3CC4P

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc4P02
1VQ8P 1NJIQ 1KD1Q 3CC7P 3CD6P 3G71P 3G6EP 2OTJP 1Q86Q 1VQ5P 3I56P 1Q81Q 1VQ9P 3CMEP 1KQSO 3CCLP 1VQ7P 3CCJP 1YIJP 1VQLP 3CPWO 1YJWP 3CXCO 3CCMP 1JJ2O 3G4SP 1VQ6P 3CC2P 3I55P 1KC8Q 3CCSP 1S72P 1VQOP 1K73Q 1QVFO 3CCQP 1VQ4P 1YHQP 1N8RQ 3CMAP 1YI2P 1M90Q 1YJNP 1VQNP 3CC4P 3CCRP 1M1KQ 3CCUP 1K9MQ 1VQMP 1K8AQ 1YJ9P 1QVGO 1Q7YQ 1VQPP 2QEXP 1W2BO 3CCVP 1VQKP 1Q82Q 1YITP 2OTLP 2QA4P 3OW2O 3CCEP
chains in the Genus database with same CATH superfamily
1KD1Q 2I1JA 2KOGA 4EIJA 4H0LC 2L9FA 1FDOA 1URQD 1SQXG 5AW9B 3EWKA 1FZFA 4PD4H 3N4XA 2GUSA 3L4FA 4NPDA 2IDBA 2KP8A 1AF8A 3WUTA 1VHNA 1N7SD 1CZQA 4AQRD 4JPZB 2M8LA 3AEBC 5AW1B 3L71G 3L70G 2LF4A 1KB9I 2GZFA 1ZXGA 3E7KA 4DG9A 3G0VA 3M9QA 4HJGH 2Q7CA 3AE7C 5F2KA 4GIFA 2ZYGA 3L73J 2Y9ZA 3D6YA 1NTKE 3B5NA 1KMIZ 1E6JP 2IYOA 2KLVA 3H1JJ 1SQBE 2CK3H 1AVYA 3H1KD 5KAFH 2I8DA 1BGYG 2W6JH 2PNGA 2KS1B 4C7NA 5KJ7A 1Q90D 3U59A 3U1AA 3IAOA 4C46A 1DIPA 1M56D 1LWUC 2BUOA 4XA4A 2OTLP 2BQ1E 2AXTE 3GHGC 5BS1A 1EQ7A 2FBWC 3B8EB 3EJDA 4L75A 1GU4A 3WUUA 1SQVJ 2HG5D 1MKMA 3GZLA 5B5EE 3AE2C 4UHPB 3B71A 2O1JA 3OJAB 4KJMA 3RK3B 5KLVE 1FS0E 3BRVB 2YO2A 5AW0B 2GM4A 3WMM0 2K88A 3IF4A 1NU1E 2M8NA 2N6ZA 1LWUB 5F2OA 1JUNA 2J5UA 1VQ4P 1RH5B 3GHGB 1S9KD 4PV1C 2N9BA 4I1LA 3KPEA 1IUQA 3RBXA 1SFCA 2P2UA 1T8ZA 3EFGA 2NRGA 4WY4D 2OTKE 2L0QA 2LR2A 2N1TD 4ZKUA 3VP8A 3L73D 2FQ0A 1PV3A 1GXHA 3PH0A 3H1JD 1DD4A 5AW5B 1ZN5A 2YXQB 4XFXA 3Q2YA 2E74C 2M8PA 4W80A 4H13C 1OFCX 2RH0A 1D1DA 1JEKA 1KILB 3B5NC 1X3OA 1NAFA 1HTLC 2EHSA 2MJZA 4W7ZA 4I7ZC 1GZLA 1SQQE 1N8RQ 2RKLA 3C1LA 3H1HJ 2KIKA 5C39A 3DS2A 4IFDK 1L0LJ 1NKZB 1VQPP 2FYNC 3GF3A 5KJ7C 2AXTH 2ERHA 1GL2A 1T2KC 2Z5IA 1JY3P 1EZVG 2Y9YA 3CWBE 3AE1C 4Y99C 1S5LE 1SQVD 3G1IA 1PPJG 4U3FJ 3W67A 3H1LE 1FC2C 4XFJA 3WBHA 3NTEA 2E74B 2CGQA 2JAZA 5B5EH 1EXIA 2ZAEB 3B5NB 1IC2A 1L0NK 4YXWH 4YTPC 1SQPE 5DJTB 1LT9B 4I7ZB 3VOPA 2K0YA 1PGOA 2EG5A 1SQVK 1Y8AA 2ZYDA 1OMIA 3OA7A 4C7NB 2HPCA 1TU3F 2VLPA 2AVAA 2AFDA 1D7MA 5CJ0A 2GZIA 1IFNA 2BCCG 4UB6E 3M91A 2N9YB 2Z5HA 2IBZE 4Y99B 3CCEP 1NTKJ 2ZVOB 3P8CE 2MVVA 3L72G 4RJTA 1Q86Q 1P84E 1E5WA 3EQ2A 1KQSO 1SQBJ 2MF4A 2YNYA 4IFFA 4GR6A 1SFCC 1JY2N 2O3JA 4D6TE 1MUUA 2FYUJ 1K73Q 1WT6A 2A45G 3ITKA 1L4AD 3CXHI 2KGCA 1NH4A 2R5DA 3PRJA 1VQKP 3S1KA 3JCUE 1AUMA 4U0FA 3B4SA 2WSFJ 3Q5PA 1LTSC 2E75B 3H1HD 2AEMA 1BXIA 2M3EA 1L0LD 3V2QA 2W6BA 2FVFA 1IMQA 3MZWB 1SFCB 1IFMA 1BCCJ 5M1BA 3C8VA 4U3FD 3V5BA 1S5LH 2R3SA 3L37A 4COPA 1W5CE 2ZJSE 2P10A 3V2PA 1L0LK 1GL2C 2K9JA 4WVZA 1LJ2A 1NU1J 3L75G 3TDKA 2ZYAA 4BWNA 1R5SA 1RE4A 1EZVI 1RHZB 2V7QH 4DZOA 1N86A 2FAEA 4H2WC 1NTMJ 2B9BA 2M8RA 2YKOA 1ZNVA 1M1JA 1PL5A 1M1KQ 1X22A 3V2NA 4UB6H 1NTKD 1HF9A 3GLMA 2KK7A 3MHVA 3F5HA 1LNQA 1SQBD 3CMEP 2KW2A 1P84H 1HUCA 1YJWP 2FYUD 4NEOA 4AUWA 4KT0J 1YJNP 1IK9A 4XE5B 1NTKK 1BGYJ 4GOFA 3ZDMA 2KGAA 1SQBK 3PTZA 4OGQC 4ASVA 2D2CC 5AVVB 2KOSA 1HGVA 2A45I 2DW3A 1S9KE 1HGZA 1OVUA 3CX5E 1JY3N 1N73A 3CWBJ 2HPCB 4BPGA 4QMAA 3RK2C 2MY5A 1YJ9P 1GD2E 2A06G 1IO4A 3H1LJ 3M0DA 1GPJA 1FOSE 1EOQA 2WPSA 4L76A 2HR3A 4R4MA 3L73E 2V7QJ 1A02F 5CBNA 1PGJA 1NU1D 3H1JE 3PP5A 1HH0A 1OR5A 2QJPC 1S4XA 3CCUP 4OGQB 2BEQD 1KTMA 2CNRA 2JWAA 3H47A 5KLVK 3M0AA 1SS1A 5AVYB 2JB0A 5AW3B 1S2EA 3H25A 1NTMD 4PXHB 2JDIH 2NPSA 2FADA 1KN7A 3FX0A 2YO3A 1UIXA 1OWAA 3AE3C 2QSIA 2Q6QA 1NU1K 2Y0EA 4WB4A 2N98A 4XFZA 4Y28J 1RE4C 5AW8B 1MZ8A 2K0DX 3TSIA 1FZEA 1IFDA 5TISE 1KFMA 3A2AA 3H32A 1M1JC 1NTZG 3FXEA 2QJPB 2B87A 3U1CA 4GODA 2QRXA 1BE3G 1MV8A 3G4SP 2KB7P 5GTHE 4R4LA 3VP9A 2ZVNB 2K9JB 4DT0A 3KYQA 3R4YA 2JR8A 1LTIC 5CJ4A 2L5GB 5AVXB 4OVNF 2PEOA 1VQLP 4H44C 1KZUB 3WU2E 3M9HA 3CWBD 1M6NA 4IPYA 3CX5H 1SQQK 1M90Q 2P67A 1M1JB 3H1LD 3H1IG 2KSEA 2HODB 5CCHD 3CD6P 1N73C 3L74G 5APXA 3KXDA 3U43A 2OQQA 3CXCO 4M3LA 1VQ6P 3M0DC 3MIWA 2KOOA 2CPSA 1RF1A 1VQNP 3TNUB 3CCRP 1Q2NA 3H6PA 1URQA 5KP6B 2O01J 2XDJA 5JPAA 4H44B 3RL0C 4N78D 2CG5B 1E79H 5APUA 1SQPK 2IBZD 2J58A 1N7SA 4N3YB 1P84D 3CXHD 2KZIA 5BVZA 3H1HE 1BDDA 4IL6E 2BHVA 1L0LE 2NPSC 1J1EB 3TYYA 5GTIE 2XXMA 3L72J 1KQFB 3QWOC 5KTBA 5TISH 3RK3D 3TGUG 5CCGA 4I2LC 1R8EA 4U3FE 1QL2A 3CL3D 1R5LA 1AFOA 3RG2A 1NAYA 3LIDA 5GTHH 1XTGB 1YI2P 2LIUA 1KB9E 2M5AA 3K5BA 1NVOA 1GK6A 3DS3A 1LP1A 5F2NA 3F89A 2PENA 4MN4C 2LXBA 2WWWA 2ZT9D 3CCJP 1G1IA 4WWIA 2NPSB 1E0HA 3WU2H 4PH1A 1FZAA 2LKMA 2L22A 2PP6A 1LTJA 2GYKA 1EDIA 3RL0g 2PGDA 3SWYA 4H0LB 4ASWA 2FYZA 1FDMA 4KHXA 2E76C 4U0DA 1FR2A 4EOTA 2FYUE 2JWDA 4BPFA 1KILD 2B87B 2LKIA 3CCQP 1IFIA 1ZW0A 2HFED 2KR5A 1JY2O 2LOLA 3AEAC 2K1AA 2W8ZA 2Q3IA 3G71P 1K04A 1T8KA 1RF1C 5H2FE 7CEIA 4QNBA 1URQC 1GMJA 1USDA 1VQOP 4IL6H 2XKMA 2CWOA 2Z45A 2AXCA 1F80D 3L72D 2WPQA 4RO0A 5GTIH 1N7SC 2N1TA 1N7LA 1BCCE 5APYA 1G1JA 2PEKA 1RQUA 2RMZA 3VMYA 1SVFA 1IFJA 4NPEA 1SQPG 4XFYA 5CCGC 1PP9G 3PHLA 3AEFC 1KB9H 3CX5D 5KJ7D 1CEIA 1L2PA 1RF1B 2QNWA 1PZQA 3MUDA 2G3AA 3G29A 2KUBA 1NTME 1URQB 1H0TB 3RGUA 1DNYA 2WITA 4ZKPA 4OWFA 3B5IA 3L70E 1KQGB 1AYIA 1NO4A 1JOCA 2VSQA 1OW8A 2Z46A 1Q82Q 2FQ2A 2V4HA 4HKZH 4QKOA 1LTJC 1VQ9P 2LXCB 4PV1B 1SLQA 2FXPA 1BGYE 1YBKA 1U7JA 3CMAP 2E75D 3NMDA 4UB8E 2X2BA 2MKVA 2QEXP 4TT3H 1Y9BA 1MZ9A 2WVRA 1KYOI 2WSFH 2FACA 5H2FH 3BCCG 3ABVC 3P8MC 4PWVB 5AVRB 3CC4P 1X9VA 4O9BA 1WMKA 5KP7B 1LTJB 2JO1A 2P7JA 2WZ7A 4H13B 1QLED 3DS1A 1BE3J 1JY3O 3N7NA 2XU6A 3V6IA 4H2YC 1L4AA 2N1TC 2ZXEB 2KNCA 3CI9A 3H1KG 3IFMA 2YXRB 2OYOA 2FYNB 4GKGA 4GT1A 2WMMA 1AVOA 2L6EA 4N78E 2L4BA 3EJBA 4JYBA 1KLPA 3CXHE 4WYMA 4ZMDA 3MUDC 3HE5A 3V2RA 2KOPA 1M74A 3W68A 3BRTB 3RK3E 2E43A 3L74J 3H0DA 1YITP 5HGOA 2N1TB 3II6A 4U0AA 3FXDA 2XT1A 2W6AA 1X8YA 5HGMA 1JM0A 1DEEG 1QGKB 3A7OA 3P32A 1NGMB 1Q7YQ 4UB8H 2E5YA 3NY7B 3HUSA 1YIJP 5APTA 2WSCH 1YTZT 2WT7A 1KFNA 2H8PD 3A0HE 1A43A 4PJ0E 1EZVE 1HY8A 2GDYA 2M0BA 4GDOA 1DD3A 3TGUJ 2LMLA 2H89C 2P9XA 1PPJE 1KB9D 1BE3D 2LTEA 3DTJA 3L73G 1SQXJ 2GZJA 2FFDA 1J1DC 3G21A 2BEZF 3AE4C 5I4TG 1KILE 2YMKA 3S9OA 1Z6MA 2GDXA 2Q5UA 3L71J 1ZMBA 3L70J 1L4AC 1GU5A 2R3CA 2N5IA 1ZMEC 1ZV8A 1GL2B 1OW6A 3CXHH 5HGNA 1L0NG 2QM7A 3L72E 3L35A 1VF5D 2K5XA 1J1DB 3G1GA 2PRRA 1HQBA 1SQVG 3HE4A 2KZJA 4ZNCA 2FQ1A 3NTNA 2YKPA 3GW6A 1DEBA 3JCUH 2GUVA 4CPGA 1T3UA 1PIXA 2FYUK 5BU5A 3GZMA 3H4EA 3DS4A 4LLHA 2KI7B 2KXPB 1RF0A 2WSCJ 4COCA 1QEXA 5APVA 5HGLA 4EYYQ 5KKZC 2QJYC 2WQYC 2E5TA 2OARA 1VQ8P 1BCCD 3T97A 3D71A 5KLIC 3A0HH 3TGUD 1OVRA 1QL1A 1EDLA 1IZNB 3GJNA 4GOEA 2XZ0D 3HUSC 2KGEA 5AW2B 1SQXD 3Q5SA 2D2CB 1RE3A 4DOJA 2E1MA 1Z56A 4U0EA 2HLOA 1N2DC 3L75E 3CCLP 1EDKA 1PP9J 3Q5RA 3RK2B 5KKZB 2FFDC 3L71D 3V4WA 2O01H 3L70D 5AVZB 1CI6A 2LIWA 1SQXK 1QRJA 2O1KA 1EDJA 3MGNA 1FZGA 3VTPC 1NTMK 4Z1MH 2GDWA 1L0LG 2VLOA 2ITAA 1IJDB 2AF8A 1JCCA 2KSJA 3TK1A 3A0BE 3DS0A 2EHTA 1KC8Q 1G2CA 2L91A 2WT7B 1JTHA 3M06A 5CBOA 5CCHA 2W27A 1BGYD 1KYOD 3GG2A 1ZRTD 2KLUA 2XNXA 2KS1A 2K92A 2B89A 2A45H 2W83C 5BS2A 2YKQA 5CHXA 2C9NY 3D6ZA 4L74A 1YQ3C 1RO2A 4U0CA 5L8RJ 3HD7A 1IK7A 1ZOYC 4PD4I 1K8AQ 2PEMA 1IFPA 1GXGA 2AEJA 1USEA 4H0LD 5AVTB 2KG9A 3BCCJ 1BAJA 4HB1A 1RF0C 1UNKA 2KG6A 1M8OB 3VMAA 2A06E 1NTKG 4IFMA 2IPPA 2VLQA 1SQBG 1YQ4C 1W2EA 2NZ2A 2JP3A 2N50A 2QA4P 5EFWB 4A7PA 2GZGA 1PP9D 5TJHA 3MTUE 4U0BA 1S1CX 2CQ8A 2BCCJ 1X0TA 1LT1A 1RE3C 1UIIA 4F37A 2IFMA 2XZ1C 2VRSA 1N73B 4DCKA 4YXDC 2GA1A 1ACPA 3M9BA 3LMOA 4MRTC 3V4QA 3D70A 1GK4A 3MP7B 4L73A 1PEUA 2JJLA 5KLVG 3A0BH 5AW4B 3RL0B 1NTZE 5DCKA 5APSA 2C0XA 1BE3E 2KYVA 1LTTC 3HRNA 3UIAA 1NU1G 1GDTA 3DPHA 1KILA 3AE6C 3G28A 1U7MA 5CCHC 1LTGC 1ZLLA 1M6EX 1NTMG 2Y0DA 1WRGA 1HJBA 4RKUJ 1EZVD 2WPRA 1CI6B 3BCCD 3HD7C 2M5RA 1PPJD 3PLNA 3FGAD 3H32B 3LIEA 3H1IE 2GZEA 2AEFA 2WPTA 5CCGD 4PV1D 3L75J 1JNMA 2XV6A 3PJSK 3L74E 1G2CB 2H7HA 1JMMA 1JTHB 1LT9A 1OXZA 1JY2P 4RESB 1T3JA 3FWLA 4XRQA 3RK3C 2K2QA 1SQQG 2FVAA 2BCCD 2K0XA 1AJYA 1S72P 4HKGA 4NPFX 5KAIE 1ZP0C 1LTBC 2LL8A 1NYHA 2B88A 3HD7B 3L36A 2E76B 1HWTC 4WY4A 3CWBG 3Q3DA 1QX8A 2E74D 4BPHA 4H13D 2IYPA 3BATA 1L0NJ 3B5ND 3H1LG 2WSEJ 4W7YA 1FAVA 2ZT9C 3TGUE 1SQXE 4M0IA 1QVGO 1NOHA 1W2BO 3AECC 1T2KD 4AYCA 1DH3A 2FY8A 2JQ4A 3VMXA 3FWNA 3VMZA 2JKVA 1LGHB 4B86A 3L71E 1N7SB 4IZ6A 2IBZG 2OYIA 1KILC 5BU8B 1EIAA 2UWJE 1YYCA 2KODA 1DX7A 1BDCA 1HVVA 2JU1A 2ZT9B 1Y47A 4D6TG 1NJIQ 3IR9A 3A3YB 4EDFA 3MD0A 5KP8B 1K30A 2ZFCA 2BASA 2FKWB 1X79B 3GKLC 3L75D 1YTZI 2SPZA 5AVUB 3DS5A 2JBGA 1KYOE 2RN0A 1ZRTE 5HV8A 1FDIA 2IZ0A 2M5AB 5AVQB 2I1KA 2R44A 4TLFA 1HJ0A 1FJKA 4U7JA 1PGQA 3I56P 5CZDB 1LP1B 1SFCD 2WPVB 3CPWO 4XROA 1LT9C 1MFZA 4EI2A 5KAIH 4BRYA 3AE8C 1VPCA 3P05A 2K94A 1AQTA 1FOSF 2Y0CA 1EMVA 1KQLA 1NTZJ 1L0ND 1OZHA 3EFFK 2XNDH 1PEOA 1FE6A 2FVEA 3SWFA 1VQ7P 4WY4C 4PD4D 2OYHA 1FU1A 2PFXA 4IOIH 2Z4EA 1RQVA 2JU2A 3NXSA 4HH2A 2PEQA 2YMYA 2ROQA 2G8YA 3Q20A 2MVUA 1PP9E 2H88C 3WUVA 2IFNA 1HBWA 3CC2P 5AVWB 2A06D 1GL2D 3G3ZA 3H1IJ 3TF5A 2K9YA 1ZR2A 2E75C 1H88A 3C9IA 4WY4B 1DV5A 4PH0A 3CC7P 1VL2A 1A02J 2OYIC 1FZBA 1VQ5P 3MGEA 1AV1A 1A8OA 5AW6B 5EJDA 2QJKC 2IBZI 2O01N 3VN0A 4JBZA 2PAJA 3HTKA 2XZRA 1P84I 2POHA 5CMZA 1ZR4A 1KYOH 3KZIE 3EJEA 2YIUC 4BXLA 3GMAA 1EC5A 1H8AA 3GF7A 3SSUA 1M57D 4IL6X 3E1RA 2VLNA 1RO0A 2K93A 4R0MA 3M1MA 2EFJA 2ONTA 1KV4A 4JYCA 2OYIB 2H43A 1PEMA 3BCCE 1NTZD 3CE7A 2R32A 2C0WA 3USSA 1FJPA 2IX7C 1NQ4A 2QJKB 5APQA 4OGQD 5KLVJ 2D2CD 3H1JG 2ZXXA 3KHUA 1PEQA 1VKUA 3OAKA 2P1JA 3S4RA 3CCMP 2C9LY 2YIUB 3I5CA 2W90A 3RG6C 2KG8A 3RK2D 3KQGA 1K05A 1NKNA 2Q9IA 1NTZK 1BSHA 2XV5A 3BVHA 3H1KE 1VDFA 3LW5H 2OYHC 3SFEC 1CW5A 4HYTB 2OTJP 4I6MC 2BCCE 3IN6A 2QM8A 4WBAA 2K37A 1RY3A 3H1ID 3CCSP 1KORA 5E79E 1GTWA 3G26A 4GR2A 2HODA 4BRYB 5EW5E 3SFDC 5B66E 3L74D 3HZQA 3CCVP 2Q1KA 1AA0A 3AE9C 2JEEA 1Q81Q 4OH8B 1JO5A 1JB0J 1FZCA 1OX3A 1L4AB 3TNUA 2KOQA 1OW7A 2HYNA 2OYHB 2KNCB 3O6QA 3KZIH 1SQQJ 3JC22 2N6YA 1BSNA 1LTAC 3QH9A 2P58A 3G6EP 4N6JA 1PFIA 3I55P 3BASA 3HE5B 2MR8A 2AFEA 1EXJA 4PJ0H 4DJGA 4H2XC 1H89A 5KLVD 1GW4A 4JQ0D 3CX5I 2DGYA 2FHSC 2K3RA 4YPCA 4H44D 3LW5J 1L0IA 4LC1A 1SQPJ 1J2JB 3AE5C 3JSVC 4K3AA 2QJYB 1XTCC 1U57A 2KGDA 5AW7B 1VF5C 4JF7A 1OVVA 3HYBA 3HTKB 5KLIB 3H1HG 1NWQA 2Q3EA 1PGPA 2CPBA 2FXMA 2R5BA 2DNWA 3HUSB 1M7LA 2M3BA 1RNIA 2PEIA 1OIPA 5E79H 2KWLA 5HVCA 4D6TJ 2JGPA 2FXOA 4U3FG 3RL0D 5B66H 1L0NE 3E1IA 1YHQP 3OW2O 2PEJA 2IZ1A 2WTYA 1SQVE 4PD4E 1GW3A 2WSSH 2FFDB 2Z44A 1FBMA 4CA3A 3G9RA 1VF5B 2J59M 2OGUA 1MFTA 3Q1MA 3CLQA 1S3JA 2NPSD 2QVAA 2KORA 3RBZA 1SQQD 2QIWA 1SP4A 3A5TA 3R2PA 1FZCC 2E42A 1JCDA 1S5LX 1IMPA 2JO0A 3VYIA 2N5HA 1T6AA 1K9MQ 2FYUG 2LPKA 2EIAA 1JMBA 3AEEC 5KAFE 2JYGA 1J1EC 3HE4B 2MR7A 1SQPD 3H1KJ 3AEDC 1LWUA 1JJ2O 5AVSB 2MD9A 4C7RA 3GHGA 2QE7H 2QG4A 1FZCB 1AQ5A 3SWKA 1VQMP 1L0HA 5DJUB 3HD7D 1H0TA 3P7KA 3O6QB 2E76D 5K5GB 3P8CD 3VRLC 3AEGC 2NO8A 5APWA 3T97B 3E2DA 3O8ZA 1CSBA 1BCCG 1QVFO 4D6TD 1NHLA 1UJZA 3LRYA 3NFQA 3B4QA 4LGDE 3KDPB 4K35A 2JYLA 2PY8A 2WSEH
chains in the Genus database with same CATH topology
2OARA 4PH0A 1NJIQ 1KD1Q 1VQ8P 3CC7P 3G71P 1BAJA 1VQ5P 2EG5A 1Q81Q 3MGEA 1K30A 2Z44A 1YIJP 1A8OA 4QNBA 2M8NA 1VQOP 5F2OA 2BHVA 1A43A 1VQ4P 3DS5A 2XV6A 4XFZA 2CWOA 2Z45A 3CC4P 1M1KQ 2XXMA 1IUQA 2P9XA 2M8LA 3DTJA 2QA4P 3DS1A 4XRQA 3CCEP 2E1MA 2LF4A 4U0EA 3G6EP 2PEKA 1Q86Q 3G21A 3I56P 3CMEP 1KQSO 5I4TG 3CCLP 3CPWO 1YJWP 4GR6A 4U0BA 3G0VA 3G4SP 1RO0A 4XROA 2JO0A 3M1MA 3I55P 1S72P 2EFJA 1K73Q 2ONTA 5F2KA 1YHQP 4XFYA 1YI2P 1YJNP 3P05A 1ZMBA 1K9MQ 1PEMA 1QRJA 2L6EA 1E6JP 3G29A 1VQKP 2EIAA 3DS3A 4XFXA 2JYGA 5F2NA 2M8PA 2DGYA 2PENA 1AUMA 4U0FA 1PEOA 1D1DA 1PEQA 2PEOA 4WYMA 3CCJP 1VQ7P 1VQLP 1PEUA 3CCMP 1JJ2O 3B5IA 3DS0A 5HGNA 1KC8Q 4PH1A 1M6NA 3RG6C 4IPYA 1N8RQ 5DCKA 1M74A 1M90Q 3G1GA 3DS2A 3HYBA 4M0IA 1VQMP 1YJ9P 1QVGO 1VQPP 2Z46A 2BUOA 2PEQA 1W2BO 3H0DA 1Q82Q 1YITP 2OTLP 2BQ1E 5HGOA 3Q20A 5BS1A 3DPHA 4U0AA 3CD6P 5BS2A 2OTJP 3G28A 4U0DA 1VQ9P 2XT1A 3VRLC 1EOQA 5HGMA 1RO2A 4U0CA 3E2DA 3CXCO 1VQ6P 3G1IA 3H4EA 3CC2P 1M6EX 1RNIA 3CCSP 2PEIA 3DS4A 4COPA 1QVFO 3CCQP 3G26A 3WBHA 3CMAP 1EIAA 3NTEA 3LRYA 4GR2A 2KODA 1VQNP 3CCRP 4COCA 3CCUP 5HGLA 2PEMA 1K8AQ 3HZQA 1Q7YQ 2QEXP 3H47A 5JPAA 3CCVP 2JYLA 2PY8A 3OW2O 2PEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 P;  1NJI Q;  1KD1 Q;  3CC7 P;  3CD6 P;  3G71 P;  3G6E P;  2OTJ P;  1Q86 Q;  1VQ5 P;  3I56 P;  1Q81 Q;  1VQ9 P;  3CME P;  1KQS O;  3CCL P;  1VQ7 P;  3CCJ P;  1YIJ P;  1VQL P;  3CPW O;  1YJW P;  3CXC O;  3CCM P;  1JJ2 O;  3G4S P;  1VQ6 P;  3CC2 P;  3I55 P;  1KC8 Q;  3CCS P;  1S72 P;  1VQO P;  1K73 Q;  1QVF O;  3CCQ P;  1VQ4 P;  1YHQ P;  1N8R Q;  3CMA P;  1YI2 P;  1M90 Q;  1YJN P;  1VQN P;  3CC4 P;  3CCR P;  1M1K Q;  3CCU P;  1K9M Q;  1VQM P;  1K8A Q;  1YJ9 P;  1QVG O;  1Q7Y Q;  1VQP P;  2QEX P;  1W2B O;  3CCV P;  1VQK P;  1Q82 Q;  1YIT P;  2OTL P;  2QA4 P;  3OW2 O;  3CCE P; 
#chains in the Genus database with same CATH topology
 1KD1 Q;  2I1J A;  2KOG A;  4EIJ A;  4H0L C;  2L9F A;  1FDO A;  1URQ D;  1SQX G;  5AW9 B;  3EWK A;  1FZF A;  4PD4 H;  3N4X A;  2GUS A;  3L4F A;  4NPD A;  2IDB A;  2KP8 A;  1AF8 A;  3WUT A;  1VHN A;  1N7S D;  1CZQ A;  4AQR D;  4JPZ B;  2M8L A;  3AEB C;  5AW1 B;  3L71 G;  3L70 G;  2LF4 A;  1KB9 I;  2GZF A;  1ZXG A;  3E7K A;  4DG9 A;  3G0V A;  3M9Q A;  4HJG H;  2Q7C A;  3AE7 C;  5F2K A;  4GIF A;  2ZYG A;  3L73 J;  2Y9Z A;  3D6Y A;  1NTK E;  3B5N A;  1KMI Z;  1E6J P;  2IYO A;  2KLV A;  3H1J J;  1SQB E;  2CK3 H;  1AVY A;  3H1K D;  5KAF H;  2I8D A;  1BGY G;  2W6J H;  2PNG A;  2KS1 B;  4C7N A;  5KJ7 A;  1Q90 D;  3U59 A;  3U1A A;  3IAO A;  4C46 A;  1DIP A;  1M56 D;  1LWU C;  2BUO A;  4XA4 A;  2OTL P;  2BQ1 E;  2AXT E;  3GHG C;  5BS1 A;  1EQ7 A;  2FBW C;  3B8E B;  3EJD A;  4L75 A;  1GU4 A;  3WUU A;  1SQV J;  2HG5 D;  1MKM A;  3GZL A;  5B5E E;  3AE2 C;  4UHP B;  3B71 A;  2O1J A;  3OJA B;  4KJM A;  3RK3 B;  5KLV E;  1FS0 E;  3BRV B;  2YO2 A;  5AW0 B;  2GM4 A;  3WMM 0;  2K88 A;  3IF4 A;  1NU1 E;  2M8N A;  2N6Z A;  1LWU B;  5F2O A;  1JUN A;  2J5U A;  1VQ4 P;  1RH5 B;  3GHG B;  1S9K D;  4PV1 C;  2N9B A;  4I1L A;  3KPE A;  1IUQ A;  3RBX A;  1SFC A;  2P2U A;  1T8Z A;  3EFG A;  2NRG A;  4WY4 D;  2OTK E;  2L0Q A;  2LR2 A;  2N1T D;  4ZKU A;  3VP8 A;  3L73 D;  2FQ0 A;  1PV3 A;  1GXH A;  3PH0 A;  3H1J D;  1DD4 A;  5AW5 B;  1ZN5 A;  2YXQ B;  4XFX A;  3Q2Y A;  2E74 C;  2M8P A;  4W80 A;  4H13 C;  1OFC X;  2RH0 A;  1D1D A;  1JEK A;  1KIL B;  3B5N C;  1X3O A;  1NAF A;  1HTL C;  2EHS A;  2MJZ A;  4W7Z A;  4I7Z C;  1GZL A;  1SQQ E;  1N8R Q;  2RKL A;  3C1L A;  3H1H J;  2KIK A;  5C39 A;  3DS2 A;  4IFD K;  1L0L J;  1NKZ B;  1VQP P;  2FYN C;  3GF3 A;  5KJ7 C;  2AXT H;  2ERH A;  1GL2 A;  1T2K C;  2Z5I A;  1JY3 P;  1EZV G;  2Y9Y A;  3CWB E;  3AE1 C;  4Y99 C;  1S5L E;  1SQV D;  3G1I A;  1PPJ G;  4U3F J;  3W67 A;  3H1L E;  1FC2 C;  4XFJ A;  3WBH A;  3NTE A;  2E74 B;  2CGQ A;  2JAZ A;  5B5E H;  1EXI A;  2ZAE B;  3B5N B;  1IC2 A;  1L0N K;  4YXW H;  4YTP C;  1SQP E;  5DJT B;  1LT9 B;  4I7Z B;  3VOP A;  2K0Y A;  1PGO A;  2EG5 A;  1SQV K;  1Y8A A;  2ZYD A;  1OMI A;  3OA7 A;  4C7N B;  2HPC A;  1TU3 F;  2VLP A;  2AVA A;  2AFD A;  1D7M A;  5CJ0 A;  2GZI A;  1IFN A;  2BCC G;  4UB6 E;  3M91 A;  2N9Y B;  2Z5H A;  2IBZ E;  4Y99 B;  3CCE P;  1NTK J;  2ZVO B;  3P8C E;  2MVV A;  3L72 G;  4RJT A;  1Q86 Q;  1P84 E;  1E5W A;  3EQ2 A;  1KQS O;  1SQB J;  2MF4 A;  2YNY A;  4IFF A;  4GR6 A;  1SFC C;  1JY2 N;  2O3J A;  4D6T E;  1MUU A;  2FYU J;  1K73 Q;  1WT6 A;  2A45 G;  3ITK A;  1L4A D;  3CXH I;  2KGC A;  1NH4 A;  2R5D A;  3PRJ A;  1VQK P;  3S1K A;  3JCU E;  1AUM A;  4U0F A;  3B4S A;  2WSF J;  3Q5P A;  1LTS C;  2E75 B;  3H1H D;  2AEM A;  1BXI A;  2M3E A;  1L0L D;  3V2Q A;  2W6B A;  2FVF A;  1IMQ A;  3MZW B;  1SFC B;  1IFM A;  1BCC J;  5M1B A;  3C8V A;  4U3F D;  3V5B A;  1S5L H;  2R3S A;  3L37 A;  4COP A;  1W5C E;  2ZJS E;  2P10 A;  3V2P A;  1L0L K;  1GL2 C;  2K9J A;  4WVZ A;  1LJ2 A;  1NU1 J;  3L75 G;  3TDK A;  2ZYA A;  4BWN A;  1R5S A;  1RE4 A;  1EZV I;  1RHZ B;  2V7Q H;  4DZO A;  1N86 A;  2FAE A;  4H2W C;  1NTM J;  2B9B A;  2M8R A;  2YKO A;  1ZNV A;  1M1J A;  1PL5 A;  1M1K Q;  1X22 A;  3V2N A;  4UB6 H;  1NTK D;  1HF9 A;  3GLM A;  2KK7 A;  3MHV A;  3F5H A;  1LNQ A;  1SQB D;  3CME P;  2KW2 A;  1P84 H;  1HUC A;  1YJW P;  2FYU D;  4NEO A;  4AUW A;  4KT0 J;  1YJN P;  1IK9 A;  4XE5 B;  1NTK K;  1BGY J;  4GOF A;  3ZDM A;  2KGA A;  1SQB K;  3PTZ A;  4OGQ C;  4ASV A;  2D2C C;  5AVV B;  2KOS A;  1HGV A;  2A45 I;  2DW3 A;  1S9K E;  1HGZ A;  1OVU A;  3CX5 E;  1JY3 N;  1N73 A;  3CWB J;  2HPC B;  4BPG A;  4QMA A;  3RK2 C;  2MY5 A;  1YJ9 P;  1GD2 E;  2A06 G;  1IO4 A;  3H1L J;  3M0D A;  1GPJ A;  1FOS E;  1EOQ A;  2WPS A;  4L76 A;  2HR3 A;  4R4M A;  3L73 E;  2V7Q J;  1A02 F;  5CBN A;  1PGJ A;  1NU1 D;  3H1J E;  3PP5 A;  1HH0 A;  1OR5 A;  2QJP C;  1S4X A;  3CCU P;  4OGQ B;  2BEQ D;  1KTM A;  2CNR A;  2JWA A;  3H47 A;  5KLV K;  3M0A A;  1SS1 A;  5AVY B;  2JB0 A;  5AW3 B;  1S2E A;  3H25 A;  1NTM D;  4PXH B;  2JDI H;  2NPS A;  2FAD A;  1KN7 A;  3FX0 A;  2YO3 A;  1UIX A;  1OWA A;  3AE3 C;  2QSI A;  2Q6Q A;  1NU1 K;  2Y0E A;  4WB4 A;  2N98 A;  4XFZ A;  4Y28 J;  1RE4 C;  5AW8 B;  1MZ8 A;  2K0D X;  3TSI A;  1FZE A;  1IFD A;  5TIS E;  1KFM A;  3A2A A;  3H32 A;  1M1J C;  1NTZ G;  3FXE A;  2QJP B;  2B87 A;  3U1C A;  4GOD A;  2QRX A;  1BE3 G;  1MV8 A;  3G4S P;  2KB7 P;  5GTH E;  4R4L A;  3VP9 A;  2ZVN B;  2K9J B;  4DT0 A;  3KYQ A;  3R4Y A;  2JR8 A;  1LTI C;  5CJ4 A;  2L5G B;  5AVX B;  4OVN F;  2PEO A;  1VQL P;  4H44 C;  1KZU B;  3WU2 E;  3M9H A;  3CWB D;  1M6N A;  4IPY A;  3CX5 H;  1SQQ K;  1M90 Q;  2P67 A;  1M1J B;  3H1L D;  3H1I G;  2KSE A;  2HOD B;  5CCH D;  3CD6 P;  1N73 C;  3L74 G;  5APX A;  3KXD A;  3U43 A;  2OQQ A;  3CXC O;  4M3L A;  1VQ6 P;  3M0D C;  3MIW A;  2KOO A;  2CPS A;  1RF1 A;  1VQN P;  3TNU B;  3CCR P;  1Q2N A;  3H6P A;  1URQ A;  5KP6 B;  2O01 J;  2XDJ A;  5JPA A;  4H44 B;  3RL0 C;  4N78 D;  2CG5 B;  1E79 H;  5APU A;  1SQP K;  2IBZ D;  2J58 A;  1N7S A;  4N3Y B;  1P84 D;  3CXH D;  2KZI A;  5BVZ A;  3H1H E;  1BDD A;  4IL6 E;  2BHV A;  1L0L E;  2NPS C;  1J1E B;  3TYY A;  5GTI E;  2XXM A;  3L72 J;  1KQF B;  3QWO C;  5KTB A;  5TIS H;  3RK3 D;  3TGU G;  5CCG A;  4I2L C;  1R8E A;  4U3F E;  1QL2 A;  3CL3 D;  1R5L A;  1AFO A;  3RG2 A;  1NAY A;  3LID A;  5GTH H;  1XTG B;  1YI2 P;  2LIU A;  1KB9 E;  2M5A A;  3K5B A;  1NVO A;  1GK6 A;  3DS3 A;  1LP1 A;  5F2N A;  3F89 A;  2PEN A;  4MN4 C;  2LXB A;  2WWW A;  2ZT9 D;  3CCJ P;  1G1I A;  4WWI A;  2NPS B;  1E0H A;  3WU2 H;  4PH1 A;  1FZA A;  2LKM A;  2L22 A;  2PP6 A;  1LTJ A;  2GYK A;  1EDI A;  3RL0 g;  2PGD A;  3SWY A;  4H0L B;  4ASW A;  2FYZ A;  1FDM A;  4KHX A;  2E76 C;  4U0D A;  1FR2 A;  4EOT A;  2FYU E;  2JWD A;  4BPF A;  1KIL D;  2B87 B;  2LKI A;  3CCQ P;  1IFI A;  1ZW0 A;  2HFE D;  2KR5 A;  1JY2 O;  2LOL A;  3AEA C;  2K1A A;  2W8Z A;  2Q3I A;  3G71 P;  1K04 A;  1T8K A;  1RF1 C;  5H2F E;  7CEI A;  4QNB A;  1URQ C;  1GMJ A;  1USD A;  1VQO P;  4IL6 H;  2XKM A;  2CWO A;  2Z45 A;  2AXC A;  1F80 D;  3L72 D;  2WPQ A;  4RO0 A;  5GTI H;  1N7S C;  2N1T A;  1N7L A;  1BCC E;  5APY A;  1G1J A;  2PEK A;  1RQU A;  2RMZ A;  3VMY A;  1SVF A;  1IFJ A;  4NPE A;  1SQP G;  4XFY A;  5CCG C;  1PP9 G;  3PHL A;  3AEF C;  1KB9 H;  3CX5 D;  5KJ7 D;  1CEI A;  1L2P A;  1RF1 B;  2QNW A;  1PZQ A;  3MUD A;  2G3A A;  3G29 A;  2KUB A;  1NTM E;  1URQ B;  1H0T B;  3RGU A;  1DNY A;  2WIT A;  4ZKP A;  4OWF A;  3B5I A;  3L70 E;  1KQG B;  1AYI A;  1NO4 A;  1JOC A;  2VSQ A;  1OW8 A;  2Z46 A;  1Q82 Q;  2FQ2 A;  2V4H A;  4HKZ H;  4QKO A;  1LTJ C;  1VQ9 P;  2LXC B;  4PV1 B;  1SLQ A;  2FXP A;  1BGY E;  1YBK A;  1U7J A;  3CMA P;  2E75 D;  3NMD A;  4UB8 E;  2X2B A;  2MKV A;  2QEX P;  4TT3 H;  1Y9B A;  1MZ9 A;  2WVR A;  1KYO I;  2WSF H;  2FAC A;  5H2F H;  3BCC G;  3ABV C;  3P8M C;  4PWV B;  5AVR B;  3CC4 P;  1X9V A;  4O9B A;  1WMK A;  5KP7 B;  1LTJ B;  2JO1 A;  2P7J A;  2WZ7 A;  4H13 B;  1QLE D;  3DS1 A;  1BE3 J;  1JY3 O;  3N7N A;  2XU6 A;  3V6I A;  4H2Y C;  1L4A A;  2N1T C;  2ZXE B;  2KNC A;  3CI9 A;  3H1K G;  3IFM A;  2YXR B;  2OYO A;  2FYN B;  4GKG A;  4GT1 A;  2WMM A;  1AVO A;  2L6E A;  4N78 E;  2L4B A;  3EJB A;  4JYB A;  1KLP A;  3CXH E;  4WYM A;  4ZMD A;  3MUD C;  3HE5 A;  3V2R A;  2KOP A;  1M74 A;  3W68 A;  3BRT B;  3RK3 E;  2E43 A;  3L74 J;  3H0D A;  1YIT P;  5HGO A;  2N1T B;  3II6 A;  4U0A A;  3FXD A;  2XT1 A;  2W6A A;  1X8Y A;  5HGM A;  1JM0 A;  1DEE G;  1QGK B;  3A7O A;  3P32 A;  1NGM B;  1Q7Y Q;  4UB8 H;  2E5Y A;  3NY7 B;  3HUS A;  1YIJ P;  5APT A;  2WSC H;  1YTZ T;  2WT7 A;  1KFN A;  2H8P D;  3A0H E;  1A43 A;  4PJ0 E;  1EZV E;  1HY8 A;  2GDY A;  2M0B A;  4GDO A;  1DD3 A;  3TGU J;  2LML A;  2H89 C;  2P9X A;  1PPJ E;  1KB9 D;  1BE3 D;  2LTE A;  3DTJ A;  3L73 G;  1SQX J;  2GZJ A;  2FFD A;  1J1D C;  3G21 A;  2BEZ F;  3AE4 C;  5I4T G;  1KIL E;  2YMK A;  3S9O A;  1Z6M A;  2GDX A;  2Q5U A;  3L71 J;  1ZMB A;  3L70 J;  1L4A C;  1GU5 A;  2R3C A;  2N5I A;  1ZME C;  1ZV8 A;  1GL2 B;  1OW6 A;  3CXH H;  5HGN A;  1L0N G;  2QM7 A;  3L72 E;  3L35 A;  1VF5 D;  2K5X A;  1J1D B;  3G1G A;  2PRR A;  1HQB A;  1SQV G;  3HE4 A;  2KZJ A;  4ZNC A;  2FQ1 A;  3NTN A;  2YKP A;  3GW6 A;  1DEB A;  3JCU H;  2GUV A;  4CPG A;  1T3U A;  1PIX A;  2FYU K;  5BU5 A;  3GZM A;  3H4E A;  3DS4 A;  4LLH A;  2KI7 B;  2KXP B;  1RF0 A;  2WSC J;  4COC A;  1QEX A;  5APV A;  5HGL A;  4EYY Q;  5KKZ C;  2QJY C;  2WQY C;  2E5T A;  2OAR A;  1VQ8 P;  1BCC D;  3T97 A;  3D71 A;  5KLI C;  3A0H H;  3TGU D;  1OVR A;  1QL1 A;  1EDL A;  1IZN B;  3GJN A;  4GOE A;  2XZ0 D;  3HUS C;  2KGE A;  5AW2 B;  1SQX D;  3Q5S A;  2D2C B;  1RE3 A;  4DOJ A;  2E1M A;  1Z56 A;  4U0E A;  2HLO A;  1N2D C;  3L75 E;  3CCL P;  1EDK A;  1PP9 J;  3Q5R A;  3RK2 B;  5KKZ B;  2FFD C;  3L71 D;  3V4W A;  2O01 H;  3L70 D;  5AVZ B;  1CI6 A;  2LIW A;  1SQX K;  1QRJ A;  2O1K A;  1EDJ A;  3MGN A;  1FZG A;  3VTP C;  1NTM K;  4Z1M H;  2GDW A;  1L0L G;  2VLO A;  2ITA A;  1IJD B;  2AF8 A;  1JCC A;  2KSJ A;  3TK1 A;  3A0B E;  3DS0 A;  2EHT A;  1KC8 Q;  1G2C A;  2L91 A;  2WT7 B;  1JTH A;  3M06 A;  5CBO A;  5CCH A;  2W27 A;  1BGY D;  1KYO D;  3GG2 A;  1ZRT D;  2KLU A;  2XNX A;  2KS1 A;  2K92 A;  2B89 A;  2A45 H;  2W83 C;  5BS2 A;  2YKQ A;  5CHX A;  2C9N Y;  3D6Z A;  4L74 A;  1YQ3 C;  1RO2 A;  4U0C A;  5L8R J;  3HD7 A;  1IK7 A;  1ZOY C;  4PD4 I;  1K8A Q;  2PEM A;  1IFP A;  1GXG A;  2AEJ A;  1USE A;  4H0L D;  5AVT B;  2KG9 A;  3BCC J;  1BAJ A;  4HB1 A;  1RF0 C;  1UNK A;  2KG6 A;  1M8O B;  3VMA A;  2A06 E;  1NTK G;  4IFM A;  2IPP A;  2VLQ A;  1SQB G;  1YQ4 C;  1W2E A;  2NZ2 A;  2JP3 A;  2N50 A;  2QA4 P;  5EFW B;  4A7P A;  2GZG A;  1PP9 D;  5TJH A;  3MTU E;  4U0B A;  1S1C X;  2CQ8 A;  2BCC J;  1X0T A;  1LT1 A;  1RE3 C;  1UII A;  4F37 A;  2IFM A;  2XZ1 C;  2VRS A;  1N73 B;  4DCK A;  4YXD C;  2GA1 A;  1ACP A;  3M9B A;  3LMO A;  4MRT C;  3V4Q A;  3D70 A;  1GK4 A;  3MP7 B;  4L73 A;  1PEU A;  2JJL A;  5KLV G;  3A0B H;  5AW4 B;  3RL0 B;  1NTZ E;  5DCK A;  5APS A;  2C0X A;  1BE3 E;  2KYV A;  1LTT C;  3HRN A;  3UIA A;  1NU1 G;  1GDT A;  3DPH A;  1KIL A;  3AE6 C;  3G28 A;  1U7M A;  5CCH C;  1LTG C;  1ZLL A;  1M6E X;  1NTM G;  2Y0D A;  1WRG A;  1HJB A;  4RKU J;  1EZV D;  2WPR A;  1CI6 B;  3BCC D;  3HD7 C;  2M5R A;  1PPJ D;  3PLN A;  3FGA D;  3H32 B;  3LIE A;  3H1I E;  2GZE A;  2AEF A;  2WPT A;  5CCG D;  4PV1 D;  3L75 J;  1JNM A;  2XV6 A;  3PJS K;  3L74 E;  1G2C B;  2H7H A;  1JMM A;  1JTH B;  1LT9 A;  1OXZ A;  1JY2 P;  4RES B;  1T3J A;  3FWL A;  4XRQ A;  3RK3 C;  2K2Q A;  1SQQ G;  2FVA A;  2BCC D;  2K0X A;  1AJY A;  1S72 P;  4HKG A;  4NPF X;  5KAI E;  1ZP0 C;  1LTB C;  2LL8 A;  1NYH A;  2B88 A;  3HD7 B;  3L36 A;  2E76 B;  1HWT C;  4WY4 A;  3CWB G;  3Q3D A;  1QX8 A;  2E74 D;  4BPH A;  4H13 D;  2IYP A;  3BAT A;  1L0N J;  3B5N D;  3H1L G;  2WSE J;  4W7Y A;  1FAV A;  2ZT9 C;  3TGU E;  1SQX E;  4M0I A;  1QVG O;  1NOH A;  1W2B O;  3AEC C;  1T2K D;  4AYC A;  1DH3 A;  2FY8 A;  2JQ4 A;  3VMX A;  3FWN A;  3VMZ A;  2JKV A;  1LGH B;  4B86 A;  3L71 E;  1N7S B;  4IZ6 A;  2IBZ G;  2OYI A;  1KIL C;  5BU8 B;  1EIA A;  2UWJ E;  1YYC A;  2KOD A;  1DX7 A;  1BDC A;  1HVV A;  2JU1 A;  2ZT9 B;  1Y47 A;  4D6T G;  1NJI Q;  3IR9 A;  3A3Y B;  4EDF A;  3MD0 A;  5KP8 B;  1K30 A;  2ZFC A;  2BAS A;  2FKW B;  1X79 B;  3GKL C;  3L75 D;  1YTZ I;  2SPZ A;  5AVU B;  3DS5 A;  2JBG A;  1KYO E;  2RN0 A;  1ZRT E;  5HV8 A;  1FDI A;  2IZ0 A;  2M5A B;  5AVQ B;  2I1K A;  2R44 A;  4TLF A;  1HJ0 A;  1FJK A;  4U7J A;  1PGQ A;  3I56 P;  5CZD B;  1LP1 B;  1SFC D;  2WPV B;  3CPW O;  4XRO A;  1LT9 C;  1MFZ A;  4EI2 A;  5KAI H;  4BRY A;  3AE8 C;  1VPC A;  3P05 A;  2K94 A;  1AQT A;  1FOS F;  2Y0C A;  1EMV A;  1KQL A;  1NTZ J;  1L0N D;  1OZH A;  3EFF K;  2XND H;  1PEO A;  1FE6 A;  2FVE A;  3SWF A;  1VQ7 P;  4WY4 C;  4PD4 D;  2OYH A;  1FU1 A;  2PFX A;  4IOI H;  2Z4E A;  1RQV A;  2JU2 A;  3NXS A;  4HH2 A;  2PEQ A;  2YMY A;  2ROQ A;  2G8Y A;  3Q20 A;  2MVU A;  1PP9 E;  2H88 C;  3WUV A;  2IFN A;  1HBW A;  3CC2 P;  5AVW B;  2A06 D;  1GL2 D;  3G3Z A;  3H1I J;  3TF5 A;  2K9Y A;  1ZR2 A;  2E75 C;  1H88 A;  3C9I A;  4WY4 B;  1DV5 A;  4PH0 A;  3CC7 P;  1VL2 A;  1A02 J;  2OYI C;  1FZB A;  1VQ5 P;  3MGE A;  1AV1 A;  1A8O A;  5AW6 B;  5EJD A;  2QJK C;  2IBZ I;  2O01 N;  3VN0 A;  4JBZ A;  2PAJ A;  3HTK A;  2XZR A;  1P84 I;  2POH A;  5CMZ A;  1ZR4 A;  1KYO H;  3KZI E;  3EJE A;  2YIU C;  4BXL A;  3GMA A;  1EC5 A;  1H8A A;  3GF7 A;  3SSU A;  1M57 D;  4IL6 X;  3E1R A;  2VLN A;  1RO0 A;  2K93 A;  4R0M A;  3M1M A;  2EFJ A;  2ONT A;  1KV4 A;  4JYC A;  2OYI B;  2H43 A;  1PEM A;  3BCC E;  1NTZ D;  3CE7 A;  2R32 A;  2C0W A;  3USS A;  1FJP A;  2IX7 C;  1NQ4 A;  2QJK B;  5APQ A;  4OGQ D;  5KLV J;  2D2C D;  3H1J G;  2ZXX A;  3KHU A;  1PEQ A;  1VKU A;  3OAK A;  2P1J A;  3S4R A;  3CCM P;  2C9L Y;  2YIU B;  3I5C A;  2W90 A;  3RG6 C;  2KG8 A;  3RK2 D;  3KQG A;  1K05 A;  1NKN A;  2Q9I A;  1NTZ K;  1BSH A;  2XV5 A;  3BVH A;  3H1K E;  1VDF A;  3LW5 H;  2OYH C;  3SFE C;  1CW5 A;  4HYT B;  2OTJ P;  4I6M C;  2BCC E;  3IN6 A;  2QM8 A;  4WBA A;  2K37 A;  1RY3 A;  3H1I D;  3CCS P;  1KOR A;  5E79 E;  1GTW A;  3G26 A;  4GR2 A;  2HOD A;  4BRY B;  5EW5 E;  3SFD C;  5B66 E;  3L74 D;  3HZQ A;  3CCV P;  2Q1K A;  1AA0 A;  3AE9 C;  2JEE A;  1Q81 Q;  4OH8 B;  1JO5 A;  1JB0 J;  1FZC A;  1OX3 A;  1L4A B;  3TNU A;  2KOQ A;  1OW7 A;  2HYN A;  2OYH B;  2KNC B;  3O6Q A;  3KZI H;  1SQQ J;  3JC2 2;  2N6Y A;  1BSN A;  1LTA C;  3QH9 A;  2P58 A;  3G6E P;  4N6J A;  1PFI A;  3I55 P;  3BAS A;  3HE5 B;  2MR8 A;  2AFE A;  1EXJ A;  4PJ0 H;  4DJG A;  4H2X C;  1H89 A;  5KLV D;  1GW4 A;  4JQ0 D;  3CX5 I;  2DGY A;  2FHS C;  2K3R A;  4YPC A;  4H44 D;  3LW5 J;  1L0I A;  4LC1 A;  1SQP J;  1J2J B;  3AE5 C;  3JSV C;  4K3A A;  2QJY B;  1XTC C;  1U57 A;  2KGD A;  5AW7 B;  1VF5 C;  4JF7 A;  1OVV A;  3HYB A;  3HTK B;  5KLI B;  3H1H G;  1NWQ A;  2Q3E A;  1PGP A;  2CPB A;  2FXM A;  2R5B A;  2DNW A;  3HUS B;  1M7L A;  2M3B A;  1RNI A;  2PEI A;  1OIP A;  5E79 H;  2KWL A;  5HVC A;  4D6T J;  2JGP A;  2FXO A;  4U3F G;  3RL0 D;  5B66 H;  1L0N E;  3E1I A;  1YHQ P;  3OW2 O;  2PEJ A;  2IZ1 A;  2WTY A;  1SQV E;  4PD4 E;  1GW3 A;  2WSS H;  2FFD B;  2Z44 A;  1FBM A;  4CA3 A;  3G9R A;  1VF5 B;  2J59 M;  2OGU A;  1MFT A;  3Q1M A;  3CLQ A;  1S3J A;  2NPS D;  2QVA A;  2KOR A;  3RBZ A;  1SQQ D;  2QIW A;  1SP4 A;  3A5T A;  3R2P A;  1FZC C;  2E42 A;  1JCD A;  1S5L X;  1IMP A;  2JO0 A;  3VYI A;  2N5H A;  1T6A A;  1K9M Q;  2FYU G;  2LPK A;  2EIA A;  1JMB A;  3AEE C;  5KAF E;  2JYG A;  1J1E C;  3HE4 B;  2MR7 A;  1SQP D;  3H1K J;  3AED C;  1LWU A;  1JJ2 O;  5AVS B;  2MD9 A;  4C7R A;  3GHG A;  2QE7 H;  2QG4 A;  1FZC B;  1AQ5 A;  3SWK A;  1VQM P;  1L0H A;  5DJU B;  3HD7 D;  1H0T A;  3P7K A;  3O6Q B;  2E76 D;  5K5G B;  3P8C D;  3VRL C;  3AEG C;  2NO8 A;  5APW A;  3T97 B;  3E2D A;  3O8Z A;  1CSB A;  1BCC G;  1QVF O;  4D6T D;  1NHL A;  1UJZ A;  3LRY A;  3NFQ A;  3B4Q A;  4LGD E;  3KDP B;  4K35 A;  2JYL A;  2PY8 A;  2WSE H; 
#chains in the Genus database with same CATH homology
 2OAR A;  4PH0 A;  1NJI Q;  1KD1 Q;  1VQ8 P;  3CC7 P;  3G71 P;  1BAJ A;  1VQ5 P;  2EG5 A;  1Q81 Q;  3MGE A;  1K30 A;  2Z44 A;  1YIJ P;  1A8O A;  4QNB A;  2M8N A;  1VQO P;  5F2O A;  2BHV A;  1A43 A;  1VQ4 P;  3DS5 A;  2XV6 A;  4XFZ A;  2CWO A;  2Z45 A;  3CC4 P;  1M1K Q;  2XXM A;  1IUQ A;  2P9X A;  2M8L A;  3DTJ A;  2QA4 P;  3DS1 A;  4XRQ A;  3CCE P;  2E1M A;  2LF4 A;  4U0E A;  3G6E P;  2PEK A;  1Q86 Q;  3G21 A;  3I56 P;  3CME P;  1KQS O;  5I4T G;  3CCL P;  3CPW O;  1YJW P;  4GR6 A;  4U0B A;  3G0V A;  3G4S P;  1RO0 A;  4XRO A;  2JO0 A;  3M1M A;  3I55 P;  1S72 P;  2EFJ A;  1K73 Q;  2ONT A;  5F2K A;  1YHQ P;  4XFY A;  1YI2 P;  1YJN P;  3P05 A;  1ZMB A;  1K9M Q;  1PEM A;  1QRJ A;  2L6E A;  1E6J P;  3G29 A;  1VQK P;  2EIA A;  3DS3 A;  4XFX A;  2JYG A;  5F2N A;  2M8P A;  2DGY A;  2PEN A;  1AUM A;  4U0F A;  1PEO A;  1D1D A;  1PEQ A;  2PEO A;  4WYM A;  3CCJ P;  1VQ7 P;  1VQL P;  1PEU A;  3CCM P;  1JJ2 O;  3B5I A;  3DS0 A;  5HGN A;  1KC8 Q;  4PH1 A;  1M6N A;  3RG6 C;  4IPY A;  1N8R Q;  5DCK A;  1M74 A;  1M90 Q;  3G1G A;  3DS2 A;  3HYB A;  4M0I A;  1VQM P;  1YJ9 P;  1QVG O;  1VQP P;  2Z46 A;  2BUO A;  2PEQ A;  1W2B O;  3H0D A;  1Q82 Q;  1YIT P;  2OTL P;  2BQ1 E;  5HGO A;  3Q20 A;  5BS1 A;  3DPH A;  4U0A A;  3CD6 P;  5BS2 A;  2OTJ P;  3G28 A;  4U0D A;  1VQ9 P;  2XT1 A;  3VRL C;  1EOQ A;  5HGM A;  1RO2 A;  4U0C A;  3E2D A;  3CXC O;  1VQ6 P;  3G1I A;  3H4E A;  3CC2 P;  1M6E X;  1RNI A;  3CCS P;  2PEI A;  3DS4 A;  4COP A;  1QVF O;  3CCQ P;  3G26 A;  3WBH A;  3CMA P;  1EIA A;  3NTE A;  3LRY A;  4GR2 A;  2KOD A;  1VQN P;  3CCR P;  4COC A;  3CCU P;  5HGL A;  2PEM A;  1K8A Q;  3HZQ A;  1Q7Y Q;  2QEX P;  3H47 A;  5JPA A;  3CCV P;  2JYL A;  2PY8 A;  3OW2 O;  2PEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...