3CC4P

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc4P02
1QVGO 1Q86Q 3G4SP 3I55P 1QVFO 3CC2P 1VQ5P 2OTLP 3CXCO 3CCSP 1YI2P 2QA4P 1VQ4P 1Q81Q 1VQKP 3CCVP 3CC4P 1Q82Q 3CCEP 2OTJP 3G6EP 1VQ6P 1JJ2O 1M90Q 1NJIQ 1K9MQ 1VQ7P 1YJ9P 1VQMP 1YIJP 1KC8Q 1K73Q 3CD6P 1KQSO 1S72P 3CCUP 1K8AQ 3G71P 1N8RQ 3CC7P 3CCLP 1VQLP 1YHQP 3CMAP 1VQ8P 3CCMP 1YJNP 3CCJP 1VQNP 1W2BO 1VQ9P 1Q7YQ 2QEXP 3OW2O 1VQPP 1VQOP 1YJWP 1YITP 3CMEP 3CCRP 3CPWO 3I56P 1M1KQ 3CCQP 1KD1Q
chains in the Genus database with same CATH superfamily
2ZT9B 1HTLC 3IN6A 1NTZJ 2JDIH 2JGPA 4EIJA 2AEMA 2BQ1E 5AVSB 3KZIH 2MD9A 2WSCH 2R32A 5APQA 3BRTB 1BGYD 1LNQA 2WQYC 1IMPA 1PGQA 1SQQK 1S9KE 1HWTC 2FXPA 1S1CX 1SQQJ 1LT9A 3E2DA 5AVTB 2DNWA 1EZVD 1FS0E 3AEFC 4YXWH 2R5BA 5CCGD 5GTIE 1FJPA 2WT7B 1ZMEC 1CZQA 3V2QA 2KGDA 1Q2NA 4GIFA 2W83C 3L74G 3WUUA 1VQLP 4PD4E 4H13D 4MRTC 3G9RA 2L6EA 1CW5A 4PH1A 4YPCA 2AFDA 2QA4P 1P84I 1YQ4C 1E79H 1VQKP 1H88A 3GF3A 5BVZA 3DS4A 2QG4A 3IF4A 3A7OA 3V6IA 1RNIA 2GZGA 4WYMA 2K92A 3DS2A 2K9JB 5B66H 1KD1Q 3PLNA 3RL0B 1L0LK 4LC1A 5KLVG 5CJ4A 3HYBA 2MKVA 1IUQA 1L0LJ 4CA3A 2BUOA 3VP9A 3Q3DA 2PRRA 2QJYC 4PJ0E 3V2NA 1UIXA 3R4YA 1X22A 3L71D 1EIAA 3OJAB 2M8RA 4C7NA 2A06G 3TGUJ 2JR8A 1M6EX 3RK3D 5EJDA 1NTKG 1X8YA 3TK1A 2KG9A 1XTCC 2KSEA 3L36A 3FGAD 5C39A 5APTA 1K73Q 2QJYB 3H1KG 1EDKA 4WBAA 3L35A 2GUVA 5CCHA 2BASA 2KSJA 4IZ6A 2E76B 1J1EC 2POHA 2MJZA 1LWUB 3HTKA 2KNCB 2JQ4A 1OW8A 3H1HG 2IFNA 2O01H 2K37A 4U0AA 2QSIA 1IFJA 1LTBC 2QEXP 1JY2P 2BCCJ 4UB8H 3UIAA 1SQBG 3VRLC 2B87A 5AW6B 3S9OA 1GU5A 2E74C 2FADA 1MKMA 1J1DC 3H1IG 3U1AA 2GYKA 4L73A 1OMIA 3MZWB 1KZUB 2R3CA 2L9FA 1J1DB 1PGOA 3P7KA 1FZCA 1AF8A 1DX7A 1RE3A 1PEQA 1IJDB 1RQVA 1RY3A 1KC8Q 2Z46A 1BE3G 3VYIA 1KQLA 3BATA 1AA0A 4U3FG 1YTZT 1NKZB 1XTGB 1FZEA 3ABVC 2N50A 2M8PA 5CCGA 1Q86Q 1RQUA 2JWAA 3U59A 2PEOA 1N86A 4ASWA 1JMMA 1VQ4P 1PP9J 3Q5RA 4C46A 2KZJA 1EZVE 1AQ5A 2LPKA 2N5IA 1SQXD 1KMIZ 5AW1B 2OYHC 3DPHA 1A43A 5M1BA 2WITA 1RF1B 2M5AB 2XV6A 3M0DA 5AVYB 3BCCD 2JWDA 2KP8A 1S3JA 4DCKA 1SQVD 4I2LC 3LIDA 2OYHB 1IFMA 1LT1A 3GZLA 2ONTA 2Y9YA 1BGYJ 3B8EB 1SQPD 3DTJA 2XZ1C 1QL2A 1JO5A 1N7SD 1BXIA 1FDMA 1IFNA 1KORA 3VMYA 2FXMA 4DJGA 1AFOA 4OGQC 2YO2A 2IZ1A 2N5HA 4I6MC 1IFDA 3EJEA 3A0BE 1L2PA 2XZ0D 3HZQA 3GHGC 1W2BO 4OGQB 1ZW0A 3EQ2A 3SWYA 2IYPA 4H0LC 1U7MA 3RK3E 5TISH 3NY7B 1G1IA 2R5DA 1GDTA 3FWLA 3V4WA 3WBHA 2E75C 3VOPA 1KB9H 2CWOA 1A02J 1GW3A 2D2CB 3D71A 1SFCD 4W80A 4JYBA 2YNYA 3H1LD 3M9BA 4ZKUA 3AE1C 3OW2O 1YITP 3USSA 3CPWO 1KQGB 1GW4A 3SFDC 1CI6A 2XDJA 4UB6E 2FFDA 2E75B 2QNWA 2XV5A 2V4HA 3H32A 4OWFA 1KILA 5AW7B 2L4BA 3D6ZA 2LOLA 3L71J 2HODA 2VLPA 5HGNA 1D7MA 1KILE 2K5XA 2RKLA 1Q81Q 2WSEJ 1M90Q 3QWOC 2KGAA 2FACA 2Q9IA 2J59M 3MIWA 1LTIC 1N73A 5KP6B 1OFCX 3ITKA 3AEAC 5CMZA 4DG9A 4KT0J 1GK4A 2R3SA 5AW8B 3CC7P 2KR5A 3VTPC 3II6A 3L70G 1T3UA 1VQPP 4F37A 2BEZF 2G8YA 1K05A 1M74A 1PGPA 2QJPB 1J2JB 1GL2C 2H8PD 2GZIA 1LTTC 1SQXE 3V2PA 5E79E 2HPCA 1DV5A 3SFEC 1URQA 3V4QA 4BPFA 1PPJG 2ZYGA 1GL2B 2YXQB 2A45I 1ZP0C 4YTPC 1SQVE 3PRJA 1GU4A 3AEEC 2B89A 1KV4A 2KODA 1SQPE 2ZVNB 1GTWA 1FZBA 1SQXK 2L22A 2Z5IA 1SP4A 1FJKA 3CI9A 2PAJA 1SQXJ 2GDWA 1S5LE 3SSUA 2K9YA 1Q90D 1FAVA 3MUDC 1SQVK 2PNGA 4Y99C 3CCJP 1URQC 3BCCJ 1SQPK 1MFZA 1VQ6P 5F2OA 1WMKA 1U57A 1SQVJ 1SFCA 2N6ZA 4IOIH 4D6TG 1HUCA 1SQPJ 3RBZA 1L0NG 3IAOA 3B5NB 1BCCE 4KHXA 1PGJA 3H1LE 4I7ZC 3SWKA 2HR3A 2E74D 3A0HH 1UIIA 3W68A 4COCA 4U0EA 1L4AC 1PEMA 1ACPA 1NTZG 3AE7C 3JCUE 4BRYB 1ZR4A 4PD4H 5F2KA 1FE6A 4RKUJ 3A3YB 3AE5C 2LXCB 3CC4P 3CCVP 1IK9A 2PGDA 1EDLA 1VHNA 2FQ2A 3GZMA 4I7ZB 3HD7C 1L4AB 3PH0A 4HKGA 2IBZG 3HUSB 1M1JB 2SPZA 1YQ3C 4H44D 1SQQG 3CXHH 2JP3A 4XA4A 1BDDA 2WT7A 1GPJA 3H1JE 3AE4C 2DGYA 3HD7B 4DZOA 3H1LJ 2W8ZA 1NQ4A 4WB4A 1NWQA 4HH2A 3AE6C 1ZR2A 3L72E 1M1KQ 2OYIC 1VQ5P 1WT6A 2K9JA 2FBWC 1AVOA 1PFIA 1SQBD 1PIXA 2MF4A 1HJ0A 3NMDA 3TNUB 2J58A 3RG6C 2LMLA 3AEBC 2WSFJ 2K94A 3W67A 2FYUE 2OYIB 2J5UA 4O9BA 2KORA 3L73D 1AJYA 1GMJA 1YTZI 2PEQA 3G28A 4NPDA 1KLPA 2FYZA 3B4QA 2Y0EA 3AEDC 4RJTA 2W90A 2AVAA 1OX3A 1L0LG 1H0TA 2OTJP 1ZN5A 2KYVA 1Z56A 4IFFA 4LGDE 4HJGH 2B88A 2K2QA 1PEOA 1KYOE 4OGQD 1FR2A 1YYCA 3TGUG 2IX7C 4ASVA 3D70A 4N3YB 2Q5UA 3PJSK 3RL0C 2JU2A 1USDA 3B71A 1LWUA 1LTGC 3PHLA 2KNCA 4U7JA 2PEJA 4H0LD 1YJNP 1G2CB 4AUWA 1S2EA 2LL8A 2E75D 3CXCO 7CEIA 3L74E 5H2FE 1GZLA 1KFNA 4L76A 2OARA 1YJ9P 3I5CA 2BCCG 2PEKA 3CMEP 3I56P 3WUVA 2OTKE 3G4SP 2E76C 1BSNA 1S5LX 3E1IA 4PWVB 3Q2YA 3LMOA 1LWUC 3NFQA 1JY3P 1LT9B 2N1TC 4EYYQ 1PV3A 2CK3H 4QNBA 3H6PA 1NYHA 4Z1MH 1T2KC 3KZIE 2A06E 4GR2A 2N1TB 2XZRA 2WPQA 3CCLP 1KYOI 3AE3C 2BHVA 3CCRP 1D1DA 1KILD 5AW4B 1PP9G 2XU6A 1SLQA 4C7RA 1VQ7P 1T3JA 3KHUA 5B5EE 1LP1B 3A0BH 2K93A 1VF5B 1YBKA 2VSQA 1N8RQ 3H1HE 2OYHA 3CCMP 1NKNA 5AW9B 5HV8A 4PH0A 3Q5PA 3GF7A 1NHLA 1GL2D 2PY8A 3RK2C 1FOSF 1BGYG 2Z4EA 3CL3D 1N7LA 1SQBE 1R5LA 5KLIB 4WY4C 3CWBD 2OGUA 2H88C 3WMM0 5B66E 1EDIA 3CXHI 3H1IE 5TJHA 4XFYA 1IK7A 3RK2B 2FVFA 1JCCA 3L73E 4I1LA 1EZVG 1RF1C 2HLOA 3P8MC 3QH9A 4DT0A 1YI2P 4XRQA 4WY4B 1LJ2A 4XFXA 2KLVA 4ZMDA 1E5WA 4R4LA 2YKQA 2XKMA 2WMMA 5CZDB 1SQBK 5KP8B 2FYNB 2JEEA 1VDFA 3RBXA 3GHGA 3WU2H 2ZAEB 4U3FE 1HGVA 2N6YA 1KB9D 1VL2A 2HFED 3G6EP 2KZIA 4U0BA 1EXJA 1URQD 2PEIA 3MGNA 2M8NA 1S72P 2N98A 2B87B 2N9BA 3L73J 2LR2A 5BU8B 2CNRA 1OIPA 2L5GB 1EOQA 3OAKA 1AVYA 3HE4B 3HE5B 3C8VA 1JY3N 1KQFB 2AFEA 3L71G 3LW5J 2DW3A 1L4AD 3DS1A 5BU5A 2D2CC 3G0VA 4MN4C 3CX5H 3TSIA 3HD7D 1NU1D 2QM7A 2NZ2A 4RO0A 1BCCD 2CPSA 3AEGC 1JY2N 5E79H 1ZXGA 4XFZA 2GUSA 2WZ7A 3EJDA 2ZT9D 2FQ1A 2MR7A 5BS1A 5KJ7A 3AE2C 2CG5B 2ZYAA 1MFTA 3VMAA 3G71P 4IFDK 3AE8C 3GG2A 1FC2C 2YIUB 2C0XA 1HQBA 4H2YC 1OXZA 1Y47A 3H1JD 4U0FA 1RF0C 5EW5E 2KXPB 2H43A 5JPAA 2UWJE 2AEJA 3VMZA 1G1JA 4JYCA 1GL2A 1TU3F 1L0HA 4IFMA 2KLUA 1FDOA 4JF7A 3H4EA 1OR5A 1SVFA 3MTUE 1E6JP 2HYNA 1W5CE 2WPRA 3L72D 3Q20A 2YXRB 5KJ7C 2MVUA 1JNMA 4R4MA 2KOGA 4OH8B 5DJTB 2EHSA 2AXTH 2IZ0A 2AXCA 2QJPC 1KTMA 1BAJA 3CWBE 2P10A 1A02F 1JEKA 2FYUD 5KAIH 1MZ9A 5APSA 3DS0A 2LKIA 1T6AA 5AVZB 5APUA 3L75D 3MD0A 3RL0D 1SS1A 3U1CA 1SQXG 4JPZB 2GZJA 2CGQA 1NTMD 1M7LA 4A7PA 1P84H 2NO8A 1QRJA 1QLED 1ZLLA 3BCCG 2IPPA 3MUDA 1KYOD 1OVUA 4GOEA 2OTLP 1SQVG 3Q1MA 3B5NA 2P9XA 2JYLA 2WSFH 1SQPG 5BS2A 4B86A 3O8ZA 1KB9E 2KOQA 2HODB 3GLMA 3CWBJ 1NJIQ 5GTHH 2CPBA 4BRYA 2JAZA 2BEQD 5KTBA 1DD3A 3CMAP 2E76D 5K5GB 1L4AA 2MVVA 2KGCA 4H2XC 2O01N 3HUSA 3L74D 2PEMA 1DD4A 4GOFA 2H7HA 2K88A 3CCUP 2LKMA 2Q1KA 3B4SA 3CXHD 3M1MA 5AW0B 2X2BA 1ZNVA 1FBMA 3B5NC 1T2KD 3HD7A 1NAFA 1DH3A 2E5YA 3EFFK 1CSBA 3P05A 2LXBA 3H1LG 2O1KA 1VPCA 5CBOA 1NU1E 5KLVD 1EQ7A 3P8CD 4EDFA 2CQ8A 1OW7A 5GTIH 1QGKB 2KUBA 2LIUA 3TNUA 3WUTA 1N7SC 1QVGO 4U0DA 3D6YA 3TYYA 2E5TA 3HUSC 1M1JC 2OYIA 1PL5A 2AF8A 1BSHA 5AW2B 2A06D 1ZMBA 4IL6E 5DCKA 1NOHA 1W2EA 1JOCA 1N7SB 1NTKD 4D6TE 3JC22 5AVWB 1RHZB 3KXDA 2ERHA 1NU1K 4PV1C 1RO2A 4XROA 3H1KD 2W27A 3CX5I 1F80D 1NU1J 1M56D 2FHSC 3MGEA 4WY4D 3RGUA 3FXEA 5APYA 2PENA 3U43A 1KB9I 1NTZE 1BCCJ 3V5BA 4HB1A 1FZFA 2M0BA 4PV1B 3H1HD 1HY8A 2KS1B 2V7QJ 2GM4A 2P58A 4PJ0H 2N9YB 2GDXA 2E1MA 1X79B 2H89C 1G2CA 3L37A 4GT1A 2KI7B 3CLQA 2WPSA 3GJNA 1SFCB 2XNDH 2K0XA 3G21A 3H1ID 4RESB 1DIPA 2ZFCA 4ZNCA 4NPFX 3H1JJ 2YKPA 3L75E 4NEOA 1H8AA 2W6AA 2WPVB 5HGLA 2Q3IA 1NTME 5CJ0A 1LTJC 1WRGA 1RE4C 4Y28J 3AE9C 1VQ8P 3L72J 1ZRTD 1BE3D 4K35A 2K0YA 1JTHB 2FVEA 3I55P 2NPSC 1LTJB 1OWAA 5KAFE 2FYUK 3KPEA 4U3FD 1KFMA 3NTEA 3ZDMA 3CCEP 1X9VA 3T97B 5F2NA 5APVA 1NTMK 2D2CD 4JQ0D 3CE7A 2FYUJ 5B5EH 3A0HE 1KN7A 1L0LE 2NPSB 4BPHA 3L75J 1A8OA 1VQOP 4OVNF 2N1TA 1NTMJ 3IFMA 4W7ZA 3TGUE 2KB7P 1E0HA 2OYOA 1AV1A 1FOSE 3O6QB 2W6JH 3L4FA 5APXA 2IYOA 2JJLA 1NVOA 3S1KA 3DS5A 3CXHE 1Q7YQ 2QJKC 4N78D 1LP1A 2EHTA 1LT9C 2M5RA 3NXSA 1U7JA 2LIWA 2KG8A 1Y8AA 3M9HA 2IBZI 3MHVA 1QL1A 3GMAA 3C1LA 4M3LA 2VLNA 3VP8A 2QJKB 2ZXEB 4AQRD 5KLVE 3EJBA 3P8CE 1OW6A 2B9BA 3KQGA 2KG6A 2YKOA 1H0TB 1L0IA 3IR9A 2WWWA 4K3AA 1LTSC 3LW5H 2Y0CA 2BCCE 1DEEG 2LF4A 3L74J 1IC2A 4EOTA 2FVAA 1K04A 5AVQB 3G29A 4W7YA 4XE5B 4EI2A 2M3EA 2RMZA 2I8DA 3EWKA 1HH0A 1NTKE 4WY4A 2ZYDA 3LRYA 4TT3H 5KJ7D 5KLVK 1VF5C 3N7NA 2VLQA 2OQQA 3H1KE 4BPGA 1RF1A 2JBGA 2EG5A 2M5AA 3SWFA 5KLVJ 2Q7CA 4IL6X 3F89A 3B5IA 2PP6A 3M0AA 1J1EB 5KLIC 1BDCA 2VRSA 3M91A 2IDBA 1NTKK 4PD4I 2ZXXA 5AVRB 2WVRA 2M8LA 2WSCJ 5AW5B 2K0DX 4XFJA 2FKWB 1CEIA 1FDIA 2ZJSE 2QIWA 5AVXB 3H25A 1JJ2O 1MV8A 1NTKJ 1IZNB 2GZFA 1PP9E 4C7NB 3L73G 5CCHC 2Q6QA 3H0DA 3JSVC 3HE4A 2AEFA 3HE5A 4GKGA 2WSEH 1USEA 4H2WC 2E74B 3H1KJ 2ZVOB 1QEXA 4NPEA 1R8EA 2FYNC 2C9NY 4H44C 2Y0DA 2A45H 4UB6H 3VMXA 3E1RA 3LIEA 4DOJA 4JBZA 2XT1A 3EFGA 3H1HJ 1EDJA 1BGYE 4COPA 3HTKB 1X3OA 1R5SA 2EIAA 4H44B 2GDYA 1UNKA 1DNYA 1BE3E 1ZRTE 3MP7B 3CX5D 2L0QA 1QVFO 4WWIA 4IPYA 3L70D 1SQBJ 4N6JA 4ZKPA 3B5ND 1HGZA 3H1IJ 1GD2E 1GXGA 2P2UA 1FZGA 3N4XA 2KOPA 1FZCC 1RE3C 2XXMA 3BASA 1K30A 5AW3B 1HVVA 1PPJD 1NH4A 3DS3A 1PEUA 5CBNA 1M8OB 1OVRA 1BE3J 3VN0A 2C9LY 4L74A 4UB8E 1VQ9P 2P1JA 5CCGC 1FZCB 4N78E 1IFPA 3FX0A 4U3FJ 2YMKA 1RF0A 2FY8A 4H13C 2FAEA 5EFWB 4PV1D 2ROQA 1NO4A 2A45G 3FWNA 3M0DC 3RL0g 1EC5A 1YJWP 2O3JA 4L75A 2LTEA 3S4RA 1HJBA 1FU1A 3L71E 5CHXA 2O01J 3AECC 5HGOA 4H13B 3G1IA 4R0MA 2YIUC 2C0WA 2KWLA 5AVVB 1ZV8A 2QM8A 2KIKA 3GHGB 3K5BA 1FZAA 4D6TD 4H0LB 1YHQP 4BWNA 1L0ND 2MY5A 2P67A 4GR6A 2FQ0A 2JU1A 3CC2P 4HKZH 1P84D 1JUNA 2Z44A 4U0CA 1Q82Q 2JO1A 2PFXA 1NTZD 3NTNA 3OA7A 1EZVI 3RK3C 1S5LH 4UHPB 2I1KA 5I4TG 2WSSH 3A5TA 1MZ8A 3FXDA 3WU2E 3RG2A 2Z45A 2VLOA 3C9IA 5AVUB 3RK3B 2MR8A 3CWBG 3TF5A 4GDOA 1IFIA 2IBZD 2JKVA 3A2AA 1SQQD 1JY3O 1YIJP 2I1JA 4QMAA 2Z5HA 2KK7A 4LLHA 2RN0A 3TDKA 1LGHB 2NPSD 3KYQA 3M9QA 2JYGA 1NGMB 2FFDC 2V7QH 1GK6A 3JCUH 2GA1A 3G3ZA 1T8ZA 1KILC 3F5HA 1VQMP 3HRNA 1CI6B 1JY2O 4IL6H 2FFDB 3G26A 2Q3EA 1S9KD 2Y9ZA 2E42A 3H32B 1JM0A 1KILB 1M57D 4YXDC 5TISE 2K1AA 1AUMA 3CX5E 3M06A 2IFMA 1QX8A 3L70E 3CCSP 1JB0J 3CD6P 3BVHA 5HGMA 1T8KA 2P7JA 1L0LD 1N73C 1VQNP 1MUUA 4PXHB 1LTAC 4PD4D 3BCCE 1N7SA 1EXIA 4QKOA 2ITAA 2L91A 3TGUD 5APWA 1JMBA 1OVVA 3GW6A 1M1JA 4BXLA 2HG5D 1PPJE 1H89A 2R44A 1N73B 2N1TD 2KOSA 1K8AQ 3BRVB 2QRXA 1HF9A 2O1JA 1HBWA 3L70J 1NU1G 4CPGA 2QE7H 1S4XA 2KS1A 1BCCG 1K9MQ 2RH0A 1KQSO 1VF5D 1Y9BA 3KDPB 3Q5SA 3PP5A 1KYOH 2E43A 1X0TA 2W6BA 2BCCD 1NAYA 2WPTA 1ZOYC 1N2DC 1Z6MA 1GXHA 2AXTE 5KAFH 2JB0A 2HPCB 2K3RA 4Y99B 1URQB 2GZEA 5KP7B 1RO0A 5KAIE 1IO4A 3H1JG 4WVZA 3V2RA 1L0NE 3RK2D 3CCQP 1UJZA 4HYTB 1RH5B 4AYCA 2EFJA 4GODA 1M6NA 3E7KA 1P84E 1PZQA 5CCHD 3GKLC 2KGEA 1JTHA 5HVCA 1LTJA 5H2FH 1VKUA 3L72G 1AQTA 2YO3A 1RE4A 2M3BA 2G3AA 3R2PA 1EMVA 3PTZA 3T97A 3P32A 1SFCC 1JCDA 5KKZC 1L0NK 2NPSA 5GTHE 2KOOA 1OZHA 2FXOA 4KJMA 1IMQA 1AYIA 2IBZE 2ZT9C 5L8RJ 3G1GA 1SQQE 2FYUG 2WTYA 4D6TJ 1PP9D 5DJUB 2KW2A 1L0NJ 2QVAA 3L75G 2XNXA 4M0IA 4TLFA 3H47A 1NTMG 1NTZK 2NRGA 3O6QA 5KKZB 2YMYA 1DEBA 2JO0A
chains in the Genus database with same CATH topology
1QVGO 1Q86Q 4U0DA 3I55P 2PY8A 1M6EX 3G0VA 2PEOA 3CXCO 2XXMA 1K30A 2EG5A 1VQ4P 3NTEA 3CCEP 2BQ1E 2DGYA 1K9MQ 2OARA 1YIJP 1YJ9P 1QRJA 3B5IA 1ZMBA 5F2NA 2KODA 1K73Q 3DS3A 1KQSO 5DCKA 1PEUA 3DPHA 1A43A 2PEKA 2OTLP 1VQ9P 4XFYA 3CMEP 1A8OA 2XV6A 1VQOP 4XFZA 3I56P 5HGNA 2JYGA 1M1KQ 1RO2A 2P9XA 4XROA 2JYLA 3G4SP 2M8LA 1VQ5P 5BS2A 3E2DA 1YI2P 5BS1A 3MGEA 4XRQA 1Q81Q 2PENA 4XFXA 1JJ2O 1M90Q 2ONTA 1NJIQ 1VQMP 3DTJA 4U0AA 3H0DA 1RO0A 3RG6C 3G71P 3G26A 3DS5A 3CMAP 3CCJP 1Q7YQ 2QEXP 1YJWP 1VQLP 2JO0A 3CCQP 5F2OA 1VQ6P 4QNBA 3VRLC 2PEQA 3G28A 5HGOA 1AUMA 2EFJA 2L6EA 1M6NA 3G1IA 4U0FA 2E1MA 4PH1A 3CCSP 2QA4P 5JPAA 1VQKP 2PEMA 2OTJP 3G6EP 4U0BA 2XT1A 2PEIA 3CD6P 3DS4A 2M8NA 4GR2A 1S72P 3CCUP 5HGMA 1RNIA 3HZQA 3CC7P 3CCLP 4WYMA 1PEOA 1YHQP 3DS2A 3M1MA 4COPA 3G21A 1VQNP 1W2BO 3H4EA 1VQPP 2BHVA 1E6JP 3CCRP 2EIAA 4COCA 4U0EA 1D1DA 1KD1Q 1EOQA 3Q20A 4GR6A 1PEMA 1QVFO 2LF4A 3CC2P 1M74A 4IPYA 5F2KA 5HGLA 3P05A 2Z44A 4U0CA 3CC4P 3CCVP 3G29A 1Q82Q 1PEQA 3G1GA 3WBHA 3HYBA 1VQ7P 1KC8Q 2Z46A 1IUQA 2CWOA 1BAJA 1K8AQ 5I4TG 4M0IA 1N8RQ 3DS1A 2PEJA 2BUOA 1VQ8P 3CCMP 1YJNP 3H47A 3LRYA 3OW2O 4PH0A 1YITP 3DS0A 3CPWO 1EIAA 2M8PA 2Z45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG O;  1Q86 Q;  3G4S P;  3I55 P;  1QVF O;  3CC2 P;  1VQ5 P;  2OTL P;  3CXC O;  3CCS P;  1YI2 P;  2QA4 P;  1VQ4 P;  1Q81 Q;  1VQK P;  3CCV P;  3CC4 P;  1Q82 Q;  3CCE P;  2OTJ P;  3G6E P;  1VQ6 P;  1JJ2 O;  1M90 Q;  1NJI Q;  1K9M Q;  1VQ7 P;  1YJ9 P;  1VQM P;  1YIJ P;  1KC8 Q;  1K73 Q;  3CD6 P;  1KQS O;  1S72 P;  3CCU P;  1K8A Q;  3G71 P;  1N8R Q;  3CC7 P;  3CCL P;  1VQL P;  1YHQ P;  3CMA P;  1VQ8 P;  3CCM P;  1YJN P;  3CCJ P;  1VQN P;  1W2B O;  1VQ9 P;  1Q7Y Q;  2QEX P;  3OW2 O;  1VQP P;  1VQO P;  1YJW P;  1YIT P;  3CME P;  3CCR P;  3CPW O;  3I56 P;  1M1K Q;  3CCQ P;  1KD1 Q; 
#chains in the Genus database with same CATH topology
 2ZT9 B;  1HTL C;  3IN6 A;  1NTZ J;  2JDI H;  2JGP A;  4EIJ A;  2AEM A;  2BQ1 E;  5AVS B;  3KZI H;  2MD9 A;  2WSC H;  2R32 A;  5APQ A;  3BRT B;  1BGY D;  1LNQ A;  2WQY C;  1IMP A;  1PGQ A;  1SQQ K;  1S9K E;  1HWT C;  2FXP A;  1S1C X;  1SQQ J;  1LT9 A;  3E2D A;  5AVT B;  2DNW A;  1EZV D;  1FS0 E;  3AEF C;  4YXW H;  2R5B A;  5CCG D;  5GTI E;  1FJP A;  2WT7 B;  1ZME C;  1CZQ A;  3V2Q A;  2KGD A;  1Q2N A;  4GIF A;  2W83 C;  3L74 G;  3WUU A;  1VQL P;  4PD4 E;  4H13 D;  4MRT C;  3G9R A;  2L6E A;  1CW5 A;  4PH1 A;  4YPC A;  2AFD A;  2QA4 P;  1P84 I;  1YQ4 C;  1E79 H;  1VQK P;  1H88 A;  3GF3 A;  5BVZ A;  3DS4 A;  2QG4 A;  3IF4 A;  3A7O A;  3V6I A;  1RNI A;  2GZG A;  4WYM A;  2K92 A;  3DS2 A;  2K9J B;  5B66 H;  1KD1 Q;  3PLN A;  3RL0 B;  1L0L K;  4LC1 A;  5KLV G;  5CJ4 A;  3HYB A;  2MKV A;  1IUQ A;  1L0L J;  4CA3 A;  2BUO A;  3VP9 A;  3Q3D A;  2PRR A;  2QJY C;  4PJ0 E;  3V2N A;  1UIX A;  3R4Y A;  1X22 A;  3L71 D;  1EIA A;  3OJA B;  2M8R A;  4C7N A;  2A06 G;  3TGU J;  2JR8 A;  1M6E X;  3RK3 D;  5EJD A;  1NTK G;  1X8Y A;  3TK1 A;  2KG9 A;  1XTC C;  2KSE A;  3L36 A;  3FGA D;  5C39 A;  5APT A;  1K73 Q;  2QJY B;  3H1K G;  1EDK A;  4WBA A;  3L35 A;  2GUV A;  5CCH A;  2BAS A;  2KSJ A;  4IZ6 A;  2E76 B;  1J1E C;  2POH A;  2MJZ A;  1LWU B;  3HTK A;  2KNC B;  2JQ4 A;  1OW8 A;  3H1H G;  2IFN A;  2O01 H;  2K37 A;  4U0A A;  2QSI A;  1IFJ A;  1LTB C;  2QEX P;  1JY2 P;  2BCC J;  4UB8 H;  3UIA A;  1SQB G;  3VRL C;  2B87 A;  5AW6 B;  3S9O A;  1GU5 A;  2E74 C;  2FAD A;  1MKM A;  1J1D C;  3H1I G;  3U1A A;  2GYK A;  4L73 A;  1OMI A;  3MZW B;  1KZU B;  2R3C A;  2L9F A;  1J1D B;  1PGO A;  3P7K A;  1FZC A;  1AF8 A;  1DX7 A;  1RE3 A;  1PEQ A;  1IJD B;  1RQV A;  1RY3 A;  1KC8 Q;  2Z46 A;  1BE3 G;  3VYI A;  1KQL A;  3BAT A;  1AA0 A;  4U3F G;  1YTZ T;  1NKZ B;  1XTG B;  1FZE A;  3ABV C;  2N50 A;  2M8P A;  5CCG A;  1Q86 Q;  1RQU A;  2JWA A;  3U59 A;  2PEO A;  1N86 A;  4ASW A;  1JMM A;  1VQ4 P;  1PP9 J;  3Q5R A;  4C46 A;  2KZJ A;  1EZV E;  1AQ5 A;  2LPK A;  2N5I A;  1SQX D;  1KMI Z;  5AW1 B;  2OYH C;  3DPH A;  1A43 A;  5M1B A;  2WIT A;  1RF1 B;  2M5A B;  2XV6 A;  3M0D A;  5AVY B;  3BCC D;  2JWD A;  2KP8 A;  1S3J A;  4DCK A;  1SQV D;  4I2L C;  3LID A;  2OYH B;  1IFM A;  1LT1 A;  3GZL A;  2ONT A;  2Y9Y A;  1BGY J;  3B8E B;  1SQP D;  3DTJ A;  2XZ1 C;  1QL2 A;  1JO5 A;  1N7S D;  1BXI A;  1FDM A;  1IFN A;  1KOR A;  3VMY A;  2FXM A;  4DJG A;  1AFO A;  4OGQ C;  2YO2 A;  2IZ1 A;  2N5H A;  4I6M C;  1IFD A;  3EJE A;  3A0B E;  1L2P A;  2XZ0 D;  3HZQ A;  3GHG C;  1W2B O;  4OGQ B;  1ZW0 A;  3EQ2 A;  3SWY A;  2IYP A;  4H0L C;  1U7M A;  3RK3 E;  5TIS H;  3NY7 B;  1G1I A;  2R5D A;  1GDT A;  3FWL A;  3V4W A;  3WBH A;  2E75 C;  3VOP A;  1KB9 H;  2CWO A;  1A02 J;  1GW3 A;  2D2C B;  3D71 A;  1SFC D;  4W80 A;  4JYB A;  2YNY A;  3H1L D;  3M9B A;  4ZKU A;  3AE1 C;  3OW2 O;  1YIT P;  3USS A;  3CPW O;  1KQG B;  1GW4 A;  3SFD C;  1CI6 A;  2XDJ A;  4UB6 E;  2FFD A;  2E75 B;  2QNW A;  2XV5 A;  2V4H A;  3H32 A;  4OWF A;  1KIL A;  5AW7 B;  2L4B A;  3D6Z A;  2LOL A;  3L71 J;  2HOD A;  2VLP A;  5HGN A;  1D7M A;  1KIL E;  2K5X A;  2RKL A;  1Q81 Q;  2WSE J;  1M90 Q;  3QWO C;  2KGA A;  2FAC A;  2Q9I A;  2J59 M;  3MIW A;  1LTI C;  1N73 A;  5KP6 B;  1OFC X;  3ITK A;  3AEA C;  5CMZ A;  4DG9 A;  4KT0 J;  1GK4 A;  2R3S A;  5AW8 B;  3CC7 P;  2KR5 A;  3VTP C;  3II6 A;  3L70 G;  1T3U A;  1VQP P;  4F37 A;  2BEZ F;  2G8Y A;  1K05 A;  1M74 A;  1PGP A;  2QJP B;  1J2J B;  1GL2 C;  2H8P D;  2GZI A;  1LTT C;  1SQX E;  3V2P A;  5E79 E;  2HPC A;  1DV5 A;  3SFE C;  1URQ A;  3V4Q A;  4BPF A;  1PPJ G;  2ZYG A;  1GL2 B;  2YXQ B;  2A45 I;  1ZP0 C;  4YTP C;  1SQV E;  3PRJ A;  1GU4 A;  3AEE C;  2B89 A;  1KV4 A;  2KOD A;  1SQP E;  2ZVN B;  1GTW A;  1FZB A;  1SQX K;  2L22 A;  2Z5I A;  1SP4 A;  1FJK A;  3CI9 A;  2PAJ A;  1SQX J;  2GDW A;  1S5L E;  3SSU A;  2K9Y A;  1Q90 D;  1FAV A;  3MUD C;  1SQV K;  2PNG A;  4Y99 C;  3CCJ P;  1URQ C;  3BCC J;  1SQP K;  1MFZ A;  1VQ6 P;  5F2O A;  1WMK A;  1U57 A;  1SQV J;  1SFC A;  2N6Z A;  4IOI H;  4D6T G;  1HUC A;  1SQP J;  3RBZ A;  1L0N G;  3IAO A;  3B5N B;  1BCC E;  4KHX A;  1PGJ A;  3H1L E;  4I7Z C;  3SWK A;  2HR3 A;  2E74 D;  3A0H H;  1UII A;  3W68 A;  4COC A;  4U0E A;  1L4A C;  1PEM A;  1ACP A;  1NTZ G;  3AE7 C;  3JCU E;  4BRY B;  1ZR4 A;  4PD4 H;  5F2K A;  1FE6 A;  4RKU J;  3A3Y B;  3AE5 C;  2LXC B;  3CC4 P;  3CCV P;  1IK9 A;  2PGD A;  1EDL A;  1VHN A;  2FQ2 A;  3GZM A;  4I7Z B;  3HD7 C;  1L4A B;  3PH0 A;  4HKG A;  2IBZ G;  3HUS B;  1M1J B;  2SPZ A;  1YQ3 C;  4H44 D;  1SQQ G;  3CXH H;  2JP3 A;  4XA4 A;  1BDD A;  2WT7 A;  1GPJ A;  3H1J E;  3AE4 C;  2DGY A;  3HD7 B;  4DZO A;  3H1L J;  2W8Z A;  1NQ4 A;  4WB4 A;  1NWQ A;  4HH2 A;  3AE6 C;  1ZR2 A;  3L72 E;  1M1K Q;  2OYI C;  1VQ5 P;  1WT6 A;  2K9J A;  2FBW C;  1AVO A;  1PFI A;  1SQB D;  1PIX A;  2MF4 A;  1HJ0 A;  3NMD A;  3TNU B;  2J58 A;  3RG6 C;  2LML A;  3AEB C;  2WSF J;  2K94 A;  3W67 A;  2FYU E;  2OYI B;  2J5U A;  4O9B A;  2KOR A;  3L73 D;  1AJY A;  1GMJ A;  1YTZ I;  2PEQ A;  3G28 A;  4NPD A;  1KLP A;  2FYZ A;  3B4Q A;  2Y0E A;  3AED C;  4RJT A;  2W90 A;  2AVA A;  1OX3 A;  1L0L G;  1H0T A;  2OTJ P;  1ZN5 A;  2KYV A;  1Z56 A;  4IFF A;  4LGD E;  4HJG H;  2B88 A;  2K2Q A;  1PEO A;  1KYO E;  4OGQ D;  1FR2 A;  1YYC A;  3TGU G;  2IX7 C;  4ASV A;  3D70 A;  4N3Y B;  2Q5U A;  3PJS K;  3RL0 C;  2JU2 A;  1USD A;  3B71 A;  1LWU A;  1LTG C;  3PHL A;  2KNC A;  4U7J A;  2PEJ A;  4H0L D;  1YJN P;  1G2C B;  4AUW A;  1S2E A;  2LL8 A;  2E75 D;  3CXC O;  7CEI A;  3L74 E;  5H2F E;  1GZL A;  1KFN A;  4L76 A;  2OAR A;  1YJ9 P;  3I5C A;  2BCC G;  2PEK A;  3CME P;  3I56 P;  3WUV A;  2OTK E;  3G4S P;  2E76 C;  1BSN A;  1S5L X;  3E1I A;  4PWV B;  3Q2Y A;  3LMO A;  1LWU C;  3NFQ A;  1JY3 P;  1LT9 B;  2N1T C;  4EYY Q;  1PV3 A;  2CK3 H;  4QNB A;  3H6P A;  1NYH A;  4Z1M H;  1T2K C;  3KZI E;  2A06 E;  4GR2 A;  2N1T B;  2XZR A;  2WPQ A;  3CCL P;  1KYO I;  3AE3 C;  2BHV A;  3CCR P;  1D1D A;  1KIL D;  5AW4 B;  1PP9 G;  2XU6 A;  1SLQ A;  4C7R A;  1VQ7 P;  1T3J A;  3KHU A;  5B5E E;  1LP1 B;  3A0B H;  2K93 A;  1VF5 B;  1YBK A;  2VSQ A;  1N8R Q;  3H1H E;  2OYH A;  3CCM P;  1NKN A;  5AW9 B;  5HV8 A;  4PH0 A;  3Q5P A;  3GF7 A;  1NHL A;  1GL2 D;  2PY8 A;  3RK2 C;  1FOS F;  1BGY G;  2Z4E A;  3CL3 D;  1N7L A;  1SQB E;  1R5L A;  5KLI B;  4WY4 C;  3CWB D;  2OGU A;  2H88 C;  3WMM 0;  5B66 E;  1EDI A;  3CXH I;  3H1I E;  5TJH A;  4XFY A;  1IK7 A;  3RK2 B;  2FVF A;  1JCC A;  3L73 E;  4I1L A;  1EZV G;  1RF1 C;  2HLO A;  3P8M C;  3QH9 A;  4DT0 A;  1YI2 P;  4XRQ A;  4WY4 B;  1LJ2 A;  4XFX A;  2KLV A;  4ZMD A;  1E5W A;  4R4L A;  2YKQ A;  2XKM A;  2WMM A;  5CZD B;  1SQB K;  5KP8 B;  2FYN B;  2JEE A;  1VDF A;  3RBX A;  3GHG A;  3WU2 H;  2ZAE B;  4U3F E;  1HGV A;  2N6Y A;  1KB9 D;  1VL2 A;  2HFE D;  3G6E P;  2KZI A;  4U0B A;  1EXJ A;  1URQ D;  2PEI A;  3MGN A;  2M8N A;  1S72 P;  2N98 A;  2B87 B;  2N9B A;  3L73 J;  2LR2 A;  5BU8 B;  2CNR A;  1OIP A;  2L5G B;  1EOQ A;  3OAK A;  1AVY A;  3HE4 B;  3HE5 B;  3C8V A;  1JY3 N;  1KQF B;  2AFE A;  3L71 G;  3LW5 J;  2DW3 A;  1L4A D;  3DS1 A;  5BU5 A;  2D2C C;  3G0V A;  4MN4 C;  3CX5 H;  3TSI A;  3HD7 D;  1NU1 D;  2QM7 A;  2NZ2 A;  4RO0 A;  1BCC D;  2CPS A;  3AEG C;  1JY2 N;  5E79 H;  1ZXG A;  4XFZ A;  2GUS A;  2WZ7 A;  3EJD A;  2ZT9 D;  2FQ1 A;  2MR7 A;  5BS1 A;  5KJ7 A;  3AE2 C;  2CG5 B;  2ZYA A;  1MFT A;  3VMA A;  3G71 P;  4IFD K;  3AE8 C;  3GG2 A;  1FC2 C;  2YIU B;  2C0X A;  1HQB A;  4H2Y C;  1OXZ A;  1Y47 A;  3H1J D;  4U0F A;  1RF0 C;  5EW5 E;  2KXP B;  2H43 A;  5JPA A;  2UWJ E;  2AEJ A;  3VMZ A;  1G1J A;  4JYC A;  1GL2 A;  1TU3 F;  1L0H A;  4IFM A;  2KLU A;  1FDO A;  4JF7 A;  3H4E A;  1OR5 A;  1SVF A;  3MTU E;  1E6J P;  2HYN A;  1W5C E;  2WPR A;  3L72 D;  3Q20 A;  2YXR B;  5KJ7 C;  2MVU A;  1JNM A;  4R4M A;  2KOG A;  4OH8 B;  5DJT B;  2EHS A;  2AXT H;  2IZ0 A;  2AXC A;  2QJP C;  1KTM A;  1BAJ A;  3CWB E;  2P10 A;  1A02 F;  1JEK A;  2FYU D;  5KAI H;  1MZ9 A;  5APS A;  3DS0 A;  2LKI A;  1T6A A;  5AVZ B;  5APU A;  3L75 D;  3MD0 A;  3RL0 D;  1SS1 A;  3U1C A;  1SQX G;  4JPZ B;  2GZJ A;  2CGQ A;  1NTM D;  1M7L A;  4A7P A;  1P84 H;  2NO8 A;  1QRJ A;  1QLE D;  1ZLL A;  3BCC G;  2IPP A;  3MUD A;  1KYO D;  1OVU A;  4GOE A;  2OTL P;  1SQV G;  3Q1M A;  3B5N A;  2P9X A;  2JYL A;  2WSF H;  1SQP G;  5BS2 A;  4B86 A;  3O8Z A;  1KB9 E;  2KOQ A;  2HOD B;  3GLM A;  3CWB J;  1NJI Q;  5GTH H;  2CPB A;  4BRY A;  2JAZ A;  2BEQ D;  5KTB A;  1DD3 A;  3CMA P;  2E76 D;  5K5G B;  1L4A A;  2MVV A;  2KGC A;  4H2X C;  2O01 N;  3HUS A;  3L74 D;  2PEM A;  1DD4 A;  4GOF A;  2H7H A;  2K88 A;  3CCU P;  2LKM A;  2Q1K A;  3B4S A;  3CXH D;  3M1M A;  5AW0 B;  2X2B A;  1ZNV A;  1FBM A;  3B5N C;  1T2K D;  3HD7 A;  1NAF A;  1DH3 A;  2E5Y A;  3EFF K;  1CSB A;  3P05 A;  2LXB A;  3H1L G;  2O1K A;  1VPC A;  5CBO A;  1NU1 E;  5KLV D;  1EQ7 A;  3P8C D;  4EDF A;  2CQ8 A;  1OW7 A;  5GTI H;  1QGK B;  2KUB A;  2LIU A;  3TNU A;  3WUT A;  1N7S C;  1QVG O;  4U0D A;  3D6Y A;  3TYY A;  2E5T A;  3HUS C;  1M1J C;  2OYI A;  1PL5 A;  2AF8 A;  1BSH A;  5AW2 B;  2A06 D;  1ZMB A;  4IL6 E;  5DCK A;  1NOH A;  1W2E A;  1JOC A;  1N7S B;  1NTK D;  4D6T E;  3JC2 2;  5AVW B;  1RHZ B;  3KXD A;  2ERH A;  1NU1 K;  4PV1 C;  1RO2 A;  4XRO A;  3H1K D;  2W27 A;  3CX5 I;  1F80 D;  1NU1 J;  1M56 D;  2FHS C;  3MGE A;  4WY4 D;  3RGU A;  3FXE A;  5APY A;  2PEN A;  3U43 A;  1KB9 I;  1NTZ E;  1BCC J;  3V5B A;  4HB1 A;  1FZF A;  2M0B A;  4PV1 B;  3H1H D;  1HY8 A;  2KS1 B;  2V7Q J;  2GM4 A;  2P58 A;  4PJ0 H;  2N9Y B;  2GDX A;  2E1M A;  1X79 B;  2H89 C;  1G2C A;  3L37 A;  4GT1 A;  2KI7 B;  3CLQ A;  2WPS A;  3GJN A;  1SFC B;  2XND H;  2K0X A;  3G21 A;  3H1I D;  4RES B;  1DIP A;  2ZFC A;  4ZNC A;  4NPF X;  3H1J J;  2YKP A;  3L75 E;  4NEO A;  1H8A A;  2W6A A;  2WPV B;  5HGL A;  2Q3I A;  1NTM E;  5CJ0 A;  1LTJ C;  1WRG A;  1RE4 C;  4Y28 J;  3AE9 C;  1VQ8 P;  3L72 J;  1ZRT D;  1BE3 D;  4K35 A;  2K0Y A;  1JTH B;  2FVE A;  3I55 P;  2NPS C;  1LTJ B;  1OWA A;  5KAF E;  2FYU K;  3KPE A;  4U3F D;  1KFM A;  3NTE A;  3ZDM A;  3CCE P;  1X9V A;  3T97 B;  5F2N A;  5APV A;  1NTM K;  2D2C D;  4JQ0 D;  3CE7 A;  2FYU J;  5B5E H;  3A0H E;  1KN7 A;  1L0L E;  2NPS B;  4BPH A;  3L75 J;  1A8O A;  1VQO P;  4OVN F;  2N1T A;  1NTM J;  3IFM A;  4W7Z A;  3TGU E;  2KB7 P;  1E0H A;  2OYO A;  1AV1 A;  1FOS E;  3O6Q B;  2W6J H;  3L4F A;  5APX A;  2IYO A;  2JJL A;  1NVO A;  3S1K A;  3DS5 A;  3CXH E;  1Q7Y Q;  2QJK C;  4N78 D;  1LP1 A;  2EHT A;  1LT9 C;  2M5R A;  3NXS A;  1U7J A;  2LIW A;  2KG8 A;  1Y8A A;  3M9H A;  2IBZ I;  3MHV A;  1QL1 A;  3GMA A;  3C1L A;  4M3L A;  2VLN A;  3VP8 A;  2QJK B;  2ZXE B;  4AQR D;  5KLV E;  3EJB A;  3P8C E;  1OW6 A;  2B9B A;  3KQG A;  2KG6 A;  2YKO A;  1H0T B;  1L0I A;  3IR9 A;  2WWW A;  4K3A A;  1LTS C;  3LW5 H;  2Y0C A;  2BCC E;  1DEE G;  2LF4 A;  3L74 J;  1IC2 A;  4EOT A;  2FVA A;  1K04 A;  5AVQ B;  3G29 A;  4W7Y A;  4XE5 B;  4EI2 A;  2M3E A;  2RMZ A;  2I8D A;  3EWK A;  1HH0 A;  1NTK E;  4WY4 A;  2ZYD A;  3LRY A;  4TT3 H;  5KJ7 D;  5KLV K;  1VF5 C;  3N7N A;  2VLQ A;  2OQQ A;  3H1K E;  4BPG A;  1RF1 A;  2JBG A;  2EG5 A;  2M5A A;  3SWF A;  5KLV J;  2Q7C A;  4IL6 X;  3F89 A;  3B5I A;  2PP6 A;  3M0A A;  1J1E B;  5KLI C;  1BDC A;  2VRS A;  3M91 A;  2IDB A;  1NTK K;  4PD4 I;  2ZXX A;  5AVR B;  2WVR A;  2M8L A;  2WSC J;  5AW5 B;  2K0D X;  4XFJ A;  2FKW B;  1CEI A;  1FDI A;  2ZJS E;  2QIW A;  5AVX B;  3H25 A;  1JJ2 O;  1MV8 A;  1NTK J;  1IZN B;  2GZF A;  1PP9 E;  4C7N B;  3L73 G;  5CCH C;  2Q6Q A;  3H0D A;  3JSV C;  3HE4 A;  2AEF A;  3HE5 A;  4GKG A;  2WSE H;  1USE A;  4H2W C;  2E74 B;  3H1K J;  2ZVO B;  1QEX A;  4NPE A;  1R8E A;  2FYN C;  2C9N Y;  4H44 C;  2Y0D A;  2A45 H;  4UB6 H;  3VMX A;  3E1R A;  3LIE A;  4DOJ A;  4JBZ A;  2XT1 A;  3EFG A;  3H1H J;  1EDJ A;  1BGY E;  4COP A;  3HTK B;  1X3O A;  1R5S A;  2EIA A;  4H44 B;  2GDY A;  1UNK A;  1DNY A;  1BE3 E;  1ZRT E;  3MP7 B;  3CX5 D;  2L0Q A;  1QVF O;  4WWI A;  4IPY A;  3L70 D;  1SQB J;  4N6J A;  4ZKP A;  3B5N D;  1HGZ A;  3H1I J;  1GD2 E;  1GXG A;  2P2U A;  1FZG A;  3N4X A;  2KOP A;  1FZC C;  1RE3 C;  2XXM A;  3BAS A;  1K30 A;  5AW3 B;  1HVV A;  1PPJ D;  1NH4 A;  3DS3 A;  1PEU A;  5CBN A;  1M8O B;  1OVR A;  1BE3 J;  3VN0 A;  2C9L Y;  4L74 A;  4UB8 E;  1VQ9 P;  2P1J A;  5CCG C;  1FZC B;  4N78 E;  1IFP A;  3FX0 A;  4U3F J;  2YMK A;  1RF0 A;  2FY8 A;  4H13 C;  2FAE A;  5EFW B;  4PV1 D;  2ROQ A;  1NO4 A;  2A45 G;  3FWN A;  3M0D C;  3RL0 g;  1EC5 A;  1YJW P;  2O3J A;  4L75 A;  2LTE A;  3S4R A;  1HJB A;  1FU1 A;  3L71 E;  5CHX A;  2O01 J;  3AEC C;  5HGO A;  4H13 B;  3G1I A;  4R0M A;  2YIU C;  2C0W A;  2KWL A;  5AVV B;  1ZV8 A;  2QM8 A;  2KIK A;  3GHG B;  3K5B A;  1FZA A;  4D6T D;  4H0L B;  1YHQ P;  4BWN A;  1L0N D;  2MY5 A;  2P67 A;  4GR6 A;  2FQ0 A;  2JU1 A;  3CC2 P;  4HKZ H;  1P84 D;  1JUN A;  2Z44 A;  4U0C A;  1Q82 Q;  2JO1 A;  2PFX A;  1NTZ D;  3NTN A;  3OA7 A;  1EZV I;  3RK3 C;  1S5L H;  4UHP B;  2I1K A;  5I4T G;  2WSS H;  3A5T A;  1MZ8 A;  3FXD A;  3WU2 E;  3RG2 A;  2Z45 A;  2VLO A;  3C9I A;  5AVU B;  3RK3 B;  2MR8 A;  3CWB G;  3TF5 A;  4GDO A;  1IFI A;  2IBZ D;  2JKV A;  3A2A A;  1SQQ D;  1JY3 O;  1YIJ P;  2I1J A;  4QMA A;  2Z5H A;  2KK7 A;  4LLH A;  2RN0 A;  3TDK A;  1LGH B;  2NPS D;  3KYQ A;  3M9Q A;  2JYG A;  1NGM B;  2FFD C;  2V7Q H;  1GK6 A;  3JCU H;  2GA1 A;  3G3Z A;  1T8Z A;  1KIL C;  3F5H A;  1VQM P;  3HRN A;  1CI6 B;  1JY2 O;  4IL6 H;  2FFD B;  3G26 A;  2Q3E A;  1S9K D;  2Y9Z A;  2E42 A;  3H32 B;  1JM0 A;  1KIL B;  1M57 D;  4YXD C;  5TIS E;  2K1A A;  1AUM A;  3CX5 E;  3M06 A;  2IFM A;  1QX8 A;  3L70 E;  3CCS P;  1JB0 J;  3CD6 P;  3BVH A;  5HGM A;  1T8K A;  2P7J A;  1L0L D;  1N73 C;  1VQN P;  1MUU A;  4PXH B;  1LTA C;  4PD4 D;  3BCC E;  1N7S A;  1EXI A;  4QKO A;  2ITA A;  2L91 A;  3TGU D;  5APW A;  1JMB A;  1OVV A;  3GW6 A;  1M1J A;  4BXL A;  2HG5 D;  1PPJ E;  1H89 A;  2R44 A;  1N73 B;  2N1T D;  2KOS A;  1K8A Q;  3BRV B;  2QRX A;  1HF9 A;  2O1J A;  1HBW A;  3L70 J;  1NU1 G;  4CPG A;  2QE7 H;  1S4X A;  2KS1 A;  1BCC G;  1K9M Q;  2RH0 A;  1KQS O;  1VF5 D;  1Y9B A;  3KDP B;  3Q5S A;  3PP5 A;  1KYO H;  2E43 A;  1X0T A;  2W6B A;  2BCC D;  1NAY A;  2WPT A;  1ZOY C;  1N2D C;  1Z6M A;  1GXH A;  2AXT E;  5KAF H;  2JB0 A;  2HPC B;  2K3R A;  4Y99 B;  1URQ B;  2GZE A;  5KP7 B;  1RO0 A;  5KAI E;  1IO4 A;  3H1J G;  4WVZ A;  3V2R A;  1L0N E;  3RK2 D;  3CCQ P;  1UJZ A;  4HYT B;  1RH5 B;  4AYC A;  2EFJ A;  4GOD A;  1M6N A;  3E7K A;  1P84 E;  1PZQ A;  5CCH D;  3GKL C;  2KGE A;  1JTH A;  5HVC A;  1LTJ A;  5H2F H;  1VKU A;  3L72 G;  1AQT A;  2YO3 A;  1RE4 A;  2M3B A;  2G3A A;  3R2P A;  1EMV A;  3PTZ A;  3T97 A;  3P32 A;  1SFC C;  1JCD A;  5KKZ C;  1L0N K;  2NPS A;  5GTH E;  2KOO A;  1OZH A;  2FXO A;  4KJM A;  1IMQ A;  1AYI A;  2IBZ E;  2ZT9 C;  5L8R J;  3G1G A;  1SQQ E;  2FYU G;  2WTY A;  4D6T J;  1PP9 D;  5DJU B;  2KW2 A;  1L0N J;  2QVA A;  3L75 G;  2XNX A;  4M0I A;  4TLF A;  3H47 A;  1NTM G;  1NTZ K;  2NRG A;  3O6Q A;  5KKZ B;  2YMY A;  1DEB A;  2JO0 A; 
#chains in the Genus database with same CATH homology
 1QVG O;  1Q86 Q;  4U0D A;  3I55 P;  2PY8 A;  1M6E X;  3G0V A;  2PEO A;  3CXC O;  2XXM A;  1K30 A;  2EG5 A;  1VQ4 P;  3NTE A;  3CCE P;  2BQ1 E;  2DGY A;  1K9M Q;  2OAR A;  1YIJ P;  1YJ9 P;  1QRJ A;  3B5I A;  1ZMB A;  5F2N A;  2KOD A;  1K73 Q;  3DS3 A;  1KQS O;  5DCK A;  1PEU A;  3DPH A;  1A43 A;  2PEK A;  2OTL P;  1VQ9 P;  4XFY A;  3CME P;  1A8O A;  2XV6 A;  1VQO P;  4XFZ A;  3I56 P;  5HGN A;  2JYG A;  1M1K Q;  1RO2 A;  2P9X A;  4XRO A;  2JYL A;  3G4S P;  2M8L A;  1VQ5 P;  5BS2 A;  3E2D A;  1YI2 P;  5BS1 A;  3MGE A;  4XRQ A;  1Q81 Q;  2PEN A;  4XFX A;  1JJ2 O;  1M90 Q;  2ONT A;  1NJI Q;  1VQM P;  3DTJ A;  4U0A A;  3H0D A;  1RO0 A;  3RG6 C;  3G71 P;  3G26 A;  3DS5 A;  3CMA P;  3CCJ P;  1Q7Y Q;  2QEX P;  1YJW P;  1VQL P;  2JO0 A;  3CCQ P;  5F2O A;  1VQ6 P;  4QNB A;  3VRL C;  2PEQ A;  3G28 A;  5HGO A;  1AUM A;  2EFJ A;  2L6E A;  1M6N A;  3G1I A;  4U0F A;  2E1M A;  4PH1 A;  3CCS P;  2QA4 P;  5JPA A;  1VQK P;  2PEM A;  2OTJ P;  3G6E P;  4U0B A;  2XT1 A;  2PEI A;  3CD6 P;  3DS4 A;  2M8N A;  4GR2 A;  1S72 P;  3CCU P;  5HGM A;  1RNI A;  3HZQ A;  3CC7 P;  3CCL P;  4WYM A;  1PEO A;  1YHQ P;  3DS2 A;  3M1M A;  4COP A;  3G21 A;  1VQN P;  1W2B O;  3H4E A;  1VQP P;  2BHV A;  1E6J P;  3CCR P;  2EIA A;  4COC A;  4U0E A;  1D1D A;  1KD1 Q;  1EOQ A;  3Q20 A;  4GR6 A;  1PEM A;  1QVF O;  2LF4 A;  3CC2 P;  1M74 A;  4IPY A;  5F2K A;  5HGL A;  3P05 A;  2Z44 A;  4U0C A;  3CC4 P;  3CCV P;  3G29 A;  1Q82 Q;  1PEQ A;  3G1G A;  3WBH A;  3HYB A;  1VQ7 P;  1KC8 Q;  2Z46 A;  1IUQ A;  2CWO A;  1BAJ A;  1K8A Q;  5I4T G;  4M0I A;  1N8R Q;  3DS1 A;  2PEJ A;  2BUO A;  1VQ8 P;  3CCM P;  1YJN P;  3H47 A;  3LRY A;  3OW2 O;  4PH0 A;  1YIT P;  3DS0 A;  3CPW O;  1EIA A;  2M8P A;  2Z45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...