F 1MNEA 1UPPA 2RS8A 1NXIA 1U24A 1VRUB 3A8IA 1N5VA 3B6BA 5K8PA 1Q8KA 4ZJOA 1EP4B 4M5KA 4Z37A 3DDNA 3W66A 3MFHA 4UUWA 3CF5Q 1YQHA 1FVQA 4R8UA 1TMMA 2FUG9 1WF1A 2P9EA 4F25A 2C2MB 3IR5B 3VCDA 1WTFA 3R5BA 3DXSX 4CH0S 1JJCB 1P6TA 3I56S 4DF4A 4K50A 1NK8A 3HVRA 1VOMA 2GAGC 2CKWA 3IN5A 2UVRA 2UXCF 2F4VF 3GR0A 2XMWA 4J90A 5CCLA 4V19X 1XMQJ 1ZYQA 1EETB 1IKWA 3G6VA 1SH3A 2EFVA 2W9BA 4B3SJ 2B5JB 4CCHA 3IR7B 2LU1A 4OLPA 3ZZ0A 1YHQS 4IKAA 3MAAA 5IQ6A 4LMZA 3A3PB 4G1IA 4W90B 2D3OR 1BD6A 2IM1A 3MXHP 3BH7B 1U1PA 5KFCA 3SBMA 4C7QA 2IY5B 2OTLS 2K7KA 1DLOA 4WCEQ 1WG1A 3LAKA 1N6QA 3M30A 1YZ6A 2R7RA 3K17A 3C15A 4OYIA 2FJAB 3MM7B 3NMRA 3VALA 1WF2A 2L3MA 3HHLB 2V2VA 5KFLA 5DQHA 4O0IA 1RP5A 4EO8A 2ZH1A 3W9IA 4BWJA 1S6QB 2RQMA 3P5TL 4IO9Q 4B3RF 2DNQA 4OI4A 2J7UA 4L3KA 4X62J 2ZFHA 5AJ3F 4F3QA 5LL6d 5EHHA 1WKLA 3C2PA 3ONQA 3GIKA 3NRBA 4BLGA 1RWVB 2V0NA 4WE1B 4U95A 1SXLA 4ZCKA 5H9FJ 3HVAA 1S6QA 2R8HA 2QL5B 3OTCA 1VI7A 2IRUA 4YR0A 1JLBB 2DIUA 4OI0A 4OI3A 1BXNA 2NXUA 4OJHA 2HFOA 1AXQA 1HIYA 5CABA 5CYQB 3MM6A 4ZVGA 4RZRA 2R7OA 2ZM6J 5ETNA 3ZZRA 2ERRA 3MEDA 2B4PA 3X3UA 4CZCA 1HBOB 4A8OA 2CQHA 2HHXA 1J27A 2HS0A 1DQAA 3C16B 1RAEB 2HRTA 2VB6A 3GIJA 3GFZA 2E1PA 3B82A 4PG4A 4IFYA 3IG1A 4OI6A 2N4DA 2CA9A 5LT5A 2PMWA 4GO5X 4KV8B 3M6XA 6AT1B 1U4BA 5F8MA 1LKZA 4TU9A 4PQUB 1RWNB 2WOMA 1F5AA 1R7IA 4RU2A 4C8YA 3IC1A 2IVYA 1PILA 5I42A 3H5UA 4F26A 4Z2XA 1EHWA 3MUVP 5AXMA 1MW7A 2ZJQQ 4DSIA 1WC5A 2VKRA 1QLNA 2LA4A 4ZCLA 1C4AA 1W25A 1C0TB 2FB0A 3IRXB 3TARA 4L3NA 1QVGR 3H5SA 3GSIA 4AL6A 3MOJB 4DHVA 3G6ES 2E29A 2EXUA 5IT9U 2X1BA 4X65F 1BC6A 4KGXB 3DMJA 3M1VA 2UUBJ 2ROPA 1W26A 4OYAA 1Q7LB 4EBEA 2DHGA 1U1QA 1LW2A 1X4FA 2KM8B 4DSEA 5THWA 4EI2A 5GAHU 1H2UX 1HI8A 1KQFB 4C97A 3MM8B 3H90A 4DI6A 3PKYA 2DB1A 3ET6A 1RQ0A 5A6PA 3D4JA 2JLFA 2RSQA 2C2RA 2G1DA 2NUUG 1DTQA 4BWMA 3KG1A 2UU9F 4NCAA 2WHOA 4OHZA 1HNVA 3J7AN 3R5GA 2CXEA 1TK5A 1LXNA 2CQ3A 4GMKA 2V94A 2IC3B 2DNPA 4XIUA 2A6OA 1WOPA 1Y10A 2IC3A 4I67A 2X1FA 4CLPA 3ZTQA 4DQIA 1JLGA 1O0PA 3DXBA 2GMHA 3G4SS
chains in the Genus database with same CATH topology
4NCGB 1JLQA 2XHWA 3OL9A 3SSSA 3BSCA 1FKPA 2LMIA 4CO4A 2M70A 2M9KA 2UVVA 4LSLA 2FLNA 2VG7B 4HH0A 3M32B 4X4UA 2KB2A 2ZD1B 2HW3A 4LFBF 1WHXA 3NCQA 3HDSA 1B0PA 2D1CA 2VONA 2CPJA 2JHEA 3B4MA 3ISND 4JI8F 2PA3A 1VQ4S 1XWLA 2OMLA 4ZCIA 3LGMA 2X1AA 3CUNA 2XSFA 4DQRA 1BWEA 4ID5A 1LW0A 5BR8F 4IG0B 1NH8A 1Q16B 1S9GB 3E8OA 2EPIA 3SEOA 3G9CA 2APOA 2CVEA 2IFXA 2MQMA 2X3GA 2UUBF 4N47A 3UW1A 4X4VA 2XSJB 2OAUA 4WZMA 4B9UA 4DL2A 4WK3A 1JLQB 2C3UA 1TL4A 3O1LA 3OHAA 1NK7A 1RKJA 3IBWA 5DG7A 1UKUA 2HVHA 1KSPA 1NB7A 4Q2LA 1O51A 1JLAA 1LXJA 2OSQA 3S6EA 4ZHRB 1NAQA 2E7WA 2DGTA 3IAM9 3N79A 4FVCA 2V4QA 2HAIA 1WTBA 2ZC3A 2FDNA 4J9QA 1K8AT 4RUHA 3V6DB 3G6XA 2LXUA 5HP1B 1YVFA 3EZ5A 3LQVA 5J2PB 1R8BA 2VG6B 1HWUA 4IOCQ 2M2BA 5K8OA 1FRXA 1RWUA 3LP0A 1IKYA 2HGLA 5KFEA 4DV4F 1IKYB 1GX6A 3KHHA 4B9LA 5CHCB 1P1TA 3C6TB 2CZ4A 1VFJA 1RT5B 2XS7A 2QT7A 5J2QA 2DNKA 3VZHA 1Q82T 3MEGA 2MGZA 3N4WA 1U25A 4O44A 3BGLA 2PSZA 2YH1A 2DRBA 4LFAF 4FZVA 1JJHA 3K5MA 2HMIB 4DLGA 2YX1A 1A6LA 3UR0A 4EO6A 1CVJA 4K0KF 2AU0A 4DN0A 4CO5A 1YSJA 2DCLA 3M8SA 4TQRA 2CQGA 1MWYA 3G6YA 3W3SA 4DQSA 1VQ6S 4LIRA 5LXYA 2MPUA 3P3DA 2KHCA 4MKAA 2L48A 2W25A 4R8UB 3CEDA 1U2RA 4ILRA 3DLGB 3OHBA 2IJNA 1S77D 2ZH4A 1D9AA 4MIBA 3M2VB 4AL5A 3OSPA 4I4BA 2B0GA 1ZM9A 1URRA 5CA5A 1N33F 4QZVB 3H4DA 2L9DA 5E3PA 4H4MB 1RT5A 5CYMB 3UD3P 3LWMA 1APSA 1DTTB 2ZOGA 3MPYA 4PXBA 3CIZA 3T6JA 3HHKA 4QJVA 3V6KA 3OPKA 3QJJA 4DJBA 1TZ0A 5E0OA 3L3CA 3H2LA 4HDGA 2O1PA 2OJ3A 2XMKA 3OFFA 1QVFR 3P6YC 2BM0A 2MSTA 1XMQF 3QYYA 1UVIA 3CCUS 2WTFA 1MMNA 2MZSA 3A1YG 2A10A 4Q0BB 3Q8QB 2VFRA 1VRTB 1S79A 2JVOA 2Q6BA 1S6PA 1UAWA 2JWNA 1QSLA 3BO4A 4FNHA 2XLIA 3GR1A 2LVWA 4IH5A 2VBZA 1VS3A 2RUGA 3H59A 1H38A 1WG5A 1D8ZA 5HROA 1FEEA 2B9XA 1Q8IA 4IG0A 5KT5A 3VAIA 3T5KA 2GMLA 4H4OA 4HTJA 3NWGA 3NMAA 1DARA 2VPYB 3E01B 3KG0A 3GIIA 2HNDB 5E33A 4R25A 3CCRS 2JRSA 3CJ2A 2FJVA 4O4GB 2PGCA 4OX8A 3HJFA 4B02A 2A1BA 2XY5A 3BDEA 2D7SA 3FFIA 5FIIA 4ZP9A 1UVLA 2XWXA 1CC8A 3ZZUA 1VIXA 4LF8F 2E1CA 4NCGA 2DD8S 5JUMA 5KG0A 2CQDA 3MECA 3BQ0A 5HMWA 5HLFB 1M5PC 1GNKA 1VGYA 2XLKA 3MEKA 1X9WA 1WACA 1IJFB 2N7CA 2ACYA 1Y3KA 4ECTA 3I32A 3N6MA 1SBRA 4CNZA 1LV5A 4Q8FA 3EX7B 1X0PA 3I96A 3EZUA 4H4KA 4QWEA 4K4XA 2IAJA 2QLXA 1QAXA 4FBTA 1X4HA 1T03B 1S1WB 4YB5A 5L39A 3FQKA 2XGPA 1VQPS 5FJ4A 1ROFA 2DGXA 2I9SA 2F8EX 2LDYA 3K5OA 1KEKA 4YOEA 5IQQA 2V4RA 1IBMF 1HW9A 1U7LA 1QSSA 3DMJB 3M1VB 1SJQA 4NMLA 1HD1A 3PEHA 4NYZA 2A18A 1ELOA 3CT9A 4DV5F 5M2UA 2UUAF 1S1VA 4U9RA 3OR1B 4CT8A 2ZHOA 5BYRA 3R1LA 2PT0A 2E5LF 1FKPB 4ATNA 3BS9A 3WBZA 1GQEA 4B17A 3BDPA 4O3OA 4C3MA 3Q8PB 2KI2A 2HRUA 4XDCA 4I2QA 1F9FA 4IRDA 2VOPA 1R89A 4ZVFA 3LH2S 4DL6A 2AX0A 2KG1A 4ECZA 4WXOA 5GAGU 3BM7A 3BQ2A 1YJTA 3VR1A 4MK8A 4X62F 4MK9A 4ICLB 4K2XA 2RRBA 2YKMB 3OJSA 3JYTB 1VBYA 2GGPA 1JJ4A 3D54A 2BW2A 1ZTTA 3VAFA 3RR7A 4C4WA 2HNZB 2CG4A 4F8RA 5CCMA 2QA1A 3DLBA 1Y5NB 5BYQA 3J7YI 4J9PA 4OI2A 1TKDA 4QWBA 2ZHAA 2AYEA 5F8HA 5GAGI 1HNIB 3GQCA 3EGZA 3IGVA 1HMVA 4J9MA 3RRGA 5D3GB 2MQLA 5IFMA 1VHFA 4C3KA 2QIFA 3LP1A 2UVWA 2OD4A 3LANA 2FJBB 1N5YB 2G13A 2LXIA 3LP2A 4H54A 4ED7A 1YTYA 4EU0A 4NCBA 2XY6A 3ISNC 2CFXA 3SFUA 5HBMB 2W9CB 3A8EA 3T1YF 3S7RA 4DDFA 5DDOC 3TI0A 1KLMA 4NOHA 4E98A 1KHVA 4FXDA 3FSXA 3OR2B 5DRKA 2ZH9A 2J6SA 4X4TA 4J9OA 1UA1A 1TK0A 3EXCX 1UJ5A 3OVSA 2IJFA 4NLXA 3MMCA 5DQGA 1RT2B 4TLRA 1FJCA 3VAKA 2B5JA 2XI2A 1UEVA 5EWEA 2HNYA 3DN9A 2VBYA 3OR2A 1NJZA 3DLEB 4MIAA 3KK1A 2BV3A 3DLHA 3SQGB 4C9DA 3PNIA 4NRUA 1UWBB 5C5JA 3CCTA 3KLGB 4P6QA 3CDBA 1YITS 2BANA 3MPVA 2HG4A 2J9DA 4P7TA 4JV5F 4KIAA 1B0TA 1U6ZA 3CJKA 4WE1A 3T5JA 1U6FA 4PQAA 2CQPA 3K58A 2ASJA 4EZ6A 4H4MA 4K4TA 3BR8A 4WYLA 2AYBA 2CQ0A 4ES3A 5JJBA 1KOHA 4KHRA 1R31A 3M2RA 1SIZA 3H4BA 2GO9A 4N56A 4ZPBA 1C4CA 3CC7S 4JI5F 1R0AB 2CYYA 2YKPA 4KO0A 3RTVA 3DRPA 1RTIA 3IAS9 3W2VB 5FD1A 2Q6CA 2B4VA 3MM5B 5B0GA 1XR7A 2PMZD 4ZP6A 3FDSA 2Q79A 4RNFA 2R7SA 4PCQA 3N9UC 1QJHA 1FNXH 4RNMA 1XC9A 3RW6A 2BDPA 2ZE2B 1B7FA 2KRBA 4I0WA 2LYVA 1S6PB 5IT9Y 3KHLA 2B7CB 3DOMA 2QA4G 3MD3A 4ED5A 1OO0B 3I4PA 4MKYA 2MQQA 1FHTA 1QY7A 1NNDA 3QO9B 1QE1B 2IM3A 2V8HA 5K14B 1Z4UA 3OSNA 5E3CA 2FLPA 2BVZA 2AGOA 1X9MA 3IWNC 2CPZA 3NL0A 1Z2LA 2FPHX 2YNGB 5AXNA 1VQSA 4I6WA 2EBGA 2KZMA 2GJ2A 5KG7A 3PX4A 3M9NB 2VG5A 4E0DA 1DURA 2H5EA 2KJWA 5J1EA 2F9DA 2RT3A 3PVXA 1LWCA 3RB4A 2K8GA 3IWXA 5LJ3Y 5G0RA 3U27A 3HZEA 3PKMA 1TVRA 3FRZA 2Z4PA 4H4OB 3TRGA 5DDPC 3RB0A 2KT3A 3CO9A 2K3IA 1ZZFA 2LA6A 4RBUA 4DL3A 4Y28C 3BO2A 3FGVA 4FF3A 4FF4A 2YKOA 1U45A 1VLYA 1XNQF 5I3UA 3V4MA 2HWHA 3CCMS 2VH7A 4LF5F 3CD0A 1AFJA 2DNZA 4JYAF 4IFVB 5KFXA 4KE5A 3C66A 3KMQA 1F5CA 1N34F 4JI3F 5DLGA 2C28A 3GV7B 3SSRA 5H1SV 4ZPWR 4RW4A 3OR1A 3MGJA 4ZCMA 4QYRA 3BF4A 1Q53A 2W4CA 3FEZA 1BLUA 4F4YA 1XR5A 4ID5B 4KB7A