3CC4P

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc4P02
3CCVP 1M90Q 1Q7YQ 1Q82Q 3CCRP 2QA4P 1KQSO 1VQ8P 3CC2P 1VQNP 1K9MQ 1K8AQ 1VQ4P 3CCMP 3CC4P 3CD6P 1W2BO 1VQ9P 3OW2O 3CCSP 1YIJP 1Q81Q 1N8RQ 3G4SP 1YI2P 3CC7P 1S72P 2OTLP 1VQMP 1KC8Q 1VQKP 3G6EP 3CPWO 1NJIQ 1YJWP 3CMAP 3I56P 2OTJP 1VQPP 1VQOP 3CCQP 3CXCO 3G71P 1VQ7P 1VQ6P 3CCUP 1YJNP 1QVFO 3CCJP 1YHQP 1K73Q 1YJ9P 3CCLP 1VQLP 1QVGO 1Q86Q 1JJ2O 1VQ5P 1M1KQ 3CMEP 1YITP 3I55P 3CCEP 1KD1Q 2QEXP
chains in the Genus database with same CATH superfamily
2QRXA 2CPBA 1SVFA 5KKZC 3RK3B 3VOPA 3TK1A 1LTSC 1SQXE 5APTA 2HYNA 3GHGC 1G2CB 3A7OA 3SWFA 3L73G 2IYPA 1IMPA 2KGEA 2LXCB 3BRTB 2E74B 1E79H 1NTKG 2KS1A 5AVTB 1IFIA 1SQBK 1KMIZ 2XU6A 4EIJA 3G0VA 3P8CE 3AE9C 5AVWB 1LP1A 2N1TB 5AW9B 5B5EH 1AV1A 3RK3D 1K30A 3C1LA 4D6TE 4JBZA 1QVGO 2KWLA 1N73B 1DV5A 3M0AA 3CI9A 2HLOA 4R0MA 1FBMA 1MV8A 1YIJP 1D1DA 3VMZA 1A02F 2JYGA 2K92A 3GG2A 1W2EA 3NFQA 2V7QJ 3WUVA 1IFMA 1RQVA 3HD7C 1S5LE 1KYOH 4RESB 1N73A 3DS1A 1SQBJ 2G3AA 1NOHA 3AEBC 3CC2P 1PPJE 1N8RQ 2P7JA 2E5TA 3L71J 4WY4D 2M8LA 1LP1B 2YXRB 1FZCA 1HTLC 3L74E 4PD4I 3L35A 2I1JA 2R3SA 3MHVA 1YQ4C 1KQLA 3V2NA 2WPQA 4H13D 2KG8A 3KXDA 3I55P 2NPSC 5EFWB 1PP9E 1PEUA 3U59A 2VLNA 1OX3A 1AJYA 1ZN5A 2MR8A 1QL1A 5DJTB 3HUSA 1DD4A 5CCGC 3GLMA 1GK6A 2FYUG 2M3EA 3O6QB 4YXDC 4XFXA 2WQYC 3G6EP 1YTZT 1KYOD 2KZIA 3S1KA 1KTMA 1VQ7P 1G1IA 3S4RA 1PL5A 1KD1Q 3OAKA 2ZXEB 3MZWB 2XV6A 1Q7YQ 3M0DA 3NMDA 3H1HD 3VP9A 2AXTH 3RK2C 4XROA 2Y9YA 1J2JB 1DEBA 4IPYA 1YJWP 1CI6A 3EJDA 4BPFA 1EC5A 1AUMA 1Q90D 1M7LA 2WT7B 4IL6X 1LNQA 4GIFA 2CPSA 2WPSA 2XKMA 5KJ7C 5F2KA 4LGDE 2Z45A 3AEAC 4PJ0E 1M1JB 3KZIH 1KC8Q 2W83C 3AE8C 1NJIQ 2QJYC 1NTZK 4H2XC 4QMAA 4UB8H 1NAYA 5HGMA 2PP6A 2OYHA 4N78D 3PH0A 1ZMBA 4PJ0H 1AF8A 3G26A 4BRYA 4H2YC 4H0LD 1Q82Q 4OWFA 2JDIH 2W6JH 3EWKA 2VLPA 3MUDC 5KLVE 3A3YB 1ZV8A 1VDFA 2KORA 1JM0A 3G3ZA 1KQFB 2OYHB 1X9VA 3DS4A 3H47A 3CCEP 2YIUB 1ZOYC 3A0BH 5KLVJ 1L4AC 2AF8A 2R3CA 2Y9ZA 1VQ8P 2Y0CA 3VMXA 2P1JA 2D2CB 2QG4A 3L70G 2GUVA 3G29A 1SFCA 1XTGB 3H1HJ 1T3UA 3KQGA 4XFJA 1SQVG 2WPVB 1WRGA 2P9XA 1VF5D 2FQ1A 2E76B 2XNXA 5CJ4A 4LC1A 2I8DA 1KFNA 1EOQA 1PPJD 2ZYAA 3PJSK 1TU3F 1LT9C 3L71E 4PD4H 2GM4A 1FDIA 4C7RA 1RF0A 1LTJB 2MVUA 3MTUE 1JY3O 1KB9I 2FVEA 2LPKA 1AQ5A 2FQ2A 2MVVA 1QVFO 2IBZG 3HUSC 1RO0A 3AE6C 2FACA 1GL2C 1BGYD 1MZ9A 1PIXA 4ASWA 3FWNA 5TJHA 5E79E 3H1KG 4IZ6A 2M3BA 1UNKA 2K9YA 3ITKA 2CG5B 2PEOA 3H32B 2GDYA 1L4AA 5CCGD 1H89A 1T8ZA 5AVVB 5JPAA 3TGUD 2RKLA 5KLVD 3P7KA 3AE7C 2IBZD 1K8AQ 2B87A 5AW2B 4Z1MH 1LTIC 1CI6B 4HKZH 1AYIA 2V7QH 4ZMDA 1BCCD 3LIEA 3T97B 5CHXA 1X3OA 2LMLA 1KB9D 4GDOA 1BSNA 1DD3A 2HODA 2HFED 2R5DA 1N73C 2H43A 2FXPA 1QEXA 3HE5B 1HJ0A 1EQ7A 1KN7A 3L4FA 1EZVG 1EZVD 1PZQA 2HPCB 1EXJA 1PEOA 1OVUA 1NTZD 1SP4A 4U0BA 3T97A 1M1KQ 1IK9A 4YXWH 3CWBE 3L72E 5AW4B 2JWAA 3DPHA 4JPZB 1JMMA 1NU1J 2DGYA 5CMZA 4QKOA 1SQBG 1SQBD 3VMYA 3EQ2A 1R5LA 2IBZI 1OW6A 4GKGA 3VRLC 1K73Q 1E0HA 2OYIA 1BGYJ 1YBKA 2CK3H 1QGKB 1KLPA 1IC2A 3E7KA 3L72D 3L72G 5M1BA 1KFMA 2O01H 1GU5A 1PGQA 3SFEC 1IJDB 3H1HE 1RF0C 1HGZA 1LTJA 1NU1D 2OYOA 3VN0A 1EZVI 3PHLA 4H0LB 1GPJA 2FVAA 2KNCB 4AUWA 5B66H 2M5AA 5GTHH 1ZMEC 3RK2B 2PEKA 1OWAA 1KB9E 3C8VA 2KYVA 3IAOA 3JCUE 1KYOI 2ZT9D 2PENA 2M8NA 3HZQA 4TLFA 1CEIA 1OW7A 1WT6A 2XDJA 1A8OA 2KW2A 2FHSC 1JY3P 4Y28J 2HR3A 1J1DB 1FOSF 3B71A 1VL2A 2OYIB 2FYNC 3BVHA 1URQD 4WBAA 4XFYA 2QJYB 3H1KE 2PY8A 1SFCB 3BCCG 2JP3A 1LGHB 4H44D 4WY4A 4OVNF 3GKLC 1MFTA 1SFCD 3E1RA 1N7SA 2WPTA 2BASA 2O01N 3H0DA 1S72P 2YO3A 1PGJA 1EIAA 1JOCA 5F2OA 2P10A 4BRYB 2NRGA 3VTPC 3A5TA 1FOSE 1S9KE 3JSVC 3ABVC 3SSUA 4AYCA 3L71G 1IFJA 2J58A 3GHGA 1U7MA 3BATA 5B66E 4IFMA 3P8MC 5KLIC 3O8ZA 3QH9A 1FU1A 2D2CC 2JEEA 3M9BA 5HVCA 5AW5B 4XA4A 3H1IG 4M0IA 1RF1C 3I5CA 3MGEA 2FBWC 3BCCE 5KP8B 2LOLA 3CCRP 2FYZA 2ZT9B 7CEIA 5CJ0A 2FAEA 2QJPC 3TYYA 4GR6A 1S5LX 4PD4E 2OTJP 2D2CD 1N7LA 3G9RA 5K5GB 3CXCO 3AEGC 2DNWA 1MKMA 4COPA 1BGYG 1NU1E 3W67A 2K37A 3CXHE 2RMZA 3CD6P 2LL8A 3D70A 1SQVD 1KZUB 2K3RA 3GF7A 2PFXA 4IFDK 2BCCG 1D7MA 2EHSA 3PP5A 1NTKD 4D6TJ 2QA4P 1PV3A 1ZRTD 2Q6QA 4C7NB 3B5IA 2P67A 4XFZA 1URQC 2JKVA 1UJZA 3HE4B 3Q5RA 1A43A 2K0XA 1SQQG 5AVZB 2LF4A 1AQTA 2KOGA 3M91A 2GZGA 4TT3H 2RN0A 2OARA 4ZKUA 2RH0A 1GD2E 5GTIH 2FADA 3RBXA 3H1LD 4EDFA 1SQBE 2GZJA 4AQRD 2N5IA 1DNYA 4JYCA 1UIIA 1VQOP 1VQ6P 2IFMA 1GMJA 4RKUJ 4UB6H 3B4QA 4WVZA 2N1TD 5APYA 3H6PA 2PRRA 1IUQA 2N9BA 1S2EA 4U3FD 1KQGB 2W8ZA 2ZVOB 3GZLA 2XZ1C 1NKZB 1BE3G 1KILC 4DZOA 1K04A 4MRTC 1T6AA 2KOPA 5HV8A 1W5CE 1T8KA 1SQVK 2ZVNB 2BUOA 1PP9G 2KUBA 1ZNVA 2E75D 4U7JA 2EHTA 2YXQB 1M1JA 2KGDA 2BEZF 2XXMA 2IFNA 2LXBA 2QM7A 4I6MC 4WWIA 2BCCE 1JTHB 1KORA 3PTZA 4U3FG 1X22A 1IFDA 3BRVB 2IX7C 1JCDA 3CX5D 5CBOA 2KG9A 1N2DC 1VQ9P 2Q1KA 2EFJA 2GYKA 4B86A 1BCCE 3V2RA 1T3JA 2KGCA 2E74C 3BCCJ 2JWDA 1SQXJ 1YJ9P 1NVOA 1SS1A 1EDIA 4PH0A 4N6JA 4I2LC 3BASA 4H0LC 1NKNA 3B5NB 2N1TC 3H1ID 1NU1K 1ZXGA 2WTYA 3HTKB 1M6EX 4KT0J 2E1MA 5AW6B 4GOFA 1SQPD 4A7PA 4YPCA 5EW5E 3JC22 3PLNA 1H0TA 3AEFC 2GZIA 1YITP 5KJ7D 1SQVJ 2M8RA 1YQ3C 1NHLA 1LT1A 3AEEC 3AE4C 3HYBA 1HGVA 3G4SP 2ERHA 3L70J 1NO4A 1S5LH 1PEMA 3Q5SA 3L73E 1FJPA 5KLVK 1RQUA 2M0BA 2G8YA 4PXHB 2N1TA 2PGDA 3RL0g 2M5RA 1GL2D 3N4XA 2BEQD 1EDJA 3L70E 1QRJA 5AW1B 2OTLP 3L73J 5CBNA 3V6IA 1HVVA 3F89A 2XZ0D 1IFNA 1SQXK 1L0NE 2OTKE 2XNDH 3F5HA 2YKQA 3GW6A 5B5EE 3LIDA 5H2FE 3NXSA 1R8EA 1JY3N 2K2QA 4ZNCA 1FZBA 2IPPA 4H13C 3ZDMA 1NTMG 3R4YA 4K3AA 1GTWA 1BE3J 4I7ZC 5AVRB 1NH4A 5TISH 2K1AA 1E5WA 2JBGA 1NGMB 3HD7D 2L5GB 4IFFA 1GDTA 1S1CX 1BE3E 1NYHA 2J59M 3A0HH 2QJPB 3CCQP 3B5NA 1VHNA 1NWQA 5CZDB 3VMAA 4U0AA 3H1JD 4PV1C 2FKWB 3FXEA 1JB0J 4N78E 3LRYA 4DG9A 2WZ7A 3H1LJ 1F80D 4WB4A 1BSHA 1NAFA 1L0NG 4OGQB 5APVA 1SQQJ 1OVVA 2JR8A 2ROQA 1ZRTE 4OH8B 5KAFE 1P84H 3DS0A 3G28A 2DW3A 2Y0DA 3H1LE 4O9BA 5APWA 1MFZA 3IF4A 2PEIA 3H1JG 2FYUE 3RG2A 1G2CA 2OYHC 1EDKA 3L75G 3H1JJ 5BVZA 4JF7A 2KSJA 1SQQK 3L36A 1L4AB 1H0TB 3CCJP 1YHQP 3G1GA 2WSEH 1JJ2O 3SWYA 2IYOA 2LR2A 3LMOA 4NPFX 4DJGA 3M9HA 2L9FA 4Y99C 5APQA 3CWBJ 1RNIA 2KOQA 1AA0A 1FAVA 3L72J 4U0EA 2AFEA 3HE5A 2GZFA 1OZHA 1L2PA 1RHZB 4K35A 1SQVE 1HWTC 2K93A 3K5BA 3V5BA 1BGYE 2LTEA 1U7JA 1LWUA 4DCKA 1FC2C 2YKOA 1HY8A 4UHPB 1LT9B 1CW5A 1VPCA 3GZMA 1KILB 2UWJE 2N9YB 1DX7A 2ZAEB 4HKGA 2WSEJ 1X8YA 2GA1A 5EJDA 3L73D 1FZFA 4C46A 2KR5A 5BS2A 4YTPC 2NPSD 3FGAD 5KP7B 3D6YA 3H1IE 2KS1B 2WSCJ 3WUTA 2E42A 4H44B 1KB9H 3L74D 2KG6A 3B5ND 4WY4C 5APSA 2A45H 3V4QA 1IZNB 2YMYA 2ZFCA 1J1EB 1VQNP 2MJZA 1L4AD 1HJBA 2E43A 4ZKPA 2M5AB 2B89A 3A2AA 3EFFK 5AVUB 2WWWA 1QX8A 2GZEA 2ITAA 2KZJA 4XRQA 2KI7B 1VQLP 2BCCD 2IZ0A 3EJEA 2KODA 3HE4A 4PH1A 2W6AA 4ASVA 2Z5IA 2A45I 1VKUA 1R5SA 3CX5I 1X0TA 3B5NC 2CWOA 3CC7P 1Y9BA 1VQMP 3CPWO 5KKZB 3RK3C 1KILA 4IOIH 3NTEA 4WYMA 5APXA 2N50A 1NTKK 2XV5A 3D71A 2K0DX 3II6A 4BXLA 2SPZA 3KDPB 4BWNA 1HQBA 1SQQE 3SWKA 1ACPA 5KAFH 1GW4A 4IL6E 2JO1A 2O3JA 1VQPP 1S9KD 3Q5PA 3N7NA 2C0XA 3CX5H 5KTBA 3CXHH 3OJAB 2A06G 3MIWA 2FFDB 1FDOA 2R32A 4DT0A 1GL2A 2FYUJ 2JU1A 1FS0E 1OR5A 1L0HA 2W6BA 4JQ0D 2HODB 5KAIE 1OIPA 1KYOE 1OMIA 3IN6A 4PWVB 1H8AA 3HD7A 1RE4C 1ZR2A 4U3FJ 1OFCX 1L0LG 3HD7B 4NPDA 1NQ4A 3L74J 2Z44A 1NU1G 3CCMP 2FYUD 3CXHI 5TISE 2WVRA 3E1IA 1YTZI 2O1KA 5CCHD 3USSA 4H13B 1P84E 2QE7H 3CMEP 2NZ2A 2QVAA 4D6TG 2P2UA 4H2WC 4F37A 1RY3A 2VLOA 1L0LK 1VF5C 2QNWA 4I7ZB 2JJLA 1MZ8A 2NPSB 3DTJA 3Q1MA 1BDDA 1CZQA 5KJ7A 1EZVE 1DH3A 3WU2E 3FX0A 2BHVA 2FY8A 2W90A 3RL0D 2L6EA 3TGUG 3CCVP 5AVQB 2J5UA 1KV4A 2FVFA 1J1DC 3H32A 2X2BA 1ZR4A 2AFDA 1QLED 3GF3A 4D6TD 2KIKA 3CWBD 3CXHD 3TSIA 3AE5C 2EIAA 1L0ND 1JNMA 2JB0A 2E75C 1HBWA 1M90Q 3L74G 2B9BA 2N98A 5BU5A 1RF1A 2JYLA 1H88A 4U0CA 3V2PA 3M0DC 2PEJA 2MR7A 4DOJA 1EDLA 2ZYGA 1RE3C 2BQ1E 1IK7A 3G1IA 2FXMA 3W68A 2AEFA 1KQSO 5DJUB 3DS2A 2AEJA 2IBZE 5CCGA 2ZYDA 1RF1B 1JUNA 4I1LA 4M3LA 2WITA 2NPSA 2KGAA 2Q3EA 2K9JB 2K94A 2KK7A 4OGQD 3RK2D 2KOOA 2BCCJ 2KP8A 5AW7B 3L71D 2YIUC 3IFMA 1BAJA 2N6ZA 3TF5A 2MD9A 2WSCH 5APUA 1RO2A 1PGPA 3H1HG 1P84I 1JTHA 3CCLP 1NTZG 1NTMK 2LKMA 4W80A 2WT7A 1JY2O 1ZW0A 1N7SD 2A06E 3B8EB 3I56P 2E74D 1JY2P 2YNYA 3WBHA 2H88C 2E76C 1X79B 2GDXA 1E6JP 2AXCA 2V4HA 1GU4A 1ZP0C 1HF9A 4PV1D 2Q9IA 4UB8E 2Z5HA 3CWBG 3P32A 2Q7CA 1RE3A 1J1EC 1BDCA 3MGNA 1IMQA 1FR2A 3CLQA 2R44A 1GXGA 3CX5E 2MY5A 4R4LA 2PNGA 4IL6H 3IR9A 4HB1A 5AW0B 1AVYA 3LW5J 2KB7P 1P84D 5BU8B 2E5YA 1GK4A 3CC4P 2H7HA 3HUSB 3OW2O 4L74A 5KAIH 1AFOA 5AVSB 4RJTA 1AVOA 1SQPE 4LLHA 1KILD 4GOEA 1JMBA 5HGOA 2N5HA 2POHA 5HGLA 3C9IA 3RL0B 1JO5A 2K0YA 1L0NJ 1LTAC 1PGOA 2ZJSE 2E76D 2QJKB 4GR2A 2M8PA 3PRJA 3U1AA 1N7SB 4COCA 1XTCC 5C39A 1EXIA 1S4XA 2JU2A 2FFDC 3HTKA 3Q20A 2C9NY 5KP6B 3WUUA 2K88A 2YMKA 1T2KC 1OXZA 5GTIE 3H4EA 2L91A 5BS1A 3CMAP 3U1CA 2B88A 1Q2NA 2KOSA 1PEQA 2FQ0A 3EJBA 1GZLA 3WU2H 2K9JA 3CE7A 1FZAA 2FYUK 3V4WA 3M9QA 5F2NA 3G21A 1K05A 1U57A 1PP9D 1FDMA 2O01J 1SLQA 1VQKP 5CCHA 1L0IA 4CPGA 1LWUB 3TDKA 1FZCC 1BCCJ 2JGPA 3L70D 3GJNA 2K5XA 2ONTA 2GUSA 3FXDA 3GHGB 3RG6C 1VF5B 3MP7B 3A0BE 3L37A 1UIXA 2C9LY 3V2QA 2CQ8A 4U0DA 2Q3IA 2PEQA 3L75E 1YJNP 3NTNA 1Z56A 3P05A 3Q2YA 2KSEA 1IO4A 2Z4EA 3U43A 3RBZA 1FJKA 2Q5UA 3H1LG 2N6YA 2QSIA 2A06D 5GTHE 3CL3D 4EYYQ 1M8OB 4HYTB 2FFDA 4L73A 1Y8AA 4W7YA 3BCCD 2KNCA 1BXIA 3S9OA 5KLVG 2E75B 3TNUA 4GODA 2EG5A 3O6QA 1SQPK 5E79H 2IDBA 2B87B 2MKVA 4HJGH 4L76A 3CCSP 1M57D 4PD4D 3D6ZA 3H1KJ 4JYBA 3E2DA 4UB6E 2AVAA 3G71P 1FZEA 2O1JA 4CA3A 1SQXG 2WSFH 3VYIA 1NTMJ 2C0WA 2OYIC 2FYNB 2L0QA 1L0NK 4NEOA 1SFCC 2KXPB 2KLUA 1SQPG 1SQPJ 1K9MQ 2LIUA 1HH0A 2VSQA 1GW3A 1NTME 1RH5B 2QIWA 3EFGA 3GMAA 3UIAA 4GT1A 3B4SA 2WSSH 5L8RJ 3AE2C 2OGUA 1FZGA 4QNBA 3H25A 3MD0A 2CNRA 4MN4C 1LJ2A 1Z6MA 1RE4A 2I1KA 1ZLLA 2CGQA 3A0HE 2NO8A 2XZRA 5HGNA 3VP8A 4PV1B 1YYCA 2WSFJ 5KLIB 3KZIE 2VRSA 2WMMA 4C7NA 2L4BA 1Y47A 3H1KD 4KHXA 4OGQC 4L75A 3HRNA 1VQ4P 2YKPA 3OA7A 2ZT9C 1IFPA 1M56D 3AE3C 1A02J 4XE5B 3DS3A 5I4TG 1VQ5P 4NPEA 2HPCA 1PPJG 1G1JA 3L75D 3NY7B 1LTBC 1N86A 1BE3D 1M1JC 1GXHA 2HG5D 2PEMA 2QM8A 2WPRA 1L0LD 1KILE 5AW3B 4HH2A 2AEMA 1MUUA 4Y99B 3H1JE 2Z46A 4U0FA 2AXTE 1L0LJ 1LTTC 3QWOC 1CSBA 2W27A 1LT9A 2ZXXA 3FWLA 3RGUA 2KLVA 2LIWA 1YI2P 3TNUB 2Y0EA 3L75J 3AEDC 2R5BA 3DS5A 1L0LE 1M74A 2GDWA 1BCCG 2LKIA 1HUCA 1FE6A 1URQB 3LW5H 1NTZE 4EOTA 5AVXB 3M1MA 1S3JA 1NTKE 1SQQD 1PP9J 3RL0C 1W2BO 4BPHA 1LTGC 4U3FE 3M06A 1DIPA 1JEKA 4KJMA 2L22A 1QL2A 2VLQA 3AECC 4EI2A 1NTZJ 2QJKC 2JO0A 1JY2N 3CCUP 2OQQA 2FXOA 1PFIA 1Q86Q 3KYQA 3WMM0 1USDA 1M6NA 1NTKJ 1N7SC 2QEXP 3TGUJ 4W7ZA 2XT1A 3JCUH 1OW8A 3KHUA 2YO2A 5H2FH 3P8CD 4H44C 4BPGA 1Q81Q 5DCKA 4WY4B 2P58A 1USEA 5CCHC 2JAZA 1JCCA 5AW8B 3TGUE 4RO0A 3AE1C 1URQA 3H1IJ 2H89C 4R4MA 1OVRA 2H8PD 3R2PA 3MUDA 1WMKA 5AVYB 1LTJC 2A45G 3SFDC 4N3YB 3RK3E 1SQXD 2MF4A 3Q3DA 2IZ1A 2JQ4A 1NTMD 2PAJA 3KPEA 1DEEG 1T2KD 1LWUC 1GL2B 1EMVA 1FZCB
chains in the Genus database with same CATH topology
4U0AA 1M90Q 5JPAA 3CCRP 5F2NA 1VQ8P 3LRYA 5BS2A 1K9MQ 1K8AQ 3G21A 3HYBA 2JYLA 1IUQA 3G4SP 2PEKA 1YI2P 4XFXA 4U0CA 4GR6A 1VQKP 3G6EP 2OTJP 3G29A 2PEJA 1PEMA 1VQ7P 3CXCO 3DS5A 2PENA 1M74A 2M8NA 3HZQA 2BQ1E 3G1IA 3DS0A 3G28A 4COPA 1KD1Q 2XV6A 3M1MA 1A8OA 2P9XA 1Q7YQ 2ONTA 1VQNP 1KQSO 2BUOA 4XROA 2Z44A 2PEIA 3DS2A 4QNBA 3CCMP 3RG6C 3CC4P 1W2BO 3CD6P 3OW2O 1QRJA 3G0VA 2OTLP 2XXMA 4IPYA 1YJWP 4U0DA 5HGNA 2PEQA 2JO0A 4XRQA 1PEOA 1K30A 3CCUP 1AUMA 4XFYA 1YJNP 5HGOA 1EOQA 3CCJP 2PY8A 1YHQP 4U0BA 3G1GA 1Q86Q 1VQLP 3CMEP 1M1KQ 1M6NA 5HGLA 3P05A 2QEXP 1QVGO 1JJ2O 2XT1A 2KODA 3DPHA 2QA4P 4PH1A 5F2KA 1BAJA 1VQ4P 2DGYA 1VQ9P 1YIJP 1D1DA 2EFJA 2Z45A 1Q81Q 3H0DA 1RNIA 2JYGA 3B5IA 5DCKA 2CWOA 4U0EA 3CC7P 1S72P 3DTJA 1VQMP 4GR2A 4XFZA 1KC8Q 3CPWO 2M8PA 3VRLC 1NJIQ 1EIAA 1RO2A 3NTEA 5HGMA 4WYMA 4COCA 1QVFO 1A43A 3DS3A 5F2OA 5I4TG 1K73Q 1YJ9P 3CCLP 2LF4A 1VQ5P 2BHVA 1ZMBA 2OARA 2L6EA 3G26A 1RO0A 4PH0A 3CCVP 3DS1A 1Q82Q 2EG5A 3Q20A 3CC2P 3CCSP 1N8RQ 2PEMA 1M6EX 2M8LA 2E1MA 3H4EA 5BS1A 3CMAP 3I56P 3E2DA 1VQPP 2EIAA 2PEOA 1VQOP 3CCQP 1VQ6P 3G71P 3WBHA 1PEQA 4M0IA 3MGEA 3H47A 1E6JP 2Z46A 3DS4A 4U0FA 3I55P 1YITP 3CCEP 1PEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV P;  1M90 Q;  1Q7Y Q;  1Q82 Q;  3CCR P;  2QA4 P;  1KQS O;  1VQ8 P;  3CC2 P;  1VQN P;  1K9M Q;  1K8A Q;  1VQ4 P;  3CCM P;  3CC4 P;  3CD6 P;  1W2B O;  1VQ9 P;  3OW2 O;  3CCS P;  1YIJ P;  1Q81 Q;  1N8R Q;  3G4S P;  1YI2 P;  3CC7 P;  1S72 P;  2OTL P;  1VQM P;  1KC8 Q;  1VQK P;  3G6E P;  3CPW O;  1NJI Q;  1YJW P;  3CMA P;  3I56 P;  2OTJ P;  1VQP P;  1VQO P;  3CCQ P;  3CXC O;  3G71 P;  1VQ7 P;  1VQ6 P;  3CCU P;  1YJN P;  1QVF O;  3CCJ P;  1YHQ P;  1K73 Q;  1YJ9 P;  3CCL P;  1VQL P;  1QVG O;  1Q86 Q;  1JJ2 O;  1VQ5 P;  1M1K Q;  3CME P;  1YIT P;  3I55 P;  3CCE P;  1KD1 Q;  2QEX P; 
#chains in the Genus database with same CATH topology
 2QRX A;  2CPB A;  1SVF A;  5KKZ C;  3RK3 B;  3VOP A;  3TK1 A;  1LTS C;  1SQX E;  5APT A;  2HYN A;  3GHG C;  1G2C B;  3A7O A;  3SWF A;  3L73 G;  2IYP A;  1IMP A;  2KGE A;  2LXC B;  3BRT B;  2E74 B;  1E79 H;  1NTK G;  2KS1 A;  5AVT B;  1IFI A;  1SQB K;  1KMI Z;  2XU6 A;  4EIJ A;  3G0V A;  3P8C E;  3AE9 C;  5AVW B;  1LP1 A;  2N1T B;  5AW9 B;  5B5E H;  1AV1 A;  3RK3 D;  1K30 A;  3C1L A;  4D6T E;  4JBZ A;  1QVG O;  2KWL A;  1N73 B;  1DV5 A;  3M0A A;  3CI9 A;  2HLO A;  4R0M A;  1FBM A;  1MV8 A;  1YIJ P;  1D1D A;  3VMZ A;  1A02 F;  2JYG A;  2K92 A;  3GG2 A;  1W2E A;  3NFQ A;  2V7Q J;  3WUV A;  1IFM A;  1RQV A;  3HD7 C;  1S5L E;  1KYO H;  4RES B;  1N73 A;  3DS1 A;  1SQB J;  2G3A A;  1NOH A;  3AEB C;  3CC2 P;  1PPJ E;  1N8R Q;  2P7J A;  2E5T A;  3L71 J;  4WY4 D;  2M8L A;  1LP1 B;  2YXR B;  1FZC A;  1HTL C;  3L74 E;  4PD4 I;  3L35 A;  2I1J A;  2R3S A;  3MHV A;  1YQ4 C;  1KQL A;  3V2N A;  2WPQ A;  4H13 D;  2KG8 A;  3KXD A;  3I55 P;  2NPS C;  5EFW B;  1PP9 E;  1PEU A;  3U59 A;  2VLN A;  1OX3 A;  1AJY A;  1ZN5 A;  2MR8 A;  1QL1 A;  5DJT B;  3HUS A;  1DD4 A;  5CCG C;  3GLM A;  1GK6 A;  2FYU G;  2M3E A;  3O6Q B;  4YXD C;  4XFX A;  2WQY C;  3G6E P;  1YTZ T;  1KYO D;  2KZI A;  3S1K A;  1KTM A;  1VQ7 P;  1G1I A;  3S4R A;  1PL5 A;  1KD1 Q;  3OAK A;  2ZXE B;  3MZW B;  2XV6 A;  1Q7Y Q;  3M0D A;  3NMD A;  3H1H D;  3VP9 A;  2AXT H;  3RK2 C;  4XRO A;  2Y9Y A;  1J2J B;  1DEB A;  4IPY A;  1YJW P;  1CI6 A;  3EJD A;  4BPF A;  1EC5 A;  1AUM A;  1Q90 D;  1M7L A;  2WT7 B;  4IL6 X;  1LNQ A;  4GIF A;  2CPS A;  2WPS A;  2XKM A;  5KJ7 C;  5F2K A;  4LGD E;  2Z45 A;  3AEA C;  4PJ0 E;  1M1J B;  3KZI H;  1KC8 Q;  2W83 C;  3AE8 C;  1NJI Q;  2QJY C;  1NTZ K;  4H2X C;  4QMA A;  4UB8 H;  1NAY A;  5HGM A;  2PP6 A;  2OYH A;  4N78 D;  3PH0 A;  1ZMB A;  4PJ0 H;  1AF8 A;  3G26 A;  4BRY A;  4H2Y C;  4H0L D;  1Q82 Q;  4OWF A;  2JDI H;  2W6J H;  3EWK A;  2VLP A;  3MUD C;  5KLV E;  3A3Y B;  1ZV8 A;  1VDF A;  2KOR A;  1JM0 A;  3G3Z A;  1KQF B;  2OYH B;  1X9V A;  3DS4 A;  3H47 A;  3CCE P;  2YIU B;  1ZOY C;  3A0B H;  5KLV J;  1L4A C;  2AF8 A;  2R3C A;  2Y9Z A;  1VQ8 P;  2Y0C A;  3VMX A;  2P1J A;  2D2C B;  2QG4 A;  3L70 G;  2GUV A;  3G29 A;  1SFC A;  1XTG B;  3H1H J;  1T3U A;  3KQG A;  4XFJ A;  1SQV G;  2WPV B;  1WRG A;  2P9X A;  1VF5 D;  2FQ1 A;  2E76 B;  2XNX A;  5CJ4 A;  4LC1 A;  2I8D A;  1KFN A;  1EOQ A;  1PPJ D;  2ZYA A;  3PJS K;  1TU3 F;  1LT9 C;  3L71 E;  4PD4 H;  2GM4 A;  1FDI A;  4C7R A;  1RF0 A;  1LTJ B;  2MVU A;  3MTU E;  1JY3 O;  1KB9 I;  2FVE A;  2LPK A;  1AQ5 A;  2FQ2 A;  2MVV A;  1QVF O;  2IBZ G;  3HUS C;  1RO0 A;  3AE6 C;  2FAC A;  1GL2 C;  1BGY D;  1MZ9 A;  1PIX A;  4ASW A;  3FWN A;  5TJH A;  5E79 E;  3H1K G;  4IZ6 A;  2M3B A;  1UNK A;  2K9Y A;  3ITK A;  2CG5 B;  2PEO A;  3H32 B;  2GDY A;  1L4A A;  5CCG D;  1H89 A;  1T8Z A;  5AVV B;  5JPA A;  3TGU D;  2RKL A;  5KLV D;  3P7K A;  3AE7 C;  2IBZ D;  1K8A Q;  2B87 A;  5AW2 B;  4Z1M H;  1LTI C;  1CI6 B;  4HKZ H;  1AYI A;  2V7Q H;  4ZMD A;  1BCC D;  3LIE A;  3T97 B;  5CHX A;  1X3O A;  2LML A;  1KB9 D;  4GDO A;  1BSN A;  1DD3 A;  2HOD A;  2HFE D;  2R5D A;  1N73 C;  2H43 A;  2FXP A;  1QEX A;  3HE5 B;  1HJ0 A;  1EQ7 A;  1KN7 A;  3L4F A;  1EZV G;  1EZV D;  1PZQ A;  2HPC B;  1EXJ A;  1PEO A;  1OVU A;  1NTZ D;  1SP4 A;  4U0B A;  3T97 A;  1M1K Q;  1IK9 A;  4YXW H;  3CWB E;  3L72 E;  5AW4 B;  2JWA A;  3DPH A;  4JPZ B;  1JMM A;  1NU1 J;  2DGY A;  5CMZ A;  4QKO A;  1SQB G;  1SQB D;  3VMY A;  3EQ2 A;  1R5L A;  2IBZ I;  1OW6 A;  4GKG A;  3VRL C;  1K73 Q;  1E0H A;  2OYI A;  1BGY J;  1YBK A;  2CK3 H;  1QGK B;  1KLP A;  1IC2 A;  3E7K A;  3L72 D;  3L72 G;  5M1B A;  1KFM A;  2O01 H;  1GU5 A;  1PGQ A;  3SFE C;  1IJD B;  3H1H E;  1RF0 C;  1HGZ A;  1LTJ A;  1NU1 D;  2OYO A;  3VN0 A;  1EZV I;  3PHL A;  4H0L B;  1GPJ A;  2FVA A;  2KNC B;  4AUW A;  5B66 H;  2M5A A;  5GTH H;  1ZME C;  3RK2 B;  2PEK A;  1OWA A;  1KB9 E;  3C8V A;  2KYV A;  3IAO A;  3JCU E;  1KYO I;  2ZT9 D;  2PEN A;  2M8N A;  3HZQ A;  4TLF A;  1CEI A;  1OW7 A;  1WT6 A;  2XDJ A;  1A8O A;  2KW2 A;  2FHS C;  1JY3 P;  4Y28 J;  2HR3 A;  1J1D B;  1FOS F;  3B71 A;  1VL2 A;  2OYI B;  2FYN C;  3BVH A;  1URQ D;  4WBA A;  4XFY A;  2QJY B;  3H1K E;  2PY8 A;  1SFC B;  3BCC G;  2JP3 A;  1LGH B;  4H44 D;  4WY4 A;  4OVN F;  3GKL C;  1MFT A;  1SFC D;  3E1R A;  1N7S A;  2WPT A;  2BAS A;  2O01 N;  3H0D A;  1S72 P;  2YO3 A;  1PGJ A;  1EIA A;  1JOC A;  5F2O A;  2P10 A;  4BRY B;  2NRG A;  3VTP C;  3A5T A;  1FOS E;  1S9K E;  3JSV C;  3ABV C;  3SSU A;  4AYC A;  3L71 G;  1IFJ A;  2J58 A;  3GHG A;  1U7M A;  3BAT A;  5B66 E;  4IFM A;  3P8M C;  5KLI C;  3O8Z A;  3QH9 A;  1FU1 A;  2D2C C;  2JEE A;  3M9B A;  5HVC A;  5AW5 B;  4XA4 A;  3H1I G;  4M0I A;  1RF1 C;  3I5C A;  3MGE A;  2FBW C;  3BCC E;  5KP8 B;  2LOL A;  3CCR P;  2FYZ A;  2ZT9 B;  7CEI A;  5CJ0 A;  2FAE A;  2QJP C;  3TYY A;  4GR6 A;  1S5L X;  4PD4 E;  2OTJ P;  2D2C D;  1N7L A;  3G9R A;  5K5G B;  3CXC O;  3AEG C;  2DNW A;  1MKM A;  4COP A;  1BGY G;  1NU1 E;  3W67 A;  2K37 A;  3CXH E;  2RMZ A;  3CD6 P;  2LL8 A;  3D70 A;  1SQV D;  1KZU B;  2K3R A;  3GF7 A;  2PFX A;  4IFD K;  2BCC G;  1D7M A;  2EHS A;  3PP5 A;  1NTK D;  4D6T J;  2QA4 P;  1PV3 A;  1ZRT D;  2Q6Q A;  4C7N B;  3B5I A;  2P67 A;  4XFZ A;  1URQ C;  2JKV A;  1UJZ A;  3HE4 B;  3Q5R A;  1A43 A;  2K0X A;  1SQQ G;  5AVZ B;  2LF4 A;  1AQT A;  2KOG A;  3M91 A;  2GZG A;  4TT3 H;  2RN0 A;  2OAR A;  4ZKU A;  2RH0 A;  1GD2 E;  5GTI H;  2FAD A;  3RBX A;  3H1L D;  4EDF A;  1SQB E;  2GZJ A;  4AQR D;  2N5I A;  1DNY A;  4JYC A;  1UII A;  1VQO P;  1VQ6 P;  2IFM A;  1GMJ A;  4RKU J;  4UB6 H;  3B4Q A;  4WVZ A;  2N1T D;  5APY A;  3H6P A;  2PRR A;  1IUQ A;  2N9B A;  1S2E A;  4U3F D;  1KQG B;  2W8Z A;  2ZVO B;  3GZL A;  2XZ1 C;  1NKZ B;  1BE3 G;  1KIL C;  4DZO A;  1K04 A;  4MRT C;  1T6A A;  2KOP A;  5HV8 A;  1W5C E;  1T8K A;  1SQV K;  2ZVN B;  2BUO A;  1PP9 G;  2KUB A;  1ZNV A;  2E75 D;  4U7J A;  2EHT A;  2YXQ B;  1M1J A;  2KGD A;  2BEZ F;  2XXM A;  2IFN A;  2LXB A;  2QM7 A;  4I6M C;  4WWI A;  2BCC E;  1JTH B;  1KOR A;  3PTZ A;  4U3F G;  1X22 A;  1IFD A;  3BRV B;  2IX7 C;  1JCD A;  3CX5 D;  5CBO A;  2KG9 A;  1N2D C;  1VQ9 P;  2Q1K A;  2EFJ A;  2GYK A;  4B86 A;  1BCC E;  3V2R A;  1T3J A;  2KGC A;  2E74 C;  3BCC J;  2JWD A;  1SQX J;  1YJ9 P;  1NVO A;  1SS1 A;  1EDI A;  4PH0 A;  4N6J A;  4I2L C;  3BAS A;  4H0L C;  1NKN A;  3B5N B;  2N1T C;  3H1I D;  1NU1 K;  1ZXG A;  2WTY A;  3HTK B;  1M6E X;  4KT0 J;  2E1M A;  5AW6 B;  4GOF A;  1SQP D;  4A7P A;  4YPC A;  5EW5 E;  3JC2 2;  3PLN A;  1H0T A;  3AEF C;  2GZI A;  1YIT P;  5KJ7 D;  1SQV J;  2M8R A;  1YQ3 C;  1NHL A;  1LT1 A;  3AEE C;  3AE4 C;  3HYB A;  1HGV A;  3G4S P;  2ERH A;  3L70 J;  1NO4 A;  1S5L H;  1PEM A;  3Q5S A;  3L73 E;  1FJP A;  5KLV K;  1RQU A;  2M0B A;  2G8Y A;  4PXH B;  2N1T A;  2PGD A;  3RL0 g;  2M5R A;  1GL2 D;  3N4X A;  2BEQ D;  1EDJ A;  3L70 E;  1QRJ A;  5AW1 B;  2OTL P;  3L73 J;  5CBN A;  3V6I A;  1HVV A;  3F89 A;  2XZ0 D;  1IFN A;  1SQX K;  1L0N E;  2OTK E;  2XND H;  3F5H A;  2YKQ A;  3GW6 A;  5B5E E;  3LID A;  5H2F E;  3NXS A;  1R8E A;  1JY3 N;  2K2Q A;  4ZNC A;  1FZB A;  2IPP A;  4H13 C;  3ZDM A;  1NTM G;  3R4Y A;  4K3A A;  1GTW A;  1BE3 J;  4I7Z C;  5AVR B;  1NH4 A;  5TIS H;  2K1A A;  1E5W A;  2JBG A;  1NGM B;  3HD7 D;  2L5G B;  4IFF A;  1GDT A;  1S1C X;  1BE3 E;  1NYH A;  2J59 M;  3A0H H;  2QJP B;  3CCQ P;  3B5N A;  1VHN A;  1NWQ A;  5CZD B;  3VMA A;  4U0A A;  3H1J D;  4PV1 C;  2FKW B;  3FXE A;  1JB0 J;  4N78 E;  3LRY A;  4DG9 A;  2WZ7 A;  3H1L J;  1F80 D;  4WB4 A;  1BSH A;  1NAF A;  1L0N G;  4OGQ B;  5APV A;  1SQQ J;  1OVV A;  2JR8 A;  2ROQ A;  1ZRT E;  4OH8 B;  5KAF E;  1P84 H;  3DS0 A;  3G28 A;  2DW3 A;  2Y0D A;  3H1L E;  4O9B A;  5APW A;  1MFZ A;  3IF4 A;  2PEI A;  3H1J G;  2FYU E;  3RG2 A;  1G2C A;  2OYH C;  1EDK A;  3L75 G;  3H1J J;  5BVZ A;  4JF7 A;  2KSJ A;  1SQQ K;  3L36 A;  1L4A B;  1H0T B;  3CCJ P;  1YHQ P;  3G1G A;  2WSE H;  1JJ2 O;  3SWY A;  2IYO A;  2LR2 A;  3LMO A;  4NPF X;  4DJG A;  3M9H A;  2L9F A;  4Y99 C;  5APQ A;  3CWB J;  1RNI A;  2KOQ A;  1AA0 A;  1FAV A;  3L72 J;  4U0E A;  2AFE A;  3HE5 A;  2GZF A;  1OZH A;  1L2P A;  1RHZ B;  4K35 A;  1SQV E;  1HWT C;  2K93 A;  3K5B A;  3V5B A;  1BGY E;  2LTE A;  1U7J A;  1LWU A;  4DCK A;  1FC2 C;  2YKO A;  1HY8 A;  4UHP B;  1LT9 B;  1CW5 A;  1VPC A;  3GZM A;  1KIL B;  2UWJ E;  2N9Y B;  1DX7 A;  2ZAE B;  4HKG A;  2WSE J;  1X8Y A;  2GA1 A;  5EJD A;  3L73 D;  1FZF A;  4C46 A;  2KR5 A;  5BS2 A;  4YTP C;  2NPS D;  3FGA D;  5KP7 B;  3D6Y A;  3H1I E;  2KS1 B;  2WSC J;  3WUT A;  2E42 A;  4H44 B;  1KB9 H;  3L74 D;  2KG6 A;  3B5N D;  4WY4 C;  5APS A;  2A45 H;  3V4Q A;  1IZN B;  2YMY A;  2ZFC A;  1J1E B;  1VQN P;  2MJZ A;  1L4A D;  1HJB A;  2E43 A;  4ZKP A;  2M5A B;  2B89 A;  3A2A A;  3EFF K;  5AVU B;  2WWW A;  1QX8 A;  2GZE A;  2ITA A;  2KZJ A;  4XRQ A;  2KI7 B;  1VQL P;  2BCC D;  2IZ0 A;  3EJE A;  2KOD A;  3HE4 A;  4PH1 A;  2W6A A;  4ASV A;  2Z5I A;  2A45 I;  1VKU A;  1R5S A;  3CX5 I;  1X0T A;  3B5N C;  2CWO A;  3CC7 P;  1Y9B A;  1VQM P;  3CPW O;  5KKZ B;  3RK3 C;  1KIL A;  4IOI H;  3NTE A;  4WYM A;  5APX A;  2N50 A;  1NTK K;  2XV5 A;  3D71 A;  2K0D X;  3II6 A;  4BXL A;  2SPZ A;  3KDP B;  4BWN A;  1HQB A;  1SQQ E;  3SWK A;  1ACP A;  5KAF H;  1GW4 A;  4IL6 E;  2JO1 A;  2O3J A;  1VQP P;  1S9K D;  3Q5P A;  3N7N A;  2C0X A;  3CX5 H;  5KTB A;  3CXH H;  3OJA B;  2A06 G;  3MIW A;  2FFD B;  1FDO A;  2R32 A;  4DT0 A;  1GL2 A;  2FYU J;  2JU1 A;  1FS0 E;  1OR5 A;  1L0H A;  2W6B A;  4JQ0 D;  2HOD B;  5KAI E;  1OIP A;  1KYO E;  1OMI A;  3IN6 A;  4PWV B;  1H8A A;  3HD7 A;  1RE4 C;  1ZR2 A;  4U3F J;  1OFC X;  1L0L G;  3HD7 B;  4NPD A;  1NQ4 A;  3L74 J;  2Z44 A;  1NU1 G;  3CCM P;  2FYU D;  3CXH I;  5TIS E;  2WVR A;  3E1I A;  1YTZ I;  2O1K A;  5CCH D;  3USS A;  4H13 B;  1P84 E;  2QE7 H;  3CME P;  2NZ2 A;  2QVA A;  4D6T G;  2P2U A;  4H2W C;  4F37 A;  1RY3 A;  2VLO A;  1L0L K;  1VF5 C;  2QNW A;  4I7Z B;  2JJL A;  1MZ8 A;  2NPS B;  3DTJ A;  3Q1M A;  1BDD A;  1CZQ A;  5KJ7 A;  1EZV E;  1DH3 A;  3WU2 E;  3FX0 A;  2BHV A;  2FY8 A;  2W90 A;  3RL0 D;  2L6E A;  3TGU G;  3CCV P;  5AVQ B;  2J5U A;  1KV4 A;  2FVF A;  1J1D C;  3H32 A;  2X2B A;  1ZR4 A;  2AFD A;  1QLE D;  3GF3 A;  4D6T D;  2KIK A;  3CWB D;  3CXH D;  3TSI A;  3AE5 C;  2EIA A;  1L0N D;  1JNM A;  2JB0 A;  2E75 C;  1HBW A;  1M90 Q;  3L74 G;  2B9B A;  2N98 A;  5BU5 A;  1RF1 A;  2JYL A;  1H88 A;  4U0C A;  3V2P A;  3M0D C;  2PEJ A;  2MR7 A;  4DOJ A;  1EDL A;  2ZYG A;  1RE3 C;  2BQ1 E;  1IK7 A;  3G1I A;  2FXM A;  3W68 A;  2AEF A;  1KQS O;  5DJU B;  3DS2 A;  2AEJ A;  2IBZ E;  5CCG A;  2ZYD A;  1RF1 B;  1JUN A;  4I1L A;  4M3L A;  2WIT A;  2NPS A;  2KGA A;  2Q3E A;  2K9J B;  2K94 A;  2KK7 A;  4OGQ D;  3RK2 D;  2KOO A;  2BCC J;  2KP8 A;  5AW7 B;  3L71 D;  2YIU C;  3IFM A;  1BAJ A;  2N6Z A;  3TF5 A;  2MD9 A;  2WSC H;  5APU A;  1RO2 A;  1PGP A;  3H1H G;  1P84 I;  1JTH A;  3CCL P;  1NTZ G;  1NTM K;  2LKM A;  4W80 A;  2WT7 A;  1JY2 O;  1ZW0 A;  1N7S D;  2A06 E;  3B8E B;  3I56 P;  2E74 D;  1JY2 P;  2YNY A;  3WBH A;  2H88 C;  2E76 C;  1X79 B;  2GDX A;  1E6J P;  2AXC A;  2V4H A;  1GU4 A;  1ZP0 C;  1HF9 A;  4PV1 D;  2Q9I A;  4UB8 E;  2Z5H A;  3CWB G;  3P32 A;  2Q7C A;  1RE3 A;  1J1E C;  1BDC A;  3MGN A;  1IMQ A;  1FR2 A;  3CLQ A;  2R44 A;  1GXG A;  3CX5 E;  2MY5 A;  4R4L A;  2PNG A;  4IL6 H;  3IR9 A;  4HB1 A;  5AW0 B;  1AVY A;  3LW5 J;  2KB7 P;  1P84 D;  5BU8 B;  2E5Y A;  1GK4 A;  3CC4 P;  2H7H A;  3HUS B;  3OW2 O;  4L74 A;  5KAI H;  1AFO A;  5AVS B;  4RJT A;  1AVO A;  1SQP E;  4LLH A;  1KIL D;  4GOE A;  1JMB A;  5HGO A;  2N5H A;  2POH A;  5HGL A;  3C9I A;  3RL0 B;  1JO5 A;  2K0Y A;  1L0N J;  1LTA C;  1PGO A;  2ZJS E;  2E76 D;  2QJK B;  4GR2 A;  2M8P A;  3PRJ A;  3U1A A;  1N7S B;  4COC A;  1XTC C;  5C39 A;  1EXI A;  1S4X A;  2JU2 A;  2FFD C;  3HTK A;  3Q20 A;  2C9N Y;  5KP6 B;  3WUU A;  2K88 A;  2YMK A;  1T2K C;  1OXZ A;  5GTI E;  3H4E A;  2L91 A;  5BS1 A;  3CMA P;  3U1C A;  2B88 A;  1Q2N A;  2KOS A;  1PEQ A;  2FQ0 A;  3EJB A;  1GZL A;  3WU2 H;  2K9J A;  3CE7 A;  1FZA A;  2FYU K;  3V4W A;  3M9Q A;  5F2N A;  3G21 A;  1K05 A;  1U57 A;  1PP9 D;  1FDM A;  2O01 J;  1SLQ A;  1VQK P;  5CCH A;  1L0I A;  4CPG A;  1LWU B;  3TDK A;  1FZC C;  1BCC J;  2JGP A;  3L70 D;  3GJN A;  2K5X A;  2ONT A;  2GUS A;  3FXD A;  3GHG B;  3RG6 C;  1VF5 B;  3MP7 B;  3A0B E;  3L37 A;  1UIX A;  2C9L Y;  3V2Q A;  2CQ8 A;  4U0D A;  2Q3I A;  2PEQ A;  3L75 E;  1YJN P;  3NTN A;  1Z56 A;  3P05 A;  3Q2Y A;  2KSE A;  1IO4 A;  2Z4E A;  3U43 A;  3RBZ A;  1FJK A;  2Q5U A;  3H1L G;  2N6Y A;  2QSI A;  2A06 D;  5GTH E;  3CL3 D;  4EYY Q;  1M8O B;  4HYT B;  2FFD A;  4L73 A;  1Y8A A;  4W7Y A;  3BCC D;  2KNC A;  1BXI A;  3S9O A;  5KLV G;  2E75 B;  3TNU A;  4GOD A;  2EG5 A;  3O6Q A;  1SQP K;  5E79 H;  2IDB A;  2B87 B;  2MKV A;  4HJG H;  4L76 A;  3CCS P;  1M57 D;  4PD4 D;  3D6Z A;  3H1K J;  4JYB A;  3E2D A;  4UB6 E;  2AVA A;  3G71 P;  1FZE A;  2O1J A;  4CA3 A;  1SQX G;  2WSF H;  3VYI A;  1NTM J;  2C0W A;  2OYI C;  2FYN B;  2L0Q A;  1L0N K;  4NEO A;  1SFC C;  2KXP B;  2KLU A;  1SQP G;  1SQP J;  1K9M Q;  2LIU A;  1HH0 A;  2VSQ A;  1GW3 A;  1NTM E;  1RH5 B;  2QIW A;  3EFG A;  3GMA A;  3UIA A;  4GT1 A;  3B4S A;  2WSS H;  5L8R J;  3AE2 C;  2OGU A;  1FZG A;  4QNB A;  3H25 A;  3MD0 A;  2CNR A;  4MN4 C;  1LJ2 A;  1Z6M A;  1RE4 A;  2I1K A;  1ZLL A;  2CGQ A;  3A0H E;  2NO8 A;  2XZR A;  5HGN A;  3VP8 A;  4PV1 B;  1YYC A;  2WSF J;  5KLI B;  3KZI E;  2VRS A;  2WMM A;  4C7N A;  2L4B A;  1Y47 A;  3H1K D;  4KHX A;  4OGQ C;  4L75 A;  3HRN A;  1VQ4 P;  2YKP A;  3OA7 A;  2ZT9 C;  1IFP A;  1M56 D;  3AE3 C;  1A02 J;  4XE5 B;  3DS3 A;  5I4T G;  1VQ5 P;  4NPE A;  2HPC A;  1PPJ G;  1G1J A;  3L75 D;  3NY7 B;  1LTB C;  1N86 A;  1BE3 D;  1M1J C;  1GXH A;  2HG5 D;  2PEM A;  2QM8 A;  2WPR A;  1L0L D;  1KIL E;  5AW3 B;  4HH2 A;  2AEM A;  1MUU A;  4Y99 B;  3H1J E;  2Z46 A;  4U0F A;  2AXT E;  1L0L J;  1LTT C;  3QWO C;  1CSB A;  2W27 A;  1LT9 A;  2ZXX A;  3FWL A;  3RGU A;  2KLV A;  2LIW A;  1YI2 P;  3TNU B;  2Y0E A;  3L75 J;  3AED C;  2R5B A;  3DS5 A;  1L0L E;  1M74 A;  2GDW A;  1BCC G;  2LKI A;  1HUC A;  1FE6 A;  1URQ B;  3LW5 H;  1NTZ E;  4EOT A;  5AVX B;  3M1M A;  1S3J A;  1NTK E;  1SQQ D;  1PP9 J;  3RL0 C;  1W2B O;  4BPH A;  1LTG C;  4U3F E;  3M06 A;  1DIP A;  1JEK A;  4KJM A;  2L22 A;  1QL2 A;  2VLQ A;  3AEC C;  4EI2 A;  1NTZ J;  2QJK C;  2JO0 A;  1JY2 N;  3CCU P;  2OQQ A;  2FXO A;  1PFI A;  1Q86 Q;  3KYQ A;  3WMM 0;  1USD A;  1M6N A;  1NTK J;  1N7S C;  2QEX P;  3TGU J;  4W7Z A;  2XT1 A;  3JCU H;  1OW8 A;  3KHU A;  2YO2 A;  5H2F H;  3P8C D;  4H44 C;  4BPG A;  1Q81 Q;  5DCK A;  4WY4 B;  2P58 A;  1USE A;  5CCH C;  2JAZ A;  1JCC A;  5AW8 B;  3TGU E;  4RO0 A;  3AE1 C;  1URQ A;  3H1I J;  2H89 C;  4R4M A;  1OVR A;  2H8P D;  3R2P A;  3MUD A;  1WMK A;  5AVY B;  1LTJ C;  2A45 G;  3SFD C;  4N3Y B;  3RK3 E;  1SQX D;  2MF4 A;  3Q3D A;  2IZ1 A;  2JQ4 A;  1NTM D;  2PAJ A;  3KPE A;  1DEE G;  1T2K D;  1LWU C;  1GL2 B;  1EMV A;  1FZC B; 
#chains in the Genus database with same CATH homology
 4U0A A;  1M90 Q;  5JPA A;  3CCR P;  5F2N A;  1VQ8 P;  3LRY A;  5BS2 A;  1K9M Q;  1K8A Q;  3G21 A;  3HYB A;  2JYL A;  1IUQ A;  3G4S P;  2PEK A;  1YI2 P;  4XFX A;  4U0C A;  4GR6 A;  1VQK P;  3G6E P;  2OTJ P;  3G29 A;  2PEJ A;  1PEM A;  1VQ7 P;  3CXC O;  3DS5 A;  2PEN A;  1M74 A;  2M8N A;  3HZQ A;  2BQ1 E;  3G1I A;  3DS0 A;  3G28 A;  4COP A;  1KD1 Q;  2XV6 A;  3M1M A;  1A8O A;  2P9X A;  1Q7Y Q;  2ONT A;  1VQN P;  1KQS O;  2BUO A;  4XRO A;  2Z44 A;  2PEI A;  3DS2 A;  4QNB A;  3CCM P;  3RG6 C;  3CC4 P;  1W2B O;  3CD6 P;  3OW2 O;  1QRJ A;  3G0V A;  2OTL P;  2XXM A;  4IPY A;  1YJW P;  4U0D A;  5HGN A;  2PEQ A;  2JO0 A;  4XRQ A;  1PEO A;  1K30 A;  3CCU P;  1AUM A;  4XFY A;  1YJN P;  5HGO A;  1EOQ A;  3CCJ P;  2PY8 A;  1YHQ P;  4U0B A;  3G1G A;  1Q86 Q;  1VQL P;  3CME P;  1M1K Q;  1M6N A;  5HGL A;  3P05 A;  2QEX P;  1QVG O;  1JJ2 O;  2XT1 A;  2KOD A;  3DPH A;  2QA4 P;  4PH1 A;  5F2K A;  1BAJ A;  1VQ4 P;  2DGY A;  1VQ9 P;  1YIJ P;  1D1D A;  2EFJ A;  2Z45 A;  1Q81 Q;  3H0D A;  1RNI A;  2JYG A;  3B5I A;  5DCK A;  2CWO A;  4U0E A;  3CC7 P;  1S72 P;  3DTJ A;  1VQM P;  4GR2 A;  4XFZ A;  1KC8 Q;  3CPW O;  2M8P A;  3VRL C;  1NJI Q;  1EIA A;  1RO2 A;  3NTE A;  5HGM A;  4WYM A;  4COC A;  1QVF O;  1A43 A;  3DS3 A;  5F2O A;  5I4T G;  1K73 Q;  1YJ9 P;  3CCL P;  2LF4 A;  1VQ5 P;  2BHV A;  1ZMB A;  2OAR A;  2L6E A;  3G26 A;  1RO0 A;  4PH0 A;  3CCV P;  3DS1 A;  1Q82 Q;  2EG5 A;  3Q20 A;  3CC2 P;  3CCS P;  1N8R Q;  2PEM A;  1M6E X;  2M8L A;  2E1M A;  3H4E A;  5BS1 A;  3CMA P;  3I56 P;  3E2D A;  1VQP P;  2EIA A;  2PEO A;  1VQO P;  3CCQ P;  1VQ6 P;  3G71 P;  3WBH A;  1PEQ A;  4M0I A;  3MGE A;  3H47 A;  1E6J P;  2Z46 A;  3DS4 A;  4U0F A;  3I55 P;  1YIT P;  3CCE P;  1PEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...