3CC2S

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cc2S00
3S8SA 1WI8A 1H2VZ 2MZTA 2RQ4A 3S01A 3B4MA 2DH7A 2MYFA 2DNZA 2E5GA 2U1AA 2ADCA 1RKJA 2DNLA 2MKCA 3CXCR 3CCMS 2YH1A 1KC8T 2BOPA 2CPZA 2O3DA 2MB0B 2LXIA 1SXLA 1WI6A 2FC8A 2LMIA 1YJNS 4C7QA 1OWXA 1WF0A 3K0JA 1WHWA 2L41A 4ZKAA 2MSSA 1UFWA 2CQHA 2CPYA 2MKHA 5DETA 2M9KA 2LEAA 2E5JA 1D8ZA 4CH1A 3CCRS 1R8HA 2RRAA 5GVQA 4IO9Q 3IRWP 2LA4A 1QVFR 2HGMA 3EX7B 2I2YA 3VF0B 1F9FA 3G8SA 2CQDA 2DO0A 2CPDA 4QU7A 5GMKa 1WEYA 3CULA 1AUDA 2U2FA 2CPIA 1P27B 3S6EA 2J0QD 1UW4A 5GADU 1S79A 2MY8A 2MMYA 1VQ4S 4C0OC 1FNXH 2OTLS 3BO3A 2KRBA 2RUGA 1FJEB 1NU4A 5D78A 1VQMS 3I56S 1YHQS 2DHSA 2RVJA 2DIVA 1VC0A 1U6BA 2G0CA 3JB9k 4WIIA 1UP1A 3CCUS 1NJIT 5CXTA 1U1LA 3TYTA 4A8XA 3SMZA 3PIOQ 3RW6A 3LQVA 3NS6A 2CQBA 2FC9A 5H1SV 2FPHX 1WELA 1VQ6S 2AYMA 2MHNA 1X4EA 3BEGB 2F9DA 3VAMA 2OJ3A 1G2EA 3VAHA 2CQIA 3MI7X 2MZJA 2DNPA 4IOCQ 1M5PC 1URNA 1X4DA 2LQ5A 1X4GA 2RRBA 5CA5A 1DRZA 3DLLQ 2M88A 2MJUA 1A7GE 2B0GA 1PO6A 5BJRA 2ERRA 4WFAQ 3BS9A 3MD1A 1JMTA 4F02A 2DK2A 1BY9A 1SJRA 4BS2A 1FJCA 2MY7A 3ZZZA 4FXWA 1VQLS 2N3LA 2E5HA 3CCVS 1YJWS 1M90T 1WG5A 3G96A 2M2BA 2MJNA 2M8HA 1X4FA 1YITS 2I38A 4OZ0A 1U1NA 2VONA 3Q2TC 4WF9Q 2MGZB 4WCEQ 2J76E 4LIRA 1U1QA 1WTBA 2M0GB 2YWKA 2ZJQQ 1U1KA 1SJFA 2X1FA 1NO8A 3UD3P 3UCGA 2ZJPQ 2CQPA 3CD6S 1K73T 1ZZFA 4PR6A 4UY8T 2MGZA 1VQOS 1X4HA 1WF1A 2XS2A 2QFJA 4IOAQ 2HVZA 3RW7A 2LEBA 1K8AT 3CC7S 1X4CA 1SJ3P 4Z2XA 1M1KT 2KYXA 2OSQA 1Q86T 2KI2A 2ZJRQ 1KOOA 2MQLA 3G8TA 3NMRA 3VAJA 3IWNC 1Q81T 1VQKS 2DNMA 2M70A 2XNRA 4F25A 2OSRA 1X5PA 3NNCA 2N82B 2N7CA 5HL7Q 3G6ES 2HZCA 1JJHA 2EK6A 2DGSA 3SDEB 2NZ4A 2DNOA 1L3KA 2J0SD 3P6YC 3P3DA 3P5TL 3ZZYA 1YI2S 1U6FA 2PE8A 1S72S 3UCUP 4FXVA 2EK1A 1M5VC 2AYBA 2G4BA 2FHOB 1WF2A 1U1OA 2QA4S 4Y00A 1KQSR 4U67Q 3SDEA 3CCES 1X0FA 3BO2A 2MZ1A 3CC4S 2GO9A 2JVOA 5D77A 4F26A 2MQPA 1CVJA 2N3OA 4YB1P 2ADBA 1HA1A 2CQCA 2RU3A 2AYEA 2E5IA 1H6KX 2A3JA 4RU2A 2MKKA 1DHMA 5DDRC 2WBRA 4M5DB 5DM7Q 2DNNA 2KRRA 1U1PA 3VAIA 2D9PA 5HO4A 4TU9A 1JJ4A 1WEXA 2RS2A 4CH0S 1N54B 3H2VE 4WFBQ 1H2UX 1U2FA 4EGLA 2L08A 1OO0B 4W90B 1ZZNA 5JVGQ 1Q82T 3VAKA 3CC2S 2K3KA 1YTYA 3LPYA 4TU7A 3FEYB 3TP2A 1W2BR 1X5SA 5ITHA 1D9AA 4TU8A 3CCJS 5LSLA 4WFNQ 1M5KC 3L3CA 1XN9A 1WHYA 4LJMA 2RT3A 2KU7A 2DGUA 5GAEU 2RS8A 2CQ2A 4TLQA 2KH9A 2DNHA 1Q7YT 1VC5A 4P6QA 3G4SS 2RQCA 1B7FA 1PGZA 3CMAS 2KHCA 1VBXA 2HYIB 5LXYA 2KFYA 3MUMP 1X5TA 5EN1A 2MZSA 3NNHA 2AD9A 2VOOA 1VQNS 1FHTA 1HD1A 1WG1A 3N9UC 2M4MA 2DGTA 1FT8A 2XSFA 2RNEA 1N52B 2D9OA 2DHAA 5IM0A 1WHXA 3R27A 3CMES 2FY1A 4Y0FA 2CPXA 4WKRA 3V4MA 1ZH5A 2CPJA 4QU6A 2J8AA 2MQMA 2F9JA 4V19X 3Q2SC 1KOHA 2MQOA 2SXLA 2XNQA 2JX2A 1VQ5S 2DB1A 3BO4A 3US5A 2LXUA 1U1MA 2F3JA 2M8DB 2CPFA 3THTA 1QM9A 3CCQS 1JJ2R 4CIOA 4YOEA 2XS5A 2KXFA 2OTJS 2VODA 5LSOA 2YH0A 1H2TZ 4UQTA 3EGZA 1SJ4P 1HD0A 2OIHA 1O0PA 1VBZA 3MURP 1RK8A 2JWNA 2L9WA 3DXBA 1YIJS 2DHXA 2CQ0A 1X4BA 3VALA 2DGOA 5MLCV 4ED5A 2YKAA 2DNQA 3I55S 2K8GA 2MKSA 3HI9A 1DZ5A 3B4DA 1WHVA 4YUDA 3THPA 2MPUA 5DDQC 3TO8A 3G9CA 2XB2D 2KG1A 2XS7A 3SXLA 5DDOC 2CQ4A 1YWXA 2KT5A 3MD3A 5LJ3Y 3UE2A 5DDPC 2VOPA 5FJ4A 4PRFA 3U1LA 2DNGA 4CQ1A 3NS5A 2MSTA 1WWHA 1SJQA 3CCSS 3R1LA 1K9MT 3EGNA 2UP1A 2DISA 2MZQA 1FXLA 3OW2R 2GHPA 2JVRA 1WEZA 2M52A 2MKJA 2JRSA 1VQ7S 3ULHA 2KM8B 2X1BA 3MOJB 2AYGA 2DGWA 3P49B 1X4AA 3MXHP 2DGQA 2DHGA 2MZRA 1N8RT 3CPWR 3HHNB 2CQ1A 3S7RA 2E44A 3NNAA 2BZ2A 2G1DA 2KXNB 1VQPS 2PEHA 4LMZA 4ERDA 2NLWA 1DBDA 2X1AA 4QQBA 3MUTP 4IUFA 1OPIA 4W92B 1A9NB 1X5OA 3MUVP 3VAGA 2DIUA 1UAWA 2LA6A 2DNKA 3PIPQ 1VBYA 3UCZP 2YTCA 2KM8C 5GAHU 2CQ3A 2DH8A 2DITA 1KD1T 2KXHA 1VQ9S 5IFMA 1IQTA 2KG0A 1WG4A 1R8PA 3R1HA 2Q79A 2LECA 1P1TA 2LCWA 4OZ1A 2CPEA 5IM0B 3CF5Q 1U1RA 5GAGU 3J7ZT 5IQQA 1QVGR 3CUNA 5JVHQ 2DGVA 5LXRA 3D2WA 5LJ5Y 2D3OR 1FJ7A 2CPHA 1N88A 2LYVA 2MXYA 3CCLS 5DM6Q 2MKIA 2DNRA 1YJ9S 2DO4A 2CJKA 3UWTA 1M5OC 2V94A 5CYJA 2KVIA 2MQQA 1VQ8S 2QEXS 3J7YU 2HGLA 3MDFA 1FO1A 3UD4P 3H2UB 1VC6A 4C4WA 4QPTA 2X1GA 2EVZA 3CTRA 2HGNA 2MQNA 3G71S 2LKZA 2KN4A 3VAFA 3FEXB 4J5OA 2DH9A 2DGXA 2M7SA 2CQGA 4PKDB 1OIAA 1HL6A 2DNYA 3U1MA
chains in the Genus database with same CATH superfamily
3GFXA 2UV8G 2W7AA 3D1OA 2U1AA 4ED2A 3D9BA 1UKUA 1TKXB 3OVSA 1N36F 1U0HA 5F41A 1EETB 2I1RA 4B17A 4CO4A 4I68A 3IRXA 2NXEA 3PKMA 3P96A 2YKOA 4AE5A 2HQDA 2W2PP 3IRWP 1QE1B 2XI2A 3EX7B 2O1PA 2FIUA 1LWFA 3QSYB 4DF4A 4K2JA 6FD1A 4K4VA 4H4KC 4C0OC 4YB6A 2OTLS 1XWLA 2VICA 3RB6A 1YBUA 1CG2A 4ZVUB 4NRTA 1XNRF 2XCAA 2RVJA 4CLUA 2V2ZA 4FF2A 2XBPA 3H98A 5E41A 2WSFC 2Z2MA 3FGVA 1HBOB 2IA6A 3UO0A 2WVEA 2R7WA 2OEMA 2ZOFA 2MHNA 3H5YA 1U09A 5CA5A 4KR0B 2B0GA 1PO6A 1LXNA 5LMUJ 4CLYA 5B09A 2A1BA 5CD4A 2BE2B 5K14B 2EFNA 1WG5A 3MEDA 2M8HA 4WE1B 4OZ0A 1RLCL 1EX8A 1KQKA 3TA0A 3THVA 2EBGA 2GC8A 4Q43A 1EAYC 7FD1A 4PWDB 2VG7A 1KHVA 4ZVGA 3FSXA 3KMQA 1S6PA 2HBYB 1BLUA 1M1KT 4MK8A 5CYQA 4DV2F 4DV3J 1SC6A 3H42A 3QWUA 4DQRA 1RA7A 3Q24A 1TL1B 2VPWB 3VGTA 2UVWA 4ECZA 5CHCB 3SDEA 1X0FA 4RNOA 3CC4S 2JVOA 5D77A 1S0OA 2A3JA 1CSJA 3M9MB 5DDRC 1B64A 1JNRB 1YX2A 2V2KA 2GCFA 3TAMB 1JJ4A 4DN0A 1WEXA 4TY9A 1N54B 2KDOA 5FD1A 3TQ1A 3TQEA 5K9FA 3GG0A 3EE3A 2W4CA 2L08A 3D6TB 4F3OA 5JVGQ 1UMJA 2FLPA 4WIQA 4QW9A 1SBRA 3LA0A 4FZVA 3IG1B 5CABA 1HQUB 3CSKA 3PJWA 5LMNJ 1Z4UA 2E1PA 5H9FJ 4KV8A 1WHYA 5T7LB 4DV7F 3BSOA 3A3OB 4DV3F 2J6UA 4YR0A 1KFDA 4E0DA 4ZIVA 5K8NA 4I7FA 1GMVA 3DRYA 3H5SA 4FKXA 4CO0A 2DGTA 3MR2A 3K59A 5KG6A 2ZZMA 3PYEA 2IJRA 1UVIA 2F9JA 1DLOA 2XNQA 3DOMB 3G6YA 1SQEA 3HFZB 2BJ7A 2AEFA 2W2NP 1IBMF 1X0PA 1X7VA 4ZMMA 4RWWA 5A6WA 3POTA 1YG0A 1IKXB 1B0PA 3OXLA 1B99A 1YIJS 5KFUA 4ED8A 2DGOA 3QGHA 3J7YI 2DNQA 5L8RC 4C97A 4Q45A 3HI9A 1DZ5A 3MM5B 5LMNF 3CDBA 1WHVA 1UVNA 3THPA 3MPDA 5HN0A 1AZSB 2OPPB 1TKXA 5DGBA 1BD6A 1WC1A 1Y5IB 1FTRA 4QIVA 5F8IA 1D1UA 3ZZTA 2VOPA 3U1NA 3TNVA 2DVIA 1VLOA 4K50A 4U7UK 1EB0A 4CT8A 1WOOA 3EGNA 1QAXA 2MZQA 1TUVA 2B7BB 3BGFA 1H38A 2RQKA 2IM1A 3EJMA 1PKUA 2IVYA 4HTJA 5K5MA 3MXHP 1RTHB 3CJ3A 1N8RT 1Q5YA 2BZ2A 2KXNB 3QWPA 4B08A 4IUFA 2LQ9A 3MUVP 1Y5LB 1MROA 2COLA 3UCZP 2V9WA 2DITA 3KHRA 3AA8A 3I4HX 4PPZA 4NZ0A 3GFZA 5IM0B 2YY3A 2V6AA 4LSNA 5ETPA 2UXDJ 4IQMA 2MXYA 1YJ9S 3UN2A 1VQ8S 1FO1A 1VC6A 1JXLA 2HGNA 3KWMA 5C2GA 1UEVA 3CVKA 3TZXA 4N76A 5L1KA 3KHHA 1FKAF 3M2VB 1HNXJ 3S01A 3B4MA 4FN5A 2IC3B 4NYZA 1RE1B 1UL3A 2ZM6J 4RX6A 2YH1A 2EBEA 4KPYA 2OHDA 3EWGA 1SXLA 4YMEA 3PG9A 4EK2A 1OWXA 3T19A 2H1YA 4LRDA 1Q1KA 1NDLA 1CEZA 4Z7YA 1XEZA 3CGIA 1D8ZA 2QJ3A 2HS4A 3MMBB 5HQLA 1T95A 2UXDF 3EDRB 1SJ1A 1Q0NA 1TL1A 1N0VC 2PMZD 3U7JA 3DLKA 1UVMA 3ILIA 4LSZB 4K5RA 1SC3B 3OJUA 2EG2A 3OR1A 3SI8A 3TAMA 4QBUA 1WOPA 1RU1A 2QV6A 3MM9B 3RG6A 4J9LA 2B51A 2ZM6F 2WBMA 4C8LA 2FJVA 1WELA 1VQ6S 3LWLA 1G6BA 5AJ3F 3M32B 1U8SA 1VBKA 4F4ZA 3D7SB 1HQUA 1M5PC 5E33A 2R8IA 3LP1A 4RJVA 4QCLA 2LQJA 3OHBA 2VU5A 3KNGA 4CLWA 2FHKA 1UFLA 1FJCA 4IYQA 5AXKA 4EEYA 2MJNA 2I38A 5GAEI 4LIRA 2YWWA 5HATA 3MFHA 4OHVA 2CQPA 1CC7A 4UY8T 3G82A 2QMUB 4O4GA 5DLFA 2LVWA 3DOMA 1DURA 4JV5J 4Z2XA 3ENAA 4ZCIA 2JHEA 3NXZA 1SI9A 2OSRA 1NSAA 2DCUB 1NJWA 2GHVC 3Q89A 4OX8A 1W26A 4QZVB 2AYBA 1P8GA 3PNIA 3NY0A 5I42A 2C3UA 4N56A 2MQPA 4NLRA 2CVIA 2RU3A 2P2CB 4KGKA 1AZSA 2OPPA 2HHPA 3N28A 2EFPA 3MPUB 2KRRA 5E3QA 2KFNA 1HW9A 5EWEA 2YQ3A 4OZ2A 1LK5A 2PO4A 3NAIA 1FK9A 3C8YA 3T6BA 4DUYJ 2K3KA 3NWGA 3FEYB 1TMJA 1XERA 4MIAA 2R8HA 4QOTA 5H9FK 4WFNQ 2CG4A 4JV5F 2XEXA 3AQOA 4CLLA 4B9VA 4DOZA 3CMAS 1IR1A 5E2QA 1FJGJ 3QGGA 1FT8A 2ACMA 2DHAA 2FGOA 4QIFA 2EG1A 5IM0A 3CMES 3BPDA 1F9HA 4DX5A 1AROP 2M3DA 3US5A 4OL8A 1HNZF 1D8YA 2HNYB 4KRWA 1QAIA 2Y3YA 5D4PA 4CM0A 1YVFA 3B54A 5CQGA 1DQAA 3J7Z5 3AH6A 3C6TB 3MWBA 2CYYA 4O44A 3BSAA 2POKA 4YHHJ 3M2VA 5MLCV 1N33J 3I55S 1YQHA 5KT7A 2AGOA 2IC3A 3W2WA 1V3RA 4LF4J 1PYSB 4C8ZA 3OQ2A 2OMLA 3JTPA 1T11A 5KG1A 2DNGA 2EPIA 4RBVA 3AOBA 1TUGB 2FHJA 2H51B 1SJQA 2UUTA 3R1LA 2BM1A 3J80U 3OW2R 2YKMB 4ECVA 3MOJB 3SCIE 2DGWA 3MMBA 1UJ6A 1U45A 2JH3A 2NLWA 1CULB 4HTIA 4FBTA 4RO0A 3CT9A 3C3LA 2LA6A 2V67A 1VBYA 3D3BJ 2V8PA 2B56A 2P9CA 1T9YA 3PVXA 1L3TA 4YHHF 1N33F 4LF4F 1VS3A 3RRGA 1SKRA 2R3VA 3DLBA 2HQFA 3HHDA 1VIXA 3MEGB 4OLPA 2FZGB 4CLPA 3UI3A 3T1HJ 2YNHB 4YQWA 4HL9A 2Z56B 3HULA 1YRUA 3ISNC 2GS8A 2E5GA 2HWIA 3QIDA 2CJXB 1RHMB 5KFKA 2Q43A 1HQ2A 2Z2YB 3I9ZA 4P2FA 1SH2A 2BANB 4P52A 4QWAA 2Q66A 2XC9A 2MSSA 4ALZA 1X9MA 2GHWA 2Y1IA 4KKOB 3WC2A 4DR7J 4HDGA 3CCRS 4JYAJ 2ASYA 2B6AB 3KNAA 4G1PA 4OV6A 1RHUB 2HWTA 3R6GB 2GQCA 4QU7A 3W9HA 5J2QB 2CPIA 3L4BC 2J0QD 2AEMA 1FDAA 1GQEA 4ETZA 4ES3A 4QIGA 5J1EB 2F40A 3GMGA 3B6BA 5K8OA 4Q8FA 5D8HB 3T1HF 3BBFA 3ITHA 2RF2A 3P5BP 3CCUS 4J9RA 3T1AA 2B4PA 2GZOA 3D1QA 3D0GE 3MCSA 4URSA 1LW0B 3PIOQ 1Y3KA 1K47A 1NSPA 2G9OA 2Y1JA 3VAMA 1T9UA 2APOA 4DQPA 4IOCQ 3DRPA 4A8YA 2MJUA 4DR7F 3KLIB 4JYAF 1JMTA 1TFWA 3NGTA 5A8WA 3WIUA 2PGCA 4WCEQ 2J76E 5IOLA 1U1QA 3KFWX 5ETLA 1U4BA 1K73T 1IXKA 4K4SA 3T9NA 3IBWA 2R2SA 2RAQA 3FRYA 2HNYA 2ZJRQ 2HG4A 2LQBA 4PWWA 3I82A 2M70A 2XO6A 1WSVA 3OFGA 5L9XA 3V5RA 3C6TA 4Q2LA 2HFNA 3ZZYA 4CO5A 1S0VA 1M5VC 1FFWB 3QLHB 3PX0A 2MZ1A 3HDSA 1Q16B 2JZ5A 3HHLC 5DZ6A 4M5DB 1V5IB 3ZZ0A 2VBXA 2W01A 2AGQA 1WC6A 1IKYB 1JLAA 2XG8A 4H4OB 2I5JB 3OFHA 5HMWA 3BKFA 2RHSB 3PFOA 3I5AA 2QC3A 3ONQA 3KUHA 5L38A 1R0AB 1GMUA 2DGUA 2CQ2A 2IIHA 1MMLA 3QGIA 5KT2A 2BX6A 2UVUA 2AKWB 2R42A 4ZHRB 4PCQA 2DYAA 5DLGA 3W5YA 3K2YA 3OL6A 3M4XA 4ZVQB 3A12A 3BF4A 3MAAA 2D9OA 1FRIA 3R27A 4I69A 4TY8B 3V4MA 2WVCA 1RCOB 3ZZRA 4AXJA 4GC7A 2LFVA 2SXLA 1RI7A 1HWUA 3QAEA 3CCQS 2AP6A 4LR9A 2RDJA 2KXFA 3R5GA 2XZWA 1E6VA 2YH0A 2OD4A 4QR0A 1IBLJ 3HT3A 2AJ0A 3VALA 2YWFA 4O23A 4Y2CA 2MKSA 5KFWA 3PW7A 1S99A 3QSIA 2Y0BB 2R7XA 2KG1A 4JI1J 2J7UA 3KOAA 5AE2A 1FI4A 4PRFA 3U1LA 3NS5A 2RE1A 1S4FA 3FDSA 1TKTB 3LTOA 1WJ9A 3NLCA 1VI7A 4XAKA 2LQ8A 4NE9C 5C25A 1S12A 3NNAA 2F1FA 3BJYA 2C2RA 1KTQA 3GLJA 1WC0A 1QLNA 3HVWA 2GMHA 1PILA 3ISND 1XJWB 5F0WA 1QVGR 3UD5A 1IKVA 4O3RA 5DM6Q 3JSMA 2DO4A 3IM8A 2XMWA 1LW0A 1Q78A 1UVJA 1QSYA 4UOGA 3KLEA 1LK7A 4RW7A 3SZ2A 2DTJA 2BVZA 1J2VA 4YDDB 4IO1A 2FY8A 5KOWA 3DRRA 4HT5A 5BR8F 2GJIA 3GCXP 1CJVA 2XZDB 5KG4A 5KFZA 3HJVA 5K8PA 3OXGA 3WZ0A 4UF4A 1ICEB 1ZETA 1S9EA 1EQ0A 3K0JA 2VBZA 1HWLA 4ZKAA 4M8LA 3GV5B 4WTYA 2CQHA 2BQ3A 1M5HA 2JSXA 2CAJA 4AXIA 4ED6A 2ALYB 4LR7A 3IM9A 3JS9A 4PABA 1SUQB 2LA4A 3Q0AA 5F3ZA 2CQDA 3QLHA 1AUDA 3S6EA 4DXLA 2CG8A 5BYRA 1NJYA 1FJEB 1REVA 1EKRA 5ETRA 1YBAA 1G1XA 2CJBA 3TR5A 3MCMA 4ZPBA 3RUBL 4S0MA 3ZO7A 2I5JA 1FWLA 4KE5A 3WBZA 5H1SV 1CQMA 1TP7A 3DKDA 3GB0A 4KB7A 2H65B 1FVQA 3MTJA 4PYDA 2MKYA 2B9XA 3DLLQ 1R0AA 3C15B 3EVWA 1A7GE 5EX3A 2GMJA 2ERRA 4C98A 2B4OA 4RW4A 4HHJA 2RH3A 2XMMA 3ZZZA 4FXWA 2HHVA 4ZHRA 1VQLS 2AX0A 4LFAJ 3MFIA 1I51B 2MGZB 2PIIA 5KFTA 3PACA 3UCGA 2ZJPQ 4TY8A 3FC9A 4ITSA 2HFSA 3JYTB 3HHLD 3CNQP 4JI4F 1X4HA 1HNWJ 4XDDA 4DDFA 1HKAA 4KGXB 1ZTWA 4RNFA 4UUWA 4P2MA 2CVEA 1KBRA 1C4CA 3I96A 2Y1LB 3HHLB 3TJ8A 2WHOA 3QGPA 4F8RA 2BKOA 3T9ZA 1UCNA 2EC2A 4NLDA 2YVSA 3HPOA 2G4BA 2XMVA 4BLGA 1T7PA 2RDDA 3CDEA 2WB4A 5KFCA 2N3OA 2J9DA 3KTQA 3BGRB 2VDHA 3O6QA 2XLIA 3W8PA 4ZLJA 2RS2A 5D3GB 3AXKA 2GAGC 4RR5A 3W66A 4DSKA 4U7CA 4LFAF 4W90B 4UZCA 1ZZNA 3TVYA 3V81B 4DV1J 2J0WA 1YTYA 1ACMB 5KFRA 4NYOA 2OUGA 4PG8A 1GXUA 2YWHA 3E2EA 4B9UA 2B4UA 4ANDA 1FEEA 3IO1A 1N5SA 4USTA 2BR0A 2QLJB 3MZIA 4OYBA 5J2PA 1I1GA 4JI2J 2M5YA 3N6LA 2V4RA 3GSIA 3M8ZA 2E1CA 3HZEA 5GAHI 3GJTB 2OAUA 3B8HA 1VR6A 1M1GA 2XLJA 1RWMB 2ZKUA 1XTZA 4YOEA 4LT6A 4UUXA 1FRKA 4GC6A 1UTAA 3JSBA 1Q5VA 4DV1F 2AGPA 4E2FB 2XY5A 2VKZG 4J91A 3VZIA 4A47A 3TX0A 3IP0A 3TVKA 3NGDA 1ZAWA 4K7QA 3UE2A 4R5PB 2QA1A 4B3MJ 4ZPWR 2R7RA 1UA1A 3M1VA 3TUIC 3AAWB 3CCSS 2RJZA 4JI2F 5JXSA 2J9DE 2JVRA 2ZDOA 4ELTA 2JRSA 2HHQA 3QFHA 4NEZA 1X4AA 5CH7B 2ZUAA 2V63A 4NLQA 4IR9A 3JTOA 4IDKB 2OD6A 2XGPA 4FNHA 3KLGB 2DIUA 2ZH2A 1SQFA 4FBUA 3O44A 4C8MA 2VB6A 2QE5A 4ZPDA 2YX7A 5DQHA 2ILYA 2RUSA 1REGX 4OYZA 4KTQA 4G1QA 3NGUA 1RWPB 3SSSA 1G7CB 4DR3J 3BQ0A 3WIVA 1FEHA 2B9WA 1RT2B 3LGMA 4B3MF 3BN4A 3D0IE 5M2UA 4C4WA 5AT1B 2GJFA 2X1GA 3FEXB 1QAYA 2DH9A 4U95A 3U1MA 3GZ7A 3H20A 2HZAA 1FXDA 4LFCF 1PCAA 2ZDPA 1TV6B 2HK2A 1R8AA 3T6JA 1OQ6A 4LRAA 4HT7A 3FBBA 4KGVB 1S76D 3PX4A 4CH1A 4YN3B 4PXCA 3RRKA 1SIZA 4ICLB 4E98A 3OJSA 2DEIA 4HACB 4DR3F 4LVOP 1RAEB 3MCNA 3LWMA 3FJ2A 1WEYA 5MAOA 4MH8A 1T05B 4PQUA 4DUZF 2HEKA 4AD6A 3QT6A 4M1KA 1HYSB 3BGRA 1FXRA 2JEFA 2H9ZA 1RACB 4YS2A 1FE4A 5HSPA 1UA0A 2G0CA 3DGVA 3V81A 1NUEA 1NK4A 3D3CJ 3RW6A 2CQBA 3TUZC 4OX7A 4FF1A 4DPXA 3DMJB 4JB8B 2M88A 5B0EA 2OPQA 2GVDB 2EKNA 3SSQA 4K4UA 3KK3B 4LREA 2NYIA 1RT4A 1F2HA 3EZUA 5D0EA 1NO8A 3LOUA 2MLYA 4KGMA 1UWAA 3RRHA 5KG7A 3VV2B 1P9YA 1WDTA 1ITPA 1ZYQA 4DV4J 1S0NA 1NB2A 3BYPA 1X5PA 4OQJA 2OPSB 2CADA 4AQYJ 5KG2A 5A8RA 4TYBA 4OYAA 2DNOA 1YI2S 1IWGA 3UCUP 3VVTA 2W9BA 2LEPA 2ZHBA 3KK2A 4PUOA 4UY85 1CVJA 3M9OB 3LUYA 2F8EX 2RRNA 3DU6A 4DFJA 3DM2A 4KFBB 3GQCA 4EZ9A 3VR1A 2Z8QA 5IT4A 4YEAA 5L1IA 4RW6B 1LEOA 4DZDA 1OO0B 1JLGB 1SKWA 2RDIA 3R5JB 1PAEX 1DFDA 2AIRB 4TU7A 3NGSA 4RBTA 1X5SA 4U8YA 2J7WA 2CA9A 3AJ1A 3CJRA 1S48A 3M05A 3L3CA 4IDKA 1Y00A 2DR7A 2KH9A 3KLGA 4P73A 5C5JA 2XLKA 3FKBA 2ROPA 4USIA 1Q7YT 4PG4A 4X65J 4M5MA 2RQCA 2HHXA 4AQYF 4KQZA 3HP6A 1X5TA 5ETTA 4OFZA 2HAIA 4UOHA 1WDDA 2HS0A 1H3DA 3TOQA 4Q7AA 5KFHA 2VJUA 3CJ4A 1OSDA 2LXUA 4OZNA 4X66J 4OJHA 3R5BA 2P5VA 1UW9A 1RT2A 1WC3A 1ZM3A 5GAGI 4CH7A 2EC0A 2VDIA 2PN6A 2C3YA 5DG7A 3GYGA 3LO3A 2CDQA 4ZITA 3VHQA 1SV5B 3IR6B 3L7OA 3I0SB 3DC2A 1K0TA 1NM2A 3TZWA 4R8UB 1TV6A 4EO8A 3CW2C 3TRGA 3DFEA 2XCPA 4CZCA 3DLHA 5DO2A 4AFFA 2V8HA 4J9PA 5F8GA 3Q83A 2WRMA 4CTAB 2Z30B 2DHGA 3WDOA 4PXEA 3D4JA 1WSRA 4LMZA 4OJ3A 2G1DA 5KFYA 4X66F 3K8VA 3BH6B 4QQBA 2ZNYA 3LH2S 5A2QY 5A0YA 4W92B 1T05A 4ZCKA 3H7HB 4X64J 1HFEL 3ZTSA 3D66A 2ZC4A 2OKQA 2CDRB 3PJ9A 3NL0A 3FMWA 4RW8B 3R1HA 3OVBA 4DQQA 2Q79A 1RT6B 4V19J 3RJMB 2QL7B 2IHR1 1RUSA 3J81Y 2IM2A 4EYIB 5IS2A 1N88A 2H4WB 3PYDA 4DSFA 4YP3A 4URGA 2AWZA 2F5GA 1OS5A 4NLXA 4P72A 2GVDA 2Z4PA 2FLOA 1GTHA 3PY8A 4F2SA 2LXFA 1HL6A 1SPBP 2K3IA 4NXNJ 1H2VZ 2RQ4A 4OI2A 1Q8KA 4QYZK 4LBHA 3EUNA 2YQ1A 2AF6A 5LOQA 1IJEB 1ZAXA 5LM7E 4X64F 3PYFA 1QUPA 4Q0BB 1RAAB 2HNZB 2HIQA 4MKVA 1U7LA 2CUYA 2GAHC 4EZ6A 3QPIA 2GVZB 2OI2A 4KAIA 4IR1A 3TA2A 4TQRA 1Y10A 2YKPA 4IO9Q 3T5JA 2YKNA 2J9EA 1FA0A 4GKJJ 1XMQF 3DHWC 5A8KB 2CPDA 1DQ8A 1N5TA 2XYGB 3CCTA 1BE4A 1HI0P 2WZ1A 4DSLA 2P6TA 2WVFA 4NXNF 4NLVA 2L9DA 4OHZA 1NK5A 1DJ0A 2YKQA 1RYRA 1FX2A 2G0IA 3D1HA 3CDAA 4J37A 3EGWB 3MI7X 2DRDA 1URNA 3NEKA 2NQPA 1SQGA 3H8YA 3TX8A 2VUGA 1FWPA 2FZKB 2BABA 1H98A 3KG4A 1KN6A 2CJYB 3DOLA 2W1BA 3NP5A 5C42B 5HMYA 2Y8WA 4KBIA 1TU0B 1YGYA 2DBBA 4YDXA 4M5NA 4NYPA 2QA2A 5K8MA 1O5JA 1YKWA 1SV5A 4XPCA 1X9WA 4CCHA 1KWMA 1VDHA 3QFWA 2GO9A 4J9KA 2UVRA 4YB1P 3GIMA 1RAJA 5DJBA 2E5IA 2RHQB 2ZHAA 3LF0A 1XR6A 4F4AA 1HARA 1Y11A 2D9PA 3KUGA 1V6HA 1HWIA 2R7UA 1U2FA 1XIQA 2E7XA 1TK5A 3K5OA 3RGIA 1RAOA 4G3IA 4F0HA 4CTAA 1N34J 1BC6A 4X4UA 4KC5A 2HBZB 4OZLA 5KAKA 4NLUA 4TYAA 1KKHA 3BYRA 1SCJB 4LJMA 3RBZA 2ZE2A 1JKHB 4LRCA 5FDLB 4FF4A 2XO7A 1MWZA 1RBLA 4C0HA 1F3FA 2FDNA 3ZTRA 4AL6A 4RW8A 1MWYA 1RT6A 5ADZA 3HD2A 2MQMA 4BBYA 3Q2SC 2V2VA 3GSDA 5KFDA 3QAUA 1HBNA 4B9NA 4LF6F 1RCXB 5KFIA 2V8GA 3VGUA 5KT3A 5CZXA 1X60A 1VYAA 1OY9A 3ZZOA 4DX6A 2NS1B 4D3GA 1GXTA 1KFSA 1OYDA 2CQ0A 2QA4G 5ETVA 1N34F 4ED5A 5BYSA 2IMOA 2HRYA 1UVLA 3OLAA 1OY6A 4J9MA 3SCJE 2Z2LA 2LU2A 1SKSA 1K9MT 4MKYA 2MKJA 1VQ7S 3ULHA 4RUCA 3N0VA 2MZRA 4WXOA 3W1YC 1S1VB 2DEJA 1SC1B 2PEHA 4ERDA 2OPRA 3HSJA 3HM9A 4M94A 4P10A 3HVRA 1A9NB 2YXLA 2VPZB 2BACA 3TEHB 1ZAVA 4YB5A 1TR0A 4ATNA 5J1NA 1IQTA 2D69A 2P8IA 1RHKB 1JXEA 1R8PA 3GYNA 1S59A 1AW0A 5DQIA 5G4DA 3T41A 5D4LA 3CUNA 2DGVA 4I64A 4O3QA 1FNMA 4QWDA 3RAMA 5B0BA 2Z2ZA 5SUHA 4Y65A 2BRKA 3DYAB 3MR3A 1UVKA 1S1TB 4QPTA 5DQGA 4YY3J 2LKZA 2KN4A 1LWCB 1PBUA 4KHPJ 2DGXA 2XWXA 3MM8A 3N4WA 4QIEA 2DNYA 2V0NA 2BUNA 2MYFA 5AE3A 2DNLA 1KC8T 2PD1A 3FZBA 2XMJA 2FYXA 4ED7A 2CJQA 5C42A 1FDNA 1ZPVA 3IRXB 3QJPA 2OMOA 3DCAA 2MKHA 3T3FA 1RWVB 4NLOA 4FYYB 2OGUA 3DLEB 2QMWA 1LWFB 4I2PA 2ZZTA 4OMFG 3V4IA 5U47A 5IV4A 3PO5A 1BGXT 1W7WA 2C42A 4KSEB 4F7VA 2PFFB 2UXBJ 3CJ0A 2KRBA 3K7RA 1IM6A 4OI6A 1TL4A 5IWAF 4KHPF 4ZVPB 1VC0A 4XIUA 3OLBA 2HHHF 4OYPA 2BA9A 1IR0A 3KJVA 4I2QA 3SMZA 3LQVA 1TL5A 2GIFA 4A4JA 1OQ3A 1X4EA 2DNPA 1MMNA 3GFHA 4O3SA 1HBMB 1JKHA 3BS9A 5DZ7A 4CRJA 1SJRA 2CJ9A 3ZTQA 3SFUA 2A2CA 2GGPA 3R97A 1U1NA 5KFEA 3Q2TC 2VG7B 1BWVA 5L39A 4BCAA 1RWNB 3KHLA 2QYGA 4FPRA 1SJFA 1S6PB 3PFEA 4ECWA 1M5SA 3IS9A 1ZM9A 2UXBF 2WOMA 1F0XA 1EHWA 3RW7A 3CC7S 2FJAB 5IV3A 1KOOA 1BMQB 3IWNC 2JNJA 3DOKB 3KJFB 3RBEA 1S77D 5HQ8A 2RU9A 3G6ES 2GIQA 3SDEB 4N41A 2J0SD 8ATCB 1W25A 2AJQA 1NHKL 2GQQA 1U1OA 2CKWA 2CNNB 3IAS9 4ZLLA 2NXJA 4F26A 4F0MA 3RR7A 2HQGA 5A76A 1WC5A 1GXLA 3R8YA 2HRTA 2QLFB 1QTMA 5KT4A 4CLTA 1T8EA 2D3UA 4NLSA 2ZNZA 3CO0P 2R7QA 4HVZA 1LW2B 1R6VA 3V6JA 5HROB 2V8DA 2RD5C 2UV8A 2H3EB 1EARA 4TU8A 4USUA 2FLNA 4FKYA 1S1VA 4JI3J 1VRQC 4JI8J 2RT3A 3BM7A 2F4FA 3MMAB 4K4YA 1RTZA 1VC5A 3KYLA 4NL5A 5J2NB 4HDHA 1PAUB 4Y34A 4DL6A 4ETXA 2E7WA 3KLFA 1RBOB 4OJ1A 4PEOA 1DLOB 2RNEA 2QG9B 2LU1A 4WPAA 4LVNP 1HR0J 3TUPA 2KTQA 1LNQA 4V19X 4O0NA 1I3OB 2ACYA 4CYUB 1NXIA 4JP8A 3L7UA 2IRXA 3POTB 2JEIA 3OL8A 3PO4A 1D9DA 1UZHA 2CWXA 4K2XA 5HK4A 1NJZA 3MURP 5E3AA 1LWCA 4X4TA 4I67A 4M5IA 2L9WA 1R8CA 3MEKA 3RBDA 4DR2J 4JI3F 4USMA 2B4VA 4JI8F 3NAHA 1LWEB 4PQAA 1Q95G 3M30B 2W25A 5LL6d 4X4QA 3SIPB 2HVDA 3EVMA 1FXLA 2GHPA 2ZH3A 1KSPA 3W7BA 3DLEA 2GW8A 2CNKB 4U6PA 4U8VA 4ZPAA 3DLGA 3HHNB 2E44A 5HANA 4IOBA 1MROB 2IJFA 3QQCD 4CWBA 5KFPA 2WTFA 3AJDA 4OYWA 4DU7A 1UAWA 4WU2A 3FBEA 4V1Ak 1RTIA 2CQ3A 2K7JA 2ZBPA 4Y3CA 4LSNB 2KG0A 2I8EA 2CPEA 4B3TJ 3OXFA 3G8QA 5GADI 5LXRA 2MQ8A 1UPPA 3HVAA 3ADAC 4DR2F 5LSRA 4NA3A 3N79A 4LSLB 2HGLA 2KZMA 2EEYA 4LFBJ 2H54B 2W8KA 3PRDA 4L3NA 1HBMA 4PKDB 3E01A 1L3VA 1WD6A 3GIKA 4F67A 2WVBA 2VJVA 3QJLA 1RKJA 2CPZA 4LR8A 2FC8A 2A10A 2LMIA 3QIPA 4BWJA 3C6UA 4HH0A 4JOUA 2G2ZA 1EIYB 3DOKA 3V6KA 4OYOA 4QPXA 1QVFR 2VFVA 2B9YA 5KFLA 3DLKB 4WP8A 3TANA 1M1HA 2FVRA 5F8MA 3MECA 4PPDA 3TZZA 3OR1B 1VHIA 3KXDA 2E1RA 1X8DA 2GO8A 3ICLA 1WORA 5LMUF 1D9FA 1B3TA 3BO3A 4LQ3A 1T03B 1FE0A 3DU5A 3KDOA 2DY1A 1R6YA 4MMOA 1KONA 3FVYA 3I56S 3UDVA 4M5JA 2DHSA 2AW0A 1U25A 3NGKA 1NJIT 2R8JA 1LW2A 4ID5B 2NR0A 1XK8A 3ZNJ1 5HROA 5EWFA 3HMJG 4UOCA 2PA3A 3LP1B 3ENWA 4WFYA 2H4YB 1RLDA 1WUUA 2C3OA 3GR1A 2ZKTA 3QMQA 2RQMA 1AB8A 3MMAA 4F02A 4BS2A 1UJ5A 1FF2A 3OSPA 5J2NA 1V3ZA 2KT3A 3CCVS 2MDAA 1FRHA 1R89A 2ZITA 4Q5VA 3TAPA 3M6WA 1YITS 4WF9Q 3M6VA 3G82B 4O4GB 3AB2B 1WTBA 4LF1A 1BQMB 4OI0A 4FYXB 4FVMA 2FZCB 3Q23A 4GVLA 1VLYA 3N5BA 4RW9A 1K8AT 4CYUA 4NA2A 1Q86T 3M7VA 4FS1A 3TWZA 3NMRA 1VQKS 3FZ2A 2HBQB 5CCMA 1S6QA 4DZ6A 1S49A 3HVTA 3HXMA 3P5TL 5I42B 1KQFB 1S72S 5IC6B 1M0SA 2EK1A 5F8HA 3PEHA 1FRLA 1QDUB 3CCES 2G1HA 2LDYA 4X4RA 3KHGA 4LRBA 4PXBA 3S1TA 5K20B 2CXEA 1APSA 1LWEA 1LQ9A 3M30A 1TL7A 4WWSA 2NXCA 1KLMB 1FK9B 4H54A 1RT5B 3I0RA 1CJKB 2DR8A 1AA1B 3UDCA 3MAQA 5IT9Y 1VFJA 2VA3A 4O4RA 2W7OA 3NCRA 1S57A 1RBAA 2BW2A 3V6DA 4DSIA 5HQMA 5LSLA 4CO1A 2F8HA 4A8KA 4ZN3A 4L73A 1FKOB 5AE1A 3ZZPA 3AD9C 2F7VA 3CJKA 2AZ3A 2C22A 3H90A 3G4SS 2KHCA 1S1UA 3NNHA 4QIWD 4RUBA 3EDQB 2M4MA 1FDDA 1N52B 4PG7A 4OI1A 3CWJA 4H4MB 4Y0FA 4ENOA 2CPJA 1S10A 3EYZA 3P4UB 2MQOA 2IYGA 1RAHB 3PRVA 2K06A 2HURA 2HAFA 4OI4A 5F9NA 1JX4A 4CIOA 4DPYA 4LSLA 4CP5A 4O44B 1BWEA 2KZZA 3HHEA 4WFXA 3CIMA 3MPWA 5C24B 4NLYA 2ABYA 1JJCB 3K8WA 1VBZA 3GJSB 2JWNA 4K0KJ 1Q8LA 3W2WB 1X4BA 2FHJD 1VCTA 2N4CA 2ZEJA 4NCGB 3EZOA 1R43A 2R7SA 2FJWA 1JLCA 4ED1A 2HFVA 3T5KA 4N7TA 3N01A 1L3UA 2CZ9A 5A6PA 2FGCA 4F4YA 4CQ1A 1TAUA 4OYIA 2UUBJ 2PMWA 1CS4A 2BXJA 1H73A 1C0UB 2ZH6A 1N5YB 1EJ7L 1B7YB 1N48A 1ZTTA 1ZOTA 1CLFA 2O67A 2HQIA 4CT9A 4HYKA 4DL2A 1Z2LA 2AU0A 2XULA 3IR5B 2F65A 3UVJA 4UT4A 1HNXF 1VK3A 1T03A 4DR5J 1SL2A 3FBCA 1HHSA 3HKWA 1EZZB 2PDAA 2UXCJ 4NX9A 1U1RA 4USVA 3J7ZT 3KG1A 4ID5A 2RILA 3CJSA 4A8FA 1IBCB 4OI3A 2QLBB 1UEKA 4B9MA 3J7YU 4BC9A 3CTRA 3CCZA 1SKUB 3H40A 5THWA 1HLWA 3P45B 2MZTA 4M5GA 3I4PA 3PW4A 2DH7A 1MU2A 3NKYA 2PC6A 3VVUA 3W2VB 1S9GB 1CJUA 1BQMA 4FNIA 3BREA 5ETOA 1T9TA 4C11B 2DJWA 1LOUA 2DD8S 4L75A 1V5VA 2UXCF 4DN9A 3G87A 1T94A 2I2YA 3AJ2A 1V3SA 2PEBA 3I5CA 3BDPA 2U2FA 4P74A 2HPUA 2YNIB 1L3SA 1C1BB 3OR2B 2MMYA 3AD8C 3ITHB 3LGNA 2RF2B 3WC0A 4NCAA 5EX0A 1NKBA 1NU4A 1VQMS 1SL0A 1KLMA 4GVBB 4ZVFA 1RT5A 2XY6A 1TKZA 1DARA 1UP1A 3AY0A 4MYUA 1CJKA 1JXVA 1YDLA 3DRPB 3GWCA 1VMBA 4CLFA 2OJ3A 1HMVA 5F8JA 2V69A 4JI0J 4I0WA 1LKZA 1RHQB 3QJJA 5A8WB 2XMKA 2HVHA 1FKOA 3QZ8A 3HD1A 4WFAQ 5IT0A 3BR8A 2QSWA 4ANEA 2ZJQQ 1U1KA 3FCWA 2ZBRA 4H4MA 4IG3B 3CD6S 1ZZFA 1WF1A 2XS2A 2KB2A 3HFVA 4C8KA 1FRJA 4IOAQ 2QSFA 4KHMA 2OSQA 1TQLA 3MM6B 3BQ1A 3T5LA 4DUYF 2XNRA 4ZJQA 2QL5B 5C24A 2EK6A 1RP5A 4ECQA 4F4KA 1WF2A 2QA4S 2XI3A 2F4VJ 4NCGA 1NK7A 2ADBA 4JI0F 1HA1A 1UZDA 1EQMA 1SIWB 1FJGF 4ZVHA 1ZBTA 1JLAB 3VCDA 4CH0S 1QUVA 4J9SA 2NSBA 5HI7A 1PBAA 2YNGB 4DJBA 4DL5A 1NDPA 4E8UA 2JEGA 3W5XA 4USKA 1UETA 1C0UA 2OH2A 1N5YA 4X62J 2HQCA 3FBFA 4B02A 3TUJC 5GAEU 2RS8A 4WJBA 4ES1A 2ZC3A 4F3QA 1NDCA 5KG3A 2C2ZB 3MAAB 1PGZA 5LXYA 1MG7A 3SYZA 4DG1B 1PSDA 4JV2A 2E5LJ 2AJ2A 1Y3JA 2BM0A 3O3LA 4OYMA 2K1RB 2BJ1A 4GO7X 4KH1B 2VC0A 2F3JA 2DKOB 2IM0A 1E6VB 3GIIA 1P1LA 4Y2MA 4Y2IA 3LGHA 2OTJS 1H2TZ 5F8LA 2OIHA 2BJ9A 3JAMY 1NJXA 2DRBA 2BV3A 1F2GA 3BDEA 5M2PA 3J81j 2WW8A 3PHEA 5EHHA 3DXBA 4NA1A 2ZFHA 3VQTA 3B4DA 1IQZA 2XM3A 4Y2AA 3W2VA 2BJ8A 5DDQC 1S9GA 2FTRA 2VKRA 4NLGA 3EVOA 3TEGA 4RPFA 1A0OB 4C11A 3MCOA 2VFSA 4IH5A 2MSTA 2XYPB 1R7IA 4G1IA 4M95A 2BJDA 2QN6B 3VGSA 3A8JA 3K57A 5C25B 2M52A 2EW9A 2VG6A 2E5LF 2KT2A 3D0HE 1HNIA 1U6ZA 3DN9A 2CFXA 1VQPS 2JL9A 2X1AA 1OPIA 3G2XA 2YNIA 2AEJA 3DDNA 1C1BA 1X9SA 1NMEB 2Z58B 3OR2A 4K4TA 2R9LA 2QRRA 2IDEA 4I56A 5E7OB 5AXMA 1WG4A 4LF9J 1F60B 5FLXY 2B9EA 2C2MB 5KFFA 1JLQB 4GVBA 1IKVB 1GX6A 3JSMB 3RZAA 3ZTPA 1KVJA 4HKQA 4DR1J 2N7YA 2HLUA 2MKIA 2ALZA 3DLJA 5CYJA 3KLEB 4WKYA 4RW7B 3N6NA 5HBMB 3LALA 4HLBA 1JLEA 1U8WA 3DRRB 1GTEA 3G71S 4J5OA 1CJVB 4PXDA 2BEFA 3FCVA 1RT7A 3KLHB 3GV8B 1NPKA 2UUWA 2LP4A 4DCJB 4LUBA 1AT1B 3SQGB 2NXNA 1S9EB 2CRLA 3T1YJ 4IQXA 3CXCR 1OY8A 4MKAA 1JK9B 2O3DA 3MHYA 2G0JA 4Y2KA 3EZ5A 4IG3A 1Y5NB 1YLXA 1DTQA 3IFEA 3CCWA 4JI7J 5DETA 2YX4A 4GO5X 2Z57B 3ELHA 4WP9A 3MM6A 1XR5A 1QD1A 3X1LB 1N5VA 2VC1A 3FUYA 4HHHA 3A3PB 2HGMA 2F8MA 1FFSB 2VBYA 1MW7A 1HI8A 2XSJB 1REVB 1RB0A 1RWKB 3CD5A 5F9LA 1QSSA 5ETNA 4IFYA 4D3HA 4B9SA 4EBCA 3D6HB 3VZHA 1RDRA 1HQEB 2ZH4A 5GMDA 2W2QP 5KFVA 1TTHB 2WK4A 1XBWA 4QWCA 1MN9A 4ZP8A 2YNGA 2DPIA 3OTDA 3WHIA 3T1YF 4A8XA 1DTTB 4OZ3A 4MFBB 2FPHX 2AYMA 1IR2A 2ZHOA 4RW4B 1NK8A 3GONA 5F8NA 5I4MA 1Y0HA 2MY7A 4DI6A 1GH8A 3W9JA 4J9NA 4PYAA 3M8WA 2M2BA 1Q4RA 3R7SB 5DG8A 4DG1A 1PIEA 5KFAA 3UQSA 3C16A 3EM1A 2K1RA 4F0KA 2J0XA 3UDLA 1VJQA 3UDEA 2G2YA 2QMXA 4CNYA 2RKIB 3M8PA 4ZPTR 1Q81T 3CD0A 4KO0B 4DR6J 4ELVA 3SV3A 2PE8A 4FXVA 2AMCB 2FHOB 5ETKA 3BO2A 4CLKA 1JLFB 2OP5A 1E6YB 3MEEA 2AYEA 4RU2A 1DHMA 3CJTA 2WSCC 2YNFA 8RUCA 1R31A 1R0CB 3TARA 3EXCX 2IA0A 3HSGA 1RT1A 4DV2J 3JSYA 5HJYA 1C1CB 3GPAA 4J9VA 4EO6A 2LLZA 3IBFB 2J8SA 1NDKA 3QATA 2C2OB 3OUYA 3MMJA 4ZVTB 5HVGA 1YRTA 1RWUA 3GJQB 3E8OA 3OTBA 5J2PB 1IBLF 4M63A 5JJBA 2KFYA 3MUMP 3R6LB 2AD9A 2B8QA 3Q86A 4C0BA 4DR6F 1FDBA 3OFFA 1JLQA 1RZMA 4JI1F 3X3UA 4WKRA 4FXDA 4QU6A 1T3OA 1YJTA 2O66A 4KYZA 2ZH1A 5FIIA 1S1XA 5HBMA 1JJ2R 1NAQA 3HSZA 4FF3A 4X4OA 4DV7J 4RNNA 3DXSX 3ENQA 1O0PA 3UN3A 5F0UA 4DFMA 2ZD1A 3BSCA 3ILLA 2DHXA 2FJBB 4IKAA 3W63A 8AT1B 3KLHA 1D0EA 3M8QA 4AL5A 2F63A 3OTOJ 3SQGA 4RNMA 5D0HA 1Q7LB 2JOQA 3OPKA 3M1VB 4OLOA 2CQ4A 3IR7B 4ZOSA 3A1YG 3Q8RB 2A6MA 4L6V3 1IBMJ 2DISA 2PI4A 3L9ZA 3P49B 1N32J 5SZTA 3IGVA 3CPWR 3S7RA 1VRTA 3QBCA 2H48B 2I6WA 2VQFJ 2XSJA 4BDPA 1LWXA 1X5OA 5E5NA 4L74A 3DGPB 3NOCA 3QZ7A 1TK8A 1F6TA 2IDLA 1HQEA 2FB0A 4G1QB 1J5OB 4ZK7M 3GYXB 1NRKA 3ZFVA 5AXLA 4P71A 2CPHA 3OTOF 3IGNA 1IKWA 1DTTA 1UEUA 4MFBA 1AFIA 3HK2A 2E7VA 2XWYA 3R5AA 1T0TV 3H2UB 1OJ4A 3R9LA 1HPZA 1N32F 3V2UC 3CO9A 3MR7A 5A2QU 1MLAA 4F4WA 2DNZA 1PC4A 2X3GA 3K5NA 3CCMS 2VQFF 1GMWA 2BOPA 4EU0A 1H7WA 1WI6A 1TL3B 3ETOA 2E29A 3J81U 2MLXA 2EWHA 2E5JA 2RKIA 1VGYA 3B82A 3A13A 1EETA 3RU0A 3ZZUA 4DEZA 1VRUB 1GFWB 4PQUB 1WNEA 2IMWP 1F9FA 4KO0A 3G8SA 1NH7A 1FCAA 4A8MP 1QE1A 2CNLB 4RZRA 5I3PA 4RKUC 2BRLA 2MY8A 1JLFA 4ZVOB 1VQ4S 1JWWA 1E6YA 3CB4A 1FESA 5KT6A 2W8LA 4P2XA 2A2DA 2FJXA 3QT5A 3D6MB 1KLNA 3BV8A 1YZ7A 3FK4A 3JB9k 1WKJA 3M2UB 4KGZB 1C1CA 1H7XA 1HNWF 2ZOGA 2HFZA 1BQNB 2OPQB 3BR9A 1HBOA 5DS7A 3RAQA 3MOZA 2HRUA 1RT4B 5BJRA 1WKKA 1TZ0A 3I5BA 1L5UA 1C4AA 1NCLA 2NPFA 2E5HA 1S6UA 2ZBIA 4O3OA 3FNNA 4F36A 3KK1B 2VHGA 2M0GB 2BE2A 5K14A 5H9EJ 4ZLPA 1VK8A 3ILOA 4WE1A 4PR6A 1NHVA 2QFJA 3ISZA 5AJ3J 2KYXA 4J9UE 3SV4A 2MQLA 5A8RB 4PWDA 2HHSA 3MTKA 5JMNA 1HI1A 2W9BB 1JJHA 2NZ4A 3KK2B 3P3DA 4IFVB 2XQCA 4PUOB 2B5JB 1S0MA 3R5DA 2Q1LA 2BQUA 3DDIA 1RHJB 1F1BB 1KS2A 3DM2B 4M5KA 1R0BG 2ZH5A 1RQ0A 3I31A 5KFOA 4R0EA 1U1PA 1TELA 3PW0A 2J9CA 2GMLA 4EGLA 2KVQE 1N0UA 4A48A 4NASA 9RUBA 2WW4A 3HF5A 2VG5B 2VV5A 3PHTA 3M8RA 1FFGB 2FVPA 5DRKA 3JXOA 4Y28C 3PM9A 3C66A 3IG1A 1FRXA 2BE7D 1SL1A 1TKDA 5T7LA 3DGPA 2MZSA 4CLSA 1HD1A 2PA8D 1J5OA 4EMDA 4C9DA 1DQ9A 3HHKA 3FMBA 2D74B 5KOXA 2IYIA 1ZH5A 2NXUA 4DSJA 4ILRA 4K4WA 3MR5A 2YWGA 2DB1A 1VQ5S 1U1MA 1QY7A 1BUXA 1WOSA 4F4XA 5CYMB 4DV0J 4HR2A 5D6GA 4NMLA 1F3VA 5D15A 1XNQJ 4L72B 3Q8SB 4MIWA 4XK8C 1T02A 2C3PA 3M8YA 1IKXA 3MGJA 2CZ4A 1EKSA 2XS7A 1CPZA 2QTWA 3KJNB 1YWXA 1TL3A 3MM5A 3EPGA 1CBKA 1DY3A 5FJ4A 3AQPA 4NRUA 1HNZJ 2V2QA 2EI5A 4USHA 3D68A 2ATCB 1O51A 2YX1A 3PJXA 1VRUA 3K5MA 5A0YB 2A6OA 2ZOMA 3TI0A 2HMIB 1RTHA 2KHDA 2DNKA 3DDKA 4Z37A 2KM8C 5GAHU 3MM7B 4DV0F 5IFMA 1RGVA 2Z0GA 2LECA 1XNQF 2UU9J 2LCWA 3LPEA 2CJAA 3CF5Q 1N56A 4A8OA 3M2UA 5JVHQ 5LJ5Y 1FJ7A 1PJ6A 3D67A 3IWLA 3CCLS 4WXWA 1M5OC 1Q79A 1HHTP 4P2SA 1BQNA 1FERA 2IVFB 4DR4J 4IH7A 4DV6J 1S7IA 3TW0A 1KTVA 3HCXA 1HBUB 2RIJA 3AXMA 3BZQA 2VD3A 4CDIA 1BHNA 3DHXA 3CJ5A 3KK1A 1BQXA 2IAJB 2NUUG 4DX7A 1R8BA 2JC0A 2PSZA 3EICA 4DFKA 5G0RB 3BSNA 2QL9B 4DSEA 4B3OB 1NPRA 2YKNB 2R2RA 2UU9F 4LRFA 1NZ8A 2B3TB 2JLEA 3CJ2A 4EBEA 1R8HA 2NSCA 2NZCA 5GVQA 4DPOA 4H4KA 3C19A 4ECXA 3RYLA 4IFVA 2B5JA 1Q53A 4WFZA 4QWBA 3AODA 4P9SA 1UW4A 4DR4F 3OD2A 4WYLA 4DV6F 1CJTB 2RUGA 2DR9A 2BQRA 3BGLA 1YHQS 2DIVA 4O0IA 3UNYA 3FSYA 3MF5A 3OL7A 3GE9A 2IRYA 4LQ9A 3E3XA 1MWQA 3QRRA 2FC9A 2VG5A 1H74A 3MM9A 3TJ9A 3H4BA 4DQIA 3BEGB 4DV4F 3NOGA 1G2EA 3DRXA 2MZJA 4ZVRB 1T9WA 4TKTA 2YPZA 4M5LA 2VZ9A 3ZXWA 3M32A 4R0JA 4QWEA 5J1PA 3AOAA 4P7VA 4RWXA 3GTYX 6AT1B 2AHOB 1BY9A 2E9RX 4QW8A 4ZJLA 3DOLB 2JC1A 1FWKA 3QYYA 2BMBA 1VISA 5C2CA 3MAHA 5H9EK 4DF8A 2G13A 5EGYA 2HVZA 2LEBA 1SJ3P 3RTVA 4WZMA 1S1WB 3M8SA 4OJGA 2XHWA 2DNMA 1NZAA 5CYMA 4LF7J 4F04B 2N82B 2N7CA 2HZCA 1L3KA 3BKTA 3MR6A 2W4DA 1VQYA 3ZTOA 5B0AA 3BBBA 3FRZA 1YJVA 4U67Q 2MLZA 4IG0B 4PAAA 5IC4B 1ZS6A 4X65F 3HX9A 2MKKA 1VOMA 5DM7Q 2DNNA 5L46A 1NHUA 4PWUA 5HO4A 3GIRA 1NK6A 3H2VE 2EXUA 1H2UX 4N77A 4ECSA 2ZH9A 3FCHA 4OHWA 4U7UD 4LF8J 1W2BR 4Q44A 5EDWA 1D9AA 2ZE2B 1RADB 2Y8YA 1RHRB 4DL3A 2C2NA 2IBKA 4DBQA 2HMIA 2KU7A 4TLQA 2PMHA 1U47A 4ELUA 4P6QA 1S97A 4LF7F 3KLVA 2EFQA 1VBXA 4ANCA 3MM7A 3UN5A 2VOOA 2FJDB 3TA1A 3CJ8A 3D5MA 2XSFA 1HBNB 1Z2ZA 3NGRA 3FFIB 4TXSA 7FDRA 4BWMA 2GX8A 2QX0A 2M8DB 1RA6A 3DRSB 4PG5A 5BXIA 3NRBA 4ZN1A 3T5HA 4X4NA 5HAOA 4ER8A 2ASLA 5M2RA 2XS5A 3LP0B 4ZPCA 4UQTA 1HD0A 5JUMA 1HBUA 3I87A 3OT9A 4LF8F 1RAIB 4FYVB 4RLEA 1HNVB 3GG1A 2NPIA 3MMCB 4YUDA 3TO8A 2PI5A 2IAJA 2JLGA 2HS3A 3MD3A 5DDPC 5G0RA 2W2MP 5KFQA 5L9NA 1IJFB 2B8PA 2AZ1A 1U02A 4B3OA 1AFJA 1RWOB 4P7TA 2KM8B 2OPRB 4FDFA 5IXUA 2ZZNA 2H5JB 2DGQA 1U48A 2XYHB 2XHCA 2YKMA 2H5IB 5ETMA 1DBDA 5BYQA 1OSCA 4UZBA 3VAGA 2NCKL 3VWSA 2KJWA 4X2BA 1CULA 3CDWA 2BKPA 5CD4H 1CJTA 1EP4B 1VQ9S 4NI2B 4FYDA 4LIWA 2JEJA 1FNOA 2P6SA 3BGUA 4B3SJ 4K5SA 5GAGU 3UFCX 3D2WA 2LYVA 3GCWP 3M6UA 2Y0SD 4DPUA 4XTTA 2QEXS 5HJXA 1AXQA 3MM8B 3W5ZA 1B0TA 3L95X 2BDPA 3VAFA 3QNWB 2CZVC 2BBEA 2M7SA 2OELA 3CDUA 4QJVA 4GKJF 2WB1D 3MEGA 3S8SA 4AL7A 1P6TA 3R7NB 2YNHA 2ADCA 2MB0B 2LXIA 1LFPA 1YJNS 3N5FA 3I32A 4N8NA 1WF0A 3QRPA 3KG0A 2C28A 2VF3A 1UFWA 2ATLA 2XTJP 3OFEA 4I2PB 2BANA 1S1WA 2LEAA 4YR3A 3V4IB 1AYEA 5HVFA 4B3SF 1KHWA 2UZAA 2RRAA 4KKOA 3IC1A 3IBCB 4DV5J 1TUWA 2HK3A 4KT0C 2B6AA 5BR8J 1WC4A 3UW1A 3NG8A 1KP6A 4IG0A 3HFKA 1F5AA 2V4JB 3PRBA 3M2RB 5J2QA 1KVIA 3KUEA 1U24A 5B0CA 2D3ZA 2AJ4A 1GX5A 3BKUA 3KJVB 4I2QB 5J1EA 4C8NA 3LAMA 4ILMA 2JDJA 1U1LA 3SBMA 3TYTA 4WTOB 3V6HA 1NH8A 4DPTA 3CJQA 2Y1RI 4W98A 3A4TA 3F73A 2LQ5A 2FHMA 4KHRA 2X7IA 4N8OA 2BE9B 2GGPB 3MD1A 4ZLNA 1YJWS 3M9NB 1M90T 4DCPB 4ZCMA 3KLIA 2GIRA 1JQGA 1X4FA 4I6YA 4DV5F 3IS9B 3H59A 2WOMB 2HFUA 3LP2B 4CLZA 2KO1A 1RWWB 4EUVA 3FFIA 3LANA 4NMXA 1Z1ZA 3Q8YA 1VQOS 1UJ4A 5C7PA 1X4CA 1RKIA 1O6XA 3WQPA 3DRSA 2D1CA 4MIBA 4KPCA 3LP0A 1WTFA 3RB4A 2DGSA 5AXNA 1OYEA 1I5OB 1KQGB 1HNVA 1SH3A 1YJ7A 2HBRB 2JFDA 3MMCA 4I6AA 4ZP7A 1YBTA 1R27B 1VQSA 3C14B 4AUKA 1LFWA 5T14A 4JI4J 3VAIA 4PG6A 3F56A 4DWIA 2XZTB 1F5BA 4M5DA 1YSJA 5KTQA 3VAKA 1FVSA 4ZDNA 3TP2A 2W9CB 4I6WA 5E3PA 1IKYA 1Q8BA 3CCJS 1S9FA 4H4OA 1T3NA 2IM3A 5IQ6A 3R7BB 2NUHA 2NREA 2R2UA 3KLFB 2CWKA 1NB7A 1B0VA 1EP4A 4EBDA 2VA2A 3G6XA 5KFSA 4NI2A 1J27A 3JTNA 2ROGA 3ZNUA 1WHXA 4ECTA 2FY1A 4WP3A 3K89A 3J80Y 2J8AA 4GMKA 2JX2A 3L7PA 2DR6A 4OYXA 3NCQA 3W8GA 2FVCA 4U9RA 2W2OP 1AUSL 3H4DA 3ZC4A 3NWRA 5IT9U 2VODA 3KMSA 4DL4A 4HHUA 1PYTA 3UPFA 2YKAA 4ILLA 2HIYA 4KH0B 2QFIA 4L3KA 4I4BA 2R8GA 1A6LA 2GA7A 4EYHB 3O5TB 5CCLA 4DLGA 5EUHA 1U49A 3VQSA 3U27A 3DLGB 2IRUA 2IBOA 4FYWB 1WEZA 5KT5A 3PW5A 2X1BA 1TKTA 1KR4A 1NLKL 3TZYA 2VL1A 2VBWA 4LF2A 4YY3F 5I3QA 1RTIB 1WACA 1YZ6A 4X4PA 3RAXA 4DX8H 2V4JA 3M2RA 1Y7PA 1D09B 4TNOA 5RUBA 5HP1B 2V8VA 4N47A 4DL0C 3BBCA 2HWHA 3ILJA 2FVSA 1ZM2A 1X31C 2KVIA 2J5AA 4NCBA 2HQ3A 3PDNA 2FUG9 4ZVSB 2R7VA 2BW7A 3UD4P 4JV0A 3E01B 2CIMA 1NK0A 2EVZA 9ATCB 4Z7CA 2UVVA 2DXEA 2CQGA 3A8EA 2B7CB 3UR3C 3DNCA 4OIXA 4OV1A 2XGQA 4YB7A 2HSEB 4WK3A 3QIPB 1RU2A 3C6UB 2MKCA 4JUZA 3Q8VA 3LP2A 1IUJA 4HI1A 4ZP6A 5EWGA 2L41A 2CPYA 2OLWA 3KKFA 1RTJB 2M9KA 4JBCA 1TVRB 2GV1A 3R2CJ 3MECB 3NS7B 1PG5B 2E9TA 3J7AN 2C2EA 2DO0A 3HO1A 4MTPA 1H72C 1NEEA 1SUQA 4I1TA 4B9TA 1P27B 5KFJA 1NPPA 3RBXA 1S79A 4LFCJ 3F41A 1U0SA 1FNXH 2WCXA 2BOAA 3BB5A 3C14A 2L48A 1ROFA 1LV5A 1D3WA 3W61A 5CXTA 2ZBQA 1SVDA 1JB0C 4GRSA 3NS6A 3IAM9 2W9CA 3DI6B 4DQSA 1V9OA 2F9DA 4WBFA 3AFGA 4K59A 2DY9A 3VAHA 5HVHA 2XMAA 2DCLA 1X4GA 2RRBA 1IN0A 2FJEB 1GNKA 4DUZJ 5KFXA 3B78A 2DXDA 3OV7A 1N6QB 3J7A1 2ZH7A 2FQQB 3O2IA 4UOFA 7AT1B 1UPMB 2LDIA 3C15A 4EI2A 2E66A 2E1MC 3G96A 2HW3A 2EFGA 4ZJOA 2YWKA 4RW9B 4A8QA 3SSRA 2MGZA 3SFGA 4QYZJ 3VGVA 4JV1A 1S6QB 1RISA 1XC9A 4O3PA 3JYTA 3HVTB 4Q8EA 3W3SA 3PX6A 3BH7B 1WKLA 3SCLE 3P6YC 1U6FA 3HHLA 4U96A 4Y00A 1U2RA 1TL7B 2AT1B 2MHEA 4F50A 3I0RB 1H6KX 1TAQA 3R3TA 2K2PA 1XMBA 1N5QA 4TU9A 2VPYB 4HH1A 3PKYA 4DS4A 4WFBQ 4YR2A 3W60A 3HKZD 2Q3PA 1HR0F 1QJHA 4C6AA 4USWA 4ZPVR 2HFOA 3V6DB 1Q82T 5D3GA 3CC2S 1MMDA 4MK7A 2Y9HA 1F5CA 5DGAA 1DAXA 1PYOB 4W4MA 3L09A 2WSEC 5ITHA 2B43A 3K5PA 3CJKB 2XMUA 1NKCA 1G3OA 1S1UB 2MEWA 4WK1A 2V4QA 2DNHA 2WVDA 3RB0A 2NYHA 4QR1A 1HW8A 2MTLA 3A8KA 5J2MB 5KFBA 3N9UC 1YK9A 5HP1A 1XQIA 3CE8A 3C46A 3HT0A 4P75A 3AT1B 2CPXA 4MT1A 2QYCA 1FX4A 3CD7A 1T9XA 3BO4A 1ZA2B 2ZH8A 1QM9A 1J5EJ 2KFZA 5KG0A 4DPWA 5LSOA 1GK8A 1RK8A 5ETQA 3NBPB 2K7KA 2JLFA 1R3NA 4TLRA 4ZA1A 1JLCB 1HIYA 2VIHA 2K8GA 1HWKA 4XO0A 5KFNA 1CS4B 2KT5A 4CM2A 4NLWA 4X84A 2Q6BA 4B3TF 2UUCJ 1WWHA 1VHFA 4R5PA 1RTJA 1TVRA 2AYGA 1VJWA 2IPOB 2HVIA 3UVJB 1P9QC 1J5EF 4LFBF 2OEKA 5KFGA 3JAMU 3PIPQ 1ULRA 3ETMA 2L9NA 1RAGB 1KD1T 4Q2MA 5L1JA 2HLTA 3R2DJ 2D7SA 4MKBA 2I9SA 1UWBB 2D41A 2E9ZA 3NCPA 2EFOA 2Q6CA 5DG9A 4NLPA 5IZHA 2CJKA 2IVMA 3K17A 3DI6A 3QT8A 2MQQA 1RABB 5B0DA 2UUCF 3PR4A 2N4DA 4DMZA 2BJ3A 4DL7A 5CZVA 1KEKA 1MU2B 1N6QA 1FKPB 2C2KB 3BN7A 4XDCA 1CJUB 4CI0B 2QZ8A 2RB7A 2X51A 5HLFB 3I6PA 3BGOP 1IM4A 1FTCA 3Q8QB 5FLXU 2KL8A 4G65A 4B9LA 1SC4B 2O5DA 4ZP9A 2ZUGA 3C2PA 4NXMJ 2HNDB 1XMOJ 3VF0B 2GNKA 3CULA 4ICLA 4HACA 5LT5A 2UUAJ 1JLBB 4DS5A 5GADU 2HKEA 3FSIA 2PT0A 4FP9A 1TKZB 4MYTA 4DU8A 3F0NA 2KJVA 3GP9A 3NMAA 2DT9A 1U6BA 1HYSA 4WIIA 1T9VA 5D4OA 3IXQA 4BHQA 1HMVB 1NK9A 3JQJA 4RL1A 3PV8A 2V68A 5L1LA 1XMQJ 1X4DA 1DRZA 4X4SA 3P8BB 3DMJA 4NXMF 4FVCA 2DK2A 3PR5B 3SCKE 2N3LA 1XMOF 5J2MA 4USJC 4NLTA 4RUAA 1HWJA 4OHYA 3KK3A 2HHWA 2UUAF 4MJKA 2J6SA 1Q8IA 4ZIWA 3EMTA 4UW2A 1U2CA 2KI2A 3G8TA 2XMTA 4OHXA 4A8SA 3FQKA 3NNCA 5E3CA 1LXJA 5HL7Q 2VFTA 4MAKA 4C8YA 1G4CA 4OZ5A 3SQOP 2ZVSA 4RU9A 3NBPA 3G86A 2OPSA 4KIAA 1ZM4A 2KKHA 2CQCA 3RR8A 4DFPA 1NKEA 2AV5A 2W4PA 1QAJA 4N5SA 5E0OA 2QT7A 1MNEA 3PCOB 2GQ2A 4NEYA 4KFBA 3IA0A 4PZVA 3HJFA 3IMQJ 4X4VA 3QO9B 4Y6IA 4WYWA 3LPYA 4RW6A 1JLGA 5GMEA 3CEDA 2QLXA 4K4ZA 2QGFB 1XN9A 4J7CA 1U26A 3KJQB 4C2MA 2C1EB 3I9V9 4NPOA 1RXOB 2HHUA 4OZJA 4A8WA 4K0KF 2HYIB 2WAQD 1RTDB 2QLWA 4AT1B 1VQNS 1WG1A 1RT3B 1VIOA 3WX4A 1UWBA 2YBVA 2AQ4A 3FEZA 2J7KA 1KOHA 2VFUA 1GEHA 2CPFA 2UUBF 2V50A 4IRDA 4DLEA 2PFDA 1PJ7A 1ZA1B 3EGZA 1I6JA 4ECUA 5B08A 1FKPA 2O01C 1PJ5A 4IRCA 4C3KA 1NSQA 1ELOA 3MPVA 1MN7A 5E3RA 4KY3A 5HLFA 3IN5A 1IWAA 2MPUA 4KJIA 2XB2D 3GU0A 2ROEA 3AD7C 1GAOA 2DXFA 3SXLA 5DDOC 2ZBCA 4DR5F 5LJ3Y 3I0SA 2A18A 1GT8A 4DUTA 4URQU 4R8UA 4YFUA 2VG6B 4LF6J 4OX9J 1HNIB 1K0VA 3H5XA 1YJRA 5I3UB 3BQ2A 3SEOA 2HNDA 2V34A 1SH0A 4IRKA 2FD2A 2C2DA 3Q22A 1FRMA 2X3DA 2EFVA 4RNHA 3HZGA 3MUTP 1F9EB 2CNOB 2VFRA 3AA9A 1IVZA 4NWBA 1JLBA 4K4XA 2WONB 4ZVEA 6FDRA 2YTCA 3CMQA 4NZ6A 3GJRB 2DH8A 2HVEA 2P9EA 3OSNA 2A0FB 2P9GA 3JSRA 3H2LA 3FQLA 4GKKJ 4OZ1A 4QYRA 2OEJA 5B0FA 2DR5A 5IQQA 2IY5B 3W64A 2D3OR 2H5EA 1JLEB 1H0HB 3O1LA 2FLLA 4WU3A 2V5HG 3A3NB 1RJJA 3UNGC 4FS2A 3MDFA 3PEJA 4FPIA 1OPZA 1RT7B 4OX9F 1SB6A 1KDNA 2DHHA 1O8BA 2ASJA 4OX6A 1UFKA 4DHVA 5B0GA 1WI8A 1C2PA 3HLUA 4C3MA 4JI6J 3ENVA 3OL9A 4ID8A 2DRAA 1TMMA 2ZVIA 2VQEJ 1DTQB 4ED3A 3AB4B 3GV7B 5D0RA 4NOHA 3GFYA 4C7QA 1WHWA 2I0XA 3GILA 4Q0BA 5T41A 3F44A 4HI2A 2HNZA 4GKKF 2OFHX 1CC8A 2HZVA 1K1SA 2RMLA 2GVZA 2ILZA 4M5HA 4B3RJ 4L76A 1C0TB 5ETSA 5GMKa 4IFYB 1ZPWX 3R5CA 1PC5A 1FD2A 4MK9A 2HHTA 2E1AA 5A8KA 3LW5C 1IBKJ 5B7WA 5KG5A 3JQMA 4CO3A 5D78A 5HMZA 1KRPA 1MSWD 4ZCLA 3H25A 2BJEA 4JI6F 3OBIA 2VQEF 3QO9A 4RBUA 2R7TA 3PYGA 4ES2A 2CQIA 3ET6B 1HHQA 2R4FA 5D4NA 2C3MA 2ZWOA 1K44A 3H5UA 3RB3A 3D6FB 1RTDA 5IWAJ 2F4VF 2G2OA 1B70B 4B3RF 4ECRA 1RT3A 2VONA 2VASA 3MPYA 3C16B 1OMSA 2DPJA 2HHHJ 3Q8PB 2J6TA 4J9OA 2X1FA 3UD3P 3QT7A 1U0HB 2R2TA 3PXGa 3M8PB 3TAQA 1IBKF 1W2IA 3CIZA 4WZQA 3VAJA 1CQNA 4F25A 1RAFB 3OVAA 1QTNB 1Y9OA 2AJ1A 3N6MA 3Q8UA 4C3LA 1KVKA 1RWXB 3PTWA 4BC7A 4X62F 1Y4ZB 2BKNA 3AHPA 2VH7A 3G6VA 2QIFA 1KNZA 3OHAA 4HEA9 3MEEB 1YJUA 1KQSR 3EXYA 4LBPA 3JQKA 4G6VB 2YNFB 4CO2A 2WBRA 5CAAA 1RT1B 3IWXA 1JIHA 4K8RA 4JI5J 1S7HA 2IJNA 4ED0A 5F3TA 3OTCA 3PZPA 3O8WA 5I3UA 2AJFE 3OUYB 4O3NA 1QSLA 4EFAC 4LBIA 2FVQA 2D3O1 1M5KC 4TQSA 2VPXB 2OO4A 3LAKA 2WONA 1B7FA 3EGVA 3GR0A 4AYBD 4A46A 4LF5J 5EN1A 2QO3A 4CNZA 3MEDB 3EPIA 1S6OA 1FHTA 5FDLA 1I94J 4QR2A 4C8OA 3BPSP 5KFMA 2BYCA 2W9AA 1S1XB 4EWTA 3AOCA 4IH6A 2GJ2A 3THTA 3OTEA 5CYQB 4TN2A 2ZD1B 2R8KA 4JI5F 1URRA 1SJ4P 1BXNA 2OFGX 3M8QB 1K1QA 4TVAB 3H0PA 4ZS6A 3PW2A 4J9QA 3U02A 2YPYA 3GIJA 1TK0A 3G9CA 4ED4A 2EKYA 3TVZA 4UTGA 1NNDA 3TJAA 1FD8A 4LF9F 3A8IA 3UR0A 4F2RA 4LF5F 2KYZA 2JFKA 3E51A 2UP1A 1S4EA 4DR1F 2XY7A 3D54A 1I94F 1VRTB 4XPEA 1XR7A 4J90A 5HMXA 1YRXA 4R25A 2AX1A 2YQ0A 1S5ZA 2IFXA 2CQ1A 1C0TA 2W24A 4KV8B 4UQGA 2V9KA 5D0GA 1RSCA 2L3MA 4DCOB 2W7PA 3W9IA 1N36J 1NBEB 3M6XA 3D28A 3VTIA 4I7FB 2KXHA 3KDNA 1N4LA 1P1TA 2RSQA 3HSDA 1IKWB 2ZWPA 3QRQA 3K5LA 2R7OA 1JNZB 4F3MA 2DNRA 2JJ4D 3UWTA 2V94A 2GFFA 3W65A 1RYSA 2YWEA 4JI7F 4NZ7A 4RUHA 1GMWD 3ET6A 3K58A 2ASDA 3WX8A 1HPZB 1TFYA 2MQNA 4ECYA 3W62A 3DYAA 1XNRJ 1OIAA 1S1TA 4C48A 1B4SA 1NSKL
chains in the Genus database with same CATH topology
3S8SA 3GFXA 4AL7A 2UV8G 2MZTA 1P6TA 3I4PA 3GZ7A 3H20A 2W7AA 3PW4A 2DH7A 3D1OA 1MU2A 3NKYA 2PC6A 3W2VB 2YNHA 2U1AA 1FXDA 4ED2A 2ADCA 1UKUA 4LFCF 1TKXB 1S9GB 2MB0B 2LXIA 3OVSA 1BQMA 4FNIA 2ZDPA 3BREA 1TV6B 1LFPA 1N36F 1YJNS 3N5FA 1R8AA 3T6JA 4C11B 3I32A 4N8NA 1WF0A 3KG0A 5F41A 1EETB 2C28A 2DJWA 1OQ6A 1UFWA 2ATLA 2I1RA 4B17A 3OFEA 4CO4A 4I2PB 4HT7A 2BANA 4I68A 1S1WA 2LEAA 4YR3A 3V4IB 1LOUA 2DD8S 1S76D 3PX4A 3IRXA 3PKMA 4CH1A 4B3SF 2UXCF 3P96A 4PXCA 1KHWA 2UZAA 2RRAA 2YKOA 4AE5A 4KKOA 3RRKA 1SIZA 3IRWP 4ICLB 4E98A 3OJSA 3IC1A 4DN9A 1QE1B 2XI2A 1T94A 4LVOP 3EX7B 4DR3F 2I2YA 3AJ2A 2O1PA 3LWMA 1V3SA 3FJ2A 2FIUA 3I5CA 4KT0C 1WEYA 1LWFA 2B6AA 3BDPA 5MAOA 4MH8A 2U2FA 4DF4A 1T05B 3UW1A 4PQUA 6FD1A 4DUZF 4K4VA 2HPUA 2YNIB 3NG8A 1L3SA 1C1BB 4H4KC 4IG0A 3HFKA 1F5AA 3OR2B 2MMYA 2V4JB 3ITHB 3LGNA 3PRBA 4C0OC 2RF2B 3M2RB 3WC0A 5J2QA 4YB6A 2OTLS 4M1KA 1HYSB 1KVIA 4NCAA 1XWLA 5EX0A 3RB6A 1U24A 3BGRA 1NKBA 5B0CA 1NU4A 2D3ZA 2AJ4A 1GX5A 1VQMS 1SL0A 1CG2A 4NRTA 1XNRF 1FXRA 1KLMA 3KJVB 4ZVFA 2RVJA 2XCAA 2JEFA 1RT5A 2XY6A 2H9ZA 4I2QB 5J1EA 1FE4A 4C8NA 4FF2A 1UA0A 2G0CA 1TKZA 3LAMA 1DARA 1UP1A 4ILMA 2XBPA 3AY0A 3H98A 4MYUA 2JDJA 5E41A 1U1LA 3TYTA 2WSFC 3V81A 2Z2MA 3FGVA 3V6HA 1HBOB 1NH8A 1NK4A 2IA6A 2R7WA 3RW6A 3DRPB 2CQBA 3TUZC 3GWCA 1VMBA 4OX7A 2ZOFA 2MHNA 3H5YA 2Y1RI 4FF1A 2OJ3A 1HMVA 5F8JA 3DMJB 4I0WA 3F73A 2LQ5A 1U09A 1LKZA 5CA5A 2M88A 3QJJA 5A8WB 4KR0B 2XMKA 2HVHA 2B0GA 1PO6A 5B0EA 1FKOA 2OPQA 2FHMA 3QZ8A 4KHRA 3SSQA 4N8OA 1LXNA 4WFAQ 2GGPB 3MD1A 5B09A 5IT0A 4K4UA 2A1BA 2BE2B 3KK3B 5K14B 1YJWS 2EFNA 2NYIA 1WG5A 2QSWA 1RT4A 3BR8A 4ZCMA 3KLIA 3M9NB 2GIRA 3MEDA 3EZUA 2M8HA 1X4FA 4I6YA 4OZ0A 4WE1B 4DV5F 3IS9B 1KQKA 3H59A 3TA0A 2WOMB 3THVA 2ZJQQ 1U1KA 2EBGA 2GC8A 3LP2B 1NO8A 4Q43A 2KO1A 7FD1A 4H4MA 3LOUA 4IG3B 4EUVA 3CD6S 4KGMA 3FFIA 1ZZFA 3LANA 3RRHA 1Z1ZA 4PWDB 5KG7A 2VG7A 1VQOS 1KHVA 1WF1A 4ZVGA 2KB2A 3FSXA 2XS2A 4C8KA 1FRJA 3KMQA 4IOAQ 2QSFA 1UJ4A 1S6PA 4KHMA 1X4CA 1BLUA 1M1KT 1RKIA 1ZYQA 2OSQA 4MK8A 3DRSA 2D1CA 1S0NA 5CYQA 1TQLA 3MM6B 3BQ1A 4MIBA 4DV2F 3T5LA 1SC6A 4DUYF 2XNRA 1X5PA 3QWUA 4OQJA 4DQRA 2OPSB 5KG2A 3LP0A 5C24A 1RA7A 5A8RA 1WTFA 4TYBA 2EK6A 3RB4A 2DGSA 3Q24A 2DNOA 1TL1B 1RP5A 5AXNA 4ECQA 2VPWB 1YI2S 4F4KA 3UCUP 2UVWA 4ECZA 5CHCB 1WF2A 2QA4S 2XI3A 1KQGB 2W9BA 1HNVA 4NCGA 3SDEA 2LEPA 2ZHBA 1NK7A 1X0FA 3KK2A 1SH3A 4RNOA 3CC4S 2JVOA 4PUOA 5D77A 1S0OA 2JFDA 4UY85 1CVJA 3MMCA 4I6AA 2ADBA 4JI0F 1HA1A 3M9OB 3LUYA 2F8EX 2A3JA 2RRNA 3DU6A 1R27B 1SIWB 1CSJA 4ZP7A 3M9MB 4DFJA 3DM2A 1VQSA 4KFBB 4AUKA 5DDRC 1B64A 1FJGF 1JNRB 1LFWA 2V2KA 4ZVHA 2GCFA 5T14A 1ZBTA 3GQCA 4EZ9A 1JLAB 3TAMB 3VCDA 3VR1A 4DN0A 2Z8QA 3VAIA 1JJ4A 1WEXA 4TY9A 4CH0S 1N54B 2KDOA 1QUVA 4PG6A 4YEAA 5FD1A 5IT4A 5L1IA 3TQ1A 4J9SA 2NSBA 3F56A 4DWIA 5HI7A 3GG0A 5K9FA 1F5BA 4M5DA 2YNGB 1YSJA 4DJBA 4RW6B 2W4CA 2L08A 1OO0B 1JLGB 5KTQA 1SKWA 5JVGQ 2RDIA 4F3OA 3VAKA 4DL5A 1UMJA 1FVSA 1DFDA 4E8UA 4TU7A 2FLPA 2JEGA 4QW9A 4ZDNA 3TP2A 1SBRA 2W9CB 4I6WA 5E3PA 1UETA 1C0UA 1X5SA 4RBTA 2OH2A 1N5YA 4FZVA 2J7WA 1IKYA 1Q8BA 3IG1B 3AJ1A 3CCJS 1HQUB 1S9FA 4H4OA 1S48A 3CSKA 3PJWA 3M05A 1T3NA 1Z4UA 2IM3A 3L3CA 5H9FJ 4B02A 5IQ6A 3TUJC 4KV8A 1WHYA 5T7LB 4IDKA 1Y00A 2NUHA 2DR7A 2NREA 4DV7F 5GAEU 2RS8A 4WJBA 4ES1A 3BSOA 2R2UA 3KLFB 2KH9A 3KLGA 2ZC3A 4F3QA 5C5JA 2XLKA 4DV3F 2ROPA 4USIA 1Q7YT 2J6UA 5KG3A 4PG4A 4YR0A 1KFDA 4E0DA 2RQCA 1PGZA 1NB7A 2HHXA 4AQYF 1B0VA 1EP4A 4KQZA 5LXYA 5K8NA 3HP6A 3G6XA 1X5TA 4EBDA 2VA2A 4I7FA 4OFZA 3DRYA 3H5SA 5KFSA 2HAIA 3SYZA 3JTNA 4CO0A 2DGTA 2ROGA 4DG1B 3MR2A 1PSDA 2HS0A 1H3DA 3TOQA 1WHXA 4Q7AA 5KG6A 5KFHA 3K59A 4ECTA 4JV2A 2ZZMA 2FY1A 1Y3JA 2BM0A 3CJ4A 3J80Y 1UVIA 2J8AA 2F9JA 1DLOA 3O3LA 2K1RB 4GMKA 4GO7X 2XNQA 1OSDA 2JX2A 3G6YA 3L7PA 2VC0A 2LXUA 1SQEA 4OZNA 2F3JA 3NCQA 4OJHA 2FVCA 2IM0A 3R5BA 2P5VA 1IBMF 1X0PA 1X7VA 1RT2A 1E6VB 1ZM3A 4U9RA 4ZMMA 5GAGI 4CH7A 2EC0A 2PN6A 3H4DA 3ZC4A 3GIIA 1P1LA 2C3YA 5DG7A 4Y2MA 4Y2IA 4RWWA 3LO3A 2CDQA 2OTJS 2VODA 5A6WA 1H2TZ 3POTA 3KMSA 5F8LA 4DL4A 2OIHA 3JAMY 1NJXA 2DRBA 1YG0A 1IKXB 2BV3A 1B0PA 3BDEA 3OXLA 5M2PA 1F2GA 2WW8A 3PHEA 5EHHA 3DXBA 3UPFA 1YIJS 4NA1A 2ZFHA 5KFUA 2DGOA 3QGHA 3VQTA 3J7YI 4ED8A 1SV5B 2YKAA 4ILLA 2DNQA 5L8RC 4C97A 4Q45A 3HI9A 1DZ5A 3B4DA 1IQZA 3MM5B 5LMNF 3CDBA 1WHVA 3IR6B 3L7OA 3I0SB 1UVNA 4Y2AA 3THPA 3DC2A 3W2VA 5HN0A 1K0TA 2OPPB 5DDQC 1TKXA 5DGBA 1S9GA 1BD6A 2FTRA 4I4BA 4R8UB 2VKRA 2R8GA 1A6LA 2GA7A 4NLGA 1Y5IB 1FTRA 1TV6A 4QIVA 5F8IA 4EYHB 1D1UA 3ZZTA 4EO8A 3O5TB 4C11A 3TRGA 2VOPA 5CCLA 3DFEA 3U1NA 2XCPA 2VFSA 3TNVA 4CZCA 2DVIA 4IH5A 4DLGA 2MSTA 5EUHA 4K50A 3DLHA 5DO2A 4U7UK 1R7IA 4G1IA 4M95A 2BJDA 4CT8A 1U49A 3VQSA 3EGNA 3U27A 1QAXA 2MZQA 4AFFA 3K57A 1TUVA 3DLGB 5C25B 2IRUA<