3CC2S

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cc2S00
2GHPA 3MD3A 5DM7Q 1WTBA 2DGQA 1VC6A 2JVRA 2OSQA 1D9AA 1VQ4S 2RS8A 4LMZA 1QVFR 3BO2A 2B0GA 3THPA 3U1LA 3ZZYA 2DHSA 1K73T 2AYGA 1KOOA 1WG4A 3UWTA 1WI8A 2PE8A 1U1RA 2UP1A 3R1LA 1W2BR 4WIIA 2MZRA 1G2EA 2RVJA 2YH1A 3SXLA 4TU9A 1M1KT 3K0JA 3J7ZT 2KG0A 2DNYA 1SJ4P 2HGNA 3TP2A 2M8HA 2DH9A 2DISA 2DNNA 3MI7X 2OIHA 5CA5A 1N52B 2DB1A 5LSOA 1S79A 1VQ7S 2LQ5A 2AD9A 1K9MT 1URNA 2LMIA 2GO9A 4Y0FA 3MD1A 3S01A 1NO8A 2YTCA 1HD0A 1AUDA 3NS5A 1VBXA 2CPHA 5FJ4A 3JB9k 2JWNA 2DGUA 1IQTA 2CQDA 2DIUA 2XS7A 2MZSA 2DHAA 2DNQA 2DK2A 3B4DA 1VQNS 1H2UX 1M90T 3N9UC 3R27A 2VOPA 3G8TA 1Q7YT 3CPWR 3G6ES 1Q86T 3DLLQ 3PIOQ 2MKKA 3VALA 4J5OA 3I55S 4CQ1A 4C0OC 2DGTA 5LXRA 2O3DA 3OW2R 2RQ4A 3VAGA 5BJRA 2KRRA 2PEHA 1H2TZ 4WCEQ 4WFAQ 3UD3P 2LA4A 2KXHA 1WHYA 2CQ1A 2FC9A 2DNMA 1DRZA 1K8AT 3CC4S 1JJHA 2HYIB 2OJ3A 2I38A 1B7FA 3CC7S 1WG5A 3CCLS 1U1NA 2OTLS 2MGZB 2MKCA 2DHGA 2VONA 1H6KX 3CCQS 2J76E 4P6QA 1U6FA 3ZZZA 4EGLA 1ZZFA 2HZCA 2CPEA 3BEGB 2MQQA 1BY9A 3MUTP 3CULA 1YHQS 3BS9A 5HL7Q 3J7YU 1X4EA 2N3LA 4TU7A 4IOAQ 1SJRA 2CQ4A 5LJ5Y 2E5HA 2HVZA 2MKHA 2KM8B 2FY1A 5LJ3Y 2F9DA 2MGZA 2E5JA 2CQCA 2D9OA 2LEAA 1OWXA 5DDPC 3LPYA 2M70A 2ADBA 3P6YC 2DGXA 2CQ0A 2KYXA 3VAIA 3Q2TC 3U1MA 2CQGA 1VQ6S 1KOHA 2DH8A 3B4MA 1FHTA 5CYJA 4WFNQ 2MPUA 2QEXS 2K3KA 3VAMA 2CQ2A 3CCES 1U2FA 3EGZA 2ZJRQ 3S6EA 1OIAA 1WELA 1X4AA 1U1QA 2V94A 1WEXA 2YKAA 5GAGU 2MQPA 2KH9A 1FT8A 1UFWA 4YUDA 3CCVS 3CCUS 3MUVP 4QPTA 1X4FA 2KFYA 3P5TL 3EGNA 3HI9A 3NNAA 2N82B 1UW4A 2DNHA 1R8HA 3RW7A 1DHMA 5HO4A 2L9WA 2J0QD 4QQBA 3MDFA 2E5GA 1Q81T 2M7SA 2RNEA 2E44A 1RK8A 2J0SD 1JMTA 1WHWA 1M5PC 1VQ8S 3DXBA 2JX2A 2ZJPQ 1YJWS 1VBYA 2XNQA 1M5OC 2BZ2A 3BO4A 1QM9A 1OPIA 3G9CA 5LSLA 2E5IA 1U1MA 1JJ2R 3CC2S 3MXHP 1WG1A 2A3JA 3G96A 2ZJQQ 2ERRA 4CH1A 2ADCA 1HL6A 2DNKA 3CMES 3D2WA 1YI2S 2I2YA 2SXLA 2QFJA 5EN1A 2M88A 5DDRC 1FNXH 2MMYA 1O0PA 1VQ9S 1XN9A 3CCSS 2MQOA 1X5TA 2KM8C 5JVHQ 4UY8T 2OSRA 2M0GB 2CPDA 4LIRA 2MZJA 4QU6A 2CPYA 2DGOA 2KI2A 3R1HA 3RW6A 4CIOA 5ITHA 2MQLA 1YITS 3S7RA 1KC8T 3UCGA 2CJKA 1VQOS 2NZ4A 3NNCA 4Z2XA 3IWNC 3NMRA 2MSSA 2QA4S 1X0FA 5IM0B 3MURP 2BOPA 4WFBQ 5DDOC 4W92B 1L3KA 3US5A 1DBDA 4YB1P 2KG1A 2OTJS 2MY7A 2RUGA 1DZ5A 2DGVA 3VAFA 1WWHA 2CPJA 2EVZA 1VQMS 3I56S 4QU7A 1YIJS 2RRBA 2DGSA 2XSFA 2CQHA 4IO9Q 1WEZA 1WHXA 2CPZA 2MZQA 1X4HA 2FHOB 2YH0A 3TO8A 5MLCV 2YWKA 2CQBA 3S8SA 2RRAA 1Q82T 1VQPS 2F3JA 2F9JA 1S72S 2LXUA 2DGWA 1R8PA 1U1LA 2MHNA 4LJMA 2L08A 3CTRA 1A7GE 5IM0A 2L41A 1FO1A 1VQKS 3CD6S 2KRBA 3CUNA 2M52A 3THTA 3G8SA 1SJQA 1VBZA 2WBRA 3BO3A 4ERDA 2LA6A 2MZ1A 3LQVA 1YTYA 3PIPQ 1NJIT 2JRSA 2CPFA 2KXFA 1SJFA 2KVIA 1SXLA 2LECA 1FJEB 2Q79A 2XNRA 1N54B 4OZ0A 1X4DA 2KU7A 1X5SA 3VAHA 1H2VZ 2MY8A 2RQCA 2DH7A 2DO4A 1QVGR 2CQPA 2X1GA 2CPXA 2DIVA 2MQMA 4BS2A 2RU3A 3P3DA 3CCJS 2MJUA 5IFMA 4PR6A 2MKIA 1FJCA 4F26A 2LKZA 5CXTA 2KT5A 5DDQC 1RKJA 3NS6A 1PGZA 3IRWP 2AYBA 1NU4A 4IUFA 2J8AA 1F9FA 1X4CA 1U6BA 2N7CA 1JJ4A 2DNOA 2MB0B 1X5OA 4FXWA 2DNZA 5LXYA 1ZZNA 5H1SV 1KQSR 1YWXA 1VQ5S 2LEBA 4ZKAA 4M5DB 2LYVA 3HHNB 4IOCQ 1FXLA 3CXCR 2AYMA 3CF5Q 2FPHX 4C4WA 5D77A 3H2UB 2RT3A 2X1BA 3Q2SC 3V4MA 3UD4P 1VC0A 2XB2D 2CPIA 2MKSA 4UQTA 4C7QA 2K8GA 5GMKa 2X1AA 2N3OA 2M4MA 3NNHA 1A9NB 1HD1A 4TLQA 2DO0A 4A8XA 2MYFA 2LCWA 1P27B 2FC8A 2MKJA 4F02A 2MQNA 3SDEB 2DNPA 2G4BA 3MUMP 2HGMA 3CCRS 3G71S 2CQ3A 2EK1A 3L3CA 2G0CA 2JVOA 1WHVA 1WF0A 5GAHU 2M2BA 2XS2A 4V19X 1WEYA 1U1KA 2G1DA 1UAWA 3UE2A 2CQIA 3G4SS 1M5KC 2VODA 4W90B 2DNRA 1D8ZA 2MZTA 1WF2A 3SMZA 3CCMS 2VOOA 3H2VE 2HGLA 4Y00A 3P49B 2EK6A 1YJ9S 5GAEU 1N88A 2DHXA 4PKDB 1U1OA 1SJ3P 4TU8A 3VAKA 4CH0S 3SDEA 2KN4A 1P1TA 3VAJA 2NLWA 4WF9Q 2KHCA 2KXNB 3EX7B 1N8RT 3MOJB 4U67Q 2D3OR 2LXIA 4RU2A 4YOEA 2M9KA 2RS2A 1KD1T 3TYTA 1ZH5A 5D78A 3UCUP 4OZ1A 4FXVA 1M5VC 1WI6A 2AYEA 3ULHA 2MSTA 3FEXB 2DNGA 1X4BA 4ED5A 1VQLS 2DITA 5DETA 2M8DB 1WF1A 4WKRA 3VF0B 1OO0B 2U2FA 3UCZP 5GADU 2D9PA 1CVJA 1FJ7A 1PO6A 2DNLA 1X4GA 1X5PA 5DM6Q 2XS5A 1U1PA 4PRFA 2MXYA 2U1AA 5JVGQ 1UP1A 1VC5A 3FEYB 1YJNS 4F25A 3CMAS 1HA1A 2X1FA 2MJNA 5GVQA 5IQQA
chains in the Genus database with same CATH superfamily
2F4VF 1D1UA 4MIAA 3HMJG 1D9AA 1K73T 5CCLA 4NMLA 1N32J 4WIIA 1JLBB 4M5NA 3CDBA 3E01A 2DR5A 1I94F 2B4PA 5C5JA 2LXFA 4O0IA 3D3CJ 3KLEA 3M8WA 1NB2A 2CNOB 3DYAB 1N33J 4WFYA 2VBXA 5J2PA 2XGQA 3TOQA 1SCJB 2PEBA 2VQFJ 1JXLA 1Y4ZB 1NXIA 3R27A 3Q0AA 3WIUA 2Q66A 3PIOQ 2DGTA 5G0RA 3ZTPA 1ZAWA 2CA9A 4A4JA 5LSRA 4IR1A 3MR5A 1FJGJ 4GKJF 5CD4A 4DV4J 2DPIA 2XBPA 5K5MA 2I38A 5B0FA 3EPIA 4DV0J 2DHGA 2M5YA 1NHVA 3SFUA 2LU1A 3SV3A 3GJTB 4G1IA 4G1QB 4FYXB 3MAAB 2J7WA 4F0KA 5J2QA 2HFUA 1VRTA 5KFMA 3UW1A 5KG6A 1UVMA 3J7YU 1BWEA 4P7TA 4NLTA 1TL1B 2F9DA 3R2DJ 3W62A 2FQQB 3U1MA 3ONQA 2L3MA 1U2FA 5CQGA 1C1BB 4WU3A 1Y00A 3CDEA 4YUDA 1Q7LB 5MAOA 2HFOA 3QSYB 3TVYA 2J0SD 3B78A 1M5PC 1S6QB 3DLEB 1GAOA 5L1LA 4CO3A 1Q8IA 2GGPB 3ISZA 2QMXA 4PXCA 1JJ2R 2JOQA 1MMDA 4ZS6A 3FC9A 2DNKA 1RWVB 1FNXH 4ZMMA 2DD8S 1VJQA 3DRXA 4Y2IA 2HFVA 2I9SA 4CM2A 4UY8T 1B0VA 4NWBA 5ITHA 2MQLA 1P1LA 2IRXA 3KK3B 1RAEB 5IV3A 4USTA 1OYEA 4K4WA 4P2FA 4ZVGA 3I0SB 4ALZA 3E51A 3GB0A 1X0FA 5IM0B 3D6HB 1S4FA 5J1PA 3L7UA 2PC6A 2NSCA 1YVFA 1LFPA 4I56A 2ZOMA 2PGCA 1DTQB 3M6XA 3FBCA 4QW8A 2DGWA 3N01A 3BR9A 2L41A 1R3NA 1VQKS 2CWXA 2C2OB 1GQEA 2WBRA 3PW4A 4USWA 2GMLA 1FNMA 4HKQA 3CCWA 4HTIA 1XMOJ 2G2YA 1P8GA 2HS4A 4UOHA 1XR5A 4CO1A 2JC1A 1VRUA 3KHLA 1ELOA 3PW5A 2VQEJ 2AQ4A 4GC7A 4M63A 3UNYA 3BBBA 3C3LA 4GO5X 4U95A 4X4PA 1U24A 3KLHB 1ZZNA 1SH3A 4PWDA 3V6DB 1FXLA 1V3SA 4B17A 4NCAA 3M8QA 4C7QA 2K8GA 2V68A 2W2NP 3GWCA 1IM6A 1VJWA 4RZRA 4A8XA 3KLIA 2C28A 4HDHA 5KFUA 4N8OA 2V50A 2I6WA 2G4BA 3VZHA 2CUYA 4QIVA 2ZH4A 2VC0A 3R7SB 3BPSP 1S77D 3P49B 1TL3A 1NKCA 4HTJA 3UDEA 3R7NB 2YX4A 3IR7B 1QE1A 3PKMA 3H59A 1RTZA 3VAJA 2EBGA 4RW8A 2KXNB 4H54A 4N8NA 3MOJB 1ZAVA 3LALA 1F2HA 1KD1T 3BREA 5ETNA 1ZH5A 4NLUA 1EHWA 4KKOA 1M5VC 1U7LA 3FBEA 1JLQA 3K5LA 3ILOA 1VK8A 2HK2A 1GTEA 2FUG9 5J2MB 3M8YA 4LFCJ 1W26A 5GVQA 4GO7X 4URQU 1BQNB 3ZZUA 4OHYA 4RUBA 1VQ4S 4RNNA 4DR5F 3AD9C 4DI6A 2B7CB 3KJVB 1T95A 1OJ4A 5D0EA 1N52B 3OPKA 1FFSB 1IKXB 1V9OA 2JJ4D 4Y0FA 3GV7B 3PO4A 1HYSB 8AT1B 3UDLA 3KJNB 2PD1A 4XPEA 2DTJA 4B3SF 3LA0A 1F5CA 3QT7A 3W2VB 3NS5A 2EEYA 5IQ6A 2KYZA 3B82A 3IM8A 3EDRB 4ZIWA 3QT8A 4C0OC 4GVLA 1J27A 2FLLA 2ASLA 5AJ3F 4EFAC 2UXDF 2UUCJ 2IVYA 2KRRA 4WFAQ 4DFPA 2LA4A 3QLHB 1UWAA 3VQTA 2W7AA 4EEYA 3SQGB 4WKYA 4C8MA 1U1NA 4QWCA 1L3SA 4OYPA 2VPZB 2CZVC 1HNIB 2ZHAA 1ZZFA 8ATCB 4N7TA 4CO4A 4XIUA 1RQ0A 2BJ7A 3RUBL 4C11B 4CZCA 3BGRA 4EWTA 4Y2AA 4P74A 1EAYC 2AGPA 2CQCA 2ZC3A 3MEDB 2LEAA 3GFXA 3M9OB 3DHWC 3TARA 1RTHB 4P71A 1KOHA 2E1MC 1QTNB 4CP5A 1LEOA 1R0CB 3CCES 2ZJRQ 2EC0A 4Y2MA 3MM9B 2MQPA 2Y1LB 1WC0A 4CM0A 4HHHA 2VHGA 1R8HA 3RW7A 5HN0A 4QQBA 2J0QD 1Q81T 3MZIA 1WHWA 1DLOB 4LF9J 4I68A 4K4UA 3DGPA 5FIIA 4G6VB 1NDLA 2HQGA 4PQAA 2GFFA 3DI6B 4UW2A 3PM9A 4KC5A 2R7QA 3D28A 2IC3A 4LVOP 4PXBA 1NAQA 1YITS 2HMIA 2HNYB 3D3BJ 4I2QB 2XGPA 4DR2F 3NNCA 5IOLA 4ZLNA 2VPXB 3RBXA 4ZVPB 3O1LA 1E6YA 3WX4A 3R6LB 3TAPA 2V6AA 2ZDOA 2RUGA 2DGSA 1E6VB 5D4NA 4AE5A 2LQ8A 2CPZA 1X4HA 4OI3A 2CQBA 2B4UA 4CRJA 5E41A 2F3JA 2HNZB 3KJQB 4DQRA 4NA2A 4J9LA 1QAYA 1FD2A 2Y1RI 1ZTWA 1VBZA 4DPWA 2RB7A 2EI5A 4HEA9 3MPYA 1RT6B 4K0KF 2K1RB 1MLAA 2DCUB 1YRXA 5KFBA 5KT6A 1RAFB 2RQCA 1OY6A 4Y34A 1K44A 5CYMA 1QJHA 1IKWA 2RAQA 2MKIA 1WC3A 1N4LA 4CO0A 3OTOJ 1F9FA 2DY1A 4L73A 3Q86A 1Q5YA 3U27A 4ZKAA 3LGNA 1T0TV 2OEJA 4QIGA 3DC2A 2RKIA 2LP4A 4R0EA 3CXCR 2ZDPA 1NRKA 2LQ9A 2DBBA 3JQJA 3GYGA 3HO1A 3HSZA 2ZVIA 2GVZB 3KUGA 4OFZA 2ZWOA 1SIWB 4FF4A 3CNQP 2E9ZA 1RWWB 5D0RA 4OLOA 3FKBA 5HLFB 3Q23A 2HHHJ 3VCDA 2HHXA 4JB8B 4OI4A 5E7OB 1CQNA 2WHOA 3M2UA 4RUAA 4OHWA 5D6GA 2DHXA 2FZGB 3DNCA 1RWOB 3HSJA 3VR1A 4DV7J 1SJ3P 3RYLA 5KG1A 1FRMA 2HWIA 2VPWB 3DRPB 2J0WA 1R7IA 5HQLA 1TUWA 5F9NA 4PPDA 3C2PA 1IWAA 4X4VA 4M1KA 3Q8SB 2DITA 2HAFA 1ZETA 3RAXA 1TL4A 1WD6A 3EWGA 2XCAA 4N47A 1UP1A 2JZ5A 1RT5A 1SC1B 4QWDA 5IQQA 2XY6A 2DR8A 4ZITA 4MJKA 3NP5A 2W9AA 3I5CA 3D68A 4CT9A 1SKRA 1GX6A 5LMNF 1SJ4P 1TMMA 2BYCA 1R89A 4I69A 3M6UA 4F4ZA 4DFJA 2YWEA 1RT7A 2GO9A 3K57A 2VV5A 3CJ3A 1NO8A 2YTCA 5H9FJ 2HNDA 2E66A 2JWNA 4TVAB 3SI8A 1Q16B 2XC9A 1OQ6A 4ITSA 3D7SB 4V19J 3R2CJ 2MQ8A 4M5DA 5HMYA 5DG9A 3AXKA 2OD6A 4DPTA 2VG6A 3TANA 4LF5F 3BKFA 2H3EB 4FF3A 2D1CA 6AT1B 2J9DA 3T5JA 2HQ3A 1GH8A 3RRGA 1FEHA 4AT1B 4F4KA 3U02A 3OUYB 4LF4J 1I3OB 4J9MA 3JTOA 5KFWA 1U25A 1T03B 1SJ1A 1KVIA 2CPEA 4DCOB 3R5DA 3WDOA 3NBPB 3CULA 1J5EJ 1PKUA 4DN9A 2VZ9A 3QIDA 1SJRA 3GLJA 3QGIA 1RZMA 1CSJA 3DOMB 1PAEX 3M8SA 3KUHA 1S0OA 5BXIA 3BSNA 2DH8A 5IZHA 4KFBA 2XZWA 1RU1A 1I5OB 3CCVS 3HVRA 1Q4RA 3KMSA 1J2VA 4KPCA 1SC3B 3N5BA 1MU2A 3ZTRA 2R2UA 3ZTQA 4GC6A 3NGUA 3QWUA 1AUSL 1RXOB 1KS2A 2WVEA 4LQ3A 1FESA 1YJWS 2EG1A 3DMJB 3OVBA 4BDPA 1HNXF 5LSLA 1FCAA 3C6TB 3OHBA 1Z4UA 1OS5A 2M88A 5HP1B 3AB2B 1IJEB 4RW7B 5KG2A 4OZ5A 5JVHQ 1X5TA 1KP6A 4FF1A 2EFPA 3DRSB 1FRLA 3KG0A 1F9EB 3BB5A 4RUCA 4C8KA 1CJKB 1B64A 5DDOC 3LWMA 2RILA 4DL7A 5AT1B 4B3TJ 2VIHA 2VG7B 2E5LJ 1R43A 2ZH5A 1S97A 2V2VA 4YDXA 3FBFA 1YIJS 1BLUA 1IBMJ 2YKNB 3BR8A 1F60B 3RBZA 2UXCF 1F1BB 4PUOA 1TKZB 4DV1J 1CS4A 1SJQA 4G1QA 1G4CA 2R8IA 3MAAA 3VGVA 4LF6J 1KEKA 2CPFA 1ZM2A 2GHVC 1NH7A 1B3TA 4FPIA 4OZ0A 4ZPTR 2ZNZA 4OYMA 3OD2A 3VAHA 1HI0P 1RTIB 3HD1A 2NXUA 2XSJA 3P3DA 5LOQA 2BM0A 1F6TA 1U0HA 4DU8A 4KTQA 3NS6A 2FJEB 4IUFA 4XAKA 4HH0A 1JJ4A 2DNOA 4NLWA 4WTOB 2B6AB 4C0HA 2LEBA 2XI3A 2ROPA 1BC6A 4DPOA 3JTNA 3MAHA 3B8HA 4NXNF 3CB4A 4MYUA 3LOUA 3AD7C 3LF0A 1IKVA 1WC5A 1EQMA 3SCLE 4HL9A 1P6TA 4ANDA 3IXQA 5J1NA 3ETMA 2XHWA 1WF0A 5GAHU 2M2BA 1L3TA 4V19X 5IXUA 5E3QA 1MROB 3MMBB 1KWMA 3H2VE 2Q43A 4PZVA 1N88A 3W1YC 2PA3A 3ZZPA 1FERA 1APSA 2VF3A 2KO1A 3AOCA 2IRUA 2F4FA 1LWEB 3KK3A 4DQPA 1OPZA 2YPZA 4PYDA 3WX8A 3B6BA 4PQUA 1HR0F 4OZ1A 4DR6J 1WDTA 2H48B 5EX3A 1HW8A 3N6NA 3N28A 1DQ9A 1T9YA 1CVJA 1Y5NB 1U1PA 1K0VA 2V5HG 2IM1A 2GAGC 5KFOA 3QJJA 2DVIA 1H7XA 2HIYA 3W3SA 2MJNA 1ZA1B 3W63A 9RUBA 4C0BA 5JUMA 1HIYA 1NSQA 1WG4A 1HNZJ 1M5SA 2AJ1A 3FNNA 3IN5A 1LWXA 3TR5A 3PR4A 1S99A 2Z8QA 2M8HA 4P7VA 3PEJA 5K14A 1QAIA 4K2JA 2DB1A 4KGXB 5C24B 4P72A 3JAMU 4BWJA 3A12A 1VFJA 1UVJA 2O1PA 4IH7A 2CPHA 4DJBA 1UVLA 5KTQA 2H5JB 1TL7A 4O3OA 1GMVA 1WOSA 3G6ES 1Q86T 2ZVSA 3VALA 2MKKA 1ICEB 1Y0HA 2X51A 4DZ6A 2GC8A 2QC3A 4ED7A 2IDLA 5AE2A 1ZPVA 4KGVB 3HT0A 2E9TA 3OT9A 1JXEA 3TAMA 1RAJA 4B9SA 3PHTA 4LFAF 2MGZB 3FFIA 5CZXA 4HACA 4X2BA 1S12A 4IFVA 3A1YG 3ET6B 1BY9A 2R7OA 1U45A 4GKKJ 3M4XA 4QWBA 1X4EA 3EZUA 2ILZA 4USKA 2GW8A 5LJ5Y 2MKHA 2KM8B 1S9EB 2V8HA 1PC4A 2HLUA 5I3PA 2H9ZA 3VVUA 4XDDA 1TTHB 2J6SA 3RB0A 3RBEA 2V94A 2YKAA 5GAGU 4C98A 1SBRA 3P8BB 3LP2B 4ICLB 2QG9B 5L1JA 2DEJA 1T9WA 2M7SA 3R9LA 4YB6A 5AXKA 4CLSA 5J2NA 1FRJA 1YJUA 1BQNA 1JLAB 3DXBA 1KLMA 4WK1A 3TAQA 1RBAA 2QA4G 5IT0A 3OR2B 3KJVA 5CHCB 3SQOP 1PCAA 2CG8A 2A3JA 4RKUC 3G96A 1RT1A 1NJZA 5AXMA 1NLKL 2UUAF 4B3OB 3EMTA 3CCSS 2CADA 2ACYA 1IKXA 3DLHA 1B0PA 2CPDA 4QU6A 1HYSA 2HBQB 4YR2A 4F0MA 3W2VA 1VLYA 2RIJA 3GYXB 1N34J 2FGCA 4OX8A 3J80U 2QA4S 2ZE2A 1MN9A 2CYYA 4QR2A 1U09A 3BGLA 4ZVFA 2V2QA 4J9SA 1ZAXA 1RADB 5LM7E 3QLHA 3IG1B 3H2LA 4ZVQB 1VQPS 3LAMA 4KO0A 4CLFA 1YK9A 1QSSA 5B0DA 3BBFA 2L08A 4ES2A 2M52A 3CDWA 3BM7A 2IVMA 2P9CA 4ZIVA 1RHMB 2LA6A 2MZ1A 2JRSA 3LP1B 2KXFA 4M5IA 4EO8A 1GK8A 2AGOA 3Q89A 2ASYA 4K4TA 3IGNA 2IAJB 4C11A 6FDRA 3V5RA 1XMQF 2HS0A 1HI1A 3D5MA 2KT3A 1QVGR 4O4RA 4DL6A 2V9KA 2RU3A 1Y11A 4DUTA 4ED2A 5CXTA 4ZLLA 1T9VA 1NU4A 1KQFB 1X4CA 5KFEA 4PG4A 3UNGC 4X4TA 5EWFA 2WB4A 3PRDA 3MEEB 4R5PA 3CF5Q 2NQPA 3H2UB 4GVBB 3V4MA 2XB2D 3P96A 3AJDA 3CD0A 3FMBA 1VCTA 3MM8B 2G0IA 4OI1A 3IS9A 1FNOA 1YKWA 1F0XA 4WIQA 3RZAA 4KHPJ 1F3VA 2R2TA 3CD7A 5KFTA 3CWJA 1VHFA 1QDUB 2IJNA 4DQIA 2UVRA 4B9MA 2ATCB 3DU6A 3H4BA 3QO9B 1BE4A 4USMA 2GJFA 2JLFA 4PABA 2BJ1A 4DX7A 1HW9A 4TU8A 5KFFA 2KN4A 2YWWA 4ZP8A 4DV3F 3VWSA 4RNHA 4IQXA 4U8YA 3ZZ0A 3AQOA 3FSIA 4U9RA 1NK5A 1GX5A 4K5RA 4DR3F 3BBCA 4M8LA 4CLPA 4TXSA 5HBMA 2QYGA 2MXYA 2IRYA 5A6PA 4N41A 2MLYA 4K4VA 4Y2CA 2QZ8A 4KGZB 2DGQA 2GQ2A 3GG1A 1ZM4A 3WZ0A 1KNZA 3BH7B 3U1LA 2DHSA 2BW7A 1RTJB 2YWFA 2HW3A 4WP9A 4YHHF 2YH1A 1M1KT 3K0JA 1RWXB 2KG0A 2Z30B 3AT1B 1VQ7S 1HHTP 4F2SA 4YR3A 1W25A 4OX9J 3DRRB 2WBMA 4F0HA 2DNQA 4ATNA 1RYRA 5ETKA 1JLFB 4JP8A 3L7OA 5IT9U 2WONB 4L3NA 2YKPA 1HI8A 3OR1A 3M8ZA 3PFEA 3HFKA 4M5HA 2JSXA 4NLSA 1IWGA 1NK9A 3CC4S 4IDKB 1DQAA 1R8AA 3NGKA 4I64A 1C4AA 1XNRF 3EICA 4JYAJ 3AA9A 1N5YA 5I3UB 4KR0B 3TA2A 4ELTA 4ECWA 4FYWB 3ZZTA 2D3ZA 3GIKA 4TU7A 2BW2A 1HWIA 3I87A 3RAMA 1FK9A 2HFZA 2J6UA 3SYZA 1NPPA 1UWBB 3QJPA 3KKFA 1TVRB 5B0EA 3AH6A 4YFUA 3LANA 3EPGA 2N82B 3TW0A 2VG5B 4JI8J 2VL1A 1JMTA 2OPPB 2F8MA 1H0HB 2FD2A 2MDAA 2XNQA 2BZ2A 2P9GA 1BQMB 1N5VA 2EXUA 1V3ZA 2Z2YB 4I0WA 3DLJA 1YI2S 3T1YF 2HHUA 2GX8A 5EN1A 2YWGA 4NXMF 2O01C 3QGGA 3VQSA 4O44A 4F50A 2AEMA 3R1HA 4JI6J 2BEFA 3IM9A 3TUZC 1KC8T 3GSDA 4Z2XA 1G1XA 1TK5A 3CDAA 3ZTSA 1FDNA 3RRHA 4PPZA 1BXNA 3GFHA 2MY7A 2YNHA 5C7PA 1DZ5A 1VQMS 3I56S 2H5IB 3KG4A 3A13A 2RE1A 2MZQA 4ETZA 4X66F 2JNJA 1SPBP 5FDLB 3JYTB 2FJVA 2YKMA 1UVNA 4DHVA 5HVGA 1FRKA 5LMUF 2V4RA 4OHXA 2HRUA 3HX9A 3IR5B 4NLOA 4WYLA 4USUA 1TKXB 1IKYB 4I7FA 2ACMA 2I5JA 2EBEA 1N6QA 4JI1F 1BWVA 1OSDA 3B54A 3CJTA 4LBHA 1PBUA 4FKYA 2AEJA 1UCNA 3G82B 5A0YB 4WYWA 4DG1A 2IFXA 1IR0A 3T41A 1LK5A 1LW2B 5KOXA 2ZKTA 5H1SV 3I31A 2BM1A 3PYFA 5I42B 1UEVA 1N33F 4UQTA 3AD8C 4JV1A 3DU5A 1NDKA 3G6YA 2VQFF 4TLQA 3CE8A 2W7OA 2MYFA 1TV6A 2LCWA 4PYAA 2FC8A 4C6AA 2JEIA 3RU0A 3SDEB 2C22A 1NCLA 3DN9A 2R7SA 1LV5A 4Q0BB 4YY3J 5E3CA 3IR6B 5ETLA 1U1KA 4DQSA 5HP1A 4HDGA 5KFNA 1REVA 4ZOSA 4DV4F 3D6TB 1X7VA 1T9TA 1LQ9A 2KFNA 4DR1J 4DV0F 4U67Q 2BR0A 4O3QA 3AJ1A 4JI2J 3GILA 3CW2C 1RHQB 4FXVA 1LOUA 4LT6A 4KH1B 4EUVA 1LWCB 2NXEA 3BKUA 4RW9A 3VF0B 1OO0B 2XMAA 5DQGA 4OLPA 3DFEA 1VQYA 2PO4A 3L09A 4DBQA 4RLEA 3FEYB 3G86A 3NGRA 4M5LA 3MM6A 5KFIA 5FLXU 5C25B 1R31A 1S9GB 3PTWA 1JKHB 2B9YA 3ZO7A 2HVHA 3D0GE 4BC7A 1W2BR 1I6JA 1T11A 4WE1B 4IO1A 2VUGA 1UFLA 1RKIA 5B0BA 1F9HA 4DSFA 2WW4A 2KFZA 3M2VA 3OTBA 5B7WA 4FS2A 1GNKA 2ZBQA 3MCOA 2IJRA 1JXVA 3G6XA 3HHDA 1HLWA 3OL9A 1RT4B 4J5OA 4CQ1A 3PJWA 2J0XA 5IS2A 4MKYA 3V6KA 5EHHA 3QFHA 4FYDA 4DPXA 4L75A 3H20A 4ECSA 2G13A 1B7FA 5T7LA 4CDIA 3CMQA 3CCLS 2P6TA 1FE4A 1QD1A 1QUVA 1SUQB 1V5IB 1JLCA 1MROA 1TAQA 1WOPA 3MMBA 2BJEA 1S1WA 3MECB 2RMLA 3U1NA 3RB6A 4EBCA 3FCVA 4R8UA 3CIZA 1S1UB 4MFBB 4C8ZA 5F8LA 1OWXA 2CQ0A 4LR9A 4JBCA 5DZ6A 2V34A 1XMOF 1CC8A 3HHKA 4FPRA 3FZBA 1QTMA 4K7QA 3I32A 4U7UD 2POKA 1CJVB 2A18A 2VBZA 2DR9A 3TI0A 2X3GA 2O67A 2Z2ZA 1NB7A 3NGTA 1PJ5A 2XQCA 3KYLA 1RBLA 2ZH3A 4A46A 4DPUA 3HVTB 4HHJA 2W4PA 2UVVA 3AY0A 4I6YA 1EARA 1BGXT 3HZEA 1EB0A 2SXLA 3HHLA 4CH7A 1S6OA 5GAHI 3LGMA 4RNMA 1U8WA 3HLUA 1D3WA 3BKTA 4JV2A 5KG0A 4GRSA 1DTTA 5DG7A 4F4WA 1RACB 2RH3A 1ZTTA 1KR4A 3ITHA 3IAS9 5B09A 1NJYA 1JLGB 3HKZD 4CLZA 2QLJB 1YSJA 5KFQA 1DBDA 4IH5A 3JTPA 3QIPB 4EBEA 2RRBA 4IO9Q 1SIZA 2CRLA 2RF2B 2HHPA 3WBZA 4MTPA 3T9NA 3S8SA 4KV8B 2MHNA 4LJMA 3CJ5A 2ZH6A 2XTJP 3RTVA 5D3GA 5F8IA 1ZA2B 1LKZA 4B3MJ 3THTA 1T3OA 1C1CB 3F73A 2CFXA 1HBMB 1NJIT 3OHAA 3JSMB 2HG4A 3LW5C 2WZ1A 1EQ0A 1X4DA 1WC4A 4MIWA 4DR5J 5BR8J 3I96A 3DLBA 2FGOA 3C14B 2FVSA 3C15B 1NHUA 5IFMA 1RTDB 4RNFA 2QV6A 2KT5A 2WB1D 2MB0B 2HRTA 5BYRA 3DLKA 5C2CA 2A1BA 2XM3A 3MR7A 3GG0A 4XK8C 2YXLA 2B9EA 4RBTA 1JNZB 3IBFB 2YNGB 4IOBA 1FKAF 3F56A 4DFKA 3CJ4A 1IR2A 4M94A 3HSGA 5AJ3J 3OR2A 4FBUA 2V8VA 2ZNYA 2XMKA 3G4SS 3SMZA 2IMOA 2H4YB 2EK6A 1GXUA 1OQ3A 3GE9A 4J7CA 2VH7A 2GIFA 5IWAJ 2ZOGA 1N48A 3NGSA 4QZVB 4DV6J 3PYGA 5GADU 1XNQF 1PIEA 4FXDA 2DNLA 3IG1A 2U1AA 4ANEA 4IG0B 2QN6B 4IH6A 5E0OA 2JFDA 2E9RX 4BC9A 2WOMB 1FTCA 4ZA1A 4DR4J 1RP5A 3LP1A 2UP1A 4H4KA 2DPJA 4O4GB 1VK3A 3X1LB 2AP6A 3J7ZT 4ECYA 2HGNA 4NCGB 2DISA 1RAAB 5ETQA 4A8FA 2HPUA 2AD9A 3M32B 4LF9F 3PCOB 2HLTA 3VGUA 4EMDA 2DJWA 2ZHOA 4XTTA 5HQMA 2BUNA 4GMKA 5HMWA 3R5BA 2V2ZA 4RNOA 1VQNS 1H2UX 3C66A 4ID5A 2XZTB 4LSNB 3MEKA 4MK8A 3VGTA 2LDYA 1RI7A 2B5JB 3DM2B 2C2KB 3FQKA 2PEHA 3QSIA 2DNMA 4J9KA 4OYXA 4ENOA 5HMZA 1NHKL 2F65A 1RLDA 1I1GA 2W9CA 4JI5J 1XJWB 4IRKA 2D3UA 4EGLA 1NZAA 4QR0A 3NCPA 3BPDA 2BABA 5HI7A 5CABA 3SSSA 3QPIA 3BS9A 3MM5A 1RA6A 2AHOB 4UQGA 1CJTB 2B43A 1CPZA 2FY1A 5D15A 2C2NA 1HBOA 2DGXA 3NKYA 3KJFB 2VICA 2BANB 1NKEA 3AOAA 1Y7PA 2ROEA 2CQ2A 2QLBB 2QLWA 2W24A 2XMWA 1FWKA 2VFTA 2DNHA 1VMBA 2PI5A 4RPFA 3TJ8A 3CJKB 4C9DA 4L3KA 2W1BA 2ZJPQ 4N76A 4LR7A 1M5OC 2A6OA 3M8PB 1RTJA 2NXJA 2ZD1A 3G9CA 1IBKF 3D1HA 3KLGB 2KTQA 1G3OA 3LO3A 3A3PB 4K59A 2MMYA 3O8WA 3BN4A 4C2MA 3BSOA 4DV2J 1DFDA 3TX8A 4MH8A 2ZZTA 4USHA 4LRDA 3VV2B 2LLZA 1Q8LA 2HEKA 1YX2A 4ECZA 1RAOA 1GTHA 1VQOS 2HHHF 2KB2A 5AXLA 5B0GA 5IV4A 3FSYA 2KG1A 2YNIB 4DV7F 3EXCX 3U7JA 3PR5B 1HMVB 3ZZRA 1R0AB 1CBKA 1KKHA 3QJLA 3MMAB 4IDKA 2AX0A 4LSLA 3EGVA 1NZ8A 4WP3A 1REGX 1XK8A 5BYQA 3NOGA 5F0WA 1C0UB 4NEYA 1BD6A 5E33A 4ERDA 3ADAC 3PIPQ 3MR3A 1SJFA 3X3UA 1SXLA 3J81U 1HNVB 3FQLA 3HXMA 3H25A 2MQMA 1CJUB 3LH2S 4DUZJ 1HHQA 2CAJA 4DL4A 1YJTA 1CULB 2BVZA 3PY8A 3GTYX 4TYAA 2FPHX 2H4WB 2BE9B 3OL7A 3RBDA 3V2UC 2DT9A 1VQSA 3ISNC 2HZVA 2X1AA 2HAIA 2OPPA 4KPYA 1XR6A 1C0TB 3O5TB 1J5OA 4QJVA 4LF5J 3HZGA 4F3MA 2KZZA 3PYDA 2G0CA 2CDQA 3FRZA 3VTIA 4P73A 1LW0B 3DXSX 2ZZMA 4LIWA 1NH8A 4TY8B 1S5ZA 4ES1A 3MEGB 5CYQA 5A2QU 1HWJA 2P9EA 1AFIA 2A6MA 5KT3A 2OHDA 4M5JA 2KHCA 3T1AA 2LXIA 4A8QA 4YOEA 3QT5A 1MG7A 5KFLA 3LWLA 2DHHA 3ULHA 3HFVA 3NCRA 1J5EF 4ED5A 4ZJOA 3GMGA 3P5BP 4WKRA 1R27B 3H4DA 2U2FA 3UDCA 1NKBA 3SEOA 1PO6A 3I9ZA 1R0BG 4PRFA 3QNWB 3E01B 3JYTA 1FJCA 3KLEB 3DOLA 1NK6A 1U47A 5J2PB 2H51B 4LMZA 1FDDA 3BDEA 3W8GA 1XTZA 4CNZA 3IFEA 2MZRA 3H8YA 1SVDA 4DQQA 1UZDA 2AJ0A 3Q22A 3C46A 3MI7X 4MMOA 2OIHA 4K4SA 1HNXJ 1FEEA 5G0RB 2JEFA 4P10A 3DOKA 3EGWB 1Y10A 1SKWA 3UPFA 4LF7J 1H73A 2IY5B 1LW2A 2DK2A 2QT7A 1R8CA 5D0GA 2J9EA 4X84A 4NZ0A 1UTAA 4CO2A 4NA1A 1S0VA 2JLEA 5U47A 1Q78A 1VRTB 2WRMA 1WHYA 1K8AT 5HJXA 4YN3B 2HYIB 2H1YA 5KG5A 3OJUA 3TZWA 5THWA 2QJ3A 2OTLS 1ZS6A 2MKCA 2E5LF 5A8KA 2LU2A 2W8LA 1IBMF 4DU7A 3QATA 3UVJA 4E98A 2ZZNA 3BSCA 4C3LA 3MUTP 3K17A 3M9MB 3FVYA 3TA0A 4DV1F 1LNQA 5F0UA 4IG3A 1EIYB 3UI3A 2B8PA 2YPYA 1WOOA 3Q8UA 2J8SA 4LF6F 3Q2TC 2CQGA 1NJXA 4LBIA 4UOFA 5KFRA 2JFKA 4P2SA 1WEXA 2I1RA 4ES3A 2AW0A 4ID8A 1KBRA 4XPCA 2J5AA 3P5TL 4CO5A 3O6QA 3K7RA 3KMQA 4DN0A 3KWMA 2YNFB 1PC5A 4NLXA 5C42B 2Y0BB 2H5EA 2QLFB 4UUWA 3D1QA 3DLGB 5KFKA 4RW6B 1HQUB 4PCQA 1KSPA 1S6PA 3M30A 2NSBA 2ILYA 4FNHA 4QCLA 2VASA 2P6SA 4DL2A 4OYZA 1S59A 1KHVA 5KFXA 3HFZB 1RT2A 2OPQA 2L9NA 4HR2A 5DG8A 1Z1ZA 2BOPA 2B9WA 4RBUA 4X4OA 5FD1A 3MCSA 2VFUA 4AXJA 2DGVA 3VAFA 1R8BA 3HHLC 1W7WA 1HBNA 1HR0J 4Q2MA 4EI2A 2YWKA 4F04B 2OFHX 3KHRA 2HHTA 1NK7A 2VA3A 3SIPB 1R8PA 4ZCKA 1U1LA 2VU5A 1VGYA 4H4OA 3CTRA 1RB0A 3FCHA 1VRUB 3CSKA 3G8SA 4OYAA 4N77A 1SL1A 3RGIA 3IP0A 5ETPA 4RW4A 1JB0C 1V6HA 2FZKB 1HQ2A 4FF2A 1DJ0A 4PWDB 3NCQA 4LF8J 1UJ4A 4YDDB 2B8QA 3M8QB 3W2WA 3PRBA 3EYZA 3OFEA 2I8EA 2KT2A 4AYBD 1HNZF 4Z7YA 4CLLA 3KLIB 2J8AA 4DSKA 1X5OA 5LXYA 1NM2A 2CJYB 3QZ8A 3ZXWA 3NEKA 5DQHA 5D77A 5KT4A 3EVOA 1CJVA 4I2PA 2CNNB 2DYAA 3HKWA 3NNHA 3WQPA 1QE1B 1PBAA 4IFYA 3HVTA 2B7BB 3OV7A 4RW8B 2OO4A 3MF5A 2OPSA 1D8YA 5IT4A 3M1VA 1UL3A 4KKOB 3H90A 1JLQB 4PG7A 3V81B 2GZOA 1MMNA 4NI2A 1XEZA 4UOCA 1JWWA 2EFOA 3JSRA 4OZLA 2JDJA 1TUVA 1LFWA 2PMWA 4LF2A 1IVZA 3TYTA 3W66A 1JLGA 3UCUP 1Z2ZA 2AYEA 3AJ2A 4GKKF 1P9YA 2Q3PA 1X4BA 1AYEA 4OV6A 1N5TA 5DETA 1LXNA 3NY0A 1SV5B 3K5MA 2RF2A 4TNOA 5HSPA 1UZHA 4DUYJ 2Q6BA 1T3NA 1HA1A 2B51A 2NYIA 4URSA 5KOWA 3THPA 1HBMA 1UPPA 2GQCA 2ZFHA 4U96A 3SCIE 4KBIA 2P5VA 3PX6A 4LBPA 1VDHA 1YBUA 3I4PA 1S1VA 2FHMA 1S0NA 1G7CB 4Z37A 2DRAA 2ZEJA 1DARA 8RUCA 1RTDA 1WJ9A 3MM7B 2BOAA 3EM1A 4I1TA 4PWUA 2DHAA 2CIMA 2VOPA 1GFWB 1Q7YT 1VISA 3THVA 2OEKA 2VB6A 2JC0A 1V3RA 4DSJA 4YB5A 1F5AA 3OW2R 1TKDA 2GQQA 5F8NA 5BJRA 1TAUA 2EWHA 4MT1A 1N34F 4ZP7A 4Q8EA 1RU2A 3BGRB 1SKUB 5HROA 3GCWP 2AZ1A 1N56A 4AD6A 2G9OA 1FRXA 1BUXA 3OLBA 5H9FK 3S1TA 4IYQA 5BYSA 3KG1A 4B3RF 5EGYA 1YJ7A 2D3O1 4RWXA 3FUYA 3GR1A 5F3TA 2HVZA 4NLRA 3NOCA 5IC6B 4CNYA 5DDPC 3LPYA 3L7PA 2ADBA 3VAIA 1XMQJ 4M5GA 1VQ6S 4MKVA 2NS1B 2UUTA 1N36J 3GP9A 4OMFG 1H98A 2A2DA 4X62F 3MTKA 3MUVP 2ZWPA 4QPTA 3O2IA 4NASA 5ETOA 5HANA 1S1TA 1HNWJ 1R6YA 3SCKE 1PJ7A 2ZUGA 2Q1LA 4U8VA 3GIIA 4J90A 3BO4A 2RDIA 1WG1A 4B9VA 1QAXA 2ZJQQ 1YZ6A 2PDAA 4NCGA 5DDRC 2HBZB 2V69A 4AL6A 1XN9A 3J81j 4KT0C 4ILLA 1Q5VA 4OI2A 4KHPF 1XIQA 5H9EJ 3OTCA 1SQGA 1IBLJ 3NRBA 1YGYA 4FYVB 4EYHB 3IWLA 2OPRB 3K59A 1NBEB 3W5XA 2EW9A 1IBCB 2OTJS 4TQSA 1S76D 2H54B 1ZYQA 2B5JA 2Y8WA 1AB8A 3LAKA 2V4JA 3CJ8A 2NCKL 1TFWA 5MLCV 4ELVA 3QFWA 5GADI 3FK4A 2E7VA 3QAEA 3GFYA 3G2XA 3H5SA 3L4BC 4KHMA 3CD6S 3C16A 1IXKA 1VBKA 3NMAA 5CYMB 1IKWB 2J7KA 4JI7J 4WZMA 5F8HA 3LQVA 4B9TA 5B0AA 2PSZA 1FJEB 4DL5A 1FF2A 4L6V3 1Y3JA 3DCAA 2JH3A 1CJTA 2IHR1 5SZTA 2RKIB 4A8YA 3ZNUA 3ILLA 3QWPA 4ZP6A 1S49A 3CCJS 3DKDA 4YHHJ 4Q5VA 1JIHA 4DV5J 2LEPA 2EFVA 4ED8A 3ICLA 1FRHA 4CYUA 3D54A 4ECRA 1HWKA 4OX7A 2AYMA 1JK9B 4OX9F 2MKSA 2BA9A 1GEHA 4Q2LA 1KVJA 3OXLA 4NRUA 2K06A 4QYRA 4FP9A 2W2MP 1P27B 2MKJA 3GYNA 4P2MA 2XO7A 3A8JA 4AQYJ 4LQ9A 4UF4A 3M8PA 2CQ3A 3BQ1A 1FKPA 1KHWA 2R2RA 1KRPA 3Q8YA 1OSCA 3AOBA 3CCMS 4D3HA 2CKWA 1XNRJ 3I5BA 2E1RA 2E29A 5KG4A 1FKOA 3TNVA 2VFSA 4JYAF 2NLWA 2ALYB 3POTB 1RUSA 2D3OR 3N0VA 4J9UE 1H3DA 1RT5B 4QPXA 2PT0A 2MSTA 4A8SA 4FZVA 4Y28C 2YNIA 3LP0A 4DFMA 2M8DB 1WF1A 3CEDA 4G65A 3IBCB 3UR3C 3UCZP 2V8DA 3K8VA 2BJ9A 1RCOB 2AWZA 3TVZA 1KTVA 1OY8A 2IJFA 1X5PA 2XS5A 4PXDA 4A47A 2RQMA 3IO1A 1RWKB 1LWFA 2X1FA 1N5QA 2GHPA 3KK2B 5DM7Q 1RT7B 4WFZA 3HJVA 2JVRA 4ECUA 3G87A 3FBBA 3R1LA 1FXDA 1HNVA 2NXNA 1UETA 3D6MB 3DDNA 4JI8F 3UN3A 4O3PA 2LQBA 4ED1A 3H42A 5CA5A 3BZQA 2N7YA 4P75A 1G6BA 1S79A 4U7UK 1RJJA 3R8YA 1D9FA 3T1HJ 3S01A 2EFGA 4NXMJ 3TRGA 2FB0A 4URGA 4LREA 3Q83A 3ENQA 4WZQA 1B99A 3ILJA 1BMQB 1JLBA 1M90T 2RSQA 2D69A 4RUHA 4K4ZA 1QUPA 2R4FA 5KT5A 1MSWD 4DR7J 5LXRA 3TVKA 2YQ3A 4JI6F 3OVSA 3DYAA 2KL8A 2NPIA 2UUWA 1FDBA 2KXHA 1C0TA 1VRQC 1MNEA 3AAWB 2Y1IA 3EUNA 3PDNA 2FHJA 1YZ7A 4X66J 1U6FA 3ZZZA 1LW0A 4KY3A 3O44A 3LTOA 2N4CA 1NMEB 4Q45A 4K4XA 3OQ2A 5F41A 4KFBB 4ZP9A 2R8HA 2QSWA 1CG2A 3TUPA 3PX0A 2E5JA 4QIEA 5AXNA 3PFOA 1MU2B 3UR0A 1EETB 2KYXA 4NYZA 4OQJA 4NRTA 4ECTA 4CLTA 2MPUA 2QEXS 4EYIB 1A0OB 2CG4A 1SB6A 2K3KA 2XY5A 3EGZA 4JI1J 3WC2A 4MKAA 2XLKA 4EZ9A 1U6ZA 2CWKA 2QE5A 2KFYA 3MCNA 1TL1A 3OSPA 3HI9A 2H65B 4ZLJA 5J1EB 4QWEA 3KHGA 1DHMA 2XYPB 2DEIA 4NMXA 5A6WA 2CVIA 1C1BA 2CVEA 1T7PA 2BKNA 4DLGA 2ZH1A 3MXHP 3HVWA 5F8MA 2I2YA 3DDIA 2QX0A 1O0PA 1S6QA 3DLEA 2Z2MA 2KI2A 3K5OA 5ADZA 1RE1B 2FDNA 5F8GA 3T9ZA 4YY3F 2GGPA 4DSIA 2C3UA 4PUOB 5KG7A 2XMVA 2ALZA 3CJRA 1ACMB 1L3KA 1CS4B 4DR1F 1F2GA 2X7IA 1NK4A 2EVZA 5JXSA 3J7AN 2CZ9A 4J9PA 2PA8D 2N4DA 3TO8A 1ZBTA 4JI2F 4X4UA 5A8RB 1KN6A 2R3VA 4O3NA 3T5LA 3I0SA 4TYBA 2G0JA 3KDOA 5DLGA 3OFHA 1NUEA 5IM0A 2GO8A 2XYGB 2XSJB 3GJSB 4ELUA 2UVUA 1U0HB 3AA8A 2WK4A 2K7JA 4QW9A 1H38A 2XG8A 2IYIA 1DTQA 1H74A 4JV5J 3D66A 2EFNA 3PW7A 1X0PA 2DXEA 3M6VA 2DIVA 1Z2LA 3FZ2A 2RHSB 1IKVB 1IQZA 4I4BA 1WORA 3NWRA 2XMMA 1DURA 3TZXA 4KYZA 3CD5A 3GIJA 3RR8A 1TKTB 2FJXA 5DLFA 3H0PA 3D1OA 4JI4J 4X64F 2AJ2A 2YNFA 2M4MA 5C42A 9ATCB 3HPOA 1HQEB 1RCXB 1AW0A 5K8NA 3VZIA 3DLGA 3KLHA 3N79A 3L3CA 1JQGA 4RW6A 1HQUA 3V6DA 2BJ3A 5K8OA 1WSVA 4PQUB 3BQ0A 2DXDA 1VYAA 3TZYA 3P45B 5K8PA 4ZVUB 4Y2KA 2EPIA 1MW7A 1RHRB 2EKYA 4JUZA 2W01A 5GMEA 4NCBA 2XULA 2BX6A 1N8RT 4QIFA 3MGJA 2RU9A 2HQIA 2IDEA 4YP3A 5D78A 4NLPA 1B7YB 3RJMB 1TFYA 1SL2A 1FVQA 2D9PA 3TJ9A 1RHJB 4QOTA 3OFGA 3PNIA 2HQCA 5K14B 4X65F 3M7VA 4O3RA 1TL5A 2G1HA 2D74B 2EFQA 2ATLA 2OSQA 3PRVA 3ETOA 1JNRB 1NSPA 3P4UB 1U1RA 2UV8G 1TL7B 2YY3A 1G2EA 2RVJA 1GXTA 4Y3CA 1IN0A 3RAQA 5EDWA 4WWSA 5J2MA 2HBYB 4BLGA 1L3UA 2LMIA 2KKHA 3OJSA 2FLOA 1KDNA 1ZPWX 1HD0A 1AUDA 1GMWA 2V8PA 2YWHA 1VBXA 1PJ6A 3TAMB 4XDCA 2MZSA 1SC4B 1MWQA 2IMWP 3CPWR 1U2RA 3GFZA 3FFIB 2BRLA 4HACB 3FMWA 2Q6CA 4IFVB 2W2PP 1UEKA 2RQ4A 2CZ4A 1U49A 3N6LA 2OKQA 1H2TZ 1U4BA 1IR1A 4KAIA 1MMLA 1JJHA 1RWNB 3A8EA 4UY85 1TUGB 3K5PA 4IKAA 2G2ZA 1RWMB 4P6QA 4ZPCA 4PXEA 5KFPA 3E3XA 2UXBJ 2HZCA 4CTAB 2UUBJ 5CCMA 3C19A 3HDSA 3V81A 2AIRB 1YG0A 2HRYA 3HD2A 3ENVA 2AGQA 2FHJD 1HFEL 1NSAA 3SQGA 3ENWA 3KTQA 2ZBPA 2OELA 1V5VA 4C3MA 4B3MF 3VGSA 3AFGA 1D09B 3AHPA 3NG8A 2UU9F 1HNIA 1C2PA 3B4MA 4M5MA 5J2NB 2C3PA 4WTYA 1KLMB 3WHIA 1OIAA 5K9FA 3NLCA 5BR8F 1SV5A 2KH9A 2L9DA 2BE7D 4NL5A 2Z0GA 4B08A 3W64A 1RT1B 3MEDA 3PJXA 4Z7CA 5DZ7A 1RTHA 2ZM6J 1VQ8S 5E2QA 3K8WA 5CAAA 2Z4PA 2OMOA 1ZOTA 3MM9A 1FX2A 2HZAA 1OPIA 4ZVTB 3CC2S 2HHWA 2HKEA 2WVDA 2ZE2B 1HL6A 1EKRA 2QFJA 2XMUA 3NL0A 2RQKA 1LK7A 2Z57B 1VQ9S 3W5ZA 1DLOA 3M8RA 1X9WA 3RW6A 3MM7A 5DQIA 4AUKA 4HT7A 3S7RA 5KFSA 3N5FA 4KO0B 2FVCA 4OZ2A 3IWNC 3R97A 1QLNA 2VBWA 2E7XA 1YLXA 3A3OB 2OEMA 3MURP 2FTRA 3DI6A 5EWGA 1QSLA 3RB4A 5L1IA 1T9UA 3F0NA 1L5UA 4C48A 5IWAF 1YQHA 2B3TB 1WKLA 2HNYA 4I2QA 4F36A 1IUJA 2APOA 3AODA 4ZPWR 3R5CA 4TKTA 3K5NA 5HQ8A 1ULRA 1XNQJ 1KTQA 4DX6A 4DV6F 2ZKUA 3SV4A 3HJFA 2IA0A 2XHCA 4CCHA 2VC1A 3F44A 4KJIA 2CNKB 4W4MA 1E6VA 2KVIA 2P2CB 3KOAA 2YX7A 2HNZA 1NSKL 3BGOP 3I4HX 4R5PB 2CQPA 5KFYA 4DR4F 3UO0A 4TQRA 5KAKA 2QSFA 4B02A 3IS9B 4WPAA 1PGZA 4ZN1A 1RT6A 2K1RA 3BN7A 2W4DA 4DX8H 2R42A 3MFIA 4IOCQ 4C4WA 2RT3A 1AROP 4JI0J 3IC1A 4JI3F 2ASDA 1WTFA 3PO5A 4C8YA 3NAHA 1X31C 2BDPA 2AMCB 2C1EB 3CCRS 3M2RB 1UJ6A 1WHVA 1VIOA 1UAWA 1M5KC 3NAIA 5B0CA 4OV1A 2HGLA 1U8SA 4WFXA 4DF4A 4ILMA 2R2SA 4CWBA 5HBMB 2GVZA 3EZ5A 5L9NA 4ZVOB 1ITPA 4JI5F 4OYOA 2V8GA 4RU2A 2OPRA 3M05A 5HLFA 2DRDA 4LFBJ 2BQUA 2DNGA 2Z56B 4OIXA 1NEEA 4NEZA 1FI4A 3GSIA 4K5SA 1PYOB 3O3LA 4R25A 5JVGQ 3DRPA 2ZH8A 4EZ6A 3CVKA 3T3FA 1YRTA 4ANCA 4OJ1A 5HVHA 3MD3A 5T41A 2C2ZB 2ABYA 4ZVRB 4DXLA 1VI7A 1Q8BA 3ZZYA 1KOOA 3R7BB 3VHQA 4FVMA 4A8OA 4Q43A 2XWYA 3E8OA 3SXLA 2KZMA 3GONA 3TP2A 4D3GA 2P8IA 4MK7A 3OR1B 1IBKJ 3FRYA 1URNA 3DGVA 4E2FB 3C6UB 2NR0A 3QGHA 3W9IA 2WAQD 3IAM9 3C8YA 4DV2F 2FHKA 1MWYA 1N5YB 2DR7A 1EZZB 2I0XA 4KRWA 3DRYA 2O3DA 5F3ZA 1GMWD 4NOHA 1N5SA 1RGVA 1UMJA 3H5XA 5L9XA 2QL9B 1DRZA 1RA7A 3W61A 1YBTA 2F40A 3MAQA 4RBVA 1Y3KA 1WG5A 1FK9B 4K50A 3LPEA 2J76E 2IA6A 5ETVA 3PHEA 1WC1A 3BEGB 4NLGA 2MQQA 1YHQS 3I0RB 4TLRA 2GIRA 4C8NA 4A8WA 2GJIA 3I82A 3FEZA 4H4MB 3POTA 5LJ3Y 2V63A 3OUYA 2CJBA 1T94A 1LXJA 3KDNA 4ZPVR 3OL8A 1T03A 2A2CA 3SCJE 2GMJA 3SSRA 2WTFA 3NBPA 1HARA 3CT9A 2F4VJ 2CNLB 4MYTA 1RABB 5GMDA 1UFWA 3RB3A 4IRCA 5ETTA 2QYCA 3KXDA 3V6JA 2DXFA 1Q79A 3DOMA 1AT1B 2AJ4A 4DUZF 1UEUA 2E44A 1N32F 1I94J 4O44B 2PFFB 3KK2A 2W4CA 2D41A 4ZN3A 1TU0B 1QM9A 3A8IA 4UZCA 1D9DA 2ZUAA 4X4QA 2V9WA 4A48A 1T02A 1VLOA 3AB4B 7FD1A 2YKOA 5E5NA 4ILRA 1SC6A 2YNHB 2M0GB 4NE9C 1M1GA 4CIOA 4DMZA 4Y65A 3DMJA 1T05B 1PYSB 4DCPB 4HH1A 3C6TA 2PN6A 3Q8VA 4GKJJ 2YKMB 4WFBQ 1VIXA 4RW7A 1NK8A 3W8PA 1FJGF 2OMLA 4YB1P 5HAOA 2QL5B 3D67A 4E8UA 2QO3A 5EUHA 4ZPAA 4QU7A 2M3DA 3DRSA 1GT8A 3D0HE 4DZDA 2F9JA 1CJKA 2LXUA 4I7FB 2I5JB 1EX8A 3L95X 1S48A 3EZOA 1N6QB 2KRBA 3CUNA 1K47A 2VG7A 2EC2A 3BO3A 4DG1B 2KHDA 2JEJA 2EKNA 4L76A 4LF1A 3V4IB 4F7VA 2LECA 2YKNA 2BQ3A 2FJBB 1N54B 5KFDA 5I3QA 1H2VZ 2DH7A 2DO4A 2BKPA 1TKZA 1UJ5A 3L9ZA 4BS2A 4KGMA 4OJ3A 1ROFA 4X4RA 1EETA 4QWAA 4PR6A 2LKZA 5DDQC 1RKJA 1TV6B 2N7CA 2VKRA 3JXOA 2MHEA 2XEXA 4A8KA 3JQKA 5CZVA 1YWXA 2F5GA 1EP4B 3TQ1A 1VQ5S 2W2OP 1RTIA 4B9UA 1RSCA 2CPIA 1UVKA 2VDHA 5J1EA 4LF7F 1REVB 2F7VA 2QMUB 2GHWA 5I4MA 5GAEI 1KVKA 3G71S 2K3IA 1VR6A 2B6AA 4FBTA 1WEYA 2WVBA 2VODA 1ZM3A 3JAMY 1YJ9S 4FKXA 3ELHA 2O5DA 3CJQA 1HWUA 4DLEA 4RW9B 4PKDB 3VAKA 1XMBA 2DRBA 2IM0A 4RO0A 1HHSA 1S9FA 2HWTA 2RS2A 2AJQA 3MM6B 3FEXB 3A4TA 3HP6A 5M2RA 1U48A 4PG5A 4W98A 3UQSA 5D4PA 4E0DA 5EWEA 2MKYA 1LWEA 1N0UA 1FTRA 2NYHA 2DR6A 1Q0NA 5M2PA 5A8RA 4CLUA 3UD5A 1HBUB 1I51B 3HULA 4OZJA 2BV3A 3J7A1 3M2VB 3KLFB 5KFGA 4LVNP 3IA0A 1A6LA 2VBYA 5E3AA 2UZAA 1UW9A 3UWTA 4QBUA 2PE8A 1XR7A 1F3FA 1RHKB 1AZSB 2DNYA 4CLYA 2VQEF 3CO0P 1UA0A 2DY9A 2DH9A 2DNNA 2FY8A 2IM3A 2RDDA 5JMNA 2F1FA 2XZDB 2HHQA 3GIRA 2VKZG 4N56A 2Y1JA 3EVMA 3ZTOA 1IQTA 2RHQB 4B9LA 3RRKA 4ECXA 4CLWA 5T7LB 4WJBA 2MLZA 1HKAA 2QFIA 2AJFE 1Y5LB 1WKKA 3I55S 1YDLA 3QBCA 3W60A 1JLCB 1TKTA 5C24A 4KIAA 2K2PA 1S1WB 3W5YA 2XI2A 1HQEA 4K2XA 4ZPBA 3WC0A 5B08A 4R8UB 4LR8A 3J7YI 3OFFA 2VONA 4DPYA 2ZH9A 4DX5A 2E7WA 1QAJA 1FA0A 1RHUB 3MR6A 2R8KA 3J80Y 2HVDA 4M5KA 4ZJLA 3R5AA 2MGZA 4NZ7A 1H7WA 3CO9A 3HHEA 3KK1B 2ZH7A 3EXYA 4PEOA 4WFNQ 3ET6A 3VAMA 3A8KA 1RAIB 1SH0A 1BQXA 4LF8F 5F9LA 2AV5A 4LFCF 4F4XA 3GCXP 2W7PA 3T5KA 4J9NA 1S9EA 2CJQA 5KT2A 3MMCB 3HHLB 1U2CA 2L9WA 1XWLA 1RK8A 1DAXA 2FYXA 2JX2A 1WACA 2RRNA 2GJ2A 1DTTB 4B3SJ 1T8EA 1PILA 4YB7A 3LP2A 2OLWA 3ITHB 4ICLA 4UUXA 2ADCA 3BQ2A 5CD4H 4LRCA 1NNDA 4KHRA 4USVA 1JLAA 3BJYA 3UCGA 2UXDJ 2CJKA 4HLBA 1JLEB 4P52A 2UUCF 5D3GB 4B3OA 2PFDA 4Q8FA 3SFGA 3EDQB 3SBMA 2V67A 1WWHA 3KHHA 2A0FB 3VVTA 2FHOB 1GMUA 2RRAA 3W7BA 4OJGA 3GPAA 1BHNA 4PG8A 1FO1A 2D7SA 4KSEB 1TZ0A 5CH7B 4FN5A 2PI4A 1WC6A 2HURA 4CTAA 2COLA 3Q24A 2Q79A 3DLKB 4DUYF 4ED3A 2XMTA 2BE2B 2FVPA 2X1GA 1S6UA 3GJRB 4RWWA 2MJUA 4FVCA 3NWGA 1ZM9A 3JSBA 4KQZA 1XERA 2AZ3A 4CI0B 1U6BA 4ED0A 2VDIA 2V2KA 2XWXA 1WKJA 4FXWA 2DNZA 3AQPA 3Q8PB 2IAJA 3KLVA 3SZ2A 3BH6B 2ZC4A 3HHNB 2GVDB 5A8WB 4NLDA 2BJ8A 4USIA 3UD4P 3TUJC 3GJQB 1H72C 3PX4A 4K4YA 1M1HA 2FJWA 3H40A 1HWLA 5GMKa 2R8GA 1F5BA 2DO0A 3OTDA 2R7WA 1YRUA 4F02A 3KFWX 3CJ2A 3K89A 3M6WA 1FXRA 4DS4A 1RDRA 2W9BB 3MEEA 1OYDA 2JVOA 2KJVA 4DR2J 1FX4A 3HSDA 4GVBA 2VOOA 3MM8A 5HATA 2HVEA 1TK0A 4FYYB 1TMJA 4KB7A 4ZHRB 2UVWA 2K7KA 1P1TA 4B3RJ 4U7CA 4G1PA 5IT9Y 3GZ7A 1YJVA 2HQDA 3QO9A 1S7IA 3OXFA 4UTGA 5EX0A 2C2EA 4ZPDA 4ETXA 3NGDA 4ZVEA 2QGFB 4K0KJ 3PACA 2ZBRA 2FLPA 2QA2A 2Y3YA 2FJDB 3A3NB 5ETSA 4F25A 4X62J 4DF8A 1GXLA 5L8RC 1TQLA 3MPWA 1N36F 1WTBA 4MIBA 1XBWA 2HQFA 4WU2A 3BO2A 2HBRB 2IPOB 4N5SA 1PSDA 3CJ0A 1S1XB 4BCAA 1X9SA 1NJWA 2C42A 4I6WA 4UZBA 5D4LA 4ID5B 1HNWF 3OTOF 4F67A 5D4OA 3TX0A 1HPZB 3WIVA 5KFJA 2LQJA 3BV8A 5T14A 1NPKA 4JOUA 3R5JB 3N9UC 1IM4A 1OMSA 1Q53A 3DLLQ 4F2RA 2W9CB 2HFSA 4JV0A 3W65A 3KNAA 2IBOA 1IBLF 3TJAA 4NLQA 3UD3P 3DRRA 3W9JA 3MM5B 2FC9A 2FJAB 3H5UA 4ZVHA 3CC7S 3GIMA 1JLFA 4OYBA 2HHSA 3M2RA 2WONA 3TEHB 2VFRA 2YVSA 1HBOB 2ZHBA 3QZ7A 3FJ2A 4QYZK 2XYHB 3D0IE 5LL6d 4M95A 4JI7F 5I3UA 2BBEA 2FIUA 4MK9A 1FHTA 2F8EX 2W25A 4UOGA 4LUBA 3DDKA 5SUHA 1U1QA 3PXGa 2XCPA 2ZD1B 3CCUS 1RT3B 3EGNA 3IRXB 3TEGA 4DV5F 4YS2A 5LMNJ 1CQMA 5HO4A 2E5GA 2YQ1A 2RNEA 5DJBA 2GV1A 4C3KA 1AXQA 2G2OA 1UWBA 1TVRA 3D4JA 5IC4B 2BJDA 5L46A 1QY7A 1U1MA 4HVZA 2ERRA 2VG5A 4LRAA 2AF6A 2MQOA 1S0MA 3HCXA 4AQYF 1K1QA 1BQMA 3C6UA 4P2XA 3T19A 3G6VA 2A10A 4LSLB 3HVAA 5DO2A 4CT8A 2QRRA 1WUUA 3MPDA 3CIMA 2QIFA 1P9QC 4ED4A 2QLXA 2HVIA 2XSFA 2CQHA 4X4NA 4LF4F 4QR1A 4F4YA 1U0SA 1WHXA 1FRIA 2YH0A 2NXCA 1Q82T 2C2MB 1S72S 1CEZA 1OY9A 4RU9A 4C8OA 4Y6IA 2C3OA 4DOZA 4R0JA 4MKBA 3I0RA 2LVWA 5FDLA 1X5SA 4EK2A 2MY8A 3JQMA 5L39A 5L1KA 4H4MA 4HI2A 3TQEA 1AFJA 2CPXA 2ZITA 3DHXA 1K0TA 2C2RA 4F26A 3QYYA 3IRWP 2AYBA 3QRPA 1TKXA 1FE0A 5A76A 1IKYA 2PIIA 1J5OB 2IIHA 4O3SA 2DKOB 1NDPA 3GV8B 2LYVA 4PAAA 3T1HF 1VC0A 2X1BA 1NPRA 5FLXY 1RAGB 1O8BA 2YX1A 3PW2A 2VPYB 2GNKA 3G82A 5A0YA 5CYQB 1A9NB 1HD1A 1DY3A 2MLXA 2MQNA 5G4DA 3HF5A 4NPOA 3SSQA 4IQMA 3MUMP 2HGMA 1RBOB 3PEHA 4DR7F 2EK1A 3HT3A 2FVQA 1SL0A 5I42A 2B4OA 4ZJQA 1PYTA 4TN2A 4QYZJ 2DNRA 1D8ZA 5J2QB 4Y00A 5KFAA 3QQCD 3QT6A 1M0SA 3R3TA 3OLAA 5AE1A 3SDEA 1T05A 4B3TF 4Q0BA 4YEAA 2M9KA 2AEFA 5K20B 3PVXA 2UXCJ 3CCTA 4WK3A 2XLIA 4ZVSB 2BQRA 3DOLB 2NUUG 2XY7A 4FDFA 1VQLS 4C97A 1YJRA 2X3DA 5HVFA 2VD3A 2E1CA 2GCFA 3MOZA 1KONA 3UFCX 3OVAA 3UDVA 1VC5A 1YJNS 2ZBIA 1QSYA 2QA1A 4O0NA 3DOKB 4EU0A 4DL0C 1VC6A 1LWCA 2CXEA 2OFGX 3I5AA 2RS8A 2VFVA 1QVFR 3N6MA 2B0GA 4USJC 2AYGA 3V4IA 1M5HA 1JX4A 2Y9HA 2LQ5A 5C25A 1K9MT 5AE3A 4DWIA 1S9GA 3MD1A 1JKHA 5DRKA 3LUYA 4EBDA 3M9NB 4NXNJ 5KFVA 4O23A 5FJ4A 2DGUA 2J9CA 2LDIA 2CQDA 2ROGA 2DIUA 2R7TA 7AT1B 1O51A 4WE1A 2BACA 4FS1A 3G8TA 1EP4A 4J9QA 1XC9A 2R7RA 5A8KB 2YBVA 4IRDA 4WP8A 1WNEA 3UVJB 2XO6A 5L38A 4WCEQ 4Q7AA 2OAUA 1N0VC 2XLJA 2OI2A 1URRA 4AL5A 1K1SA 4IG3B 1KLNA 2PMHA 4F8RA 1RT4A 4G3IA 4NYPA 2UV8A 2RDJA 4P9SA 3BGUA 1FDAA 4IR9A 2CDRB 2VA2A 4DCJB 4XO0A 7FDRA 5K8MA 2JL9A 4OZ3A 2FLNA 2N3LA 3PV8A 2CQ4A 4DR6F 4I67A 4OI0A 4ZCLA 2QMWA 1KFDA 2D9OA 1X9MA 4PG6A 2M70A 1SUQA 3CDUA 3P6YC 3QAUA 1WSRA 1X60A 1Q8KA 4JV5F 3MECA 5DS7A 3S6EA 1TP7A 1L3VA 1WELA 1FT8A 1EJ7L 1NK0A 2Z2LA 2WSCC 1S6PB 3M30B 4HHUA 1S1UA 4MFBA 1HBUA 2E1AA 1RYSA 4FNIA 3MTJA 3KLFA 4LRFA 3T6JA 4B9NA 3IMQJ 2E1PA 2R8JA 3W9HA 4F3OA 4X64J 2EG2A 5RUBA 2HK3A 4WXWA 3BYRA 4AXIA 1VOMA 1RT2B 4NZ6A 4UT4A 2OPQB 4JI4F 3CMES 1AZSA 5E3RA 2HIQA 1TL3B 1IJFB 3LGHA 3E2EA 2KM8C 3UN2A 2OSRA 2FVRA 3AXMA 4LIRA 2PMZD 4A8MP 2CPYA 1HBNB 3OTEA 4EO6A 3T5HA 3MFHA 2NZ4A 4DL3A 2NREA 2MSSA 4OX6A 4H4OB 3GV5B 3QRQA 4W92B 3US5A 4LFAJ 2J6TA 4BWMA 2CPJA 3Q8RB 5KFCA 3TUIC 1WEZA 4RW4B 4U6PA 4C8LA 2YQ0A 1B0TA 1A7GE 6FD1A 5H9EK 3W2WB 3QIPA 3FGVA 4X65J 3FCWA 1B70B 1O5JA 2XNRA 2KU7A 3EVWA 4KV8A 3D6FB 5KG3A 4YQWA 2V0NA 4I2PB 3TZZA 4NX9A 3KK1A 1FWLA 3TA1A 5KT7A 1C1CA 2GIQA 2WVFA 4NA3A 4IFYB 3JSMA 5DGAA 3MWBA 4DS5A 4J91A 2OPSB 1Q95G 3M1VB 1SI9A 3MMCA 3C14A 1RAHB 3JS9A 1RWUA 3C15A 3D9BA 3PZPA 2C3YA 3N4WA 1XQIA 1T9XA 2UUAJ 4NI2B 1U02A 1UFKA 2J9DE 4NLVA 3HK2A 1SQFA 4OI6A 2XS2A 1AA1B 2RJZA 5KFZA 4H4KC 2MZTA 2YNGA 4HI1A 5DGBA 3OXGA 2VJVA 4F3QA 2NPFA 2QTWA 3H5YA 1NDCA 4CH0S 5D0HA 2R7UA 5KFHA 2CJXB 4J9RA 3K58A 4WF9Q 4BBYA 3Q8QB 4HYKA 3EX7B 3PG9A 1RLCL 1MWZA 2UXBF 1JLEA 2UUBF 3FDSA 2KVQE 1WI6A 4Q44A 4PWWA 2UU9J 2BRKA 3ILIA 2DCLA 3CGIA 4MAKA 3PW0A 5DM6Q 1R6VA 1S4EA 4J9OA 5HJYA 1W2IA 2CJAA 2HS3A 1S1VB 3NXZA 3T6BA 1VHIA 3PYEA 4ECQA 2V4QA 4L72B 4AFFA 5F8JA 2ZH2A 5E3PA 3MCMA 2W8KA 3ZZOA 2BKOA 1WI8A 3DGPB 2IBKA 2BXJA 3ISND 4TU9A 1D0EA 1UKUA 4IG0A 3JSYA 2ZM6F 2BE2A 2AT1B 5LSOA 4KE5A 2R7VA 2WOMA 5JJBA 2IC3B 2HMIB 2WW8A 3JB9k 2MEWA 4DSEA 3BF4A 3CCZA 2XS7A 2VJUA 3BDPA 5HROB 3B4DA 4O4GA 1O6XA 2YKQA 1CC7A 4TY9A 1X8DA 1E6YB 2GVDA 5A8WA 2O66A 2HWHA 3M32A 5ETRA 3OSNA 1FVSA 3K2YA 2KJWA 3VAGA 2CQ1A 4ER8A 2ZOFA 1TR0A 4HT5A 2OJ3A 2RUSA 4QIWD 1TELA 3MHYA 2W9BA 5ETMA 1H6KX 3CCQS 4DV3J 2WSFC 4LSNA 4AL7A 1U26A 4NLYA 4LRBA 4RL1A 3DM2A 3R5GA 2ZBCA 2B4VA 1PG5B 4DR3J 3CJSA 3NS7B 1C4CA 5HL7Q 3EE3A 4ZK7M 4IOAQ 2R7XA 3GQCA 4ZHRA 1UPMB 1S7HA 2E5HA 2NUHA 5C2GA 5GAGI 1EKSA 4RX6A 3PJ9A 1S1TB 2HSEB 1KFSA 2WVCA 1Y5IB 3QMQA 3R6GB 5CYJA 4CLKA 4J37A 2QL7B 4ED6A 1X4AA 3FSXA 2IVFB 4OYWA 1FFWB 1S10A 2R9LA 1X4FA 1DQ8A 2MTLA 3NNAA 1B4SA 2OD4A 1UW4A 4S0MA 3MDFA 3QGPA 1WDDA 2BANA 4F4AA 3GR0A 4LSZB 4YR0A 4ZCIA 4OL8A 3J81Y 2ASJA 1FD8A 1VBYA 4RJVA 3V6HA 3RG6A 4JI3J 1CLFA 2CJ9A 2E5IA 2GAHC 3IBWA 1S1XA 4JI0F 3ZFVA 1S57A 2F63A 4CH1A 2Y8YA 1RISA 3D2WA 2C3MA 2XMJA 4OZNA 2JEGA 4YMEA 3M2UB 3CJKA 3OL6A 4X4SA 2MZJA 2DGOA 4OJHA 2V4JB 4OHVA 1HPZA 3BYPA 4L74A 3NMRA 3KLGA 1MN7A 2GA7A 5HMXA 3C16B 3UN5A 3I9V9 1SQEA 3ZC4A 3MPVA 2IM2A 5M2UA 4RR5A 2AU0A 4ZCMA 4LFBF 3TWZA 4I6AA 3BGFA 1Y9OA 2IYGA 1FFGB 4KH0B 1Q1KA 2Y0SD 5A2QY 2L48A 4OHZA 3OBIA 1YTYA 2HHVA 2WCXA 4CYUB 2B9XA 1HMVA 1UA1A 1R0AA 2AX1A 2B56A 2NZCA 3G8QA 3MMAA 4V1Ak 2FZCB 5HK4A 5D8HB 3KUEA 3GU0A 2W2QP 1TK8A 1C0UA 2OGUA 4OYIA 4J9VA 1SH2A 1YBAA 2GS8A 2HNDB 5LT5A 3H7HB 3F41A 4K8RA 3RR7A 1KQGB 1KQSR 2HFNA 4M5DB 1FKPB 4WXOA 4DSLA 1RT3A 3EJMA 3QRRA 3Q2SC 3IRXA 2VG6B 1CJUA 3IWXA 1RWPB 2KDOA 3T1YJ 2RD5C 4WBFA 1UVIA 2N3OA 2WSEC 3J7Z5 3MR2A 3PKYA 1FKOB 3MMJA 2JLGA 2DNPA 4KGKA 1CULA 3HHLD 2G1DA 3UE2A 2CQIA 4W90B 2F8HA 1WF2A 3ZNJ1 5GAEU 3KNGA 3LP0B 4DEZA 2J7UA 1U1OA 3H98A 3BSAA 1FWPA 3IGVA 4ZDNA 4DDFA 1PAUB 2OH2A 4NYOA 2Z58B 1LWFB 4BHQA 2BMBA 1KQKA 1SKSA 4ECVA 2AKWB 2GMHA 2JHEA 4TY8A 3MEGA 2C2DA 1JJCB 2OUGA 3ENAA 1VS3A 5LMUJ 1FJ7A 3MPUB 4ZLPA 1X4GA 3HM9A 2LFVA 2OP5A 3CMAS 3I6PA
chains in the Genus database with same CATH topology
2B51A 2NYIA 2F4VF 2DGQA 4LVNP 4URSA 1D1UA 2GQ2A 3GG1A 4MIAA 3HMJG 3IA0A 1A6LA 2VBYA 5E3AA 5KOWA 1D9AA 1ZM4A 3WZ0A 1KNZA 3THPA 3U1LA 2DHSA 2UZAA 1K73T 1RTJB 2YWFA 1HBMA 5CCLA 3UWTA 4NMLA 4QBUA 2PE8A 1XR7A 2GQCA 2ZFHA 2HW3A 4WIIA 3SCIE 1JLBB 4YHHF 4KBIA 2YH1A 1M1KT 3K0JA 2P5VA 2KG0A 2DNYA 3CDBA 2VQEF 3PX6A 1UA0A 3E01A 2DR5A 2DH9A 2DNNA 1I94F 2B4PA 3I4PA 1S1VA 2FHMA 2IM3A 5C5JA 2LXFA 2F1FA 4O0IA 1VQ7S 3KLEA 2HHQA 1S0NA 1G7CB 1HHTP 4Z37A 3DYAB 4F2SA 4YR3A 2DRAA 1W25A 4WFYA 2VKZG 4N56A 2Y1JA 2VBXA 1DARA 1RTDA 3MM7B 5J2PA 3DRRB 2XGQA 2WBMA 3TOQA 1IQTA 4I1TA 1JXLA 4B9LA 4PWUA 3RRKA 4ECXA 1Y4ZB 2CIMA 2DHAA 2DNQA 4ATNA 1RYRA 5T7LB 3R27A 1JLFB 4WJBA 2VOPA 3L7OA 3Q0AA 1Q7YT 2WONB 4L3NA 2AJFE 2Q66A 1Y5LB 3THVA 3PIOQ 2YKPA 3I55S 1HI8A 2VB6A 2JC0A 3OR1A 2DGTA 1V3RA 1JLCB 1TKTA 4YB5A 4DSJA 5G0RA 5C24A 3PFEA 1F5AA 3OW2R 3HFKA 1TKDA 4KIAA 2GQQA 2K2PA 1ZAWA 2JSXA 4NLSA 4A4JA 5F8NA 1S1WB 5BJRA 5LSRA 1TAUA 2EWHA 1NK9A 4IR1A 3MR5A 1N34F 2XI2A 4ZP7A 1HQEA 4Q8EA 4GKJF 3CC4S 2DPIA 2XBPA 5K5MA 3BGRB 4IDKB 2I38A 5HROA 1DQAA 1R8AA 5B0FA 4K2XA 4ZPBA 1N56A 3WC0A 2G9OA 3NGKA 5B08A 4I64A 3EPIA 1C4AA 1FRXA 4R8UB 1XNRF 2DHGA 3AA9A 3J7YI 3OLBA 3OFFA 2M5YA 2VONA 1NHVA 3SFUA 2LU1A 3S1TA 1N5YA 4IYQA 5BYSA 3SV3A 5I3UB 4G1IA 4G1QB 4KR0B 2J7WA 3KG1A 2ZH9A 5J2QA 4B3RF 5EGYA 1VRTA 3TA2A 4ELTA 4ECWA 3ZZTA 5KFMA 3UW1A 2D3ZA 2E7WA 3GIKA 1QAJA 1FA0A 3MR6A 5KG6A 1UVMA 3J7YU 4TU7A 4RWXA 2BW2A 1BWEA 2R8KA 4P7TA 1HWIA 4NLTA 3J80Y 3GR1A 3I87A 5F3TA 3RAMA 1TL1B 2HVZA 4NLRA 1FK9A 2HFZA 3R5AA 2F9DA 2MGZA 2J6UA 4NZ7A 1H7WA 4CNYA 3SYZA 5DDPC 3LPYA 3L7PA 3CO9A 2ADBA 3HHEA 3KK1B 2ZH7A 3VAIA 3EXYA 3U1MA 3ONQA 1VQ6S 4WFNQ 2L3MA 3VAMA 1UWBB 1U2FA 5CQGA 3KKFA 3QJPA 1C1BB 1TVRB 4WU3A 1Y00A 2NS1B 2UUTA 5B0EA 3CDEA 4OMFG 3AH6A 1H98A 2A2DA 1SH0A 1BQXA 4LF8F 5F9LA 4X62F 4YUDA 2AV5A 4LFCF 4YFUA 3MTKA 3MUVP 4F4XA 4QPTA 3LANA 3O2IA 2W7PA 3T5KA 4J9NA 1S9EA 3EPGA 2CJQA 5KT2A 3MMCB 2N82B 3TW0A 3HHLB 1Q7LB 5MAOA 2HFOA 2L9WA 1XWLA 1S1TA 3TVYA 2VG5B 1RK8A 2J0SD 2VL1A 1JMTA 3B78A 2OPPB 1M5PC 1S6QB 1R6YA 3DLEB 1GAOA 2F8MA 1DAXA 3SCKE 5L1LA 1H0HB 2ZUGA 2JX2A 2Q1LA 2FD2A 2MDAA 2XNQA 4CO3A 1WACA 2BZ2A 2P9GA 2RRNA 3GIIA 3BO4A 1Q8IA 1BQMB 2GJ2A 2GGPB 1DTTB 1N5VA 3ISZA 2QMXA 1T8EA 4PXCA 1PILA 1JJ2R 2RDIA 4YB7A 1WG1A 2JOQA 4B9VA 1QAXA 3LP2A 2ZJQQ 2OLWA 1MMDA 1V3ZA 3ITHB 2DNKA 4I0WA 2PDAA 4ICLA 3DLJA 4UUXA 4ZS6A 3T1YF 2ADCA 1YI2S 2HHUA 2GX8A 5EN1A 2YWGA 4NCGA 3BQ2A 4NXMF 5DDRC 5CD4H 1FNXH 1NNDA 2O01C 4ZMMA 2DD8S 3DRXA 4KHRA 4AL6A 4Y2IA 1XN9A 2I9SA 4KT0C 3QGGA 4ILLA 3VQSA 4O44A 4UY8T 4F50A 2HHWA 1B0VA 4OI2A 1JLAA 4KHPF 4NWBA 3R1HA 5ITHA 5H9EJ 3OTCA 2MQLA 1P1LA 2IRXA 3NRBA 3KK3B 3BJYA 1YGYA 3TUZC 1KC8T 3GSDA 3UCGA 4K4WA 2CJKA 4ZVGA 4EYHB 3IWLA 4Z2XA 1TK5A 1G1XA 3CDAA 3I0SB 4HLBA 4ALZA 2OPRB 3E51A 1FDNA 3K59A 3GB0A 1JLEB 1X0FA 3RRHA 5IM0B 2UUCF 2EW9A 5D3GB 1S4FA 4PPZA 4B3OA 5J1PA 4Q8FA 3SFGA 2OTJS 4TQSA 3GFHA 1S76D 2PC6A 2NSCA 1YVFA 1LFPA 2MY7A 2YNHA 1DZ5A 1ZYQA 1WWHA 2B5JA 1VQMS 3I56S 3KHHA 3KG4A 4I56A 2ZOMA 3LAKA 2PGCA 1DTQB 3M6XA 2V4JA 2RE1A 4QW8A 1TFWA 2MZQA 2FHOB 5MLCV 4ETZA 4X66F 2RRAA 3W7BA 4OJGA 4ELVA 5GADI 5FDLB 2DGWA 3QAEA 3JYTB 3N01A 3BR9A 3GFYA 3H5SA 4KHMA 2L41A 2FJVA 2YKMA 4PG8A 1UVNA 1R3NA 1FO1A 2D7SA 4DHVA 1VQKS 3CD6S 1IXKA 4KSEB 1TZ0A 3NMAA 5CYMB 5CH7B 4FN5A 1FRKA 1IKWB 2PI4A 5LMUF 2V4RA 4OHXA 2HRUA 1GQEA 2WBRA 3PW4A 2J7KA 3HX9A 2GMLA 3IR5B 4WZMA 4NLOA 5F8HA 4CTAA 1FNMA 2COLA 3LQVA 4WYLA 4B9TA 1TKXB 5B0AA 3Q24A 1IKYB 2PSZA 4HKQA 1FJEB 2Q79A 3CCWA 4DL5A 4HTIA 1FF2A 3DLKB 4L6V3 1Y3JA 4DUYF 1P8GA 2HS4A 3DCAA 4ED3A 2JH3A 2XMTA 4I7FA 2I5JA 2IHR1 2BE2B 5SZTA 2RKIB 2FVPA 4A8YA 2EBEA 1XR5A 4CO1A 2JC1A 1N6QA 1VRUA 2X1GA 3KHLA 4JI1F 3QWPA 1S6UA 4ZP6A 1OSDA 1S49A 3CCJS 1ELOA 2MJUA 4RWWA 4Q5VA 1JIHA 3PW5A 2LEPA 4FVCA 2EFVA 5A0YB 4WYWA 2AQ4A 4GC7A 3NWGA 1ZM9A 4DG1A 3JSBA 2IFXA 4ED8A 1IR0A 4KQZA 1XERA 3ICLA 4M63A 4CI0B 1LK5A 1FRHA 1U6BA 4ED0A 3C3LA 1LW2B 4GO5X 2V2KA 4X4PA 2XWXA 1U24A 4FXWA 2DNZA 5KOXA 2ZKTA 3KLHB 3AQPA 5H1SV 1ZZNA 3D54A 3I31A 3Q8PB 2BM1A 2IAJA 3KLVA 3SZ2A 1SH3A 2ZC4A 4PWDA 4ECRA 1HWKA 4OX7A 3V6DB 5I42B 1UEVA 3HHNB 1FXLA 5A8WB 1N33F 1V3SA 2AYMA 4NLDA 4USIA 4B17A 1JK9B 3UD4P 3TUJC 4NCAA 4OX9F 2MKSA 2BA9A 3M8QA 4UQTA 4Q2LA 3PX4A 4C7QA 4K4YA 4JV1A 2FJWA 2K8GA 3H40A 1KVJA 1HWLA 3GWCA 5GMKa 3DU5A 2R8GA 1VJWA 3OXLA 4NRUA 1F5BA 4QYRA 4RZRA 3G6YA 2VQFF 4TLQA 4FP9A 2DO0A 3CE8A 2W7OA 3OTDA 4A8XA 2MYFA 1TV6A 2LCWA 1P27B 2FC8A 2MKJA 3KLIA 2R7WA 4HDHA 2C28A 2JEIA 1YRUA 3GYNA 4F02A 2XO7A 3KFWX 3CJ2A 4N8OA 5KFUA 3RU0A 3SDEB 3M6WA 1FXRA 2G4BA 2C22A 4LQ9A 4DS4A 3VZHA 3M8PA 4QIVA 1RDRA 2CQ3A 3DN9A 2W9BB 3MEEA 3BQ1A 2R7SA 2ZH4A 2JVOA 2KJVA 1LV5A 1FKPA 4Q0BB 1KHWA 5E3CA 3IR6