3CC2V

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc2V00
1M90W 3CCQV 4WFAV 2D3OW 1KC8W 3I56V 1YHQV 1KD1W 1K9MW 1R73A 4WFBV 2OTJV 5DM6V 1W2BU 3CCUV 3CD6V 3CXCU 3I55V 1YJNV 3G71V 1KQSU 3CPWU 1VQ8V 1QVGU 3CCMV 3CMAV 1K73W 3G6EV 1VQLV 2QEXV 4WF9V 1YJ9V 1VQ5V 1YITV 1M1KW 1VQNV 1JJ2U 3CCEV 3CCRV 1N8RW 1VQ4V 1QVFU 1VQ6V 1VQOV 1YI2V 1VQPV 1Q86W 1Q7YW 2QA4V 1YIJV 1YJWV 1VQ9V 1NJIW 3CC4V 3CCVV 1K8AW 4WCEV 3G4SV 3CC7V 3OW2U 3CMEV 1S72V 3CCLV 1Q81W 2OTLV 1VQ7V 1Q82W 3CC2V 3CCSV 1VQMV 3CCJV 1VQKV
chains in the Genus database with same CATH superfamily
2BTQB 4TT3G 4E2LA 1KBHA 4DV0B 3E22B 2HFEC 1KYOF 3J81N 3GB7C 1F4NA 2B1GA 5CA0B 3UT5A 4O4JB 4CS3A 4CH5A 1VMGA 1Y74A 2N05A 1COWG 2ZM6B 1BQ0A 5J9PC 3E35A 1Q6IA 1QLNA 1HR0O 3ABLB 2V4DA 1PNKA 4KP4A 1JA8A 5KX5B 5EIBD 3P3PA 3HKBB 5KHJA 1EN5A 1XHZA 4DR7O 4Z1VA 4QE7A 2PUSA 2OCCC 4X1YB 5J2TB 1IBKB 1Q43A 4YY3O 4J11A 2EIKC 3DXRB 1GAXA 4KFMA 2V7QG 5KA5A 4U3FH 3SPGA 2A79B 4X89A 1KU9A 1GN3A 3N2GB 1TUBA 5DEDA 3DC6A 4QNHB 1H2NA 3R65A 3G6EV 5EYPB 1FYJA 2EBOA 3A2FA 3EFFK 4QIWF 2ZT9B 3JD3A 2GSMB 3H01A 4WCEV 5LP6C 4X62B 4H44B 2E74B 3MD0A 4LH6A 1FXHA 4DV4B 2D3OW 5B5EZ 1LNQA 3AG2C 5IYBO 2L35A 3AG3C 2BTQA 4EEQA 5KMGB 3LNNA 4ICGA 4O4IA 3ETDA 4DR6O 4DV2B 3IGAC 3K08A 4H37A 1VQ9V 2P7TC 5BZBA 1XOUA 3FB5C 3FB6C 4EB6A 4PI2A 1I5XA 1YF2A 3UQ8A 4LWSB 5IY5B 3D8CA 4FK5C 1KQSU 4ZHQA 4NXNO 2VS0A 3AG3B 4LF8B 1VIBA 5KX5A 4U7NA 2AHZA 1GM8A 3RVYA 3G80A 4GLXA 5JH7B 2QTSA 1VF6A 2WLLA 4FLZA 2KB1A 4H13B 5B3SC 2Y0PA 2EULA 2WLNA 2K1EA 1KP3A 1SA0B 1MSWD 1M1KW 3KG2A 3N2GA 1ZAUA 4O4HA 1J5EB 5CA3A 3H1IH 4PDVA 3C90A 3PJSK 1R3JC 4DR5O 2X6AA 3BEHA 2QE7G 1G8MA 2CDYA 4UB8Z 4DW0A 3CJHA 2Q0AA 4B3SB 1KKCA 5KAFZ 5DECA 4OX9B 1VF7A 3U0ZA 4YXWG 3K79A 3WG7C 5A2QN 3OR7C 3F5WC 3P30A 1N4CA 4JV5B 1BHAA 4PJ0Z 1N0NA 3QO7A 1Y66A 2Q69A 1Q6HA 1H2KA 3DGEA 5FL7G 3OGIB 2OT5A 4U7OA 1YCIA 2DJVA 4P2ZA 2JEUA 2EINB 3O65A 2ITDC 1VQ5V 3JASB 1HP8A 2Y69B 4X65B 3ZCCA 1IVSA 2EJ7A 2Q5ZA 3FB8C 2OIGA 3APOA 2R70A 3ICXA 1AI6A 3BABA 2PY5A 1YVWA 4X1KA 1SKVA 5GTHZ 4NXNB 3QG5A 3ZHTA 5FNVA 4MSWC 4LF8O 5H6QA 1ZTEA 2MW2B 3ZHQA 3QNEA 2YIDA 3VQYA 1IBLB 1E1RG 3K0DA 1SS3A 2P5OA 1SC5B 4D7TA 1K3EA 1GN4A 3LNMB 3SPHA 1JFFA 1XI1A 2AZ0A 3SJQC 3L73H 2Z3YA 1PKXA 4BAYA 3CE2A 2PI5A 3E8BA 2YEVB 2ITCC 3OMNB 2LW7A 5JVDB 3K03A 4W4KA 1KUQA 2UU9B 4J7JA 4DK1A 4P9PA 3ZHSA 4DR5B 3CRQA 1V9PA 4FLVA 4JPRA 2O57A 5C93A 4JI5B 3GVMA 4LCUC 1WNSA 1WA8A 4PA3A 2HHHO 2WLJA 4BIUA 4UCOA 3A0BZ 2VRZA 3SGIA 1ZLZA 3AK3A 4H0LB 1JJ2U 4GKKO 1I08A 1MG1A 3JALA 4OGQB 4U3JA 2ZINA 1GM7A 3ZS8C 1SQXH 4X62O 4PDRA 2YI9A 1WPBA 1TUBB 4MVMA 4JI3B 3HB3B 3K04A 5LHGA 4WFHA 2N04A 2CE4A 2DQ0A 1WB8A 2IJIA 3IJ4A 2UUAB 1BMFG 1ZX3A 4RAIA 1YZBA 3LSSA 1MOFA 2DQ3A 1XL4A 2B5UA 2WPDG 2QKSA 1FXKC 4E4EA 4WFGA 1DF4A 1S72V 4X9QA 1JFFB 4J41A 1BE3H 4RUFA 4O4IB 3B09A 1U97A 1RM1B 2XOKG 4FMTA 2MK3A 1F7YA 1NR1A 1R6TA 1GN6A 4YJ2B 2JJ1G 4B08A 4TQFA 4LWSA 1UFIA 4DV7O 1XBLA 2X6CA 3I5DA 1Q8IA 2UXCB 1S3JA 3JCZA 3TXSA 3J80N 3KCXA 2VQEO 3E83A 1S5LZ 1AP6A 3W7SA 4DR7B 1ZL8A 3BA8A 4LFAO 3ABMB 1JJOA 4JTCB 4LFAB 4DV1B 5L3FA 2Q9LA 2XAJA 4LF5O 5JH7A 4RQEA 1XUQA 5KA6A 1SQPH 3JALB 1IBMB 3WG7B 5KAIZ 3ZHUA 1D5AA 2IM9A 3OEHG 4JYBA 2L6LA 1AR5A 3M7MX 4LC1A 1EN4A 3RYHA 4JZ2A 4DR2O 3T4ZA 2NNUA 3JSNA 5ITZB 1CXZB 3RVZA 3L74H 4RWUA 1SESA 3T1YO 4TUYB 1T5EA 3HPLC 3MDSA 5CA1B 2ZNJA 3CJHB 3UKMA 3T1YB 4MS2A 3T1CA 2VWKA 3OR6C 1AJNA 1VQLV 3D36C 4TQDA 5KLVH 1I94O 3N2KB 1TA8A 4CZZA 4K3AA 2NLJC 3TJTA 1QHTA 2WLMA 1BT8A 5CA0A 2JS5A 4I55A 2QGNA 3CCVV 1PV0A 2VQFO 1NTZH 4MTXA 4JI5O 4J9YB 4YJ2A 3BCCH 3I56V 3FAVB 4K8XA 3ZBHA 1OCRC 3K58A 3ZRXA 4DXWA 4B3SO 3AG7A 1THZA 2XTAA 1YITV 4Z2WA 2Z0AA 1H8HG 3HKBA 3OD4A 3ASNC 4DR2B 3B8MA 2ZD9A 3OAAG 1H8EG 1JQ0A 4KUMA 1JCHA 2QSAA 5B1BB 4KHPB 3K5LA 1P84F 1HW7A 4FLXA 3E89A 1H38A 4CS2A 1BZKA 1TUEB 5FNVB 2XAFA 5DM6V 4DV3O 1ENVA 5EIBC 2E5LO 1N33O 4L87A 1JVMA 4X64B 3CRMA 4X64O 3ETEA 3RYCA 4J9ZB 2DW4A 4LF9B 5CBGA 1R1BA 3CCSV 4CH3A 1BSMA 1R3KC 2V1DA 4MVRA 3ZRSA 2UXDB 3ABKC 2QWPB 2WWWA 2FKXA 2ADQB 2PI4A 2EX3A 3U11A 3JYCA 5H2FZ 1IX9A 1XNRO 1NH2B 2EIMC 1EZVH 3OT7A 1ZSPA 1XEQA 3N2KA 2Y69C 3RW0A 2AHYA 4X66B 1OZ0A 2AGAA 1VF6C 2OCCB 2ZM6O 1KKDA 1FXKB 3OGCC 1MSDA 3JSLA 4UVCA 3ABKB 4JI4B 1XMQB 4DV3B 3L71H 3ASOC 4U3JB 1M56C 4YJ3A 2UU9O 3LSQA 2LW1A 5IDJA 2HVJC 4NTXA 3ML0A 3CEIA 4B7KA 2OTJV 1NBMG 2QKCA 4K35A 3LSUA 1B04A 3STLC 2UUCB 2CK3G 3ZN1A 2NR5A 5JQGA 4FM0A 2QM8A 1V55C 1WJZA 2DWEC 4DK0A 1YI2V 1GRJA 1NKDA 4UCVA 5EK0A 4OPAA 4JYAO 3RYCB 3KKYA 3SYAA 1MNGA 2ZXWC 1Z5VA 5EBMC 1XMQO 1K4CC 3QF7A 4DV2O 1BCCH 3ZMSA 1GN2A 1CP9A 1BHBA 1EBOA 4NKGB 3CXHF 3EXAA 1NZ6A 2GDSA 2ZNIA 3M99B 3JD1A 5IJ9B 2HHHB 4RO2A 4LR3A 2ZE7A 4UB6Z 1TVKA 3A0HZ 3MHHC 1D5NA 4HZ3A 3HKCB 5CB4A 3P32A 4NXMB 4KHPO 2QWOB 4YJ3B 4FIPC 3L9DA 5IYZA 4HNAA 3K5MA 1F23A 1FJGO 1Q3EA 1AR4A 2E5LB 1WPXA 1X4TA 1QU7A 1OCOC 4DR3O 3JAMN 3KZIZ 4YIPA 4FFBB 5B1OA 1IXMA 3G4SV 2HEPA 4ABMA 1Q81W 3CC2V 4DV5O 4JI8O 3JARA 3GWKC 2IJKA 4WFAV 2FB5A 4IIJA 4O2BA 2PTMA 4BWAA 5L3BA 2FMLA 4I55B 3AG1C 3CP1A 3RT3C 4JV5O 1YIJV 1GO3F 1URFA 4TWKA 1XNQO 4JYAB 1HDJA 3E8FA 5B1NA 2IH3C 4O2AB 1HR0B 4JI4O 1QBZA 1Y4MA 2RQ6A 3TK1A 4GCZA 4JI6O 1H2SB 4PI0A 4O4LB 2RJZA 4LF5B 5IJ0A 4D7SA 3HKCA 5CB4B 1KECA 5L3CA 2ZE6A 2RNBA 2P4KA 2ETNA 4HNAB 3JD0A 4OXSA 2DYSB 5LGTA 4CC6A 1N36B 1IBLO 2BCCH 2CGOA 1QLEB 4UV8A 4AILC 3CHXA 1VEWA 4LNUB 3CCLV 1EFRG 1S5JA 1OCZB 2JDIG 1M56B 4JYYA 4X20A 2B9ZA 4ZBMA 1K9MW 1XREA 5LOVA 5KHKA 1ZWIC 2W0XA 4O2BB 5LMNB 3CMAV 1BQZA 1PPJH 2HJFC 3E22A 2ILMA 3OMAB 4NB5A 2EILC 4ZI7A 1YJWV 1SZXA 3QTCA 1JOYA 1M93A 1SRYA 2VQFB 3VOUA 1V55B 1M90W 4LFBO 2P6JA 4JTDB 3CSXA 5LGNA 4UCSA 2YUAA 3THOA 4LBEC 4TOIA 2BE3A 1ZL8B 1SETA 2ZXWB 4QPKA 3CRRA 4BR6A 4UXNA 1CEZA 1YTFB 4X1YA 2A0LA 4CS4A 1G1XB 1YSCA 1LUWA 4FM1A 1V54C 4MVSA 2UUAO 2P67A 4Q20A 1F4MA 4JAUA 1PNMA 3C3TA 1Q7YW 4I9WA 4KL1A 3OTOB 4WBNB 2JRIA 2OTLV 2CTWA 3K9SA 1XQ8A 1TGOA 3TETA 2JS3A 2QTOA 4F4LA 1US6A 4PV1B 5E1AC 2NN4A 3HR0A 2XHBA 4JI0B 3W7XA 4N21A 1N36O 1OCCB 3X2QB 4PD4F 4I0XB 5BMVB 4G27B 2N74A 1QCEA 2RMKB 2JJ2G 3CMEV 4DV7B 4FLWA 4ZI7B 4D6TH 2R9AA 2M7WA 3OEEG 3P3NA 3LDCA 1I0HA 3F5TA 1GKFA 1PM9A 5GTIZ 2ARHA 3MHSC 4JI7B 1QR9A 5IYZB 2X7RB 1WP8A 3A8TA 4FFKA 1WAZA 4MVQA 2EIMB 2ZCEA 1A32A 1IBMO 3ETQA 1W2BU 4G28B 4JI1O 4BW5A 2WA3A 5LHIA 3K5NA 2Y48A 2P4VA 1NH2D 1XMOB 1JX9A 4JTAB 4UV9A 3FFQA 3SYQA 2UUCO 5HFLA 1MABG 5JWPA 2AZ2A 2UXXA 3APQA 3SYCA 1K8AW 1PL4A 3T1HB 1I5YA 1WB7A 2F4VB 4DV6B 2Q7HA 4HBNA 4I5SA 3ZRWA 4LF4B 3OTFA 3AK2A 4PA9A 4ZIBA 1I94B 3HKDA 1WP7A 1BS3A 3E8GA 4R7CA 4DR6B 1MMMA 2ODMA 1N32B 1H2GA 4J7ZA 3OUSA 3CCQV 1HNZB 2QM7A 4I7ZB 1XL6A 1B06A 1FXKA 5AG2A 2YXYA 4PELA 1XDCA 5EZYB 5L3GA 2GUZB 2WLIB 2X0LA 2CTQA 2X6BA 3JASA 4QPJA 2F23A 1VARA 2LQTA 3OW2U 1FAFA 3QVNA 1OCOB 1S5HC 3CCJV 3LDEA 1AJPA 4YIOA 3OE7G 1R73A 1W0KG 4X1KB 4MW8A 4LF4O 1K73W 1SQFA 4DR3B 1RP3B 2FTKA 4JI7O 1FPOA 4CH4A 1GTOA 4LNUA 1VQ4V 4FLYA 4TV9B 2G38A 4FPPA 4GYCB 2UUBB 2P90A 4PDLA 2UUBO 5LYJA 2EZOA 5EBWC 4Z1MG 3JATA 5KUKA 3ABTA 4JF3A 3ZMZA 1FS0G 2A9HA 1DLBA 5BY1A 3S3XA 3ZJZA 5LA6A 4TV8B 3ZMTA 4B3MO 1R3IC 1V54B 3SJBC 4MVZA 1SQGA 2YXHA 4Q6GA 5JVDA 2OCHA 1P4RA 4GX1A 4DR4B 2UXBO 1JPXA 2UXCO 4X8AA 4EKWA 3UT5B 3BHPA 4PA7A 1EM1A 2ZDIC 2WA4A 5FPOA 4LP8A 2DYRB 2WSSG 3SPJA 3SJCC 4P9OA 2GUZA 2GBOA 3UM7A 2CAZC 1IBKO 3OTOO 1AR1B 3FX7A 3VQWA 3D36A 1YHQV 1DTOA 3SYPA 5J2UB 5KHHA 1B6QA 1RM1C 1H2MA 2EIJB 5J2TA 2H3OA 4DUYB 2QA4V 3BA9A 4MVOA 3JAKA 5DN6G 2LP7A 3H9VA 3D3IA 4G2KA 2QDOA 1VQKV 1HNWB 1IURA 1M57C 3JARB 5EYPA 2XAHA 1Z5WA 5LL6Y 2YS8A 1S76D 3VBBA 3JCUZ 1AROP 1CPYA 2RN9A 3N27A 4MW3A 1QVFU 2A3QA 1F51A 4EFBA 2UXNA 4UCTA 2JIZG 3ETGA 1YTFD 1N32O 3HKEB 1N34O 5F2VO 2EZPA 3K9AA 4RQFA 1QLEC 4CBCA 1MZEA 1QR8A 3FB7C 1M57B 1LUVA 4RUEA 4QJFB 1KP2A 2KKWA 4R50A 3CS5A 1PNLA 4C7UA 2YICA 1AVMA 1Q86W 5LP6A 1XNQB 2QR4A 2QKAA 2RDCA 4EB6B 4AQYB 2P22C 4DR4O 2Q4PA 4DO2A 2R9RB 1HNWO 2ADPA 2D2CB 1YJNV 2HR3A 3G71V 3BY6A 3B4SA 5CMUA 4X1IA 3CCMV 1P7BA 3IAYA 3E8HA 4X65O 1N33B 2IJHA 2XT9A 3ZEDA 3CCEV 3SR2C 3JAWA 4YHHB 4P30A 4L8JA 3T2MA 2LFRA 3STZC 5IWAB 1SERA 3W7WA 4IGGA 1DK1A 1YEWA 2IW5A 3ZRWB 1SA0A 3G6BA 3RWRD 4ZOLA 3I55V 5IY5C 3CPWU 2Q67A 1Q5OA 3IFXA 3KCYA 4PA4A 2F95B 2GTSA 1G6UA 4I4TA 4B3RB 3RYIA 3ZIAG 2BTOA 4GX2A 3K59A 3T1HO 4AHCA 2KQXA 4UVAA 2DMXA 4DV4O 4KXRA 4X66O 3BAAA 1QQCA 1GM9A 3RGBA 3HKEA 5IE9A 5LMNO 2QWQB 2WLIA 2OYQA 3ZX6A 1EN6A 4K8ZA 4CH6A 2H8PC 1DGSA 4F6RB 2F66C 3AK1A 1L1FA 5C8YA 3RFRA 4PDMA 1K4DC 2PF4E 4FZ1A 1K97A 1X59A 1SF9A 2CTRA 4JI1B 3ZMUA 3CRCA 2HKOA 2F1MA 4JYCA 3AEIA 3OUFA 2LO1A 1NU1H 1O9GA 3CCRV 4NR1A 4BIZA 1VQ6V 5L3EA 1S0VA 3TGUH 1M9NA 1NJIW 4XDLA 2F4VO 1NQTA 1Q6UA 2EILB 4WBNA 2Z5UA 2HG5C 4UCRA 1FJGB 3ZN0A 5LA6B 2YIBD 1P49A 3ABMC 3ABUA 1L0NH 4A5UB 5JJJB 2YXLA 4FLTA 2WAMA 4DRXA 1G4YB 4LH7A 4B3TB 4FM2A 1O9HA 3T4DA 2EIJC 1VF5B 5BMVA 1N34B 2YEVA 1KD1W 3Q4HA 2KSDA 3UO2A 4JAAA 4R8CA 2P06A 3TXQA 1N0JA 5IYDO 4B3RO 5CBFA 3RBZA 3EVKA 2FL4A 4XDJA 5JCOA 1M4UA 1FFXB 2JGDA 1SQQH 2XNDG 2E76B 5B66Z 4I50B 2ZQMA 1PD3A 2KG7A 2E3CA 2ZR3A 3CCUV 3CXCU 2DE0X 2AW9A 1R3LC 1NS1A 1Y67A 4DUZO 3SPIA 4JGSA 2Q6AA 3L75H 2ZIOA 5GONA 1NVPB 4JI2O 3CC7V 4DR1O 2ZIMA 1OCCC 3X2QC 4IYHA 4TSFG 2Y4UA 4MT8A 5H9CA 1GH6A 2OIEA 4NTYA 3VQXA 5LHHA 3JD2A 2FYUH 2UXDO 1XMOO 1B3QA 3FD9A 2IJJA 1Y76A 3J7AU 2GTAA 3AG4B 4OX9O 3C3SA 1XNRB 3HKDB 2AXTZ 5B1BC 2ZR2A 3CC4V 3ZMVA 4DRXB 1VQMV 3FYIB 3S3WA 3B2EE 5LXTA 5IJ9A 1H2LA 4EFEA 1OJHA 3WU2Z 4O4JA 1XILA 1NI8A 4B7EA 5FPRA 2QEXV 5LP6B 2F43G 1EZJA 2QWRB 2CH7B 2Q68A 5B1AC 2W6IG 1VQPV 1XHXA 2PGGA 1IDSA 2CGNA 3AG2B 2VWJA 1VQ7V 4LFBB 1FFXA 3PN1A 1WLEA 3ZHVA 3RN4A 4X1IB 1MA1A 2R9IA 3QO5A 2KG7B 5IYCO 4K0KB 4GZRB 4UCUA 5D5QA 4LF6B 3JAWB 4BW9A 5D5PA 3CRAA 5H5NA 2YC0A 3UO3A 3DXRA 1FKAO 5L3DA 3L72H 1RFYA 1RPRA 1W59A 4PHZA 5GONB 5JJEB 1ZUQA 3K3WA 1NR7A 4HAMA 4TV9A 1ROPA 4ZOLB 2K9PA 2QM4A 3WB0A 2HVKC 5LYJB 4IL6Z 3RYHB 1TAEA 3JATB 4GKJO 4IIJB 1GMGA 3B40A 3RYIB 3ASOB 1R6NA 4UFZA 1Y76B 2ZDIA 2XASA 1HWYA 2WLKA 4DV5B 4TUYA 1ORQC 5CA1A 3W7UA 3F7VC 4ASUG 1FFTB 2W6JG 5KMGA 1RPOA 3B77A 3BVOA 5HFMA 1VP7A 3DSQA 1KB9F 2PYLA 1K5SA 4JI0O 5LXTB 4F6RA 1QVGU 2IU3A 2DN9A 4MTGA 4NVPA 4HYOA 5CN0A 4B3MB 5C8YB 1N8RW 4GKKB 3DC5A 4LF7B 2Q73A 1OCZC 5EBLC 5K1PA 3FAVA 1E1QG 5IJ0B 1AB3A 5EC1C 4LFCO 5A9GA 4ZHQB 4WFEA 3H1HH 2GV9A 2Y4TA 5LBQA 4JI3O 1IZ3A 1PL0A 4GKJB 5J2UA 3K5OA 2RCVA 2BOCC 1P7GA 3UCSC 3ZRVA 1K34A 1SZTA 4AI8A 1BGYH 3A0RA 4DW1A 1YDXA 4JI2B 5K1XA 3ABLC 4B3TO 2Y0IA 4BIOA 3K0GA 2XUMA 3CX5F 1Z2GA 1NTKH 2W0FC 3JAKB 3U10A 1KMIZ 5FLXN 4F6EA 1OCRB 2IH1C 2OWOA 1FXVA 3FKSG 4MTOA 4N23A 2A06H 3CYOA 2EIKB 3RYFB 2LJ2A 2CUGA 4CC5A 1Q90D 5TISZ 1VQOV 4NYKA 3ASNB 5JCOC 1AI7A 4LF7O 3Q4HB 4QE9A 5KUMA 2PZSA 1MZFA 1LR1A 4JZGA 2DYRC 2YI8A 1L8DA 3TCUA 2UXBB 2R72A 4GUNA 1HNXB 3M8AA 1U96A 5LMUO 2E75B 4FVMA 4R6ZA 3BRCA 1NT2B 1UJWB 4DV1O 4I50A 5B3SB 4X88A 4H33A 5GW7A 2ZKOA 4FLUA 2YIAA 1Y74B 1HNZO 2XAQA 4J42A 5BR8O 1KC8W 1R6KA 1AJQA 5CBHA 2Q7GA 5LGUA 3AG1B 2A7WA 3SDLA 2LFSA 2JVDA 4K0KO 4I9QA 1FD9A 4JAVA 1PP9H 3OFNG 4DUYO 4MTFA 3QO8A 4UVBA 2M6YA 1Q82W 3OMIB 3R66A 5B1AB 4WFBV 4DUZB 5JQGB 2XAGA 1HNXO 1NTMH 3CWBH 3GWOA 4PA6A 4GT1A 2F93B 3W7TA 3F7YC 3MAQA 5BXZA 2WLHA 2DWDC 4I4TB 1J5EO 4IYIA 4I0XA 1OHHG 2H94A 3WB1A 2IU0A 3BFRA 1E79G 3BPZA 1S77D 5IT9N 4GX5A 2DYSC 3NXSA 1K33A 2CH7A 1VQ8V 1IXBA 3H1JH 1YJ9V 3IC9A 4OPHA 2HJDA 3IC7A 4AQYO 1VQNV 1WA8B 4XDKA 4LFCB 2PYJA 2LGQA 1GK9A 2CTPA 1L0LH 1TVKB 2BSKA 4W4LA 1QNMA 2VQEB 4UUJC 3E86A 2GHYA 2JGUA 4JI6B 2IBZH 1SQVH 2Q0OC 4FZ0A 4J7KA 1M5IA 3K57A 1RSOB 4JASA 4DYLA 2YIBA 3SPCA 4YHHO 3FYEB 4DR1B 2ATKC 5BR8B 4JI8B 1SQBH 3LDDA 2WLLB 1JMKC 2BOBC 4IHJB 3SYOA 2C2AA 4ZKIA 2YSUB 2HP8A 5H6RA 2QWNB 1AILA 4FFBA 2ZE8A 3OM3B 4FJCC 3O9OA 1NVPD 3NR7A 3JD4A 4O4HB 2YDEA 3D3QA 3CD6V 2Q7EA 1D2DA 1YXBA 3H1LH 3VQVA 4QGPA 1K5QA 1W0JG 1WN7A 5EZYA 1JR9A 5E79Z 1UPGA 2B1IA 3LUTB 4XBFA 5KHIA 4O2AA 4GX0A 3AG4C 3WB2A 4WFFA 2JGDB 4IT5A 1OV9A 4J80A 3L70H 1DF5A 3ZHRA 4DV0O 1AI5A 1BL8A 2LGWA 4MVUA 3CB2A 2DOSA 1K92A 4NTWA 4O4LA 3DTUB 2BSKB 4NXMO 4LF6O 3E2EA 1J95A 3SJAC 3G67A 2HLDG 1K7DA 1RSOA 3B8NA 2ZE5A 5KHGA 4DV6O 3RYFA 1AI4A 3K06A 2JK5C 1Y6XA 3EHBB 3WFVA 5LMUB 4WF9V 1AP5A 4IHJA 2EJRA 5ITZA 1I7FA 2JEXA 5JJNB 3H1KH 5IWAO 4YY3B 4TV8A 5EC2C 4LF9O 2QJ1A 4X20B 5LOVB 4J10A 2Q8VA 2EINC
chains in the Genus database with same CATH topology
4TSFG 4J9YB 3I56V 4MT8A 5H9CA 4TT3G 4E2LA 1OCRC 5LHHA 4G28B 1W2BU 3JD2A 4BW5A 3ZRXA 2HFEC 5LHIA 2Y48A 3GB7C 4DXWA 1NH2D 2IJJA 1THZA 1F4NA 1JX9A 4JTAB 2B1GA 4UV9A 3SYQA 1YITV 1H8HG 3AG4B 5HFLA 1MABG 3ASNC 3B8MA 2ZD9A 5B1BC 3OAAG 2UXXA 1H8EG 1JQ0A 2ZR2A 3SYCA 3ZMVA 1K8AW 3CC4V 4KUMA 1JCHA 5B1BB 1COWG 1I5YA 1VQMV 3E89A 1H38A 5J9PC 3E35A 3FYIB 1TUEB 1QLNA 2XAFA 3ABLB 5DM6V 1PNKA 4KP4A 4I5SA 3ZRWA 1ENVA 4PA9A 2QEXV 4L87A 2F43G 1JVMA 1EZJA 3E8GA 4QE7A 3ETEA 4R7CA 2Q68A 2OCCC 5B1AC 2W6IG 1VQPV 4J9ZB 3AG2B 1H2GA 2EIKC 2DW4A 5CBGA 1VQ7V 3CCSV 4KFMA 2V7QG 5KA5A 3OUSA 3SPGA 1WLEA 3CCQV 1R3KC 2A79B 2V1DA 4X89A 4MVRA 3ZRSA 3ABKC 2QM7A 2R9IA 2WWWA 1XL6A 3QO5A 2PI4A 4QNHB 1FXKA 5IYCO 3R65A 4PELA 3G6EV 3JYCA 2EBOA 3EFFK 5L3GA 1NH2B 2WLIB 2EIMC 4QIWF 2X0LA 5L3DA 2X6BA 3JD3A 2GSMB 1RPRA 4QPJA 3H01A 3K3WA 4WCEV 3OW2U 1NR7A 1OCOB 2Y69C 3RW0A 2AHYA 4HAMA 1S5HC 3MD0A 3CCJV 1FXHA 3LDEA 1OZ0A 1ROPA 2D3OW 2OCCB 2HVKC 1AJPA 1KKDA 3OE7G 1R73A 1FXKB 1LNQA 3OGCC 3AG2C 5IYBO 1W0KG 4UVCA 1GMGA 3AG3C 3ABKB 4MW8A 3ASOB 1K73W 1R6NA 2FTKA 3ASOC 3ETDA 1M56C 1GTOA 1VQ4V 3IGAC 3LSQA 2ZDIA 4FPPA 3K08A 2XASA 4H37A 1VQ9V 1HWYA 2WLKA 2P90A 2P7TC 4PDLA 5BZBA 3FB5C 5IDJA 1ORQC 3W7UA 3FB6C 2EZOA 2HVJC 3F7VC 5EBWC 4ASUG 4Z1MG 5KUKA 3ABTA 3ML0A 1I5XA 4JF3A 3ZMZA 1FFTB 2W6JG 1FS0G 5IY5B 2OTJV 1RPOA 3B77A 1NBMG 5HFMA 2A9HA 1DLBA 4FK5C 1KQSU 3STLC 1K5SA 1QVGU 2IU3A 3AG3B 4MTGA 3ZJZA 4HYOA 5CN0A 2CK3G 3ZN1A 3ZMTA 2QM8A 4U7NA 2AHZA 1V55C 1R3IC 1GM8A 1N8RW 2DWEC 1V54B 1YI2V 3RVYA 4MVZA 1OCZC 5EBLC 1NKDA 5EK0A 1E1QG 1P4RA 2WLLA 4GX1A 5EC1C 4WFEA 1JPXA 3SYAA 4X8AA 4EKWA 2KB1A 5B3SC 5LBQA 2ZXWC 2WLNA 4PA7A 1PL0A 2K1EA 1KP3A 5EBMC 1K4CC 2BOCC 1MSWD 3ZRVA 1M1KW 1K34A 3KG2A 1SZTA 2ZDIC 4LP8A 3A0RA 2DYRB 2WSSG 3SPJA 4P9OA 3ZMSA 5CA3A 3ABLC 1CP9A 1BHBA 1EBOA 3UM7A 3K0GA 4PDVA 3PJSK 1AR1B 1R3JC 3M99B 2W0FC 3JD1A 2X6AA 3BEHA 3D36A 1DTOA 3SYPA 2QE7G 1YHQV 1G8MA 4RO2A 1B6QA 1OCRB 2IH1C 1FXVA 3FKSG 1RM1C 4MTOA 4N23A 3MHHC 2EIJB 3CYOA 2EIKB 4YXWG 4HZ3A 3K79A 3WG7C 3P32A 3OR7C 3F5WC 3P30A 1VQOV 2QA4V 4MVOA 1BHAA 3ASNB 1AI7A 3QO7A 1Y66A 4QE9A 5DN6G 4FIPC 5KUMA 2Q69A 2LP7A 3DGEA 3D3IA 4G2KA 5FL7G 2DYRC 1VQKV 3TCUA 2OT5A 1M57C 1F23A 4U7OA 2XAHA 4P2ZA 2JEUA 2EINB 1WPXA 2ITDC 4R6ZA 1VQ5V 1S76D 1OCOC 2Y69B 3VBBA 1AROP 1CPYA 3ZCCA 1UJWB 4MW3A 1QVFU 3FB8C 1F51A 2UXNA 5B1OA 2JIZG 5B3SB 4X88A 1IXMA 3G4SV 4H33A 1Q81W 5GW7A 3ETGA 1YTFD 3CC2V 1AI6A 2IJKA 4WFAV 2XAQA 2EZPA 1KC8W 3K9AA 1R6KA 4RQFA 1QLEC 4CBCA 1AJQA 1QR8A 3FB7C 1M57B 4RUEA 4QJFB 1KP2A 5CBHA 4MSWC 5L3BA 5H6QA 5LGUA 3QNEA 3AG1B 4R50A 2LFSA 1E1RG 1PNLA 3AG1C 3CP1A 3K0DA 4JAVA 1K3EA 3OFNG 1Q86W 3LNMB 1GO3F 1YIJV 4MTFA 4TWKA 3SPHA 3QO8A 4UVBA 1Q82W 3SJQC 3E8FA 3OMIB 5B1NA 4DO2A 2Z3YA 1PKXA 2R9RB 2IH3C 5B1AB 4BAYA 4WFBV 2PI5A 3E8BA 1YJNV 2HR3A 2YEVB 1QBZA 3BY6A 3G71V 2ITCC 5CMUA 1Y4MA 2XAGA 3CCMV 1P7BA 3TK1A 3GWOA 3E8HA 3OMNB 4GCZA 4PA6A 4GT1A 2IJHA 3CCEV 3W7TA 3F7YC 3K03A 2WLHA 2DWDC 4P30A 3T2MA 2LFRA 3STZC 4P9PA 1SERA 3W7WA 1KECA 1OHHG 2H94A 5L3CA 4JPRA 2IW5A 2IU0A 3ZRWB 1E79G 5C93A 1S77D 4LCUC 4GX5A 3I55V 4PA3A 2DYSC 3JD0A 4OXSA 5IY5C 3CPWU 2WLJA 4BIUA 2Q67A 1K33A 3NXSA 1VQ8V 2DYSB 3IFXA 4PA4A 1YJ9V 5LGTA 1JJ2U 3ZIAG 1MG1A 1QLEB 4UV8A 4GX2A 3IC7A 1GM7A 3CCLV 1EFRG 4UVAA 1VQNV 1OCZB 2JDIG 1M56B 4XDKA 4PDRA 4ZBMA 1K9MW 1GM9A 4MVMA 1GK9A 3HB3B 3K04A 5LHGA 1ZWIC 4WFHA 2DQ0A 2WLIA 4UUJC 3E86A 2GHYA 2IJIA 3CMAV 2HJFC 1BMFG 4RAIA 2H8PC 3OMAB 3LSSA 1MOFA 2DQ3A 1XL4A 2B5UA 2WPDG 2EILC 2QKSA 4JASA 1YJWV 1FXKC 1L1FA 3SPCA 4WFGA 1JOYA 1DF4A 1S72V 3FYEB 4PDMA 1K4DC 1SRYA 2ATKC 3VOUA 1V55B 1M90W 2P6JA 4JTDB 3LDDA 2WLLB 1K97A 2BOBC 3SYOA 4ZKIA 2C2AA 5LGNA 4RUFA 2YSUB 5H6RA 3ZMUA 2HKOA 4JYCA 3AEIA 3OUFA 4LBEC 1RM1B 2XOKG 4FMTA 2MK3A 3CCRV 1SETA 1NR1A 2ZXWB 4QPKA 4BIZA 1VQ6V 3OM3B 4FJCC 5L3EA 1S0VA 1NVPD 1M9NA 1NJIW 2JJ1G 3JD4A 4XDLA 4UXNA 1CEZA 1YTFB 2X6CA 1NQTA 2EILB 1S3JA 2HG5C 2A0LA 2Z5UA 3JCZA 1YSCA 3ZN0A 3CD6V 3E83A 1V54C 3ABMC 4MVSA 3ABUA 3W7SA 2P67A 3ABMB 4Q20A 1F4MA 4JTCB 4JAUA 5L3FA 2WAMA 2XAJA 1G4YB 1PNMA 4RQEA 1K5QA 1W0JG 1Q7YW 4I9WA 2B1IA 5KA6A 3T4DA 2EIJC 3LUTB 4XBFA 2OTLV 4GX0A 3AG4C 3WG7B 4WFFA 2YEVA 1KD1W 1DF5A 3TETA 3OEHG 2QTOA 4JYBA 4R8CA 1BL8A 1AI5A 4F4LA 4MVUA 4LC1A 5E1AC 5IYDO 1K92A 5CBFA 3RBZA 3DTUB 3W7XA 4N21A 1OCCB 3X2QB 3E2EA 3T4ZA 1J95A 2NNUA 4XDJA 4G27B 1QCEA 2JJ2G 2XNDG 2HLDG 3CMEV 3RVZA 1K7DA 3B8NA 2ZQMA 1SESA 2M7WA 3OEEG 1PD3A 3HPLC 3UKMA 2ZR3A 3CCUV 3LDCA 3CXCU 4MS2A 3T1CA 1R3LC 1AI4A 3OR6C 3K06A 3SPIA 1AJNA 4JGSA 2JK5C 3EHBB 3WFVA 1VQLV 4WF9V 2Q6AA 1GKFA 2EJRA 3MHSC 2JEXA 4CZZA 2NLJC 2WLMA 1QR9A 1NVPB 2X7RB 5EC2C 3CCVV 3CC7V 1OCCC 3X2QC 4MTXA 4MVQA 2EIMB 2EINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 W;  3CCQ V;  4WFA V;  2D3O W;  1KC8 W;  3I56 V;  1YHQ V;  1KD1 W;  1K9M W;  1R73 A;  4WFB V;  2OTJ V;  5DM6 V;  1W2B U;  3CCU V;  3CD6 V;  3CXC U;  3I55 V;  1YJN V;  3G71 V;  1KQS U;  3CPW U;  1VQ8 V;  1QVG U;  3CCM V;  3CMA V;  1K73 W;  3G6E V;  1VQL V;  2QEX V;  4WF9 V;  1YJ9 V;  1VQ5 V;  1YIT V;  1M1K W;  1VQN V;  1JJ2 U;  3CCE V;  3CCR V;  1N8R W;  1VQ4 V;  1QVF U;  1VQ6 V;  1VQO V;  1YI2 V;  1VQP V;  1Q86 W;  1Q7Y W;  2QA4 V;  1YIJ V;  1YJW V;  1VQ9 V;  1NJI W;  3CC4 V;  3CCV V;  1K8A W;  4WCE V;  3G4S V;  3CC7 V;  3OW2 U;  3CME V;  1S72 V;  3CCL V;  1Q81 W;  2OTL V;  1VQ7 V;  1Q82 W;  3CC2 V;  3CCS V;  1VQM V;  3CCJ V;  1VQK V; 
#chains in the Genus database with same CATH topology
 2BTQ B;  4TT3 G;  4E2L A;  1KBH A;  4DV0 B;  3E22 B;  2HFE C;  1KYO F;  3J81 N;  3GB7 C;  1F4N A;  2B1G A;  5CA0 B;  3UT5 A;  4O4J B;  4CS3 A;  4CH5 A;  1VMG A;  1Y74 A;  2N05 A;  1COW G;  2ZM6 B;  1BQ0 A;  5J9P C;  3E35 A;  1Q6I A;  1QLN A;  1HR0 O;  3ABL B;  2V4D A;  1PNK A;  4KP4 A;  1JA8 A;  5KX5 B;  5EIB D;  3P3P A;  3HKB B;  5KHJ A;  1EN5 A;  1XHZ A;  4DR7 O;  4Z1V A;  4QE7 A;  2PUS A;  2OCC C;  4X1Y B;  5J2T B;  1IBK B;  1Q43 A;  4YY3 O;  4J11 A;  2EIK C;  3DXR B;  1GAX A;  4KFM A;  2V7Q G;  5KA5 A;  4U3F H;  3SPG A;  2A79 B;  4X89 A;  1KU9 A;  1GN3 A;  3N2G B;  1TUB A;  5DED A;  3DC6 A;  4QNH B;  1H2N A;  3R65 A;  3G6E V;  5EYP B;  1FYJ A;  2EBO A;  3A2F A;  3EFF K;  4QIW F;  2ZT9 B;  3JD3 A;  2GSM B;  3H01 A;  4WCE V;  5LP6 C;  4X62 B;  4H44 B;  2E74 B;  3MD0 A;  4LH6 A;  1FXH A;  4DV4 B;  2D3O W;  5B5E Z;  1LNQ A;  3AG2 C;  5IYB O;  2L35 A;  3AG3 C;  2BTQ A;  4EEQ A;  5KMG B;  3LNN A;  4ICG A;  4O4I A;  3ETD A;  4DR6 O;  4DV2 B;  3IGA C;  3K08 A;  4H37 A;  1VQ9 V;  2P7T C;  5BZB A;  1XOU A;  3FB5 C;  3FB6 C;  4EB6 A;  4PI2 A;  1I5X A;  1YF2 A;  3UQ8 A;  4LWS B;  5IY5 B;  3D8C A;  4FK5 C;  1KQS U;  4ZHQ A;  4NXN O;  2VS0 A;  3AG3 B;  4LF8 B;  1VIB A;  5KX5 A;  4U7N A;  2AHZ A;  1GM8 A;  3RVY A;  3G80 A;  4GLX A;  5JH7 B;  2QTS A;  1VF6 A;  2WLL A;  4FLZ A;  2KB1 A;  4H13 B;  5B3S C;  2Y0P A;  2EUL A;  2WLN A;  2K1E A;  1KP3 A;  1SA0 B;  1MSW D;  1M1K W;  3KG2 A;  3N2G A;  1ZAU A;  4O4H A;  1J5E B;  5CA3 A;  3H1I H;  4PDV A;  3C90 A;  3PJS K;  1R3J C;  4DR5 O;  2X6A A;  3BEH A;  2QE7 G;  1G8M A;  2CDY A;  4UB8 Z;  4DW0 A;  3CJH A;  2Q0A A;  4B3S B;  1KKC A;  5KAF Z;  5DEC A;  4OX9 B;  1VF7 A;  3U0Z A;  4YXW G;  3K79 A;  3WG7 C;  5A2Q N;  3OR7 C;  3F5W C;  3P30 A;  1N4C A;  4JV5 B;  1BHA A;  4PJ0 Z;  1N0N A;  3QO7 A;  1Y66 A;  2Q69 A;  1Q6H A;  1H2K A;  3DGE A;  5FL7 G;  3OGI B;  2OT5 A;  4U7O A;  1YCI A;  2DJV A;  4P2Z A;  2JEU A;  2EIN B;  3O65 A;  2ITD C;  1VQ5 V;  3JAS B;  1HP8 A;  2Y69 B;  4X65 B;  3ZCC A;  1IVS A;  2EJ7 A;  2Q5Z A;  3FB8 C;  2OIG A;  3APO A;  2R70 A;  3ICX A;  1AI6 A;  3BAB A;  2PY5 A;  1YVW A;  4X1K A;  1SKV A;  5GTH Z;  4NXN B;  3QG5 A;  3ZHT A;  5FNV A;  4MSW C;  4LF8 O;  5H6Q A;  1ZTE A;  2MW2 B;  3ZHQ A;  3QNE A;  2YID A;  3VQY A;  1IBL B;  1E1R G;  3K0D A;  1SS3 A;  2P5O A;  1SC5 B;  4D7T A;  1K3E A;  1GN4 A;  3LNM B;  3SPH A;  1JFF A;  1XI1 A;  2AZ0 A;  3SJQ C;  3L73 H;  2Z3Y A;  1PKX A;  4BAY A;  3CE2 A;  2PI5 A;  3E8B A;  2YEV B;  2ITC C;  3OMN B;  2LW7 A;  5JVD B;  3K03 A;  4W4K A;  1KUQ A;  2UU9 B;  4J7J A;  4DK1 A;  4P9P A;  3ZHS A;  4DR5 B;  3CRQ A;  1V9P A;  4FLV A;  4JPR A;  2O57 A;  5C93 A;  4JI5 B;  3GVM A;  4LCU C;  1WNS A;  1WA8 A;  4PA3 A;  2HHH O;  2WLJ A;  4BIU A;  4UCO A;  3A0B Z;  2VRZ A;  3SGI A;  1ZLZ A;  3AK3 A;  4H0L B;  1JJ2 U;  4GKK O;  1I08 A;  1MG1 A;  3JAL A;  4OGQ B;  4U3J A;  2ZIN A;  1GM7 A;  3ZS8 C;  1SQX H;  4X62 O;  4PDR A;  2YI9 A;  1WPB A;  1TUB B;  4MVM A;  4JI3 B;  3HB3 B;  3K04 A;  5LHG A;  4WFH A;  2N04 A;  2CE4 A;  2DQ0 A;  1WB8 A;  2IJI A;  3IJ4 A;  2UUA B;  1BMF G;  1ZX3 A;  4RAI A;  1YZB A;  3LSS A;  1MOF A;  2DQ3 A;  1XL4 A;  2B5U A;  2WPD G;  2QKS A;  1FXK C;  4E4E A;  4WFG A;  1DF4 A;  1S72 V;  4X9Q A;  1JFF B;  4J41 A;  1BE3 H;  4RUF A;  4O4I B;  3B09 A;  1U97 A;  1RM1 B;  2XOK G;  4FMT A;  2MK3 A;  1F7Y A;  1NR1 A;  1R6T A;  1GN6 A;  4YJ2 B;  2JJ1 G;  4B08 A;  4TQF A;  4LWS A;  1UFI A;  4DV7 O;  1XBL A;  2X6C A;  3I5D A;  1Q8I A;  2UXC B;  1S3J A;  3JCZ A;  3TXS A;  3J80 N;  3KCX A;  2VQE O;  3E83 A;  1S5L Z;  1AP6 A;  3W7S A;  4DR7 B;  1ZL8 A;  3BA8 A;  4LFA O;  3ABM B;  1JJO A;  4JTC B;  4LFA B;  4DV1 B;  5L3F A;  2Q9L A;  2XAJ A;  4LF5 O;  5JH7 A;  4RQE A;  1XUQ A;  5KA6 A;  1SQP H;  3JAL B;  1IBM B;  3WG7 B;  5KAI Z;  3ZHU A;  1D5A A;  2IM9 A;  3OEH G;  4JYB A;  2L6L A;  1AR5 A;  3M7M X;  4LC1 A;  1EN4 A;  3RYH A;  4JZ2 A;  4DR2 O;  3T4Z A;  2NNU A;  3JSN A;  5ITZ B;  1CXZ B;  3RVZ A;  3L74 H;  4RWU A;  1SES A;  3T1Y O;  4TUY B;  1T5E A;  3HPL C;  3MDS A;  5CA1 B;  2ZNJ A;  3CJH B;  3UKM A;  3T1Y B;  4MS2 A;  3T1C A;  2VWK A;  3OR6 C;  1AJN A;  1VQL V;  3D36 C;  4TQD A;  5KLV H;  1I94 O;  3N2K B;  1TA8 A;  4CZZ A;  4K3A A;  2NLJ C;  3TJT A;  1QHT A;  2WLM A;  1BT8 A;  5CA0 A;  2JS5 A;  4I55 A;  2QGN A;  3CCV V;  1PV0 A;  2VQF O;  1NTZ H;  4MTX A;  4JI5 O;  4J9Y B;  4YJ2 A;  3BCC H;  3I56 V;  3FAV B;  4K8X A;  3ZBH A;  1OCR C;  3K58 A;  3ZRX A;  4DXW A;  4B3S O;  3AG7 A;  1THZ A;  2XTA A;  1YIT V;  4Z2W A;  2Z0A A;  1H8H G;  3HKB A;  3OD4 A;  3ASN C;  4DR2 B;  3B8M A;  2ZD9 A;  3OAA G;  1H8E G;  1JQ0 A;  4KUM A;  1JCH A;  2QSA A;  5B1B B;  4KHP B;  3K5L A;  1P84 F;  1HW7 A;  4FLX A;  3E89 A;  1H38 A;  4CS2 A;  1BZK A;  1TUE B;  5FNV B;  2XAF A;  5DM6 V;  4DV3 O;  1ENV A;  5EIB C;  2E5L O;  1N33 O;  4L87 A;  1JVM A;  4X64 B;  3CRM A;  4X64 O;  3ETE A;  3RYC A;  4J9Z B;  2DW4 A;  4LF9 B;  5CBG A;  1R1B A;  3CCS V;  4CH3 A;  1BSM A;  1R3K C;  2V1D A;  4MVR A;  3ZRS A;  2UXD B;  3ABK C;  2QWP B;  2WWW A;  2FKX A;  2ADQ B;  2PI4 A;  2EX3 A;  3U11 A;  3JYC A;  5H2F Z;  1IX9 A;  1XNR O;  1NH2 B;  2EIM C;  1EZV H;  3OT7 A;  1ZSP A;  1XEQ A;  3N2K A;  2Y69 C;  3RW0 A;  2AHY A;  4X66 B;  1OZ0 A;  2AGA A;  1VF6 C;  2OCC B;  2ZM6 O;  1KKD A;  1FXK B;  3OGC C;  1MSD A;  3JSL A;  4UVC A;  3ABK B;  4JI4 B;  1XMQ B;  4DV3 B;  3L71 H;  3ASO C;  4U3J B;  1M56 C;  4YJ3 A;  2UU9 O;  3LSQ A;  2LW1 A;  5IDJ A;  2HVJ C;  4NTX A;  3ML0 A;  3CEI A;  4B7K A;  2OTJ V;  1NBM G;  2QKC A;  4K35 A;  3LSU A;  1B04 A;  3STL C;  2UUC B;  2CK3 G;  3ZN1 A;  2NR5 A;  5JQG A;  4FM0 A;  2QM8 A;  1V55 C;  1WJZ A;  2DWE C;  4DK0 A;  1YI2 V;  1GRJ A;  1NKD A;  4UCV A;  5EK0 A;  4OPA A;  4JYA O;  3RYC B;  3KKY A;  3SYA A;  1MNG A;  2ZXW C;  1Z5V A;  5EBM C;  1XMQ O;  1K4C C;  3QF7 A;  4DV2 O;  1BCC H;  3ZMS A;  1GN2 A;  1CP9 A;  1BHB A;  1EBO A;  4NKG B;  3CXH F;  3EXA A;  1NZ6 A;  2GDS A;  2ZNI A;  3M99 B;  3JD1 A;  5IJ9 B;  2HHH B;  4RO2 A;  4LR3 A;  2ZE7 A;  4UB6 Z;  1TVK A;  3A0H Z;  3MHH C;  1D5N A;  4HZ3 A;  3HKC B;  5CB4 A;  3P32 A;  4NXM B;  4KHP O;  2QWO B;  4YJ3 B;  4FIP C;  3L9D A;  5IYZ A;  4HNA A;  3K5M A;  1F23 A;  1FJG O;  1Q3E A;  1AR4 A;  2E5L B;  1WPX A;  1X4T A;  1QU7 A;  1OCO C;  4DR3 O;  3JAM N;  3KZI Z;  4YIP A;  4FFB B;  5B1O A;  1IXM A;  3G4S V;  2HEP A;  4ABM A;  1Q81 W;  3CC2 V;  4DV5 O;  4JI8 O;  3JAR A;  3GWK C;  2IJK A;  4WFA V;  2FB5 A;  4IIJ A;  4O2B A;  2PTM A;  4BWA A;  5L3B A;  2FML A;  4I55 B;  3AG1 C;  3CP1 A;  3RT3 C;  4JV5 O;  1YIJ V;  1GO3 F;  1URF A;  4TWK A;  1XNQ O;  4JYA B;  1HDJ A;  3E8F A;  5B1N A;  2IH3 C;  4O2A B;  1HR0 B;  4JI4 O;  1QBZ A;  1Y4M A;  2RQ6 A;  3TK1 A;  4GCZ A;  4JI6 O;  1H2S B;  4PI0 A;  4O4L B;  2RJZ A;  4LF5 B;  5IJ0 A;  4D7S A;  3HKC A;  5CB4 B;  1KEC A;  5L3C A;  2ZE6 A;  2RNB A;  2P4K A;  2ETN A;  4HNA B;  3JD0 A;  4OXS A;  2DYS B;  5LGT A;  4CC6 A;  1N36 B;  1IBL O;  2BCC H;  2CGO A;  1QLE B;  4UV8 A;  4AIL C;  3CHX A;  1VEW A;  4LNU B;  3CCL V;  1EFR G;  1S5J A;  1OCZ B;  2JDI G;  1M56 B;  4JYY A;  4X20 A;  2B9Z A;  4ZBM A;  1K9M W;  1XRE A;  5LOV A;  5KHK A;  1ZWI C;  2W0X A;  4O2B B;  5LMN B;  3CMA V;  1BQZ A;  1PPJ H;  2HJF C;  3E22 A;  2ILM A;  3OMA B;  4NB5 A;  2EIL C;  4ZI7 A;  1YJW V;  1SZX A;  3QTC A;  1JOY A;  1M93 A;  1SRY A;  2VQF B;  3VOU A;  1V55 B;  1M90 W;  4LFB O;  2P6J A;  4JTD B;  3CSX A;  5LGN A;  4UCS A;  2YUA A;  3THO A;  4LBE C;  4TOI A;  2BE3 A;  1ZL8 B;  1SET A;  2ZXW B;  4QPK A;  3CRR A;  4BR6 A;  4UXN A;  1CEZ A;  1YTF B;  4X1Y A;  2A0L A;  4CS4 A;  1G1X B;  1YSC A;  1LUW A;  4FM1 A;  1V54 C;  4MVS A;  2UUA O;  2P67 A;  4Q20 A;  1F4M A;  4JAU A;  1PNM A;  3C3T A;  1Q7Y W;  4I9W A;  4KL1 A;  3OTO B;  4WBN B;  2JRI A;  2OTL V;  2CTW A;  3K9S A;  1XQ8 A;  1TGO A;  3TET A;  2JS3 A;  2QTO A;  4F4L A;  1US6 A;  4PV1 B;  5E1A C;  2NN4 A;  3HR0 A;  2XHB A;  4JI0 B;  3W7X A;  4N21 A;  1N36 O;  1OCC B;  3X2Q B;  4PD4 F;  4I0X B;  5BMV B;  4G27 B;  2N74 A;  1QCE A;  2RMK B;  2JJ2 G;  3CME V;  4DV7 B;  4FLW A;  4ZI7 B;  4D6T H;  2R9A A;  2M7W A;  3OEE G;  3P3N A;  3LDC A;  1I0H A;  3F5T A;  1GKF A;  1PM9 A;  5GTI Z;  2ARH A;  3MHS C;  4JI7 B;  1QR9 A;  5IYZ B;  2X7R B;  1WP8 A;  3A8T A;  4FFK A;  1WAZ A;  4MVQ A;  2EIM B;  2ZCE A;  1A32 A;  1IBM O;  3ETQ A;  1W2B U;  4G28 B;  4JI1 O;  4BW5 A;  2WA3 A;  5LHI A;  3K5N A;  2Y48 A;  2P4V A;  1NH2 D;  1XMO B;  1JX9 A;  4JTA B;  4UV9 A;  3FFQ A;  3SYQ A;  2UUC O;  5HFL A;  1MAB G;  5JWP A;  2AZ2 A;  2UXX A;  3APQ A;  3SYC A;  1K8A W;  1PL4 A;  3T1H B;  1I5Y A;  1WB7 A;  2F4V B;  4DV6 B;  2Q7H A;  4HBN A;  4I5S A;  3ZRW A;  4LF4 B;  3OTF A;  3AK2 A;  4PA9 A;  4ZIB A;  1I94 B;  3HKD A;  1WP7 A;  1BS3 A;  3E8G A;  4R7C A;  4DR6 B;  1MMM A;  2ODM A;  1N32 B;  1H2G A;  4J7Z A;  3OUS A;  3CCQ V;  1HNZ B;  2QM7 A;  4I7Z B;  1XL6 A;  1B06 A;  1FXK A;  5AG2 A;  2YXY A;  4PEL A;  1XDC A;  5EZY B;  5L3G A;  2GUZ B;  2WLI B;  2X0L A;  2CTQ A;  2X6B A;  3JAS A;  4QPJ A;  2F23 A;  1VAR A;  2LQT A;  3OW2 U;  1FAF A;  3QVN A;  1OCO B;  1S5H C;  3CCJ V;  3LDE A;  1AJP A;  4YIO A;  3OE7 G;  1R73 A;  1W0K G;  4X1K B;  4MW8 A;  4LF4 O;  1K73 W;  1SQF A;  4DR3 B;  1RP3 B;  2FTK A;  4JI7 O;  1FPO A;  4CH4 A;  1GTO A;  4LNU A;  1VQ4 V;  4FLY A;  4TV9 B;  2G38 A;  4FPP A;  4GYC B;  2UUB B;  2P90 A;  4PDL A;  2UUB O;  5LYJ A;  2EZO A;  5EBW C;  4Z1M G;  3JAT A;  5KUK A;  3ABT A;  4JF3 A;  3ZMZ A;  1FS0 G;  2A9H A;  1DLB A;  5BY1 A;  3S3X A;  3ZJZ A;  5LA6 A;  4TV8 B;  3ZMT A;  4B3M O;  1R3I C;  1V54 B;  3SJB C;  4MVZ A;  1SQG A;  2YXH A;  4Q6G A;  5JVD A;  2OCH A;  1P4R A;  4GX1 A;  4DR4 B;  2UXB O;  1JPX A;  2UXC O;  4X8A A;  4EKW A;  3UT5 B;  3BHP A;  4PA7 A;  1EM1 A;  2ZDI C;  2WA4 A;  5FPO A;  4LP8 A;  2DYR B;  2WSS G;  3SPJ A;  3SJC C;  4P9O A;  2GUZ A;  2GBO A;  3UM7 A;  2CAZ C;  1IBK O;  3OTO O;  1AR1 B;  3FX7 A;  3VQW A;  3D36 A;  1YHQ V;  1DTO A;  3SYP A;  5J2U B;  5KHH A;  1B6Q A;  1RM1 C;  1H2M A;  2EIJ B;  5J2T A;  2H3O A;  4DUY B;  2QA4 V;  3BA9 A;  4MVO A;  3JAK A;  5DN6 G;  2LP7 A;  3H9V A;  3D3I A;  4G2K A;  2QDO A;  1VQK V;  1HNW B;  1IUR A;  1M57 C;  3JAR B;  5EYP A;  2XAH A;  1Z5W A;  5LL6 Y;  2YS8 A;  1S76 D;  3VBB A;  3JCU Z;  1ARO P;  1CPY A;  2RN9 A;  3N27 A;  4MW3 A;  1QVF U;  2A3Q A;  1F51 A;  4EFB A;  2UXN A;  4UCT A;  2JIZ G;  3ETG A;  1YTF D;  1N32 O;  3HKE B;  1N34 O;  5F2V O;  2EZP A;  3K9A A;  4RQF A;  1QLE C;  4CBC A;  1MZE A;  1QR8 A;  3FB7 C;  1M57 B;  1LUV A;  4RUE A;  4QJF B;  1KP2 A;  2KKW A;  4R50 A;  3CS5 A;  1PNL A;  4C7U A;  2YIC A;  1AVM A;  1Q86 W;  5LP6 A;  1XNQ B;  2QR4 A;  2QKA A;  2RDC A;  4EB6 B;  4AQY B;  2P22 C;  4DR4 O;  2Q4P A;  4DO2 A;  2R9R B;  1HNW O;  2ADP A;  2D2C B;  1YJN V;  2HR3 A;  3G71 V;  3BY6 A;  3B4S A;  5CMU A;  4X1I A;  3CCM V;  1P7B A;  3IAY A;  3E8H A;  4X65 O;  1N33 B;  2IJH A;  2XT9 A;  3ZED A;  3CCE V;  3SR2 C;  3JAW A;  4YHH B;  4P30 A;  4L8J A;  3T2M A;  2LFR A;  3STZ C;  5IWA B;  1SER A;  3W7W A;  4IGG A;  1DK1 A;  1YEW A;  2IW5 A;  3ZRW B;  1SA0 A;  3G6B A;  3RWR D;  4ZOL A;  3I55 V;  5IY5 C;  3CPW U;  2Q67 A;  1Q5O A;  3IFX A;  3KCY A;  4PA4 A;  2F95 B;  2GTS A;  1G6U A;  4I4T A;  4B3R B;  3RYI A;  3ZIA G;  2BTO A;  4GX2 A;  3K59 A;  3T1H O;  4AHC A;  2KQX A;  4UVA A;  2DMX A;  4DV4 O;  4KXR A;  4X66 O;  3BAA A;  1QQC A;  1GM9 A;  3RGB A;  3HKE A;  5IE9 A;  5LMN O;  2QWQ B;  2WLI A;  2OYQ A;  3ZX6 A;  1EN6 A;  4K8Z A;  4CH6 A;  2H8P C;  1DGS A;  4F6R B;  2F66 C;  3AK1 A;  1L1F A;  5C8Y A;  3RFR A;  4PDM A;  1K4D C;  2PF4 E;  4FZ1 A;  1K97 A;  1X59 A;  1SF9 A;  2CTR A;  4JI1 B;  3ZMU A;  3CRC A;  2HKO A;  2F1M A;  4JYC A;  3AEI A;  3OUF A;  2LO1 A;  1NU1 H;  1O9G A;  3CCR V;  4NR1 A;  4BIZ A;  1VQ6 V;  5L3E A;  1S0V A;  3TGU H;  1M9N A;  1NJI W;  4XDL A;  2F4V O;  1NQT A;  1Q6U A;  2EIL B;  4WBN A;  2Z5U A;  2HG5 C;  4UCR A;  1FJG B;  3ZN0 A;  5LA6 B;  2YIB D;  1P49 A;  3ABM C;  3ABU A;  1L0N H;  4A5U B;  5JJJ B;  2YXL A;  4FLT A;  2WAM A;  4DRX A;  1G4Y B;  4LH7 A;  4B3T B;  4FM2 A;  1O9H A;  3T4D A;  2EIJ C;  1VF5 B;  5BMV A;  1N34 B;  2YEV A;  1KD1 W;  3Q4H A;  2KSD A;  3UO2 A;  4JAA A;  4R8C A;  2P06 A;  3TXQ A;  1N0J A;  5IYD O;  4B3R O;  5CBF A;  3RBZ A;  3EVK A;  2FL4 A;  4XDJ A;  5JCO A;  1M4U A;  1FFX B;  2JGD A;  1SQQ H;  2XND G;  2E76 B;  5B66 Z;  4I50 B;  2ZQM A;  1PD3 A;  2KG7 A;  2E3C A;  2ZR3 A;  3CCU V;  3CXC U;  2DE0 X;  2AW9 A;  1R3L C;  1NS1 A;  1Y67 A;  4DUZ O;  3SPI A;  4JGS A;  2Q6A A;  3L75 H;  2ZIO A;  5GON A;  1NVP B;  4JI2 O;  3CC7 V;  4DR1 O;  2ZIM A;  1OCC C;  3X2Q C;  4IYH A;  4TSF G;  2Y4U A;  4MT8 A;  5H9C A;  1GH6 A;  2OIE A;  4NTY A;  3VQX A;  5LHH A;  3JD2 A;  2FYU H;  2UXD O;  1XMO O;  1B3Q A;  3FD9 A;  2IJJ A;  1Y76 A;  3J7A U;  2GTA A;  3AG4 B;  4OX9 O;  3C3S A;  1XNR B;  3HKD B;  2AXT Z;  5B1B C;  2ZR2 A;  3CC4 V;  3ZMV A;  4DRX B;  1VQM V;  3FYI B;  3S3W A;  3B2E E;  5LXT A;  5IJ9 A;  1H2L A;  4EFE A;  1OJH A;  3WU2 Z;  4O4J A;  1XIL A;  1NI8 A;  4B7E A;  5FPR A;  2QEX V;  5LP6 B;  2F43 G;  1EZJ A;  2QWR B;  2CH7 B;  2Q68 A;  5B1A C;  2W6I G;  1VQP V;  1XHX A;  2PGG A;  1IDS A;  2CGN A;  3AG2 B;  2VWJ A;  1VQ7 V;  4LFB B;  1FFX A;  3PN1 A;  1WLE A;  3ZHV A;  3RN4 A;  4X1I B;  1MA1 A;  2R9I A;  3QO5 A;  2KG7 B;  5IYC O;  4K0K B;  4GZR B;  4UCU A;  5D5Q A;  4LF6 B;  3JAW B;  4BW9 A;  5D5P A;  3CRA A;  5H5N A;  2YC0 A;  3UO3 A;  3DXR A;  1FKA O;  5L3D A;  3L72 H;  1RFY A;  1RPR A;  1W59 A;  4PHZ A;  5GON B;  5JJE B;  1ZUQ A;  3K3W A;  1NR7 A;  4HAM A;  4TV9 A;  1ROP A;  4ZOL B;  2K9P A;  2QM4 A;  3WB0 A;  2HVK C;  5LYJ B;  4IL6 Z;  3RYH B;  1TAE A;  3JAT B;  4GKJ O;  4IIJ B;  1GMG A;  3B40 A;  3RYI B;  3ASO B;  1R6N A;  4UFZ A;  1Y76 B;  2ZDI A;  2XAS A;  1HWY A;  2WLK A;  4DV5 B;  4TUY A;  1ORQ C;  5CA1 A;  3W7U A;  3F7V C;  4ASU G;  1FFT B;  2W6J G;  5KMG A;  1RPO A;  3B77 A;  3BVO A;  5HFM A;  1VP7 A;  3DSQ A;  1KB9 F;  2PYL A;  1K5S A;  4JI0 O;  5LXT B;  4F6R A;  1QVG U;  2IU3 A;  2DN9 A;  4MTG A;  4NVP A;  4HYO A;  5CN0 A;  4B3M B;  5C8Y B;  1N8R W;  4GKK B;  3DC5 A;  4LF7 B;  2Q73 A;  1OCZ C;  5EBL C;  5K1P A;  3FAV A;  1E1Q G;  5IJ0 B;  1AB3 A;  5EC1 C;  4LFC O;  5A9G A;  4ZHQ B;  4WFE A;  3H1H H;  2GV9 A;  2Y4T A;  5LBQ A;  4JI3 O;  1IZ3 A;  1PL0 A;  4GKJ B;  5J2U A;  3K5O A;  2RCV A;  2BOC C;  1P7G A;  3UCS C;  3ZRV A;  1K34 A;  1SZT A;  4AI8 A;  1BGY H;  3A0R A;  4DW1 A;  1YDX A;  4JI2 B;  5K1X A;  3ABL C;  4B3T O;  2Y0I A;  4BIO A;  3K0G A;  2XUM A;  3CX5 F;  1Z2G A;  1NTK H;  2W0F C;  3JAK B;  3U10 A;  1KMI Z;  5FLX N;  4F6E A;  1OCR B;  2IH1 C;  2OWO A;  1FXV A;  3FKS G;  4MTO A;  4N23 A;  2A06 H;  3CYO A;  2EIK B;  3RYF B;  2LJ2 A;  2CUG A;  4CC5 A;  1Q90 D;  5TIS Z;  1VQO V;  4NYK A;  3ASN B;  5JCO C;  1AI7 A;  4LF7 O;  3Q4H B;  4QE9 A;  5KUM A;  2PZS A;  1MZF A;  1LR1 A;  4JZG A;  2DYR C;  2YI8 A;  1L8D A;  3TCU A;  2UXB B;  2R72 A;  4GUN A;  1HNX B;  3M8A A;  1U96 A;  5LMU O;  2E75 B;  4FVM A;  4R6Z A;  3BRC A;  1NT2 B;  1UJW B;  4DV1 O;  4I50 A;  5B3S B;  4X88 A;  4H33 A;  5GW7 A;  2ZKO A;  4FLU A;  2YIA A;  1Y74 B;  1HNZ O;  2XAQ A;  4J42 A;  5BR8 O;  1KC8 W;  1R6K A;  1AJQ A;  5CBH A;  2Q7G A;  5LGU A;  3AG1 B;  2A7W A;  3SDL A;  2LFS A;  2JVD A;  4K0K O;  4I9Q A;  1FD9 A;  4JAV A;  1PP9 H;  3OFN G;  4DUY O;  4MTF A;  3QO8 A;  4UVB A;  2M6Y A;  1Q82 W;  3OMI B;  3R66 A;  5B1A B;  4WFB V;  4DUZ B;  5JQG B;  2XAG A;  1HNX O;  1NTM H;  3CWB H;  3GWO A;  4PA6 A;  4GT1 A;  2F93 B;  3W7T A;  3F7Y C;  3MAQ A;  5BXZ A;  2WLH A;  2DWD C;  4I4T B;  1J5E O;  4IYI A;  4I0X A;  1OHH G;  2H94 A;  3WB1 A;  2IU0 A;  3BFR A;  1E79 G;  3BPZ A;  1S77 D;  5IT9 N;  4GX5 A;  2DYS C;  3NXS A;  1K33 A;  2CH7 A;  1VQ8 V;  1IXB A;  3H1J H;  1YJ9 V;  3IC9 A;  4OPH A;  2HJD A;  3IC7 A;  4AQY O;  1VQN V;  1WA8 B;  4XDK A;  4LFC B;  2PYJ A;  2LGQ A;  1GK9 A;  2CTP A;  1L0L H;  1TVK B;  2BSK A;  4W4L A;  1QNM A;  2VQE B;  4UUJ C;  3E86 A;  2GHY A;  2JGU A;  4JI6 B;  2IBZ H;  1SQV H;  2Q0O C;  4FZ0 A;  4J7K A;  1M5I A;  3K57 A;  1RSO B;  4JAS A;  4DYL A;  2YIB A;  3SPC A;  4YHH O;  3FYE B;  4DR1 B;  2ATK C;  5BR8 B;  4JI8 B;  1SQB H;  3LDD A;  2WLL B;  1JMK C;  2BOB C;  4IHJ B;  3SYO A;  2C2A A;  4ZKI A;  2YSU B;  2HP8 A;  5H6R A;  2QWN B;  1AIL A;  4FFB A;  2ZE8 A;  3OM3 B;  4FJC C;  3O9O A;  1NVP D;  3NR7 A;  3JD4 A;  4O4H B;  2YDE A;  3D3Q A;  3CD6 V;  2Q7E A;  1D2D A;  1YXB A;  3H1L H;  3VQV A;  4QGP A;  1K5Q A;  1W0J G;  1WN7 A;  5EZY A;  1JR9 A;  5E79 Z;  1UPG A;  2B1I A;  3LUT B;  4XBF A;  5KHI A;  4O2A A;  4GX0 A;  3AG4 C;  3WB2 A;  4WFF A;  2JGD B;  4IT5 A;  1OV9 A;  4J80 A;  3L70 H;  1DF5 A;  3ZHR A;  4DV0 O;  1AI5 A;  1BL8 A;  2LGW A;  4MVU A;  3CB2 A;  2DOS A;  1K92 A;  4NTW A;  4O4L A;  3DTU B;  2BSK B;  4NXM O;  4LF6 O;  3E2E A;  1J95 A;  3SJA C;  3G67 A;  2HLD G;  1K7D A;  1RSO A;  3B8N A;  2ZE5 A;  5KHG A;  4DV6 O;  3RYF A;  1AI4 A;  3K06 A;  2JK5 C;  1Y6X A;  3EHB B;  3WFV A;  5LMU B;  4WF9 V;  1AP5 A;  4IHJ A;  2EJR A;  5ITZ A;  1I7F A;  2JEX A;  5JJN B;  3H1K H;  5IWA O;  4YY3 B;  4TV8 A;  5EC2 C;  4LF9 O;  2QJ1 A;  4X20 B;  5LOV B;  4J10 A;  2Q8V A;  2EIN C; 
#chains in the Genus database with same CATH homology
 4TSF G;  4J9Y B;  3I56 V;  4MT8 A;  5H9C A;  4TT3 G;  4E2L A;  1OCR C;  5LHH A;  4G28 B;  1W2B U;  3JD2 A;  4BW5 A;  3ZRX A;  2HFE C;  5LHI A;  2Y48 A;  3GB7 C;  4DXW A;  1NH2 D;  2IJJ A;  1THZ A;  1F4N A;  1JX9 A;  4JTA B;  2B1G A;  4UV9 A;  3SYQ A;  1YIT V;  1H8H G;  3AG4 B;  5HFL A;  1MAB G;  3ASN C;  3B8M A;  2ZD9 A;  5B1B C;  3OAA G;  2UXX A;  1H8E G;  1JQ0 A;  2ZR2 A;  3SYC A;  3ZMV A;  1K8A W;  3CC4 V;  4KUM A;  1JCH A;  5B1B B;  1COW G;  1I5Y A;  1VQM V;  3E89 A;  1H38 A;  5J9P C;  3E35 A;  3FYI B;  1TUE B;  1QLN A;  2XAF A;  3ABL B;  5DM6 V;  1PNK A;  4KP4 A;  4I5S A;  3ZRW A;  1ENV A;  4PA9 A;  2QEX V;  4L87 A;  2F43 G;  1JVM A;  1EZJ A;  3E8G A;  4QE7 A;  3ETE A;  4R7C A;  2Q68 A;  2OCC C;  5B1A C;  2W6I G;  1VQP V;  4J9Z B;  3AG2 B;  1H2G A;  2EIK C;  2DW4 A;  5CBG A;  1VQ7 V;  3CCS V;  4KFM A;  2V7Q G;  5KA5 A;  3OUS A;  3SPG A;  1WLE A;  3CCQ V;  1R3K C;  2A79 B;  2V1D A;  4X89 A;  4MVR A;  3ZRS A;  3ABK C;  2QM7 A;  2R9I A;  2WWW A;  1XL6 A;  3QO5 A;  2PI4 A;  4QNH B;  1FXK A;  5IYC O;  3R65 A;  4PEL A;  3G6E V;  3JYC A;  2EBO A;  3EFF K;  5L3G A;  1NH2 B;  2WLI B;  2EIM C;  4QIW F;  2X0L A;  5L3D A;  2X6B A;  3JD3 A;  2GSM B;  1RPR A;  4QPJ A;  3H01 A;  3K3W A;  4WCE V;  3OW2 U;  1NR7 A;  1OCO B;  2Y69 C;  3RW0 A;  2AHY A;  4HAM A;  1S5H C;  3MD0 A;  3CCJ V;  1FXH A;  3LDE A;  1OZ0 A;  1ROP A;  2D3O W;  2OCC B;  2HVK C;  1AJP A;  1KKD A;  3OE7 G;  1R73 A;  1FXK B;  1LNQ A;  3OGC C;  3AG2 C;  5IYB O;  1W0K G;  4UVC A;  1GMG A;  3AG3 C;  3ABK B;  4MW8 A;  3ASO B;  1K73 W;  1R6N A;  2FTK A;  3ASO C;  3ETD A;  1M56 C;  1GTO A;  1VQ4 V;  3IGA C;  3LSQ A;  2ZDI A;  4FPP A;  3K08 A;  2XAS A;  4H37 A;  1VQ9 V;  1HWY A;  2WLK A;  2P90 A;  2P7T C;  4PDL A;  5BZB A;  3FB5 C;  5IDJ A;  1ORQ C;  3W7U A;  3FB6 C;  2EZO A;  2HVJ C;  3F7V C;  5EBW C;  4ASU G;  4Z1M G;  5KUK A;  3ABT A;  3ML0 A;  1I5X A;  4JF3 A;  3ZMZ A;  1FFT B;  2W6J G;  1FS0 G;  5IY5 B;  2OTJ V;  1RPO A;  3B77 A;  1NBM G;  5HFM A;  2A9H A;  1DLB A;  4FK5 C;  1KQS U;  3STL C;  1K5S A;  1QVG U;  2IU3 A;  3AG3 B;  4MTG A;  3ZJZ A;  4HYO A;  5CN0 A;  2CK3 G;  3ZN1 A;  3ZMT A;  2QM8 A;  4U7N A;  2AHZ A;  1V55 C;  1R3I C;  1GM8 A;  1N8R W;  2DWE C;  1V54 B;  1YI2 V;  3RVY A;  4MVZ A;  1OCZ C;  5EBL C;  1NKD A;  5EK0 A;  1E1Q G;  1P4R A;  2WLL A;  4GX1 A;  5EC1 C;  4WFE A;  1JPX A;  3SYA A;  4X8A A;  4EKW A;  2KB1 A;  5B3S C;  5LBQ A;  2ZXW C;  2WLN A;  4PA7 A;  1PL0 A;  2K1E A;  1KP3 A;  5EBM C;  1K4C C;  2BOC C;  1MSW D;  3ZRV A;  1M1K W;  1K34 A;  3KG2 A;  1SZT A;  2ZDI C;  4LP8 A;  3A0R A;  2DYR B;  2WSS G;  3SPJ A;  4P9O A;  3ZMS A;  5CA3 A;  3ABL C;  1CP9 A;  1BHB A;  1EBO A;  3UM7 A;  3K0G A;  4PDV A;  3PJS K;  1AR1 B;  1R3J C;  3M99 B;  2W0F C;  3JD1 A;  2X6A A;  3BEH A;  3D36 A;  1DTO A;  3SYP A;  2QE7 G;  1YHQ V;  1G8M A;  4RO2 A;  1B6Q A;  1OCR B;  2IH1 C;  1FXV A;  3FKS G;  1RM1 C;  4MTO A;  4N23 A;  3MHH C;  2EIJ B;  3CYO A;  2EIK B;  4YXW G;  4HZ3 A;  3K79 A;  3WG7 C;  3P32 A;  3OR7 C;  3F5W C;  3P30 A;  1VQO V;  2QA4 V;  4MVO A;  1BHA A;  3ASN B;  1AI7 A;  3QO7 A;  1Y66 A;  4QE9 A;  5DN6 G;  4FIP C;  5KUM A;  2Q69 A;  2LP7 A;  3DGE A;  3D3I A;  4G2K A;  5FL7 G;  2DYR C;  1VQK V;  3TCU A;  2OT5 A;  1M57 C;  1F23 A;  4U7O A;  2XAH A;  4P2Z A;  2JEU A;  2EIN B;  1WPX A;  2ITD C;  4R6Z A;  1VQ5 V;  1S76 D;  1OCO C;  2Y69 B;  3VBB A;  1ARO P;  1CPY A;  3ZCC A;  1UJW B;  4MW3 A;  1QVF U;  3FB8 C;  1F51 A;  2UXN A;  5B1O A;  2JIZ G;  5B3S B;  4X88 A;  1IXM A;  3G4S V;  4H33 A;  1Q81 W;  5GW7 A;  3ETG A;  1YTF D;  3CC2 V;  1AI6 A;  2IJK A;  4WFA V;  2XAQ A;  2EZP A;  1KC8 W;  3K9A A;  1R6K A;  4RQF A;  1QLE C;  4CBC A;  1AJQ A;  1QR8 A;  3FB7 C;  1M57 B;  4RUE A;  4QJF B;  1KP2 A;  5CBH A;  4MSW C;  5L3B A;  5H6Q A;  5LGU A;  3QNE A;  3AG1 B;  4R50 A;  2LFS A;  1E1R G;  1PNL A;  3AG1 C;  3CP1 A;  3K0D A;  4JAV A;  1K3E A;  3OFN G;  1Q86 W;  3LNM B;  1GO3 F;  1YIJ V;  4MTF A;  4TWK A;  3SPH A;  3QO8 A;  4UVB A;  1Q82 W;  3SJQ C;  3E8F A;  3OMI B;  5B1N A;  4DO2 A;  2Z3Y A;  1PKX A;  2R9R B;  2IH3 C;  5B1A B;  4BAY A;  4WFB V;  2PI5 A;  3E8B A;  1YJN V;  2HR3 A;  2YEV B;  1QBZ A;  3BY6 A;  3G71 V;  2ITC C;  5CMU A;  1Y4M A;  2XAG A;  3CCM V;  1P7B A;  3TK1 A;  3GWO A;  3E8H A;  3OMN B;  4GCZ A;  4PA6 A;  4GT1 A;  2IJH A;  3CCE V;  3W7T A;  3F7Y C;  3K03 A;  2WLH A;  2DWD C;  4P30 A;  3T2M A;  2LFR A;  3STZ C;  4P9P A;  1SER A;  3W7W A;  1KEC A;  1OHH G;  2H94 A;  5L3C A;  4JPR A;  2IW5 A;  2IU0 A;  3ZRW B;  1E79 G;  5C93 A;  1S77 D;  4LCU C;  4GX5 A;  3I55 V;  4PA3 A;  2DYS C;  3JD0 A;  4OXS A;  5IY5 C;  3CPW U;  2WLJ A;  4BIU A;  2Q67 A;  1K33 A;  3NXS A;  1VQ8 V;  2DYS B;  3IFX A;  4PA4 A;  1YJ9 V;  5LGT A;  1JJ2 U;  3ZIA G;  1MG1 A;  1QLE B;  4UV8 A;  4GX2 A;  3IC7 A;  1GM7 A;  3CCL V;  1EFR G;  4UVA A;  1VQN V;  1OCZ B;  2JDI G;  1M56 B;  4XDK A;  4PDR A;  4ZBM A;  1K9M W;  1GM9 A;  4MVM A;  1GK9 A;  3HB3 B;  3K04 A;  5LHG A;  1ZWI C;  4WFH A;  2DQ0 A;  2WLI A;  4UUJ C;  3E86 A;  2GHY A;  2IJI A;  3CMA V;  2HJF C;  1BMF G;  4RAI A;  2H8P C;  3OMA B;  3LSS A;  1MOF A;  2DQ3 A;  1XL4 A;  2B5U A;  2WPD G;  2EIL C;  2QKS A;  4JAS A;  1YJW V;  1FXK C;  1L1F A;  3SPC A;  4WFG A;  1JOY A;  1DF4 A;  1S72 V;  3FYE B;  4PDM A;  1K4D C;  1SRY A;  2ATK C;  3VOU A;  1V55 B;  1M90 W;  2P6J A;  4JTD B;  3LDD A;  2WLL B;  1K97 A;  2BOB C;  3SYO A;  4ZKI A;  2C2A A;  5LGN A;  4RUF A;  2YSU B;  5H6R A;  3ZMU A;  2HKO A;  4JYC A;  3AEI A;  3OUF A;  4LBE C;  1RM1 B;  2XOK G;  4FMT A;  2MK3 A;  3CCR V;  1SET A;  1NR1 A;  2ZXW B;  4QPK A;  4BIZ A;  1VQ6 V;  3OM3 B;  4FJC C;  5L3E A;  1S0V A;  1NVP D;  1M9N A;  1NJI W;  2JJ1 G;  3JD4 A;  4XDL A;  4UXN A;  1CEZ A;  1YTF B;  2X6C A;  1NQT A;  2EIL B;  1S3J A;  2HG5 C;  2A0L A;  2Z5U A;  3JCZ A;  1YSC A;  3ZN0 A;  3CD6 V;  3E83 A;  1V54 C;  3ABM C;  4MVS A;  3ABU A;  3W7S A;  2P67 A;  3ABM B;  4Q20 A;  1F4M A;  4JTC B;  4JAU A;  5L3F A;  2WAM A;  2XAJ A;  1G4Y B;  1PNM A;  4RQE A;  1K5Q A;  1W0J G;  1Q7Y W;  4I9W A;  2B1I A;  5KA6 A;  3T4D A;  2EIJ C;  3LUT B;  4XBF A;  2OTL V;  4GX0 A;  3AG4 C;  3WG7 B;  4WFF A;  2YEV A;  1KD1 W;  1DF5 A;  3TET A;  3OEH G;  2QTO A;  4JYB A;  4R8C A;  1BL8 A;  1AI5 A;  4F4L A;  4MVU A;  4LC1 A;  5E1A C;  5IYD O;  1K92 A;  5CBF A;  3RBZ A;  3DTU B;  3W7X A;  4N21 A;  1OCC B;  3X2Q B;  3E2E A;  3T4Z A;  1J95 A;  2NNU A;  4XDJ A;  4G27 B;  1QCE A;  2JJ2 G;  2XND G;  2HLD G;  3CME V;  3RVZ A;  1K7D A;  3B8N A;  2ZQM A;  1SES A;  2M7W A;  3OEE G;  1PD3 A;  3HPL C;  3UKM A;  2ZR3 A;  3CCU V;  3LDC A;  3CXC U;  4MS2 A;  3T1C A;  1R3L C;  1AI4 A;  3OR6 C;  3K06 A;  3SPI A;  1AJN A;  4JGS A;  2JK5 C;  3EHB B;  3WFV A;  1VQL V;  4WF9 V;  2Q6A A;  1GKF A;  2EJR A;  3MHS C;  2JEX A;  4CZZ A;  2NLJ C;  2WLM A;  1QR9 A;  1NVP B;  2X7R B;  5EC2 C;  3CCV V;  3CC7 V;  1OCC C;  3X2Q C;  4MTX A;  4MVQ A;  2EIM B;  2EIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...