3CC2S

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cc2S00
5LJ5Y 1H6KX 2CPDA 2B0GA 4W92B 5JVGQ 2CQCA 3CPWR 5CA5A 1WG4A 3EGNA 2DITA 1VBXA 1U2FA 2DNMA 2LXIA 1D9AA 1QVFR 3S6EA 2E5GA 3VF0B 1SJRA 4Y00A 1X4CA 4WKRA 2CQGA 1DBDA 3V4MA 1A7GE 2M8HA 1F9FA 2M9KA 2BZ2A 2KVIA 2CPIA 1U6FA 3G9CA 1H2VZ 1WELA 2LCWA 2MSTA 2RNEA 5LXYA 1G2EA 2N7CA 3CCUS 2LA6A 1CVJA 1ZH5A 2CPYA 4UY8T 2VODA 2QFJA 1NJIT 3B4MA 4OZ0A 3Q2TC 2J76E 3MUTP 5D78A 1YHQS 2MQPA 1H2UX 1FJCA 4PR6A 2DGOA 2K3KA 1X4BA 2XS5A 1X4HA 1Q81T 2LKZA 5ITHA 1VQ8S 2CPEA 2MMYA 2DNNA 2CPHA 2M8DB 3L3CA 4WIIA 4PRFA 3CTRA 2DGSA 2WBRA 2MJNA 2M7SA 3S8SA 2X1BA 3TYTA 3P6YC 2F9DA 1HL6A 4QPTA 1N54B 2BOPA 1VC5A 2MYFA 1X0FA 4QQBA 3G6ES 3S01A 3CCES 2MSSA 2DB1A 1PGZA 2YKAA 4CQ1A 2LQ5A 1R8PA 1UP1A 2KM8C 1Q7YT 4YOEA 2PEHA 5IFMA 3J7YU 2DGTA 2HGLA 3SXLA 4C4WA 3DLLQ 1VQNS 1YTYA 5DDQC 3I55S 3OW2R 4IOCQ 2MGZA 3CC7S 2CQHA 2GO9A 5IM0A 1X4AA 1SJFA 3R27A 2MZTA 2XSFA 3BS9A 5MLCV 2ZJQQ 3UCUP 1U1QA 2FHOB 2E5IA 3NMRA 1R8HA 3CD6S 2HYIB 3K0JA 2DNGA 2DGQA 2DGWA 1P27B 2J8AA 4WFNQ 2XS2A 1DZ5A 2DNQA 3CCVS 1ZZFA 2VOPA 2CPXA 4PKDB 4Z2XA 2KG0A 3UD4P 3CC2S 2AD9A 3MXHP 4LJMA 2X1AA 2EK6A 1FJEB 1HD0A 3MUVP 2ERRA 2JVOA 1WHWA 2U1AA 3G96A 2M52A 2DGVA 1WF1A 1WF2A 3UCZP 2MZRA 2KXHA 1U1KA 2YH0A 3VAFA 1VQ7S 1KOHA 1HD1A 3R1HA 3G8SA 4YB1P 3BO4A 5CYJA 2MZQA 3ZZYA 2F3JA 2I2YA 2M2BA 3CCJS 2DH9A 2DNHA 5H1SV 2KRRA 1YJWS 4QU7A 1P1TA 2MKSA 1K9MT 2DK2A 1M5VC 3Q2SC 3LPYA 2DHAA 1M5PC 2E5HA 2NZ4A 3H2UB 1VC6A 3LQVA 1KOOA 4WFBQ 2FPHX 3RW7A 3NNHA 2MQQA 2CPZA 2MKHA 3PIOQ 1JMTA 2LMIA 1KD1T 4UQTA 1JJ2R 5JVHQ 2AYEA 1URNA 5IQQA 2RVJA 2N82B 2D9OA 2RS8A 3UD3P 3HI9A 2M88A 2MQNA 1U1NA 2G1DA 2UP1A 2DIUA 3BO3A 5HO4A 1WHXA 5DDOC 3MD3A 1SJQA 2XNQA 4U67Q 1ZZNA 2DHSA 1U1OA 2LEBA 3DXBA 3HHNB 2DNLA 2DNPA 2RQCA 3R1LA 2OJ3A 2J0SD 1XN9A 1N52B 2KXFA 2RRAA 3US5A 1SXLA 1YI2S 2L08A 2F9JA 2HZCA 2VOOA 3UE2A 5BJRA 5DETA 4YUDA 1S72S 2KFYA 2FY1A 1M5KC 2OTLS 1DHMA 3VALA 3CCRS 3NNAA 1FO1A 1FJ7A 2XB2D 2MHNA 3JB9k 2KXNB 3CXCR 3EX7B 1X4DA 1S79A 3S7RA 3ZZZA 4EGLA 1N88A 2RRBA 2JWNA 1WEXA 2CPJA 2MY8A 1UAWA 3IWNC 2MKKA 3G8TA 4ED5A 4F25A 4TU7A 3CF5Q 2AYGA 5GAEU 2K8GA 2MZSA 2E44A 2ADBA 2D9PA 2DO4A 1HA1A 1U1MA 3THPA 2LECA 3ULHA 1YITS 4W90B 3RW6A 2PE8A 2RT3A 1OO0B 2MPUA 1RKJA 5DDRC 1U6BA 2G0CA 3MURP 3BO2A 1U1PA 2KU7A 4WCEQ 2CJKA 2CQ3A 1VQPS 2L41A 3VAMA 2YH1A 2DNOA 3IRWP 3U1MA 4A8XA 3BEGB 1BY9A 3U1LA 2D3OR 2DGUA 2OSRA 1VQKS 5LSOA 1WG1A 5GVQA 2FC8A 5GMKa 2DIVA 1VBYA 2MQLA 2E5JA 3CUNA 2DNZA 1U1RA 2FC9A 1AUDA 1OWXA 1WHVA 4LIRA 4BS2A 2YWKA 1YIJS 2I38A 3VAJA 3CMAS 1QM9A 2N3OA 4IO9Q 2U2FA 1WEZA 2DNRA 1U1LA 4C7QA 3P5TL 3UWTA 1B7FA 1VQ6S 1VC0A 1NU4A 4QU6A 2MY7A 2X1GA 4LMZA 4ZKAA 2DNYA 3MDFA 1WHYA 3NNCA 1WG5A 1X5PA 1WTBA 3CCSS 1M5OC 4P6QA 1YWXA 3B4DA 2MZ1A 3VAHA 2KH9A 2KG1A 1UW4A 1M1KT 3SDEB 2MJUA 1UFWA 2NLWA 1OIAA 2EK1A 2CQIA 3MD1A 3J7ZT 3TO8A 2V94A 2ZJPQ 3CCQS 1WF0A 1X5TA 2DGXA 5LXRA 5GADU 1N8RT 2DH7A 2MB0B 1H2TZ 2RU3A 1FT8A 1X5OA 1KC8T 1Q86T 4RU2A 2GHPA 2MKIA 1OPIA 1WI6A 5D77A 1JJHA 2KI2A 1JJ4A 2KN4A 1X4FA 5CXTA 2QEXS 2MQOA 1SJ3P 2RQ4A 1VQMS 2XS7A 2OTJS 2CQ2A 3MUMP 4V19X 2JX2A 2KYXA 1W2BR 1YJNS 1A9NB 2OIHA 3I56S 2DISA 5LSLA 5DM6Q 4CH0S 4TU9A 1QVGR 1WI8A 2DH8A 3P49B 1RK8A 1D8ZA 2ZJRQ 2RS2A 2DNKA 2SXLA 3UCGA 2DHGA 2MQMA 1IQTA 3MOJB 2YTCA 3NS6A 2JRSA 2RUGA 5GAHU 1WEYA 3SMZA 1VBZA 5LJ3Y 4C0OC 4FXVA 3FEXB 2M70A 2EVZA 3PIPQ 4CIOA 2LA4A 4TU8A 4CH1A 1Q82T 5EN1A 2XNRA 2MKCA 1VQ9S 5HL7Q 5DM7Q 3VAKA 2CQ1A 3G71S 2ADCA 4ERDA 2KM8B 3MI7X 3NS5A 4Y0FA 1M90T 2HGMA 2M0GB 2Q79A 2LEAA 1NO8A 2KHCA 3P3DA 3CCLS 1FXLA 4TLQA 4M5DB 2KRBA 2AYBA 2CQPA 4IUFA 5FJ4A 1FNXH 2MZJA 3D2WA 3H2VE 2M4MA 4IOAQ 2VONA 3N9UC 2QA4S 2N3LA 1VQ4S 4WF9Q 3VAIA 3FEYB 2AYMA 5GAGU 1X5SA 2MGZB 1KQSR 1VQLS 1X4EA 1K73T 2CPFA 2LXUA 3TP2A 5IM0B 1X4GA 3CC4S 2CQDA 2CQBA 1YJ9S 3CULA 2HGNA 2OSQA 1K8AT 2MKJA 1VQOS 4OZ1A 2A3JA 4F02A 2LYVA 4WFAQ 3G4SS 3CMES 4FXWA 1VQ5S 2G4BA 1DRZA 3EGZA 3SDEA 2CQ0A 3THTA 1O0PA 5DDPC 4J5OA 1WWHA 2MXYA 3CCMS 2O3DA 2KT5A 2X1FA 1SJ4P 2HVZA 2DO0A 2L9WA 1FHTA 4F26A 2CQ4A 2J0QD 3VAGA 2DHXA 2JVRA 1PO6A 1L3KA
chains in the Genus database with same CATH superfamily
1H6KX 3ZNJ1 3NCRA 2CZVC 3VR1A 4HHHA 1F5CA 2XQCA 1Q8BA 4WKRA 2EG2A 1KDNA 5F8NA 1FEHA 1CC7A 5HSPA 2IMWP 1H2VZ 2LP4A 4ZIVA 2QA2A 3SQGB 4A47A 2LVWA 1H2UX 4C3MA 1X4BA 1VDHA 3TAQA 1QSSA 2CPEA 4C48A 2ROGA 4E2FB 1R0AA 5D6GA 4LIWA 1PC5A 5DRKA 3ZTQA 2FUG9 3GYGA 3M8PB 1TKZB 2E9ZA 4DR1J 5EWGA 3H4DA 3OL6A 2AW0A 3VGTA 4RW8B 9RUBA 2XG8A 3NMAA 2BRKA 1F1BB 2C3OA 2E5IA 2YNGA 4WE1A 1P27B 1IBMJ 2KG0A 2AQ4A 3DGVA 3RGIA 3V5RA 3ET6B 2DR9A 3V2UC 3M8YA 1ZM2A 2U1AA 3O8WA 2EPIA 3SBMA 1S7IA 4FS1A 3RBXA 1Q1KA 4DV0J 3ZZUA 1VIOA 5CYJA 1FDBA 4RNHA 5DQIA 4NZ6A 3MEDA 5C42A 1WACA 2KRRA 1YJWS 4QU7A 2W7AA 1HNIA 2OPRB 1U4BA 4QOTA 5M2PA 2AJQA 3EJMA 4AFFA 3NGUA 4ZJQA 2W4DA 3SFUA 2XY7A 5IQQA 4ICLA 1AYEA 3RZAA 1KVKA 4I0WA 2R7SA 2F7VA 2ZE2A 1DLOA 3MR5A 3BBBA 3HM9A 5HQMA 2RQCA 1KR4A 4OHWA 1YI2S 5FLXY 4C9DA 4K4YA 1S72S 4LSNA 2VPZB 2ROEA 3SIPB 2PI5A 3HVWA 3M9NB 2W25A 1HPZB 3RAMA 2IMOA 1SL1A 4E98A 3KK3A 1JLBA 4W90B 3V6DB 2UVRA 4JV5J 1GEHA 4USWA 3EXCX 2VDHA 3OR1A 4C97A 3QLHA 3IAS9 3J7YI 1B3TA 2XI2A 4K5SA 2VA3A 2VC1A 2FC8A 2EI5A 2GVDA 2BM1A 2BKNA 4O4RA 4HI1A 4DV6J 3QGIA 1WHVA 2Q6BA 2GAHC 1RAEB 1YIJS 1S1UB 3EICA 1SC1B 2CVEA 3OJSA 2XI3A 4ER8A 2XZDB 2I9SA 4RUHA 1NU4A 3GV5B 4LMZA 1D3WA 4AYBD 4IR1A 1HI0P 4R5PA 2AGOA 3NG8A 2MZ1A 3QSIA 4DL4A 3BBFA 4LF7F 3RUBL 5JUMA 2KHDA 5RUBA 1BC6A 4HLBA 1IBKJ 3NGRA 1SB6A 5LXRA 2W4PA 4RKUC 5J2NA 1ZTWA 2GHPA 1OPIA 4ITSA 3W2WB 1S9GB 4HH1A 3EM1A 5KFXA 4V19X 2KYXA 4KQZA 4DL0C 3BZQA 3DU5A 1XBWA 5DM6Q 1K47A 3I0SA 2ZJRQ 3DMJB 4AD6A 1HHSA 1S1WA 3BPSP 2YTCA 1S1XB 1Y7PA 4RBUA 1FX2A 4NLTA 3BGRA 4CIOA 1RTIA 4U8VA 4F8RA 3DLJA 4OZNA 4FVMA 1RUSA 3ZFVA 1SH0A 3BKUA 1ZPVA 4S0MA 6FDRA 3CCLS 4BCAA 3K58A 2R7RA 4GKJJ 3CDAA 2MZJA 1RAAB 4PG5A 3FEYB 2B9WA 2AYMA 4AL7A 1EP4A 3GR1A 1N5SA 3THVA 4FBTA 1VQOS 4DV1J 1QTMA 1Z2LA 3MPVA 3SDEA 1S1VB 2P9CA 3MEGB 3J80U 3HFVA 1WWHA 1RCOB 3GSDA 2X1FA 3TARA 4HHUA 2UXCF 4NLQA 3FZ2A 1EHWA 4MYUA 3CGIA 3PRDA 3FBFA 2UVUA 2OPSA 3MM6B 4ED7A 1Q78A 2V2QA 1WG4A 5KFYA 5THWA 1VMBA 2KJWA 1Z2ZA 2DD8S 1AW0A 3SSRA 1PG5B 4Q2LA 4J7CA 2IYIA 4JI8F 3CO9A 3A8JA 2QFJA 2HZAA 3BDEA 2CAJA 2K3KA 4P72A 2LKZA 4DI6A 4ZP8A 2E7XA 1HYSA 2NREA 2AX0A 1NSKL 3DHXA 1X7VA 2J6SA 2ZH1A 1B0VA 4EZ6A 3HPOA 2RF2B 3BR8A 4ZP7A 3VQSA 3OW2R 5KFFA 3HDSA 3CB4A 3T1HF 4PXCA 4LVNP 5BR8J 2ZJQQ 2B3TB 1JLCB 2HSEB 3R9LA 2WVCA 3ENWA 4RWWA 5J1PA 2R7OA 5D8HB 3BREA 1RTHA 2WAQD 1D9FA 4KFBB 2RKIA 2QZ8A 3ZTOA 3NWGA 4PQAA 1LNQA 1PYTA 5GAGI 1VBKA 5H1SV 1D9DA 1NHVA 1O8BA 3GFHA 3D1QA 2DHAA 5KG3A 1FFGB 4ZCIA 3A3PB 4C8KA 3AQPA 4CNZA 2MKHA 3SQGA 5B0AA 1C4AA 4FN5A 3TVKA 3PJ9A 3CJ0A 2H48B 3NCQA 2MQNA 1TR0A 2UP1A 3GJQB 3IN5A 2OFHX 2HHUA 3I32A 4IH6A 1U1OA 3GFXA 3HHNB 3CJQA 3M8PA 3Q8UA 2VG5B 1TKZA 1RTZA 5KFTA 2V8HA 5KAKA 3Q8YA 1TL1B 3CXCR 5DZ6A 4RW8A 4DF4A 3W1YC 4J9KA 4P9SA 2NR0A 5CYMB 4OZLA 3KJVB 2VBZA 1VJQA 1NB7A 2HWHA 4F0MA 5KFJA 4RW7A 2E44A 4A8QA 4D3HA 4M1KA 5A76A 2MLZA 3ET6A 2UVVA 2ZC4A 3R5CA 4YR0A 3H5UA 1N36J 5IZHA 3A12A 4A8XA 1CG2A 4RX6A 2D1CA 2PIIA 2IM3A 1BLUA 2CFXA 1M0SA 2OPRA 3LALA 2HFOA 1PJ6A 3VAJA 3IC1A 3QMQA 1LFWA 1RGVA 3H5XA 3FQLA 2FLPA 4N56A 2V2KA 2XZWA 4RL1A 2Q3PA 4X4UA 1M5OC 3VAHA 4OYWA 2UUCF 1NAQA 1YBTA 3MD1A 2AKWB 5F8LA 1DQ8A 3OFHA 2ZH3A 3OBIA 2AJ2A 4HT7A 2VPXB 4FPIA 2AV5A 3W65A 4E0DA 3WIUA 3AD8C 2MTLA 2NPFA 4ECWA 2BW2A 2V4JB 1XNRJ 3QGPA 3LP2B 4F2RA 1U8SA 3PW5A 2XMUA 3Q8QB 3CT9A 1GXLA 1VBZA 2XLIA 4K4TA 3CDUA 3V6DA 4CM0A 1NRKA 1T9YA 1EQ0A 2XNRA 5ETQA 1TL7B 4HHJA 3RB4A 1EAYC 3VAKA 1S57A 3CWJA 2Q79A 3W66A 4P71A 3C66A 4MYTA 4M5DB 1UWBB 2QSWA 3BH7B 4ZP6A 1HI8A 4UOHA 1S1UA 1N5VA 4JI5J 2M5YA 4WP8A 3QZ7A 3MMAB 3P5BP 3GLJA 3G4SS 4DLGA 4P2MA 1F60B 3MEEB 1WKLA 2O01C 2NPIA 1S0MA 4XDCA 4Y2CA 2HQFA 1NK7A 1YZ7A 4NRTA 4B3RJ 2ZZNA 1SJ4P 2DHXA 4WU2A 1C4CA 3D68A 1T95A 3K2YA 2A6MA 5CA5A 1F6TA 3W2WA 1S9GA 3HD1A 2VU5A 2ZWOA 4B3OA 2DXDA 3IM9A 3V4MA 1A7GE 2ZM6J 3ZZOA 1H73A 1GMVA 1OS5A 4NA3A 2LDYA 1S1XA 1M1GA 3N28A 4OZ0A 4B3SJ 4PR6A 2QL5B 3Q22A 2EFGA 1NKCA 5H9EJ 4QIEA 4CLSA 2XMAA 3M30B 2LQ5A 3CVKA 3GIIA 3NL0A 2JHEA 3LTOA 2KVQE 5KG5A 4F2SA 5D4LA 1EJ7L 3KLEB 3JSMB 3W7BA 1U1QA 2X51A 4LRCA 3IG1B 4EO8A 4WFNQ 2B51A 3SSSA 1JLFB 3JQKA 1S1VA 4USVA 3MEGA 4M94A 1MROB 4NI2B 3G96A 3DOLB 3ENAA 3UN3A 3MM6A 5GMDA 2VJVA 2HK3A 4DQSA 3ZZYA 2CZ4A 2Y1LB 4QWBA 2IDEA 5C5JA 2GQ2A 2B8QA 4DV3F 4ELVA 1SH2A 4A8SA 2VPWB 3MR6A 4JB8B 3UDCA 3RRGA 1XK8A 4WTOB 3PIOQ 2J9DE 3WX4A 4DV2F 3D6HB 3JXOA 4RJVA 4YFUA 1U1NA 2K3IA 3B8HA 3BH6B 3BO3A 3PYGA 1RBAA 3GP9A 1YSJA 2F8MA 1FVQA 2QLJB 2ZKTA 2KFYA 2Z56B 1FO1A 5HJXA 2ZH2A 2RF2A 5ETKA 3ISND 1WD6A 3OXFA 3KJFB 1FA0A 2RRBA 1IBLF 2D41A 3PFEA 2HS0A 4F4XA 4ZLJA 3CF5Q 1JLCA 2K8GA 1LV5A 1J5OB 3OXGA 1N56A 1HA1A 4HT5A 4DCOB 2W2OP 1PYOB 1VHIA 2IYGA 1YLXA 2GX8A 2PD1A 1TL4A 4KFBA 5ETVA 2WOMB 1U1PA 2WSFC 3DCAA 4K4ZA 2L41A 3N4WA 3F0NA 1EB0A 4CNYA 1S4EA 3AQOA 2HFUA 3NGKA 4DS5A 2E5JA 5K20B 4C8ZA 4FYYB 5F3ZA 2ZZTA 2OELA 2U2FA 4FF3A 1VQ6S 3K5PA 2AF6A 3ITHB 1HWKA 3JS9A 4P6QA 4LVOP 3QZ8A 2KG1A 4G3IA 4EFAC 4X84A 1G1XA 2D74B 2VG5A 5KFSA 3K8VA 1ZAXA 3CJRA 2ATLA 4DR1F 3HSGA 2QLFB 3SCKE 5DO2A 2MKIA 1JJ4A 2OPQB 5CYMA 3MGJA 3KJVA 4R8UB 3KJNB 3KMQA 1UEKA 3PG9A 4A46A 1D8ZA 3V6JA 1OY9A 1IQTA 1Y5LB 3WX8A 3Q8PB 5KG1A 5GAHU 3VHQA 1IBMF 3CSKA 4B3TJ 1RWPB 1S5ZA 2HLUA 3PO4A 4K4UA 2NXUA 1FK9B 5EN1A 2C2RA 5K9FA 3KHGA 4HTIA 2POKA 2PMHA 3JAMU 2W7PA 3NS5A 1DTTB 1RU1A 4M5GA 4DR5J 2B4VA 1I94J 2CNKB 3W9HA 2HQCA 3UD5A 2N3LA 1Q0NA 3FSYA 4GRSA 5IT9U 2LXUA 1NH7A 3CULA 1PBUA 2VQFJ 3TUPA 4C0BA 3CW2C 1RABB 1PJ5A 2VH7A 4K8RA 3TEHB 5ETRA 4U95A 2ILZA 4CLLA 4ID8A 2CKWA 2VUGA 3ZTRA 1UZDA 4RW6B 2L9WA 4F26A 2OI2A 4PQUB 2HQ3A 5IWAJ 3DRPB 4B9UA 3CPWR 2ZC3A 1AFIA 2V4JA 2W01A 1DBDA 2ZDPA 3LP2A 3EZ5A 3WC0A 1YRUA 2MSTA 1MWYA 2LA6A 2BE9B 3MWBA 5A8KB 2WRMA 3O6QA 4B9TA 2K1RB 2FGCA 3MF5A 1OJ4A 2W4CA 4JV5F 1Q81T 1W7WA 2PFDA 3PFOA 3TWZA 4OX9J 1TL7A 3QIDA 3N6MA 3KNAA 2IIHA 4Z7CA 3HSDA 4C8NA 1T9WA 1NM2A 3K89A 1X0FA 1IM4A 1MLAA 4M8LA 1E6VB 4M5DA 1UWBA 2JLGA 1FRIA 1D09B 2PEHA 3QNWB 4DV6F 4OX8A 3VQTA 3OVSA 4OYAA 3MMAA 2ABYA 1GMUA 5KFAA 2XSFA 5MLCV 1RYRA 3M4XA 1RT2B 2RE1A 4JP8A 5L9NA 4GKKJ 2DGQA 4UT4A 3MEEA 4GO7X 2J0XA 2J7KA 3MUVP 2JVOA 1LEOA 3BSOA 1IBKF 1S0OA 1KOHA 2Q1LA 2I2YA 4K2JA 5T14A 2DNHA 2HBRB 3KHRA 4QWDA 4QWCA 1P1TA 1K9MT 3MR3A 2MQ8A 5B0DA 3C46A 1FRJA 5A8RB 1OQ6A 2V0NA 3H2UB 1KOOA 4WFBQ 4ZJOA 3RW7A 3QFHA 2XM3A 1LK5A 4ZMMA 2VB6A 1R8BA 1N5QA 4WXOA 3QT6A 3D1HA 2D9OA 4N7TA 3IS9B 1TMJA 3QPIA 5IC6B 4HACB 3HHLB 1F5BA 3ILJA 4ZHRB 4LR9A 5HMXA 4IDKB 2J0SD 2KXFA 1FFWB 4I4BA 3M30A 1RA7A 4GKJF 3R7BB 4U8YA 3KLEA 2DJWA 2B9YA 2DRBA 1F3VA 1UAWA 4HVZA 3BBCA 2E9TA 4YEAA 2GAGC 1ZOTA 2AYGA 4DV1F 3IG1A 4PXDA 1UMJA 4MKBA 4B9NA 1HWIA 1U1MA 1JLFA 1AZSB 4PUOB 2Y8YA 2BJ3A 1MROA 5KTQA 5DDRC 4NI2A 4CO5A 3DOLA 1TL3B 3LPEA 2YX7A 2JFDA 2CJKA 1RYSA 2D3O1 5H9FJ 3TA0A 3D5MA 3MCMA 4USKA 4LIRA 5E33A 5CCLA 4BLGA 2BE2B 3JSRA 2N3OA 3LO3A 4IO9Q 1WEZA 1U1LA 2R7TA 4RO0A 1T05B 2R2UA 2ZOFA 1UVJA 2JSXA 1WHYA 4HDHA 2HHWA 2HVEA 3EXYA 2EK1A 1RWMB 3CJSA 2CQIA 1Q79A 2V94A 3VGVA 4LF6J 5G0RB 5SUHA 5DG9A 1S7HA 2H9ZA 4ES1A 4J9NA 3P96A 4IH5A 5D77A 2KI2A 2XS7A 3E3XA 2LLZA 4RWXA 1W2BR 4JI7J 5KFPA 5H9EK 3N5BA 1KEKA 3N5FA 2RS2A 5BR8F 4DZDA 2DHGA 2G2OA 3H4BA 2JRSA 4NLOA 1R0CB 3PJWA 3NGTA 1UL3A 4FXVA 3FEXB 2M70A 2WOMA 3KTQA 2NUUG 4ELUA 1FE4A 2KM8B 1CS4B 1WKKA 1VRUB 2YKQA 3VVTA 2HGMA 1SV5B 1NO8A 5A2QU 1FXLA 4A4JA 5FJ4A 3VZIA 4IFYB 4DN0A 2EWHA 1R6VA 3BR9A 1ITPA 1W25A 1K73T 3I9ZA 3OFGA 2HGNA 1ZA2B 3ITHA 1FERA 3UPFA 1FDDA 5DG7A 3PR4A 3X3UA 5K5MA 1IKVB 2OEJA 3CCMS 4J9MA 1RCXB 3HT0A 5KT7A 4ZA1A 2CQ4A 3PEHA 1V3RA 1YJ7A 5C25B 1JLEB 2Y3YA 2E5LJ 1U2FA 2RAQA 4ZVPB 1RBLA 2OPQA 4DSEA 2HIQA 5EDWA 1FWLA 4RNFA 2WVDA 2CA9A 4R8UA 1RAJA 1F9FA 4HH0A 9ATCB 4UZCA 1ZM9A 4N8OA 2RNEA 2YBVA 2OEKA 4PXEA 4O3SA 2B4OA 1N34J 2GV1A 3OFEA 4OYIA 2DT9A 1FK9A 3AA8A 1X4HA 3FK4A 3EPIA 2VFUA 2Z2LA 2DNNA 1N36F 1RDRA 2UUAJ 4HYKA 1DTTA 1LWXA 2EFQA 2R2SA 3H25A 3BM7A 2DPJA 5IFMA 3DLLQ 2AEMA 4UY85 2GIQA 3N01A 2UUBJ 3OL8A 4H4KA 5A6PA 1C0TB 4RUBA 3CCVS 2XWYA 4LJMA 1HNZJ 1BMQB 1BQMA 2Z57B 3LH2S 3BKTA 4OI1A 4RW6A 4EYIB 4AL5A 4PQUA 1HD1A 2ATCB 4RZRA 5AXMA 2JH3A 4KPYA 3DRPA 4DUYJ 1ZM4A 2YX1A 2EC2A 2V2VA 4AUKA 4LRDA 3CD5A 5BYRA 4M5KA 1UA0A 2E66A 1XNRF 3GU0A 3KKFA 2W24A 1HLWA 5B0GA 1KD1T 5A8KA 1JJ2R 5JVHQ 4E8UA 1URNA 2AWZA 2RVJA 2N82B 2K1RA 1QLNA 1JKHB 5DG8A 3GCXP 2DIUA 3M9MB 4LBIA 4P73A 2IA6A 2ZVSA 2UU9F 4AXJA 2HS4A 1E6VA 4X64J 5HANA 2ZBQA 4YDDB 4C8LA 3NNAA 4I2QB 4QR2A 4DJBA 2IJRA 3S7RA 2W9AA 3CCZA 3T3FA 4JI5F 1NSAA 4Y34A 4TYAA 3IWNC 4I64A 4G1PA 4O23A 5K8OA 3MAQA 1IR1A 2DKOB 4OI2A 1QSLA 3K5LA 5L46A 2QA4G 1RACB 3HD2A 1FKAF 4BBYA 2EFPA 1NJYA 5A0YA 5HP1B 2E1PA 1I1GA 3CMQA 4J37A 2HFSA 2JLEA 2K7KA 1O5JA 4UF4A 4X66J 3HFZB 4IO1A 5HMWA 5A8RA 4DLEA 2ZM6F 4ANEA 3PW4A 4DQQA 1SL2A 2AHOB 2FZGB 3FCVA 2ASDA 5HVGA 2DNYA 1CC8A 4B3SF 1SJ1A 1X5PA 4FBUA 3L7OA 4F4YA 2IBOA 3IS9A 2HHXA 2P9EA 4HACA 3HHLA 1S77D 2X3GA 4ZHRA 4ZVEA 4IDKA 2ZNZA 4N76A 5GADU 1H2TZ 1KC8T 3WBZA 4LRBA 5KFLA 1ZBTA 5CXTA 4HDGA 5HVHA 5HN0A 2HRYA 4OI6A 3I5CA 3FVYA 2W1BA 2WW8A 2UZAA 3GV7B 1FE0A 4Y28C 3UCGA 4USTA 2RUGA 2HURA 2PA3A 2L9DA 1AZSA 1HBMA 4PUOA 1FTCA 1TL3A 1SQFA 4P10A 3TZZA 2GFFA 3IBFB 4CLWA 1DTQB 3OJUA 1OSCA 1U45A 2FJVA 1TZ0A 2LU2A 3UR0A 2VA2A 4G1IA 3MMBB 3BGUA 4ED2A 2V8DA 2BE2A 3JQJA 1RWKB 4MJKA 1T05A 1K8AT 5D0GA 5B0EA 4WFAQ 1DURA 2IRYA 4LF5J 1RU2A 4DXLA 3EVOA 2RMLA 1O0PA 3QWPA 1XJWB 2V8PA 3B82A 2PN6A 3DLEB 5D15A 4HI2A 3J81Y 4CTAB 1R89A 5G0RA 2HVHA 1U49A 1REVB 2YQ0A 1PO6A 2HG4A 4R0EA 2W8LA 3V4IB 3GIKA 3MAAB 1WSRA 1GFWB 3JYTB 3AB4B 3FDSA 3S6EA 5JJBA 3QSYB 4OI4A 1ZTTA 4NLSA 1G2EA 1CVJA 4ED1A 3Q0AA 2QO3A 3LUYA 3QT8A 1TAUA 2MMYA 1VFJA 4URSA 1CS4A 1VRUA 1VR6A 4DSLA 4B9LA 4L3NA 2MYFA 5AE1A 3G6YA 1SV5A 4QQBA 4ZPVR 4PWDA 1NUEA 4P7TA 2DB1A 5KG7A 1NLKL 2RQKA 4C2MA 5IC4B 2BUNA 4IFYA 4LF2A 3M1VB 2VBXA 1VQSA 3R7SB 1PSDA 3CJ3A 3RU0A 3A4TA 4BWMA 2GO9A 3EUNA 3R27A 4A8MP 4L73A 5H9FK 2XHCA 3PX6A 3GTYX 2W9CB 4Z2XA 1IKVA 3BJYA 2ZH4A 5AJ3J 3UCZP 5KG0A 3FCHA 2KXHA 2C2EA 2F4FA 4QIVA 3G87A 4MFBB 5C25A 1PKUA 4NMLA 1JLEA 4O3OA 4ALZA 4B17A 4YB6A 1TL5A 4F04B 1BWEA 1V3SA 3LP1B 3Q2SC 4OYZA 2JEFA 2EFOA 2KZZA 3TA2A 3GONA 3DDKA 3CEDA 3OLBA 4WK3A 4QR1A 4K4WA 4KGMA 1NBEB 2GIFA 1KTVA 1DARA 4ED3A 3VCDA 2RRNA 4B3TF 1Y3JA 5KFBA 2HHTA 3H40A 3SV3A 2LFVA 3CIZA 3C14B 1FTRA 5HO4A 2VG6B 6AT1B 1ZZNA 4LT6A 2A2DA 3R1LA 4MKYA 2FTRA 4Q0BB 4Y2MA 4JI4J 4DR5F 4YUDA 1TVRB 3HHLD 1I94F 2K2PA 2F8HA 2DEIA 1OYDA 2RH3A 2C2KB 1HWLA 7FDRA 3TEGA 2MHNA 3JB9k 2WB4A 1IQZA 4J9UE 3ZZZA 2HMIB 1GX5A 2WHOA 1R27B 2E9RX 3JTOA 2QL9B 4DU7A 3TQEA 4M63A 4ZCLA 3MCOA 3KG0A 2VQFF 4DL6A 3HFKA 4CRJA 2FB0A 5MAOA 3AOCA 1C0TA 3VGSA 1WUUA 4K7QA 5B09A 3W5YA 1WC5A 2HRUA 2WTFA 4L74A 1O6XA 5FIIA 1KQGB 1BXNA 2DR7A 4ZLNA 1UA1A 4ZPTR 1LK7A 2FJEB 1BY9A 5IWAF 5AXKA 4KYZA 3OTDA 2AEFA 3EVWA 1XWLA 1L3VA 4ZDNA 2GMLA 4PZVA 3KG4A 2FD2A 4LSLB 4G6VB 1L3UA 1JKHA 3BSAA 4RNOA 4NASA 4M5LA 4OX9F 2XCAA 5EX0A 1FRKA 4ZVFA 3CCQS 2B6AB 3Q89A 1RAGB 2VASA 1B7YB 3R5AA 1NSPA 3FBBA 1TP7A 2IVMA 2CIMA 3DRRB 4I2QA 3KNGA 5LM7E 2MQOA 1VQMS 1N4LA 4KE5A 4ZPDA 2DRDA 1JLAB 2DH8A 4WK1A 1SKWA 4O3PA 2SXLA 2HK2A 2ZVIA 2Y1JA 4GKKF 3VWSA 2BJ8A 2Y1RI 3UDLA 1AROP 3J7Z5 4L6V3 1HWJA 8AT1B 1R31A 4NLVA 1RI7A 4X4RA 1VQ9S 5HP1A 3AHPA 4DFKA 2QJ3A 4FF2A 2VF3A 3AODA 2R7WA 3CD7A 3QRQA 4KV8B 3PCOB 3BSCA 3R8YA 1T8EA 3X1LB 3HVAA 1NPKA 3D2WA 4IOAQ 3NBPB 2VONA 1IJFB 4RLEA 4X4TA 2R9LA 3ELHA 3JTNA 5IM0B 5E7OB 2PGCA 2ACMA 4NCBA 2FHKA 3RAXA 4OZ1A 4F02A 4X65J 3D1OA 4N8NA 1DJ0A 4L72B 1VQ5S 3W8PA 4KC5A 5L39A 2ZWPA 3PYDA 3R2CJ 4QZVB 2CQ0A 2MXYA 2ZKUA 1MNEA 4GVLA 4R0JA 4QW9A 5KFRA 5CH7B 2OGUA 3K7RA 3NOGA 2DITA 1VBXA 2LXIA 2Q43A 1Z4UA 2E5GA 2AJ0A 1HBUB 3VF0B 3IGNA 5KFNA 2GNKA 3HVRA 3GJSB 3KUEA 2ZOMA 1IKWB 4C98A 1WORA 3P8BB 3SSQA 5ETLA 1HQEB 4URGA 5KG4A 4NPOA 1L3SA 1YHQS 4J9PA 2ZBPA 2LQJA 3ZTPA 1YBAA 4X2BA 2J9CA 2ZZMA 4NLWA 3I31A 5L8RC 2ZBCA 3W3SA 2F9DA 1DTQA 1HL6A 2UV8G 2BOPA 1VC5A 2JJ4D 2C2DA 2G2ZA 1SQEA 2FHJA 3CDWA 2IBKA 3UVJB 4CQ1A 3WIVA 2F1FA 3MMBA 5J2PB 3EDQB 3BF4A 1ELOA 2XZTB 4I2PB 1VQNS 1VJWA 3CC7S 3T1AA 2A10A 3L09A 4LF9J 1UVIA 4U7UD 2EW9A 4OHZA 4G1QB 1CQNA 2AD9A 1XIQA 4L75A 1VQYA 4BWJA 3R97A 3DLEA 5CD4A 4LF8J 4WJBA 1VQ7S 4DR2J 2DTJA 4LF6F 1REVA 1N5YB 4ZOSA 3V4IA 3MAAA 4JI3J 4CO4A 4UOGA 3OXLA 3LPYA 1CEZA 5KFUA 1M5PC 1Q16B 5D4NA 4JI7F 4KGVB 1ZPWX 1RWNB 1WKJA 2GO8A 1QUVA 3OV7A 3RBEA 1Z1ZA 3UN2A 2AYEA 3T41A 2XWXA 3HI9A 2VPYB 4K4SA 1RWOB 2G2YA 1Q5YA 3ZC4A 2EKYA 1WHXA 2YQ1A 2VFTA 1I3OB 3GG1A 2DNLA 3MOZA 4J9VA 1ZETA 4A8YA 1Q8KA 1N52B 1LWEB 3RBZA 4YDXA 1Y5NB 2O5DA 1G7CB 5DETA 3BN7A 3AAWB 4DR4J 3LAKA 3M1VA 1C1CA 4M5JA 4YS2A 4LF1A 3GIJA 1S10A 1S79A 4ED6A 4ZJLA 3I5BA 3MM7B 1TTHB 2RUSA 3R6GB 3FFIB 4Y6IA 1RHMB 1JLGB 3IFEA 4CO1A 4DSFA 2W9CA 2XMKA 2CYYA 3AD7C 5IOLA 1OPZA 2K7JA 2G0CA 3MURP 1TKDA 3H2LA 1S9EB 4AL6A 2IM0A 4DCPB 2KFZA 4MFBA 2QG9B 5GAEI 1ZYQA 4K5RA 5LSOA 4Q8FA 5GMKa 3KDOA 3FNNA 4OZ3A 1SKUB 2GGPB 2E5LF 3LP1A 2FLLA 3A3NB 2OMOA 1LW0B 2VV5A 4F0KA 3O3LA 2J9EA 2XC9A 1FDNA 3PXGa 1B7FA 1S9FA 4QU6A 2MY7A 1N34F 5KT2A 4U7CA 4OYXA 1DAXA 3FMWA 1YWXA 3C14A 2KH9A 2VG6A 4DPYA 2UUAF 4IKAA 1TAQA 4Q0BA 2KZMA 1TKXB 4DV4J 1TVRA 1X5OA 1YZ6A 4B08A 1KHVA 4RU2A 1NKEA 4DPWA 2HMIA 4WTYA 1J5EJ 3CIMA 2JNJA 4A8FA 2ZEJA 2UUBF 3SMZA 3KLIB 3FUYA 1RWWB 4ZIWA 4CDIA 2GMHA 5C7PA 1HNZF 3C16B 3U7JA 3RYLA 3W64A 1FCAA 4TYBA 4C8YA 1WOSA 3R5BA 2ZHBA 3LGHA 3U02A 3O2IA 1GTEA 2BRLA 2LEAA 4TKTA 4F4AA 1B0TA 4DUYF 2KHCA 2QMXA 1B70B 2CQPA 4DR6J 1KFDA 2RD5C 4LSLA 4DPTA 4RW7B 4P2FA 2FHJD 1KQSR 3NS7B 1V9OA 3BQ0A 2CPFA 2WVBA 1SKRA 2GS8A 2FJBB 1HMVB 4X4PA 3IWXA 4IFVB 1CLFA 3NXZA 3EGZA 3ILLA 4M5IA 4WZMA 1R43A 3QT5A 1YKWA 2B6AA 2X7IA 2J0QD 3HSJA 2HKEA 1S1TA 2ASYA 3KHLA 4HKQA 4X64F 2HFVA 3DRRA 4ECRA 3C19A 2GMJA 4B3MJ 1UWAA 1JLAA 4HEA9 2FJWA 2HVDA 1JNZB 2A1BA 2A18A 1HFEL 4RU9A 1Q7LB 3SV4A 4LQ9A 1B4SA 1U8WA 1ZH5A 2FVCA 3MECB 2VODA 4IQXA 4USIA 1RBOB 3B4MA 5EWEA 1S49A 3Q8VA 3R2DJ 2MQPA 3EGVA 4OX6A 4Q45A 2CPHA 2WBRA 5L1JA 2F65A 4KV8A 4LF4J 2L48A 2MSSA 4P52A 5BXIA 2BQUA 2H51B 4X66F 3NBPA 3SXLA 5D4OA 3MFIA 4IOCQ 4B9VA 3O44A 5IM0A 1NK4A 1SJFA 4JI0J 2J7UA 3UCUP 2FHOB 3NMRA 2P8IA 2H5EA 2YPZA 1RWUA 3UD4P 3MXHP 3V81B 3M32B 4H4KC 1WHWA 3MCSA 3CNQP 1WF1A 4NLYA 1I5OB 2J7WA 2QRRA 3F44A 3R1HA 1XR7A 4USHA 4BC9A 1TK0A 5E3QA 4OYBA 4WXWA 3CCJS 2DH9A 2GW8A 3HHEA 2CG4A 1HBUA 4RUCA 3DRXA 4KBIA 3UN5A 2W9BB 2E5HA 1GAOA 3LA0A 3ZZ0A 4UZBA 1IKWA 4PEOA 2RHQB 3TJ9A 2CPZA 1N33J 3Q83A 4UQTA 4ANCA 1X0PA 1HQEA 4N5SA 1K44A 4PPDA 4UW2A 2RS8A 3A8IA 3B78A 2JEIA 4UUWA 4IH7A 1XEZA 4FF4A 1X9MA 2PA8D 1YRTA 1NK0A 3DXBA 4RPFA 2V69A 2L08A 2F9JA 3TRGA 5BJRA 5DZ7A 3UVJA 4B3OB 4CH7A 1QUPA 3M6XA 5J2PA 1UEVA 4HL9A 4I2PA 4I6YA 4K50A 1K1SA 5JMNA 2CNNB 3PDNA 3K57A 1FDAA 1IWAA 3BYPA 3MPWA 1IJEB 4DSIA 2W2QP 2EBGA 2H4YB 4G1QA 4LF5F 1FKPB 4Z37A 2B56A 2J6UA 5B0FA 4JBCA 1ZS6A 4NZ7A 4UOFA 5T41A 1FRMA 6FD1A 2Q6CA 1U48A 1S6QB 4WCEQ 3MHYA 2RQMA 4ZVSB 1CQMA 1N5YA 1DFDA 2DBBA 2HBQB 2DGUA 3W63A 2CRLA 5EX3A 2NS1B 4IOBA 3ZZRA 3BPDA 1PJ7A 2CUYA 5CZXA 3HVTB 2CDQA 3UWTA 4ZVTB 1CSJA 4CI0B 3MDFA 1TUGB 1S97A 4KGXB 2OD6A 2QT7A 2Y0SD 3TNVA 2Z30B 3E2EA 4OHYA 2E1MC 1T9XA 3KDNA 3EPGA 2IPOB 2V4RA 4ILLA 3GYXB 3OTEA 4DR7J 1LWEA 2ZJPQ 2CJYB 4PG4A 4KY3A 2LU1A 3BN4A 3HHLC 3DGPB 3NOCA 2NXCA 5AE3A 1WC0A 2L9NA 2OKQA 3OTBA 3HP6A 1PAEX 3ZZTA 1XTZA 3MM7A 2OIHA 4CH0S 4TU9A 1KBRA 4B9SA 3FFIA 4OJ3A 1VHFA 1HBNB 1JLGA 3BDPA 1EARA 1NSQA 1RP5A 4C3KA 1RT5B 2QYCA 2H3EB 4TY9A 1Q82T 1IXKA 4Q44A 1S9EA 3M8WA 3PKYA 5AJ3F 4CLKA 2HAFA 3MMJA 1LKZA 2E1AA 2M0GB 4DV7J 2DY1A 4KAIA 4YY3J 4DSKA 3KLHB 1KRPA 2GGPA 5CZVA 1MMDA 3T5HA 2YQ3A 2HFNA 1LW0A 3W9IA 3UI3A 2YKPA 4QYZJ 2ALYB 3AY0A 1TQLA 1X4GA 3EWGA 2VKZG 3K8WA 4W98A 5M2UA 2RJZA 4GC7A 4QPXA 1PIEA 2YNHB 1R8CA 4QIFA 3KLFB 3D66A 3GPAA 1RZMA 2OP5A 3M2RB 2BQ3A 2YX4A 2HVZA 1IN0A 4CO2A 4F3MA 1U2RA 3H5SA 1TKXA 3HHDA 4JI4F 4C0HA 1Y4ZB 2WK4A 1EIYB 1WJ9A 1V5IB 1NCLA 4PAAA 3DOMB 3K5OA 4CCHA 2V68A 4V1Ak 1H38A 2FJXA 3PX4A 3SCLE 3G9CA 2LCWA 2ILYA 3GB0A 3NGSA 4XTTA 4ZVQB 1QAXA 3KLIA 1WDTA 1XMBA 3Q2TC 1NK8A 2OHDA 4NEYA 1L5UA 3C16A 3W5XA 5GADI 4W4MA 2M8DB 4OFZA 2XY6A 2OUGA 2PT0A 4G65A 1LXNA 1IUJA 3IM8A 2IM1A 3OL7A 5F0UA 2KM8C 5DQGA 1PBAA 3J80Y 5CABA 1Y11A 5KG2A 2O66A 1WC1A 2DCUB 4DL7A 3TZYA 2EC0A 2B9XA 5KFIA 1U09A 2CDRB 4N47A 1HMVA 2XS2A 4IFVA 5B08A 4BDPA 2DNQA 4Q2MA 3UDVA 4PKDB 2HHSA 1WOPA 1JJCB 2EK6A 3GE9A 4CLTA 4D3GA 3BO4A 4NLGA 4DCJB 3DLKB 3O1LA 3T9ZA 2RB7A 1M5VC 3N6LA 3F56A 2N4DA 3M6VA 1RT6B 2VICA 5LMNJ 4I69A 1YBUA 1VCTA 1MMLA 2NSCA 1BUXA 4Y65A 3K17A 1TFWA 2FPHX 3B54A 2ZOGA 4Y3CA 4M95A 3JQMA 3MECA 4NXMF 2K06A 1T0TV 3RRKA 4OMFG 2CG8A 3D0HE 1ROFA 4X4SA 2OAUA 3R7NB 1XR6A 2OJ3A 1XN9A 1IKYB 3US5A 1SXLA 4WYWA 1OYEA 4NCAA 1KQFB 5EGYA 4CP5A 2RIJA 4ES3A 2R2RA 2FY1A 1DHMA 1HBOB 1UZHA 1ZM3A 4ECUA 3PV8A 3H0PA 1NDKA 2MKKA 5LMUJ 1KSPA 4F25A 1TMMA 1IKXB 4X65F 4C8OA 3ADAC 3ZXWA 3DHWC 3QGGA 2FIUA 3CCTA 1ACMB 3V81A 2UU9J 3M32A 3W8GA 4K4VA 4YN3B 1VQPS 3J7A1 3D6TB 4URQU 1NHUA 1LFPA 2XGQA 1G4CA 4NLDA 3D54A 2ZH9A 2W9BA 2FC9A 2F40A 2GVZB 1H7XA 4OV6A 2D3UA 4Y2KA 1FVSA 5IT4A 4TN2A 5DLFA 3DN9A 4RBTA 4GVBB 2I8EA 3LOUA 4O44B 5ETPA 2DR8A 1HR0J 3BSNA 1WG5A 1WTBA 2YWHA 1APSA 1L3TA 1SC6A 1UW4A 4H4OB 4RUAA 2V4QA 1GTHA 1MN9A 2DGXA 1N8RT 2ZBIA 1J27A 2VFRA 4P75A 2B7CB 3CJ5A 4UQGA 2RU9A 2XY5A 5L38A 2VBYA 1LW2B 3OLAA 2GA7A 2DISA 4K4XA 2Q66A 3DI6B 2G0IA 3FBEA 4LF9F 1RTJB 2BXJA 2ZHOA 3RBDA 1WEYA 4YHHJ 3DXSX 1FKPA 1C0UB 4DR3J 2YNFB 7FD1A 3MM5B 1S6QA 2W2PP 3ENQA 4LF8F 4DR2F 1FXDA 4X62J 2AJFE 3H20A 4LBHA 2QC3A 4LFAJ 4TLQA 4F50A 3M7VA 2YKMB 5J2QB 4JI3F 3H2VE 3JTPA 3MM9B 2QA4S 3D0IE 4KKOB 2C2MB 1X4EA 2COLA 4L3KA 3HVTA 2CQBA 3LP0B 4IYQA 3OUYB 3IAM9 4JI1J 4EBEA 1RA6A 1G6BA 4J5OA 1TKTB 1B0PA 3LGNA 4JV2A 5KFEA 3DGPA 1KNZA 2HNYB 4DR4F 2BQRA 2IRUA 2CADA 3IRXB 1NMEB 2JEGA 4WKYA 3LF0A 4WBFA 2M8HA 2CPIA 2R8IA 1TV6B 5KG6A 1HBNA 4PG7A 2R2TA 4WZQA 2MEWA 1NJIT 3V6HA 2FVSA 2J76E 2H5IB 5F9LA 1RT5A 2A2CA 2DGOA 2E1RA 4NMXA 2HQGA 4PG8A 2PEBA 4ENOA 2M7SA 4NXNJ 4J91A 2UXBJ 2X1BA 3QGHA 4J9QA 1GT8A 5IV4A 3KLHA 4AXIA 1SIZA 1UP1A 5E41A 3F73A 5K8MA 3ENVA 2HHQA 5F3TA 1TU0B 1S0NA 3HK2A 3CD6S 5EUHA 2FVPA 2ZITA 2YNHA 5FLXU 3KLFA 5LSRA 3TVZA 2VOPA 3M2RA 2LQ8A 4X4QA 2XO7A 3SFGA 2G0JA 2ERRA 3FBCA 3HHKA 1NZAA 1W2IA 1RHUB 1XERA 4C8MA 2BABA 5A8WB 4DV4F 2MZQA 2YWFA 4XPEA 2VD3A 2XMMA 3D3BJ 3DOMA 5E3PA 4CT9A 4QWEA 1J5EF 1X9WA 2R3VA 1VC6A 3EDRB 2DVIA 2MQQA 2JC0A 4F4KA 1U47A 1JMTA 1MN7A 3RR8A 3UQSA 2EBEA 5E2QA 1SC3B 4A48A 4CO3A 2ZUGA 4WYLA 4OLOA 3L7PA 3T5JA 4CZCA 2FGOA 5E3AA 4GC6A 2OTLS 4DN9A 2BJ7A 1EKSA 3HF5A 4DR6F 5F0WA 4X4NA 1X4DA 5HAOA 5HK4A 3OFFA 4ZITA 1RT7B 4Q43A 1RXOB 2C3UA 1OSDA 2P9GA 1Q4RA 1YRXA 4ECSA 2D9PA 3TUJC 4LFBJ 2NYIA 1BE4A 3NWRA 4JV1A 3L95X 1IBCB 4QYZK 2WCXA 2C1EB 3I0RB 5L1IA 3QJLA 2KU7A 4QIGA 1DQ9A 2Z58B 1JLQB 2QMWA 1QY7A 3VAMA 1ICEB 2QX0A 3SZ2A 4ELTA 3BEGB 1HNWJ 4RNMA 1WG1A 3DLKA 5I4MA 3RB0A 4CLUA 1KVIA 3H5YA 2R8JA 4WWSA 1RT6A 4B3MF 2YY3A 4KB7A 4DL5A 5FD1A 3CMAS 3G6VA 4KPCA 4C7QA 1T3OA 3KUHA 3OL9A 3C6TB 3Q8SB 1F9EB 1UETA 1BQMB 4ID5B 3DRYA 3KUGA 1OIAA 3VVUA 1IKYA 3D28A 3EE3A 1S6PB 2DH7A 4LF4F 3HJVA 1VYAA 1HBOA 3G8QA 4NYZA 1JJHA 2E7WA 4K0KJ 1FNMA 2EXUA 1N48A 3LWMA 3SCJE 1XNQJ 5KFOA 2CJ9A 1KP6A 4TVAB 3T1YJ 2UVWA 3FC9A 4JI0F 4DBQA 2IJNA 1GNKA 1IKXA 3FQKA 3GZ7A 1CPZA 2YWGA 2BACA 1ULRA 4L76A 5U47A 4IR9A 1T3NA 3DU6A 2DYAA 1RLDA 1OQ3A 4PWUA 5KFDA 2NZCA 5HL7Q 5DGAA 4USUA 5ETOA 2HQDA 2ZNYA 2PFFB 2NXEA 3D6MB 1U02A 3DRSB 2BANA 4R25A 4KR0B 4PYDA 3H42A 2CXEA 5ETNA 2GVZA 3G82B 5I3QA 1I51B 3AFGA 4GVBA 2KTQA 4UOCA 3TUIC 1N33F 4O44A 3OD2A 2R7VA 1CULB 3P4UB 5KFVA 4C6AA 4FXWA 3I96A 4U96A 5A0YB 4H4OA 1FRLA 5DDPC 4F4WA 4F3QA 3EZOA 2FY8A 1FXRA 3TW0A 3T5KA 3GR0A 3VAGA 2JVRA 4K2XA 3SYZA 2CPDA 3PM9A 5I3PA 1EX8A 1VGYA 3B6BA 2AEJA 4K59A 4C3LA 1SJRA 1LW2A 1RHQB 5IXUA 4H4MB 3AOAA 3DI6A 4IG3B 3JAMY 3HO1A 1WELA 1RTJA 5HQLA 2CPYA 2VDIA 4NCGB 1C0UA 1HNXJ 5CD4H 3MUTP 2JFKA 2YNFA 2M3DA 3MM5A 1ZA1B 2XS5A 1RWXB 2R42A 4ZK7M 3SQOP 1UFKA 2BJ1A 5IT9Y 1KN6A 4WIIA 4DFJA 4RNNA 1U25A 4ZCMA 1XC9A 1K0VA 1RT3B 2CZ9A 3NLCA 1SKSA 3H8YA 2VQEJ 2YKAA 1TELA 2YKMA 4LRAA 3KMSA 5J2QA 3MM9A 4C4WA 1FF2A 2NUHA 4KKOA 2C42A 3OVAA 3CE8A 5CCMA 4MK9A 3DYAB 1X4AA 3OUYA 2CJQA 3LP0A 1HBMB 3BS9A 4FS2A 3D9BA 3AJ1A 1R8HA 5HBMB 3K0JA 1N0VC 4ECQA 3VZHA 4JI6J 4CLFA 5LOQA 2CJXB 4ZCKA 1TKTA 4XDDA 4DX6A 2M52A 1KFSA 4DR7F 3IP0A 2MZRA 3Q86A 4KO0B 1GQEA 3PHTA 5KFCA 2YPYA 2HNYA 3BV8A 1VLOA 3IRXA 1SQGA 1TV6A 4JYAJ 1FEEA 3E01B 3QO9B 4PWWA 1U2CA 1FRXA 4MTPA 1NK6A 2G1DA 1SH3A 3UNYA 3RJMB 2P5VA 1C1BB 3EVMA 3IMQJ 4U67Q 1NEEA 4F7VA 4GO5X 4NA2A 2FJDB 1LWFB 1I6JA 1YVFA 4DV7F 3UE2A 3WZ0A 1SUQB 4YY3F 3NAHA 4CWBA 1AB8A 3EX7B 2KYZA 4N41A 1PC4A 2JWNA 2MY8A 3G8TA 2RILA 2WZ1A 1UJ6A 1NK5A 3M8SA 2O1PA 1YITS 2LQBA 5BYQA 2PE8A 4X4VA 1FNOA 4C11B 1SIWB 4IG0B 4O3NA 4PWDB 2YH1A 2ZH6A 5A8WA 4DOZA 1X31C 4USJC 2DIVA 2MQLA 1F2HA 5L1KA 2DNZA 3QYYA 2HNZB 1U1RA 3M6UA 1OWXA 2PO4A 4MH8A 2AZ1A 2V63A 3A1YG 2FYXA 4WIQA 4EEYA 4Z7YA 4XPCA 1M1KT 5F8MA 3HJFA 3HT3A 1UFWA 4KTQA 3WHIA 1RSCA 3J81j 1SL0A 1SC4B 1T9UA 1UJ4A 4P7VA 2KFNA 2KN4A 1X4FA 3IA0A 4ED8A 1RT7A 1P1LA 5C24B 1QVGR 4I7FB 3NS6A 1RAIB 4CLYA 2QIFA 3IXQA 3K59A 3PR5B 2PMZD 3OQ2A 3PIPQ 3I0RA 2LA4A 1S48A 5F8JA 3RR7A 3AT1B 1JLQA 2QA1A 2GJIA 3N79A 3FCWA 4Y0FA 2XULA 4ZVRB 2WSEC 2BA9A 3KOAA 4X4OA 3W60A 5GMEA 5LMNF 1TK5A 1KLNA 3GMGA 5CYQB 3S1TA 3M8ZA 3CJTA 3C6TA 2F5GA 3G2XA 1NPRA 3CMES 1JXLA 2W2NP 4ID5A 3T6BA 3QJPA 2JL9A 5M2RA 4KJIA 3GIMA 4ED0A 2V6AA 4OQJA 2EFNA 3BQ2A 1LOUA 1FHTA 1S6PA 2I0XA 4FKXA 1L3KA 1A6LA 4OJ1A 3EGNA 2Z2YB 1QVFR 1VRTB 4O3RA 1JNRB 2BZ2A 4AQYJ 3H59A 1U6FA 5LMUF 5IT0A 1NHKL 5LXYA 2YWEA 2D7SA 3GSIA 5A2QY 2AMCB 2VBWA 1HPZA 1JIHA 3OTOF 3CJKB 1Y0HA 5ITHA 3VTIA 3L3CA 1XMOJ 4WP9A 5HI7A 2MJNA 2BKOA 4TQRA 1N54B 4QW8A 4DUTA 3ETOA 3DRSA 3G6ES 3CCES 5KOWA 3UR3C 1YJRA 2GJ2A 4YOEA 1Q7YT 3FRYA 3EGWB 2V67A 5DDQC 3I55S 3G82A 2CQHA 3KK2B 4JV0A 2MLYA 1CULA 1HR0F 1DZ5A 2H1YA 3NCPA 2IC3B 4HTJA 2XLKA 1HQ2A 3PKMA 1OMSA 1HD0A 1E6YB 4UUXA 4ECVA 2PSZA 4DF8A 4KHMA 5I42B 5KFZA 1U0SA 1WF2A 3QBCA 1U24A 2VC0A 3HXMA 1H74A 4RW4B 2MDAA 1ZAVA 4LSZB 1SPBP 2IAJB 4QWAA 4FYXB 2DK2A 4FZVA 3PYFA 4U6PA 3PTWA 4EBDA 2NZ4A 3BYRA 4H4MA 2GQQA 4M5HA 4IG3A 1FWPA 4YHHF 4NCGA 3A8EA 2HEKA 2UXDJ 3OPKA 1RE1B 3I82A 3DMJA 5E5NA 1QTNB 4NLRA 3UD3P 3CJ4A 4DR3F 2NQPA 1NPPA 2ASJA 2RDIA 2AP6A 4IRKA 5DDOC 2AX1A 2OO4A 1GXTA 2LEBA 1RT3A 2C22A 1QAYA 4PABA 2C2NA 2QL7B 1A0OB 4X62F 3W9JA 2OEMA 4ZPCA 1M5KC 4LFAF 3VALA 2LXFA 5AXLA 2XB2D 3PO5A 2VJUA 3MAHA 2KXNB 1BD6A 3CD0A 4FVCA 3DYAA 3ZZPA 4GMKA 2DY9A 3QATA 1U0HB 3DDNA 4TU7A 1RTDB 2BX6A 5HBMA 1OY8A 4DV5J 4JI1F 2OMLA 2FLOA 3ULHA 3QRPA 1X8DA 5AT1B 3BO2A 3WQPA 2B8PA 1TK8A 4KO0A 4I68A 5AE2A 1MWQA 4NZ0A 2YKOA 4OX7A 2QLBB 2OSRA 2IRXA 3PRVA 2KB2A 4OIXA 3CUNA 3WC2A 2KO1A 5EHHA 1FRHA 2F4VJ 2CWKA 1WC4A 3I87A 4F67A 3PHEA 2HLTA 3QO9A 3E01A 2HHHJ 3GG0A 3CCSS 1CJVB 4ZLLA 3T5LA 5J1EB 2E29A 1Y3KA 4MIWA 2WW4A 1C1BA 1QJHA 5D0RA 4LFCJ 1LWFA 4NXNF 2V8VA 1NK9A 2UXBF 1RT1B 3I6PA 3FKBA 1SUQA 2RU3A 1Q86T 2HS3A 1RHRB 4JI2J 2PMWA 1M5SA 1AT1B 3W2VB 4TXSA 1YK9A 2NXJA 2XSJB 2B4PA 5LSLA 3NEKA 3H98A 2UUWA 4OV1A 3PEJA 2MQMA 1HW8A 1HWUA 2BYCA 2GHVC 4DUZJ 2V5HG 1SBRA 3KFWX 3KJQB 4NYOA 4C11A 2XMVA 4IG0A 4MK8A 4DSJA 2C2ZB 4O4GB 2CQ1A 3G71S 4YB7A 5D4PA 4ERDA 1KHWA 1NKBA 1C1CB 1VLYA 2AYBA 2R4FA 1UVNA 2XYGB 2HNZA 3DFEA 1AFJA 1KS2A 3AA9A 2Z2MA 3N9UC 1VOMA 1VQ4S 4WF9Q 4QR0A 3VAIA 5HROB 3GILA 1N0UA 4U9RA 2OH2A 3TP2A 3AXMA 5B0BA 2BE7D 5KFGA 3HKWA 2XEXA 2WVFA 2IFXA 5K8PA 2Z4PA 2QV6A 5KT3A 3TAPA 3HX9A 3THTA 1T94A 2O3DA 3FRZA 1UVMA 4DFPA 3BGOP 4TNOA 2CNLB 2QFIA 1WOOA 1K1QA 4ATNA 4W92B 5JVGQ 3FMBA 4FYWB 3CJ8A 2DNMA 4ILRA 3SEOA 3ONQA 4EBCA 4F36A 4B9MA 4U7UK 5C24A 1TL1A 5K8NA 4I7FA 2HZVA 2GC8A 1IM6A 4LFBF 5F8GA 2HQIA 3UFCX 5D78A 5SZTA 3CDBA 4IRDA 1D0EA 4PRFA 3CTRA 3N0VA 1KQKA 4DPUA 1FI4A 1SCJB 1HNWF 1M5HA 2XO6A 3ZTSA 2AJ1A 1VK8A 1IWGA 4DV0F 4NL5A 2H54B 2HFZA 1R3NA 1EZZB 5CYQA 5DLGA 4ZVHA 3DLGB 2MZTA 1RQ0A 3U27A 4DWIA 3AD9C 2AIRB 2VFVA 3GFYA 4O0NA 2R7QA 3IGVA 3CJ2A 1ZZFA 4RW9B 4J9OA 1H72C 2AT1B 3DDIA 4ZN1A 1U1KA 4KH0B 2DRAA 4DQRA 3QRRA 5C2CA 3IBCB 1XQIA 2L3MA 4DX8H 4DFMA 1VRTA 4K0KF 1IVZA 2GHWA 3MMCB 1XNQF 2GZOA 5IS2A 1JWWA 3T1YF 1N32J 1X60A 5HVFA 3EMTA 3ZNUA 2BDPA 2CNOB 3SCIE 3RB3A 1UPMB 4QIWD 1NB2A 3U1NA 3QT7A 4NYPA 3CJKA 3GCWP 2J0WA 3IWLA 1VIXA 1S1TB 3A13A 2DHSA 4F4ZA 2CJAA 3R6LB 4FP9A 5L9XA 4DPXA 1N6QB 1S76D 1JQGA 3M9OB 4QYRA 2QYGA 3PACA 1K0TA 3FSXA 1GH8A 3CCRS 4J9RA 1FFSB 2YWWA 5KFWA 4DMZA 5HATA 2YNIB 4ED4A 1GX6A 1WEXA 4OZ2A 4NXMJ 3KK2A 3PW2A 3HKZD 4KHRA 3ILOA 5GAEU 2QLXA 3T6JA 3THPA 2OFGX 3RW6A 5DS7A 2IC3A 1EQMA 3KWMA 2IM2A 2RT3A 2MPUA 3W5ZA 1E6YA 4XIUA 1RWVB 5I42A 3DLBA 5HLFB 4QJVA 2MKYA 3QJJA 2FDNA 4RW4A 2JLFA 1NXIA 3U1LA 2ROPA 5GVQA 2IAJA 3C15B 1VBYA 4M5MA 2V9WA 2N4CA 2ZD1B 4H54A 3Q23A 2Y0BB 4BS2A 2YWKA 2I38A 2XBPA 1JXVA 3IO1A 1MSWD 3R5DA 2DNRA 3M2VB 1HIYA 1F3FA 4Y2IA 1HNXF 3MCNA 2XLJA 4WFYA 2EEYA 2E1CA 4PCQA 2NLWA 1R6YA 2ZBRA 1CJTB 1X5TA 1UW9A 3TZXA 2VQEF 1G3OA 1GMWA 2DCLA 2ACYA 2AZ3A 2OTJS 2JX2A 5HMZA 3KHHA 1Y5IB 3T9NA 2I1RA 1U0HA 2I5JB 3P49B 1RTDA 2DNKA 2QTWA 5KT4A 1KTQA 8RUCA 3EZUA 3L4BC 3JSMA 2FVRA 4JI6F 4A8KA 5BYSA 4F0HA 4EUVA 1B99A 4DHVA 2G9OA 2H65B 5DM7Q 1NJZA 3LGMA 3JSYA 2Y9HA 1HHQA 4ZVGA 3KK1B 5A6WA 2C28A 5GAHI 1YX2A 2XTJP 4OHXA 1RAOA 2KRBA 4IUFA 3OVBA 1GXUA 2AJ4A 2IY5B 3TZWA 3LW5C 5ADZA 4LRFA 4JYAF 2J5AA 3O5TB 4ZVUB 4P2SA 1F0XA 4WFXA 3PX0A 3GYNA 4FNIA 1CJVA 2C2OB 5J1EA 3FZBA 1R7IA 2QGFB 3QAEA 4FXDA 4FYDA 5FDLB 3PVXA 4TLRA 5I3UB 1RT1A 2B43A 1XMQJ 3R3TA 2QE5A 1BQXA 4DX7A 5F8HA 5DQHA 1R0BG 2H5JB 1FJGJ 4ECZA 1N5TA 1MW7A 3W2VA 2XSJA 3OHBA 3KLGB 2N7CA 3CCUS 2OLWA 2APOA 3DLHA 2C3YA 3PW7A 2BBEA 4OHVA 4FNHA 2XMJA 3IR7B 2FZKB 3N6NA 1J5OA 5KT5A 1VQ8S 1V5VA 4CLZA 4O4GA 2BW7A 3CDEA 3TYTA 4QPTA 2V34A 4KT0C 3UDEA 3NRBA 3VV2B 3TX0A 4EO6A 4DX5A 4A8OA 5D0EA 2AU0A 3DC2A 4MKAA 3J7YU 2DGTA 2HGLA 3MTKA 2HWTA 3AJ2A 1UTAA 5CQGA 3M8QB 5HROA 1U6ZA 2H4WB 2HNDB 4P2XA 3WDOA 1H0HB 1IR0A 4Q7AA 3NGDA 5ETMA 2KT3A 2HYIB 2G13A 2J8AA 3PYEA 2HWIA 1WNEA 3CC2S 1R8AA 2X1AA 1FJEB 2BV3A 2DGVA 4KHPJ 3VAFA 1HQUB 3G8SA 3HZGA 3MM8B 2F3JA 2JEJA 2BOAA 3NP5A 3LANA 3I4HX 2MKSA 2QLWA 2HHPA 4QBUA 4QCLA 2FZCB 5F41A 4PG6A 5KFQA 1FD8A 2LMIA 4ECTA 2IVYA 1PYSB 2MLXA 4DG1B 2AGQA 2BJDA 3J7AN 3MPDA 3I9V9 2WBMA 1SJQA 3BQ1A 1KVJA 4EZ9A 2HBZB 3NY0A 1VK3A 4TY8B 4ETZA 2WONB 3E8OA 2VOOA 3DKDA 5D3GB 2B7BB 1FJ7A 4ECYA 3C3LA 4EGLA 2CPJA 3DLGA 1UCNA 4UTGA 1GMWD 3PY8A 3A8KA 4DPOA 1Q53A 3M2UB 2ZDOA 2ASLA 3MFHA 1AUSL 3QQCD 5KFHA 1YGYA 4RW9A 4FF1A 3AJDA 1BHNA 4P74A 1CJUB 5B0CA 3I4PA 3M6WA 2FQQB 2A0FB 3U1MA 3TANA 1VQKS 4DEZA 1RT4B 1HARA 4FYVB 1RJJA 2XMTA 3ISZA 3W61A 1T7PA 3MMCA 2DPIA 4MAKA 2CWXA 1RISA 3OT9A 4XK8C 4J9LA 3OR2B 4J9SA 4AQYF 2C3MA 3P5TL 1HNVB 1VC0A 2HAIA 2PDAA 3HCXA 3B4DA 1CBKA 1REGX 2ZFHA 3DOKB 1XMOF 2OPPB 3TO8A 1N6QA 1U7LA 4DU8A 3OSPA 2X3DA 2MB0B 4CYUB 3G6XA 1B64A 3TVYA 1Y9OA 4OL8A 2YNIA 2QEXS 4OJGA 2RQ4A 4NWBA 3MUMP 3D3CJ 1YJNS 3CCWA 3I56S 3J81U 1RK8A 4YQWA 2EFVA 2OD4A 1T03B 3UW1A 3A3OB 3QFWA 5IQ6A 4TQSA 3MR2A 1RT2A 3TUZC 4CH1A 4ILMA 1Q95G 2Y8WA 2FJAB 5HLFA 2BJ9A 2MKCA 1KLMB 2XCPA 1T02A 1NJWA 1EETB 2GIRA 4B3RF 3MI7X 4Q8EA 1UJ5A 2JZ5A 2XHWA 4LUBA 4I67A 3C15A 8ATCB 3G86A 1FNXH 4MIAA 1RAFB 2I6WA 2VG7B 2ZD1A 3P45B 4ZP9A 2B5JB 5GAGU 1KWMA 4ZLPA 2PC6A 2MGZB 5KFKA 3M2VA 4RBVA 1DY3A 2BEFA 2V50A 3C6UB 4ZPWR 2A3JA 3HZEA 4CT8A 2UXDF 1NDLA 2RHSB 2YKNB 1Q8IA 3MR7A 5LL6d 4CO0A 4O3QA 1FKOB 4MIBA 1CJTA 3AOBA 1NDPA 3BGFA 2YVSA 4AE5A 5LJ5Y 1H7WA 2B0GA 2DR5A 1BGXT 3POTB 1X4CA 3D0GE 3ISNC 2I5JA 3SI8A 3DM2B 1S6UA 1WDDA 1UEUA 1LWCB 3IR5B 4UY8T 4DV5F 1MWZA 5J2MB 4DS4A 5K14B 2A6OA 1V3ZA 5E3CA 4I56A 1FJCA 1MMNA 2BVZA 3RB6A 3MPYA 3QIPB 1HHTP 3AH6A 4LF7J 3V6KA 1EKRA 2XGPA 1QE1B 2DGSA 4MK7A 5IV3A 3C2PA 3S8SA 4LREA 3P6YC 1T9VA 1BQNB 1RADB 4ZPBA 3KK1A 4WFZA 4I6AA 3BB5A 1PGZA 1R8PA 3ICLA 2G1HA 1F2GA 3R5JB 1YTYA 1QSYA 3TA1A 1H3DA 2F4VF 1M1HA 1FESA 2BR0A 3OTCA 2VKRA 4PYAA 1DQAA 2HPUA 3HSZA 2RDJA 3TAMB 4EYHB 2HHHF 3GWCA 2DNGA 2DGWA 1D1UA 4MMOA 4MKVA 3TQ1A 1KONA 2BKPA 5FDLA 1JXEA 4LBPA 3GJRB 5I3UA 2JDJA 4LFCF 5EWFA 2YH0A 1YJVA 3I5AA 1SI9A 4YB1P 5HMYA 1HW9A 4LQ3A 4JI2F 3QAUA 2NCKL 1WSVA 2EG1A 4NX9A 1RB0A 3KLGA 3BKFA 4EI2A 2LDIA 3KG1A 3DNCA 1AXQA 3M8RA 2XYPB 4OZJA 3AB2B 2MHEA 4DUZF 2KKHA 1JB0C 3TI0A 4WPAA 3MD3A 2VIHA 4DDFA 2W2MP 2DNPA 2UXCJ 5DGBA 4USMA 2FLNA 2RRAA 4DQPA 3ILIA 1RHKB 1UFLA 3UNGC 1RLCL 3W62A 2WVEA 3M05A 2D69A 3D67A 3M8QA 2J8SA 1N88A 2HNDA 2GCFA 4LR7A 3K5NA 5G4DA 2W7OA 4OI3A 2F63A 3Q24A 4ED5A 5ETSA 1CJKB 3RAQA 5DJBA 4I6WA 1SVDA 4JI8J 2ADBA 5B7WA 3K5MA 3D4JA 2R7XA 1YQHA 3FEZA 1RKJA 1U6BA 2DXEA 5T7LB 3C8YA 2CQ3A 4HR2A 1HQUA 3FGVA 4KGKA 2IVFB 3MM8A 5HQ8A 4ZVOB 5E0OA 2D3OR 1AA1B 2ZUAA 4B02A 3FSIA 1NH8A 1S12A 3PNIA 2VHGA 1QDUB 4ES2A 2KJVA 1QM9A 3T1HJ 2KT2A 3NAIA 4YB5A 2Z8QA 3QWUA 1P9QC 4ZS6A 2CJBA 3NNCA 4DG1A 1MU2B 2W8KA 2FHMA 2XMWA 2HRTA 2VZ9A 2BMBA 4TY8A 2JC1A 3RG6A 2WONA 2V8GA 4YR2A 3ZO7A 2ZH5A 5D3GA 3HMJG 2RDDA 1TUWA 4OYOA 1WI6A 3GFZA 2NXNA 3TJAA 2Z0GA 4FDFA 5D0HA 2Y1IA 3RRHA 3M2UA 1W26A 1S0VA 4F3OA 4WU3A 3HLUA 5J1NA 2EVZA 1PILA 3PJXA 1CJUA 4O0IA 1QAIA 1HI1A 4J90A 4NOHA 4YP3A 1YG0A 4XAKA 1R0AB 4RR5A 3D7SB 1D8YA 1M90T 3JSBA 2R8HA 1RT4A 3P3DA 2HHVA 4EMDA 1URRA 1IR2A 3VGUA 4ETXA 1MG7A 1U26A 2IHR1 4EK2A 1XR5A 4A8WA 3KXDA 3OR2A 1VQLS 1N32F 1YDLA 4KRWA 2CQDA 2OSQA 1HNVA 2NSBA 3LWLA 2MKJA 2YNGB 4WE1B 2WB1D 1JK9B 4KH1B 2N7YA 1P9YA 1DRZA 3DOKA 4LR8A 3GIRA 5LT5A 2OPPA 2VFSA 4CYUA 2WSCC 4DL2A 2CQCA 1KKHA 3MEDB 1D9AA 5C42B 1HNIB 4Y00A 2CQGA 5KOXA 1UPPA 2M9KA 1Y10A 2KVIA 5CAAA 1T03A 2Z2ZA 2DHHA 2ZH8A 4ICLB 7AT1B 2UUCJ 1KLMA 2ZE2B 1DLOB 1EETA 4KIAA 4WP3A 4PXBA 3FJ2A 3S01A 4ZPAA 2KDOA 1LQ9A 1NDCA 2RSQA 4IQMA 1J2VA 1RHJB 4LSNB 3GV8B 1QD1A 2DEJA 1PCAA 2VG7A 1UVKA 4NLUA 4NLXA 1VRQC 2B5JA 4BHQA 2QSFA 2MGZA 5E3RA 4IRCA 1O51A 3C6UA 3L7UA 2GJFA 4OLPA 3MZIA 3OTOJ 2R8GA 1VISA 3IR6B 3KK3B 3AXKA 2YKNA 1JLBB 4V19J 1Q5VA 2P6SA 1VI7A 2IDLA 4FKYA 2CPXA 4NEZA 3TX8A 3H7HB 1OY6A 3MTJA 1FKOA 2ZH7A 2D3ZA 2BANB 3OR1B 2DXFA 3QLHB 1S6OA 4OJHA 1S99A 2M2BA 2BM0A 2GVDB 2KL8A 3ETMA 3POTA 3KLVA 1T9TA 1S4FA 3LQVA 1NJXA 3DM2A 4JUZA 4Q5VA 3NNHA 1LWCA 1RKIA 3R5GA 5J2MA 5K14A 4NA1A 3MPUB 2HIYA 2B9EA 2M88A 4R5PB 3QIPA 5CHCB 2EKNA 3UO0A 4EWTA 5HJYA 2XNQA 4CLPA 1QE1A 2IA0A 2XYHB 1FWKA 4NRUA 2UV8A 1BQNA 4YMEA 3T19A 3L9ZA 2HZCA 1UVLA 2FVQA 2J6TA 1X9SA 5J2NB 4ECXA 2V9KA 1P8GA 4AT1B 4BC7A 2V2ZA 3OSNA 3CO0P 3EYZA 4N77A 3TAMA 4OZ5A 3I0SB 2YXLA 1S1WB 2MZSA 1QAJA 2DO4A 2LECA 1FX4A 3F41A 1T11A 4ZN3A 4ANDA 1JX4A 3BGRB 4FPRA 2QN6B 2F8EX 1OO0B 5AXNA 4DQIA 1PAUB 1LXJA 3TR5A 1RTIB 1HKAA 2HBYB 2J9DA 3IBWA 2BJEA 2DNOA 3IRWP 5F9NA 1XMQF 1YJTA 1WTFA 2UUTA 4CM2A 3PZPA 3HULA 3GJTB 4CTAA 1FJGF 1TFYA 4XO0A 1AUDA 3JYTA 1EP4B 1H98A 4KSEB 3NKYA 3RTVA 4M5NA 2HVIA 2X1GA 4ZKAA 3E51A 3Q8RB 4OYPA 3SDEB 2MJUA 3LAMA 2ZHAA 1BWVA 2CVIA 2C3PA 1VS3A 2JOQA 4I1TA 1NZ8A 3J7ZT 5ETTA 1TUVA 1WF0A 4KGZB 2P2CB 2OPSB 1FT8A 2VL1A 4OYMA 1F9HA 1NNDA 2LEPA 3MEKA 1SJ3P 4DV3J 2CQ2A 2ALZA 1A9NB 1S59A 1WI8A 1CJKA 4PPZA 3MOJB 4DV2J 2DR6A 5JXSA 5LJ3Y 1V6HA 4C0OC 2NYHA 1WC6A 1GK8A 5T7LA 4MT1A 4NE9C 4TU8A 1YJUA 4JOUA 3TJ8A 2HW3A 2P6TA 3GQCA 4KHPF 2GQCA 2ADCA 1HYSB 1C2PA 1F5AA 5F8IA 4OI0A 2R7UA 2E7VA 2AGPA 2B4UA 2O67A 1ZAWA 2M4MA 5KFMA 1P6TA 1IBLJ 4EU0A 1X5SA 3CC4S 1YJ9S 4YR3A 1Q8LA 2QMUB 4DZ6A 5L1LA 3BGLA 2LYVA 3TOQA 3OHAA 3PRBA 4Y2AA 1Y00A 5KT6A 1RAHB 1MU2A 2LQ9A 2G4BA 1WC3A 1RTHB 2R8KA 2IJFA 2PI4A 3KYLA 3PW0A 2KT5A 3D6FB 2RKIB 4NLPA 2DO0A 4DL3A 1FD2A 5C2GA 1UKUA 3H90A
chains in the Genus database with same CATH topology
4ATNA 1JLEB 1H6KX 3NCRA 4W92B 5JVGQ 3FMBA 2CZVC 3VR1A 1U2FA 2DNMA 4ILRA 2OPQA 3K5OA 3SEOA 3ONQA 4DSEA 2HIQA 4CCHA 1F5CA 5EDWA 4EBCA 1Q8BA 1H38A 4WKRA 4RNFA 2EG2A 2FJXA 4R8UA 4B9MA 3PX4A 1RAJA 4U7UK 1F9FA 5C24A 1TL1A 5K8NA 3SCLE 4HH0A 5F8NA 1FEHA 1CC7A 2IMWP 3G9CA 1ZM9A 1H2VZ 2LCWA 2ILYA 4I7FA 4N8OA 2GC8A 2RNEA 3GB0A 2QA2A 1QAXA 3KLIA 3SQGB 4A47A 4O3SA 4PXEA 2B4OA 4LFBF 1XMBA 5F8GA 2HQIA 2LVWA 3UFCX 3Q2TC 2GV1A 1NK8A 5D78A 3OFEA 1H2UX 2DT9A 4C3MA 1FK9A 1X4BA 1L5UA 3AA8A 5SZTA 1X4HA 5GADI 3TAQA 3CDBA 4IRDA 1QSSA 2CPEA 2VFUA 3EPIA 2Z2LA 2DNNA 1D0EA 2ROGA 1N36F 2M8DB 4PRFA 1RDRA 3CTRA 1R0AA 5D6GA 3N0VA 4LIWA 4OFZA 1KQKA 1PC5A 5DRKA 2XY6A 4HYKA 2PT0A 1DTTA 2EFQA 2FUG9 2R2SA 3M8PB 3H25A 1LXNA 1IUJA 1M5HA 1HNWF 1TKZB 2E9ZA 3BM7A 5EWGA 2IM1A 3H4DA 3OL6A 2AJ1A 1VK8A 3OL7A 2DPJA 5F0UA 2KM8C 4DV0F 5DQGA 5IFMA 2AW0A 3J80Y 4NL5A 2HFZA 3DLLQ 5KG2A 1R3NA 2O66A 4UY85 4RW8B 2DCUB 4DL7A 2EC0A 2XG8A 5CYQA 2B9XA 5DLGA 4ZVHA 1U09A 5KFIA 3DLGB 3NMAA 2GIQA 2BRKA 2MZTA 2C3OA 3N01A 1RQ0A 2E5IA 3U27A 4DWIA 4N47A 2VFVA 3GFYA 2YNGA 4WE1A 3OL8A 1HMVA 1P27B 4H4KA 2XS2A 4IFVA 5A6PA 5B08A 2R7QA 4BDPA 2DNQA 3IGVA 3CJ2A 1C0TB 3CCVS 4Q2MA 1ZZFA 2XWYA 4PKDB 2KG0A 2HHSA 2AQ4A 4LJMA 4RW9B 4J9OA 2EK6A 3V5RA 2DR9A 3GE9A 3V2UC 1BQMA 1ZM2A 2U1AA 3LH2S 4OI1A 4RW6A 4EYIB 3O8WA 2EPIA 1U1KA 4AL5A 4FS1A 2DRAA 1Q1KA 4PQUA 1HD1A 4DQRA 3ZZUA 4D3GA 4RZRA 5AXMA 3BO4A 1VIOA 5CYJA 2JH3A 1FDBA 4NLGA 4RNHA 4KPYA 3DRPA 5DQIA 1ZM4A 2L3MA 2YX1A 3DLKB 3O1LA 4NZ6A 3MEDA 4DX8H 3T9ZA 4AUKA 5C42A 1WACA 2KRRA 4DFMA 1YJWS 1VRTA 4QU7A 2W7AA 3CD5A 2RB7A 5BYRA 1M5VC 4K0KF 3N6LA 3F56A 1HNIA 2N4DA 3M6VA 2OPRB 1UA0A 1U4BA 1RT6B 4QOTA 2GHWA 3MMCB 2E66A 4I69A 1XNRF 1XNQF 5M2PA 5IS2A 1MMLA 2NSCA 1JWWA 2AJQA 4Y65A 1TFWA 3T1YF 4AFFA 2FPHX 3KKFA 2W24A 2W4DA 3SFUA 2XY7A 2ZOGA 4Y3CA 2BDPA 5B0GA 3SCIE 3MECA 3RB3A 4M95A 1KD1T 5A8KA 1JJ2R 4NXMF 5JVHQ 4E8UA 1URNA 2AWZA 2RVJA 5IQQA 2K1RA 2N82B 4ICLA 4QIWD 1QLNA 1JKHB 3U1NA 3RRKA 4OMFG 3D0HE 4NYPA 3CJKA 5DG8A 2DIUA 1ROFA 3M9MB 3RZAA 2J0WA 3IWLA 4I0WA 4X4SA 2R7SA 1VIXA 1S1TB 2OAUA 2F7VA 2DHSA 2ZE2A 1DLOA 4F4ZA 3MR5A 1XR6A 2CJAA 4FP9A 5L9XA 3HM9A 2RQCA 1KR4A 2ZVSA 2IA6A 2OJ3A 1XN9A 2UU9F 1IKYB 4AXJA 3US5A 1SXLA 1N6QB 1S76D 4OHWA 1YI2S 2HS4A 5FLXY 4WYWA 4C9DA 1E6VA 4NCAA 1KQFB 5EGYA 3M9OB 2RIJA 4K4YA 4ES3A 4QYRA 1S72S 4YDDB 2R2RA 2FY1A 3PACA 4C8LA 4LSNA 1DHMA 1K0TA 3FSXA 1HBOB 1GH8A 3CCRS 3NNAA 4J9RA 4I2QB 1ZM3A 4QR2A 2VPZB 4ECUA 2ROEA 4DJBA 2PI5A 5KFWA 4DMZA 3S7RA 2YNIB 2W9AA 3HVWA 3CCZA 3M9NB 1GX6A 3T3FA 4JI5F 3PV8A 1WEXA 4Y34A 4TYAA 3KK2A 3IWNC 2MKKA 3PW2A 3HKZD 4KHRA 1KSPA 2W25A 1HPZB 4F25A 4I64A 3RAMA 4G1PA 4O23A 5GAEU 1IKXB 2IMOA 1SL1A 2QLXA 5K8OA 4X65F 4E98A 3MAQA 3KK3A 3T6JA 4C8OA 1JLBA 3THPA 2OFGX 4W90B 3RW6A 4OI2A 3V6DB 1QSLA 3DHWC 5DS7A 3QGGA 2IC3A 3K5LA 2UVRA 2FIUA 3KWMA 2IM2A 2RT3A 3CCTA 2QA4G 2MPUA 1E6YA 3V81A 3M32A 3EXCX 4XIUA 1FKAF 5I42A 3DLBA 4K4VA 4BBYA 2EFPA 1NJYA 5HLFB 4QJVA 3QJJA 3OR1A 2FDNA 5A0YA 4C97A 3QLHA 5HP1B 1VQPS 3IAS9 1I1GA 3J7A1 3J7YI 4RW4A 2XI2A 2JLFA 4J37A 4K5SA 4URQU 2VA3A 2JLEA 1NHUA 1LFPA 2K7KA 3U1LA 2VC1A 2ROPA 1O5JA 5GVQA 2XGQA 2FC8A 4NLDA 2EI5A 2IAJA 1VBYA 3D54A 2V9WA 2BM1A 2N4CA 2ZH9A 4O4RA 4HI1A 4IO1A 2W9BA 5HMWA 3QGIA 5A8RA 2FC9A 2ZD1B 1WHVA 2Q6BA 4H54A 3Q23A 2F40A 4BS2A 2YWKA 1YIJS 2I38A 1S1UB 4DLEA 2ZM6F 3PW4A 1H7XA 4DQQA 1SL2A 2XBPA 3IO1A 2CVEA 2D3UA 3R5DA 4Y2KA 1MSWD 3OJSA 1FVSA 2DNRA 2XI3A 3M2VB 4TN2A 5IT4A 5DLFA 3DN9A 4RBTA 2I8EA 2I9SA 3LOUA 4RUHA 4O44B 1NU4A 3GV5B 4Y2IA 4LMZA 2ASDA 1D3WA 2DNYA 2DR8A 1CC8A 3BSNA 4B3SF 1SJ1A 1WG5A 4AYBD 1X5PA 1HI0P 3L7OA 1WTBA 1HNXF 4FBUA 4IR1A 2YWHA 4R5PA 2AGOA 4F4YA 3NG8A 2IBOA 1APSA 2MZ1A 3IS9A 2HHXA 1L3TA 1SC6A 1UW4A 2XLJA 4WFYA 4H4OB 4DL4A 2P9EA 4RUAA 1S77D 3HHLA 4LF7F 2E1CA 4PCQA 2V4QA 2NLWA 2X3GA 4ZHRA 5JUMA 1GTHA 2KHDA 4ZVEA 1BC6A 4IDKA 1R6YA 4HLBA 1SB6A 2ZNZA 4N76A 1X5TA 2DGXA 5LXRA 5GADU 1N8RT 2ZBIA 2W4PA 1H2TZ 2VFRA 4RKUC 5J2NA 1KC8T 2VQEF 1ZTWA 1G3OA 2GHPA 2DCLA 1OPIA 2B7CB 3WBZA 4ITSA 2ACYA 3CJ5A 5KFLA 1ZBTA 3W2WB 1S9GB 4HH1A 4UQGA 5CXTA 4HDGA 2RU9A 2OTJS 2XY5A 5KFXA 5L38A 2VBYA 1LW2B 2JX2A 2KYXA 5HN0A 5HMZA 3OLAA 1Y5IB 2GA7A 4KQZA 2HRYA 2DISA 2I1RA 3BZQA 3DU5A 3T9NA 4DL0C 1XBWA 5DM6Q 4K4XA 2Q66A 4OI6A 2I5JB 3P49B 3DI6B 3I0SA 3I5CA 2ZJRQ 3DMJB 2DNKA 5KT4A 1RTDA 3FVYA 1HHSA 1KTQA 2WW8A 2UZAA 1S1WA 1FE0A 3GV7B 4LF9F 4Y28C 1RTJB 3UCGA 2BXJA 2ZHOA 2YTCA 3RBDA 3EZUA 3JSMA 2RUGA 1WEYA 1S1XB 1Y7PA 4RBUA 3DXSX 2FVRA 4JI6F 2PA3A 2L9DA 1FKPA 1HBMA 4NLTA 4A8KA 4PUOA 1C0UB 5BYSA 3BGRA 4EUVA 2YNFB 7FD1A 3MM5B 4DHVA 4CIOA 1S6QA 1RTIA 1FTCA 1TL3A 2G9OA 3ENQA 4F8RA 2GFFA 4LF8F 5DM7Q 1NJZA 3DLJA 3LGMA 4OZNA 4FVMA 4DR2F 3JSYA 1FXDA 3ZFVA 4ZVGA 1SH0A<