3CC7S

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cc7S00
5LJ5Y 2MKJA 4IUFA 1UFWA 2M9KA 3S7RA 1URNA 1R8HA 2CPHA 2AYBA 2MGZB 2M88A 2LA6A 2MKHA 2MHNA 3ZZYA 5IM0A 2KXNB 3DLLQ 3Q2SC 2U2FA 1XN9A 1N88A 1JMTA 4WKRA 1HL6A 2X1GA 2MY8A 2DHAA 1VC0A 2DGXA 4A8XA 2MB0B 3CULA 2MKIA 1Q7YT 5CXTA 2DNQA 2G1DA 2L9WA 1WEZA 3CTRA 5CA5A 1FO1A 2AD9A 2DGTA 3CCES 1YJWS 1VQPS 5DETA 4Y00A 4RU2A 1KOOA 2FC9A 5HL7Q 2XSFA 1WI6A 2F9JA 2YKAA 1VQ6S 2HZCA 1K9MT 2F9DA 4CIOA 3DXBA 3VAIA 2DH9A 1U6BA 2MQQA 2CPFA 2E44A 2M0GB 5DDPC 2CQ3A 2VODA 3MOJB 2M52A 2M2BA 4P6QA 3TO8A 3NS6A 1X4DA 1H2UX 1A7GE 3TP2A 2MKCA 4IOAQ 2M7SA 2CQ2A 4QQBA 2MZ1A 2DHGA 3MUTP 4TLQA 3SDEB 2KRBA 1VQOS 4UQTA 3PIOQ 2JRSA 2CQIA 2DHSA 2LXIA 3VAGA 1UP1A 2WBRA 2DNHA 3BO3A 2DNGA 3UCUP 2KHCA 4ZKAA 1DZ5A 2CJKA 4C4WA 3SXLA 2QFJA 2RVJA 2MYFA 2MZJA 3UCGA 4FXWA 2MJUA 5D78A 5DDRC 2NZ4A 4UY8T 3UCZP 3EX7B 4PRFA 5GMKa 4IO9Q 2ZJPQ 2DK2A 1OWXA 1VQNS 1KOHA 2MZQA 3D2WA 2RNEA 2D9OA 4QU6A 5EN1A 3I55S 3R1LA 5IM0B 4CH1A 1WF0A 2JVOA 3LPYA 2KG1A 2MXYA 3ZZZA 3MUVP 2DNLA 3MXHP 2RS8A 3BEGB 3R27A 2V94A 2CQHA 4V19X 2KXFA 2YTCA 3EGZA 1WI8A 2LQ5A 2X1BA 3CXCR 1FJCA 4WFNQ 3VAFA 1K73T 3THPA 2KXHA 2X1FA 2RQ4A 3G4SS 3VF0B 1VQ9S 4WF9Q 5D77A 1VBYA 1X5TA 1A9NB 2DH8A 2DO4A 2DGQA 2J0QD 2D3OR 3R1HA 2DGSA 4WFAQ 1QVGR 2DISA 2M4MA 2DNZA 3HI9A 1RK8A 4C7QA 4YUDA 4CH0S 5GADU 4TU9A 2KT5A 2CPXA 5LXRA 1SJQA 1SJ3P 5LJ3Y 1FT8A 5HO4A 2G4BA 3BO4A 5LSOA 1G2EA 2DNRA 1P1TA 3G71S 3VAHA 2DGWA 2DGUA 3CMAS 2QEXS 2MZTA 2MPUA 2MQLA 2KU7A 2DNOA 2E5IA 4TU8A 4M5DB 2N82B 3PIPQ 4W92B 2G0CA 2KRRA 2DO0A 4J5OA 2L08A 3CCQS 1S72S 1ZZNA 4IOCQ 1Q86T 5LXYA 1QM9A 2KI2A 3H2UB 1VBXA 2VONA 2CQDA 3P5TL 2DH7A 1WWHA 4WCEQ 2OSRA 3S8SA 2PE8A 3VALA 1YITS 3P6YC 1W2BR 3G96A 2DNNA 2CPIA 4Y0FA 2RRBA 2ERRA 2KH9A 5JVGQ 2MZSA 1U6FA 3G8SA 3CCVS 3CCJS 2LA4A 3S6EA 2RU3A 3MI7X 2O3DA 2J0SD 1BY9A 1VQKS 3P3DA 2JVRA 3IRWP 1SJFA 2YWKA 2HGNA 1VQ8S 1Q81T 2CQ1A 1JJ4A 2N3LA 1PO6A 1VBZA 4LIRA 3FEXB 3CCLS 2AYMA 2DIUA 2PEHA 2D9PA 2DHXA 5JVHQ 2FC8A 1YWXA 4YB1P 1H2TZ 2LECA 2BZ2A 2N7CA 2I2YA 1N54B 2KM8B 3UWTA 3UE2A 1M90T 3BO2A 2CQCA 1U1PA 2HYIB 2Q79A 3CD6S 1D9AA 2FPHX 1UAWA 2FHOB 2RUGA 3CF5Q 2OTJS 2MKKA 4QPTA 1UW4A 2AYGA 1ZZFA 2CQGA 3CC4S 3K0JA 1VQMS 3L3CA 5IQQA 1H6KX 2XS2A 1X5OA 1S79A 1OIAA 2MQNA 5MLCV 1M1KT 2LYVA 2CPDA 4U67Q 3ULHA 1WELA 3TYTA 2MQMA 4EGLA 1QVFR 2E5HA 1WF1A 2MJNA 4W90B 5DM7Q 1JJHA 3CC2S 1WTBA 1OPIA 2XNQA 4LMZA 2HGLA 2KYXA 1N8RT 3V4MA 4Z2XA 1U1KA 3MURP 2CQ0A 2DB1A 4ED5A 2KN4A 2K3KA 2MQOA 3HHNB 1B7FA 2EK6A 4WFBQ 3OW2R 1SJ4P 2EK1A 3P49B 3UD4P 2DNKA 3J7YU 2XNRA 2MZRA 4LJMA 1M5VC 2CPEA 3LQVA 3MD1A 2DNMA 1P27B 2DGVA 5GVQA 2CPYA 2ZJQQ 1YIJS 1VQLS 4C0OC 1FJEB 3CPWR 2JX2A 2M8DB 2UP1A 3CCRS 2J76E 3US5A 2KVIA 1RKJA 3J7ZT 2K8GA 2MSSA 1X4BA 2N3OA 2JWNA 2YH1A 1L3KA 2AYEA 4F25A 2XB2D 1VC5A 1U1QA 2CPJA 1DHMA 4FXVA 3CUNA 1K8AT 1HD1A 1WG4A 1X4EA 3MDFA 2LEAA 1H2VZ 3G6ES 3JB9k 1WF2A 2DNPA 1JJ2R 3H2VE 5DDOC 1NU4A 1FNXH 5GAGU 1WG5A 2ADCA 3CCSS 2OJ3A 2DNYA 2LKZA 1WEYA 3NNAA 4OZ0A 2MQPA 3CMES 2RQCA 4OZ1A 4ERDA 1NJIT 2KG0A 3NS5A 1PGZA 1U2FA 3FEYB 5IFMA 1VQ4S 3RW6A 1U1OA 4F26A 2RT3A 2MKSA 3SMZA 2I38A 2XS5A 1X5SA 3MUMP 1R8PA 5FJ4A 3IWNC 2DGOA 2MY7A 2DITA 2ADBA 5BJRA 5DM6Q 2LXUA 3NNCA 2DIVA 2MGZA 3VAMA 2OTLS 2EVZA 1F9FA 3I56S 3MD3A 4WIIA 1YTYA 3S01A 3CCUS 2GHPA 2M8HA 1D8ZA 1VC6A 2LEBA 2FY1A 4CQ1A 2KFYA 1M5KC 1YJNS 1X0FA 2SXLA 2L41A 1SJRA 1WHYA 2YH0A 3G8TA 3VAKA 2ZJRQ 3Q2TC 1NO8A 5GAEU 2OIHA 4QU7A 2E5JA 2CPZA 3B4MA 5LSLA 2LCWA 3THTA 1WEXA 3RW7A 3UD3P 1WHVA 2B0GA 3VAJA 1CVJA 1X4AA 2CQBA 3U1LA 2U1AA 1SXLA 1U1MA 2MSTA 2E5GA 2CQ4A 1U1LA 3N9UC 1M5PC 5DDQC 1KQSR 2BOPA 1WG1A 1YJ9S 4BS2A 4F02A 1Q82T 2LMIA 1WHXA 2VOPA 1X4CA 2A3JA 2VOOA 4YOEA 3NMRA 5H1SV 1O0PA 3B4DA 2HVZA 1ZH5A 3G9CA 1YI2S 1IQTA 3U1MA 2OSQA 3SDEA 3BS9A 1HD0A 1X4HA 3CC7S 5CYJA 1KC8T 2XS7A 2CQPA 3EGNA 4PR6A 3NNHA 1FXLA 2M70A 1DBDA 1OO0B 5GAHU 1KD1T 1DRZA 2J8AA 1YHQS 1X5PA 2X1AA 1X4GA 1AUDA 1X4FA 1VQ5S 1FHTA 2NLWA 1WHWA 2F3JA 1U1RA 2RS2A 1M5OC 2RRAA 2KM8C 1VQ7S 3CCMS 4PKDB 1N52B 1FJ7A 2QA4S 2MMYA 5ITHA 1HA1A 2GO9A 2HGMA 1U1NA 4TU7A
chains in the Genus database with same CATH superfamily
2P6TA 3W9IA 1FNOA 3OJUA 4EBCA 2GO8A 2FGOA 1WC5A 1YJ7A 4F0MA 2AKWB 4JOUA 1NJWA 2DGXA 2FJBB 3CULA 1OYEA 4OHVA 5DLFA 4HH1A 4RU2A 1RAGB 3HDSA 4B9NA 4MIWA 5HL7Q 1RACB 3CJ2A 3MM7A 5T7LA 1FRMA 2V9WA 3SFGA 2UU9J 5DG8A 3JSBA 3OFGA 1C0TA 2DHGA 1BC6A 5KT2A 4DL4A 2MQ8A 3HFVA 3H98A 3R7SB 2BR0A 3HHLB 5KFKA 5KOWA 4U7UD 1WKJA 3CJKB 2HKEA 2Z2MA 4CLKA 3ZTRA 2VF3A 2GHVC 4ELUA 4LVNP 4J9VA 4PRFA 5CYMA 4FF4A 2KTQA 1VQNS 2M3DA 4UUXA 4Q8FA 4JI8J 2MZQA 3PV8A 1VJWA 1RCXB 3CJ0A 4DPUA 4B3SJ 3ZNUA 1CQMA 3JQMA 1TK0A 4DG1A 4UOHA 1NCLA 2CQHA 4QYZK 2KXFA 4I67A 3FDSA 1D0EA 3AOCA 2KXHA 2NXJA 4BC7A 3N6NA 1VQ9S 1VHIA 3FFIA 4PG7A 3UDEA 1JXVA 2DKOB 5IT4A 5GADU 3I96A 9RUBA 3MM7B 4U8VA 1YLXA 5T7LB 3LGHA 3V6KA 2J8SA 4UW2A 1NHKL 2IYGA 2DGWA 4ZJOA 4MK9A 3GMGA 2HIYA 1C0TB 4PXCA 2N82B 3HHLD 2WB1D 4P7VA 4YFUA 2ZH2A 3VHQA 1YK9A 3JTNA 1HBNA 3BBCA 4ECVA 2JLGA 3QT5A 4OZJA 3RBEA 2EBGA 3VALA 3SCIE 4O3SA 4NRTA 1FDAA 3H90A 3X3UA 4DV7J 2C2OB 4WU2A 1VQKS 3HVRA 1RADB 1VQ8S 2HQDA 5CYMB 3RBZA 2FZKB 2ZD1A 1UKUA 4I2PA 4F4ZA 2CVEA 3OSPA 3V6JA 1H7WA 2RMLA 2LECA 3W1YC 4MKAA 4DG1B 3D7SB 2HYIB 3ISNC 3IR6B 3PX0A 3FFIB 5J2MA 2VKRA 2HBRB 2RDDA 2YKMA 3H59A 2MQNA 3BBBA 1WELA 4OHZA 1RP5A 4KQZA 1JJHA 1EB0A 3BM7A 4OHXA 2KB2A 1TK5A 3K57A 2KYXA 3AOAA 4M95A 2V69A 3LAMA 4PQAA 2DNKA 3LQVA 3M8PA 1MWQA 2L48A 4LF6J 4USWA 1TUGB 1FTRA 1LOUA 4NLOA 1NK7A 3BF4A 1YRXA 5KFTA 4LF1A 2ZD1B 4I2PB 4LT6A 1SUQA 2P6SA 3I9V9 4K7QA 3AJDA 4LRAA 3TA0A 2DNPA 1JJ2R 2DRAA 1HKAA 3OR2A 1S59A 3DHWC 1TTHB 3A4TA 2XLKA 4X84A 5IFMA 1JLCA 3LPEA 5J2MB 1R8PA 3VTIA 5F3TA 5BJRA 4G65A 4K59A 2EVZA 2IM0A 3CCUS 2XO6A 3GG0A 2R3VA 2R4FA 4AD6A 2L41A 1T9TA 3G8TA 2VQFF 3GP9A 2LCWA 2IJFA 1RWXB 3ENVA 4X4OA 1IWAA 1U47A 3M8PB 1K1QA 1UJ4A 2QA2A 1GX5A 3OVAA 2G9OA 2E5GA 4OI0A 2GMHA 3GYGA 2BANA 1OJ4A 3J7YI 5HBMA 1IKYA 4DSFA 1N34J 1K0VA 2W8LA 4ZLJA 1SUQB 2ZWOA 2AQ4A 2AW0A 2IVMA 4USHA 3T1YF 4PR6A 2AJ0A 4P73A 4TY9A 1R8AA 3OR2B 2EEYA 4DU7A 2RRAA 1HNIA 4JV2A 1PIEA 2GIRA 1JLCB 1HNVA 2ROPA 2G2ZA 3M6UA 1S0OA 1FJGJ 2GO9A 1VDHA 1H0HB 3PTWA 3D5MA 5GAGI 3IRXA 1X9WA 2R8GA 1FRIA 1XN9A 1NNDA 4KE5A 4DPWA 2DXDA 2F8MA 3MMBA 4DR6J 3RG6A 4YHHF 4QW9A 1NJXA 5B0GA 3QT8A 3HD1A 1VQPS 1QSSA 2GC8A 2I0XA 1ZAXA 1UFLA 5E7OB 2ZH1A 3QJLA 2BANB 1QTMA 4RX6A 3FQKA 3W60A 3IWLA 5HBMB 1IKYB 4JI3J 2AGOA 2IBKA 3ILIA 1VQOS 3FQLA 4UQTA 5HN0A 3RBDA 1D9DA 3ZZRA 2IIHA 1TR0A 3SXLA 2DHHA 2FHJA 2FJWA 2MYFA 3Q8UA 3GQCA 2B8QA 5J1EA 5G0RA 3TX8A 3H5YA 1HNIB 1S5ZA 5D78A 2VC0A 1HNVB 4CCHA 5GMEA 3IRXB 3OTCA 4NLTA 5B7WA 3I55S 1NKEA 5DRKA 3DRYA 4CT8A 1RYSA 4ZP7A 5KFEA 3MXHP 3ADAC 2V4JA 4MK8A 4NA3A 3MMBB 3Q8YA 1FJCA 1R43A 1CULA 4LSZB 4Y28C 1T9UA 1IXKA 1LXNA 4OQJA 3IN5A 3UFCX 1SJ3P 5HO4A 2PA3A 3BN7A 1KHVA 2G13A 3G71S 1BUXA 3EZ5A 2J9DE 1YJTA 3CCQS 5LXYA 4BLGA 1OY8A 2CQDA 4J9SA 1CC7A 2VFRA 4P2SA 3N6MA 2R7RA 2ZC4A 4H54A 5J1EB 4DX8H 5G0RB 4YR3A 2ZBRA 2VDIA 3IRWP 2YWKA 1JLBA 5AE3A 4O3OA 1DARA 4G1IA 5KT5A 3AOBA 5D4OA 1RAJA 2PEHA 1BHNA 2ZITA 4KHPF 1UVJA 3QZ8A 1Y4ZB 4XPCA 2G2OA 4F4KA 5FIIA 2IM3A 1RT5A 4PXDA 4X4VA 4UOCA 2V4JB 2XZDB 3CD6S 2YX7A 1UAWA 2FHOB 1CULB 3IFEA 2UXBJ 4U9RA 4K8RA 2HNZA 3DMJA 3W2WA 4JV1A 1QVFR 3HZEA 3S1TA 3QRRA 2VFUA 3K7RA 1DQ9A 4LMZA 3HSJA 4E0DA 2HGLA 4RUAA 2XC9A 4F4XA 4ED5A 2WTFA 1DY3A 1FDBA 2C2MB 3WQPA 4X64F 4KIAA 2I8EA 4F3OA 2PIIA 1BD6A 5GVQA 4AL6A 3AXKA 4F4AA 2K8GA 2IJRA 2HFNA 2QLFB 3ZC4A 2WW8A 1JLBB 1X8DA 4F04B 4ALZA 2FZGB 2W4DA 3LGNA 3DGPA 2R7XA 4NA2A 1RT5B 1RLDA 1ZTTA 1Y9OA 5HQMA 3C19A 2W25A 3CCSS 3NOGA 2EKYA 2QMUB 4ELVA 3AD9C 4ERDA 3T6JA 2KG0A 4DV0F 1RTHA 4I69A 3PRBA 3FEYB 1VQ4S 4PQUB 1GX6A 1CG2A 2HNZB 2CJYB 3DMJB 3F56A 1CC8A 3W2WB 2OH2A 3NGUA 1Y0HA 4ZPWR 2DITA 3BN4A 2BKPA 2HHTA 2B56A 2XULA 3W2VA 2Y0SD 3DGVA 4F4WA 1X0FA 3MFHA 1N48A 1WHYA 2DJWA 2W9CA 2WZ1A 4ELTA 2J9DA 4ZPTR 1S4FA 3Q8SB 4LF5J 4A46A 1FERA 4DCPB 4ZLNA 3HJVA 2K3IA 2Y8YA 4ZP6A 3AA9A 3IG1A 2ZHBA 3SDEA 3W8GA 3A3OB 1ZETA 1RWOB 1ZM4A 3DGPB 1CJKA 2NPFA 2J8AA 1AUDA 1VQ5S 1YBUA 1F1BB 1YSJA 4FF2A 1RTHB 2XYHB 4O0IA 3CCMS 1QUVA 4JV0A 2JLEA 1CJUA 4ICLA 4TU7A 2MKJA 1UFWA 3BKFA 4B9MA 3S7RA 2XWXA 1JMTA 2CZ4A 3OTEA 3W2VB 3HHKA 3EMTA 5AJ3F 2PT0A 3QATA 1WEZA 1XTZA 2W9CB 4Q44A 4DUZF 3KUHA 1VI7A 3CCES 5DZ7A 5DETA 3HJFA 3LAKA 1KOOA 4HEA9 4YP3A 2V8PA 3Q83A 3WDOA 1U6BA 4CZCA 1D8YA 4J9OA 2QLBB 1LWFA 3IG1B 2V8VA 1REGX 2VASA 3SDEB 7FDRA 1VRQC 3MR7A 4QWAA 2F5GA 1I5OB 1CJKB 4X4RA 1JLEA 3NLCA 1NMEB 4JI4J 4UY8T 2Z2YB 3FBBA 4F67A 5K14A 1CJUB 4ICLB 3WC2A 1IBKJ 5HQ8A 1ZM2A 4YR0A 2EG1A 5H9FJ 2C3YA 2HG4A 3MEDA 3NWRA 2H1YA 2XMWA 1RE1B 2BE9B 5KFWA 4ED0A 5BYRA 4NLSA 4OYZA 2XTJP 3EGZA 2W8KA 2ABYA 2KJWA 2DH8A 4Y65A 2J0QD 2DNZA 3Q22A 1RU2A 3M6WA 3AA8A 4B02A 4U6PA 4ZCLA 3TZWA 2BM0A 5KG7A 2R2RA 5B08A 4F3QA 3RB0A 3CMAS 2YPZA 2BACA 2LDYA 2WSEC 1LWFB 4NRUA 3OL9A 4A8QA 3C16A 3DDNA 2L08A 3RBXA 1XJWB 3CB4A 2NSCA 3LP2A 1LWCA 2BXJA 2J0WA 1YITS 3G96A 4K4VA 1HI0P 1JLEB 4A47A 3QAEA 4ZCMA 2PDAA 3BREA 3MMJA 5K14B 1PO6A 4JV5J 2FHMA 3RRGA 1HPZA 1XNRJ 3I6PA 4L3KA 1RTJA 3MEDB 4WZMA 2Y8WA 1U4BA 1HLWA 1Q0NA 4OX8A 4PEOA 1NHUA 2CQCA 1DLOA 4FF3A 3MM5A 4KH0B 1FWPA 2LEPA 2OTJS 4P71A 2ALZA 2C28A 3VGVA 2V68A 3ULHA 2E5HA 3PX4A 2R8HA 1WTBA 4USVA 3K5NA 3NAHA 3DN9A 2Z30B 4DR1F 2W9AA 4M63A 3G86A 2CQ0A 3JAMY 3M9MB 2RSQA 1GK8A 2CJQA 3C16B 5DQHA 4LIWA 4BWJA 2MZRA 2CDRB 3IAM9 3NGTA 3LP2B 1LWCB 2LQ8A 1SC6A 4L75A 2HAIA 3U1NA 3EVWA 4J9LA 2MSSA 4WP9A 4J37A 1MG7A 3PEHA 3EGVA 3PDNA 1Q4RA 2F4VJ 1HPZB 1QAIA 1RTJB 1X4EA 1Z2ZA 1N36F 3LOUA 1HR0J 4JI5F 2LDIA 1WG5A 3DHXA 5CH7B 9ATCB 2AP6A 1DLOB 2FIUA 3MM5B 3N5BA 2F8HA 2UVWA 4BC9A 1QAJA 3CIMA 3DI6A 3UR3C 5LL6d 4DOZA 5LMUF 2DIVA 1N0VC 5JMNA 3HVTA 2OMOA 3PW0A 1VC6A 4LSLA 4CQ1A 1YJNS 3PFEA 4FPIA 2QRRA 2HNYA 2E5JA 3CCWA 5LSLA 3THTA 3GONA 1S77D 2ZH7A 1HBUA 2MEWA 4NLUA 3CJSA 3R5DA 4Y6IA 1ITPA 1HNZF 4JI1J 1FRHA 1RTZA 2H4WB 1EP4A 1SQEA 3QRQA 4ED7A 8RUCA 1UWAA 3GFZA 1CQNA 1JX4A 5JXSA 4ANEA 3WBZA 2I1RA 4V1Ak 3KK3A 4X62F 2Y1LB 4Q43A 2XMUA 5D4PA 4NXNJ 4Z37A 1X5PA 2ZE2A 3UDCA 3CWJA 4PPZA 1UL3A 3LGMA 1SVDA 4EYHB 3OFFA 5D3GA 4IR1A 2KDOA 3OV7A 1VQ7S 5D15A 3CD0A 2QA4S 3DI6B 2RIJA 5ETSA 1C4CA 4ZP8A 2EFGA 4C3MA 3A8IA 2D41A 5IM0A 3HVTB 2MY8A 4LSLB 3SYZA 4L3NA 3BSAA 2MB0B 4MJKA 4WFXA 4K0KJ 2OP5A 2D7SA 2HNYB 3DCAA 4WP3A 3LWLA 5H9EK 1H98A 2JEFA 1NUEA 1HBUB 2BJ3A 2UXCJ 3H0PA 8ATCB 1EP4B 4GKKJ 3CEDA 4KFBA 5F41A 4ZVSB 1LK7A 4OX9F 2MQQA 1TUVA 3J7Z5 3Q0AA 3OXGA 2VBYA 3KK3B 2DNGA 2C2ZB 3H2LA 5DQIA 2ZE2B 4Y2AA 2FVPA 1KFSA 3NP5A 5D3GB 1JWWA 2CNLB 3BSCA 4OYXA 1X9SA 4WFZA 4OZ3A 4YMEA 4DV4J 2C2EA 5HROA 2RNEA 2J6SA 1UA1A 2VB6A 5IM0B 4PAAA 1WF0A 2CWXA 1SV5A 5KT3A 1IM4A 1Q7LB 4CI0B 4IH5A 3CO0P 1V9OA 4F4YA 3T5JA 4EZ6A 5D77A 2WK4A 2DO4A 2VFSA 2DGSA 4CH0S 3SBMA 1LQ9A 5KFZA 1SIWB 2D3ZA 4GC6A 4YB6A 4J90A 4KFBB 4DJBA 1G2EA 1IKWA 5KFSA 1KONA 4IQMA 3PW4A 2MPUA 3LWMA 2DNOA 7FD1A 2CYYA 1HQUA 2R42A 5EUHA 2J9EA 3QRPA 1JQGA 4DQIA 3G6YA 4A48A 3UPFA 3P6YC 2DNNA 1LV5A 5DG9A 2HMIA 4RBVA 2Z57B 4O3NA 2DPJA 4DZDA 4HHJA 3P3DA 1SJFA 1Z2LA 2YNFA 1SH3A 3TJAA 3FEXB 5HROB 2DIUA 3RRKA 4ZLLA 2DEJA 1SV5B 2VV5A 1FVQA 4DSEA 3LUYA 4NE9C 1RHMB 4J9UE 5AE2A 4U8YA 1QAXA 4NXMJ 3JS9A 3K89A 3TANA 4DL0C 3IR5B 1ZZFA 1IBLJ 2GVDA 3HSDA 1S9GA 3OTOF 3M8QA 3OJSA 2ALYB 3M2UA 2QFIA 1OPIA 1IKWB 2QMWA 1SC3B 1EKRA 2BYCA 2H5IB 2R7TA 2Z58B 4RBTA 3W5XA 1HQUB 3NGKA 2BJ8A 4KYZA 3MF5A 2EK1A 1WC6A 4A8FA 2UV8G 1EARA 2DGVA 3GZ7A 1EAYC 2EWHA 4LF4J 2JX2A 2HMIB 3Q86A 1OS5A 2XMKA 1KHWA 4C8OA 1QUPA 3HULA 2YNFB 1VLOA 1FF2A 2LEAA 1FNMA 1JLGA 1RWMB 2ZZTA 5DDOC 5K8PA 3ILLA 1NKCA 4U96A 4DQSA 2E7XA 2DNYA 2LKZA 1UVLA 2UU9F 1U2FA 2EFPA 3RW6A 1MROA 2GVDB 1NSPA 4KBIA 3IR7B 1S9GB 3M8QB 2YQ3A 1NBEB 3M2UB 3QIDA 4A8KA 3R9LA 3CJ8A 3AFGA 4E8UA 5DGAA 2KFYA 2I6WA 3VGSA 5C7PA 4U7CA 2HS3A 2ZHOA 2ZH4A 2GNKA 4JI8F 2FTRA 1OSDA 1YG0A 3I32A 3N9UC 2QLJB 2N7YA 1VJQA 4LSNA 1WDTA 1WACA 4GRSA 1BLUA 4DI6A 5THWA 5C2CA 3MHYA 5CYJA 5L46A 1FI4A 1JLGB 2YX1A 5I42A 1OO0B 3KXDA 2WVFA 2FJVA 1UVNA 2FJXA 2QLXA 1MROB 4M5HA 4GVBA 2ZNZA 2PMZD 1HA1A 2AWZA 5LJ5Y 4BWMA 2E1CA 5M2RA 3PJWA 3D3BJ 4IQXA 5HATA 2APOA 5A8KA 2E9TA 1I51B 4DV7F 3H42A 4LQ3A 4J9NA 1BWVA 2J6TA 1R6YA 4KHMA 2ZBPA 3W3SA 5ETRA 2HZCA 4KKOA 1O8BA 5LM7E 4LSNB 2DH9A 2CQ3A 5G4DA 1H3DA 2V8DA 3SCLE 2HHHF 2JEIA 2MZ1A 1UVMA 2V34A 1RWKB 1NB7A 2WVEA 3AAWB 3R7BB 2R8KA 2DHSA 1XMOJ 5I42B 2JHEA 1LFPA 1SJ1A 2GFFA 3RB4A 4QIVA 4ED1A 4KT0C 3GTYX 3RB6A 3M2VA 2B4VA 4DPOA 3Q8PB 3Q23A 2B4UA 4DS4A 1EQMA 2B7BB 1K0TA 2CJXB 4GVBB 2FY8A 3L4BC 2H3EB 3B6BA 2C2NA 2ZFHA 1VHFA 4K4ZA 1UCNA 4CH1A 2JH3A 3FCVA 2MXYA 2EC0A 3NG8A 3BGLA 3EZOA 3NS7B 4LF6F 5C2GA 5K8OA 5A8KB 4OZ5A 4V19X 2FVCA 1J5OA 2X1FA 4DSLA 1FFGB 4B3MF 3KHGA 4FS1A 2CNOB 1VISA 1V5IB 1T7PA 4KKOB 3J80U 4PG8A 2BABA 2DNRA 2ZEJA 4CO0A 1U2CA 2QEXS 2E5IA 1XIQA 1B0VA 2DO0A 4J5OA 1P1LA 4ZVUB 4Z7YA 3DLHA 2DH7A 1W7WA 4WCEQ 1JNRB 5KFUA 3PKMA 1T9XA 3M2VB 1NK9A 3QQCD 3BPSP 2AJ2A 1VK8A 3G8SA 3CCJS 3S6EA 4RR5A 1SC1B 3PHEA 3MCMA 3D0HE 5F8GA 3TZYA 4IFVA 4DL5A 4KSEB 4DFPA 2KM8B 2NXUA 2YNHA 2YWHA 2XQCA 1P9QC 1TL7A 3BO2A 1J5OB 2CWKA 2PGCA 4KHPJ 4OJGA 4I6AA 3GJQB 5MLCV 3TYTA 5A6PA 5ETKA 2XSJA 1A6LA 4HT7A 1B70B 1LW0A 2ZBIA 3CC2S 1C0UA 5J2PA 4ITSA 1KSPA 3MOZA 5HMZA 2VG7A 2K3KA 4XK8C 4GMKA 3UD4P 2R2UA 2CPEA 3MD1A 2OPQA 2H51B 5EHHA 4K4UA 3CCRS 4PXEA 4DR6F 2OAUA 2R2TA 5D0HA 2Q6CA 3EM1A 2ZUGA 2EC2A 1KS2A 4D3GA 4PCQA 4IFVB 1RBAA 5L9XA 2OPRA 5CZXA 1HIYA 5ETTA 2YNHB 3U02A 3D0GE 2KL8A 1TL7B 3VZHA 1NZAA 1B64A 4XO0A 4JI3F 4X4UA 5C42A 3NBPA 2XSJB 4L72B 1LW0B 4WU3A 4K4YA 1PBUA 4WIIA 5ETPA 2YKQA 3OBIA 1C0UB 5J2PB 4DV0J 2A6OA 2DY1A 2KVQE 2XY7A 1MWYA 4WXWA 2VG7B 5GAEU 3BB5A 3GYNA 4ECWA 3KFWX 1R0AA 2W2NP 3VAJA 2OPQB 4DFMA 1FA0A 2ATCB 5A8RA 5D0EA 3EDRB 1TK8A 1U1MA 3MPYA 4HDGA 2CQ4A 1NXIA 4PPDA 4WTOB 3D6HB 2LMIA 5KFNA 4CYUA 4RU9A 2L3MA 3PX6A 3B4DA 4H4KA 3DRPA 3GSDA 1A0OB 2FHKA 4NWBA 4USMA 1KC8T 2OPRB 2AGQA 1HW9A 1N0UA 1RJJA 1FHTA 3IM9A 3RRHA 3PEJA 1S7IA 4J91A 1NRKA 4AQYJ 2F4FA 1PYTA 3MCOA 3EICA 3NXZA 2B3TB 2YWFA 1FDNA 4O3PA 5C42B 4CO5A 3NBPB 3EPIA 1R8HA 4HKQA 1RCOB 2MKHA 3RTVA 3W64A 2YQ0A 5T41A 3KUGA 3CTRA 3M1VA 5CA5A 3QYYA 2XMMA 2V50A 4USTA 2E1PA 3KLEA 2OD4A 1DFDA 1R0AB 2R2SA 2NR0A 1HWIA 5L1KA 1RT2A 5A8RB 2N4CA 3DXBA 3ZNJ1 1OQ6A 5A76A 4CYUB 2CA9A 1N32J 1LEOA 3AH6A 1RTDA 3QT6A 4DQRA 2JZ5A 4DR3J 2UXBF 3FSYA 3DRPB 1UW9A 3CT9A 3UCUP 4WZQA 1T95A 3J7AN 1EZZB 3QZ7A 4MT1A 2OEKA 5KFFA 3CJRA 4TLRA 2VZ9A 2AHOB 1YJVA 2OELA 2VDHA 1M0SA 1OWXA 2XM3A 2CIMA 1NB2A 3MMCA 5GAHI 2LU2A 1ZYQA 2K7KA 1HWUA 2DYAA 2V94A 2B5JA 3BSOA 1AT1B 4C8KA 5KFCA 3M1VB 4KGXB 3THPA 1Z1ZA 3KLEB 3VF0B 1A9NB 1PAEX 1HQ2A 1SKWA 3HCXA 2CJ9A 5B0FA 4URGA 1RT2B 4YDXA 3T1HJ 5LJ3Y 3ET6A 5LSOA 1UPPA 2XLIA 1TVRA 3L9ZA 3UW1A 4XPEA 4OJHA 1RTDB 4LF7J 4TQRA 1CEZA 1NH7A 1OY6A 4IOCQ 1N5VA 1Q86T 2DCLA 4TYAA 2VONA 4LFBJ 2RRBA 2YNIA 2VUGA 1FX4A 2YBVA 3FMBA 2RU3A 5KAKA 2V5HG 4CLWA 3GIRA 4NLVA 1NDCA 1VBZA 2MHEA 3MMCB 4LF5F 3BQ2A 3J7A1 4TKTA 3GYXB 3VVTA 2N7CA 1N54B 2ASDA 2YX4A 1M90T 2IRYA 2B5JB 4CLUA 2QO3A 3K0JA 4DN9A 5KFQA 3L3CA 1NJZA 1S1UA 5KOXA 4U67Q 3R97A 3GFXA 3WX4A 3EVOA 3ET6B 1JLFA 2C42A 4FKYA 1TVRB 3L7PA 4ED8A 4LVOP 1N8RT 3M8SA 2V4RA 4F0KA 4DV2J 3BDEA 3PR5B 4P10A 2V4QA 4NA1A 1F3VA 4B3OA 2DR8A 4LFAF 4NEYA 1T05A 2QV6A 3BR9A 1TFYA 2YNIB 2FQQB 4QIWD 3GR1A 2A18A 2HBQB 1EQ0A 1G7CB 2QX0A 5GMDA 2IM2A 2AYEA 2CPJA 3TA2A 5BYQA 3CUNA 1K8AT 4DV1J 3DRRB 1WF2A 1NU4A 3NCRA 3CE8A 3CMQA 1WEYA 4E98A 3L95X 2XZWA 4FP9A 1PGZA 3BYPA 2ZM6F 1U1OA 4F26A 5I3QA 1N36J 5I4MA 1S1UB 3ZTPA 4IYQA 3R3TA 4JI5J 5DM6Q 3CDWA 1HFEL 3NCQA 1JLFB 3HK2A 2GHPA 3SI8A 2QYGA 1M5KC 2RAQA 1YBAA 2ZJRQ 2BJEA 3R7NB 2OIHA 2HURA 3F41A 1WEXA 5HJYA 3QIPA 1IBKF 1V3ZA 1U0HA 4B3OB 1QAYA 1N5YA 1NK8A 4MMOA 1T05B 1SXLA 4ZPCA 2BUNA 3IGNA 1HW8A 1KTVA 4M1KA 4Y34A 4BS2A 2HHPA 1Q82T 3WZ0A 1Q8LA 1X4CA 3MPDA 3MM6A 5FLXY 4QWDA 1TKXA 2B9WA 3QPIA 4M5JA 1KR4A 2JEGA 1IQTA 2VU5A 1AFIA 3D9BA 2YKOA 4OYPA 1D09B 3F73A 2B9YA 2OO4A 1R7IA 2W2PP 2PMHA 4FPRA 4O3QA 2F3JA 1ZAWA 3HHEA 3HF5A 4FBUA 5HLFA 2HK3A 1E6VA 5J2NA 1MWZA 5H9EJ 2MMYA 1UJ6A 4X62J 1U24A 3GR0A 5JJBA 1RISA 4WPAA 3OL7A 4EK2A 4WJBA 2R7WA 4WKRA 1ACMB 3AD7C 1UEKA 4ETXA 3KOAA 1HNXJ 1RHRB 2HHVA 2BJ7A 4DPXA 3QIPB 4JV5F 3RAMA 2LQ9A 1CBKA 1U0HB 2JC1A 4KGVB 4Y00A 1N5YB 2C3UA 1XNRF 2NREA 4DFKA 3LP0A 3HKWA 4HL9A 4NZ6A 4JYAJ 3HZGA 3MM6B 3KNAA 1TKXB 2M7SA 4QQBA 4X66J 3MUTP 3TZXA 1D3WA 2CQIA 5E2QA 3QO9A 2W7OA 1DQAA 1KP6A 2BKOA 2MKYA 1GNKA 1Z4UA 5HLFB 2C2KB 3BKUA 1E6VB 5J2NB 3NRBA 4IO9Q 2LQJA 4B3TF 1QSLA 1R6VA 3PXGa 2BJ1A 5EN1A 3MM8A 1YKWA 4Q7AA 2DNLA 1AYEA 2VHGA 2CNNB 2UVUA 3HMJG 3OUYA 3N4WA 1X5TA 1JXLA 1MMNA 2YWEA 3LW5C 2F4VF 2QA4G 2GVZA 4NZ7A 3SCJE 2PFFB 3LP0B 3BO4A 2F65A 3W9JA 2XI3A 5HI7A 5T14A 2W1BA 4JB8B 3UDLA 1ZPWX 4ZVHA 4IG3A 2Z2ZA 3KHRA 3IGVA 3QO9B 3BH6B 2QN6B 5B0EA 4QYRA 2B6AA 2PA8D 3C15A 5JVGQ 2HFVA 4RZRA 3A3NB 1Q5VA 3KLIA 1UZHA 3GIMA 3A1YG 1LKZA 4F3MA 4PYAA 2FJEB 3FBFA 1WD6A 2ZNYA 3MM8B 1YWXA 3M7VA 3C3LA 3B82A 4GVLA 4JI1F 1I94J 3FSXA 3UE2A 3DOLA 1RABB 4P2FA 3H25A 3VGTA 4Y2IA 4FNHA 2NXCA 3OUYB 1R0CB 1NSQA 1TL1A 4P75A 1S9EA 1IM6A 2RH3A 3VR1A 2GVZB 2XO7A 4W90B 4NYPA 3MPUB 3HSGA 1PILA 3V4MA 3B8HA 2EKNA 3MURP 2QZ8A 1KVKA 1FTCA 2OEMA 3HHNB 4IG3B 3OTOJ 1V5VA 1TP7A 3J7YU 5ETVA 3P45B 4I64A 2B6AB 4KV8A 1AB8A 2QL5B 4QWBA 3R8YA 3C15B 3T9NA 4CO4A 2FVRA 3IWXA 4CWBA 4O4GA 1IR1A 3KLIB 1KTQA 5RUBA 4K0KF 2Q1LA 3MTKA 2VPXB 4ZVGA 3MAAA 1S99A 1PSDA 2G1HA 2UXCF 2BRLA 5GAGU 1AROP 4GKKF 2GS8A 3DOLB 3IC1A 2A10A 1SL0A 3W5ZA 2LFVA 5A2QU 4DDFA 1CPZA 1FESA 1TL1B 1U25A 5IXUA 1S9EB 2PMWA 1IJFB 3PW5A 1NDKA 3BGUA 4P74A 1NDPA 3QGIA 1R8CA 1D8ZA 2DR5A 2J9CA 3MMAA 1XMQF 4X4TA 3N5FA 2XMVA 2KKHA 5M2UA 2PN6A 3B4MA 3QLHA 4F36A 4U7UK 4J9MA 4DV4F 3M8ZA 1M1HA 1GAOA 1KQKA 4KV8B 3W63A 3DLBA 3JYTA 3KJFB 3O44A 2BOPA 2HZVA 4YB7A 4O4GB 3UD5A 2A3JA 1L3TA 3UN2A 2XCPA 3CNQP 3MAAB 2PO4A 3JQKA 3RR8A 2CQPA 1DRZA 1CS4A 1UEVA 1APSA 2H4YB 2DBBA 4F7VA 4UOFA 1WC0A 3FK4A 2FVSA 4LBPA 4DWIA 1IKXA 4O3RA 3PZPA 3N01A 2XEXA 3SV3A 3JSMA 1BQMA 3MMAB 5K8NA 3N6LA 3MFIA 3CSKA 1EHWA 4WWSA 2UUTA 3D6MB 2HZAA 3QLHB 4JI0J 2FD2A 2VG6A 4OLPA 2QSWA 3GCXP 3PM9A 1M5SA 4UZCA 4CO2A 3JYTB 4JI6J 4Q2LA 4DUYJ 4RL1A 5DDPC 3EJMA 2B4PA 4FNIA 3OL6A 2MKCA 4NXMF 4ZJLA 3GWCA 2NS1B 1HHTP 3PYEA 3PACA 1IBLF 1VLYA 4JI7J 2JDJA 4GO5X 3OSNA 5B0AA 2H65B 4OLOA 1FD2A 1CS4B 3JSYA 4K4WA 2HQGA 3N28A 2HHHJ 3G87A 4DX5A 3T1AA 2V8GA 1NH8A 5DGBA 1RHKB 3ISND 2H54B 1IKXB 2CRLA 1ZM9A 2DK2A 3FMWA 2DD8S 1NPPA 4WK1A 4FS2A 3UO0A 1D9FA 1WJ9A 3JSMB 4QCLA 4LF4F 1BQMB 4DV6J 1DJ0A 4QR1A 4GKJJ 4A8WA 3P96A 1WI8A 4ZITA 5BR8J 3AQOA 3G4SS 2D1CA 4LR9A 2VG6B 2DGQA 1UWBB 4TU9A 5LMNF 1V3RA 4KAIA 3G82A 2E1AA 1F3FA 2MZTA 2CKWA 2JLFA 4B3MJ 4MIAA 4ECUA 4FF1A 4IKAA 3PIPQ 5FDLA 2PC6A 1S7HA 3P8BB 4X65F 3MPVA 2V2VA 1FRKA 3V2UC 3KDNA 1SCJB 2XCAA 5KFIA 4C0BA 3ELHA 3RAQA 4F2RA 2GAGC 1Q79A 3I5CA 1P9YA 1LNQA 4YDDB 2FYXA 2D9PA 2CAJA 4X2BA 3KUEA 2G0IA 2I2YA 4EFAC 3HVWA 3TEHB 2B9EA 2Q79A 3Q8RB 4NYOA 2AYGA 3ITHA 1RZMA 4LF2A 4KGZB 2CQGA 2ZH3A 3HM9A 2W2MP 3G82B 1FKAF 1LWXA 2AX0A 4CDIA 4EO8A 3UN3A 5BXIA 4MTPA 4XDCA 2UUCJ 5F0WA 5FDLB 2MQOA 1M1GA 1AXQA 3PRVA 3A8JA 3MECA 2O67A 1R27B 1Y5LB 2UP1A 4ZPDA 1RKJA 3ETMA 1VR6A 4DPTA 1T02A 2YH1A 4FVMA 1UJ5A 3BGRA 4OYIA 1L5UA 4P52A 1FNXH 1SIZA 2HVDA 2ADCA 1TZ0A 2RQCA 1I1GA 3GPAA 3Q8VA 3ITHB 4NMXA 3BDPA 4KRWA 3D54A 1NK4A 1X5SA 4P7TA 1RHJB 1XMOF 5HJXA 3KHLA 2EBEA 3AD8C 3AY0A 1H38A 3KG0A 2AJ1A 1F9HA 2LEBA 2AJQA 2FY1A 2RJZA 4RW8A 2F7VA 4DN0A 3SSSA 1KRPA 2YH0A 5CD4A 2JSXA 4K2JA 4HVZA 1N5QA 2CPZA 2FDNA 4OI2A 5F9NA 3RW7A 1KEKA 5ETMA 5KFLA 1Y00A 3OLAA 3NAIA 3MECB 5D0RA 4KR0B 2EXUA 1NLKL 3T41A 2E5LJ 4YOEA 3NMRA 3BGRB 2V6AA 4OZLA 4I6WA 4CM0A 3R6GB 3JSRA 2HFUA 4B9VA 1RT1A 3IP0A 3PKYA 4OJ1A 3PW7A 1MNEA 1S97A 2QC3A 4OYBA 5SUHA 1M5OC 2C3MA 3A13A 1N52B 1T3NA 1VCTA 1YBTA 2ILZA 2AV5A 4IUFA 1T94A 4AXIA 2AYBA 4ATNA 2MHNA 2M5YA 2KXNB 3PRDA 1KVJA 4DR4J 3L09A 1AFJA 4OYAA 4IDKA 3L7UA 3M9OB 4RW8B 3A3PB 1FXDA 5A8WA 2FZCB 2G1DA 5LT5A 1FO1A 1XR7A 3MWBA 1KDNA 1Y10A 3KLHA 1IJEB 1UPMB 4M5GA 2F9JA 2XI2A 1RAEB 4CO1A 1N5SA 4HTIA 2YVSA 4A8YA 4USJC 2VODA 4ECQA 3TO8A 4M5NA 3TP2A 4IOAQ 4LR7A 4NLPA 2HK2A 3OHAA 2VFVA 1HQEA 1TMJA 3EPGA 1RT1B 2WBRA 2IVYA 1SKUB 1GXTA 4UOGA 4TYBA 1ELOA 5J1PA 2V63A 4PQUA 1VIOA 5KG1A 2O5DA 2RRNA 3BV8A 1VBKA 2WSCC 2B43A 3R1LA 5AXMA 3LPYA 1UZDA 1O51A 2HPUA 4IDKB 2E66A 2EW9A 1S6PA 3R5BA 5A8WB 2YTCA 3VAFA 2D69A 3KLHB 2AJFE 5DG7A 4O0NA 3HI9A 4C7QA 4YUDA 2XMAA 4RPFA 3T6BA 1RWUA 3PJXA 1Q8KA 4G3IA 4P9SA 4A8OA 3NOCA 3C66A 4XTTA 2YNGA 4F2SA 2G0CA 1SB6A 3OPKA 3WIUA 1HQEB 3M32A 4ES3A 1V3SA 2IBOA 5AT1B 3LA0A 3M8RA 2EFOA 2FJAB 1OPZA 2NSBA 2H9ZA 2KZZA 2BRKA 1K47A 4TQSA 5GAEI 1BY9A 2BQRA 2ZOFA 3QSIA 1EETA 1Q81T 2CQ1A 3I0SA 2UV8A 5IZHA 2FLOA 4HDHA 1SH2A 3KMQA 1XR6A 5E5NA 4HR2A 4YY3J 2GJFA 2W7AA 1RT4A 3UWTA 1U1PA 1S6PB 4O44A 2KT3A 3FBEA 1S76D 5E3CA 4KB7A 4PUOA 1X5OA 1M1KT 4DMZA 6FDRA 1Y5IB 3PO5A 2BQUA 2ZKTA 3D28A 4CTAA 1JLAA 4M94A 2R7OA 5E3QA 3NGRA 1XK8A 1NPRA 1W26A 4Z2XA 4AQYF 2YNGB 4K2XA 2DR7A 1RI7A 2VBZA 3RB3A 3M32B 3OW2R 2NXNA 5H9FK 3IMQJ 2DNMA 4DCJB 3O6QA 3EGWB 3GIIA 5HMWA 1SBRA 3TWZA 3A8KA 4HTJA 2V9KA 4Y2CA 2XHWA 5IS2A 1EETB 3I0SB 1VC5A 1U1QA 5HSPA 2NPIA 4QWCA 1WSVA 4LFAJ 2IDEA 3MEKA 4ENOA 3G6ES 2CUYA 4FYVB 1B7YB 1N5TA 5HMYA 4ES1A 4J9PA 1RT4B 3K17A 1R3NA 5IC6B 4O44B 1VRTA 1S12A 4DS5A 1N32F 3TAMA 3DRSA 4PUOB 2MKSA 7AT1B 4DR3F 5I3UA 1T9VA 5FJ4A 1Q5YA 2XLJA 2KZMA 2W7PA 2OTLS 4TVAB 1RT6A 4CTAB 1JLAB 2IYIA 3S01A 1C2PA 4QIFA 3TQ1A 4Q0BA 2ZM6J 2HHSA 1IBCB 3MTJA 1DAXA 3RUBL 5KFHA 4Q5VA 3VZIA 4DR5J 2GMLA 4ZPBA 5KTQA 1S0NA 3VVUA 2B0GA 3H40A 1OY9A 3ZTSA 1PJ6A 4PABA 1YX2A 4KC5A 6AT1B 4ZP9A 1FK9A 2XBPA 1Q78A 4N5SA 3QAUA 1VQSA 4ECXA 2VOOA 1AA1B 4RW9A 2HW3A 3C8YA 1X4HA 4RNMA 2BEFA 3ENAA 3BZQA 3PR4A 3T1HF 4N77A 1FWKA 3A12A 3LH2S 3CDUA 2CFXA 1J5EF 5KFDA 3K59A 1VRTB 2VPZB 3TAMB 3DRSB 1AZSA 4NLYA 3M6XA 4LF7F 5I3UB 1B4SA 1EIYB 1F5CA 2IMWP 4Y2MA 4ZK7M 1GH8A 1RT6B 2U2FA 2AX1A 3KK1A 4LFBF 4MIBA 1VGYA 2QTWA 4Q0BB 2Y1IA 3RR7A 2VQEJ 3D1HA 2I9SA 4LFCJ 3X1LB 2KYZA 4E2FB 1T8EA 4Q8EA 3I5AA 1FK9B 1SPBP 4NOHA 2IRUA 2RHQB 2CPFA 3FCWA 3C6UA 2M52A 1L3UA 3KKFA 4M5DA 4RW9B 1RXOB 3OFHA 2V2QA 2HEKA 1R8BA 2HFZA 4OI6A 2LXIA 2E9ZA 4ZKAA 1DZ5A 4M5LA 5IT9U 1U8WA 5MAOA 4NLWA 1XR5A 3UCGA 5KG6A 4FXWA 4K50A 3T3FA 4OIXA 1AZSB 1WOSA 5F8NA 2P2CB 5GMKa 4DV2F 4ECYA 4ED2A 3O3LA 2OMLA 4B9LA 1FWLA 3KK1B 1I3OB 4X4SA 1ZM3A 4V19J 4NCGA 2LQ5A 4WYWA 2WB4A 4B3TJ 2RQ4A 3IM8A 4DSJA 4WF9Q 1VBYA 2DISA 2M4MA 5L1JA 1WDDA 3E01A 4DV1F 2AT1B 3QFHA 3TAPA 2BA9A 4TNOA 1RBLA 4J7CA 3C6UB 3JTOA 3VAHA 2DGUA 2VH7A 2KU7A 3K8WA 4M5DB 4OZNA 5HP1A 3MAHA 1TELA 3SSQA 1Q1KA 4C0HA 1QM9A 4L73A 2GX8A 3QT7A 4N8OA 1SQGA 1RUSA 4EEYA 1CJVA 2KH9A 3MCSA 1PJ7A 2J0XA 2GAHC 4FZVA 3TRGA 4CT9A 3MI7X 2VJVA 2AMCB 5CAAA 4DLEA 2HGNA 4QJVA 1LFWA 2BW2A 1JJ4A 2N3LA 5CZVA 4LIRA 4BBYA 3CCLS 2AYMA 3EZUA 3ZTQA 2QG9B 2VFTA 4K4SA 2ATLA 4S0MA 4YB1P 2JFKA 4BHQA 2W24A 4ZDNA 3TARA 1WOOA 4NCGB 3PCOB 2RUGA 3CF5Q 2MKKA 4QPTA 3MAQA 4NCAA 5LOQA 4CO3A 1H6KX 2RDJA 1J2VA 3E01B 4WYLA 4EGLA 4B9TA 4BDPA 3GJRB 2BQ3A 2X51A 3NMAA 4LF9J 2B51A 2KN4A 1ULRA 5HP1B 1U26A 2RHSB 5FD1A 3ENWA 4C8LA 1YJUA 2UVVA 4FDFA 1CJVB 1ZAVA 2FLNA 2J76E 4I4BA 3HHLC 3J7ZT 2AZ1A 3KNGA 3H8YA 1HNXF 1UA0A 3TZZA 5L9NA 4F25A 3M4XA 3HHDA 3GJSB 1WKLA 3DLGA 4HLBA 2XHCA 2RQKA 5ETOA 4OZ0A 1Y11A 2GCFA 4C8MA 4JYAF 2HHQA 2MDAA 2RT3A 2ZDPA 4K5RA 4X66F 1FRJA 1RA7A 3DLKA 5AE1A 2LXUA 2MGZA 4RLEA 2LU1A 2B9XA 4FKXA 3HLUA 4ZIWA 4H4MA 4Y3CA 3FNNA 4NZ0A 2SXLA 3QNWB 1CJTA 1SJRA 1RHUB 4H4OA 2NXEA 1ZPVA 4ANCA 2KFNA 3NCPA 1WSRA 2EFQA 3G8QA 1XMQJ 2ROGA 1Y3KA 1M5PC 4HI2A 4QYZJ 4KH1B 4P72A 4ZPAA 4HYKA 3KLFA 2DT9A 1RSCA 3CO9A 4IG0A 1HWKA 1HBNB 3GG1A 1N56A 3UVJA 3DLGB 1SKSA 2HHXA 1KD1T 5A6WA 2R7SA 2NLWA 2UZAA 1U1RA 4KPCA 4OV6A 1VFJA 3LO3A 2G0JA 3BQ1A 1SL2A 5A2QY 4PKDB 5E41A 2P8IA 5JUMA 4RW7A 4MAKA 3K5MA 3D6TB 2XYPB 3DLKB 4DXLA 2NYHA 2M9KA 2IC3A 3W8PA 2MGZB 2LA6A 2DEIA 3DLLQ 3DYAA 3Q2SC 4J9QA 2XMJA 3OT9A 4Z7CA 4H4MB 4CLTA 1VC0A 2XGQA 3RGIA 1MN9A 1CJTB 1Q7YT 2DNQA 3C6TA 4ZVPB 4H4OB 5AXNA 2GZOA 2J5AA 3V81A 1BMQB 2YKMB 2FC9A 1WI6A 4DSKA 2IMOA 5CYQA 3SZ2A 3MZIA 1I94F 1O5JA 2M0GB 4P6QA 1X4DA 2I5JA 3ZXWA 1PYOB 3O2IA 3FC9A 4ZVRB 3KLFB 4HH0A 5EWEA 2IY5B 3CJ4A 4IG0B 1RWVB 4DQQA 4B08A 2DNHA 3UVJB 4A4JA 3GFYA 4ED6A 4C4WA 3UNYA 1RB0A 4LBHA 3KLVA 2MZJA 3TA1A 4OI3A 4ES2A 2JC0A 4NLGA 5KT6A 3A8EA 4L74A 3MEEA 3KWMA 3EX7B 4RW7B 3C2PA 2BJDA 2IC3B 2D9OA 2VBWA 2HNDA 4OI4A 3DYAB 3T5HA 5BYSA 2ASYA 1EJ7L 3ZZTA 2ZZMA 3C6TB 2H5EA 1S0MA 3M2RA 3FZBA 3W7BA 4URSA 3GJTB 3V81B 1MSWD 2UUBJ 4DL6A 1QVGR 3WC0A 1SH0A 3IAS9 5CYQB 2IA6A 4JI2F 1FT8A 1TV6A 2MLZA 2I5JB 1FE4A 2PSZA 3D0IE 4KY3A 2G2YA 2E1MC 5LMNJ 3VGUA 1WORA 3H2UB 1FFSB 2Z2LA 3S8SA 1NZ8A 3TQEA 4NEZA 2O3DA 2J0SD 3MEEB 4G1PA 1FDDA 4X65J 3DRXA 3DLEA 5EGYA 3TUPA 2HNDB 1JJCB 2EFNA 4I7FA 3ZO7A 2A6MA 2GGPA 3I31A 1EKSA 4YEAA 5CCLA 3E51A 3M2RB 2GMJA 2QLWA 1S6OA 2LYVA 1BQNA 1SI9A 1TV6B 1MN7A 1U1KA 3UDVA 4F8RA 2DB1A 2K2PA 1GFWB 3EVMA 5GADI 1UVIA 1IBMJ 4DL7A 4LJMA 1M5VC 1P27B 3CPWR 3CJTA 4DHVA 5E0OA 3TX0A 3GFHA 5HAOA 1HWJA 4AFFA 1YVFA 2BDPA 4NI2A 4JI0F 4OI1A 3UR0A 4PYDA 3DLEB 4EBEA 4I7FB 4DU8A 3H2VE 1NAQA 4M8LA 3PVXA 3RZAA 3BH7B 2F40A 5CD4H 3W9HA 3RU0A 2GGPB 4JI6F 4DPYA 2R8IA 2OJ3A 3JXOA 4ILLA 3NNAA 3DOMA 4DUYF 3NGSA 3GV5B 3SMZA 2I38A 1GXLA 1VQYA 2Y9HA 2BKNA 2DGOA 1BQNB 4JI7F 4DQPA 4EUVA 1UETA 2GQ2A 2Z8QA 3CJQA 3ZFVA 4OYWA 4U95A 4YR2A 4MKYA 4MYTA 5B0DA 1RQ0A 2EI5A 3U1LA 3AQPA 2FUG9 3V4IA 3ENQA 2Y1RI 1SC4B 4O4RA 2WHOA 2HS4A 4DV6F 4GKJF 2OLWA 4C8NA 1S10A 1YRTA 1KBRA 5BR8F 4NI2B 4UTGA 1OQ3A 1YI2S 3U1MA 2OSQA 3ZZ0A 2FHJD 2AIRB 1HD0A 4CLSA 2O01C 1FCAA 3V5RA 2C1EB 1WTFA 1JK9B 2GA7A 4JP8A 3OFEA 2V67A 3DLJA 2VC1A 5GAHU 2X1AA 3FBCA 2DRBA 1ZBTA 4QR2A 3DOMB 1F5BA 1RAAB 2RS2A 1S57A 4ZCKA 5KFBA 5KT7A 1U1NA 4PXBA 2RKIA 4K4XA 1S4EA 3P5BP 4DR7F 1RTIA 4F0HA 1YGYA 5KFAA 2X1GA 2HWHA 3CGIA 1JLQA 5L1IA 1G3OA 4WK3A 1GMWA 3BQ0A 4G6VB 4PWDA 2C2DA 1N33J 4D3HA 3QSYB 2RQMA 4IO1A 2FB0A 2ACYA 2NUHA 3ZZOA 2F9DA 3V4IB 4WTYA 3GIKA 2OKQA 2B4OA 2X3GA 4DV5J 2M2BA 3NS6A 1H2UX 3VQSA 1A7GE 2IJNA 4P2XA 2CQ2A 3N0VA 1XNQJ 5DS7A 2KRBA 1IQZA 4EBDA 2JRSA 1H73A 1S6QA 3VAGA 4CLLA 1UP1A 2AU0A 1KWMA 1KKHA 3J81U 3E3XA 3GILA 2WOMA 2QFJA 1HNWJ 2P9GA 1NSKL 1UVKA 3HXMA 2UUCF 5E3AA 2RKIB 3DU6A 5HVHA 1RTIB 3AB4B 2V2ZA 3BGOP 2JVOA 5ETNA 4MKVA 4R5PA 1F60B 2JNJA 1HMVA 1JLQB 4DLGA 3U27A 4PWDB 2IHR1 2LP4A 1C1BA 2BV3A 3R1HA 2LQBA 4ZVQB 3SV4A 4OL8A 2BJ9A 2KT5A 3ETOA 1NSAA 4GO7X 2R9LA 4X4NA 4LUBA 2BX6A 3PHTA 1S9FA 3MR6A 2LVWA 1T9YA 4RW4A 2ZUAA 3VQTA 3H7HB 2X7IA 1S6QB 2J7WA 3UI3A 5D6GA 4EU0A 1NEEA 2KJVA 3GCWP 3M6VA 4AUKA 2WOMB 1W2BR 1WOPA 1G4CA 2LXFA 3PO4A 4EZ9A 1U6FA 2WW4A 4TXSA 4RUBA 3R5CA 4DEZA 2VJUA 4X4PA 3E8OA 4ZVFA 3HFKA 5CHCB 5JVHQ 2HS0A 1FEEA 2FC8A 2ILYA 1GMWD 1KQFB 4R5PB 2IA0A 5F8HA 1IVZA 5L8RC 1HMVB 1QE1A 2OFGX 4M5IA 2FPHX 4LRDA 1UW4A 1C1BB 1S49A 2E5LF 3AT1B 1VQMS 2DXEA 1S79A 2OFHX 4ZN1A 2MJNA 3D66A 4WKYA 5DM7Q 2C22A 4ZN3A 1TFWA 5KFRA 4WFYA 2ZOMA 3PYDA 1S1WA 1FE0A 3FVYA 1G1XA 2UXDJ 4RW4B 1B7FA 2EK6A 1XWLA 4LF8J 1SL1A 3P49B 3GB0A 5DZ6A 1VK3A 3QGPA 2CPYA 3AJ2A 4RNOA 2DVIA 1FJEB 2VPYB 3ZZPA 4DR2J 4DR4F 1HI1A 5B09A 1U49A 3GIJA 2JWNA 4UY85 4K4TA 1PAUB 1L3KA 5M2PA 4FXVA 1HD1A 1WG4A 4FXDA 5L38A 3W65A 1QE1B 1FRXA 2NCKL 3EYZA 2C3PA 5KG0A 1GMUA 5E33A 3BBFA 3FGVA 2OGUA 3K58A 3MUMP 4UQGA 1H72C 4YB5A 3HPOA 3NNCA 1DURA 3I56S 4C9DA 2KFZA 1U02A 2M8HA 2WVDA 3AJ1A 5KFOA 3FJ2A 1PJ5A 4KJIA 1S1WB 4CLYA 1ZA2B 3VAKA 2ZBQA 2Q43A 2ZZNA 2BMBA 4QU7A 4F50A 3UQSA 3D1OA 1FD8A 3KYLA 3UD3P 2HQIA 1F6TA 3QFWA 3R5AA 1KFDA 1K44A 3RAXA 3FRZA 1TAQA 1F5AA 1WHXA 3OXLA 3D1QA 3BYRA 3BS9A 1D1UA 3IA0A 1BQXA 4JBCA 1Q8BA 3ISZA 3P4UB 1F2GA 3WIVA 3GSIA 2M70A 4PG4A 4R0JA 1X4FA 3MGJA 3OVBA 1MMDA 1ZTWA 1RAFB 2E29A 5SZTA 4R25A 2EG2A 1RDRA 5FLXU 4PZVA 4YN3B 4USUA 4C11A 2CPHA 4LBIA 1J5EJ 3K5PA 2AF6A 3KG1A 1GEHA 3PJ9A 3K5LA 2PEBA 2P9EA 2NZCA 3M8WA 5HANA 2MKIA 5CXTA 2VD3A 1QDUB 2DGTA 4L6V3 4ETZA 2WAQD 2KT2A 2HRYA 4ANDA 5EX3A 1X60A 2XSFA 1QTNB 3LF0A 3TAQA 4DV3J 4DSIA 1ZA1B 2UUAJ 2AGPA 3CCTA 4YY3F 2B7CB 4N47A 5KFPA 2QJ3A 1V6HA 3MR3A 4MH8A 4FBTA 2AJ4A 2L9DA 3DRRA 2FLPA 3QBCA 2CJKA 1N4LA 1RAOA 3WHIA 1WNEA 1IWGA 2YQ1A 4ZVTB 4LRBA 3T9ZA 1RU1A 2GV1A 3UCZP 1S1XA 3DKDA 1QSYA 1URRA 4OX7A 5L39A 4B3RJ 1B3TA 4C11B 4QU6A 3ONQA 4NASA 4N41A 2GIQA 2HIQA 4C8ZA 4X4QA 3MUVP 3L7OA 2RS8A 1I6JA 1ZOTA 4ZA1A 4CM2A 4RBUA 4WFNQ 5DLGA 4FN5A 5KFJA 3NY0A 4QZVB 1KLNA 5IWAJ 4WFAQ 5F9LA 5B0CA 1RK8A 2UVRA 3BKTA 5LXRA 3SQGA 3V6HA 3M8YA 1Q8IA 3CDAA 2W4PA 2AEJA 5CABA 1VS3A 4TU8A 1NJYA 5CCMA 3CJ5A 3FEZA 4W92B 4QOTA 2KRRA 2W9BA 5F8MA 1S72S 2KI2A 3HD2A 3QWPA 3P5TL 2PE8A 3D67A 1RA6A 2HAFA 5IT9Y 2YKNA 2ZHAA 2CZ9A 4FYXB 1DTTA 2LA4A 1GTHA 4LRFA 2JVRA 1S1XB 3DFEA 4WBFA 3R2CJ 4DR5F 1RYRA 3BSNA 1RT7A 4AXJA 2DHXA 4ZVOB 2IFXA 1DTQA 1H2TZ 3HFZB 4ZOSA 2BZ2A 3LANA 2B8PA 4FYDA 3CDEA 1NKBA 1QLNA 1D9AA 3D68A 2VL1A 2JL9A 4DX6A 2XS2A 1H74A 4DUTA 4K5SA 1UTAA 1LWEA 3SQGB 4EO6A 2PI5A 1WF1A 2ZDOA 1MU2A 2XNQA 3G6VA 4AYBD 5KG5A 1U7LA 1F0XA 4NX9A 1TUWA 1LK5A 4KO0A 2W9BB 2FGCA 2VG5A 3BGFA 5J1NA 3GU0A 3PNIA 2CZVC 1FEHA 1GMVA 3OL8A 2RUSA 3U7JA 2YKNB 3OR1A 2BOAA 2QT7A 1DTTB 2YXLA 2KVIA 5HVGA 4KTQA 2VPWB 4NLXA 2VQEF 5HVFA 3DNCA 2XB2D 3HX9A 1RT7B 1DHMA 4LFCF 3EUNA 1U8SA 2BE7D 1DTQB 2IAJA 3OQ2A 5KFGA 1TU0B 1VYAA 2QE5A 1U48A 1NJIT 5EWGA 4QWEA 3SEOA 3SCKE 4OV1A 3IWNC 5I3PA 1LWEB 1JB0C 1MU2B 3ILJA 1YTYA 2VA3A 2BE2A 3I4PA 4DF4A 1XQIA 4KO0B 3TW0A 1XEZA 2EFVA 2VG5B 2O66A 2O1PA 2CQBA 3OR1B 5KFMA 1U1LA 2D74B 4ZS6A 1WG1A 4C3LA 1M5HA 2W01A 3PW2A 1NPKA 1FVSA 2IAJB 2HHWA 3NNHA 5K20B 1G6BA 1U6ZA 2PFDA 1YHQS 4OMFG 1U2RA 4C2MA 1S0VA 2OUGA 2IRXA 2Y3YA 1BGXT 1T3OA 2WSFC 4CH7A 2GJ2A 2VIHA 3FRYA 1C1CA 1SKRA 1IKVA 2YPYA 3NL0A 1URNA 2PD1A 1X9MA 2HFSA 3ZZYA 4R0EA 4PG5A 1N88A 1HL6A 2DHAA 2BE2B 2GQQA 2ZVIA 4L76A 1OMSA 4N8NA 3RJMB 1HYSA 2ZH5A 1QY7A 2WRMA 1YJWS 3T5KA 1B0TA 1YZ6A 4ILMA 2YKAA 2RDIA 3T5LA 2CJAA 2ASJA 3DC2A 2ROEA 4CLFA 2QL9B 3VAIA 2E44A 3DDKA 4I68A 3TR5A 4C48A 4TLQA 2HLUA 4RWXA 1ZS6A 3PIOQ 2Y0BB 4HT5A 5LSRA 1RWWB 3BO3A 2KHCA 3MR5A 5EDWA 2F63A 2RVJA 2L9NA 4MYUA 1X7VA 4B3SF 2XY6A 4NCBA 2VQFJ 4FYWB 1CLFA 5KG3A 5DDRC 4LF9F 2E7VA 1C1CB 2R7QA 4C6AA 2ZJPQ 1IKVB 1KOHA 3ZZUA 1B0PA 3MCNA 1P6TA 3OD2A 3ZZZA 4NLDA 4W4MA 5E3PA 2HBZB 1HYSB 2ASLA 2XYGB 3MPWA 3VV2B 3OLBA 2D3OR 2CDQA 1PG5B 2YKPA 5L1LA 3T1YJ 1HHQA 2GW8A 2HSEB 2HRTA 5KT4A 3AHPA 4RO0A 2HQFA 2HRUA 3MM9A 2HQCA 2VKZG 1L3VA 1NHVA 2A1BA 1B99A 4QPXA 3HO1A 1JKHA 3TVZA 4JI2J 2E9RX 2P9CA 3Q8QB 3FCHA 1TL3A 1TL5A 2CPIA 4Y0FA 4QIGA 4FYYB 3IXQA 3CCVS 2R7VA 5IC4B 2UUWA 1Q95G 1RGVA 3JTPA 1AW0A 4ILRA 4YHHJ 2RILA 3VWSA 5U47A 3MEGA 1FFWB 4N7TA 4DFJA 2IVFB 2HWIA 3OTBA 3I9ZA 4IR9A 3IS9A 3O5TB 3DU5A 3W62A 3F0NA 3CCZA 4C8YA 1L3SA 4Y2KA 2XY5A 3CC4S 3OXFA 1PYSB 2QIFA 5F8JA 4YS2A 1HARA 2WCXA 3B78A 3CD5A 3IBWA 2QL7B 4HHUA 2H5JB 3MM9B 4ZLPA 2J7UA 3R5JB 4BCAA 5IQ6A 4EMDA 1WKKA 4KHRA 4J9KA 2AZ3A 1JKHB 1UFKA 2XWYA 1HHSA 1TL3B 1C4AA 4ED4A 2ZJQQ 5A0YA 5KG4A 1LXJA 1PCAA 4RKUC 3TI0A 3SSRA 1OYDA 4PWUA 2A0FB 2VICA 4OZ2A 2P5VA 5CQGA 2HQ3A 3MEGB 1RAIB 1H7XA 1KNZA 3NKYA 3C46A 1IR0A 3IS9B 3M30A 4RNNA 3V6DA 4M5KA 4ED3A 3CW2C 3CJ3A 2XS5A 1UWBA 3I87A 4NYZA 1ICEB 3VAMA 1XBWA 1IR2A 1F9FA 3MD3A 1BE4A 3KMSA 3K8VA 1MW7A 1REVA 3H4BA 2JEJA 2RF2A 5DQGA 1NO8A 1RBOB 3I82A 3AODA 4ID8A 4DX7A 4FVCA 5AXLA 1WHVA 3TUZC 1N34F 1CVJA 2COLA 2HVHA 3CD7A 4JUZA 2XGPA 2ZH9A 1S1VA 5A0YB 5C5JA 5F8LA 2MSTA 3UN5A 4M5MA 1KQSR 1W25A 1IN0A 4ZVEA 2YWGA 1VRUA 3RYLA 5H1SV 3B54A 2HVZA 1ZH5A 1F9EB 1JNZB 3G6XA 3IBFB 2MLYA 1FJGF 2UUBF 1N6QA 5J2QA 1BWEA 1DBDA 2ZC3A 4I0WA 3M30B 3V6DB 1GT8A 1YZ7A 2YWWA 3W61A 1WHWA 1JXEA 1T0TV 2CXEA 3W66A 2BBEA 5IOLA 2KM8C 4TN2A 1NK6A 3KTQA 2Z56B 4AL5A 4X64J 2JJ4D 3TEGA 3H20A 3TNVA 2Q3PA 4USKA 2M88A 3TVYA 1S6UA 2IDLA 1REVB 1S1TA 4A8XA 2A2CA 3OVSA 1UEUA 3GE9A 4OFZA 2RF2B 2CG8A 2L9WA 2JFDA 2BW7A 4DR7J 4CRJA 3VCDA 1QJHA 3QGHA 4XAKA 4G1QA 3DOKA 1S1VB 4C3KA 1VQ6S 4ID5A 1XERA 2E7WA 1X0PA 1VRUB 1R31A 3MOJB 3LP1A 2QSFA 3HKZD 2W2OP 4IH7A 3SQOP 1YJRA 4DL3A 1N6QB 5J2QB 4B9SA 5IV4A 1MMLA 2XZTB 3AB2B 1FKOA 3FUYA 2NQPA 4RWWA 5KG2A 5D4LA 2MJUA 2DXFA 4KPYA 2NZ4A 1PBAA 2Y1JA 4P2MA 8AT1B 3DXSX 1IBMF 2BVZA 3GV8B 3D2WA 4WIQA 5C25A 3J80Y 4LR8A 2KG1A 2OPPA 4OYMA 1S1TB 1X31C 6FD1A 1RKIA 3EWGA 3QJJA 3CXCR 2X1BA 4DL2A 2QA1A 1K73T 3AXMA 4I1TA 5KFXA 4ZJQA 4C97A 1KN6A 1RT3A 4G1QB 4IRDA 3DOKB 4CLPA 2CPXA 4I2QA 1SJQA 4ID5B 2CNKB 1U0SA 3H5SA 4YQWA 2G4BA 3ZTOA 1KLMA 1R0BG 4HACA 4ECRA 2LLZA 2OHDA 3LP1B 1AUSL 2GJIA 3KDOA 2MQLA 2Q6BA 4RNFA 3LTOA 3QWUA 3TJ8A 5HQLA 1ZZNA 2NUUG 2RB7A 3TJ9A 4OX6A 1WWHA 3J81Y 1FKOB 3Q24A 4B9UA 4UT4A 2ERRA 4IRCA 5AJ3J 4TY8A 4RW6A 1FKPA 4DUZJ 1DQ8A 3HVAA 5IV3A 5C25B 4PG6A 3ICLA 4A8SA 4B17A 1O6XA 2OPPB 2FLLA 2XG8A 3KJVA 1NM2A 2OI2A 5F3ZA 2VBXA 2IM1A 3M05A 2AEFA 5IQQA 1RT3B 2MLXA 4NLQA 2CPDA 4I2QB 3D3CJ 2HLTA 2MQMA 5DO2A 3IO1A 2F8EX 1KLMB 4HACB 3N79A 2DY9A 4CLZA 4UUWA 2HVEA 4EI2A 1VOMA 2D3UA 3TOQA 5D8HB 3QGGA 2XMTA 4WFBQ 1SJ4P 5K8MA 2W4CA 3HT3A 3I5BA 3T19A 1VMBA 4H4KC 2V2KA 3D6FB 4MFBA 1VQLS 4URQU 2M8DB 4AL7A 4TY8B 2ACMA 1NK5A 4RW6B 1TKTA 1FKPB 2N3OA 1Y3JA 5HK4A 1XMBA 2DRDA 4KGMA 1N33F 1H2VZ 2IPOB 1T03A 1PC5A 4ZPVR 1T11A 1GQEA 3CMES 1Y5NB 2MQPA 3KJVB 3KHHA 5EWFA 3SFUA 1GXUA 4DV5F 5D4NA 2DPIA 1HBOA 2HVIA 3KK2A 2ZOGA 1LW2A 1XNQF 2MY7A 3DM2A 4ECSA 4GC7A 4EWTA 4PWWA 3D4JA 2EPIA 3HP6A 4LRCA 3PG9A 1HNWF 5K5MA 1OSCA 4WXOA 4UZBA 3Q2TC 4QBUA 2ZKUA 2R7UA 1S48A 2CVIA 3W5YA 1HI8A 3OHBA 2U1AA 4MFBB 2J6UA 4ZMMA 3TVKA 5DDQC 1RLCL 3EXCX 1TKTB 3BPDA 2ZWPA 2D3O1 4XIUA 1TAUA 2WBMA 1GTEA 2QGFB 3GV7B 4C98A 4QW8A 1Y7PA 4EYIB 2XS7A 2KHDA 4NLRA 3EGNA 1T03B 2C2RA 5DJBA 1YRUA 3PYGA 3QMQA 5B0BA 1NDLA 2N4DA 1F2HA 4DR1J 3M9NB 1Q53A 1QD1A 5ITHA 1HBOB 3SIPB 2HGMA 3KK2B 1LW2B 4RJVA 3DM2B 1RHQB 3TUIC 1BXNA 1T9WA 1FRLA 2POKA 2OPSA 3KLGA 3EDQB 2AD9A 2PI4A 2YY3A 2JOQA 1FXRA 3H5XA 3I0RA 5K9FA 2CADA 4DCOB 1K9MT 4DF8A 1WC3A 4CIOA 3PY8A 4N56A 2MTLA 4ZCIA 4RUCA 4N76A 2Q66A 3QJPA 2ZH6A 4JI4F 1R89A 3BR8A 5LMUJ 2DTJA 3IBCB 2HBYB 1HBMA 1RWNB 4AT1B 3K2YA 2GHWA 2ZVSA 4R8UA 1WC1A 1XC9A 1U09A 5ETQA 2UXDF 2QMXA 4CNZA 4DBQA 2Z0GA 3OTDA 4LF8F 3POTA 3J81j 3KJQB 4Q45A 2BM1A 1HNZJ 2X3DA 4NPOA 3BEGB 1PKUA 4DR2F 3R27A 1CSJA 4IOBA 3LALA 3I4HX 2OPSB 3KLGB 3R5GA 3I0RB 2OEJA 2NYIA 2WVCA 4QIEA 1P1TA 2KO1A 4W98A 4O23A 3JAMU 4IFYA 3NEKA 4WE1A 2GIFA 4USIA 4OHWA 2A2DA 5KFVA 1VBXA 4NL5A 4WP8A 1HBMB 3TUJC 4CNYA 2OSRA 3K5OA 4J9RA 3H4DA 1JIHA 4ER8A 4LREA 3R6LB 1TMMA 1HWLA 2ZBCA 2HHUA 2MZSA 4R8UB 2V0NA 2E1RA 4ZHRA 3FSIA 3HT0A 4ECZA 4Q2MA 5ADZA 1TL4A 3WX8A 3EE3A 3POTB 3O1LA 2OD6A 1Q16B 2QYCA 1UMJA 4MKBA 4RUHA 2AEMA 4A8MP 4OX9J 4NMLA 3KG4A 1KQGB 4HHHA 5AXKA 2K06A 3G2XA 1J27A 2HWTA 2DR9A 1RAHB 4OJ3A 1OIAA 3H5UA 5HMXA 1MLAA 1IUJA 2HFOA 4XDDA 1KVIA 4ZIVA 2Z4PA 4IFYB 4WE1B 2R8JA 4UF4A 2J7KA 2XNRA 1W2IA 2RE1A 2W2QP 2RD5C 1YIJS 4C0OC 4KGKA 1YDLA 2FJDB 4IH6A 3ILOA 1HR0F 3US5A 1TKDA 4ZHRB 3BJYA 5EX0A 2V8HA 3MR2A 3NWGA 1X4BA 2GQCA 4I56A 5KFYA 3R2DJ 1E6YA 2RU9A 3NGDA 2K1RA 3CDBA 3MDFA 1EX8A 3DDIA 3JB9k 1RWPB 3C14A 4DV3F 2UUAF 2FVQA 1FX2A 2DCUB 2DR6A 4OZ1A 3O8WA 2WONA 1VIXA 3NS5A 3PFOA 3PYFA 2H48B 3UNGC 5C24A 5D0GA 1TKZA 3JQJA 2ADBA 3CIZA 1WC4A 5F8IA 1PC4A 4CP5A 2CJBA 3FZ2A 3F44A 5E3RA 4AE5A 1ROFA 3FKBA 3E2EA 2CG4A 2VA2A 1NK0A 4B3RF 3CVKA 1X4AA 1TQLA 1U45A 3HSZA 3THVA 4RNHA 4DZ6A 4HI1A 4MK7A 4LQ9A 4QR0A 3Q89A 5IT0A 4NXNF 1YJ9S 2K7JA 4F02A 5ETLA 2VOPA 3KJNB 4OYOA 2F1FA 1E6YB 1O0PA 3G9CA 2K1RB 3CC7S 3GLJA 3EXYA 5IWAF 1SQFA 4IRKA 3C14B 1FXLA 1K1SA 2ZH8A 3HHLA 1P8GA 4I6YA 1X4GA 3CJKA 2WONB 1YQHA 2WVBA 2C3OA 4ECTA 4OHYA 1FJ7A 5F0UA 1WUUA 5C24B 1TKZB
chains in the Genus database with same CATH topology
2AV5A 2AWZA 5LJ5Y 4IUFA 1T94A 4AXIA 2P6TA 1FNOA 3OJUA 4EBCA 4BWMA 2E1CA 2GO8A 4C11A 2CPHA 2AYBA 2FGOA 4ATNA 2MHNA 2M5YA 5M2RA 2KXNB 3PRDA 3PJWA 3K5PA 2AF6A 3KG1A 4IQXA 1KVJA 3K5LA 3L09A 1AFJA 4JOUA 2APOA 2P9EA 1NJWA 2DGXA 4IDKA 3M9OB 4RW8B 5A8KA 2FJBB 2E9TA 3CULA 2MKIA 1FXDA 5CXTA 5A8WA 2G1DA 4DV7F 2VD3A 5LT5A 1FO1A 2DGTA 4LQ3A 4J9NA 4L6V3 4ETZA 1XR7A 2WAQD 3MWBA 3KLHA 4OHVA 5DLFA 1IJEB 4HH1A 2J6TA 1R6YA 2KT2A 2HRYA 4RU2A 3HDSA 4KHMA 5EX3A 4MIWA 4B9NA 5HL7Q 2XSFA 2F9JA 3CJ2A 3W3SA 3LF0A 3TAQA 3MM7A 2XI2A 4CO1A 4DSIA 2HZCA 4KKOA 1N5SA 2AGPA 4HTIA 3CCTA 5T7LA 1FRMA 1O8BA 2YVSA 4YY3F 4A8YA 4LSNB 2DH9A 2V9WA 3SFGA 4USJC 2CQ3A 2B7CB 2VODA 5G4DA 1H3DA 4N47A 5KFPA 4ECQA 2V8DA 3TO8A 5DG8A 3JSBA 1V6HA 3OFGA 1C0TA 3SCLE 2HHHF 2JEIA 3TP2A 4IOAQ 2MZ1A 1UVMA 4NLPA 3MR3A 2DHGA 3OHAA 1BC6A 2VFVA 5KT2A 1HQEA 4MH8A 1NB7A 4FBTA 3AAWB 3EPGA 4DL4A 1RT1B 2R8KA 2AJ4A 2DHSA 2L9DA 2WBRA 3DRRA 2FLPA 5I42B 2IVYA 2JHEA 3H98A 1LFPA 2BR0A 2CJKA 3HHLB 1N4LA 1SJ1A 2GFFA 5KFKA 4QIVA 5KOWA 4ED1A 4KT0C 3RB6A 3RB4A 1GXTA 3M2VA 1WNEA 2B4VA 4DPOA 3Q8PB 3CJKB 3Q23A 2Z2MA 4TYBA 2GHVC 3T9ZA 2B4UA 4ELUA 1ELOA 4LVNP 4DS4A 5J1PA 2B7BB 2GV1A 1K0TA 4PQUA 3UCZP 1S1XA 1VIOA 5KG1A 4PRFA 5CYMA 4FF4A 1QSYA 2O5DA 2ZFHA 2RRNA 1URRA 1VQNS 2M3DA 4OX7A 4UUXA 4Q8FA 2KTQA 5L39A 2MZQA 2WSCC 1VHFA 3PV8A 1VJWA 2B43A 4C11B 4QU6A 3ONQA 3R1LA 4K4ZA 3CJ0A 4N41A 5AXMA 4CH1A 2JH3A 2GIQA 2HIQA 3LPYA 4X4QA 4C8ZA 1CQMA 2MXYA 1TK0A 3MUVP 3NG8A 2EC0A 1O51A 3BGLA 3L7OA 4LF6F 2RS8A 2HPUA 1I6JA 4IDKB 4DG1A 1ZOTA 2E66A 2EW9A 5K8OA 5A8KB 1S6PA 4OZ5A 2CQHA 4V19X 3R5BA 4ZA1A 5A8WB 2KXFA 2YTCA 4I67A 2FVCA 4RBUA 1J5OA 3FDSA 4WFNQ 3VAFA 1D0EA 2KXHA 2X1FA 4DSLA 5DLGA 4FN5A 5KFJA 3KLHB 4BC7A 3N6NA 1VQ9S 2AJFE 3FFIA 4PG7A 4QZVB 4B3MF 3KHGA 4FS1A 1KLNA 4WFAQ 5F9LA 5B0CA 5DG7A 3HI9A 1RK8A 4C7QA 4YUDA 5IT4A 5GADU 3T6BA 3I96A 2UVRA 5LXRA 3MM7B 1T7PA 4KKOB 1RWUA 3SQGA 4PG8A 3PJXA 5T7LB 3V6HA 1Q8IA 3V6KA 4UW2A 3CDAA 4G3IA 2BABA 2DNRA 4CO0A 2W4PA 2IYGA 4A8OA 2DGWA 4MK9A 3C66A 2QEXS 3GMGA 1C0TB 2E5IA 1VS3A 2YNGA 4TU8A 1NJYA 4F2SA 5CCMA 4PXCA 2N82B 3CJ5A 2WB1D 3FEZA 3HHLD 4P7VA 4YFUA 4W92B 2ZH2A 1B0VA 2G0CA 1SB6A 2DO0A 2KRRA 1HQEB 3M32A 3OPKA 4J5OA 4QOTA 3JTNA 1P1LA 1HBNA 4ES3A 5F8MA 2W9BA 1S72S 1V3SA 2IBOA 4ECVA 3DLHA 2KI2A 2JLGA 3QWPA 3P5TL 2DH7A 3M8RA 2EFOA 4WCEQ 4OZJA 1JNRB 2PE8A 2FJAB 2EBGA 5KFUA 3VALA 3RBEA 3PKMA 1RA6A 1OPZA 2NSBA 5IT9Y 3M2VB 2YKNA 1NK9A 2ZHAA 3SCIE 4O3SA 2H9ZA 4NRTA 1DTTA 1VK8A 3G8SA 2KZZA 1FDAA 3CCJS 2LA4A 2BRKA 3S6EA 3X3UA 4TQSA 5GAEI 1BY9A 4WU2A 1VQKS 2BQRA 1GTHA 3HVRA 2JVRA 2ZOFA 1S1XB 1VQ8S 1EETA 3DFEA 1Q81T 2CQ1A 3I0SA 3PHEA 5CYMB 4DR5F 1RYRA 2UV8A 1RT7A 3BSNA 5IZHA 2ZD1A 1UKUA 4I2PA 4AXJA 3D0HE 5F8GA 2DHXA 4F4ZA 4IFVA 2CVEA 3OSPA 3V6JA 1H7WA 2FLOA 4KSEB 4DL5A 2IFXA 2RMLA 1DTQA 1H2TZ 1SH2A 4HDHA 4ZOSA 2LECA 3KMQA 1XR6A 2BZ2A 4DFPA 5E5NA 2KM8B 3LANA 4FYDA 2W7AA 2NXUA 2YNHA 2YWHA 4MKAA 1RT4A 3CDEA 4DG1B 3UWTA 1P9QC 3BO2A 1U1PA 1S6PB 4O44A 2KT3A 2HYIB 1NKBA 3ISNC 1S76D 5E3CA 1QLNA 1D9AA 1J5OB 3IR6B 4KB7A 2VL1A 3PX0A 2JL9A 3FFIB 4PUOA 2PGCA 4OJGA 5J2MA 2VKRA 4I6AA 2XS2A 1X5OA 2YKMA 3H59A 2MQNA 5MLCV 1M1KT 4DMZA 6FDRA 1WELA 1Y5IB 4OHZA 4K5SA 3TYTA 5A6PA 3PO5A 2BQUA 1LWEA 1A6LA 2XSJA 4HT7A 3SQGB 1LW0A 1RP5A 2ZKTA 3D28A 1WF1A 2ZBIA 2ZDOA 4KQZA 1MU2A 4CTAA 2PI5A 1JLAA 1JJHA 4M94A 3BM7A 3CC2S 2XNQA 1C0UA 2R7OA 4OHXA 3G6VA 2KB2A 5E3QA 1TK5A 4AYBD 5KG5A 1U7LA 5J2PA 1XK8A 3K57A 1F0XA 2KYXA 4ITSA 4M95A 1KSPA 4Z2XA 3MOZA 5HMZA 4NX9A 4AQYF 2YNGB 4K2XA 1LK5A 3LAMA 2DR7A 2VG7A 1RI7A 2K3KA 4KO0A 2VBZA 4XK8C 3RB3A 4PQAA 3M32B 2W9BB 2FGCA 2VG5A 3BGFA 3OW2R 4GMKA 5J1NA 3UD4P 2DNKA 2R2UA 2CPEA 3LQVA 3MD1A 3PNIA 2CZVC 1FEHA 2DNMA 2OPQA 3M8PA 3O6QA 3EGWB 3OL8A 3U7JA 5EHHA 3GIIA 2L48A 4K4UA 2YKNB 3OR1A 5HMWA 3CCRS 1SBRA 2QT7A 4HTJA 1DTTB 2KVIA 2V9KA 4Y2CA 4KTQA 2VPWB 4PXEA 4NLXA 2XHWA 1FTRA 1LOUA 2VQEF 4NLOA 5IS2A 4DR6F 1EETB 1NK7A 3BF4A 2OAUA 3I0SB 1YRXA 3DNCA 2R2TA 2XB2D 1VC5A 2Q6CA 1U1QA 2ZUGA 3HX9A 5KFTA 1RT7B 1DHMA 2NPIA 2ZD1B 4I2PB 4QWCA 4LT6A 1SUQA 2P6SA 4LFCF 1KS2A 3EUNA 1U8SA 4D3GA 3I9V9 4PCQA 3MEKA 4IFVB 3TA0A 3G6ES 5L9XA 1DTQB 2DNPA 2IAJA 2OPRA 1JJ2R 3OQ2A 5CZXA 1N5TA 5HMYA 4ES1A 4J9PA 2YNHB 2DRAA 1RT4B 3OR2A 3D0GE 3U02A 5KFGA 1R3NA 1NZAA 3DHWC 4O44B 3VZHA 2QE5A 1B64A 1U48A 1VRTA 4XO0A 1NJIT 5EWGA 4DS5A 1N32F 2XLKA 3TAMA 4X84A 5IFMA 4QWEA 3DRSA 1JLCA 4PUOB 2MKSA 4JI3F 4DR3F 5J2MB 5I3UA 3SEOA 3SCKE 1R8PA 5FJ4A 4OV1A 3IWNC 4X4UA 5C42A 2XLJA 3VTIA 5F3TA 3NBPA 5BJRA 5I3PA 1LWEB 2XSJB 4L72B 4K59A 1JB0C 2KZMA 1LW0B 4WU3A 2W7PA 2OTLS 1RT6A 2EVZA 4CTAB 4K4YA 1MU2B 4WIIA 1JLAB 2YKQA 2IYIA 3OBIA 2IM0A 1YTYA 3S01A 3CCUS 1C0UB 3GG0A 2VA3A 1C2PA 5J2PB 4QIFA 3TQ1A 4Q0BA 2R4FA