3CC2V

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc2V00
3CCUV 1QVFU 1VQKV 1N8RW 1VQ5V 1YITV 1M1KW 4WFAV 1VQNV 3G71V 1R73A 3G4SV 3I56V 4WCEV 1VQMV 1JJ2U 1Q82W 5DM6V 1VQ9V 3CCJV 1YJ9V 1Q86W 3CCVV 1YHQV 3CC4V 1K8AW 2QEXV 1YI2V 1NJIW 2OTLV 1VQ4V 2OTJV 1KD1W 3CCEV 3CMEV 1VQ7V 1YIJV 2D3OW 3CCQV 1K9MW 3CXCU 3OW2U 1VQLV 3CC7V 1KQSU 3CPWU 1VQOV 1W2BU 1M90W 3G6EV 1KC8W 3CCSV 1Q7YW 3CCMV 3CCLV 1VQPV 1Q81W 1VQ8V 3CD6V 4WFBV 3CC2V 3CMAV 3I55V 1S72V 2QA4V 1YJWV 3CCRV 1YJNV 1QVGU 1K73W 1VQ6V 4WF9V
chains in the Genus database with same CATH superfamily
1HNXB 1TUBA 4L8JA 2ETNA 2V7QG 1SRYA 3ABKB 3BAAA 3A2FA 3T1YB 3ZMZA 5FNVB 5FLXN 2CH7B 2GTAA 1ZLZA 1Q90D 4J7JA 3OR6C 1I94O 3JATB 2G38A 1QVGU 4UXNA 1Y76A 3RYIA 3B8NA 3ICXA 2WLNA 2CAZC 1BE3H 1TVKA 4IL6Z 2Q7GA 2JGDB 3SJCC 3O65A 1FXKB 1H8EG 4I55A 3JD4A 2JDIG 2BTOA 1OCRB 3FAVB 2IJKA 4JGSA 1MSWD 4DUZO 3O9OA 3B40A 1IXBA 2UUCO 1S0VA 4DV2B 5D5PA 1WPXA 4PDRA 3M8AA 4DO2A 3OTOO 3OGIB 3S3XA 2DYRB 1GK9A 4LC1A 3U10A 5IYZA 4BW5A 3OEHG 3SYAA 4HYOA 1VQPV 2ZDIA 1VF7A 1M56B 3B2EE 2OCCB 3D8CA 1KKCA 4PDVA 1VQMV 2V4DA 2PI5A 2M7WA 2CGOA 1P4RA 1YJ9V 4DR1B 1BS3A 1YI2V 1F23A 1ORQC 4MVZA 3D3QA 3VQXA 4HNAA 2QM8A 2LFRA 1UJWB 2YIDA 4HBNA 2ZE5A 3JD0A 3LSSA 2A79B 4UCVA 3BVOA 4EB6A 1TAEA 3OT7A 1N34O 1N32B 1FXVA 5LA6A 2ADPA 3BRCA 4JI0B 2EIJC 1L8DA 3W7SA 3FB6C 4YIPA 1NI8A 1FFTB 3EVKA 4J11A 1KP2A 1GN6A 1GM9A 5KLVH 5HFLA 5IWAO 2CDYA 4YY3O 1AI5A 2EILC 1Y74A 2HFEC 1H38A 2EINB 4PA6A 3G6EV 3K3WA 1W59A 4X64O 4MTGA 4X20B 1HR0O 5EBWC 3J7AU 4B3TO 2FYUH 1J5EB 3NR7A 1E1QG 1MMMA 3T4DA 4JASA 2YI9A 5J2TA 3AG2C 3PJSK 5KHJA 3T1CA 2OIEA 4J42A 4BIZA 4K0KB 2KKWA 1AJPA 5JVDB 2ZE8A 4B3MB 3L9DA 3IFXA 4I0XB 4IIJB 3JSNA 1HP8A 4QE9A 1N0JA 4I5SA 4LF9O 2PUSA 5CA3A 1N33O 4BIOA 5LP6A 4DR2O 1XMQB 2Q6AA 5KA6A 1FXHA 5LOVA 1K92A 2RDCA 3FFQA 1QLEB 1GN3A 2EJRA 1FAFA 4OX9B 4E4EA 2B9ZA 3T1HB 4WFAV 3E22A 3A8TA 4LCUC 2QM7A 5JCOA 2ITDC 2X6BA 1K8AW 3QO7A 1R6TA 2K9PA 4W4LA 5L3EA 4GKJO 5FL7G 4LF8B 2DQ3A 2QTSA 4HAMA 2HKOA 3K0GA 2X6AA 3BEHA 2Y4TA 3D36A 5BR8O 3C90A 3ZHRA 1R6NA 4FVMA 2CK3G 1WA8A 4PI2A 2F4VB 4KUMA 2YICA 1PL0A 2GSMB 4U7NA 4MTFA 3OMIB 1RPOA 4DV3O 4JYCA 3ABMC 3RWRD 4LF6B 4IHJB 3LNMB 2Y69B 2ZQMA 3L75H 2QA4V 1XL6A 2UXCB 5B3SB 4NVPA 2Q0OC 1NR1A 4R7CA 2MK3A 1XBLA 4QGPA 5HFMA 4GX0A 4TQDA 4FM2A 4R8CA 1VF6A 4MVOA 2AZ0A 1L0NH 3STLC 1YEWA 1I5XA 1D5AA 3DXRB 4LF5B 3ZS8C 3CCUV 2P7TC 1H2KA 1P7GA 2QJ1A 1M93A 3A0BZ 4RUEA 1UFIA 3K06A 4EFEA 4LNUB 2R70A 1AILA 3G67A 4JI6O 2JEXA 3K04A 4TWKA 5CBFA 2ZD9A 3K9SA 1VQ8V 1SZTA 2Y48A 4PI0A 3ZRXA 4C7UA 3F7YC 3UO3A 1SA0A 5H2FZ 2YEVB 4DV6O 3HR0A 3HKCB 3CJHA 4XBFA 1LR1A 1PNLA 2YDEA 1IURA 5F2VO 2D2CB 1D5NA 3CMEV 2UXDB 5FNVA 4JTAB 3ZMSA 3QTCA 1Q6UA 3TK1A 4IYHA 5KX5A 1MZFA 1AR1B 3JATA 1OCCB 4JYBA 2UU9B 3JD2A 3J80N 4PD4F 3P3NA 5E1AC 5B5EZ 4TV8A 5FPOA 2CTQA 2IJHA 3EXAA 4DV5B 3AG7A 2Q8VA 2QWNB 1V54C 2ILMA 3W7TA 5IYCO 3IJ4A 2VS0A 3JAWA 4FLUA 4I9WA 1QNMA 3CCMV 4FIPC 4ZKIA 3W7WA 4PDMA 3ABKC 2LQTA 2MW2B 2UUAB 4W4KA 4JYAO 1BGYH 2OTJV 5GTIZ 4I7ZB 3QNEA 1PP9H 3CCEV 4PA7A 5GTHZ 4DR4O 4N23A 4ICGA 3CCQV 4X1IB 3N2GB 1K9MW 3AG2B 3A0RA 3OR7C 2KQXA 1XL4A 2B1GA 3E8BA 1R3IC 1FXKC 4MTOA 1PNMA 2AGAA 3QVNA 4H13B 2AHYA 4R6ZA 4CS3A 4DR7B 4OPAA 1IZ3A 4I4TA 2B5UA 4O2AB 1OCRC 4Z2WA 5LHHA 1E1RG 3S3WA 4ZBMA 4DRXB 2CTRA 4YJ3A 4LH7A 4GKKO 2WLLA 3CCRV 2RQ6A 1Q6IA 3HKBB 3KCXA 4B3RO 4ZOLA 4Q20A 1LUVA 4DV4O 1HNWO 4GYCB 5LXTA 5EIBD 1G8MA 4CH6A 5KHGA 5IDJA 5KAIZ 1M56C 2YIAA 2OCCC 2X0LA 2XAHA 1R3JC 5IT9N 1H2SB 2FL4A 2JIZG 3RFRA 1XNQB 4NYKA 4NXMB 4D6TH 3K5LA 5BMVA 4UCTA 4DV1B 1GRJA 1H2MA 3I56V 3ZIAG 2FMLA 4UCRA 3N2KA 4X62O 4DV7B 4MVRA 1NVPB 4LWSB 1VQLV 2ZCEA 4IT5A 4J41A 4O4IA 3AK2A 4DK0A 2P22C 5KHHA 3GWOA 4JI7O 1NR7A 4P9PA 5D5QA 5B66Z 1PM9A 5BZBA 4X66O 4LP8A 2EINC 3ETEA 4MSWC 2QWOB 4DXWA 3ASNB 1MA1A 2F66C 4WFHA 3CRQA 4CBCA 4MW8A 2WA4A 4X1KB 1JFFB 2ZR2A 2QWRB 1NVPD 2EJ7A 4DUYO 1SQQH 2GHYA 1HNXO 2BCCH 1K33A 3CS5A 3E35A 3LUTB 3X2QB 4GLXA 3IGAC 1QR8A 2RMKB 3T1YO 3ABUA 3Q4HB 5L3CA 3OMNB 2XAGA 5CA0B 1QCEA 3CCLV 2JVDA 1MOFA 3BPZA 1Y67A 2HJDA 2UXBO 3LNNA 4UCSA 1JX9A 3OEEG 4DR6B 2YUAA 3B8MA 1QLEC 1SC5B 5EZYB 3WU2Z 1EM1A 2QDOA 5J2UA 3U0ZA 4WBNB 1DTOA 1IBLB 1R6KA 3CC7V 3CXHF 2AZ2A 3APQA 2WLIB 1Q81W 2QKSA 2LP7A 1PD3A 2UUBB 3JARA 4JAAA 1AJNA 3E8GA 3IC9A 2KG7A 3B4SA 2X6CA 3OTFA 1K5QA 4NR1A 3AG1B 3JALB 3HKDA 4DV2O 1EN4A 1NQTA 2DMXA 1GN4A 1Q7YW 2P6JA 3K5OA 4U7OA 3WB0A 5JH7A 2WPDG 3RYFB 3HPLC 5GONA 3RYHA 4D7SA 4PJ0Z 1Q82W 1RSOB 4KP4A 1OCOB 1NJIW 4JI2B 5AG2A 3TXSA 3CSXA 5JJJB 2Y69C 4LNUA 3RW0A 4LFBB 4DR1O 4X88A 3VQWA 2YSUB 5B3SC 1KP3A 2IH3C 2DWEC 3DC5A 1N32O 5J9PC 2HEPA 1R73A 4ZHQB 2R9IA 4CC6A 4NTWA 2WLHA 4TT3G 2Y0IA 1LUWA 2ZKOA 2ZINA 4YIOA 1WB8A 5LYJB 5B1OA 4F6RB 1YIJV 4TOIA 4X65B 4LF7B 4QE7A 3BA8A 3CRMA 1K73W 4YJ2A 1OJHA 1EZVH 3RVYA 3VOUA 3RT3C 2X7RB 3K9AA 1J5EO 1X4TA 4DR3B 4G28B 1N36O 2JEUA 2EZPA 3JD3A 1I08A 2PY5A 5IE9A 3K59A 2QSAA 4LFAB 4K0KO 2E5LO 1SQXH 5JQGA 4YHHO 1URFA 3K79A 2E74B 1VQ9V 3ZX6A 4PA3A 2JK5C 3C3SA 1IX9A 2HVKC 2Q67A 3RYCB 1H2GA 3AG4B 4JAVA 2M6YA 3OW2U 1OCCC 5K1PA 4TV9B 4AI8A 1ENVA 3BA9A 2Q69A 1KBHA 3SGIA 2LW7A 3JASB 3C3TA 1XI1A 4OX9O 5KMGA 2IW5A 1KB9F 3SPJA 4JI4B 3T1HO 5LMNO 1Z5WA 4X1YB 3ZMVA 4J9YB 1B3QA 4O2AA 3L73H 5EYPA 4DV0B 2ADQB 4WFGA 5EBLC 3P32A 1EN6A 3B09A 4LF8O 2E75B 5IJ9A 3G4SV 3HKBA 2HHHB 1NT2B 2Q73A 3ZRWB 4GZRB 5EIBC 3MAQA 4MVQA 3E2EA 3SJAC 1Y6XA 3ZBHA 3K58A 2F4VO 2VQFB 1LNQA 2Q68A 3ZJZA 1YJNV 1SZXA 1EN5A 3UO2A 4JI1O 5CMUA 4LF6O 1MSDA 2YS8A 2YI8A 5CB4B 2UXCO 2XOKG 2KB1A 1HDJA 1K7DA 4JV5B 3F7VC 1JOYA 1Q8IA 3MHHC 1L1FA 1B06A 1XMOB 1KECA 2ITCC 4FFBB 1XOUA 4FM1A 1ZUQA 3JAKB 2OYQA 2GUZA 4O2BB 4LF5O 2EBOA 2F1MA 1I5YA 4RQFA 2LFSA 4AQYB 1IBKB 4I50B 2OTLV 3TGUH 3SPHA 3UKMA 2JGUA 3ABTA 2OT5A 4NXNB 5ITZA 1KU9A 4XDLA 5IJ0B 3ETGA 2XT9A 3SJQC 2KSDA 2UXNA 5IWAB 4J80A 4LF4B 1GM8A 5EC2C 3QO8A 4G27B 1VQNV 4H33A 5KHKA 2Q5ZA 1ZL8A 4KXRA 4FLXA 2RN9A 1NU1H 1YDXA 4JI3B 5IY5C 3SDLA 2QKCA 4JI8B 2UXDO 4O4LA 4UCOA 1YF2A 1BL8A 3ASNC 2HR3A 2UU9O 2PI4A 2A9HA 5EZYA 2RNBA 1W0KG 4DV5O 2OIGA 4WBNA 2BTQB 3JCZA 4PELA 2WWWA 1UPGA 2NN4A 4LF9B 1B6QA 1GO3F 1N33B 4DR2B 1S5JA 3D3IA 3X2QC 3JYCA 1S3JA 4G2KA 3CCVV 1Z2GA 3ZMUA 1SF9A 2UUAO 1ZWIC 5B1BB 5LHGA 1VF5B 2Z0AA 4MT8A 3SR2C 3CCSV 1SESA 2YC0A 2AHZA 1TUBB 4TUYB 3BY6A 2ZM6B 4JAUA 3OD4A 4J7KA 1SS3A 3H9VA 1NS1A 1TA8A 2IH1C 1QLNA 1PKXA 2H94A 1AR5A 4KFMA 3ABLC 3AK1A 3BABA 3JCUZ 3AK3A 1S5LZ 4DR7O 1T5EA 1Y76B 2DJVA 3P30A 2CH7A 3RYIB 4ASUG 2HG5C 1KQSU 4FPPA 1SQVH 3FB8C 2IBZH 3UQ8A 5KA5A 2PGGA 2QKAA 3AG1C 2F43G 1FS0G 4NKGB 2HP8A 4ZI7B 4I55B 1I7FA 2ZT9B 2JGDA 1TGOA 1FXKA 1JVMA 3H01A 1IXMA 5CA1B 2NLJC 1JJOA 1OCOC 3FAVA 1XILA 4QNHB 4OPHA 5LMUB 1Q86W 1IDSA 2VWJA 5IYZB 2P90A 4PA9A 4F4LA 1P49A 3E89A 2FB5A 4DV1O 3CE2A 2EZOA 2QWPB 2XAJA 5L3DA 4FLZA 3AG3B 1G4YB 1R3KC 1XNRB 1A32A 1R1BA 1AR4A 5E79Z 3W7XA 4FLWA 2N74A 2AXTZ 1V55B 4WF9V 4KL1A 2YXHA 3AEIA 3H1LH 3UM7A 2BSKB 3ZRSA 4KHPB 4JI6B 2P4KA 3SJBC 4HNAB 1WB7A 3A0HZ 4PV1B 4O4JB 5L3FA 4EB6B 3K5MA 4CS4A 2ZE7A 4ZIBA 5LA6B 3CXCU 3RYCA 1IBMB 3CPWU 3K57A 5H6RA 1GKFA 1JCHA 1F4MA 1QVFU 3ZHTA 5H5NA 3R66A 2VRZA 4LBEC 1RPRA 2DYSB 4MVMA 4FLTA 2V1DA 1NBMG 3SYQA 3RVZA 1THZA 2GBOA 2N05A 2XNDG 3THOA 4UV8A 2YXYA 1IVSA 1KYOF 1JQ0A 4LFCB 5DN6G 4U3JB 3ETQA 2Q4PA 1BCCH 3CP1A 4LH6A 1QQCA 2PYLA 2E3CA 4B3SB 4X20A 4WCEV 3AG4C 3IC7A 4JZGA 1HNZB 1O9GA 2Q9LA 1DGSA 1H2NA 3ZRWA 3ASOB 4QPJA 4FLVA 4AILC 1OCZB 2A06H 4JYAB 1YJWV 4EFBA 1IBLO 4FMTA 5IY5B 5JVDA 2QM4A 2PTMA 1F51A 2QR4A 3OUSA 2W0FC 1JR9A 1VEWA 2P67A 5LP6B 4K3AA 5LOVB 2UUBO 2LO1A 3OMAB 3LSUA 4I0XA 4IIJA 5LGTA 1FJGO 4CH5A 2O57A 5H9CA 4N21A 1P7BA 4QPKA 2WLJA 4EEQA 1QHTA 2ZNJA 1S72V 3E22B 1PV0A 2AW9A 3DC6A 1NTKH 4P30A 1YVWA 1SETA 4UB6Z 4DR5B 1KKDA 1KD1W 3JAMN 2E76B 2IJJA 4GX5A 1QU7A 2VQEB 4JI5B 4JI2O 2CE4A 3OGCC 3UCSC 1HNWB 4LFBO 4O4HB 5IJ0A 3ZCCA 4GX1A 3FYEB 5KUKA 3H1KH 1M9NA 5EC1C 1WA8B 1KUQA 3K0DA 3H1JH 4RQEA 2NR5A 3ABLB 4X65O 1Y4MA 3SPIA 4LF7O 1Z5VA 1M57C 1CXZB 1WN7A 4IHJA 1ZAUA 3STZC 1AI6A 1MZEA 2Y4UA 1EZJA 1Q43A 4EKWA 4D7TA 1XDCA 3MHSC 4CC5A 4NTXA 3KZIZ 3ZHQA 4ABMA 1G6UA 2GDSA 5JJEB 1XEQA 3TETA 4UVAA 3L70H 5LGNA 4DR3O 4X66B 1AJQA 3DXRA 5A9GA 1US6A 1K5SA 4LFAO 2JS5A 3DSQA 4P2ZA 1VQ4V 3OE7G 2JJ1G 4CH4A 2R9RB 3HKEB 5DECA 2H3OA 5C93A 1SA0B 3ZN0A 2PF4E 2Q7EA 3APOA 1M1KW 3N27A 1N4CA 3CJHB 4X9QA 1XHZA 2XASA 1HW7A 1U96A 3FB7C 4TUYA 4JI0O 1NH2B 3KG2A 1EBOA 3L74H 2LGQA 3PN1A 1YHQV 1WP8A 5B1AB 1BQ0A 2YEVA 4RUFA 3HKCA 4JI4O 3ETDA 2IM9A 2UXBB 1XHXA 3CEIA 4I9QA 2FTKA 3OFNG 5KX5B 2DE0X 5KHIA 3LSQA 4TV8B 4DV0O 2ZXWB 2XAFA 5B1BC 1SQFA 4UVCA 3U11A 4CH3A 5C8YB 2QEXV 4ZI7A 3JAWB 1BMFG 2JJ2G 5CBGA 4FK5C 2HHHO 4L87A 4J10A 3K08A 4FLYA 3H1HH 1S5HC 1NH2D 1GM7A 4H44B 5CBHA 4B7KA 5CA1A 4GCZA 1CPYA 2XTAA 1P84F 3WG7B 4B3MO 2VQFO 4F6EA 1FFXB 1JA8A 2OCHA 1NZ6A 4JV5O 1XMQO 1KC8W 1DK1A 4X1IA 3FB5C 3N2GA 4YXWG 3I55V 5TISZ 4UUJC 1XMOO 4FFKA 4UB8Z 2JS3A 3OUFA 4I4TB 5DM6V 2BSKA 3MDSA 4BW9A 2HLDG 1I94B 1YSCA 1J95A 2ZR3A 4YJ3B 1RM1B 2D3OW 4O4JA 2WLLB 4AQYO 3OM3B 4J9ZB 1IBKO 4P9OA 2CTWA 1M90W 1AROP 1AI7A 4ZOLB 4DRXA 4WFFA 4NXNO 2GTSA 5LXTB 5GW7A 3FD9A 1BSMA 2EIKB 3GVMA 1N8RW 2WAMA 3AG3C 3CRCA 3FKSG 3IAYA 2ZDIC 4LF4O 4A5UB 5LL6Y 3CC4V 4PHZA 1PPJH 5L3BA 2DOSA 1HWYA 1WNSA 1V55C 4DUZB 2XHBA 4JI3O 5B1NA 3K5NA 3UT5B 5BMVB 4K8ZA 2UUCB 4JI8O 5BXZA 4MVUA 4UVBA 4PA4A 4Z1VA 3DTUB 3N2KB 2YXLA 2BOBC 4JYYA 4U3JA 2EIMB 4IYIA 2WA3A 3E83A 5CN0A 1OHHG 3OTOB 1N36B 2CTPA 2Y0PA 2EX3A 1SERA 1R3LC 1GMGA 4O4IB 2DWDC 2LGWA 3F5WC 3RN4A 2E5LB 4YHHB 4LWSA 1SQPH 2DYSC 3ZN1A 2P5OA 4MW3A 3KCYA 1AP6A 1MABG 2DQ0A 1M57B 4BAYA 2FKXA 2ZNIA 1X59A 1N34B 4BR6A 1NTZH 3OAAG 3JSLA 2W6JG 1H8HG 4E2LA 3E8HA 4X89A 2P06A 3CMAV 5LMNB 3CWBH 4YY3B 2A0LA 4JTDB 5H6QA 5IYBO 1BHAA 4X1KA 1JFFA 3L71H 1B04A 2W0XA 3CB2A 1EFRG 3WB2A 2ZM6O 3CYOA 5FPRA 2YIBD 3ASOC 4CZZA 1BHBA 1OCZC 1MNGA 3I5DA 2NNUA 4X64B 1BT8A 1HR0B 3G80A 2N04A 5JJNB 2L6LA 4JTCB 4B3TB 5EBMC 3CD6V 3TCUA 4FZ0A 1ZX3A 5LP6C 3Q4HA 2IU0A 3RBZA 5CA0A 1VQKV 3WFVA 4O4HA 3BFRA 2ATKC 2XUMA 4UCUA 3GWKC 2QE7G 4FJCC 5J2UB 1FKAO 4FZ1A 3FX7A 1Q5OA 5JWPA 2UXXA 4JI1B 3BHPA 3CRAA 3JD1A 1W2BU 5JCOC 3JARB 4DK1A 1L0LH 1OV9A 2KG7B 3ZMTA 3SYPA 1YZBA 5IYDO 2WLIA 2ZE6A 3B77A 4DYLA 4NTYA 3HKDB 2CGNA 3DGEA 3TJTA 1AB3A 4UFZA 3SPGA 4MTXA 3D36C 4TSFG 5LMUO 4RWUA 3JALA 1DF4A 4MS2A 5KAFZ 5JH7B 1S76D 2ZIOA 5GONB 3RYHB 1XNRO 3M99B 2RCVA 5K1XA 3QO5A 3ZEDA 3RYFA 2ARHA 4GKJB 1K4CC 4KHPO 3VQYA 4UV9A 4IGGA 3T2MA 4U3FH 1VQ7V 1RSOA 2QTOA 1G1XB 2C2AA 1VQOV 4X8AA 5BR8B 1O9HA 4AHCA 1F7YA 1BQZA 2QGNA 5A2QN 1WAZA 3LDEA 3HKEA 1K3EA 1M5IA 1IBMO 4GX2A 1F4NA 1VF6C 1TVKB 1TUEB 3R65A 1WP7A 3CCJV 4XDJA 4ZHQA 2DW4A 3HB3B 4DV3B 4HZ3A 4YJ2B 5LYJA 2RJZA 4OGQB 4F6RA 1SKVA 4WFBV 3TXQA 4JPRA 1FD9A 1AP5A 4LFCO 1ZTEA 3QF7A 3L72H 4DW1A 1SQBH 2EIJB 1XNQO 4RO2A 1OZ0A 4NXMO 4B3SO 4QJFB 5C8YA 2EILB 1HNZO 2GV9A 1GH6A 3CRRA 3SYCA 4DV7O 2PYJA 3CC2V 5JQGB 2HVJC 4B08A 4H37A 4NB5A 1K34A 5B1AC 1WPBA 3ZRVA 3ZHVA 1W0JG 3W7UA 2JRIA 1KMIZ 1VARA 1FFXA 3G6BA 1COWG 3EHBB 4R50A 2CUGA 2WLKA 3KKYA 4K35A 2ZXWC 2VWKA 3ML0A 1CP9A 4DV6B 5KMGB 4TV9A 2WSSG 3EFFK 1K4DC 1VMGA 1DLBA 3LDDA 1Y74B 4K8XA 1XUQA 3JASA 1NTMH 1QR9A 5LGUA 4BWAA 1N0NA 4JZ2A 2R72A 2Z3YA 1D2DA 5EYPB 2Q0AA 2Z5UA 4X1YA 1AI4A 1JPXA 4DR5O 4H0LB 1YTFB 2F93B 2W6IG 3WG7C 1NKDA 5IJ9B 2VQEO 4JI5O 3G71V 3E86A 5J2TB 2DYRC 2R9AA 4Z1MG 2QWQB 1Q6HA 2IJIA 1H2LA 2A7WA 4XDKA 1PL4A 4DR6O 4FM0A 4DW0A 3CX5F 1GTOA 3MD0A 4Q6GA 2OWOA 1MG1A 4BIUA 3WB1A 2IU3A 3T4ZA 4TQFA 1CEZA 3UT5A 3GB7C 4QIWF 4J7ZA 1PNKA 2A3QA 1JJ2U 1RM1C 1VIBA 4DR4B 1YTFD 2P4VA 2Q7HA 5CB4A 2L35A 3ZHSA 1SQGA 2BOCC 3VBBA 2EIKC 2GUZB 1XQ8A 1XREA 2YIBA 3ABMB 1VQ5V 3CHXA 1QBZA 4FFBA 2F23A 4JF3A 1Q3EA 3JAKA 2K1EA 1WJZA 1RP3B 4O2BA 1K97A 5ITZB 1GN2A 5LBQA 4GKKB 4I50A 5BY1A 3FYIB 4B3RB 2LJ2A 4DV4B 2EIMC 1DF5A 1I0HA 3SPCA 1ZL8B 1YITV 4MVSA 3QG5A 1BZKA 2WLMA 3SYOA 3BCCH 4GUNA 1AVMA 3K03A 3ZHUA 2EULA 2LW1A 2ZIMA 4O4LB 3F5TA 4CS2A 3H1IH 2XAQA 1S77D 1RFYA 3RGBA 1GAXA 1Y66A 1JMKC 4X62B 2H8PC 4RAIA 5DEDA 4OXSA 2BE3A 5LHIA 2PZSA 5EK0A 4B7EA 1ZSPA 1VP7A 4JI7B 3P3PA 3NXSA 4PDLA 1WLEA 2ODMA 2F95B 1ROPA 1YXBA 1YCIA 3E8FA 2DN9A 1E79G 4WFEA 2BTQA 1U97A 2B1IA 1FJGB 3M7MX 4LR3A 1M4UA 5L3GA 1FPOA 5KUMA 3LDCA 3VQVA 2HJFC 1V54B 3J81N 1FYJA 1V9PA 1VQ6V 4GT1A 4DUYB
chains in the Genus database with same CATH topology
4UVBA 4PA4A 3BY6A 3DTUB 4JAUA 2BOBC 3I56V 2EIMB 3ZIAG 2V7QG 1SRYA 3E83A 5CN0A 1OHHG 3ABKB 2IH1C 1QLNA 3ZMZA 1PKXA 2H94A 4MVRA 4KFMA 3ABLC 3OR6C 1NVPB 1R3LC 1GMGA 2DWDC 3F5WC 1VQLV 1SERA 1KQSU 3P30A 4ASUG 2HG5C 4FPPA 3FB8C 2DYSC 1QVGU 4UXNA 3GWOA 3ZN1A 5KA5A 3B8NA 1NR7A 4P9PA 2WLNA 2F43G 1FS0G 3AG1C 4MW3A 5BZBA 4LP8A 2EINC 3ETEA 4MSWC 4DXWA 1MABG 2DQ0A 3ASNB 1M57B 1FXKB 4BAYA 1H8EG 3JD4A 2JDIG 3OAAG 2W6JG 1FXKA 1H8HG 1JVMA 4WFHA 4E2LA 3E8HA 1OCRB 3H01A 1IXMA 4X89A 4CBCA 2IJKA 2NLJC 4JGSA 4MW8A 3CMAV 1MSWD 2ZR2A 1OCOC 2A0LA 4JTDB 5H6QA 1NVPD 5IYBO 1BHAA 4QNHB 2GHYA 1S0VA 1Q86W 1EFRG 1K33A 2P90A 3CYOA 4PA9A 4F4LA 3ASOC 3E89A 1WPXA 4PDRA 2EZOA 4CZZA 4DO2A 3E35A 2XAJA 3LUTB 1BHBA 1OCZC 5L3DA 3X2QB 3AG3B 3IGAC 1QR8A 2DYRB 1G4YB 1GK9A 1R3KC 2NNUA 4LC1A 3ABUA 4BW5A 4JTCB 3OEHG 3OMNB 2XAGA 3SYAA 1QCEA 5EBMC 4HYOA 5L3CA 3TCUA 1MOFA 2ZDIA 3W7XA 3CCLV 1VQPV 3CD6V 1M56B 2OCCB 2IU0A 1V55B 4WF9V 3AEIA 3RBZA 3UM7A 1VQKV 3WFVA 1JX9A 4PDVA 2ATKC 3OEEG 3ZRSA 1VQMV 2PI5A 2M7WA 2QE7G 4FJCC 1P4RA 1YJ9V 3B8MA 1QLEC 5L3FA 1YI2V 1F23A 1ORQC 4MVZA 2QM8A 2LFRA 1UJWB 1DTOA 3CXCU 1R6KA 2UXXA 3JD0A 3LSSA 2A79B 3JD1A 3CPWU 3CC7V 1W2BU 1FXVA 2WLIB 1Q81W 5H6RA 2QKSA 2LP7A 1GKFA 1PD3A 1JCHA 2EIJC 1F4MA 3ZMTA 3SYPA 1QVFU 3W7SA 5IYDO 2WLIA 3FB6C 3B77A 1AJNA 4LBEC 1FFTB 3E8GA 1RPRA 1KP2A 2DYSB 1GM9A 2X6CA 3DGEA 4MVMA 2V1DA 1NBMG 5HFLA 1K5QA 1AI5A 2EILC 3AG1B 3SYQA 3RVZA 1THZA 3SPGA 4MTXA 2HFEC 2XNDG 4TSFG 1H38A 4UV8A 2EINB 1NQTA 1DF4A 4MS2A 4PA6A 1JQ0A 1S76D 3G6EV 1Q7YW 3K3WA 2P6JA 3M99B 4U7OA 4MTGA 5DN6G 5EBWC 3CP1A 2WPDG 3HPLC 3QO5A 4WCEV 3AG4C 1E1QG 1Q82W 3IC7A 3T4DA 4JASA 4KP4A 1K4CC 1OCOB 3AG2C 3PJSK 1NJIW 4UV9A 3ZRWA 3T2MA 1VQ7V 3T1CA 2Y69C 2QTOA 3RW0A 2C2AA 4X88A 3ASOB 4BIZA 4QPJA 1VQOV 4X8AA 2YSUB 5B3SC 1AJPA 1OCZB 1KP3A 2IH3C 3LDEA 1YJWV 1K3EA 4FMTA 4GX2A 2DWEC 5IY5B 1F4NA 5J9PC 1F51A 3IFXA 1TUEB 1R73A 3OUSA 3R65A 2R9IA 2W0FC 2P67A 3CCJV 4QE9A 2WLHA 4I5SA 4TT3G 4XDJA 3OMAB 5CA3A 2DW4A 3HB3B 5LGTA 2Q6AA 5KA6A 1FXHA 5B1OA 1K92A 1YIJV 4HZ3A 1QLEB 5H9CA 4N21A 2EJRA 1P7BA 4QPKA 2WLJA 4QE7A 4WFBV 1S72V 4JPRA 1K73W 4WFAV 3RVYA 3VOUA 4LCUC 2EIJB 2X7RB 4P30A 3K9AA 2QM7A 1OZ0A 1SETA 2ITDC 2X6BA 4RO2A 1K8AW 3QO7A 1KKDA 1KD1W 4QJFB 5L3EA 5FL7G 2IJJA 4G28B 4GX5A 2EILB 2DQ3A 2EZPA 2JEUA 4HAMA 3JD3A 2HKOA 3K0GA 2X6AA 3SYCA 3OGCC 3BEHA 3CC2V 2HVJC 3ZCCA 4H37A 4GX1A 3FYEB 3D36A 1K34A 5B1AC 5KUKA 5EC1C 1M9NA 3K79A 1VQ9V 3ZRVA 3K0DA 4PA3A 1R6NA 1W0JG 2JK5C 2CK3G 3W7UA 2HVKC 2Q67A 1H2GA 4KUMA 3AG4B 4JAVA 1COWG 1PL0A 2GSMB 3EHBB 4RQEA 4R50A 4U7NA 2WLKA 3OW2U 4MTFA 3OMIB 1OCCC 1RPOA 4JYCA 3ABMC 2ZXWC 1ENVA 3LNMB 2Y69B 2ZQMA 3ABLB 3ML0A 1Y4MA 1CP9A 2QA4V 2Q69A 3SPIA 1XL6A 5B3SB 1M57C 2WSSG 3EFFK 1K4DC 1NR1A 4R7CA 2IW5A 3STZC 1DLBA 2MK3A 3LDDA 1AI6A 3SPJA 1EZJA 4EKWA 5HFMA 4GX0A 1QR9A 5LGUA 3ZMVA 2Z3YA 3MHSC 4R8CA 4J9YB 4MVOA 2Z5UA 1AI4A 1JPXA 3STLC 1YTFB 2W6IG 3TETA 4UVAA 3WG7C 1I5XA 5LGNA 1NKDA 4WFGA 5EBLC 3P32A 3CCUV 1AJQA 2P7TC 3G71V 3E86A 3G4SV 4RUEA 2DYRC 4Z1MG 1K5SA 3K06A 3ZRWB 2IJIA 4P2ZA 1VQ4V 4XDKA 3OE7G 2JJ1G 4MVQA 2JEXA 3K04A 3E2EA 4TWKA 2R9RB 5CBFA 1GTOA 3MD0A 2ZD9A 1MG1A 4BIUA 1VQ8V 1SZTA 2Y48A 5C93A 2IU3A 3ZN0A 3ZRXA 1LNQA 2Q68A 3T4ZA 3ZJZA 1YJNV 1M1KW 1CEZA 3F7YC 5CMUA 3GB7C 4QIWF 2XASA 1PNKA 2YEVB 1JJ2U 3FB7C 1RM1C 1NH2B 3KG2A 1EBOA 4XBFA 2XOKG 2KB1A 1YTFD 1YHQV 1PNLA 1K7DA 5B1AB 3F7VC 2YEVA 4RUFA 3ETDA 3CMEV 1JOYA 3MHHC 2FTKA 4JTAB 2BOCC 3OFNG 1L1FA 3ZMSA 3VBBA 2EIKC 1KECA 3TK1A 2ITCC 3LSQA 1AR1B 4JYBA 1OCCB 3JD2A 3ABMB 1VQ5V 5E1AC 1QBZA 2ZXWB 2XAFA 5B1BC 2EBOA 4JF3A 1I5YA 4UVCA 2K1EA 4RQFA 2IJHA 2LFSA 2QEXV 1K97A 2OTLV 1BMFG 2JJ2G 5CBGA 4FK5C 3SPHA 3UKMA 4L87A 1V54C 3K08A 5LBQA 3W7TA 5IYCO 3ABTA 2OT5A 4XDLA 4I9WA 3ETGA 3FYIB 3CCMV 1S5HC 3SJQC 1NH2D 1GM7A 2EIMC 4FIPC 4ZKIA 3W7WA 1DF5A 2UXNA 4PDMA 5CBHA 3ABKC 3SPCA 1GM8A 3QO8A 1CPYA 4GCZA 5EC2C 4G27B 4MVSA 3WG7B 1YITV 1VQNV 4H33A 2WLMA 3SYOA 2OTJV 3QNEA 3K03A 3CCEV 4PA7A 4N23A 3CCQV 5IY5C 1K9MW 3AG2B 3A0RA 3OR7C 1KC8W 1XL4A 2XAQA 3FB5C 4YXWG 2B1GA 3I55V 1S77D 3E8BA 1Y66A 1BL8A 4UUJC 1R3IC 3ASNC 3OUFA 2H8PC 1FXKC 4MTOA 1PNMA 2HR3A 5DM6V 4RAIA 2AHYA 4R6ZA 2PI4A 4OXSA 2HLDG 1YSCA 1J95A 5LHIA 2ZR3A 2B5UA 5EK0A 1OCRC 5LHHA 1RM1B 2A9HA 2D3OW 1E1RG 2WLLB 4ZBMA 3OM3B 4J9ZB 4P9OA 1W0KG 1M90W 1AROP 3NXSA 1AI7A 3JCZA 2WLLA 2WWWA 4PELA 4PDLA 1WLEA 3CCRV 4WFFA 1ROPA 3E8FA 5GW7A 1E79G 4WFEA 2EIKB 1N8RW 1B6QA 1GO3F 2B1IA 2WAMA 4Q20A 3D3IA 3X2QC 3JYCA 3AG3C 3FKSG 1S3JA 4G2KA 2ZDIC 3CCVV 3CC4V 3ZMUA 1G8MA 5L3GA 1ZWIC 5B1BB 5L3BA 5KUMA 1HWYA 5IDJA 5LHGA 3LDCA 1M56C 2OCCC 1V55C 2X0LA 2XAHA 1R3JC 4MT8A 5B1NA 3CCSV 2HJFC 1SESA 1V54B 2AHZA 2JIZG 1VQ6V 4GT1A 4MVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU V;  1QVF U;  1VQK V;  1N8R W;  1VQ5 V;  1YIT V;  1M1K W;  4WFA V;  1VQN V;  3G71 V;  1R73 A;  3G4S V;  3I56 V;  4WCE V;  1VQM V;  1JJ2 U;  1Q82 W;  5DM6 V;  1VQ9 V;  3CCJ V;  1YJ9 V;  1Q86 W;  3CCV V;  1YHQ V;  3CC4 V;  1K8A W;  2QEX V;  1YI2 V;  1NJI W;  2OTL V;  1VQ4 V;  2OTJ V;  1KD1 W;  3CCE V;  3CME V;  1VQ7 V;  1YIJ V;  2D3O W;  3CCQ V;  1K9M W;  3CXC U;  3OW2 U;  1VQL V;  3CC7 V;  1KQS U;  3CPW U;  1VQO V;  1W2B U;  1M90 W;  3G6E V;  1KC8 W;  3CCS V;  1Q7Y W;  3CCM V;  3CCL V;  1VQP V;  1Q81 W;  1VQ8 V;  3CD6 V;  4WFB V;  3CC2 V;  3CMA V;  3I55 V;  1S72 V;  2QA4 V;  1YJW V;  3CCR V;  1YJN V;  1QVG U;  1K73 W;  1VQ6 V;  4WF9 V; 
#chains in the Genus database with same CATH topology
 1HNX B;  1TUB A;  4L8J A;  2ETN A;  2V7Q G;  1SRY A;  3ABK B;  3BAA A;  3A2F A;  3T1Y B;  3ZMZ A;  5FNV B;  5FLX N;  2CH7 B;  2GTA A;  1ZLZ A;  1Q90 D;  4J7J A;  3OR6 C;  1I94 O;  3JAT B;  2G38 A;  1QVG U;  4UXN A;  1Y76 A;  3RYI A;  3B8N A;  3ICX A;  2WLN A;  2CAZ C;  1BE3 H;  1TVK A;  4IL6 Z;  2Q7G A;  2JGD B;  3SJC C;  3O65 A;  1FXK B;  1H8E G;  4I55 A;  3JD4 A;  2JDI G;  2BTO A;  1OCR B;  3FAV B;  2IJK A;  4JGS A;  1MSW D;  4DUZ O;  3O9O A;  3B40 A;  1IXB A;  2UUC O;  1S0V A;  4DV2 B;  5D5P A;  1WPX A;  4PDR A;  3M8A A;  4DO2 A;  3OTO O;  3OGI B;  3S3X A;  2DYR B;  1GK9 A;  4LC1 A;  3U10 A;  5IYZ A;  4BW5 A;  3OEH G;  3SYA A;  4HYO A;  1VQP V;  2ZDI A;  1VF7 A;  1M56 B;  3B2E E;  2OCC B;  3D8C A;  1KKC A;  4PDV A;  1VQM V;  2V4D A;  2PI5 A;  2M7W A;  2CGO A;  1P4R A;  1YJ9 V;  4DR1 B;  1BS3 A;  1YI2 V;  1F23 A;  1ORQ C;  4MVZ A;  3D3Q A;  3VQX A;  4HNA A;  2QM8 A;  2LFR A;  1UJW B;  2YID A;  4HBN A;  2ZE5 A;  3JD0 A;  3LSS A;  2A79 B;  4UCV A;  3BVO A;  4EB6 A;  1TAE A;  3OT7 A;  1N34 O;  1N32 B;  1FXV A;  5LA6 A;  2ADP A;  3BRC A;  4JI0 B;  2EIJ C;  1L8D A;  3W7S A;  3FB6 C;  4YIP A;  1NI8 A;  1FFT B;  3EVK A;  4J11 A;  1KP2 A;  1GN6 A;  1GM9 A;  5KLV H;  5HFL A;  5IWA O;  2CDY A;  4YY3 O;  1AI5 A;  2EIL C;  1Y74 A;  2HFE C;  1H38 A;  2EIN B;  4PA6 A;  3G6E V;  3K3W A;  1W59 A;  4X64 O;  4MTG A;  4X20 B;  1HR0 O;  5EBW C;  3J7A U;  4B3T O;  2FYU H;  1J5E B;  3NR7 A;  1E1Q G;  1MMM A;  3T4D A;  4JAS A;  2YI9 A;  5J2T A;  3AG2 C;  3PJS K;  5KHJ A;  3T1C A;  2OIE A;  4J42 A;  4BIZ A;  4K0K B;  2KKW A;  1AJP A;  5JVD B;  2ZE8 A;  4B3M B;  3L9D A;  3IFX A;  4I0X B;  4IIJ B;  3JSN A;  1HP8 A;  4QE9 A;  1N0J A;  4I5S A;  4LF9 O;  2PUS A;  5CA3 A;  1N33 O;  4BIO A;  5LP6 A;  4DR2 O;  1XMQ B;  2Q6A A;  5KA6 A;  1FXH A;  5LOV A;  1K92 A;  2RDC A;  3FFQ A;  1QLE B;  1GN3 A;  2EJR A;  1FAF A;  4OX9 B;  4E4E A;  2B9Z A;  3T1H B;  4WFA V;  3E22 A;  3A8T A;  4LCU C;  2QM7 A;  5JCO A;  2ITD C;  2X6B A;  1K8A W;  3QO7 A;  1R6T A;  2K9P A;  4W4L A;  5L3E A;  4GKJ O;  5FL7 G;  4LF8 B;  2DQ3 A;  2QTS A;  4HAM A;  2HKO A;  3K0G A;  2X6A A;  3BEH A;  2Y4T A;  3D36 A;  5BR8 O;  3C90 A;  3ZHR A;  1R6N A;  4FVM A;  2CK3 G;  1WA8 A;  4PI2 A;  2F4V B;  4KUM A;  2YIC A;  1PL0 A;  2GSM B;  4U7N A;  4MTF A;  3OMI B;  1RPO A;  4DV3 O;  4JYC A;  3ABM C;  3RWR D;  4LF6 B;  4IHJ B;  3LNM B;  2Y69 B;  2ZQM A;  3L75 H;  2QA4 V;  1XL6 A;  2UXC B;  5B3S B;  4NVP A;  2Q0O C;  1NR1 A;  4R7C A;  2MK3 A;  1XBL A;  4QGP A;  5HFM A;  4GX0 A;  4TQD A;  4FM2 A;  4R8C A;  1VF6 A;  4MVO A;  2AZ0 A;  1L0N H;  3STL C;  1YEW A;  1I5X A;  1D5A A;  3DXR B;  4LF5 B;  3ZS8 C;  3CCU V;  2P7T C;  1H2K A;  1P7G A;  2QJ1 A;  1M93 A;  3A0B Z;  4RUE A;  1UFI A;  3K06 A;  4EFE A;  4LNU B;  2R70 A;  1AIL A;  3G67 A;  4JI6 O;  2JEX A;  3K04 A;  4TWK A;  5CBF A;  2ZD9 A;  3K9S A;  1VQ8 V;  1SZT A;  2Y48 A;  4PI0 A;  3ZRX A;  4C7U A;  3F7Y C;  3UO3 A;  1SA0 A;  5H2F Z;  2YEV B;  4DV6 O;  3HR0 A;  3HKC B;  3CJH A;  4XBF A;  1LR1 A;  1PNL A;  2YDE A;  1IUR A;  5F2V O;  2D2C B;  1D5N A;  3CME V;  2UXD B;  5FNV A;  4JTA B;  3ZMS A;  3QTC A;  1Q6U A;  3TK1 A;  4IYH A;  5KX5 A;  1MZF A;  1AR1 B;  3JAT A;  1OCC B;  4JYB A;  2UU9 B;  3JD2 A;  3J80 N;  4PD4 F;  3P3N A;  5E1A C;  5B5E Z;  4TV8 A;  5FPO A;  2CTQ A;  2IJH A;  3EXA A;  4DV5 B;  3AG7 A;  2Q8V A;  2QWN B;  1V54 C;  2ILM A;  3W7T A;  5IYC O;  3IJ4 A;  2VS0 A;  3JAW A;  4FLU A;  4I9W A;  1QNM A;  3CCM V;  4FIP C;  4ZKI A;  3W7W A;  4PDM A;  3ABK C;  2LQT A;  2MW2 B;  2UUA B;  4W4K A;  4JYA O;  1BGY H;  2OTJ V;  5GTI Z;  4I7Z B;  3QNE A;  1PP9 H;  3CCE V;  4PA7 A;  5GTH Z;  4DR4 O;  4N23 A;  4ICG A;  3CCQ V;  4X1I B;  3N2G B;  1K9M W;  3AG2 B;  3A0R A;  3OR7 C;  2KQX A;  1XL4 A;  2B1G A;  3E8B A;  1R3I C;  1FXK C;  4MTO A;  1PNM A;  2AGA A;  3QVN A;  4H13 B;  2AHY A;  4R6Z A;  4CS3 A;  4DR7 B;  4OPA A;  1IZ3 A;  4I4T A;  2B5U A;  4O2A B;  1OCR C;  4Z2W A;  5LHH A;  1E1R G;  3S3W A;  4ZBM A;  4DRX B;  2CTR A;  4YJ3 A;  4LH7 A;  4GKK O;  2WLL A;  3CCR V;  2RQ6 A;  1Q6I A;  3HKB B;  3KCX A;  4B3R O;  4ZOL A;  4Q20 A;  1LUV A;  4DV4 O;  1HNW O;  4GYC B;  5LXT A;  5EIB D;  1G8M A;  4CH6 A;  5KHG A;  5IDJ A;  5KAI Z;  1M56 C;  2YIA A;  2OCC C;  2X0L A;  2XAH A;  1R3J C;  5IT9 N;  1H2S B;  2FL4 A;  2JIZ G;  3RFR A;  1XNQ B;  4NYK A;  4NXM B;  4D6T H;  3K5L A;  5BMV A;  4UCT A;  4DV1 B;  1GRJ A;  1H2M A;  3I56 V;  3ZIA G;  2FML A;  4UCR A;  3N2K A;  4X62 O;  4DV7 B;  4MVR A;  1NVP B;  4LWS B;  1VQL V;  2ZCE A;  4IT5 A;  4J41 A;  4O4I A;  3AK2 A;  4DK0 A;  2P22 C;  5KHH A;  3GWO A;  4JI7 O;  1NR7 A;  4P9P A;  5D5Q A;  5B66 Z;  1PM9 A;  5BZB A;  4X66 O;  4LP8 A;  2EIN C;  3ETE A;  4MSW C;  2QWO B;  4DXW A;  3ASN B;  1MA1 A;  2F66 C;  4WFH A;  3CRQ A;  4CBC A;  4MW8 A;  2WA4 A;  4X1K B;  1JFF B;  2ZR2 A;  2QWR B;  1NVP D;  2EJ7 A;  4DUY O;  1SQQ H;  2GHY A;  1HNX O;  2BCC H;  1K33 A;  3CS5 A;  3E35 A;  3LUT B;  3X2Q B;  4GLX A;  3IGA C;  1QR8 A;  2RMK B;  3T1Y O;  3ABU A;  3Q4H B;  5L3C A;  3OMN B;  2XAG A;  5CA0 B;  1QCE A;  3CCL V;  2JVD A;  1MOF A;  3BPZ A;  1Y67 A;  2HJD A;  2UXB O;  3LNN A;  4UCS A;  1JX9 A;  3OEE G;  4DR6 B;  2YUA A;  3B8M A;  1QLE C;  1SC5 B;  5EZY B;  3WU2 Z;  1EM1 A;  2QDO A;  5J2U A;  3U0Z A;  4WBN B;  1DTO A;  1IBL B;  1R6K A;  3CC7 V;  3CXH F;  2AZ2 A;  3APQ A;  2WLI B;  1Q81 W;  2QKS A;  2LP7 A;  1PD3 A;  2UUB B;  3JAR A;  4JAA A;  1AJN A;  3E8G A;  3IC9 A;  2KG7 A;  3B4S A;  2X6C A;  3OTF A;  1K5Q A;  4NR1 A;  3AG1 B;  3JAL B;  3HKD A;  4DV2 O;  1EN4 A;  1NQT A;  2DMX A;  1GN4 A;  1Q7Y W;  2P6J A;  3K5O A;  4U7O A;  3WB0 A;  5JH7 A;  2WPD G;  3RYF B;  3HPL C;  5GON A;  3RYH A;  4D7S A;  4PJ0 Z;  1Q82 W;  1RSO B;  4KP4 A;  1OCO B;  1NJI W;  4JI2 B;  5AG2 A;  3TXS A;  3CSX A;  5JJJ B;  2Y69 C;  4LNU A;  3RW0 A;  4LFB B;  4DR1 O;  4X88 A;  3VQW A;  2YSU B;  5B3S C;  1KP3 A;  2IH3 C;  2DWE C;  3DC5 A;  1N32 O;  5J9P C;  2HEP A;  1R73 A;  4ZHQ B;  2R9I A;  4CC6 A;  4NTW A;  2WLH A;  4TT3 G;  2Y0I A;  1LUW A;  2ZKO A;  2ZIN A;  4YIO A;  1WB8 A;  5LYJ B;  5B1O A;  4F6R B;  1YIJ V;  4TOI A;  4X65 B;  4LF7 B;  4QE7 A;  3BA8 A;  3CRM A;  1K73 W;  4YJ2 A;  1OJH A;  1EZV H;  3RVY A;  3VOU A;  3RT3 C;  2X7R B;  3K9A A;  1J5E O;  1X4T A;  4DR3 B;  4G28 B;  1N36 O;  2JEU A;  2EZP A;  3JD3 A;  1I08 A;  2PY5 A;  5IE9 A;  3K59 A;  2QSA A;  4LFA B;  4K0K O;  2E5L O;  1SQX H;  5JQG A;  4YHH O;  1URF A;  3K79 A;  2E74 B;  1VQ9 V;  3ZX6 A;  4PA3 A;  2JK5 C;  3C3S A;  1IX9 A;  2HVK C;  2Q67 A;  3RYC B;  1H2G A;  3AG4 B;  4JAV A;  2M6Y A;  3OW2 U;  1OCC C;  5K1P A;  4TV9 B;  4AI8 A;  1ENV A;  3BA9 A;  2Q69 A;  1KBH A;  3SGI A;  2LW7 A;  3JAS B;  3C3T A;  1XI1 A;  4OX9 O;  5KMG A;  2IW5 A;  1KB9 F;  3SPJ A;  4JI4 B;  3T1H O;  5LMN O;  1Z5W A;  4X1Y B;  3ZMV A;  4J9Y B;  1B3Q A;  4O2A A;  3L73 H;  5EYP A;  4DV0 B;  2ADQ B;  4WFG A;  5EBL C;  3P32 A;  1EN6 A;  3B09 A;  4LF8 O;  2E75 B;  5IJ9 A;  3G4S V;  3HKB A;  2HHH B;  1NT2 B;  2Q73 A;  3ZRW B;  4GZR B;  5EIB C;  3MAQ A;  4MVQ A;  3E2E A;  3SJA C;  1Y6X A;  3ZBH A;  3K58 A;  2F4V O;  2VQF B;  1LNQ A;  2Q68 A;  3ZJZ A;  1YJN V;  1SZX A;  1EN5 A;  3UO2 A;  4JI1 O;  5CMU A;  4LF6 O;  1MSD A;  2YS8 A;  2YI8 A;  5CB4 B;  2UXC O;  2XOK G;  2KB1 A;  1HDJ A;  1K7D A;  4JV5 B;  3F7V C;  1JOY A;  1Q8I A;  3MHH C;  1L1F A;  1B06 A;  1XMO B;  1KEC A;  2ITC C;  4FFB B;  1XOU A;  4FM1 A;  1ZUQ A;  3JAK B;  2OYQ A;  2GUZ A;  4O2B B;  4LF5 O;  2EBO A;  2F1M A;  1I5Y A;  4RQF A;  2LFS A;  4AQY B;  1IBK B;  4I50 B;  2OTL V;  3TGU H;  3SPH A;  3UKM A;  2JGU A;  3ABT A;  2OT5 A;  4NXN B;  5ITZ A;  1KU9 A;  4XDL A;  5IJ0 B;  3ETG A;  2XT9 A;  3SJQ C;  2KSD A;  2UXN A;  5IWA B;  4J80 A;  4LF4 B;  1GM8 A;  5EC2 C;  3QO8 A;  4G27 B;  1VQN V;  4H33 A;  5KHK A;  2Q5Z A;  1ZL8 A;  4KXR A;  4FLX A;  2RN9 A;  1NU1 H;  1YDX A;  4JI3 B;  5IY5 C;  3SDL A;  2QKC A;  4JI8 B;  2UXD O;  4O4L A;  4UCO A;  1YF2 A;  1BL8 A;  3ASN C;  2HR3 A;  2UU9 O;  2PI4 A;  2A9H A;  5EZY A;  2RNB A;  1W0K G;  4DV5 O;  2OIG A;  4WBN A;  2BTQ B;  3JCZ A;  4PEL A;  2WWW A;  1UPG A;  2NN4 A;  4LF9 B;  1B6Q A;  1GO3 F;  1N33 B;  4DR2 B;  1S5J A;  3D3I A;  3X2Q C;  3JYC A;  1S3J A;  4G2K A;  3CCV V;  1Z2G A;  3ZMU A;  1SF9 A;  2UUA O;  1ZWI C;  5B1B B;  5LHG A;  1VF5 B;  2Z0A A;  4MT8 A;  3SR2 C;  3CCS V;  1SES A;  2YC0 A;  2AHZ A;  1TUB B;  4TUY B;  3BY6 A;  2ZM6 B;  4JAU A;  3OD4 A;  4J7K A;  1SS3 A;  3H9V A;  1NS1 A;  1TA8 A;  2IH1 C;  1QLN A;  1PKX A;  2H94 A;  1AR5 A;  4KFM A;  3ABL C;  3AK1 A;  3BAB A;  3JCU Z;  3AK3 A;  1S5L Z;  4DR7 O;  1T5E A;  1Y76 B;  2DJV A;  3P30 A;  2CH7 A;  3RYI B;  4ASU G;  2HG5 C;  1KQS U;  4FPP A;  1SQV H;  3FB8 C;  2IBZ H;  3UQ8 A;  5KA5 A;  2PGG A;  2QKA A;  3AG1 C;  2F43 G;  1FS0 G;  4NKG B;  2HP8 A;  4ZI7 B;  4I55 B;  1I7F A;  2ZT9 B;  2JGD A;  1TGO A;  1FXK A;  1JVM A;  3H01 A;  1IXM A;  5CA1 B;  2NLJ C;  1JJO A;  1OCO C;  3FAV A;  1XIL A;  4QNH B;  4OPH A;  5LMU B;  1Q86 W;  1IDS A;  2VWJ A;  5IYZ B;  2P90 A;  4PA9 A;  4F4L A;  1P49 A;  3E89 A;  2FB5 A;  4DV1 O;  3CE2 A;  2EZO A;  2QWP B;  2XAJ A;  5L3D A;  4FLZ A;  3AG3 B;  1G4Y B;  1R3K C;  1XNR B;  1A32 A;  1R1B A;  1AR4 A;  5E79 Z;  3W7X A;  4FLW A;  2N74 A;  2AXT Z;  1V55 B;  4WF9 V;  4KL1 A;  2YXH A;  3AEI A;  3H1L H;  3UM7 A;  2BSK B;  3ZRS A;  4KHP B;  4JI6 B;  2P4K A;  3SJB C;  4HNA B;  1WB7 A;  3A0H Z;  4PV1 B;  4O4J B;  5L3F A;  4EB6 B;  3K5M A;  4CS4 A;  2ZE7 A;  4ZIB A;  5LA6 B;  3CXC U;  3RYC A;  1IBM B;  3CPW U;  3K57 A;  5H6R A;  1GKF A;  1JCH A;  1F4M A;  1QVF U;  3ZHT A;  5H5N A;  3R66 A;  2VRZ A;  4LBE C;  1RPR A;  2DYS B;  4MVM A;  4FLT A;  2V1D A;  1NBM G;  3SYQ A;  3RVZ A;  1THZ A;  2GBO A;  2N05 A;  2XND G;  3THO A;  4UV8 A;  2YXY A;  1IVS A;  1KYO F;  1JQ0 A;  4LFC B;  5DN6 G;  4U3J B;  3ETQ A;  2Q4P A;  1BCC H;  3CP1 A;  4LH6 A;  1QQC A;  2PYL A;  2E3C A;  4B3S B;  4X20 A;  4WCE V;  3AG4 C;  3IC7 A;  4JZG A;  1HNZ B;  1O9G A;  2Q9L A;  1DGS A;  1H2N A;  3ZRW A;  3ASO B;  4QPJ A;  4FLV A;  4AIL C;  1OCZ B;  2A06 H;  4JYA B;  1YJW V;  4EFB A;  1IBL O;  4FMT A;  5IY5 B;  5JVD A;  2QM4 A;  2PTM A;  1F51 A;  2QR4 A;  3OUS A;  2W0F C;  1JR9 A;  1VEW A;  2P67 A;  5LP6 B;  4K3A A;  5LOV B;  2UUB O;  2LO1 A;  3OMA B;  3LSU A;  4I0X A;  4IIJ A;  5LGT A;  1FJG O;  4CH5 A;  2O57 A;  5H9C A;  4N21 A;  1P7B A;  4QPK A;  2WLJ A;  4EEQ A;  1QHT A;  2ZNJ A;  1S72 V;  3E22 B;  1PV0 A;  2AW9 A;  3DC6 A;  1NTK H;  4P30 A;  1YVW A;  1SET A;  4UB6 Z;  4DR5 B;  1KKD A;  1KD1 W;  3JAM N;  2E76 B;  2IJJ A;  4GX5 A;  1QU7 A;  2VQE B;  4JI5 B;  4JI2 O;  2CE4 A;  3OGC C;  3UCS C;  1HNW B;  4LFB O;  4O4H B;  5IJ0 A;  3ZCC A;  4GX1 A;  3FYE B;  5KUK A;  3H1K H;  1M9N A;  5EC1 C;  1WA8 B;  1KUQ A;  3K0D A;  3H1J H;  4RQE A;  2NR5 A;  3ABL B;  4X65 O;  1Y4M A;  3SPI A;  4LF7 O;  1Z5V A;  1M57 C;  1CXZ B;  1WN7 A;  4IHJ A;  1ZAU A;  3STZ C;  1AI6 A;  1MZE A;  2Y4U A;  1EZJ A;  1Q43 A;  4EKW A;  4D7T A;  1XDC A;  3MHS C;  4CC5 A;  4NTX A;  3KZI Z;  3ZHQ A;  4ABM A;  1G6U A;  2GDS A;  5JJE B;  1XEQ A;  3TET A;  4UVA A;  3L70 H;  5LGN A;  4DR3 O;  4X66 B;  1AJQ A;  3DXR A;  5A9G A;  1US6 A;  1K5S A;  4LFA O;  2JS5 A;  3DSQ A;  4P2Z A;  1VQ4 V;  3OE7 G;  2JJ1 G;  4CH4 A;  2R9R B;  3HKE B;  5DEC A;  2H3O A;  5C93 A;  1SA0 B;  3ZN0 A;  2PF4 E;  2Q7E A;  3APO A;  1M1K W;  3N27 A;  1N4C A;  3CJH B;  4X9Q A;  1XHZ A;  2XAS A;  1HW7 A;  1U96 A;  3FB7 C;  4TUY A;  4JI0 O;  1NH2 B;  3KG2 A;  1EBO A;  3L74 H;  2LGQ A;  3PN1 A;  1YHQ V;  1WP8 A;  5B1A B;  1BQ0 A;  2YEV A;  4RUF A;  3HKC A;  4JI4 O;  3ETD A;  2IM9 A;  2UXB B;  1XHX A;  3CEI A;  4I9Q A;  2FTK A;  3OFN G;  5KX5 B;  2DE0 X;  5KHI A;  3LSQ A;  4TV8 B;  4DV0 O;  2ZXW B;  2XAF A;  5B1B C;  1SQF A;  4UVC A;  3U11 A;  4CH3 A;  5C8Y B;  2QEX V;  4ZI7 A;  3JAW B;  1BMF G;  2JJ2 G;  5CBG A;  4FK5 C;  2HHH O;  4L87 A;  4J10 A;  3K08 A;  4FLY A;  3H1H H;  1S5H C;  1NH2 D;  1GM7 A;  4H44 B;  5CBH A;  4B7K A;  5CA1 A;  4GCZ A;  1CPY A;  2XTA A;  1P84 F;  3WG7 B;  4B3M O;  2VQF O;  4F6E A;  1FFX B;  1JA8 A;  2OCH A;  1NZ6 A;  4JV5 O;  1XMQ O;  1KC8 W;  1DK1 A;  4X1I A;  3FB5 C;  3N2G A;  4YXW G;  3I55 V;  5TIS Z;  4UUJ C;  1XMO O;  4FFK A;  4UB8 Z;  2JS3 A;  3OUF A;  4I4T B;  5DM6 V;  2BSK A;  3MDS A;  4BW9 A;  2HLD G;  1I94 B;  1YSC A;  1J95 A;  2ZR3 A;  4YJ3 B;  1RM1 B;  2D3O W;  4O4J A;  2WLL B;  4AQY O;  3OM3 B;  4J9Z B;  1IBK O;  4P9O A;  2CTW A;  1M90 W;  1ARO P;  1AI7 A;  4ZOL B;  4DRX A;  4WFF A;  4NXN O;  2GTS A;  5LXT B;  5GW7 A;  3FD9 A;  1BSM A;  2EIK B;  3GVM A;  1N8R W;  2WAM A;  3AG3 C;  3CRC A;  3FKS G;  3IAY A;  2ZDI C;  4LF4 O;  4A5U B;  5LL6 Y;  3CC4 V;  4PHZ A;  1PPJ H;  5L3B A;  2DOS A;  1HWY A;  1WNS A;  1V55 C;  4DUZ B;  2XHB A;  4JI3 O;  5B1N A;  3K5N A;  3UT5 B;  5BMV B;  4K8Z A;  2UUC B;  4JI8 O;  5BXZ A;  4MVU A;  4UVB A;  4PA4 A;  4Z1V A;  3DTU B;  3N2K B;  2YXL A;  2BOB C;  4JYY A;  4U3J A;  2EIM B;  4IYI A;  2WA3 A;  3E83 A;  5CN0 A;  1OHH G;  3OTO B;  1N36 B;  2CTP A;  2Y0P A;  2EX3 A;  1SER A;  1R3L C;  1GMG A;  4O4I B;  2DWD C;  2LGW A;  3F5W C;  3RN4 A;  2E5L B;  4YHH B;  4LWS A;  1SQP H;  2DYS C;  3ZN1 A;  2P5O A;  4MW3 A;  3KCY A;  1AP6 A;  1MAB G;  2DQ0 A;  1M57 B;  4BAY A;  2FKX A;  2ZNI A;  1X59 A;  1N34 B;  4BR6 A;  1NTZ H;  3OAA G;  3JSL A;  2W6J G;  1H8H G;  4E2L A;  3E8H A;  4X89 A;  2P06 A;  3CMA V;  5LMN B;  3CWB H;  4YY3 B;  2A0L A;  4JTD B;  5H6Q A;  5IYB O;  1BHA A;  4X1K A;  1JFF A;  3L71 H;  1B04 A;  2W0X A;  3CB2 A;  1EFR G;  3WB2 A;  2ZM6 O;  3CYO A;  5FPR A;  2YIB D;  3ASO C;  4CZZ A;  1BHB A;  1OCZ C;  1MNG A;  3I5D A;  2NNU A;  4X64 B;  1BT8 A;  1HR0 B;  3G80 A;  2N04 A;  5JJN B;  2L6L A;  4JTC B;  4B3T B;  5EBM C;  3CD6 V;  3TCU A;  4FZ0 A;  1ZX3 A;  5LP6 C;  3Q4H A;  2IU0 A;  3RBZ A;  5CA0 A;  1VQK V;  3WFV A;  4O4H A;  3BFR A;  2ATK C;  2XUM A;  4UCU A;  3GWK C;  2QE7 G;  4FJC C;  5J2U B;  1FKA O;  4FZ1 A;  3FX7 A;  1Q5O A;  5JWP A;  2UXX A;  4JI1 B;  3BHP A;  3CRA A;  3JD1 A;  1W2B U;  5JCO C;  3JAR B;  4DK1 A;  1L0L H;  1OV9 A;  2KG7 B;  3ZMT A;  3SYP A;  1YZB A;  5IYD O;  2WLI A;  2ZE6 A;  3B77 A;  4DYL A;  4NTY A;  3HKD B;  2CGN A;  3DGE A;  3TJT A;  1AB3 A;  4UFZ A;  3SPG A;  4MTX A;  3D36 C;  4TSF G;  5LMU O;  4RWU A;  3JAL A;  1DF4 A;  4MS2 A;  5KAF Z;  5JH7 B;  1S76 D;  2ZIO A;  5GON B;  3RYH B;  1XNR O;  3M99 B;  2RCV A;  5K1X A;  3QO5 A;  3ZED A;  3RYF A;  2ARH A;  4GKJ B;  1K4C C;  4KHP O;  3VQY A;  4UV9 A;  4IGG A;  3T2M A;  4U3F H;  1VQ7 V;  1RSO A;  2QTO A;  1G1X B;  2C2A A;  1VQO V;  4X8A A;  5BR8 B;  1O9H A;  4AHC A;  1F7Y A;  1BQZ A;  2QGN A;  5A2Q N;  1WAZ A;  3LDE A;  3HKE A;  1K3E A;  1M5I A;  1IBM O;  4GX2 A;  1F4N A;  1VF6 C;  1TVK B;  1TUE B;  3R65 A;  1WP7 A;  3CCJ V;  4XDJ A;  4ZHQ A;  2DW4 A;  3HB3 B;  4DV3 B;  4HZ3 A;  4YJ2 B;  5LYJ A;  2RJZ A;  4OGQ B;  4F6R A;  1SKV A;  4WFB V;  3TXQ A;  4JPR A;  1FD9 A;  1AP5 A;  4LFC O;  1ZTE A;  3QF7 A;  3L72 H;  4DW1 A;  1SQB H;  2EIJ B;  1XNQ O;  4RO2 A;  1OZ0 A;  4NXM O;  4B3S O;  4QJF B;  5C8Y A;  2EIL B;  1HNZ O;  2GV9 A;  1GH6 A;  3CRR A;  3SYC A;  4DV7 O;  2PYJ A;  3CC2 V;  5JQG B;  2HVJ C;  4B08 A;  4H37 A;  4NB5 A;  1K34 A;  5B1A C;  1WPB A;  3ZRV A;  3ZHV A;  1W0J G;  3W7U A;  2JRI A;  1KMI Z;  1VAR A;  1FFX A;  3G6B A;  1COW G;  3EHB B;  4R50 A;  2CUG A;  2WLK A;  3KKY A;  4K35 A;  2ZXW C;  2VWK A;  3ML0 A;  1CP9 A;  4DV6 B;  5KMG B;  4TV9 A;  2WSS G;  3EFF K;  1K4D C;  1VMG A;  1DLB A;  3LDD A;  1Y74 B;  4K8X A;  1XUQ A;  3JAS A;  1NTM H;  1QR9 A;  5LGU A;  4BWA A;  1N0N A;  4JZ2 A;  2R72 A;  2Z3Y A;  1D2D A;  5EYP B;  2Q0A A;  2Z5U A;  4X1Y A;  1AI4 A;  1JPX A;  4DR5 O;  4H0L B;  1YTF B;  2F93 B;  2W6I G;  3WG7 C;  1NKD A;  5IJ9 B;  2VQE O;  4JI5 O;  3G71 V;  3E86 A;  5J2T B;  2DYR C;  2R9A A;  4Z1M G;  2QWQ B;  1Q6H A;  2IJI A;  1H2L A;  2A7W A;  4XDK A;  1PL4 A;  4DR6 O;  4FM0 A;  4DW0 A;  3CX5 F;  1GTO A;  3MD0 A;  4Q6G A;  2OWO A;  1MG1 A;  4BIU A;  3WB1 A;  2IU3 A;  3T4Z A;  4TQF A;  1CEZ A;  3UT5 A;  3GB7 C;  4QIW F;  4J7Z A;  1PNK A;  2A3Q A;  1JJ2 U;  1RM1 C;  1VIB A;  4DR4 B;  1YTF D;  2P4V A;  2Q7H A;  5CB4 A;  2L35 A;  3ZHS A;  1SQG A;  2BOC C;  3VBB A;  2EIK C;  2GUZ B;  1XQ8 A;  1XRE A;  2YIB A;  3ABM B;  1VQ5 V;  3CHX A;  1QBZ A;  4FFB A;  2F23 A;  4JF3 A;  1Q3E A;  3JAK A;  2K1E A;  1WJZ A;  1RP3 B;  4O2B A;  1K97 A;  5ITZ B;  1GN2 A;  5LBQ A;  4GKK B;  4I50 A;  5BY1 A;  3FYI B;  4B3R B;  2LJ2 A;  4DV4 B;  2EIM C;  1DF5 A;  1I0H A;  3SPC A;  1ZL8 B;  1YIT V;  4MVS A;  3QG5 A;  1BZK A;  2WLM A;  3SYO A;  3BCC H;  4GUN A;  1AVM A;  3K03 A;  3ZHU A;  2EUL A;  2LW1 A;  2ZIM A;  4O4L B;  3F5T A;  4CS2 A;  3H1I H;  2XAQ A;  1S77 D;  1RFY A;  3RGB A;  1GAX A;  1Y66 A;  1JMK C;  4X62 B;  2H8P C;  4RAI A;  5DED A;  4OXS A;  2BE3 A;  5LHI A;  2PZS A;  5EK0 A;  4B7E A;  1ZSP A;  1VP7 A;  4JI7 B;  3P3P A;  3NXS A;  4PDL A;  1WLE A;  2ODM A;  2F95 B;  1ROP A;  1YXB A;  1YCI A;  3E8F A;  2DN9 A;  1E79 G;  4WFE A;  2BTQ A;  1U97 A;  2B1I A;  1FJG B;  3M7M X;  4LR3 A;  1M4U A;  5L3G A;  1FPO A;  5KUM A;  3LDC A;  3VQV A;  2HJF C;  1V54 B;  3J81 N;  1FYJ A;  1V9P A;  1VQ6 V;  4GT1 A;  4DUY B; 
#chains in the Genus database with same CATH homology
 4UVB A;  4PA4 A;  3BY6 A;  3DTU B;  4JAU A;  2BOB C;  3I56 V;  2EIM B;  3ZIA G;  2V7Q G;  1SRY A;  3E83 A;  5CN0 A;  1OHH G;  3ABK B;  2IH1 C;  1QLN A;  3ZMZ A;  1PKX A;  2H94 A;  4MVR A;  4KFM A;  3ABL C;  3OR6 C;  1NVP B;  1R3L C;  1GMG A;  2DWD C;  3F5W C;  1VQL V;  1SER A;  1KQS U;  3P30 A;  4ASU G;  2HG5 C;  4FPP A;  3FB8 C;  2DYS C;  1QVG U;  4UXN A;  3GWO A;  3ZN1 A;  5KA5 A;  3B8N A;  1NR7 A;  4P9P A;  2WLN A;  2F43 G;  1FS0 G;  3AG1 C;  4MW3 A;  5BZB A;  4LP8 A;  2EIN C;  3ETE A;  4MSW C;  4DXW A;  1MAB G;  2DQ0 A;  3ASN B;  1M57 B;  1FXK B;  4BAY A;  1H8E G;  3JD4 A;  2JDI G;  3OAA G;  2W6J G;  1FXK A;  1H8H G;  1JVM A;  4WFH A;  4E2L A;  3E8H A;  1OCR B;  3H01 A;  1IXM A;  4X89 A;  4CBC A;  2IJK A;  2NLJ C;  4JGS A;  4MW8 A;  3CMA V;  1MSW D;  2ZR2 A;  1OCO C;  2A0L A;  4JTD B;  5H6Q A;  1NVP D;  5IYB O;  1BHA A;  4QNH B;  2GHY A;  1S0V A;  1Q86 W;  1EFR G;  1K33 A;  2P90 A;  3CYO A;  4PA9 A;  4F4L A;  3ASO C;  3E89 A;  1WPX A;  4PDR A;  2EZO A;  4CZZ A;  4DO2 A;  3E35 A;  2XAJ A;  3LUT B;  1BHB A;  1OCZ C;  5L3D A;  3X2Q B;  3AG3 B;  3IGA C;  1QR8 A;  2DYR B;  1G4Y B;  1GK9 A;  1R3K C;  2NNU A;  4LC1 A;  3ABU A;  4BW5 A;  4JTC B;  3OEH G;  3OMN B;  2XAG A;  3SYA A;  1QCE A;  5EBM C;  4HYO A;  5L3C A;  3TCU A;  1MOF A;  2ZDI A;  3W7X A;  3CCL V;  1VQP V;  3CD6 V;  1M56 B;  2OCC B;  2IU0 A;  1V55 B;  4WF9 V;  3AEI A;  3RBZ A;  3UM7 A;  1VQK V;  3WFV A;  1JX9 A;  4PDV A;  2ATK C;  3OEE G;  3ZRS A;  1VQM V;  2PI5 A;  2M7W A;  2QE7 G;  4FJC C;  1P4R A;  1YJ9 V;  3B8M A;  1QLE C;  5L3F A;  1YI2 V;  1F23 A;  1ORQ C;  4MVZ A;  2QM8 A;  2LFR A;  1UJW B;  1DTO A;  3CXC U;  1R6K A;  2UXX A;  3JD0 A;  3LSS A;  2A79 B;  3JD1 A;  3CPW U;  3CC7 V;  1W2B U;  1FXV A;  2WLI B;  1Q81 W;  5H6R A;  2QKS A;  2LP7 A;  1GKF A;  1PD3 A;  1JCH A;  2EIJ C;  1F4M A;  3ZMT A;  3SYP A;  1QVF U;  3W7S A;  5IYD O;  2WLI A;  3FB6 C;  3B77 A;  1AJN A;  4LBE C;  1FFT B;  3E8G A;  1RPR A;  1KP2 A;  2DYS B;  1GM9 A;  2X6C A;  3DGE A;  4MVM A;  2V1D A;  1NBM G;  5HFL A;  1K5Q A;  1AI5 A;  2EIL C;  3AG1 B;  3SYQ A;  3RVZ A;  1THZ A;  3SPG A;  4MTX A;  2HFE C;  2XND G;  4TSF G;  1H38 A;  4UV8 A;  2EIN B;  1NQT A;  1DF4 A;  4MS2 A;  4PA6 A;  1JQ0 A;  1S76 D;  3G6E V;  1Q7Y W;  3K3W A;  2P6J A;  3M99 B;  4U7O A;  4MTG A;  5DN6 G;  5EBW C;  3CP1 A;  2WPD G;  3HPL C;  3QO5 A;  4WCE V;  3AG4 C;  1E1Q G;  1Q82 W;  3IC7 A;  3T4D A;  4JAS A;  4KP4 A;  1K4C C;  1OCO B;  3AG2 C;  3PJS K;  1NJI W;  4UV9 A;  3ZRW A;  3T2M A;  1VQ7 V;  3T1C A;  2Y69 C;  2QTO A;  3RW0 A;  2C2A A;  4X88 A;  3ASO B;  4BIZ A;  4QPJ A;  1VQO V;  4X8A A;  2YSU B;  5B3S C;  1AJP A;  1OCZ B;  1KP3 A;  2IH3 C;  3LDE A;  1YJW V;  1K3E A;  4FMT A;  4GX2 A;  2DWE C;  5IY5 B;  1F4N A;  5J9P C;  1F51 A;  3IFX A;  1TUE B;  1R73 A;  3OUS A;  3R65 A;  2R9I A;  2W0F C;  2P67 A;  3CCJ V;  4QE9 A;  2WLH A;  4I5S A;  4TT3 G;  4XDJ A;  3OMA B;  5CA3 A;  2DW4 A;  3HB3 B;  5LGT A;  2Q6A A;  5KA6 A;  1FXH A;  5B1O A;  1K92 A;  1YIJ V;  4HZ3 A;  1QLE B;  5H9C A;  4N21 A;  2EJR A;  1P7B A;  4QPK A;  2WLJ A;  4QE7 A;  4WFB V;  1S72 V;  4JPR A;  1K73 W;  4WFA V;  3RVY A;  3VOU A;  4LCU C;  2EIJ B;  2X7R B;  4P30 A;  3K9A A;  2QM7 A;  1OZ0 A;  1SET A;  2ITD C;  2X6B A;  4RO2 A;  1K8A W;  3QO7 A;  1KKD A;  1KD1 W;  4QJF B;  5L3E A;  5FL7 G;  2IJJ A;  4G28 B;  4GX5 A;  2EIL B;  2DQ3 A;  2EZP A;  2JEU A;  4HAM A;  3JD3 A;  2HKO A;  3K0G A;  2X6A A;  3SYC A;  3OGC C;  3BEH A;  3CC2 V;  2HVJ C;  3ZCC A;  4H37 A;  4GX1 A;  3FYE B;  3D36 A;  1K34 A;  5B1A C;  5KUK A;  5EC1 C;  1M9N A;  3K79 A;  1VQ9 V;  3ZRV A;  3K0D A;  4PA3 A;  1R6N A;  1W0J G;  2JK5 C;  2CK3 G;  3W7U A;  2HVK C;  2Q67 A;  1H2G A;  4KUM A;  3AG4 B;  4JAV A;  1COW G;  1PL0 A;  2GSM B;  3EHB B;  4RQE A;  4R50 A;  4U7N A;  2WLK A;  3OW2 U;  4MTF A;  3OMI B;  1OCC C;  1RPO A;  4JYC A;  3ABM C;  2ZXW C;  1ENV A;  3LNM B;  2Y69 B;  2ZQM A;  3ABL B;  3ML0 A;  1Y4M A;  1CP9 A;  2QA4 V;  2Q69 A;  3SPI A;  1XL6 A;  5B3S B;  1M57 C;  2WSS G;  3EFF K;  1K4D C;  1NR1 A;  4R7C A;  2IW5 A;  3STZ C;  1DLB A;  2MK3 A;  3LDD A;  1AI6 A;  3SPJ A;  1EZJ A;  4EKW A;  5HFM A;  4GX0 A;  1QR9 A;  5LGU A;  3ZMV A;  2Z3Y A;  3MHS C;  4R8C A;  4J9Y B;  4MVO A;  2Z5U A;  1AI4 A;  1JPX A;  3STL C;  1YTF B;  2W6I G;  3TET A;  4UVA A;  3WG7 C;  1I5X A;  5LGN A;  1NKD A;  4WFG A;  5EBL C;  3P32 A;  3CCU V;  1AJQ A;  2P7T C;  3G71 V;  3E86 A;  3G4S V;  4RUE A;  2DYR C;  4Z1M G;  1K5S A;  3K06 A;  3ZRW B;  2IJI A;  4P2Z A;  1VQ4 V;  4XDK A;  3OE7 G;  2JJ1 G;  4MVQ A;  2JEX A;  3K04 A;  3E2E A;  4TWK A;  2R9R B;  5CBF A;  1GTO A;  3MD0 A;  2ZD9 A;  1MG1 A;  4BIU A;  1VQ8 V;  1SZT A;  2Y48 A;  5C93 A;  2IU3 A;  3ZN0 A;  3ZRX A;  1LNQ A;  2Q68 A;  3T4Z A;  3ZJZ A;  1YJN V;  1M1K W;  1CEZ A;  3F7Y C;  5CMU A;  3GB7 C;  4QIW F;  2XAS A;  1PNK A;  2YEV B;  1JJ2 U;  3FB7 C;  1RM1 C;  1NH2 B;  3KG2 A;  1EBO A;  4XBF A;  2XOK G;  2KB1 A;  1YTF D;  1YHQ V;  1PNL A;  1K7D A;  5B1A B;  3F7V C;  2YEV A;  4RUF A;  3ETD A;  3CME V;  1JOY A;  3MHH C;  2FTK A;  4JTA B;  2BOC C;  3OFN G;  1L1F A;  3ZMS A;  3VBB A;  2EIK C;  1KEC A;  3TK1 A;  2ITC C;  3LSQ A;  1AR1 B;  4JYB A;  1OCC B;  3JD2 A;  3ABM B;  1VQ5 V;  5E1A C;  1QBZ A;  2ZXW B;  2XAF A;  5B1B C;  2EBO A;  4JF3 A;  1I5Y A;  4UVC A;  2K1E A;  4RQF A;  2IJH A;  2LFS A;  2QEX V;  1K97 A;  2OTL V;  1BMF G;  2JJ2 G;  5CBG A;  4FK5 C;  3SPH A;  3UKM A;  4L87 A;  1V54 C;  3K08 A;  5LBQ A;  3W7T A;  5IYC O;  3ABT A;  2OT5 A;  4XDL A;  4I9W A;  3ETG A;  3FYI B;  3CCM V;  1S5H C;  3SJQ C;  1NH2 D;  1GM7 A;  2EIM C;  4FIP C;  4ZKI A;  3W7W A;  1DF5 A;  2UXN A;  4PDM A;  5CBH A;  3ABK C;  3SPC A;  1GM8 A;  3QO8 A;  1CPY A;  4GCZ A;  5EC2 C;  4G27 B;  4MVS A;  3WG7 B;  1YIT V;  1VQN V;  4H33 A;  2WLM A;  3SYO A;  2OTJ V;  3QNE A;  3K03 A;  3CCE V;  4PA7 A;  4N23 A;  3CCQ V;  5IY5 C;  1K9M W;  3AG2 B;  3A0R A;  3OR7 C;  1KC8 W;  1XL4 A;  2XAQ A;  3FB5 C;  4YXW G;  2B1G A;  3I55 V;  1S77 D;  3E8B A;  1Y66 A;  1BL8 A;  4UUJ C;  1R3I C;  3ASN C;  3OUF A;  2H8P C;  1FXK C;  4MTO A;  1PNM A;  2HR3 A;  5DM6 V;  4RAI A;  2AHY A;  4R6Z A;  2PI4 A;  4OXS A;  2HLD G;  1YSC A;  1J95 A;  5LHI A;  2ZR3 A;  2B5U A;  5EK0 A;  1OCR C;  5LHH A;  1RM1 B;  2A9H A;  2D3O W;  1E1R G;  2WLL B;  4ZBM A;  3OM3 B;  4J9Z B;  4P9O A;  1W0K G;  1M90 W;  1ARO P;  3NXS A;  1AI7 A;  3JCZ A;  2WLL A;  2WWW A;  4PEL A;  4PDL A;  1WLE A;  3CCR V;  4WFF A;  1ROP A;  3E8F A;  5GW7 A;  1E79 G;  4WFE A;  2EIK B;  1N8R W;  1B6Q A;  1GO3 F;  2B1I A;  2WAM A;  4Q20 A;  3D3I A;  3X2Q C;  3JYC A;  3AG3 C;  3FKS G;  1S3J A;  4G2K A;  2ZDI C;  3CCV V;  3CC4 V;  3ZMU A;  1G8M A;  5L3G A;  1ZWI C;  5B1B B;  5L3B A;  5KUM A;  1HWY A;  5IDJ A;  5LHG A;  3LDC A;  1M56 C;  2OCC C;  1V55 C;  2X0L A;  2XAH A;  1R3J C;  4MT8 A;  5B1N A;  3CCS V;  2HJF C;  1SES A;  1V54 B;  2AHZ A;  2JIZ G;  1VQ6 V;  4GT1 A;  4MVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...