3CC2V

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc2V00
1M90W 1QVGU 3OW2U 1W2BU 2OTJV 3I55V 1KD1W 2OTLV 2QA4V 1Q82W 3CCJV 1QVFU 3CMAV 4WFAV 3CPWU 5DM6V 1VQMV 3CCUV 1R73A 1M1KW 3CMEV 3CCRV 2D3OW 1K9MW 1VQ7V 1N8RW 1KC8W 1YJWV 1VQLV 4WFBV 1VQPV 3CCEV 4WF9V 3CCVV 1VQ4V 3G4SV 4WCEV 1YI2V 1YJNV 1JJ2U 1VQ6V 1VQNV 3CCMV 1VQ8V 3CCSV 3CXCU 1VQ9V 1VQKV 3G6EV 1K8AW 3CC4V 1KQSU 1VQOV 1Q86W 1S72V 1Q7YW 1Q81W 1NJIW 3CC7V 1YHQV 2QEXV 1YJ9V 3G71V 3CCQV 3CCLV 1VQ5V 3CD6V 1YITV 1YIJV 3CC2V 1K73W 3I56V
chains in the Genus database with same CATH superfamily
2F93B 4J80A 4B3SO 2CAZC 2HFEC 4JZ2A 1DF4A 1OV9A 5EIBC 4NTWA 3UM7A 5H2FZ 2PF4E 1FFTB 3GWKC 2VWKA 5CA1A 1WA8A 3OT7A 1MMMA 2QWPB 4HZ3A 2E76B 4J10A 2OYQA 3FX7A 2BTOA 3SPCA 2LJ2A 1J95A 2ZXWC 5JQGA 2R9RB 2ZE5A 4B7KA 4L87A 2AHZA 2P4VA 2QWQB 1IXMA 2PTMA 4MVRA 1K4CC 3R66A 2Q7GA 2VQFB 3K5OA 4J7JA 4ZOLB 2EZOA 4W4KA 2CH7B 1XMQB 2DQ3A 3FAVB 3CC4V 4DR6B 2IU3A 3K08A 3CC7V 4JI5B 1VQ5V 4JI8O 3K0DA 1XEQA 1R3KC 2XT9A 3T1YO 3AG7A 3FB5C 1ZSPA 5C8YB 1SS3A 1F7YA 3ASNB 2R72A 2KQXA 2PY5A 1S5JA 4KFMA 3Q4HA 2KSDA 4NVPA 4X62B 2ZDIC 2JJ2G 3K0GA 3SYAA 2WLLB 1SA0A 3ZEDA 2NNUA 4DV7B 2Y69C 4LFAB 1BMFG 3SDLA 4WFBV 3B8NA 4R7CA 3K9AA 1OCOB 1Z5WA 1VQOV 1CXZB 2F1MA 4R6ZA 4I4TB 2ATKC 1XL4A 4J7ZA 3UCSC 4FPPA 5KHKA 3ETEA 4F6EA 4DR4O 2V1DA 5CN0A 4ASUG 1NQTA 5LP6B 4DV0O 3IC7A 1B06A 2LFRA 5KMGB 2BTQA 3CEIA 4RQFA 2JGUA 3SYOA 1O9HA 2XASA 4O4HB 5GTHZ 3ZMZA 2GHYA 2OWOA 3BAAA 4LF8O 2UUBO 2CTRA 4O2AB 2CTWA 3RYIA 4OGQB 3LDCA 1KB9F 1Q8IA 4JTAB 2EX3A 4RUFA 2EIKB 2BCCH 5J9PC 1COWG 3VQVA 4DR5B 4X88A 2EILB 4E4EA 1I08A 3TK1A 4KP4A 3JAMN 3ZRWA 2HR3A 3OGCC 3JCZA 3BRCA 1Y74A 1TAEA 3BHPA 1R3JC 3CCEV 1NT2B 2VQEB 2IU0A 1VIBA 2Q6AA 1K8AW 5LP6C 4X89A 2P06A 3DC6A 4NXNO 1R3LC 4QPJA 3U10A 2W0XA 2Q9LA 4UCUA 3K59A 3ZHRA 5IT9N 4I55A 1XREA 4EFBA 2PYLA 1VF6A 2EIKC 5DECA 5BR8O 1VF5B 5EYPB 2DQ0A 3BPZA 3CJHB 4Q6GA 2JS5A 2EILC 1UPGA 1NVPD 1TVKA 1XBLA 2Q68A 3FB7C 5IJ0B 3CRAA 3CRQA 1M5IA 5B1OA 2C2AA 1TUEB 4X64B 1YJWV 1HP8A 4YHHB 3JALA 5BY1A 1VP7A 2RQ6A 3W7WA 2EIJB 3CCSV 2LGWA 2RN9A 4FLWA 4MVMA 4EFEA 3O65A 2YEVB 3CWBH 4DV4B 5IWAB 4DR2O 3K5LA 2OTJV 3ZMTA 4JZGA 2BOCC 4X1YA 4Z1VA 3ABLB 5EIBD 3QTCA 3CPWU 1BHBA 3VQWA 2BE3A 3A0BZ 5LYJB 4MVSA 4NTXA 4B3MO 4DUYO 3TXQA 3B8MA 3F5TA 3HKDA 4ZBMA 2QWOB 1AI6A 2PYJA 4JI3O 4PI2A 1OCCC 3A8TA 4JI1O 4DXWA 1GM7A 3ZHUA 2UXXA 4QGPA 2P90A 1FXKB 4GKJO 4GYCB 2NR5A 4R50A 3FB8C 2OIEA 4GUNA 2UU9O 1WLEA 4H33A 5EZYB 1Y4MA 4ZKIA 5LXTB 3K9SA 1R6KA 2DWEC 1DGSA 2EIJC 2WA4A 2UUAB 1P49A 4JI2O 5J2UB 3RVZA 1BGYH 2O57A 1M90W 2FMLA 4LF4B 4YXWG 2RJZA 3JATB 3U11A 1N34B 2GDSA 1NH2B 3K3WA 2W0FC 2XHBA 4EB6B 4TV8A 2EINC 4JYYA 2Q67A 1AILA 3STLC 3CCLV 3MD0A 3DC5A 1FYJA 1F4MA 4FFBB 1GAXA 1P4RA 3UT5B 1S3JA 5KHHA 5JVDB 4FM0A 2YXLA 1G6UA 1L0NH 3E22B 3AG2B 4MTGA 1AJPA 4ZI7B 1JOYA 4QE7A 4OPHA 1HNZB 3CD6V 4PHZA 3BCCH 1WJZA 4U3JA 3WFVA 4DR3O 1DF5A 1Y66A 4IYHA 1Q6HA 1H2SB 3L71H 1GH6A 4JASA 4P9OA 1SF9A 1P7GA 3E8HA 4YJ3A 3ABUA 2Z3YA 5B1NA 3TETA 2F4VB 1RM1B 4K0KB 4XDLA 2QTSA 3L9DA 2W6IG 3H1HH 1GMGA 4UCOA 4JV5B 1IZ3A 1WB7A 2GUZB 2ZNJA 3OGIB 4JYBA 4WBNA 1AR1B 1G4YB 2XAGA 4X20B 4LF5B 2UXBO 2EJRA 4DV1O 1NZ6A 1FJGB 4MW8A 3PN1A 3X2QB 3JAWB 1QR8A 1I5XA 3E86A 4IHJA 1F51A 1V9PA 1H2KA 5KUKA 2P7TC 4I7ZB 3JYCA 1KD1W 2MK3A 1PV0A 1DK1A 1H38A 4FLXA 1K92A 2R70A 4UUJC 5HFMA 2Y0PA 1Y67A 2YICA 1HNWO 4FZ1A 1IDSA 4DW1A 1GN4A 4DV6B 1XNRO 3GVMA 3L72H 4QE9A 2OIGA 1NTMH 3QO7A 1M56B 4O4IA 2WLMA 2HHHB 2XTAA 3SGIA 3J81N 1AP5A 4DYLA 4FLUA 5B1AB 3BA8A 4B3RO 4CZZA 1H2MA 4MVOA 5A2QN 2AGAA 3ZMUA 3C3TA 4E2LA 2N74A 1FFXA 2DYRC 3OTOO 3M8AA 2K1EA 1QHTA 4JI7B 3SR2C 4JI0B 2DE0X 1E1QG 5EK0A 3OFNG 5CB4A 3CSXA 1JR9A 4F6RB 1NR1A 5LHIA 4NYKA 5ITZA 2X6BA 1VEWA 1XNQO 2N05A 4I0XB 3JD2A 4PD4F 1IX9A 3AG4B 1ORQC 3HR0A 3E89A 3AG1C 2JGDB 2YXHA 2IJIA 1Q6IA 4ABMA 1Y76B 4LWSA 2Y48A 3H01A 3K57A 5B1AC 5IE9A 1JCHA 1VQNV 1RSOA 5DEDA 1Q7YW 1K4DC 1Q5OA 1ZX3A 4OPAA 3W7TA 1BQ0A 4R8CA 2ZDIA 4J41A 3JAKA 4CH4A 1N33O 1AI7A 4LF7B 3ICXA 5B1BB 4DRXB 3G67A 5B5EZ 5GONB 5B3SB 2F43G 4DW0A 2EIMB 2B5UA 1SZTA 4NTYA 3M7MX 1PL4A 2PI4A 3OR6C 3K04A 3FAVA 4Z1MG 2IJKA 4PA6A 5LMNB 5JWPA 1EBOA 2UUCO 3A2FA 3VQXA 2QA4V 2GSMB 4CC5A 1SERA 1UJWB 4JI8B 1FPOA 4MS2A 1QLEB 3SJCC 1NR7A 3ABMB 1RPRA 4BIUA 3DXRB 4NR1A 2IW5A 1KQSU 4JAUA 4CS3A 3HKBB 2P6JA 3EVKA 4TV9B 5L3GA 4JI6O 4WFFA 4W4LA 3LSUA 1QVGU 3CXHF 3OW2U 4YJ2A 2YIDA 2F95B 1EFRG 1WPBA 2ZM6B 4N23A 5B1BC 3SYPA 1TGOA 2QDOA 4TT3G 5AG2A 3W7UA 2JEXA 2FTKA 3EHBB 3TCUA 3ETQA 1SQVH 4LFBO 5EC1C 4QNHB 5TISZ 3LNNA 3RYHB 2B1GA 5LOVB 4X1KA 3ETDA 1K73W 2E5LB 4UB8Z 1SQQH 5J2TB 1ZL8B 4NKGB 3CRMA 2UXCB 2M6YA 4HAMA 4AQYB 2DW4A 2ILMA 3D3QA 4X1IB 4XBFA 4FLVA 1BT8A 4DV3O 1QLEC 1H8EG 1R3IC 1VQKV 2KG7A 3A0HZ 3JD0A 3UO2A 4DR4B 3ZHVA 1B6QA 2Y4TA 3SPIA 4PI0A 3ZIAG 5JJEB 4DV0B 4QJFB 2Q0OC 2ZQMA 3NXSA 3D3IA 2UXDO 4H37A 1N8RW 2Q69A 3JD3A 4L8JA 5BZBA 2ZNIA 3H9VA 1IBLO 1VMGA 4XDJA 2JRIA 1MG1A 4GZRB 1KP3A 1N32O 2JEUA 1SZXA 3STZC 3OR7C 2QM8A 1SETA 1QQCA 1EZJA 1X59A 3QNEA 2BOBC 4G28B 4DV5O 1PNMA 4RUEA 1M1KW 2VRZA 3D36C 3IC9A 1VQ7V 2L35A 1JFFA 3P3PA 5JJNB 1VQ9V 2ZKOA 5LA6A 1S72V 3MHHC 2ZINA 4LR3A 1W59A 3CP1A 1A32A 5CA1B 2DN9A 5IYDO 1WA8B 1GRJA 3WG7B 2Y4UA 4O2BA 4TUYA 4BAYA 4P30A 4PA4A 3QO5A 3ASNC 5JQGB 5GW7A 3T1HB 1MZEA 2M7WA 3APQA 3QG5A 3SJBC 2A06H 2ADQB 1P84F 2VQFO 4NXMB 1SQFA 1XMQO 4TQFA 5EYPA 3G80A 4DR6O 1NTZH 1TUBA 4ZIBA 1DLBA 2DJVA 2EULA 2WLNA 1XUQA 5F2VO 5BMVA 2DMXA 2HLDG 3JASA 5CA0A 2YUAA 1NBMG 2XAQA 1OCOC 1N36B 3N2GA 4JAAA 4FLZA 5IY5B 4MVQA 3Q4HB 5IJ9A 1IVSA 1B04A 1LUWA 1P7BA 4UCRA 5C93A 2RMKB 1SA0B 1U96A 3WB2A 4WFGA 4DV7O 4N21A 4LFAO 4PA7A 1E79G 4O4LA 1XQ8A 4UVBA 1QR9A 2ZD9A 5L3DA 4DV2B 2WPDG 3BFRA 2QKAA 4UVCA 3ZCCA 1NTKH 3ZBHA 1PD3A 3UKMA 3BY6A 4JI3B 2DYSB 3HKEA 2BSKA 3SPHA 5KX5A 3RYCA 2LGQA 2LFSA 2X7RB 2ZE7A 1D5AA 4EEQA 2AXTZ 5IYZA 1YJ9V 3ZMVA 4GKJB 1URFA 5IDJA 3JARA 4KXRA 2Q73A 5CBGA 5LXTA 2YIBD 3CE2A 4PA9A 2CDYA 2HJDA 5KLVH 2LP7A 3K03A 3CCRV 1Q43A 2RNBA 3K5MA 2WLHA 2E75B 4RAIA 2ARHA 1WAZA 1S5LZ 3G6EV 4YY3O 3G71V 2IBZH 2CTPA 3UO3A 3RWRD 3QVNA 4PELA 4CH3A 3BEHA 3CCJV 1N0JA 1HNXO 4DR5O 2IJHA 4JPRA 1ZTEA 4MTXA 4FFBA 1GO3F 2Q7EA 3OUSA 2XAHA 5CBFA 5JVDA 4J11A 3JD4A 1LNQA 1YZBA 2ZCEA 1QCEA 1WNSA 3FB6C 3ZRWB 2HVJC 4LH7A 1AI4A 1Y74B 1PM9A 2VQEO 4D7TA 3RYFA 4DR1O 2ITCC 1PL0A 3ZX6A 4WFAV 4JI4B 4U7NA 3EXAA 3IFXA 3CS5A 4UVAA 1M57B 1ZWIC 4AILC 4WF9V 4DR3B 3IJ4A 1YVWA 3H1JH 1GM8A 3TGUH 4LBEC 1Q81W 1M4UA 5FNVB 1V55B 4J9ZB 3HPLC 5K1PA 1XMOO 2FB5A 1L8DA 1IBMB 4I55B 1KKCA 2Q7HA 3E83A 4GX5A 1HR0B 1N4CA 3JSLA 2A3QA 3ABLC 3A0RA 4LF9B 3TJTA 4GX1A 1NI8A 4LNUA 3JSNA 1HDJA 1TVKB 1SKVA 1AP6A 1D2DA 1YCIA 3LDEA 1GM9A 4DUZB 4IIJA 3AK1A 4YHHO 4G27B 3OMIB 3JALB 2OTLV 1BSMA 5L3FA 5CA3A 4DV4O 3P3NA 5IWAO 4OX9O 4IGGA 2EJ7A 1FXKC 2NN4A 1R6NA 5FPOA 4LF6B 3K58A 2A0LA 4X1YB 2FL4A 2X0LA 1JVMA 1SC5B 4TOIA 3L70H 1YIJV 4H44B 4GX2A 1OCRB 1V55C 3RN4A 4AHCA 1S77D 4HYOA 1K5SA 1Q3EA 3HKDB 2IJJA 5EBLC 4JAVA 2IH3C 3G6BA 2JK5C 1SQGA 4UB6Z 5JJJB 2Q8VA 5L3CA 5L3EA 4QIWF 3OM3B 3N2KA 4FLYA 1MOFA 4J7KA 4LFCB 1G1XB 3FD9A 4BW5A 5E79Z 4GKKB 1Z5VA 1QVFU 2UUAO 4J9YB 1AR4A 2H3OA 2ETNA 2A7WA 2RCVA 3CCVV 3B77A 1YXBA 4LF4O 3AG2C 1PNKA 1W0JG 4O4JB 4F6RA 1N34O 1JQ0A 4X66B 5KA5A 2OCCB 4GCZA 1XNQB 2XOKG 1I94B 3APOA 3HKCA 4B7EA 1OCRC 2GTSA 4YIPA 5DM6V 2OCHA 4KHPO 1KUQA 2YIBA 1KC8W 1EN5A 5JH7A 4B3TB 3LDDA 2HVKC 1RPOA 3KKYA 5FLXN 5EC2C 1JJ2U 1Y76A 4FMTA 1KMIZ 5B66Z 1H8HG 2QEXV 3GWOA 3KG2A 1AROP 4UCVA 1QBZA 3OE7G 1RM1C 1B3QA 1V54B 1VF7A 3CCUV 2WLIA 3CRCA 1J5EB 1HNZO 1IURA 2JJ1G 4I50A 1N33B 2IM9A 1K7DA 4U3JB 2KB1A 1XHZA 1YHQV 2QM4A 3CCQV 3X2QC 2F66C 3DSQA 2B1IA 5CBHA 1S0VA 2AHYA 4JYCA 4P9PA 1U97A 2ADPA 1JJOA 1AR5A 4DR7B 4K0KO 2GV9A 3RFRA 2UXNA 2AZ0A 4YIOA 2W6JG 1TA8A 5DN6G 1IBKO 1WPXA 3ZRSA 5K1XA 5JCOC 1KP2A 4LF5O 5E1AC 4DO2A 4WBNB 1M56C 1FJGO 4JYAB 3LNMB 4TV9A 4ZHQA 2KKWA 4WCEV 4IHJB 1SQPH 2Q0AA 4B3SB 3KZIZ 2A9HA 1K34A 2YS8A 2YDEA 4XDKA 3E8FA 4DV6O 4JTDB 3ABKB 3IGAC 4Q20A 1MA1A 1OCZB 3FFQA 2QJ1A 2HEPA 1JA8A 4O4IB 3D36A 1KKDA 1DTOA 1MZFA 3ZHSA 3OMNB 2GTAA 3AK3A 1NU1H 2H94A 5HFLA 3IAYA 3OEEG 5KAFZ 4ZOLA 3AG4C 2CH7A 2VS0A 1YDXA 1GN2A 1Q90D 2QSAA 3KCYA 3RGBA 1FFXB 4HNAB 1VQLV 4JI7O 4JI0O 3RW0A 3CXCU 3T1YB 1QNMA 3CHXA 5C8YA 2ZXWB 1OHHG 2UXDB 2EBOA 2R9IA 5CB4B 5ITZB 3RBZA 1UFIA 3ZHTA 3S3WA 4X65O 3K06A 1BZKA 2WLLA 2JS3A 5B3SC 3HB3B 4RQEA 1AI5A 5LMUO 3T2MA 2EIMC 1XL6A 4DV5B 1KECA 1Q86W 5LL6Y 1PPJH 4LWSB 2CGOA 1M93A 1S5HC 3ZS8C 2B9ZA 5LGNA 1RSOB 4I4TA 3OTFA 2E74B 1NH2D 2QKCA 4LF7O 2V4DA 3JAKB 4K8ZA 3ABMC 5FL7G 3ZRVA 3J7AU 1LR1A 3CX5F 1KYOF 3S3XA 5LP6A 2CGNA 1MNGA 2Y69B 5KMGA 3O9OA 3OMAB 4PJ0Z 4CH6A 5LMNO 2ITDC 4O4HA 1HWYA 4O2AA 4LF8B 2UUBB 1NJIW 3B09A 2ODMA 3I56V 1ZLZA 1Z2GA 2GBOA 3FYEB 4QPKA 5D5PA 2ZIOA 1FKAO 2EZPA 3M99B 2Q4PA 2FYUH 4FM1A 2WSSG 2YXYA 4CH5A 2QWRB 4MSWC 2ZM6O 4YJ2B 3K79A 2YI8A 2LW7A 2ZT9B 2N04A 5IYBO 4GT1A 1GTOA 2P67A 3B40A 3CB2A 2AW9A 3WU2Z 2E5LO 1FAFA 5LBQA 4NXNB 3JD1A 3RT3C 1YI2V 4LP8A 4X1KB 2UXCO 1PKXA 4X8AA 4AQYO 2OT5A 3T4ZA 2L6LA 2CUGA 3VBBA 2R9AA 2Z0AA 3AEIA 3WB1A 4PDVA 3ZRXA 5BR8B 3CJHA 2KG7B 4JI5O 3AG3B 3D8CA 3T1CA 3TXSA 1QU7A 1YJNV 5IJ0A 4LH6A 2WA3A 1PNLA 4CC6A 4PDMA 1THZA 3GB7C 2F23A 3B4SA 4K35A 4EKWA 1YITV 2CTQA 2P22C 2H8PC 1D5NA 3KCXA 4X62O 4B08A 2YEVA 4YY3B 3I5DA 1K33A 1FXVA 1YSCA 4PDRA 1CEZA 3WG7C 4DR2B 1I0HA 2HJFC 3ZN0A 1HNXB 5LYJA 1SQBH 2HP8A 4AI8A 4UCSA 1H2LA 4MTFA 1AJQA 4I9QA 3LSQA 4PV1B 1ZUQA 4B3MB 1JFFB 4DUYB 3W7SA 3DGEA 4J42A 1M9NA 5LA6B 1R1BA 2CK3G 4D7SA 1MABG 3AG3C 1XOUA 1Y6XA 3ETGA 4HBNA 4JI1B 4DR1B 1FXKA 4G2KA 4CS2A 5A9GA 3J80N 4O2BB 4TUYB 2XNDG 2NLJC 3T1HO 5EZYA 2UU9B 4MVUA 5FNVA 5IYCO 3L73H 1VQMV 4JGSA 5J2UA 1AJNA 5IY5C 4JI2B 1XI1A 1XMOB 4NXMO 1JX9A 3SYCA 2BTQB 4JTCB 4IYIA 4DK1A 2P5OA 3JATA 1EM1A 1OCCB 4K3AA 1G8MA 2WLJA 3RYIB 3P30A 1TUBB 4EB6A 2MW2B 3ZMSA 2FKXA 2YI9A 4FJCC 1CP9A 2QGNA 1GN3A 4BIZA 5BMVB 4GX0A 2DOSA 3QO8A 2XAJA 2PGGA 1N36O 3JASB 1FXHA 5CA0B 3UQ8A 2X6AA 3N2GB 5CMUA 1VQ4V 2DYSC 3E8BA 3UT5A 5FPRA 4LCUC 4FFKA 4MW3A 1WB8A 1HW7A 4UXNA 4OX9B 2E3CA 3E22A 1H2NA 5IJ9B 1SESA 5H6RA 3FYIB 3E2EA 3R65A 4KUMA 1W2BU 4ZI7A 3FKSG 2PZSA 1BCCH 4MT8A 1ZAUA 1YTFB 3SPJA 4Z2WA 1R73A 5KUMA 3JCUZ 1PP9H 1ENVA 1VARA 3MAQA 4DV2O 4O4LB 1GK9A 1SQXH 3ZN1A 2EINB 4CS4A 1NKDA 1RFYA 2K9PA 3H1KH 2IH1C 2V7QG 5KHGA 3AK2A 4IT5A 3HKEB 5BXZA 2QR4A 1QLNA 3I55V 2BSKB 5LGTA 2ZR3A 3B2EE 1X4TA 5KX5B 2XUMA 4TSFG 4I5SA 3NR7A 3RYCB 5GTIZ 4BIOA 5IYZB 4IL6Z 1WN7A 2ZIMA 3JARB 5H6QA 3K5NA 1O9GA 2QKSA 2GUZA 3BABA 4X64O 4X20A 2UXBB 2HKOA 4DK0A 4O4JA 3JAWA 4DV1B 1I5YA 1GN6A 5LHGA 3VOUA 3CMEV 2D3OW 4F4LA 5L3BA 4BWAA 2Q5ZA 1BHAA 3CRRA 1M57C 4MTOA 3CCMV 2Y0IA 4U3FH 4K8XA 2ZE8A 4KHPB 1K5QA 1MSDA 3F7YC 1US6A 1LUVA 5KA6A 1HNWB 5JCOA 2ZE6A 3N27A 1XNRB 2WWWA 1EN6A 2PI5A 1JPXA 5D5QA 1S76D 1VF6C 1CPYA 2Z5UA 5LHHA 2WLKA 4FIPC 4I9WA 3RYFB 4JI4O 3L75H 4FLTA 1N0NA 5EBMC 2P4KA 4B3RB 4MVZA 2LO1A 2YSUB 4BW9A 3H1LH 2A79B 4TWKA 1Q82W 2VWJA 3OTOB 1IBMO 1FD9A 3OUFA 4UCTA 3SJAC 4NB5A 1VQ8V 1W0KG 4CBCA 1HR0O 3L74H 2LQTA 4I0XA 4LF9O 2QTOA 1AVMA 3ABTA 2QE7G 3SJQC 4LC1A 3E35A 4H13B 4UFZA 2WAMA 3W7XA 4LNUB 4TV8B 5KHJA 3CMAV 4DUZO 1IBKB 1K9MW 3OD4A 4IIJB 2JGDA 2QM7A 2DYRB 3CYOA 3ML0A 1YF2A 3E8GA 5KHIA 4FZ0A 4C7UA 1XHXA 2ZR2A 3F7VC 2PUSA 4LF6O 2DWDC 4OXSA 1MSWD 3ZHQA 3LUTB 1YEWA 4U7OA 3EFFK 4FVMA 2G38A 4DRXA 4FK5C 5GONA 1T5EA 4GLXA 3AG1B 4PA3A 4UV9A 1ROPA 2RDCA 5H9CA 1L1FA 3ASOB 3P32A 1XILA 3ZJZA 3MHSC 2OCCC 5H5NA 1NS1A 1IXBA 1KBHA 1WP7A 4TQDA 2F4VO 1H2GA 2QWNB 4YJ3B 3SYQA 1OJHA 4LFCO 4WFHA 3N2KB 2UUCB 1VQ6V 4GKKO 5KAIZ 4HNAA 4JV5O 2YIAA 2XAFA 4P2ZA 1GKFA 1K97A 2YC0A 1BQZA 2JDIG 3OEHG 3DXRA 4X9QA 3WB0A 1EN4A 3HKBA 3DTUB 4X66O 3RVYA 1V54C 1VQPV 1I94O 4JI6B 4RWUA 3HKCB 3QF7A 3T4DA 1E1RG 4X65B 3H1IH 4B3TO 1R6TA 1NVPB 5JH7B 1L0LH 5LMUB 3ASOC 1WP8A 1EZVH 2JVDA 1KU9A 3RYHA 5EBWC 3OAAG 1FS0G 4KL1A 3U0ZA 4LFBB 5LOVA 1F4NA 2HHHO 3PJSK 5J2TA 1RP3B 1ZL8A 1BE3H 3C3SA 1J5EO 3C90A 4A5UB 2WLIB 4X1IA 3THOA 2AZ2A 2JIZG 1K3EA 3BA9A 3VQYA 4DV3B 4I50B 4D6TH 4UV8A 1AB3A 4PDLA 1I7FA 3BVOA 3LSSA 4WFEA 2HG5C 4FM2A 4DR7O 3CC2V 3F5WC 4H0LB 1IBLB 1XDCA 4ICGA 2CE4A 3ABKC 3MDSA 1YTFD 1N32B 4RO2A 1F23A 1BL8A 1Q6UA 1OCZC 4JF3A 2X6CA 3G4SV 2D2CB 2LW1A 1JMKC 1SRYA 4BR6A 5LGUA 4JYAO 3SPGA 1BS3A 4ZHQB 1OZ0A
chains in the Genus database with same CATH topology
2H8PC 2HFEC 1DF4A 2YEVA 3E83A 4GX5A 3UM7A 1FFTB 5B1AB 1K33A 1FXVA 3ABLC 1YSCA 3A0RA 4PDRA 1CEZA 3WG7C 4GX1A 4CZZA 4MVOA 2HJFC 4HZ3A 3ZMUA 3ZN0A 4E2LA 3LDEA 1GM9A 3SPCA 2DYRC 2K1EA 1J95A 2ZXWC 2R9RB 4L87A 4MTFA 1AJQA 2AHZA 1IXMA 3LSQA 4G27B 3OMIB 4MVRA 2OTLV 1K4CC 3W7SA 3DGEA 1E1QG 5L3FA 5EK0A 3OFNG 1M9NA 5CA3A 2CK3G 1NR1A 1FXKC 5LHIA 1MABG 2X6BA 2EZOA 3AG3C 1R6NA 2DQ3A 3ETGA 3JD2A 1FXKA 4G2KA 2A0LA 3CC4V 3AG4B 2IU3A 1ORQC 3K08A 3CC7V 2X0LA 1JVMA 1VQ5V 1YIJV 3K0DA 3E89A 4GX2A 1OCRB 1V55C 2XNDG 3AG1C 2NLJC 1S77D 4HYOA 1R3KC 4MVUA 1K5SA 3FB5C 5IYCO 2IJIA 1VQMV 4JGSA 1AJNA 2IJJA 3ASNB 2Y48A 3H01A 4JAVA 2IH3C 5EBLC 5IY5C 1JX9A 2JK5C 5B1AC 3SYCA 4JTCB 1JCHA 4KFMA 1VQNV 5L3CA 1OCCB 2ZDIC 1Q7YW 1K4DC 1G8MA 2JJ2G 2WLJA 3K0GA 3P30A 5L3EA 3SYAA 4QIWF 3OM3B 3W7TA 3ZMSA 4R8CA 2WLLB 2ZDIA 1MOFA 4FJCC 1AI7A 1CP9A 4BW5A 5B1BB 4BIZA 1QVFU 4GX0A 2NNUA 3QO8A 2XAJA 4J9YB 5B3SB 2F43G 2Y69C 1FXHA 1BMFG 4WFBV 2EIMB 2X6AA 3B8NA 3CCVV 2B5UA 1VQ4V 5CMUA 2DYSC 4R7CA 1SZTA 3E8BA 3B77A 3K9AA 1OCOB 3AG2C 1PNKA 1W0JG 4LCUC 1VQOV 4MW3A 4UXNA 4R6ZA 2PI4A 3OR6C 1JQ0A 5KA5A 2ATKC 3K04A 4Z1MG 2OCCB 1SESA 2IJKA 4GCZA 4PA6A 5H6RA 2XOKG 3FYIB 1EBOA 1XL4A 3E2EA 3R65A 4KUMA 1OCRC 1W2BU 4FPPA 3FKSG 2QA4V 2GSMB 4MT8A 5DM6V 1YTFB 3SPJA 1SERA 1R73A 5KUMA 3ETEA 1UJWB 1KC8W 1ENVA 2V1DA 4MS2A 1QLEB 3LDDA 2HVKC 1GK9A 1RPOA 1NR7A 3ABMB 5EC2C 3ZN1A 2EINB 1RPRA 5CN0A 4ASUG 1NKDA 4BIUA 1JJ2U 1NQTA 4FMTA 3IC7A 2IH1C 2IW5A 1KQSU 4JAUA 1H8HG 2QEXV 2LFRA 3GWOA 3KG2A 2P6JA 2V7QG 4RQFA 3SYOA 1AROP 5L3GA 2XASA 4WFFA 1QVGU 1QBZA 3OE7G 3OW2U 1QLNA 3ZMZA 2GHYA 1RM1C 3I55V 5LGTA 1V54B 2ZR3A 1EFRG 3CCUV 2WLIA 4N23A 4I5SA 4TSFG 5B1BC 3LDCA 3SYPA 4JTAB 2JJ1G 4TT3G 4RUFA 2EIKB 5H6QA 3W7UA 1K7DA 2QKSA 2JEXA 2KB1A 2FTKA 3EHBB 3TCUA 5J9PC 1COWG 1YHQV 5EC1C 4QNHB 3CCQV 2B1GA 4X88A 3X2QC 2EILB 1K73W 3ETDA 2B1IA 2HKOA 5CBHA 1S0VA 2AHYA 4JYCA 3TK1A 4KP4A 4P9PA 1I5YA 3ZRWA 4HAMA 2HR3A 5LHGA 3OGCC 3JCZA 3VOUA 3CMEV 2D3OW 2DW4A 4F4LA 5L3BA 1R3JC 1BHAA 4XBFA 3CCEV 2IU0A 1QLEC 2UXNA 1M57C 4MTOA 1H8EG 3CCMV 1R3IC 2W6JG 1VQKV 2Q6AA 1K8AW 3JD0A 5DN6G 1WPXA 3ZRSA 1K5QA 4X89A 1KP2A 3F7YC 5E1AC 5KA6A 4DO2A 1R3LC 1B6QA 4QPJA 1M56C 3SPIA 3ZIAG 2WWWA 2PI5A 4QJFB 2ZQMA 3LNMB 1JPXA 1S76D 3NXSA 3D3IA 4H37A 1N8RW 2Q69A 3JD3A 1CPYA 2Z5UA 5BZBA 5LHHA 4WCEV 2WLKA 4FIPC 4XDJA 4I9WA 2EIKC 1MG1A 2A9HA 1K34A 2DQ0A 1KP3A 2JEUA 3STZC 3OR7C 4XDKA 1OZ0A 3E8FA 5EBMC 2QM8A 1SETA 4MVZA 2YSUB 2EILC 4JTDB 1NVPD 3ABKB 1EZJA 2A79B 3QNEA 2Q68A 3FB7C 2BOBC 3IGAC 4G28B 4Q20A 4TWKA 1Q82W 1PNMA 1OCZB 4RUEA 1M1KW 5B1OA 2C2AA 1TUEB 1VQ7V 1YJWV 3OUFA 1KKDA 3D36A 1DTOA 1VQ8V 1W0KG 2EIJB 3W7WA 3OMNB 3CCSV 1VQ9V 4MVMA 4CBCA 1S72V 3MHHC 2H94A 5HFLA 2YEVB 3OEEG 3AG4C 2QTOA 2OTJV 3CP1A 3ABTA 3ZMTA 2QE7G 3SJQC 4LC1A 3E35A 2BOCC 2WAMA 5IYDO 3ABLB 3W7XA 3CMAV 3CPWU 1BHBA 3WG7B 4BAYA 4P30A 1K9MW 4PA4A 3QO5A 1VQLV 3ASNC 2QM7A 5GW7A 4MVSA 3RW0A 2DYRB 3CYOA 3ML0A 3B8MA 4ZBMA 3CXCU 2M7WA 2ZXWB 1AI6A 1OHHG 3E8GA 2EBOA 2R9IA 1OCCC 2ZR2A 3F7VC 3RBZA 4DXWA 1GM7A 2DWDC 2UXXA 2P90A 4OXSA 1FXKB 1MSWD 3K06A 1DLBA 3LUTB 2WLLA 4U7OA 3EFFK 2WLNA 4R50A 5B3SC 3FB8C 3HB3B 4RQEA 1AI5A 1WLEA 4H33A 3T2MA 2EIMC 1Y4MA 4FK5C 4ZKIA 1XL6A 1KECA 2HLDG 1Q86W 1R6KA 2DWEC 2EIJC 3AG1B 4PA3A 4UV9A 1NBMG 2XAQA 1OCOC 1ROPA 3RVZA 5H9CA 1L1FA 3ASOB 1M90W 1S5HC 3P32A 3ZJZA 5IY5B 3MHSC 2OCCC 4MVQA 5LGNA 4YXWG 1H2GA 1NH2B 3K3WA 3SYQA 1P7BA 2W0FC 4WFHA 5C93A 1NH2D 1VQ6V 3ABMC 4WFGA 5FL7G 2EINC 2Q67A 3ZRVA 4N21A 1E79G 4PA7A 2XAFA 4P2ZA 3STLC 4UVBA 1GKFA 1K97A 1QR9A 3CCLV 2ZD9A 2JDIG 3OEHG 5L3DA 3MD0A 2WPDG 4UVCA 3ZCCA 1F4MA 1P4RA 2Y69B 3DTUB 1S3JA 1PD3A 3OMAB 3UKMA 3BY6A 3RVYA 1V54C 2DYSB 1VQPV 2ITDC 3AG2B 1HWYA 4MTGA 3SPHA 1AJPA 3T4DA 4QE7A 1E1RG 1NJIW 1JOYA 2LFSA 2X7RB 1YJ9V 3CD6V 3ZMVA 5IDJA 5CBGA 1NVPB 3I56V 3WFVA 3FYEB 3ASOC 1DF5A 1Y66A 4PA9A 4QPKA 5EBWC 2LP7A 3K03A 3OAAG 1FS0G 3CCRV 2EZPA 1F4NA 2WLHA 4RAIA 3M99B 3PJSK 4JASA 2WSSG 4P9OA 4MSWC 3G6EV 3E8HA 3ABUA 2Z3YA 5B1NA 3K79A 3TETA 3G71V 2WLIB 5IYBO 1RM1B 4XDLA 2JIZG 4GT1A 1K3EA 1GTOA 4PELA 2P67A 3BEHA 3CCJV 2W6IG 1GMGA 2IJHA 4JPRA 4UV8A 4JYBA 1AR1B 1G4YB 2XAGA 3JD1A 4MTXA 4PDLA 5LBQA 1GO3F 1YI2V 3OUSA 4LP8A 2XAHA 5CBFA 2EJRA 3LSSA 4WFEA 4MW8A 3X2QB 1PKXA 4X8AA 3JD4A 2OT5A 1QR8A 1I5XA 1LNQA 2HG5C 1QCEA 3ZRWB 3FB6C 3T4ZA 2HVJC 3E86A 1F51A 3VBBA 3CC2V 1AI4A 3F5WC 5KUKA 2P7TC 2ITCC 3JYCA 1KD1W 2MK3A 1PL0A 3AEIA 4PDVA 4WFAV 3ZRXA 1H38A 1K92A 3ABKC 4U7NA 3IFXA 4UUJC 1YTFD 4RO2A 1F23A 1BL8A 3AG3B 1M57B 4UVAA 5HFMA 1ZWIC 1OCZC 3T1CA 4JF3A 4WF9V 2X6CA 3G4SV 1YJNV 4QE9A 1SRYA 1PNLA 5LGUA 1GM8A 4PDMA 1THZA 3GB7C 4LBEC 1Q81W 3QO7A 3SPGA 1V55B 4J9ZB 3HPLC 4EKWA 1M56B 1YITV 2WLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 W;  1QVG U;  3OW2 U;  1W2B U;  2OTJ V;  3I55 V;  1KD1 W;  2OTL V;  2QA4 V;  1Q82 W;  3CCJ V;  1QVF U;  3CMA V;  4WFA V;  3CPW U;  5DM6 V;  1VQM V;  3CCU V;  1R73 A;  1M1K W;  3CME V;  3CCR V;  2D3O W;  1K9M W;  1VQ7 V;  1N8R W;  1KC8 W;  1YJW V;  1VQL V;  4WFB V;  1VQP V;  3CCE V;  4WF9 V;  3CCV V;  1VQ4 V;  3G4S V;  4WCE V;  1YI2 V;  1YJN V;  1JJ2 U;  1VQ6 V;  1VQN V;  3CCM V;  1VQ8 V;  3CCS V;  3CXC U;  1VQ9 V;  1VQK V;  3G6E V;  1K8A W;  3CC4 V;  1KQS U;  1VQO V;  1Q86 W;  1S72 V;  1Q7Y W;  1Q81 W;  1NJI W;  3CC7 V;  1YHQ V;  2QEX V;  1YJ9 V;  3G71 V;  3CCQ V;  3CCL V;  1VQ5 V;  3CD6 V;  1YIT V;  1YIJ V;  3CC2 V;  1K73 W;  3I56 V; 
#chains in the Genus database with same CATH topology
 2F93 B;  4J80 A;  4B3S O;  2CAZ C;  2HFE C;  4JZ2 A;  1DF4 A;  1OV9 A;  5EIB C;  4NTW A;  3UM7 A;  5H2F Z;  2PF4 E;  1FFT B;  3GWK C;  2VWK A;  5CA1 A;  1WA8 A;  3OT7 A;  1MMM A;  2QWP B;  4HZ3 A;  2E76 B;  4J10 A;  2OYQ A;  3FX7 A;  2BTO A;  3SPC A;  2LJ2 A;  1J95 A;  2ZXW C;  5JQG A;  2R9R B;  2ZE5 A;  4B7K A;  4L87 A;  2AHZ A;  2P4V A;  2QWQ B;  1IXM A;  2PTM A;  4MVR A;  1K4C C;  3R66 A;  2Q7G A;  2VQF B;  3K5O A;  4J7J A;  4ZOL B;  2EZO A;  4W4K A;  2CH7 B;  1XMQ B;  2DQ3 A;  3FAV B;  3CC4 V;  4DR6 B;  2IU3 A;  3K08 A;  3CC7 V;  4JI5 B;  1VQ5 V;  4JI8 O;  3K0D A;  1XEQ A;  1R3K C;  2XT9 A;  3T1Y O;  3AG7 A;  3FB5 C;  1ZSP A;  5C8Y B;  1SS3 A;  1F7Y A;  3ASN B;  2R72 A;  2KQX A;  2PY5 A;  1S5J A;  4KFM A;  3Q4H A;  2KSD A;  4NVP A;  4X62 B;  2ZDI C;  2JJ2 G;  3K0G A;  3SYA A;  2WLL B;  1SA0 A;  3ZED A;  2NNU A;  4DV7 B;  2Y69 C;  4LFA B;  1BMF G;  3SDL A;  4WFB V;  3B8N A;  4R7C A;  3K9A A;  1OCO B;  1Z5W A;  1VQO V;  1CXZ B;  2F1M A;  4R6Z A;  4I4T B;  2ATK C;  1XL4 A;  4J7Z A;  3UCS C;  4FPP A;  5KHK A;  3ETE A;  4F6E A;  4DR4 O;  2V1D A;  5CN0 A;  4ASU G;  1NQT A;  5LP6 B;  4DV0 O;  3IC7 A;  1B06 A;  2LFR A;  5KMG B;  2BTQ A;  3CEI A;  4RQF A;  2JGU A;  3SYO A;  1O9H A;  2XAS A;  4O4H B;  5GTH Z;  3ZMZ A;  2GHY A;  2OWO A;  3BAA A;  4LF8 O;  2UUB O;  2CTR A;  4O2A B;  2CTW A;  3RYI A;  4OGQ B;  3LDC A;  1KB9 F;  1Q8I A;  4JTA B;  2EX3 A;  4RUF A;  2EIK B;  2BCC H;  5J9P C;  1COW G;  3VQV A;  4DR5 B;  4X88 A;  2EIL B;  4E4E A;  1I08 A;  3TK1 A;  4KP4 A;  3JAM N;  3ZRW A;  2HR3 A;  3OGC C;  3JCZ A;  3BRC A;  1Y74 A;  1TAE A;  3BHP A;  1R3J C;  3CCE V;  1NT2 B;  2VQE B;  2IU0 A;  1VIB A;  2Q6A A;  1K8A W;  5LP6 C;  4X89 A;  2P06 A;  3DC6 A;  4NXN O;  1R3L C;  4QPJ A;  3U10 A;  2W0X A;  2Q9L A;  4UCU A;  3K59 A;  3ZHR A;  5IT9 N;  4I55 A;  1XRE A;  4EFB A;  2PYL A;  1VF6 A;  2EIK C;  5DEC A;  5BR8 O;  1VF5 B;  5EYP B;  2DQ0 A;  3BPZ A;  3CJH B;  4Q6G A;  2JS5 A;  2EIL C;  1UPG A;  1NVP D;  1TVK A;  1XBL A;  2Q68 A;  3FB7 C;  5IJ0 B;  3CRA A;  3CRQ A;  1M5I A;  5B1O A;  2C2A A;  1TUE B;  4X64 B;  1YJW V;  1HP8 A;  4YHH B;  3JAL A;  5BY1 A;  1VP7 A;  2RQ6 A;  3W7W A;  2EIJ B;  3CCS V;  2LGW A;  2RN9 A;  4FLW A;  4MVM A;  4EFE A;  3O65 A;  2YEV B;  3CWB H;  4DV4 B;  5IWA B;  4DR2 O;  3K5L A;  2OTJ V;  3ZMT A;  4JZG A;  2BOC C;  4X1Y A;  4Z1V A;  3ABL B;  5EIB D;  3QTC A;  3CPW U;  1BHB A;  3VQW A;  2BE3 A;  3A0B Z;  5LYJ B;  4MVS A;  4NTX A;  4B3M O;  4DUY O;  3TXQ A;  3B8M A;  3F5T A;  3HKD A;  4ZBM A;  2QWO B;  1AI6 A;  2PYJ A;  4JI3 O;  4PI2 A;  1OCC C;  3A8T A;  4JI1 O;  4DXW A;  1GM7 A;  3ZHU A;  2UXX A;  4QGP A;  2P90 A;  1FXK B;  4GKJ O;  4GYC B;  2NR5 A;  4R50 A;  3FB8 C;  2OIE A;  4GUN A;  2UU9 O;  1WLE A;  4H33 A;  5EZY B;  1Y4M A;  4ZKI A;  5LXT B;  3K9S A;  1R6K A;  2DWE C;  1DGS A;  2EIJ C;  2WA4 A;  2UUA B;  1P49 A;  4JI2 O;  5J2U B;  3RVZ A;  1BGY H;  2O57 A;  1M90 W;  2FML A;  4LF4 B;  4YXW G;  2RJZ A;  3JAT B;  3U11 A;  1N34 B;  2GDS A;  1NH2 B;  3K3W A;  2W0F C;  2XHB A;  4EB6 B;  4TV8 A;  2EIN C;  4JYY A;  2Q67 A;  1AIL A;  3STL C;  3CCL V;  3MD0 A;  3DC5 A;  1FYJ A;  1F4M A;  4FFB B;  1GAX A;  1P4R A;  3UT5 B;  1S3J A;  5KHH A;  5JVD B;  4FM0 A;  2YXL A;  1G6U A;  1L0N H;  3E22 B;  3AG2 B;  4MTG A;  1AJP A;  4ZI7 B;  1JOY A;  4QE7 A;  4OPH A;  1HNZ B;  3CD6 V;  4PHZ A;  3BCC H;  1WJZ A;  4U3J A;  3WFV A;  4DR3 O;  1DF5 A;  1Y66 A;  4IYH A;  1Q6H A;  1H2S B;  3L71 H;  1GH6 A;  4JAS A;  4P9O A;  1SF9 A;  1P7G A;  3E8H A;  4YJ3 A;  3ABU A;  2Z3Y A;  5B1N A;  3TET A;  2F4V B;  1RM1 B;  4K0K B;  4XDL A;  2QTS A;  3L9D A;  2W6I G;  3H1H H;  1GMG A;  4UCO A;  4JV5 B;  1IZ3 A;  1WB7 A;  2GUZ B;  2ZNJ A;  3OGI B;  4JYB A;  4WBN A;  1AR1 B;  1G4Y B;  2XAG A;  4X20 B;  4LF5 B;  2UXB O;  2EJR A;  4DV1 O;  1NZ6 A;  1FJG B;  4MW8 A;  3PN1 A;  3X2Q B;  3JAW B;  1QR8 A;  1I5X A;  3E86 A;  4IHJ A;  1F51 A;  1V9P A;  1H2K A;  5KUK A;  2P7T C;  4I7Z B;  3JYC A;  1KD1 W;  2MK3 A;  1PV0 A;  1DK1 A;  1H38 A;  4FLX A;  1K92 A;  2R70 A;  4UUJ C;  5HFM A;  2Y0P A;  1Y67 A;  2YIC A;  1HNW O;  4FZ1 A;  1IDS A;  4DW1 A;  1GN4 A;  4DV6 B;  1XNR O;  3GVM A;  3L72 H;  4QE9 A;  2OIG A;  1NTM H;  3QO7 A;  1M56 B;  4O4I A;  2WLM A;  2HHH B;  2XTA A;  3SGI A;  3J81 N;  1AP5 A;  4DYL A;  4FLU A;  5B1A B;  3BA8 A;  4B3R O;  4CZZ A;  1H2M A;  4MVO A;  5A2Q N;  2AGA A;  3ZMU A;  3C3T A;  4E2L A;  2N74 A;  1FFX A;  2DYR C;  3OTO O;  3M8A A;  2K1E A;  1QHT A;  4JI7 B;  3SR2 C;  4JI0 B;  2DE0 X;  1E1Q G;  5EK0 A;  3OFN G;  5CB4 A;  3CSX A;  1JR9 A;  4F6R B;  1NR1 A;  5LHI A;  4NYK A;  5ITZ A;  2X6B A;  1VEW A;  1XNQ O;  2N05 A;  4I0X B;  3JD2 A;  4PD4 F;  1IX9 A;  3AG4 B;  1ORQ C;  3HR0 A;  3E89 A;  3AG1 C;  2JGD B;  2YXH A;  2IJI A;  1Q6I A;  4ABM A;  1Y76 B;  4LWS A;  2Y48 A;  3H01 A;  3K57 A;  5B1A C;  5IE9 A;  1JCH A;  1VQN V;  1RSO A;  5DED A;  1Q7Y W;  1K4D C;  1Q5O A;  1ZX3 A;  4OPA A;  3W7T A;  1BQ0 A;  4R8C A;  2ZDI A;  4J41 A;  3JAK A;  4CH4 A;  1N33 O;  1AI7 A;  4LF7 B;  3ICX A;  5B1B B;  4DRX B;  3G67 A;  5B5E Z;  5GON B;  5B3S B;  2F43 G;  4DW0 A;  2EIM B;  2B5U A;  1SZT A;  4NTY A;  3M7M X;  1PL4 A;  2PI4 A;  3OR6 C;  3K04 A;  3FAV A;  4Z1M G;  2IJK A;  4PA6 A;  5LMN B;  5JWP A;  1EBO A;  2UUC O;  3A2F A;  3VQX A;  2QA4 V;  2GSM B;  4CC5 A;  1SER A;  1UJW B;  4JI8 B;  1FPO A;  4MS2 A;  1QLE B;  3SJC C;  1NR7 A;  3ABM B;  1RPR A;  4BIU A;  3DXR B;  4NR1 A;  2IW5 A;  1KQS U;  4JAU A;  4CS3 A;  3HKB B;  2P6J A;  3EVK A;  4TV9 B;  5L3G A;  4JI6 O;  4WFF A;  4W4L A;  3LSU A;  1QVG U;  3CXH F;  3OW2 U;  4YJ2 A;  2YID A;  2F95 B;  1EFR G;  1WPB A;  2ZM6 B;  4N23 A;  5B1B C;  3SYP A;  1TGO A;  2QDO A;  4TT3 G;  5AG2 A;  3W7U A;  2JEX A;  2FTK A;  3EHB B;  3TCU A;  3ETQ A;  1SQV H;  4LFB O;  5EC1 C;  4QNH B;  5TIS Z;  3LNN A;  3RYH B;  2B1G A;  5LOV B;  4X1K A;  3ETD A;  1K73 W;  2E5L B;  4UB8 Z;  1SQQ H;  5J2T B;  1ZL8 B;  4NKG B;  3CRM A;  2UXC B;  2M6Y A;  4HAM A;  4AQY B;  2DW4 A;  2ILM A;  3D3Q A;  4X1I B;  4XBF A;  4FLV A;  1BT8 A;  4DV3 O;  1QLE C;  1H8E G;  1R3I C;  1VQK V;  2KG7 A;  3A0H Z;  3JD0 A;  3UO2 A;  4DR4 B;  3ZHV A;  1B6Q A;  2Y4T A;  3SPI A;  4PI0 A;  3ZIA G;  5JJE B;  4DV0 B;  4QJF B;  2Q0O C;  2ZQM A;  3NXS A;  3D3I A;  2UXD O;  4H37 A;  1N8R W;  2Q69 A;  3JD3 A;  4L8J A;  5BZB A;  2ZNI A;  3H9V A;  1IBL O;  1VMG A;  4XDJ A;  2JRI A;  1MG1 A;  4GZR B;  1KP3 A;  1N32 O;  2JEU A;  1SZX A;  3STZ C;  3OR7 C;  2QM8 A;  1SET A;  1QQC A;  1EZJ A;  1X59 A;  3QNE A;  2BOB C;  4G28 B;  4DV5 O;  1PNM A;  4RUE A;  1M1K W;  2VRZ A;  3D36 C;  3IC9 A;  1VQ7 V;  2L35 A;  1JFF A;  3P3P A;  5JJN B;  1VQ9 V;  2ZKO A;  5LA6 A;  1S72 V;  3MHH C;  2ZIN A;  4LR3 A;  1W59 A;  3CP1 A;  1A32 A;  5CA1 B;  2DN9 A;  5IYD O;  1WA8 B;  1GRJ A;  3WG7 B;  2Y4U A;  4O2B A;  4TUY A;  4BAY A;  4P30 A;  4PA4 A;  3QO5 A;  3ASN C;  5JQG B;  5GW7 A;  3T1H B;  1MZE A;  2M7W A;  3APQ A;  3QG5 A;  3SJB C;  2A06 H;  2ADQ B;  1P84 F;  2VQF O;  4NXM B;  1SQF A;  1XMQ O;  4TQF A;  5EYP A;  3G80 A;  4DR6 O;  1NTZ H;  1TUB A;  4ZIB A;  1DLB A;  2DJV A;  2EUL A;  2WLN A;  1XUQ A;  5F2V O;  5BMV A;  2DMX A;  2HLD G;  3JAS A;  5CA0 A;  2YUA A;  1NBM G;  2XAQ A;  1OCO C;  1N36 B;  3N2G A;  4JAA A;  4FLZ A;  5IY5 B;  4MVQ A;  3Q4H B;  5IJ9 A;  1IVS A;  1B04 A;  1LUW A;  1P7B A;  4UCR A;  5C93 A;  2RMK B;  1SA0 B;  1U96 A;  3WB2 A;  4WFG A;  4DV7 O;  4N21 A;  4LFA O;  4PA7 A;  1E79 G;  4O4L A;  1XQ8 A;  4UVB A;  1QR9 A;  2ZD9 A;  5L3D A;  4DV2 B;  2WPD G;  3BFR A;  2QKA A;  4UVC A;  3ZCC A;  1NTK H;  3ZBH A;  1PD3 A;  3UKM A;  3BY6 A;  4JI3 B;  2DYS B;  3HKE A;  2BSK A;  3SPH A;  5KX5 A;  3RYC A;  2LGQ A;  2LFS A;  2X7R B;  2ZE7 A;  1D5A A;  4EEQ A;  2AXT Z;  5IYZ A;  1YJ9 V;  3ZMV A;  4GKJ B;  1URF A;  5IDJ A;  3JAR A;  4KXR A;  2Q73 A;  5CBG A;  5LXT A;  2YIB D;  3CE2 A;  4PA9 A;  2CDY A;  2HJD A;  5KLV H;  2LP7 A;  3K03 A;  3CCR V;  1Q43 A;  2RNB A;  3K5M A;  2WLH A;  2E75 B;  4RAI A;  2ARH A;  1WAZ A;  1S5L Z;  3G6E V;  4YY3 O;  3G71 V;  2IBZ H;  2CTP A;  3UO3 A;  3RWR D;  3QVN A;  4PEL A;  4CH3 A;  3BEH A;  3CCJ V;  1N0J A;  1HNX O;  4DR5 O;  2IJH A;  4JPR A;  1ZTE A;  4MTX A;  4FFB A;  1GO3 F;  2Q7E A;  3OUS A;  2XAH A;  5CBF A;  5JVD A;  4J11 A;  3JD4 A;  1LNQ A;  1YZB A;  2ZCE A;  1QCE A;  1WNS A;  3FB6 C;  3ZRW B;  2HVJ C;  4LH7 A;  1AI4 A;  1Y74 B;  1PM9 A;  2VQE O;  4D7T A;  3RYF A;  4DR1 O;  2ITC C;  1PL0 A;  3ZX6 A;  4WFA V;  4JI4 B;  4U7N A;  3EXA A;  3IFX A;  3CS5 A;  4UVA A;  1M57 B;  1ZWI C;  4AIL C;  4WF9 V;  4DR3 B;  3IJ4 A;  1YVW A;  3H1J H;  1GM8 A;  3TGU H;  4LBE C;  1Q81 W;  1M4U A;  5FNV B;  1V55 B;  4J9Z B;  3HPL C;  5K1P A;  1XMO O;  2FB5 A;  1L8D A;  1IBM B;  4I55 B;  1KKC A;  2Q7H A;  3E83 A;  4GX5 A;  1HR0 B;  1N4C A;  3JSL A;  2A3Q A;  3ABL C;  3A0R A;  4LF9 B;  3TJT A;  4GX1 A;  1NI8 A;  4LNU A;  3JSN A;  1HDJ A;  1TVK B;  1SKV A;  1AP6 A;  1D2D A;  1YCI A;  3LDE A;  1GM9 A;  4DUZ B;  4IIJ A;  3AK1 A;  4YHH O;  4G27 B;  3OMI B;  3JAL B;  2OTL V;  1BSM A;  5L3F A;  5CA3 A;  4DV4 O;  3P3N A;  5IWA O;  4OX9 O;  4IGG A;  2EJ7 A;  1FXK C;  2NN4 A;  1R6N A;  5FPO A;  4LF6 B;  3K58 A;  2A0L A;  4X1Y B;  2FL4 A;  2X0L A;  1JVM A;  1SC5 B;  4TOI A;  3L70 H;  1YIJ V;  4H44 B;  4GX2 A;  1OCR B;  1V55 C;  3RN4 A;  4AHC A;  1S77 D;  4HYO A;  1K5S A;  1Q3E A;  3HKD B;  2IJJ A;  5EBL C;  4JAV A;  2IH3 C;  3G6B A;  2JK5 C;  1SQG A;  4UB6 Z;  5JJJ B;  2Q8V A;  5L3C A;  5L3E A;  4QIW F;  3OM3 B;  3N2K A;  4FLY A;  1MOF A;  4J7K A;  4LFC B;  1G1X B;  3FD9 A;  4BW5 A;  5E79 Z;  4GKK B;  1Z5V A;  1QVF U;  2UUA O;  4J9Y B;  1AR4 A;  2H3O A;  2ETN A;  2A7W A;  2RCV A;  3CCV V;  3B77 A;  1YXB A;  4LF4 O;  3AG2 C;  1PNK A;  1W0J G;  4O4J B;  4F6R A;  1N34 O;  1JQ0 A;  4X66 B;  5KA5 A;  2OCC B;  4GCZ A;  1XNQ B;  2XOK G;  1I94 B;  3APO A;  3HKC A;  4B7E A;  1OCR C;  2GTS A;  4YIP A;  5DM6 V;  2OCH A;  4KHP O;  1KUQ A;  2YIB A;  1KC8 W;  1EN5 A;  5JH7 A;  4B3T B;  3LDD A;  2HVK C;  1RPO A;  3KKY A;  5FLX N;  5EC2 C;  1JJ2 U;  1Y76 A;  4FMT A;  1KMI Z;  5B66 Z;  1H8H G;  2QEX V;  3GWO A;  3KG2 A;  1ARO P;  4UCV A;  1QBZ A;  3OE7 G;  1RM1 C;  1B3Q A;  1V54 B;  1VF7 A;  3CCU V;  2WLI A;  3CRC A;  1J5E B;  1HNZ O;  1IUR A;  2JJ1 G;  4I50 A;  1N33 B;  2IM9 A;  1K7D A;  4U3J B;  2KB1 A;  1XHZ A;  1YHQ V;  2QM4 A;  3CCQ V;  3X2Q C;  2F66 C;  3DSQ A;  2B1I A;  5CBH A;  1S0V A;  2AHY A;  4JYC A;  4P9P A;  1U97 A;  2ADP A;  1JJO A;  1AR5 A;  4DR7 B;  4K0K O;  2GV9 A;  3RFR A;  2UXN A;  2AZ0 A;  4YIO A;  2W6J G;  1TA8 A;  5DN6 G;  1IBK O;  1WPX A;  3ZRS A;  5K1X A;  5JCO C;  1KP2 A;  4LF5 O;  5E1A C;  4DO2 A;  4WBN B;  1M56 C;  1FJG O;  4JYA B;  3LNM B;  4TV9 A;  4ZHQ A;  2KKW A;  4WCE V;  4IHJ B;  1SQP H;  2Q0A A;  4B3S B;  3KZI Z;  2A9H A;  1K34 A;  2YS8 A;  2YDE A;  4XDK A;  3E8F A;  4DV6 O;  4JTD B;  3ABK B;  3IGA C;  4Q20 A;  1MA1 A;  1OCZ B;  3FFQ A;  2QJ1 A;  2HEP A;  1JA8 A;  4O4I B;  3D36 A;  1KKD A;  1DTO A;  1MZF A;  3ZHS A;  3OMN B;  2GTA A;  3AK3 A;  1NU1 H;  2H94 A;  5HFL A;  3IAY A;  3OEE G;  5KAF Z;  4ZOL A;  3AG4 C;  2CH7 A;  2VS0 A;  1YDX A;  1GN2 A;  1Q90 D;  2QSA A;  3KCY A;  3RGB A;  1FFX B;  4HNA B;  1VQL V;  4JI7 O;  4JI0 O;  3RW0 A;  3CXC U;  3T1Y B;  1QNM A;  3CHX A;  5C8Y A;  2ZXW B;  1OHH G;  2UXD B;  2EBO A;  2R9I A;  5CB4 B;  5ITZ B;  3RBZ A;  1UFI A;  3ZHT A;  3S3W A;  4X65 O;  3K06 A;  1BZK A;  2WLL A;  2JS3 A;  5B3S C;  3HB3 B;  4RQE A;  1AI5 A;  5LMU O;  3T2M A;  2EIM C;  1XL6 A;  4DV5 B;  1KEC A;  1Q86 W;  5LL6 Y;  1PPJ H;  4LWS B;  2CGO A;  1M93 A;  1S5H C;  3ZS8 C;  2B9Z A;  5LGN A;  1RSO B;  4I4T A;  3OTF A;  2E74 B;  1NH2 D;  2QKC A;  4LF7 O;  2V4D A;  3JAK B;  4K8Z A;  3ABM C;  5FL7 G;  3ZRV A;  3J7A U;  1LR1 A;  3CX5 F;  1KYO F;  3S3X A;  5LP6 A;  2CGN A;  1MNG A;  2Y69 B;  5KMG A;  3O9O A;  3OMA B;  4PJ0 Z;  4CH6 A;  5LMN O;  2ITD C;  4O4H A;  1HWY A;  4O2A A;  4LF8 B;  2UUB B;  1NJI W;  3B09 A;  2ODM A;  3I56 V;  1ZLZ A;  1Z2G A;  2GBO A;  3FYE B;  4QPK A;  5D5P A;  2ZIO A;  1FKA O;  2EZP A;  3M99 B;  2Q4P A;  2FYU H;  4FM1 A;  2WSS G;  2YXY A;  4CH5 A;  2QWR B;  4MSW C;  2ZM6 O;  4YJ2 B;  3K79 A;  2YI8 A;  2LW7 A;  2ZT9 B;  2N04 A;  5IYB O;  4GT1 A;  1GTO A;  2P67 A;  3B40 A;  3CB2 A;  2AW9 A;  3WU2 Z;  2E5L O;  1FAF A;  5LBQ A;  4NXN B;  3JD1 A;  3RT3 C;  1YI2 V;  4LP8 A;  4X1K B;  2UXC O;  1PKX A;  4X8A A;  4AQY O;  2OT5 A;  3T4Z A;  2L6L A;  2CUG A;  3VBB A;  2R9A A;  2Z0A A;  3AEI A;  3WB1 A;  4PDV A;  3ZRX A;  5BR8 B;  3CJH A;  2KG7 B;  4JI5 O;  3AG3 B;  3D8C A;  3T1C A;  3TXS A;  1QU7 A;  1YJN V;  5IJ0 A;  4LH6 A;  2WA3 A;  1PNL A;  4CC6 A;  4PDM A;  1THZ A;  3GB7 C;  2F23 A;  3B4S A;  4K35 A;  4EKW A;  1YIT V;  2CTQ A;  2P22 C;  2H8P C;  1D5N A;  3KCX A;  4X62 O;  4B08 A;  2YEV A;  4YY3 B;  3I5D A;  1K33 A;  1FXV A;  1YSC A;  4PDR A;  1CEZ A;  3WG7 C;  4DR2 B;  1I0H A;  2HJF C;  3ZN0 A;  1HNX B;  5LYJ A;  1SQB H;  2HP8 A;  4AI8 A;  4UCS A;  1H2L A;  4MTF A;  1AJQ A;  4I9Q A;  3LSQ A;  4PV1 B;  1ZUQ A;  4B3M B;  1JFF B;  4DUY B;  3W7S A;  3DGE A;  4J42 A;  1M9N A;  5LA6 B;  1R1B A;  2CK3 G;  4D7S A;  1MAB G;  3AG3 C;  1XOU A;  1Y6X A;  3ETG A;  4HBN A;  4JI1 B;  4DR1 B;  1FXK A;  4G2K A;  4CS2 A;  5A9G A;  3J80 N;  4O2B B;  4TUY B;  2XND G;  2NLJ C;  3T1H O;  5EZY A;  2UU9 B;  4MVU A;  5FNV A;  5IYC O;  3L73 H;  1VQM V;  4JGS A;  5J2U A;  1AJN A;  5IY5 C;  4JI2 B;  1XI1 A;  1XMO B;  4NXM O;  1JX9 A;  3SYC A;  2BTQ B;  4JTC B;  4IYI A;  4DK1 A;  2P5O A;  3JAT A;  1EM1 A;  1OCC B;  4K3A A;  1G8M A;  2WLJ A;  3RYI B;  3P30 A;  1TUB B;  4EB6 A;  2MW2 B;  3ZMS A;  2FKX A;  2YI9 A;  4FJC C;  1CP9 A;  2QGN A;  1GN3 A;  4BIZ A;  5BMV B;  4GX0 A;  2DOS A;  3QO8 A;  2XAJ A;  2PGG A;  1N36 O;  3JAS B;  1FXH A;  5CA0 B;  3UQ8 A;  2X6A A;  3N2G B;  5CMU A;  1VQ4 V;  2DYS C;  3E8B A;  3UT5 A;  5FPR A;  4LCU C;  4FFK A;  4MW3 A;  1WB8 A;  1HW7 A;  4UXN A;  4OX9 B;  2E3C A;  3E22 A;  1H2N A;  5IJ9 B;  1SES A;  5H6R A;  3FYI B;  3E2E A;  3R65 A;  4KUM A;  1W2B U;  4ZI7 A;  3FKS G;  2PZS A;  1BCC H;  4MT8 A;  1ZAU A;  1YTF B;  3SPJ A;  4Z2W A;  1R73 A;  5KUM A;  3JCU Z;  1PP9 H;  1ENV A;  1VAR A;  3MAQ A;  4DV2 O;  4O4L B;  1GK9 A;  1SQX H;  3ZN1 A;  2EIN B;  4CS4 A;  1NKD A;  1RFY A;  2K9P A;  3H1K H;  2IH1 C;  2V7Q G;  5KHG A;  3AK2 A;  4IT5 A;  3HKE B;  5BXZ A;  2QR4 A;  1QLN A;  3I55 V;  2BSK B;  5LGT A;  2ZR3 A;  3B2E E;  1X4T A;  5KX5 B;  2XUM A;  4TSF G;  4I5S A;  3NR7 A;  3RYC B;  5GTI Z;  4BIO A;  5IYZ B;  4IL6 Z;  1WN7 A;  2ZIM A;  3JAR B;  5H6Q A;  3K5N A;  1O9G A;  2QKS A;  2GUZ A;  3BAB A;  4X64 O;  4X20 A;  2UXB B;  2HKO A;  4DK0 A;  4O4J A;  3JAW A;  4DV1 B;  1I5Y A;  1GN6 A;  5LHG A;  3VOU A;  3CME V;  2D3O W;  4F4L A;  5L3B A;  4BWA A;  2Q5Z A;  1BHA A;  3CRR A;  1M57 C;  4MTO A;  3CCM V;  2Y0I A;  4U3F H;  4K8X A;  2ZE8 A;  4KHP B;  1K5Q A;  1MSD A;  3F7Y C;  1US6 A;  1LUV A;  5KA6 A;  1HNW B;  5JCO A;  2ZE6 A;  3N27 A;  1XNR B;  2WWW A;  1EN6 A;  2PI5 A;  1JPX A;  5D5Q A;  1S76 D;  1VF6 C;  1CPY A;  2Z5U A;  5LHH A;  2WLK A;  4FIP C;  4I9W A;  3RYF B;  4JI4 O;  3L75 H;  4FLT A;  1N0N A;  5EBM C;  2P4K A;  4B3R B;  4MVZ A;  2LO1 A;  2YSU B;  4BW9 A;  3H1L H;  2A79 B;  4TWK A;  1Q82 W;  2VWJ A;  3OTO B;  1IBM O;  1FD9 A;  3OUF A;  4UCT A;  3SJA C;  4NB5 A;  1VQ8 V;  1W0K G;  4CBC A;  1HR0 O;  3L74 H;  2LQT A;  4I0X A;  4LF9 O;  2QTO A;  1AVM A;  3ABT A;  2QE7 G;  3SJQ C;  4LC1 A;  3E35 A;  4H13 B;  4UFZ A;  2WAM A;  3W7X A;  4LNU B;  4TV8 B;  5KHJ A;  3CMA V;  4DUZ O;  1IBK B;  1K9M W;  3OD4 A;  4IIJ B;  2JGD A;  2QM7 A;  2DYR B;  3CYO A;  3ML0 A;  1YF2 A;  3E8G A;  5KHI A;  4FZ0 A;  4C7U A;  1XHX A;  2ZR2 A;  3F7V C;  2PUS A;  4LF6 O;  2DWD C;  4OXS A;  1MSW D;  3ZHQ A;  3LUT B;  1YEW A;  4U7O A;  3EFF K;  4FVM A;  2G38 A;  4DRX A;  4FK5 C;  5GON A;  1T5E A;  4GLX A;  3AG1 B;  4PA3 A;  4UV9 A;  1ROP A;  2RDC A;  5H9C A;  1L1F A;  3ASO B;  3P32 A;  1XIL A;  3ZJZ A;  3MHS C;  2OCC C;  5H5N A;  1NS1 A;  1IXB A;  1KBH A;  1WP7 A;  4TQD A;  2F4V O;  1H2G A;  2QWN B;  4YJ3 B;  3SYQ A;  1OJH A;  4LFC O;  4WFH A;  3N2K B;  2UUC B;  1VQ6 V;  4GKK O;  5KAI Z;  4HNA A;  4JV5 O;  2YIA A;  2XAF A;  4P2Z A;  1GKF A;  1K97 A;  2YC0 A;  1BQZ A;  2JDI G;  3OEH G;  3DXR A;  4X9Q A;  3WB0 A;  1EN4 A;  3HKB A;  3DTU B;  4X66 O;  3RVY A;  1V54 C;  1VQP V;  1I94 O;  4JI6 B;  4RWU A;  3HKC B;  3QF7 A;  3T4D A;  1E1R G;  4X65 B;  3H1I H;  4B3T O;  1R6T A;  1NVP B;  5JH7 B;  1L0L H;  5LMU B;  3ASO C;  1WP8 A;  1EZV H;  2JVD A;  1KU9 A;  3RYH A;  5EBW C;  3OAA G;  1FS0 G;  4KL1 A;  3U0Z A;  4LFB B;  5LOV A;  1F4N A;  2HHH O;  3PJS K;  5J2T A;  1RP3 B;  1ZL8 A;  1BE3 H;  3C3S A;  1J5E O;  3C90 A;  4A5U B;  2WLI B;  4X1I A;  3THO A;  2AZ2 A;  2JIZ G;  1K3E A;  3BA9 A;  3VQY A;  4DV3 B;  4I50 B;  4D6T H;  4UV8 A;  1AB3 A;  4PDL A;  1I7F A;  3BVO A;  3LSS A;  4WFE A;  2HG5 C;  4FM2 A;  4DR7 O;  3CC2 V;  3F5W C;  4H0L B;  1IBL B;  1XDC A;  4ICG A;  2CE4 A;  3ABK C;  3MDS A;  1YTF D;  1N32 B;  4RO2 A;  1F23 A;  1BL8 A;  1Q6U A;  1OCZ C;  4JF3 A;  2X6C A;  3G4S V;  2D2C B;  2LW1 A;  1JMK C;  1SRY A;  4BR6 A;  5LGU A;  4JYA O;  3SPG A;  1BS3 A;  4ZHQ B;  1OZ0 A; 
#chains in the Genus database with same CATH homology
 2H8P C;  2HFE C;  1DF4 A;  2YEV A;  3E83 A;  4GX5 A;  3UM7 A;  1FFT B;  5B1A B;  1K33 A;  1FXV A;  3ABL C;  1YSC A;  3A0R A;  4PDR A;  1CEZ A;  3WG7 C;  4GX1 A;  4CZZ A;  4MVO A;  2HJF C;  4HZ3 A;  3ZMU A;  3ZN0 A;  4E2L A;  3LDE A;  1GM9 A;  3SPC A;  2DYR C;  2K1E A;  1J95 A;  2ZXW C;  2R9R B;  4L87 A;  4MTF A;  1AJQ A;  2AHZ A;  1IXM A;  3LSQ A;  4G27 B;  3OMI B;  4MVR A;  2OTL V;  1K4C C;  3W7S A;  3DGE A;  1E1Q G;  5L3F A;  5EK0 A;  3OFN G;  1M9N A;  5CA3 A;  2CK3 G;  1NR1 A;  1FXK C;  5LHI A;  1MAB G;  2X6B A;  2EZO A;  3AG3 C;  1R6N A;  2DQ3 A;  3ETG A;  3JD2 A;  1FXK A;  4G2K A;  2A0L A;  3CC4 V;  3AG4 B;  2IU3 A;  1ORQ C;  3K08 A;  3CC7 V;  2X0L A;  1JVM A;  1VQ5 V;  1YIJ V;  3K0D A;  3E89 A;  4GX2 A;  1OCR B;  1V55 C;  2XND G;  3AG1 C;  2NLJ C;  1S77 D;  4HYO A;  1R3K C;  4MVU A;  1K5S A;  3FB5 C;  5IYC O;  2IJI A;  1VQM V;  4JGS A;  1AJN A;  2IJJ A;  3ASN B;  2Y48 A;  3H01 A;  4JAV A;  2IH3 C;  5EBL C;  5IY5 C;  1JX9 A;  2JK5 C;  5B1A C;  3SYC A;  4JTC B;  1JCH A;  4KFM A;  1VQN V;  5L3C A;  1OCC B;  2ZDI C;  1Q7Y W;  1K4D C;  1G8M A;  2JJ2 G;  2WLJ A;  3K0G A;  3P30 A;  5L3E A;  3SYA A;  4QIW F;  3OM3 B;  3W7T A;  3ZMS A;  4R8C A;  2WLL B;  2ZDI A;  1MOF A;  4FJC C;  1AI7 A;  1CP9 A;  4BW5 A;  5B1B B;  4BIZ A;  1QVF U;  4GX0 A;  2NNU A;  3QO8 A;  2XAJ A;  4J9Y B;  5B3S B;  2F43 G;  2Y69 C;  1FXH A;  1BMF G;  4WFB V;  2EIM B;  2X6A A;  3B8N A;  3CCV V;  2B5U A;  1VQ4 V;  5CMU A;  2DYS C;  4R7C A;  1SZT A;  3E8B A;  3B77 A;  3K9A A;  1OCO B;  3AG2 C;  1PNK A;  1W0J G;  4LCU C;  1VQO V;  4MW3 A;  4UXN A;  4R6Z A;  2PI4 A;  3OR6 C;  1JQ0 A;  5KA5 A;  2ATK C;  3K04 A;  4Z1M G;  2OCC B;  1SES A;  2IJK A;  4GCZ A;  4PA6 A;  5H6R A;  2XOK G;  3FYI B;  1EBO A;  1XL4 A;  3E2E A;  3R65 A;  4KUM A;  1OCR C;  1W2B U;  4FPP A;  3FKS G;  2QA4 V;  2GSM B;  4MT8 A;  5DM6 V;  1YTF B;  3SPJ A;  1SER A;  1R73 A;  5KUM A;  3ETE A;  1UJW B;  1KC8 W;  1ENV A;  2V1D A;  4MS2 A;  1QLE B;  3LDD A;  2HVK C;  1GK9 A;  1RPO A;  1NR7 A;  3ABM B;  5EC2 C;  3ZN1 A;  2EIN B;  1RPR A;  5CN0 A;  4ASU G;  1NKD A;  4BIU A;  1JJ2 U;  1NQT A;  4FMT A;  3IC7 A;  2IH1 C;  2IW5 A;  1KQS U;  4JAU A;  1H8H G;  2QEX V;  2LFR A;  3GWO A;  3KG2 A;  2P6J A;  2V7Q G;  4RQF A;  3SYO A;  1ARO P;  5L3G A;  2XAS A;  4WFF A;  1QVG U;  1QBZ A;  3OE7 G;  3OW2 U;  1QLN A;  3ZMZ A;  2GHY A;  1RM1 C;  3I55 V;  5LGT A;  1V54 B;  2ZR3 A;  1EFR G;  3CCU V;  2WLI A;  4N23 A;  4I5S A;  4TSF G;  5B1B C;  3LDC A;  3SYP A;  4JTA B;  2JJ1 G;  4TT3 G;  4RUF A;  2EIK B;  5H6Q A;  3W7U A;  1K7D A;  2QKS A;  2JEX A;  2KB1 A;  2FTK A;  3EHB B;  3TCU A;  5J9P C;  1COW G;  1YHQ V;  5EC1 C;  4QNH B;  3CCQ V;  2B1G A;  4X88 A;  3X2Q C;  2EIL B;  1K73 W;  3ETD A;  2B1I A;  2HKO A;  5CBH A;  1S0V A;  2AHY A;  4JYC A;  3TK1 A;  4KP4 A;  4P9P A;  1I5Y A;  3ZRW A;  4HAM A;  2HR3 A;  5LHG A;  3OGC C;  3JCZ A;  3VOU A;  3CME V;  2D3O W;  2DW4 A;  4F4L A;  5L3B A;  1R3J C;  1BHA A;  4XBF A;  3CCE V;  2IU0 A;  1QLE C;  2UXN A;  1M57 C;  4MTO A;  1H8E G;  3CCM V;  1R3I C;  2W6J G;  1VQK V;  2Q6A A;  1K8A W;  3JD0 A;  5DN6 G;  1WPX A;  3ZRS A;  1K5Q A;  4X89 A;  1KP2 A;  3F7Y C;  5E1A C;  5KA6 A;  4DO2 A;  1R3L C;  1B6Q A;  4QPJ A;  1M56 C;  3SPI A;  3ZIA G;  2WWW A;  2PI5 A;  4QJF B;  2ZQM A;  3LNM B;  1JPX A;  1S76 D;  3NXS A;  3D3I A;  4H37 A;  1N8R W;  2Q69 A;  3JD3 A;  1CPY A;  2Z5U A;  5BZB A;  5LHH A;  4WCE V;  2WLK A;  4FIP C;  4XDJ A;  4I9W A;  2EIK C;  1MG1 A;  2A9H A;  1K34 A;  2DQ0 A;  1KP3 A;  2JEU A;  3STZ C;  3OR7 C;  4XDK A;  1OZ0 A;  3E8F A;  5EBM C;  2QM8 A;  1SET A;  4MVZ A;  2YSU B;  2EIL C;  4JTD B;  1NVP D;  3ABK B;  1EZJ A;  2A79 B;  3QNE A;  2Q68 A;  3FB7 C;  2BOB C;  3IGA C;  4G28 B;  4Q20 A;  4TWK A;  1Q82 W;  1PNM A;  1OCZ B;  4RUE A;  1M1K W;  5B1O A;  2C2A A;  1TUE B;  1VQ7 V;  1YJW V;  3OUF A;  1KKD A;  3D36 A;  1DTO A;  1VQ8 V;  1W0K G;  2EIJ B;  3W7W A;  3OMN B;  3CCS V;  1VQ9 V;  4MVM A;  4CBC A;  1S72 V;  3MHH C;  2H94 A;  5HFL A;  2YEV B;  3OEE G;  3AG4 C;  2QTO A;  2OTJ V;  3CP1 A;  3ABT A;  3ZMT A;  2QE7 G;  3SJQ C;  4LC1 A;  3E35 A;  2BOC C;  2WAM A;  5IYD O;  3ABL B;  3W7X A;  3CMA V;  3CPW U;  1BHB A;  3WG7 B;  4BAY A;  4P30 A;  1K9M W;  4PA4 A;  3QO5 A;  1VQL V;  3ASN C;  2QM7 A;  5GW7 A;  4MVS A;  3RW0 A;  2DYR B;  3CYO A;  3ML0 A;  3B8M A;  4ZBM A;  3CXC U;  2M7W A;  2ZXW B;  1AI6 A;  1OHH G;  3E8G A;  2EBO A;  2R9I A;  1OCC C;  2ZR2 A;  3F7V C;  3RBZ A;  4DXW A;  1GM7 A;  2DWD C;  2UXX A;  2P90 A;  4OXS A;  1FXK B;  1MSW D;  3K06 A;  1DLB A;  3LUT B;  2WLL A;  4U7O A;  3EFF K;  2WLN A;  4R50 A;  5B3S C;  3FB8 C;  3HB3 B;  4RQE A;  1AI5 A;  1WLE A;  4H33 A;  3T2M A;  2EIM C;  1Y4M A;  4FK5 C;  4ZKI A;  1XL6 A;  1KEC A;  2HLD G;  1Q86 W;  1R6K A;  2DWE C;  2EIJ C;  3AG1 B;  4PA3 A;  4UV9 A;  1NBM G;  2XAQ A;  1OCO C;  1ROP A;  3RVZ A;  5H9C A;  1L1F A;  3ASO B;  1M90 W;  1S5H C;  3P32 A;  3ZJZ A;  5IY5 B;  3MHS C;  2OCC C;  4MVQ A;  5LGN A;  4YXW G;  1H2G A;  1NH2 B;  3K3W A;  3SYQ A;  1P7B A;  2W0F C;  4WFH A;  5C93 A;  1NH2 D;  1VQ6 V;  3ABM C;  4WFG A;  5FL7 G;  2EIN C;  2Q67 A;  3ZRV A;  4N21 A;  1E79 G;  4PA7 A;  2XAF A;  4P2Z A;  3STL C;  4UVB A;  1GKF A;  1K97 A;  1QR9 A;  3CCL V;  2ZD9 A;  2JDI G;  3OEH G;  5L3D A;  3MD0 A;  2WPD G;  4UVC A;  3ZCC A;  1F4M A;  1P4R A;  2Y69 B;  3DTU B;  1S3J A;  1PD3 A;  3OMA B;  3UKM A;  3BY6 A;  3RVY A;  1V54 C;  2DYS B;  1VQP V;  2ITD C;  3AG2 B;  1HWY A;  4MTG A;  3SPH A;  1AJP A;  3T4D A;  4QE7 A;  1E1R G;  1NJI W;  1JOY A;  2LFS A;  2X7R B;  1YJ9 V;  3CD6 V;  3ZMV A;  5IDJ A;  5CBG A;  1NVP B;  3I56 V;  3WFV A;  3FYE B;  3ASO C;  1DF5 A;  1Y66 A;  4PA9 A;  4QPK A;  5EBW C;  2LP7 A;  3K03 A;  3OAA G;  1FS0 G;  3CCR V;  2EZP A;  1F4N A;  2WLH A;  4RAI A;  3M99 B;  3PJS K;  4JAS A;  2WSS G;  4P9O A;  4MSW C;  3G6E V;  3E8H A;  3ABU A;  2Z3Y A;  5B1N A;  3K79 A;  3TET A;  3G71 V;  2WLI B;  5IYB O;  1RM1 B;  4XDL A;  2JIZ G;  4GT1 A;  1K3E A;  1GTO A;  4PEL A;  2P67 A;  3BEH A;  3CCJ V;  2W6I G;  1GMG A;  2IJH A;  4JPR A;  4UV8 A;  4JYB A;  1AR1 B;  1G4Y B;  2XAG A;  3JD1 A;  4MTX A;  4PDL A;  5LBQ A;  1GO3 F;  1YI2 V;  3OUS A;  4LP8 A;  2XAH A;  5CBF A;  2EJR A;  3LSS A;  4WFE A;  4MW8 A;  3X2Q B;  1PKX A;  4X8A A;  3JD4 A;  2OT5 A;  1QR8 A;  1I5X A;  1LNQ A;  2HG5 C;  1QCE A;  3ZRW B;  3FB6 C;  3T4Z A;  2HVJ C;  3E86 A;  1F51 A;  3VBB A;  3CC2 V;  1AI4 A;  3F5W C;  5KUK A;  2P7T C;  2ITC C;  3JYC A;  1KD1 W;  2MK3 A;  1PL0 A;  3AEI A;  4PDV A;  4WFA V;  3ZRX A;  1H38 A;  1K92 A;  3ABK C;  4U7N A;  3IFX A;  4UUJ C;  1YTF D;  4RO2 A;  1F23 A;  1BL8 A;  3AG3 B;  1M57 B;  4UVA A;  5HFM A;  1ZWI C;  1OCZ C;  3T1C A;  4JF3 A;  4WF9 V;  2X6C A;  3G4S V;  1YJN V;  4QE9 A;  1SRY A;  1PNL A;  5LGU A;  1GM8 A;  4PDM A;  1THZ A;  3GB7 C;  4LBE C;  1Q81 W;  3QO7 A;  3SPG A;  1V55 B;  4J9Z B;  3HPL C;  4EKW A;  1M56 B;  1YIT V;  2WLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...