3CC4P

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc4P02
2OTJP 1VQKP 1VQOP 1M1KQ 1KD1Q 1JJ2O 1K9MQ 3CC7P 1VQMP 1Q7YQ 1VQ4P 3I55P 1YHQP 2QEXP 1K73Q 3CC2P 3CCMP 3CXCO 1VQPP 3CMAP 1YI2P 1S72P 1K8AQ 3CC4P 3CMEP 1VQ9P 3G4SP 3CCVP 1Q86Q 1KC8Q 1VQ8P 1YITP 1VQ7P 3CCUP 3G71P 1YJNP 3CCQP 3CCRP 1YJWP 1KQSO 1QVGO 3CCJP 1YJ9P 1N8RQ 3CCSP 3CCLP 1QVFO 1VQ6P 3CD6P 1VQ5P 1NJIQ 3CPWO 3G6EP 1VQLP 1VQNP 2QA4P 3I56P 1W2BO 3OW2O 1YIJP 1Q81Q 1Q82Q 3CCEP 1M90Q 2OTLP
chains in the Genus database with same CATH superfamily
1BXIA 1QL2A 2ZJSE 1K04A 3G9RA 4UB8E 1FE6A 2N1TB 1NGMB 1CEIA 2N1TC 4F37A 2OYHA 3CE7A 1JTHB 1S2EA 2ERHA 2KSEA 1VQKP 5JPAA 1KILC 2R32A 3HTKB 2VSQA 1AQ5A 3USSA 2QG4A 3VYIA 4EOTA 1YJNP 3NY7B 2HYNA 3IFMA 1E0HA 1GMJA 2GM4A 1IMQA 1CI6B 5M1BA 1JOCA 3BASA 3BCCJ 2WT7A 3BATA 1S4XA 4AUWA 2MR8A 4M0IA 1PFIA 2KNCA 3RBZA 2W8ZA 2CQ8A 2C0WA 2H7HA 1HH0A 2JGPA 2LF4A 1RF1A 4AYCA 1A8OA 4HYTB 2BCCJ 2E74D 1HGVA 1L2PA 3GHGA 3HD7C 3CC7P 1VDFA 3L73J 1GW3A 1JY3N 1GL2B 1RE3C 2H43A 1UNKA 5KKZC 1G2CA 1LP1A 3M1MA 1VQ6P 2ZYGA 3HZQA 1PEOA 2HODB 1FDOA 3PLNA 2KGAA 4DZOA 1RF1C 3AE6C 2VLPA 1LWUB 3HYBA 3M0DC 2E76B 1Y8AA 3FX0A 4EI2A 4PV1B 1N7SB 2FQ0A 2J59M 1AYIA 2FYUD 2XV5A 1GXHA 3DS5A 1ZLLA 1JY2O 3FXEA 1PEMA 3M9HA 3VMZA 4HKGA 3CPWO 1GTWA 1VQLP 2ZT9D 3PRJA 3HRNA 3L73E 1ZRTE 3TGUE 3V2NA 2OARA 2VRSA 3M06A 3DS0A 2JYLA 2KGCA 4UB8H 1URQB 1BE3J 2OYIA 2WT7B 3MIWA 4U0EA 1PP9G 1DX7A 5AW7B 3AE5C 2HR3A 4O9BA 2N1TA 2Q9IA 1USEA 5KKZB 2WMMA 2IZ0A 1K05A 2YIUC 2FFDA 1NAFA 3R4YA 2P67A 1R5LA 4UHPB 1JEKA 1M56D 5EFWB 5BS1A 2KG6A 1GZLA 3RK3D 1RH5B 1BDDA 1LTAC 1U7JA 1OVUA 2KW2A 1YQ3C 5AVTB 1OXZA 4YXDC 1NU1K 1LP1B 2FVFA 2HPCB 2LXCB 3D6YA 3A0HE 2E76C 2IBZD 3KZIE 3RL0D 3CX5I 1S5LH 3AE1C 1FDMA 2KG9A 1LTSC 3EFFK 1KB9H 2FYUG 1JJ2O 2JWAA 2LR2A 2JKVA 1BE3D 3H1IG 3RGUA 2IYOA 2O3JA 2WPVB 2JWDA 1FZBA 2PY8A 2YKPA 1NTMG 3P7KA 2DW3A 1HJBA 1GW4A 2E42A 5EJDA 3CWBE 4XRQA 2NO8A 1N86A 4BPHA 5AW4B 4XFXA 2K0XA 3F5HA 2AEMA 1IFDA 4WVZA 3V5BA 4TLFA 5CMZA 2QA4P 1ACPA 4PD4E 4ASWA 1T3JA 3MGEA 2O1KA 3Q1MA 2K1AA 4COPA 2I8DA 3H32B 2EHTA 2Z5IA 1EMVA 2NRGA 1WRGA 1SQXG 4ASVA 2BASA 1OR5A 2LTEA 1PV3A 1RQUA 3L75D 2M3EA 2KR5A 4XE5B 4GR2A 1KLPA 4RO0A 1NTMD 1K73Q 2FYNB 1NTZK 3CCVP 2CNRA 1YJWP 2K3RA 3GHGB 3A0HH 2N50A 3E1RA 4DJGA 4D6TE 4BRYA 2QE7H 4H0LC 3CCEP 2LMLA 2WSEH 1H88A 2ZT9C 3H1IJ 2JU1A 3JSVC 1SQQD 2FYUJ 4H13C 1VQPP 5KJ7C 1J1DB 1Q86Q 1T8ZA 4XA4A 1NTZG 2O1JA 1L0LK 1M74A 4GOEA 4R0MA 2PEKA 1JY3O 3HE4A 3A2AA 4IFDK 3I5CA 2XKMA 5HGNA 2L5GB 1SQBD 2H8PD 5KLVE 2K9JB 3L71D 2I1KA 3H1IE 4U7JA 1L0LG 3L72G 1ZMBA 2WWWA 5F2OA 1SQBJ 5AVSB 2YO2A 4B86A 1QL1A 1WT6A 2E74C 1L4AB 4U0BA 1SQVG 1SQVE 2L91A 4GKGA 2YMKA 1NWQA 2KIKA 2OGUA 3FGAD 1AUMA 1IJDB 1VL2A 3L72E 2A06D 1EXJA 5AW0B 1PP9E 2YIUB 2YKOA 3SFDC 5BS2A 3CD6P 3D70A 1EZVE 2KS1B 2QJPB 3I56P 1M1JC 4K35A 3DTJA 3O8ZA 3AE7C 2NZ2A 2QRXA 2HG5D 2E75D 2FXPA 1PPJD 4OH8B 1G1JA 3CX5H 3P8CD 2LIUA 4H44B 2ZVOB 2WSFH 1SQXK 1RE3A 1X22A 1N7SD 4H44C 1N8RQ 4BPGA 1AVOA 4IPYA 1SQPK 1KQLA 2A06G 3P05A 3DS1A 5AW8B 4IL6H 2P9XA 3NTNA 3H1KD 2ZFCA 4I1LA 2B87A 4KT0J 2XV6A 3AE4C 1AA0A 3A3YB 1BCCJ 1GK6A 2MR7A 1EOQA 1KMIZ 1J2JB 4BWNA 4D6TG 3L72D 4GOFA 3DS3A 1M1KQ 3TDKA 2WSEJ 3AEGC 3G29A 1NH4A 3I55P 1SQQG 1BCCE 3M0DA 1QEXA 2FAEA 1OFCX 3D71A 2KWLA 1VQ9P 2L6EA 1EDLA 2GZEA 3H6PA 4RESB 3L70D 1BGYD 3EQ2A 1NU1D 4N6JA 2LPKA 3H1KE 4K3AA 2CPBA 4GODA 2Y9YA 1Y9BA 1OWAA 3GHGC 2WPRA 4QKOA 4W7ZA 2KGEA 3CXHE 3C9IA 1EC5A 1L0ND 3B71A 1KN7A 2NPSD 1MV8A 3R2PA 2KLUA 3H1LE 1CZQA 5APQA 4RKUJ 2JR8A 2B9BA 1LTJA 2GZJA 4W80A 3E2DA 5AVQB 3CC2P 3CL3D 1RO2A 3RG2A 1URQA 1KC8Q 3FWLA 3H1HE 1VF5D 5KP8B 3MD0A 3BRVB 1NJIQ 3TGUD 1EZVG 3N7NA 3RK2C 4PWVB 2D2CD 1Q7YQ 2FFDB 1PGQA 2G8YA 1RQVA 1CSBA 1J1EB 4L73A 1HY8A 4WY4A 1KYOE 3NFQA 4JQ0D 2KS1A 1T2KC 3CXHI 3V2RA 3GJNA 2QJKC 2Q5UA 2WITA 2QJKB 3HE4B 3BCCD 3IR9A 1X9VA 1S72P 2KYVA 3H1KJ 4BPFA 5AW2B 2E76D 1YTZT 1WMKA 2KUBA 3H1JD 2A45I 2B88A 2KXPB 1JUNA 1SFCD 4PD4I 2JBGA 5KAIH 2EHSA 3P32A 3B5NB 1KYOH 1P84D 1AF8A 4HH2A 4Y99C 1PPJE 4Y99B 2KB7P 3QWOC 2RH0A 1SQQK 1VQ5P 3DS4A 2EFJA 4N3YB 3V4QA 5CJ4A 3AEFC 1KILB 3AE3C 2J58A 4JYBA 1LGHB 4LC1A 2KLVA 1A43A 3M9BA 2ONTA 1YTZI 2K0DX 2MY5A 3CCJP 1NTKD 1G1IA 1RY3A 2KORA 1NTKG 4PXHB 1UJZA 1SFCA 4JPZB 2KGDA 1HUCA 4NEOA 1ZR4A 2FADA 1P84H 3EJBA 1VF5C 1BDCA 2JP3A 1JCCA 2J5UA 3H1JE 4ZKPA 5C39A 2N5IA 2KZIA 3SWYA 4PH0A 1MFZA 3CCSP 1LTBC 3PH0A 1Q90D 1W2BO 5AVUB 1GU5A 2JAZA 1YIJP 2OTKE 1NTKE 3Q2YA 3G28A 1LT9C 3HUSC 5APWA 3G21A 1SQBE 4OGQC 3F89A 1Z56A 2R44A 2PEJA 2FY8A 2ZXEB 3AEEC 1E5WA 1PGOA 3PP5A 4NPDA 3BVHA 4WB4A 1GDTA 2GYKA 2FVEA 3H1LJ 3HD7D 1HWTC 1FOSE 1RF1B 1BGYG 1YQ4C 2R5BA 2YO3A 2OYHB 4OVNF 1SQBK 1EDKA 3E7KA 4YPCA 1N73B 3NMDA 3H4EA 5HVCA 3H25A 3JCUE 1PP9J 2N9YB 2XU6A 4QNBA 5APSA 1FBMA 1BSNA 3HUSA 3FWNA 3Q5RA 1QGKB 1X3OA 3S1KA 2LOLA 1KQSO 1Y47A 1PGPA 4ZKUA 1W5CE 1IC2A 2IBZG 5AW1B 1FZAA 5KLVD 3WU2H 3RL0B 1L0LD 2Z44A 2AXCA 1NTKK 1ZOYC 1NHLA 2ZYDA 3CMAP 3GF7A 2K94A 4H44D 1BCCG 1NVOA 5GTIE 1XTGB 5KLVJ 1GU4A 2SPZA 2VLOA 3GG2A 1NTKJ 3PTZA 1AQTA 2OYHC 2NPSA 2N9BA 1ZNVA 1N73C 3MZWB 1OVRA 4L74A 1JMMA 3KHUA 3O6QB 2YMYA 1HVVA 1PP9D 1MKMA 3L73D 4GR6A 4Y28J 4EIJA 2OYIC 3L70G 2GUVA 2QJPC 3G1GA 2DNWA 3Q3DA 5AVXB 1FAVA 2BEQD 1URQC 2O01H 2IFNA 2K9YA 5KTBA 2W6AA 2YKQA 5BU8B 3MHVA 2W6JH 5AVRB 2P10A 1ZR2A 1FOSF 2MVVA 1M6NA 2A45G 1ZRTD 3OW2O 1ZP0C 2ZT9B 2QM8A 2Y0DA 3H1KG 3M91A 1KB9D 3CX5D 4DOJA 1S9KD 3A0BE 1R5SA 4XFJA 1GL2A 3EJDA 1M1JB 2IPPA 1A02F 4PV1D 1G2CB 1FZCA 1L0LJ 2XT1A 3B8EB 2PNGA 1LWUA 2N6YA 2JO1A 2XNDH 5APUA 1MFTA 2R3CA 1VQ7P 3CCRP 1FZCC 2XZ1C 1PZQA 5AW6B 4KHXA 3EJEA 2XNXA 1FU1A 1MZ8A 2HPCA 3IN6A 3RL0C 4I7ZB 2FYUK 4M3LA 2O01N 1IFPA 1DH3A 3WUTA 1VQ4P 1HBWA 1UIIA 2CWOA 5EW5E 2M5AB 1DV5A 1H0TA 1E79H 5CZDB 1NTMK 2E75B 1OX3A 5CCGA 1RF0A 3KXDA 4JF7A 3KYQA 3FXDA 2MJZA 1LNQA 1IZNB 3NXSA 2K37A 3W68A 4PH1A 1T2KD 1N73A 1PIXA 4I2LC 2JQ4A 2AXTE 1FZCB 1JMBA 2PEMA 1DD3A 2WPQA 4CPGA 1NOHA 5HGOA 4UB6E 1M8OB 1XTCC 3P8MC 5CCGC 1M90Q 1URQD 3UIAA 2OYOA 2AEFA 2IBZE 3RK2D 3EFGA 2GZGA 4IL6E 4R4MA 1SQXE 1NQ4A 3L74E 1EXIA 2E1MA 3S4RA 4ZMDA 5GTIH 2Z5HA 2Y0CA 2MF4A 2MKVA 4IL6X 5KLVG 2KK7A 1MZ9A 5KLIC 2IDBA 1Q81Q 1ZV8A 3AE8C 3D6ZA 1KFNA 1JY2P 2VLQA 3GZLA 4TT3H 1NTZE 2UWJE 1LTJB 1ZMEC 1MUUA 2ROQA 1M1JA 5KJ7A 2IZ1A 3MUDC 1NU1E 1M7LA 2YXQB 5AW9B 1RO0A 2V7QJ 4BXLA 3B5ND 1L0HA 3AECC 3B4SA 1J1EC 5CHXA 1JNMA 1FZGA 1PEUA 2OTJP 3H1HJ 1FZFA 2XXMA 3WUUA 2KOQA 1ZXGA 1IFIA 3BCCG 3AEDC 4QMAA 3CCMP 5DCKA 5TISE 1NU1G 2H88C 5AVVB 2GZFA 1SQVJ 2X2BA 1JTHA 2CK3H 2YNYA 2K93A 1H8AA 3U1CA 5AVZB 3PJSK 2KOOA 1BGYJ 1QVFO 2W6BA 1JM0A 3L74D 1EZVI 3G0VA 3RBXA 2C9NY 4NPFX 3L75G 1W2EA 3H1HG 4GIFA 3HTKA 1BE3G 3RL0g 2WQYC 2C0XA 1JB0J 2CPSA 3HD7B 2PEOA 2QNWA 2AXTH 2WSCH 1KORA 1IFMA 2D2CB 4Z1MH 2N6ZA 2ZXXA 2GDXA 1LT1A 4PJ0E 3P8CE 1AV1A 3LW5H 3WUVA 2PRRA 1M57D 1HJ0A 1VF5B 2JEEA 3L71G 1OZHA 1K8AQ 3LIEA 3NTEA 3TSIA 4I7ZC 2AFEA 3CCUP 1N7SC 2L4BA 2POHA 2RKLA 3VRLC 1SVFA 2BCCD 3GKLC 3A7OA 2E74B 1USDA 1LTTC 1NTME 3HUSB 3VTPC 1H89A 1S5LX 2E75C 4MRTC 3GLMA 2FFDC 1VPCA 3KQGA 1AJYA 3WMM0 4U0DA 1VQ8P 5CJ0A 1GK4A 3AE9C 4CA3A 4AQRD 5HGMA 3H1ID 1SQXJ 5CCHD 1NO4A 2AEJA 2M8LA 3L73G 2MD9A 1KV4A 3U59A 4JBZA 1SQVD 2FACA 5B66H 1N7SA 2KOPA 3KZIH 1T6AA 1X8YA 2E5TA 1YYCA 1FR2A 2ZYAA 3H0DA 2P7JA 4DT0A 3KDPB 1AFOA 1KILD 3AEBC 3L4FA 3CLQA 3RK3B 4I6MC 5HGLA 3T97A 4H2YC 2GA1A 1KYOI 1PPJG 1YI2P 1D1DA 3BCCE 4N78D 2N1TD 1N2DC 3L74G 3B4QA 5B66E 2VLNA 2JYGA 4H13D 4U0FA 5F2KA 1GXGA 1KTMA 1GD2E 4PD4D 4IZ6A 1SQPD 1SFCC 4GDOA 2EG5A 1X0TA 2B87B 3H47A 3TF5A 1ZN5A 3G6EP 2FXMA 4L76A 4OWFA 4U3FG 4U3FE 3TNUB 5CCGD 3RK3E 4H2WC 4XFYA 4H2XC 1VKUA 3MUDA 3L75J 1KILE 5APVA 5CBNA 2IFMA 2WZ7A 2XZ0D 3L35A 1LT9A 1SQPG 1DEBA 2JJLA 3CX5E 1L4AD 2M0BA 1NTZD 1NU1J 2OTLP 3GZMA 3H32A 1FC2C 2N98A 2LKIA 1JY2N 4WY4C 1L0LE 1S1CX 5I4TG 2DGYA 1OIPA 2KODA 2PGDA 1P84E 3MTUE 1EDJA 1L0NE 2L9FA 3II6A 2FQ2A 5GTHE 3T97B 2WSFJ 2JDIH 2NPSB 1PGJA 3H1JJ 1Z6MA 2ZVNB 2K0YA 3A0BH 4WY4D 1BGYE 3L70J 5F2NA 1TU3F 1IO4A 2XZRA 4D6TD 1L4AC 1FDIA 3V6IA 2Q7CA 2AF8A 1BE3E 3G3ZA 1SQVK 2V4HA 1N7LA 2QJYB 3C1LA 3CXHH 2M5AA 3L36A 1YBKA 2P58A 4D6TJ 5KAFE 1Q2NA 3RG6C 3S9OA 1HQBA 1A02J 4HKZH 1QLED 2HLOA 2D2CC 3CWBJ 2CG5B 1IFJA 2I1JA 5BVZA 3M0AA 4UB6H 3MP7B 5AVYB 3ITKA 2A06E 2K92A 3BRTB 1KYOD 2K9JA 2E43A 1LTIC 1L0IA 1RHZB 2PFXA 1BSHA 2HFED 1OW8A 2BCCG 4COCA 2IBZI 3K5BA 1LT9B 1KB9E 1L4AA 1T3UA 1U57A 4EDFA 1RE4A 5CCHA 2NPSC 4IFMA 1D7MA 1VQOP 1QX8A 1IUQA 2GUSA 2L22A 2M3BA 4OGQB 1QRJA 2JU2A 2FYNC 3WU2E 3G4SP 3OA7A 3MGNA 2CGQA 2W83C 5E79E 2WTYA 2W90A 3C8VA 5H2FH 2JB0A 1F80D 3H1LG 3CWBD 3WBHA 4H0LB 1NAYA 3ZDMA 5DJTB 3OAKA 1K9MQ 1KILA 4GT1A 1VQMP 5KLVK 3EWKA 1JCDA 1GL2C 4L75A 1T8KA 2K2QA 3JC22 2YXRB 1PEQA 2KZJA 1HF9A 2OYIB 1HGZA 1R8EA 4XFZA 1GPJA 4C46A 2WSCJ 4HB1A 1IK9A 4MN4C 1HTLC 5AW5B 5AW3B 3Q20A 3PHLA 1LJ2A 1CI6A 3TGUJ 5B5EH 1YITP 3HE5A 3U1AA 7CEIA 3GW6A 3V2PA 3A5TA 2FYZA 4U0CA 1L0NG 2P1JA 3CMEP 2KNCB 3HD7A 1L0NK 1BAJA 3Q5PA 3LW5J 2Q3EA 3KPEA 4C7NB 2AFDA 2ZAEB 2Z4EA 2L0QA 2ITAA 1FJPA 1SP4A 3G71P 5TJHA 3CCQP 3VN0A 2XDJA 2FQ1A 3IAOA 2Q3IA 2M8PA 2RN0A 2V7QH 1CW5A 4KJMA 3QH9A 2FVAA 1K30A 2Q1KA 2C9LY 4ZNCA 1E6JP 1AVYA 3TYYA 1YHQP 1DEEG 1NYHA 3GF3A 2KSJA 2LKMA 3DS2A 4R4LA 3H1LD 2QM7A 5APYA 2Y0EA 1SQXD 2LIWA 1DD4A 3L37A 4HJGH 5KP7B 1SQQJ 4YXWH 3DPHA 3TK1A 2B89A 3OJAB 2WVRA 2M5RA 2BCCE 4OGQD 5CBOA 3SWKA 3V4WA 1DNYA 5APXA 2Y9ZA 1LTGC 2GDWA 3L70E 3B5NC 1S5LE 1VQNP 4PJ0H 2BHVA 4WBAA 1EIAA 2Z46A 2FHSC 4W7YA 5DJUB 1NKNA 5KAFH 1L0NJ 4LGDE 2FBWC 4EYYQ 1UIXA 3CXCO 5KJ7D 3HE5B 1SQQE 1P84I 4DG9A 2LL8A 1GL2D 1EZVD 1DIPA 3TGUG 4DCKA 3VMAA 4H0LD 1KFMA 3E1IA 3L71J 2N5HA 4WYMA 4C7RA 5KLIB 4XROA 5L8RJ 5E79H 2QEXP 3H1JG 2KOSA 3O6QA 2H89C 2R5DA 1X79B 1PL5A 3G1IA 3AE2C 3N4XA 1VHNA 2G3AA 3B5NA 2MVUA 2BEZF 1EDIA 4N78E 5K5GB 4YTPC 1EQ7A 1RF0C 4WWIA 3LRYA 3VOPA 4IFFA 4WY4B 1RNIA 1QVGO 3L71E 2W27A 2A45H 2JO0A 4PD4H 1KZUB 2KOGA 2WPTA 3ABVC 3V2QA 1SQPE 1ZW0A 2HODA 2KI7B 2BQ1E 2WSSH 1SLQA 3U43A 3LMOA 1OMIA 1JO5A 2QVAA 4A7PA 4U3FJ 2PP6A 1U7MA 2OQQA 3CCLP 2FYUE 5AVWB 3SFEC 1LTJC 1NTZJ 3LIDA 1IFNA 5GTHH 1KQGB 2K5XA 3Q5SA 3CC4P 3VP8A 4U0AA 1JY3P 5BU5A 1H0TB 4NPEA 5B5EE 2M8RA 5KP6B 2RMZA 1OVVA 3CWBG 2FKWB 1IK7A 2R3SA 3VMYA 1S9KE 1KB9I 3L74J 2PEQA 2K88A 1IMPA 2LXBA 1Q82Q 5H2FE 1KQFB 2M8NA 1LWUC 1J1DC 3H1HD 3JCUH 1FJKA 5APTA 4JYCA 2P2UA 2BUOA 2GDYA 3VP9A 1OW7A 3AEAC 4IOIH 1YJ9P 2E5YA 2IYPA 1RE4C 1NKZB 2Q6QA 4PV1C 1SFCB 4C7NA 3RK3C 4H13B 3SWFA 2Z45A 2PAJA 4LLHA 2EIAA 4RJTA 2PEIA 1KD1Q 2QJYC 4BRYB 2KG8A 3CI9A 3G26A 1FS0E 3CXHD 3B5IA 3GMAA 2QIWA 3L75E 1M6EX 1BCCD 2WPSA 2KP8A 2O01J 1SS1A 2AVAA 3M9QA 5HV8A 3IF4A 2PENA 4U3FD 3TNUA 2IX7C 5TISH 1SQPJ 3SSUA 1SQBG 1S3JA 1NTMJ 5KAIE 2GZIA 1FZEA 2QSIA 3RK2B 3L72J 2FXOA 3W67A 5CCHC 1OW6A 3VMXA
chains in the Genus database with same CATH topology
2Z44A 1JJ2O 1Q7YQ 3DS1A 3RG6C 3Q20A 3CXCO 1VQPP 2P9XA 3CMAP 1K8AQ 3NTEA 3CC4P 2E1MA 4U0AA 1Q86Q 1YITP 2EG5A 3CCUP 4PH0A 1VQ7P 2XV6A 3DS5A 3CCRP 1M74A 3VRLC 2PEKA 1PEMA 3CCSP 3H47A 2PY8A 1EOQA 3G6EP 2PEQA 3CPWO 1VQLP 1W2BO 4U0CA 1YIJP 1Q81Q 1Q82Q 5HGNA 3CMEP 3G28A 4WYMA 3DS3A 1VQKP 4XROA 1M1KQ 4XRQA 5JPAA 1BAJA 3G29A 4XFYA 2OARA 2M8NA 3I55P 2QEXP 3G21A 1S72P 3DS0A 4XFXA 1VQ9P 4COCA 2L6EA 2JYLA 4U0DA 1VQ8P 4GR6A 3G71P 1YJNP 2BUOA 3CCQP 1RO0A 2PEJA 1ZMBA 1YJ9P 5F2OA 3G1IA 5HGMA 2M8PA 2QA4P 4U0BA 2M8LA 1K30A 3G1GA 2Z45A 3MGEA 2OTLP 1PEUA 2OTJP 2EIAA 2XXMA 1E6JP 4U0EA 2PEIA 1VQOP 1KD1Q 1IUQA 4COPA 1VQ4P 1AUMA 2CWOA 1YHQP 3CCMP 5DCKA 3G26A 1QRJA 5I4TG 3G4SP 2DGYA 4M0IA 3H0DA 3LRYA 2KODA 3DS2A 3B5IA 1RNIA 1QVGO 1M6EX 5BS2A 1QVFO 3CD6P 1VQ5P 3DS4A 5BS1A 1M6NA 2JO0A 3H4EA 2EFJA 2LF4A 3I56P 3G0VA 3OW2O 1A8OA 3DTJA 3WBHA 5HGLA 4QNBA 3E2DA 1K9MQ 3CC7P 4GR2A 1VQMP 2PENA 3DPHA 1K73Q 3CC2P 4PH1A 1YI2P 2BQ1E 5F2NA 1D1DA 1A43A 1RO2A 2ONTA 1KC8Q 3CCVP 2PEOA 3M1MA 1PEQA 2PEMA 1YJWP 1KQSO 3CCJP 5HGOA 1N8RQ 1VQ6P 3CCLP 3HZQA 4XFZA 1PEOA 1NJIQ 2JYGA 1VQNP 4U0FA 2BHVA 4IPYA 5F2KA 2XT1A 3HYBA 1EIAA 3CCEP 1M90Q 2Z46A 3P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ P;  1VQK P;  1VQO P;  1M1K Q;  1KD1 Q;  1JJ2 O;  1K9M Q;  3CC7 P;  1VQM P;  1Q7Y Q;  1VQ4 P;  3I55 P;  1YHQ P;  2QEX P;  1K73 Q;  3CC2 P;  3CCM P;  3CXC O;  1VQP P;  3CMA P;  1YI2 P;  1S72 P;  1K8A Q;  3CC4 P;  3CME P;  1VQ9 P;  3G4S P;  3CCV P;  1Q86 Q;  1KC8 Q;  1VQ8 P;  1YIT P;  1VQ7 P;  3CCU P;  3G71 P;  1YJN P;  3CCQ P;  3CCR P;  1YJW P;  1KQS O;  1QVG O;  3CCJ P;  1YJ9 P;  1N8R Q;  3CCS P;  3CCL P;  1QVF O;  1VQ6 P;  3CD6 P;  1VQ5 P;  1NJI Q;  3CPW O;  3G6E P;  1VQL P;  1VQN P;  2QA4 P;  3I56 P;  1W2B O;  3OW2 O;  1YIJ P;  1Q81 Q;  1Q82 Q;  3CCE P;  1M90 Q;  2OTL P; 
#chains in the Genus database with same CATH topology
 1BXI A;  1QL2 A;  2ZJS E;  1K04 A;  3G9R A;  4UB8 E;  1FE6 A;  2N1T B;  1NGM B;  1CEI A;  2N1T C;  4F37 A;  2OYH A;  3CE7 A;  1JTH B;  1S2E A;  2ERH A;  2KSE A;  1VQK P;  5JPA A;  1KIL C;  2R32 A;  3HTK B;  2VSQ A;  1AQ5 A;  3USS A;  2QG4 A;  3VYI A;  4EOT A;  1YJN P;  3NY7 B;  2HYN A;  3IFM A;  1E0H A;  1GMJ A;  2GM4 A;  1IMQ A;  1CI6 B;  5M1B A;  1JOC A;  3BAS A;  3BCC J;  2WT7 A;  3BAT A;  1S4X A;  4AUW A;  2MR8 A;  4M0I A;  1PFI A;  2KNC A;  3RBZ A;  2W8Z A;  2CQ8 A;  2C0W A;  2H7H A;  1HH0 A;  2JGP A;  2LF4 A;  1RF1 A;  4AYC A;  1A8O A;  4HYT B;  2BCC J;  2E74 D;  1HGV A;  1L2P A;  3GHG A;  3HD7 C;  3CC7 P;  1VDF A;  3L73 J;  1GW3 A;  1JY3 N;  1GL2 B;  1RE3 C;  2H43 A;  1UNK A;  5KKZ C;  1G2C A;  1LP1 A;  3M1M A;  1VQ6 P;  2ZYG A;  3HZQ A;  1PEO A;  2HOD B;  1FDO A;  3PLN A;  2KGA A;  4DZO A;  1RF1 C;  3AE6 C;  2VLP A;  1LWU B;  3HYB A;  3M0D C;  2E76 B;  1Y8A A;  3FX0 A;  4EI2 A;  4PV1 B;  1N7S B;  2FQ0 A;  2J59 M;  1AYI A;  2FYU D;  2XV5 A;  1GXH A;  3DS5 A;  1ZLL A;  1JY2 O;  3FXE A;  1PEM A;  3M9H A;  3VMZ A;  4HKG A;  3CPW O;  1GTW A;  1VQL P;  2ZT9 D;  3PRJ A;  3HRN A;  3L73 E;  1ZRT E;  3TGU E;  3V2N A;  2OAR A;  2VRS A;  3M06 A;  3DS0 A;  2JYL A;  2KGC A;  4UB8 H;  1URQ B;  1BE3 J;  2OYI A;  2WT7 B;  3MIW A;  4U0E A;  1PP9 G;  1DX7 A;  5AW7 B;  3AE5 C;  2HR3 A;  4O9B A;  2N1T A;  2Q9I A;  1USE A;  5KKZ B;  2WMM A;  2IZ0 A;  1K05 A;  2YIU C;  2FFD A;  1NAF A;  3R4Y A;  2P67 A;  1R5L A;  4UHP B;  1JEK A;  1M56 D;  5EFW B;  5BS1 A;  2KG6 A;  1GZL A;  3RK3 D;  1RH5 B;  1BDD A;  1LTA C;  1U7J A;  1OVU A;  2KW2 A;  1YQ3 C;  5AVT B;  1OXZ A;  4YXD C;  1NU1 K;  1LP1 B;  2FVF A;  2HPC B;  2LXC B;  3D6Y A;  3A0H E;  2E76 C;  2IBZ D;  3KZI E;  3RL0 D;  3CX5 I;  1S5L H;  3AE1 C;  1FDM A;  2KG9 A;  1LTS C;  3EFF K;  1KB9 H;  2FYU G;  1JJ2 O;  2JWA A;  2LR2 A;  2JKV A;  1BE3 D;  3H1I G;  3RGU A;  2IYO A;  2O3J A;  2WPV B;  2JWD A;  1FZB A;  2PY8 A;  2YKP A;  1NTM G;  3P7K A;  2DW3 A;  1HJB A;  1GW4 A;  2E42 A;  5EJD A;  3CWB E;  4XRQ A;  2NO8 A;  1N86 A;  4BPH A;  5AW4 B;  4XFX A;  2K0X A;  3F5H A;  2AEM A;  1IFD A;  4WVZ A;  3V5B A;  4TLF A;  5CMZ A;  2QA4 P;  1ACP A;  4PD4 E;  4ASW A;  1T3J A;  3MGE A;  2O1K A;  3Q1M A;  2K1A A;  4COP A;  2I8D A;  3H32 B;  2EHT A;  2Z5I A;  1EMV A;  2NRG A;  1WRG A;  1SQX G;  4ASV A;  2BAS A;  1OR5 A;  2LTE A;  1PV3 A;  1RQU A;  3L75 D;  2M3E A;  2KR5 A;  4XE5 B;  4GR2 A;  1KLP A;  4RO0 A;  1NTM D;  1K73 Q;  2FYN B;  1NTZ K;  3CCV P;  2CNR A;  1YJW P;  2K3R A;  3GHG B;  3A0H H;  2N50 A;  3E1R A;  4DJG A;  4D6T E;  4BRY A;  2QE7 H;  4H0L C;  3CCE P;  2LML A;  2WSE H;  1H88 A;  2ZT9 C;  3H1I J;  2JU1 A;  3JSV C;  1SQQ D;  2FYU J;  4H13 C;  1VQP P;  5KJ7 C;  1J1D B;  1Q86 Q;  1T8Z A;  4XA4 A;  1NTZ G;  2O1J A;  1L0L K;  1M74 A;  4GOE A;  4R0M A;  2PEK A;  1JY3 O;  3HE4 A;  3A2A A;  4IFD K;  3I5C A;  2XKM A;  5HGN A;  2L5G B;  1SQB D;  2H8P D;  5KLV E;  2K9J B;  3L71 D;  2I1K A;  3H1I E;  4U7J A;  1L0L G;  3L72 G;  1ZMB A;  2WWW A;  5F2O A;  1SQB J;  5AVS B;  2YO2 A;  4B86 A;  1QL1 A;  1WT6 A;  2E74 C;  1L4A B;  4U0B A;  1SQV G;  1SQV E;  2L91 A;  4GKG A;  2YMK A;  1NWQ A;  2KIK A;  2OGU A;  3FGA D;  1AUM A;  1IJD B;  1VL2 A;  3L72 E;  2A06 D;  1EXJ A;  5AW0 B;  1PP9 E;  2YIU B;  2YKO A;  3SFD C;  5BS2 A;  3CD6 P;  3D70 A;  1EZV E;  2KS1 B;  2QJP B;  3I56 P;  1M1J C;  4K35 A;  3DTJ A;  3O8Z A;  3AE7 C;  2NZ2 A;  2QRX A;  2HG5 D;  2E75 D;  2FXP A;  1PPJ D;  4OH8 B;  1G1J A;  3CX5 H;  3P8C D;  2LIU A;  4H44 B;  2ZVO B;  2WSF H;  1SQX K;  1RE3 A;  1X22 A;  1N7S D;  4H44 C;  1N8R Q;  4BPG A;  1AVO A;  4IPY A;  1SQP K;  1KQL A;  2A06 G;  3P05 A;  3DS1 A;  5AW8 B;  4IL6 H;  2P9X A;  3NTN A;  3H1K D;  2ZFC A;  4I1L A;  2B87 A;  4KT0 J;  2XV6 A;  3AE4 C;  1AA0 A;  3A3Y B;  1BCC J;  1GK6 A;  2MR7 A;  1EOQ A;  1KMI Z;  1J2J B;  4BWN A;  4D6T G;  3L72 D;  4GOF A;  3DS3 A;  1M1K Q;  3TDK A;  2WSE J;  3AEG C;  3G29 A;  1NH4 A;  3I55 P;  1SQQ G;  1BCC E;  3M0D A;  1QEX A;  2FAE A;  1OFC X;  3D71 A;  2KWL A;  1VQ9 P;  2L6E A;  1EDL A;  2GZE A;  3H6P A;  4RES B;  3L70 D;  1BGY D;  3EQ2 A;  1NU1 D;  4N6J A;  2LPK A;  3H1K E;  4K3A A;  2CPB A;  4GOD A;  2Y9Y A;  1Y9B A;  1OWA A;  3GHG C;  2WPR A;  4QKO A;  4W7Z A;  2KGE A;  3CXH E;  3C9I A;  1EC5 A;  1L0N D;  3B71 A;  1KN7 A;  2NPS D;  1MV8 A;  3R2P A;  2KLU A;  3H1L E;  1CZQ A;  5APQ A;  4RKU J;  2JR8 A;  2B9B A;  1LTJ A;  2GZJ A;  4W80 A;  3E2D A;  5AVQ B;  3CC2 P;  3CL3 D;  1RO2 A;  3RG2 A;  1URQ A;  1KC8 Q;  3FWL A;  3H1H E;  1VF5 D;  5KP8 B;  3MD0 A;  3BRV B;  1NJI Q;  3TGU D;  1EZV G;  3N7N A;  3RK2 C;  4PWV B;  2D2C D;  1Q7Y Q;  2FFD B;  1PGQ A;  2G8Y A;  1RQV A;  1CSB A;  1J1E B;  4L73 A;  1HY8 A;  4WY4 A;  1KYO E;  3NFQ A;  4JQ0 D;  2KS1 A;  1T2K C;  3CXH I;  3V2R A;  3GJN A;  2QJK C;  2Q5U A;  2WIT A;  2QJK B;  3HE4 B;  3BCC D;  3IR9 A;  1X9V A;  1S72 P;  2KYV A;  3H1K J;  4BPF A;  5AW2 B;  2E76 D;  1YTZ T;  1WMK A;  2KUB A;  3H1J D;  2A45 I;  2B88 A;  2KXP B;  1JUN A;  1SFC D;  4PD4 I;  2JBG A;  5KAI H;  2EHS A;  3P32 A;  3B5N B;  1KYO H;  1P84 D;  1AF8 A;  4HH2 A;  4Y99 C;  1PPJ E;  4Y99 B;  2KB7 P;  3QWO C;  2RH0 A;  1SQQ K;  1VQ5 P;  3DS4 A;  2EFJ A;  4N3Y B;  3V4Q A;  5CJ4 A;  3AEF C;  1KIL B;  3AE3 C;  2J58 A;  4JYB A;  1LGH B;  4LC1 A;  2KLV A;  1A43 A;  3M9B A;  2ONT A;  1YTZ I;  2K0D X;  2MY5 A;  3CCJ P;  1NTK D;  1G1I A;  1RY3 A;  2KOR A;  1NTK G;  4PXH B;  1UJZ A;  1SFC A;  4JPZ B;  2KGD A;  1HUC A;  4NEO A;  1ZR4 A;  2FAD A;  1P84 H;  3EJB A;  1VF5 C;  1BDC A;  2JP3 A;  1JCC A;  2J5U A;  3H1J E;  4ZKP A;  5C39 A;  2N5I A;  2KZI A;  3SWY A;  4PH0 A;  1MFZ A;  3CCS P;  1LTB C;  3PH0 A;  1Q90 D;  1W2B O;  5AVU B;  1GU5 A;  2JAZ A;  1YIJ P;  2OTK E;  1NTK E;  3Q2Y A;  3G28 A;  1LT9 C;  3HUS C;  5APW A;  3G21 A;  1SQB E;  4OGQ C;  3F89 A;  1Z56 A;  2R44 A;  2PEJ A;  2FY8 A;  2ZXE B;  3AEE C;  1E5W A;  1PGO A;  3PP5 A;  4NPD A;  3BVH A;  4WB4 A;  1GDT A;  2GYK A;  2FVE A;  3H1L J;  3HD7 D;  1HWT C;  1FOS E;  1RF1 B;  1BGY G;  1YQ4 C;  2R5B A;  2YO3 A;  2OYH B;  4OVN F;  1SQB K;  1EDK A;  3E7K A;  4YPC A;  1N73 B;  3NMD A;  3H4E A;  5HVC A;  3H25 A;  3JCU E;  1PP9 J;  2N9Y B;  2XU6 A;  4QNB A;  5APS A;  1FBM A;  1BSN A;  3HUS A;  3FWN A;  3Q5R A;  1QGK B;  1X3O A;  3S1K A;  2LOL A;  1KQS O;  1Y47 A;  1PGP A;  4ZKU A;  1W5C E;  1IC2 A;  2IBZ G;  5AW1 B;  1FZA A;  5KLV D;  3WU2 H;  3RL0 B;  1L0L D;  2Z44 A;  2AXC A;  1NTK K;  1ZOY C;  1NHL A;  2ZYD A;  3CMA P;  3GF7 A;  2K94 A;  4H44 D;  1BCC G;  1NVO A;  5GTI E;  1XTG B;  5KLV J;  1GU4 A;  2SPZ A;  2VLO A;  3GG2 A;  1NTK J;  3PTZ A;  1AQT A;  2OYH C;  2NPS A;  2N9B A;  1ZNV A;  1N73 C;  3MZW B;  1OVR A;  4L74 A;  1JMM A;  3KHU A;  3O6Q B;  2YMY A;  1HVV A;  1PP9 D;  1MKM A;  3L73 D;  4GR6 A;  4Y28 J;  4EIJ A;  2OYI C;  3L70 G;  2GUV A;  2QJP C;  3G1G A;  2DNW A;  3Q3D A;  5AVX B;  1FAV A;  2BEQ D;  1URQ C;  2O01 H;  2IFN A;  2K9Y A;  5KTB A;  2W6A A;  2YKQ A;  5BU8 B;  3MHV A;  2W6J H;  5AVR B;  2P10 A;  1ZR2 A;  1FOS F;  2MVV A;  1M6N A;  2A45 G;  1ZRT D;  3OW2 O;  1ZP0 C;  2ZT9 B;  2QM8 A;  2Y0D A;  3H1K G;  3M91 A;  1KB9 D;  3CX5 D;  4DOJ A;  1S9K D;  3A0B E;  1R5S A;  4XFJ A;  1GL2 A;  3EJD A;  1M1J B;  2IPP A;  1A02 F;  4PV1 D;  1G2C B;  1FZC A;  1L0L J;  2XT1 A;  3B8E B;  2PNG A;  1LWU A;  2N6Y A;  2JO1 A;  2XND H;  5APU A;  1MFT A;  2R3C A;  1VQ7 P;  3CCR P;  1FZC C;  2XZ1 C;  1PZQ A;  5AW6 B;  4KHX A;  3EJE A;  2XNX A;  1FU1 A;  1MZ8 A;  2HPC A;  3IN6 A;  3RL0 C;  4I7Z B;  2FYU K;  4M3L A;  2O01 N;  1IFP A;  1DH3 A;  3WUT A;  1VQ4 P;  1HBW A;  1UII A;  2CWO A;  5EW5 E;  2M5A B;  1DV5 A;  1H0T A;  1E79 H;  5CZD B;  1NTM K;  2E75 B;  1OX3 A;  5CCG A;  1RF0 A;  3KXD A;  4JF7 A;  3KYQ A;  3FXD A;  2MJZ A;  1LNQ A;  1IZN B;  3NXS A;  2K37 A;  3W68 A;  4PH1 A;  1T2K D;  1N73 A;  1PIX A;  4I2L C;  2JQ4 A;  2AXT E;  1FZC B;  1JMB A;  2PEM A;  1DD3 A;  2WPQ A;  4CPG A;  1NOH A;  5HGO A;  4UB6 E;  1M8O B;  1XTC C;  3P8M C;  5CCG C;  1M90 Q;  1URQ D;  3UIA A;  2OYO A;  2AEF A;  2IBZ E;  3RK2 D;  3EFG A;  2GZG A;  4IL6 E;  4R4M A;  1SQX E;  1NQ4 A;  3L74 E;  1EXI A;  2E1M A;  3S4R A;  4ZMD A;  5GTI H;  2Z5H A;  2Y0C A;  2MF4 A;  2MKV A;  4IL6 X;  5KLV G;  2KK7 A;  1MZ9 A;  5KLI C;  2IDB A;  1Q81 Q;  1ZV8 A;  3AE8 C;  3D6Z A;  1KFN A;  1JY2 P;  2VLQ A;  3GZL A;  4TT3 H;  1NTZ E;  2UWJ E;  1LTJ B;  1ZME C;  1MUU A;  2ROQ A;  1M1J A;  5KJ7 A;  2IZ1 A;  3MUD C;  1NU1 E;  1M7L A;  2YXQ B;  5AW9 B;  1RO0 A;  2V7Q J;  4BXL A;  3B5N D;  1L0H A;  3AEC C;  3B4S A;  1J1E C;  5CHX A;  1JNM A;  1FZG A;  1PEU A;  2OTJ P;  3H1H J;  1FZF A;  2XXM A;  3WUU A;  2KOQ A;  1ZXG A;  1IFI A;  3BCC G;  3AED C;  4QMA A;  3CCM P;  5DCK A;  5TIS E;  1NU1 G;  2H88 C;  5AVV B;  2GZF A;  1SQV J;  2X2B A;  1JTH A;  2CK3 H;  2YNY A;  2K93 A;  1H8A A;  3U1C A;  5AVZ B;  3PJS K;  2KOO A;  1BGY J;  1QVF O;  2W6B A;  1JM0 A;  3L74 D;  1EZV I;  3G0V A;  3RBX A;  2C9N Y;  4NPF X;  3L75 G;  1W2E A;  3H1H G;  4GIF A;  3HTK A;  1BE3 G;  3RL0 g;  2WQY C;  2C0X A;  1JB0 J;  2CPS A;  3HD7 B;  2PEO A;  2QNW A;  2AXT H;  2WSC H;  1KOR A;  1IFM A;  2D2C B;  4Z1M H;  2N6Z A;  2ZXX A;  2GDX A;  1LT1 A;  4PJ0 E;  3P8C E;  1AV1 A;  3LW5 H;  3WUV A;  2PRR A;  1M57 D;  1HJ0 A;  1VF5 B;  2JEE A;  3L71 G;  1OZH A;  1K8A Q;  3LIE A;  3NTE A;  3TSI A;  4I7Z C;  2AFE A;  3CCU P;  1N7S C;  2L4B A;  2POH A;  2RKL A;  3VRL C;  1SVF A;  2BCC D;  3GKL C;  3A7O A;  2E74 B;  1USD A;  1LTT C;  1NTM E;  3HUS B;  3VTP C;  1H89 A;  1S5L X;  2E75 C;  4MRT C;  3GLM A;  2FFD C;  1VPC A;  3KQG A;  1AJY A;  3WMM 0;  4U0D A;  1VQ8 P;  5CJ0 A;  1GK4 A;  3AE9 C;  4CA3 A;  4AQR D;  5HGM A;  3H1I D;  1SQX J;  5CCH D;  1NO4 A;  2AEJ A;  2M8L A;  3L73 G;  2MD9 A;  1KV4 A;  3U59 A;  4JBZ A;  1SQV D;  2FAC A;  5B66 H;  1N7S A;  2KOP A;  3KZI H;  1T6A A;  1X8Y A;  2E5T A;  1YYC A;  1FR2 A;  2ZYA A;  3H0D A;  2P7J A;  4DT0 A;  3KDP B;  1AFO A;  1KIL D;  3AEB C;  3L4F A;  3CLQ A;  3RK3 B;  4I6M C;  5HGL A;  3T97 A;  4H2Y C;  2GA1 A;  1KYO I;  1PPJ G;  1YI2 P;  1D1D A;  3BCC E;  4N78 D;  2N1T D;  1N2D C;  3L74 G;  3B4Q A;  5B66 E;  2VLN A;  2JYG A;  4H13 D;  4U0F A;  5F2K A;  1GXG A;  1KTM A;  1GD2 E;  4PD4 D;  4IZ6 A;  1SQP D;  1SFC C;  4GDO A;  2EG5 A;  1X0T A;  2B87 B;  3H47 A;  3TF5 A;  1ZN5 A;  3G6E P;  2FXM A;  4L76 A;  4OWF A;  4U3F G;  4U3F E;  3TNU B;  5CCG D;  3RK3 E;  4H2W C;  4XFY A;  4H2X C;  1VKU A;  3MUD A;  3L75 J;  1KIL E;  5APV A;  5CBN A;  2IFM A;  2WZ7 A;  2XZ0 D;  3L35 A;  1LT9 A;  1SQP G;  1DEB A;  2JJL A;  3CX5 E;  1L4A D;  2M0B A;  1NTZ D;  1NU1 J;  2OTL P;  3GZM A;  3H32 A;  1FC2 C;  2N98 A;  2LKI A;  1JY2 N;  4WY4 C;  1L0L E;  1S1C X;  5I4T G;  2DGY A;  1OIP A;  2KOD A;  2PGD A;  1P84 E;  3MTU E;  1EDJ A;  1L0N E;  2L9F A;  3II6 A;  2FQ2 A;  5GTH E;  3T97 B;  2WSF J;  2JDI H;  2NPS B;  1PGJ A;  3H1J J;  1Z6M A;  2ZVN B;  2K0Y A;  3A0B H;  4WY4 D;  1BGY E;  3L70 J;  5F2N A;  1TU3 F;  1IO4 A;  2XZR A;  4D6T D;  1L4A C;  1FDI A;  3V6I A;  2Q7C A;  2AF8 A;  1BE3 E;  3G3Z A;  1SQV K;  2V4H A;  1N7L A;  2QJY B;  3C1L A;  3CXH H;  2M5A A;  3L36 A;  1YBK A;  2P58 A;  4D6T J;  5KAF E;  1Q2N A;  3RG6 C;  3S9O A;  1HQB A;  1A02 J;  4HKZ H;  1QLE D;  2HLO A;  2D2C C;  3CWB J;  2CG5 B;  1IFJ A;  2I1J A;  5BVZ A;  3M0A A;  4UB6 H;  3MP7 B;  5AVY B;  3ITK A;  2A06 E;  2K92 A;  3BRT B;  1KYO D;  2K9J A;  2E43 A;  1LTI C;  1L0I A;  1RHZ B;  2PFX A;  1BSH A;  2HFE D;  1OW8 A;  2BCC G;  4COC A;  2IBZ I;  3K5B A;  1LT9 B;  1KB9 E;  1L4A A;  1T3U A;  1U57 A;  4EDF A;  1RE4 A;  5CCH A;  2NPS C;  4IFM A;  1D7M A;  1VQO P;  1QX8 A;  1IUQ A;  2GUS A;  2L22 A;  2M3B A;  4OGQ B;  1QRJ A;  2JU2 A;  2FYN C;  3WU2 E;  3G4S P;  3OA7 A;  3MGN A;  2CGQ A;  2W83 C;  5E79 E;  2WTY A;  2W90 A;  3C8V A;  5H2F H;  2JB0 A;  1F80 D;  3H1L G;  3CWB D;  3WBH A;  4H0L B;  1NAY A;  3ZDM A;  5DJT B;  3OAK A;  1K9M Q;  1KIL A;  4GT1 A;  1VQM P;  5KLV K;  3EWK A;  1JCD A;  1GL2 C;  4L75 A;  1T8K A;  2K2Q A;  3JC2 2;  2YXR B;  1PEQ A;  2KZJ A;  1HF9 A;  2OYI B;  1HGZ A;  1R8E A;  4XFZ A;  1GPJ A;  4C46 A;  2WSC J;  4HB1 A;  1IK9 A;  4MN4 C;  1HTL C;  5AW5 B;  5AW3 B;  3Q20 A;  3PHL A;  1LJ2 A;  1CI6 A;  3TGU J;  5B5E H;  1YIT P;  3HE5 A;  3U1A A;  7CEI A;  3GW6 A;  3V2P A;  3A5T A;  2FYZ A;  4U0C A;  1L0N G;  2P1J A;  3CME P;  2KNC B;  3HD7 A;  1L0N K;  1BAJ A;  3Q5P A;  3LW5 J;  2Q3E A;  3KPE A;  4C7N B;  2AFD A;  2ZAE B;  2Z4E A;  2L0Q A;  2ITA A;  1FJP A;  1SP4 A;  3G71 P;  5TJH A;  3CCQ P;  3VN0 A;  2XDJ A;  2FQ1 A;  3IAO A;  2Q3I A;  2M8P A;  2RN0 A;  2V7Q H;  1CW5 A;  4KJM A;  3QH9 A;  2FVA A;  1K30 A;  2Q1K A;  2C9L Y;  4ZNC A;  1E6J P;  1AVY A;  3TYY A;  1YHQ P;  1DEE G;  1NYH A;  3GF3 A;  2KSJ A;  2LKM A;  3DS2 A;  4R4L A;  3H1L D;  2QM7 A;  5APY A;  2Y0E A;  1SQX D;  2LIW A;  1DD4 A;  3L37 A;  4HJG H;  5KP7 B;  1SQQ J;  4YXW H;  3DPH A;  3TK1 A;  2B89 A;  3OJA B;  2WVR A;  2M5R A;  2BCC E;  4OGQ D;  5CBO A;  3SWK A;  3V4W A;  1DNY A;  5APX A;  2Y9Z A;  1LTG C;  2GDW A;  3L70 E;  3B5N C;  1S5L E;  1VQN P;  4PJ0 H;  2BHV A;  4WBA A;  1EIA A;  2Z46 A;  2FHS C;  4W7Y A;  5DJU B;  1NKN A;  5KAF H;  1L0N J;  4LGD E;  2FBW C;  4EYY Q;  1UIX A;  3CXC O;  5KJ7 D;  3HE5 B;  1SQQ E;  1P84 I;  4DG9 A;  2LL8 A;  1GL2 D;  1EZV D;  1DIP A;  3TGU G;  4DCK A;  3VMA A;  4H0L D;  1KFM A;  3E1I A;  3L71 J;  2N5H A;  4WYM A;  4C7R A;  5KLI B;  4XRO A;  5L8R J;  5E79 H;  2QEX P;  3H1J G;  2KOS A;  3O6Q A;  2H89 C;  2R5D A;  1X79 B;  1PL5 A;  3G1I A;  3AE2 C;  3N4X A;  1VHN A;  2G3A A;  3B5N A;  2MVU A;  2BEZ F;  1EDI A;  4N78 E;  5K5G B;  4YTP C;  1EQ7 A;  1RF0 C;  4WWI A;  3LRY A;  3VOP A;  4IFF A;  4WY4 B;  1RNI A;  1QVG O;  3L71 E;  2W27 A;  2A45 H;  2JO0 A;  4PD4 H;  1KZU B;  2KOG A;  2WPT A;  3ABV C;  3V2Q A;  1SQP E;  1ZW0 A;  2HOD A;  2KI7 B;  2BQ1 E;  2WSS H;  1SLQ A;  3U43 A;  3LMO A;  1OMI A;  1JO5 A;  2QVA A;  4A7P A;  4U3F J;  2PP6 A;  1U7M A;  2OQQ A;  3CCL P;  2FYU E;  5AVW B;  3SFE C;  1LTJ C;  1NTZ J;  3LID A;  1IFN A;  5GTH H;  1KQG B;  2K5X A;  3Q5S A;  3CC4 P;  3VP8 A;  4U0A A;  1JY3 P;  5BU5 A;  1H0T B;  4NPE A;  5B5E E;  2M8R A;  5KP6 B;  2RMZ A;  1OVV A;  3CWB G;  2FKW B;  1IK7 A;  2R3S A;  3VMY A;  1S9K E;  1KB9 I;  3L74 J;  2PEQ A;  2K88 A;  1IMP A;  2LXB A;  1Q82 Q;  5H2F E;  1KQF B;  2M8N A;  1LWU C;  1J1D C;  3H1H D;  3JCU H;  1FJK A;  5APT A;  4JYC A;  2P2U A;  2BUO A;  2GDY A;  3VP9 A;  1OW7 A;  3AEA C;  4IOI H;  1YJ9 P;  2E5Y A;  2IYP A;  1RE4 C;  1NKZ B;  2Q6Q A;  4PV1 C;  1SFC B;  4C7N A;  3RK3 C;  4H13 B;  3SWF A;  2Z45 A;  2PAJ A;  4LLH A;  2EIA A;  4RJT A;  2PEI A;  1KD1 Q;  2QJY C;  4BRY B;  2KG8 A;  3CI9 A;  3G26 A;  1FS0 E;  3CXH D;  3B5I A;  3GMA A;  2QIW A;  3L75 E;  1M6E X;  1BCC D;  2WPS A;  2KP8 A;  2O01 J;  1SS1 A;  2AVA A;  3M9Q A;  5HV8 A;  3IF4 A;  2PEN A;  4U3F D;  3TNU A;  2IX7 C;  5TIS H;  1SQP J;  3SSU A;  1SQB G;  1S3J A;  1NTM J;  5KAI E;  2GZI A;  1FZE A;  2QSI A;  3RK2 B;  3L72 J;  2FXO A;  3W67 A;  5CCH C;  1OW6 A;  3VMX A; 
#chains in the Genus database with same CATH homology
 2Z44 A;  1JJ2 O;  1Q7Y Q;  3DS1 A;  3RG6 C;  3Q20 A;  3CXC O;  1VQP P;  2P9X A;  3CMA P;  1K8A Q;  3NTE A;  3CC4 P;  2E1M A;  4U0A A;  1Q86 Q;  1YIT P;  2EG5 A;  3CCU P;  4PH0 A;  1VQ7 P;  2XV6 A;  3DS5 A;  3CCR P;  1M74 A;  3VRL C;  2PEK A;  1PEM A;  3CCS P;  3H47 A;  2PY8 A;  1EOQ A;  3G6E P;  2PEQ A;  3CPW O;  1VQL P;  1W2B O;  4U0C A;  1YIJ P;  1Q81 Q;  1Q82 Q;  5HGN A;  3CME P;  3G28 A;  4WYM A;  3DS3 A;  1VQK P;  4XRO A;  1M1K Q;  4XRQ A;  5JPA A;  1BAJ A;  3G29 A;  4XFY A;  2OAR A;  2M8N A;  3I55 P;  2QEX P;  3G21 A;  1S72 P;  3DS0 A;  4XFX A;  1VQ9 P;  4COC A;  2L6E A;  2JYL A;  4U0D A;  1VQ8 P;  4GR6 A;  3G71 P;  1YJN P;  2BUO A;  3CCQ P;  1RO0 A;  2PEJ A;  1ZMB A;  1YJ9 P;  5F2O A;  3G1I A;  5HGM A;  2M8P A;  2QA4 P;  4U0B A;  2M8L A;  1K30 A;  3G1G A;  2Z45 A;  3MGE A;  2OTL P;  1PEU A;  2OTJ P;  2EIA A;  2XXM A;  1E6J P;  4U0E A;  2PEI A;  1VQO P;  1KD1 Q;  1IUQ A;  4COP A;  1VQ4 P;  1AUM A;  2CWO A;  1YHQ P;  3CCM P;  5DCK A;  3G26 A;  1QRJ A;  5I4T G;  3G4S P;  2DGY A;  4M0I A;  3H0D A;  3LRY A;  2KOD A;  3DS2 A;  3B5I A;  1RNI A;  1QVG O;  1M6E X;  5BS2 A;  1QVF O;  3CD6 P;  1VQ5 P;  3DS4 A;  5BS1 A;  1M6N A;  2JO0 A;  3H4E A;  2EFJ A;  2LF4 A;  3I56 P;  3G0V A;  3OW2 O;  1A8O A;  3DTJ A;  3WBH A;  5HGL A;  4QNB A;  3E2D A;  1K9M Q;  3CC7 P;  4GR2 A;  1VQM P;  2PEN A;  3DPH A;  1K73 Q;  3CC2 P;  4PH1 A;  1YI2 P;  2BQ1 E;  5F2N A;  1D1D A;  1A43 A;  1RO2 A;  2ONT A;  1KC8 Q;  3CCV P;  2PEO A;  3M1M A;  1PEQ A;  2PEM A;  1YJW P;  1KQS O;  3CCJ P;  5HGO A;  1N8R Q;  1VQ6 P;  3CCL P;  3HZQ A;  4XFZ A;  1PEO A;  1NJI Q;  2JYG A;  1VQN P;  4U0F A;  2BHV A;  4IPY A;  5F2K A;  2XT1 A;  3HYB A;  1EIA A;  3CCE P;  1M90 Q;  2Z46 A;  3P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...