3CC7L

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cc7L02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 3cc7L01
1KC8M 1VQ6O 1YIJL 1Q81P 3CC2L 1YIJO 1YI2L 1VQPO 3CCEL 1YI2O 3CCEO 1Q86M 1NJIP 1YJNL 1K9MP 1YJ9L 3CD6O 1K8AM 1YJ9O 3CCJL 1YITL 3CPWN 2OTJL 1VQ8L 3CCVO 1VQNL 1Q7YP 2OTJO 1YHQL 1M1KM 1VQ8O 1YHQO 3I56L 2OTLL 3I55O 1VQML 1JJ2K 1Q81M 1VQMO 1W2BK 1VQ5L 1Q82P 3CC2O 1VQ5O 1VQ4L 1K73M 1VQ4O 3OW2K 1KD1P 3G6EL 1M90P 3G6EO 1NJIM 3OW2N 1YJNO 1N8RP 1K9MM 1S72L 1S72O 1VQOL 3CCJO 3CCRL 1YITO 1VQNO 3G4SL 3G71L 3I56O 3G4SO 1VQKL 2OTLO 1VQKO 3CC7L 1QVFK 3CC7O 1Q86P 3CMEL 1VQ7L 1QVFN 3CMEO 1JJ2N 3CCSL 1W2BN 3CCSO 3CC4L 3CMAL 1M90M 3CCML 1VQ6L 1KC8P 1VQOO 1Q7YM 3CCRO 3CXCK 2QA4L 3G71O 3CXCN 2QA4O 1VQPL 1K73P 1KQSK 3CCQL 1YJWL 3CPWK 1Q82M 3CCQO 1YJWO 3CD6L 1VQ7O 3CCUL 1K8AP 2QEXL 1KQSN 3CCLL 3CCUO 1QVGK 3CCVL 2QEXO 1KD1M 3CCLO 1M1KP 3CC4O 1VQLL 3CMAO 1VQLO 1QVGN 1VQ9L 1N8RM 1VQ9O 3CCMO 3I55L
chains in the Genus database with same CATH superfamily
1KC8M 1VQ6O 1YIJL 1Q81P 3CC2L 1YIJO 4XTKA 5DQTA 2YZSA 1YI2L 1VQPO 3CCEL 1YI2O 3CCEO 1Q86M 1NJIP 3NKDA 1YJNL 1K9MP 1YJ9L 3GODA 3CD6O 1K8AM 1YJ9O 3CCJL 1YITL 3CPWN 2OTJL 1VQ8L 3CCVO 1VQNL 1Q7YP 2OTJO 1YHQL 1M1KM 1VQ8O 1YHQO 3I56L 2OTLL 4W8KA 4WJ0A 3I55O 1VQML 1JJ2K 1Q81M 1VQMO 1W2BK 1VQ5L 1Q82P 3CC2O 1VQ5O 1VQ4L 1K73M 1VQ4O 3OW2K 1KD1P 3G6EL 1M90P 3G6EO 1NJIM 3OW2N 1YJNO 1N8RP 1K9MM 1S72L 5FCLA 1S72O 1VQOL 5DQZA 3CCJO 3CCRL 1YITO 1VQNO 5DS4A 3G4SL 3G71L 3I56O 3G4SO 1VQKL 2OTLO 1VQKO 3CC7L 1QVFK 3CC7O 1Q86P 3CMEL 1VQ7L 1QVFN 3CMEO 1JJ2N 3CCSL 1W2BN 3CCSO 3CC4L 3CMAL 1M90M 3CCML 1VQ6L 1KC8P 4P6IC 1VQOO 1Q7YM 3CCRO 3CXCK 2QA4L 3G71O 4QDLA 3CXCN 2QA4O 1VQPL 1K73P 1KQSK 3CCQL 1YJWL 3CPWK 1Q82M 3CCQO 1YJWO 3CD6L 1VQ7O 3CCUL 1K8AP 2QEXL 1KQSN 3CCLL 3CCUO 1QVGK 5DS6A 3CCVL 2QEXO 5DLJA 1KD1M 3CCLO 1M1KP 5DS5A 3CC4O 1VQLL 3CMAO 1VQLO 1QVGN 1VQ9L 1N8RM 1VQ9O 3CCMO 4N06A 3I55L
chains in the Genus database with same CATH topology
1KC8M 1VQ6O 1YIJL 1Q81P 3CC2L 1YIJO 4XTKA 5DQTA 2YZSA 1YI2L 1VQPO 3CCEL 1YI2O 3CCEO 1Q86M 1NJIP 3NKDA 1YJNL 1K9MP 1YJ9L 3GODA 3CD6O 1K8AM 1YJ9O 3CCJL 1YITL 3CPWN 2OTJL 1VQ8L 3CCVO 1VQNL 1Q7YP 2OTJO 1YHQL 1M1KM 1VQ8O 1YHQO 3I56L 2OTLL 4W8KA 4WJ0A 3I55O 1VQML 1JJ2K 1Q81M 1VQMO 1W2BK 1VQ5L 1Q82P 3CC2O 1VQ5O 1VQ4L 1K73M 1VQ4O 3OW2K 1KD1P 3G6EL 1M90P 3G6EO 1NJIM 3OW2N 1YJNO 1N8RP 1K9MM 1S72L 5FCLA 1S72O 1VQOL 5DQZA 3CCJO 3CCRL 1YITO 1VQNO 5DS4A 3G4SL 3G71L 3I56O 3G4SO 1VQKL 2OTLO 1VQKO 3CC7L 1QVFK 3CC7O 1Q86P 3CMEL 1VQ7L 1QVFN 3CMEO 1JJ2N 3CCSL 1W2BN 3CCSO 3CC4L 3CMAL 1M90M 3CCML 1VQ6L 1KC8P 4P6IC 1VQOO 1Q7YM 3CCRO 3CXCK 2QA4L 3G71O 4QDLA 3CXCN 2QA4O 1VQPL 1K73P 1KQSK 3CCQL 1YJWL 3CPWK 1Q82M 3CCQO 1YJWO 3CD6L 1VQ7O 3CCUL 1K8AP 2QEXL 1KQSN 3CCLL 3CCUO 1QVGK 5DS6A 3CCVL 2QEXO 5DLJA 1KD1M 3CCLO 1M1KP 5DS5A 3CC4O 1VQLL 3CMAO 1VQLO 1QVGN 1VQ9L 1N8RM 1VQ9O 3CCMO 4N06A 3I55L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 M;  1VQ6 O;  1YIJ L;  1Q81 P;  3CC2 L;  1YIJ O;  1YI2 L;  1VQP O;  3CCE L;  1YI2 O;  3CCE O;  1Q86 M;  1NJI P;  1YJN L;  1K9M P;  1YJ9 L;  3CD6 O;  1K8A M;  1YJ9 O;  3CCJ L;  1YIT L;  3CPW N;  2OTJ L;  1VQ8 L;  3CCV O;  1VQN L;  1Q7Y P;  2OTJ O;  1YHQ L;  1M1K M;  1VQ8 O;  1YHQ O;  3I56 L;  2OTL L;  3I55 O;  1VQM L;  1JJ2 K;  1Q81 M;  1VQM O;  1W2B K;  1VQ5 L;  1Q82 P;  3CC2 O;  1VQ5 O;  1VQ4 L;  1K73 M;  1VQ4 O;  3OW2 K;  1KD1 P;  3G6E L;  1M90 P;  3G6E O;  1NJI M;  3OW2 N;  1YJN O;  1N8R P;  1K9M M;  1S72 L;  1S72 O;  1VQO L;  3CCJ O;  3CCR L;  1YIT O;  1VQN O;  3G4S L;  3G71 L;  3I56 O;  3G4S O;  1VQK L;  2OTL O;  1VQK O;  3CC7 L;  1QVF K;  3CC7 O;  1Q86 P;  3CME L;  1VQ7 L;  1QVF N;  3CME O;  1JJ2 N;  3CCS L;  1W2B N;  3CCS O;  3CC4 L;  3CMA L;  1M90 M;  3CCM L;  1VQ6 L;  1KC8 P;  1VQO O;  1Q7Y M;  3CCR O;  3CXC K;  2QA4 L;  3G71 O;  3CXC N;  2QA4 O;  1VQP L;  1K73 P;  1KQS K;  3CCQ L;  1YJW L;  3CPW K;  1Q82 M;  3CCQ O;  1YJW O;  3CD6 L;  1VQ7 O;  3CCU L;  1K8A P;  2QEX L;  1KQS N;  3CCL L;  3CCU O;  1QVG K;  3CCV L;  2QEX O;  1KD1 M;  3CCL O;  1M1K P;  3CC4 O;  1VQL L;  3CMA O;  1VQL O;  1QVG N;  1VQ9 L;  1N8R M;  1VQ9 O;  3CCM O;  3I55 L; 
#chains in the Genus database with same CATH topology
 1KC8 M;  1VQ6 O;  1YIJ L;  1Q81 P;  3CC2 L;  1YIJ O;  4XTK A;  5DQT A;  2YZS A;  1YI2 L;  1VQP O;  3CCE L;  1YI2 O;  3CCE O;  1Q86 M;  1NJI P;  3NKD A;  1YJN L;  1K9M P;  1YJ9 L;  3GOD A;  3CD6 O;  1K8A M;  1YJ9 O;  3CCJ L;  1YIT L;  3CPW N;  2OTJ L;  1VQ8 L;  3CCV O;  1VQN L;  1Q7Y P;  2OTJ O;  1YHQ L;  1M1K M;  1VQ8 O;  1YHQ O;  3I56 L;  2OTL L;  4W8K A;  4WJ0 A;  3I55 O;  1VQM L;  1JJ2 K;  1Q81 M;  1VQM O;  1W2B K;  1VQ5 L;  1Q82 P;  3CC2 O;  1VQ5 O;  1VQ4 L;  1K73 M;  1VQ4 O;  3OW2 K;  1KD1 P;  3G6E L;  1M90 P;  3G6E O;  1NJI M;  3OW2 N;  1YJN O;  1N8R P;  1K9M M;  1S72 L;  5FCL A;  1S72 O;  1VQO L;  5DQZ A;  3CCJ O;  3CCR L;  1YIT O;  1VQN O;  5DS4 A;  3G4S L;  3G71 L;  3I56 O;  3G4S O;  1VQK L;  2OTL O;  1VQK O;  3CC7 L;  1QVF K;  3CC7 O;  1Q86 P;  3CME L;  1VQ7 L;  1QVF N;  3CME O;  1JJ2 N;  3CCS L;  1W2B N;  3CCS O;  3CC4 L;  3CMA L;  1M90 M;  3CCM L;  1VQ6 L;  1KC8 P;  4P6I C;  1VQO O;  1Q7Y M;  3CCR O;  3CXC K;  2QA4 L;  3G71 O;  4QDL A;  3CXC N;  2QA4 O;  1VQP L;  1K73 P;  1KQS K;  3CCQ L;  1YJW L;  3CPW K;  1Q82 M;  3CCQ O;  1YJW O;  3CD6 L;  1VQ7 O;  3CCU L;  1K8A P;  2QEX L;  1KQS N;  3CCL L;  3CCU O;  1QVG K;  5DS6 A;  3CCV L;  2QEX O;  5DLJ A;  1KD1 M;  3CCL O;  1M1K P;  5DS5 A;  3CC4 O;  1VQL L;  3CMA O;  1VQL O;  1QVG N;  1VQ9 L;  1N8R M;  1VQ9 O;  3CCM O;  4N06 A;  3I55 L; 
#chains in the Genus database with same CATH homology
 1KC8 M;  1VQ6 O;  1YIJ L;  1Q81 P;  3CC2 L;  1YIJ O;  4XTK A;  5DQT A;  2YZS A;  1YI2 L;  1VQP O;  3CCE L;  1YI2 O;  3CCE O;  1Q86 M;  1NJI P;  3NKD A;  1YJN L;  1K9M P;  1YJ9 L;  3GOD A;  3CD6 O;  1K8A M;  1YJ9 O;  3CCJ L;  1YIT L;  3CPW N;  2OTJ L;  1VQ8 L;  3CCV O;  1VQN L;  1Q7Y P;  2OTJ O;  1YHQ L;  1M1K M;  1VQ8 O;  1YHQ O;  3I56 L;  2OTL L;  4W8K A;  4WJ0 A;  3I55 O;  1VQM L;  1JJ2 K;  1Q81 M;  1VQM O;  1W2B K;  1VQ5 L;  1Q82 P;  3CC2 O;  1VQ5 O;  1VQ4 L;  1K73 M;  1VQ4 O;  3OW2 K;  1KD1 P;  3G6E L;  1M90 P;  3G6E O;  1NJI M;  3OW2 N;  1YJN O;  1N8R P;  1K9M M;  1S72 L;  5FCL A;  1S72 O;  1VQO L;  5DQZ A;  3CCJ O;  3CCR L;  1YIT O;  1VQN O;  5DS4 A;  3G4S L;  3G71 L;  3I56 O;  3G4S O;  1VQK L;  2OTL O;  1VQK O;  3CC7 L;  1QVF K;  3CC7 O;  1Q86 P;  3CME L;  1VQ7 L;  1QVF N;  3CME O;  1JJ2 N;  3CCS L;  1W2B N;  3CCS O;  3CC4 L;  3CMA L;  1M90 M;  3CCM L;  1VQ6 L;  1KC8 P;  4P6I C;  1VQO O;  1Q7Y M;  3CCR O;  3CXC K;  2QA4 L;  3G71 O;  4QDL A;  3CXC N;  2QA4 O;  1VQP L;  1K73 P;  1KQS K;  3CCQ L;  1YJW L;  3CPW K;  1Q82 M;  3CCQ O;  1YJW O;  3CD6 L;  1VQ7 O;  3CCU L;  1K8A P;  2QEX L;  1KQS N;  3CCL L;  3CCU O;  1QVG K;  5DS6 A;  3CCV L;  2QEX O;  5DLJ A;  1KD1 M;  3CCL O;  1M1K P;  5DS5 A;  3CC4 O;  1VQL L;  3CMA O;  1VQL O;  1QVG N;  1VQ9 L;  1N8R M;  1VQ9 O;  3CCM O;  4N06 A;  3I55 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...