3CC7S

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cc7S00
2E5IA 1JJ2R 2OIHA 2GO9A 2LKZA 5GMKa 2N7CA 2QA4S 2MMYA 1UW4A 5LJ5Y 1DHMA 2CQGA 1KOOA 1H6KX 2DH8A 2K8GA 1Q86T 2HGNA 1VQ6S 2AYGA 5IM0B 2CPHA 3MDFA 1YJNS 1VC0A 2M8DB 1FJCA 1X4AA 2CPFA 5CYJA 5DM6Q 2MQPA 5DM7Q 1P27B 1KQSR 5DDRC 2YH0A 1ZZFA 1X4HA 5DDPC 2CPEA 1VC6A 2MKIA 1VQLS 4Z2XA 3EX7B 3G96A 5DETA 3CCSS 2DK2A 3ZZYA 3CCJS 2AD9A 2MKJA 1FXLA 1VQ7S 2XNRA 1O0PA 1XN9A 2FC8A 2DGTA 2DGSA 2MXYA 2KG1A 4EGLA 1SJFA 1WEZA 1YWXA 2DHXA 2F3JA 2XB2D 2NLWA 3BS9A 3VAKA 2B0GA 3MXHP 2DGWA 3MI7X 2N82B 2HGMA 4ED5A 4J5OA 2MJNA 2MJUA 1ZZNA 1WEXA 4YB1P 2DNPA 2HVZA 2JVRA 4Y00A 4PR6A 3BO4A 2CPJA 3FEXB 1VQNS 1HD1A 2MSSA 3IWNC 3CC2S 2WBRA 2KHCA 3CCLS 2M7SA 1N52B 2E5GA 2DNQA 2XS2A 2ADBA 1H2TZ 2MQOA 4C4WA 1JJ4A 4OZ1A 3CC4S 1R8PA 1JMTA 4P6QA 3J7YU 5HL7Q 3VAFA 3CULA 1L3KA 1N88A 2X1BA 2XNQA 2CPZA 3S7RA 1U1MA 1M5KC 4RU2A 2MKSA 2JX2A 1X5PA 2VOPA 2LA4A 1OPIA 1WG4A 4BS2A 2DHAA 2RUGA 2KT5A 2CPXA 4F26A 4CIOA 2LQ5A 1U1OA 2V94A 1DZ5A 2A3JA 1SJRA 1U1RA 2RS8A 4V19X 3Q2TC 1NO8A 2DGVA 3PIOQ 2EK1A 2Q79A 2KXNB 3BO3A 4CH0S 2CPYA 4PRFA 1WHYA 1H2VZ 3K0JA 2LA6A 3SMZA 3UCGA 1NJIT 1M5PC 2DNKA 2KYXA 3NS6A 4OZ0A 1WELA 2RVJA 2DNGA 1WI6A 2DNNA 4WIIA 4C0OC 2MYFA 5IFMA 3OW2R 1X5OA 2KRRA 2KU7A 5CA5A 4IOCQ 1K9MT 1U1PA 2MZJA 1FHTA 1WHXA 1M1KT 2RU3A 2DHGA 2HGLA 3NS5A 3J7ZT 3UD4P 2MZSA 1X4BA 2M8HA 2G4BA 5D78A 1G2EA 2M0GB 5LJ3Y 2HYIB 2DH7A 1S79A 2KG0A 4LMZA 2E5HA 5LSLA 3TO8A 2EK6A 1D9AA 2E44A 3CC7S 2J0SD 4M5DB 1KC8T 4UY8T 2KM8B 1X4GA 4IOAQ 5FJ4A 3CUNA 2FHOB 2AYEA 2CQCA 3H2VE 2DNHA 1N8RT 2UP1A 2BOPA 5GAHU 2OSRA 1DRZA 1WHWA 2X1GA 4QPTA 3P6YC 1Q81T 1KOHA 2QFJA 1WHVA 2JWNA 5LSOA 1YI2S 2CJKA 1WTBA 2L9WA 2MY7A 2SXLA 3IRWP 1U1KA 2FC9A 1W2BR 1SXLA 3SDEA 2FY1A 3CTRA 2KH9A 3R1LA 2RT3A 4WF9Q 3UD3P 2LEBA 1K73T 1IQTA 2JRSA 2DO4A 2MB0B 2MZ1A 3CCRS 3UWTA 1VQOS 2PE8A 2G0CA 3CCUS 5D77A 4A8XA 3UE2A 2CQHA 1UAWA 2L41A 3UCUP 2O3DA 5GAGU 4F25A 2OJ3A 5GAEU 1M90T 1FNXH 3U1LA 1NU4A 2DNYA 1S72S 2E5JA 5CXTA 1M5OC 4ERDA 1WF1A 2ERRA 1Q7YT 2MKHA 1FT8A 4IO9Q 1YITS 1VQ5S 1WF2A 5DDOC 3DLLQ 4WFBQ 5IQQA 3CMAS 1KD1T 1YHQS 2MQNA 1VQKS 4CH1A 1WI8A 4W90B 4FXWA 3CCES 3BO2A 1A9NB 3SXLA 3Q2SC 2MKCA 1U1QA 2KN4A 5IM0A 1X0FA 2YH1A 2DGQA 3VAHA 4QU6A 2CPIA 1YIJS 1OO0B 2CQ2A 1ZH5A 3MD3A 2DNRA 2DNZA 2VOOA 1OIAA 1PO6A 1X5SA 2EVZA 2CQIA 2LXIA 4QQBA 2DISA 3EGNA 1QVGR 2LECA 2LEAA 3VAGA 1WWHA 2YTCA 5MLCV 2KXFA 3JB9k 5JVHQ 2RRBA 5LXRA 4WKRA 2N3LA 1VQ4S 4U67Q 3BEGB 2M4MA 1A7GE 1X4EA 2NZ4A 1X5TA 3NNCA 2DHSA 2ZJPQ 3HI9A 3B4DA 3MUMP 3P5TL 1FO1A 1U2FA 2I2YA 3G9CA 2M70A 3CPWR 4PKDB 3S6EA 3NNHA 3FEYB 3RW7A 3MURP 1X4CA 1FJ7A 5EN1A 3N9UC 4QU7A 3VAJA 1X4DA 3CD6S 1M5VC 2DIVA 5HO4A 2G1DA 1SJQA 1HA1A 5ITHA 3P49B 2BZ2A 2OSQA 2ZJQQ 4FXVA 5BJRA 2KM8C 2CQ0A 1B7FA 2CPDA 2MGZB 1DBDA 2CQ1A 2L08A 3NNAA 1R8HA 4TLQA 3CF5Q 2OTLS 3TP2A 2AYMA 1VBYA 4TU7A 4Y0FA 2YKAA 2DGUA 2RQCA 2VONA 3MOJB 2KRBA 3V4MA 2DIUA 1WEYA 2DGOA 3U1MA 3CCVS 2ZJRQ 2DB1A 3MD1A 3NMRA 1UFWA 4WCEQ 2ADCA 3VAMA 2DNOA 2CQ4A 2J8AA 3LPYA 2RNEA 1AUDA 4WFAQ 3EGZA 3THTA 1WF0A 2GHPA 3THPA 2MZTA 2PEHA 2RS2A 1QM9A 2K3KA 3R1HA 2KXHA 2D3OR 1H2UX 2D9OA 2QEXS 1URNA 1UP1A 3H2UB 2KVIA 2LMIA 2I38A 2X1FA 2JVOA 4YOEA 2AYBA 1YTYA 2MZQA 3CXCR 2MGZA 1P1TA 2RQ4A 3G71S 1PGZA 1VQMS 2J76E 3SDEB 4UQTA 3D2WA 2D9PA 2MQMA 2LCWA 2KI2A 1VC5A 1WG1A 2MQLA 2KFYA 1U6FA 1X4FA 3VAIA 2OTJS 2MKKA 2MPUA 2N3OA 5LXYA 2U1AA 1SJ4P 2DITA 2DGXA 1U1NA 2M2BA 3VALA 2MHNA 5JVGQ 3G4SS 1RKJA 3DXBA 5GADU 3RW6A 2U2FA 1K8AT 2MY8A 4LJMA 1D8ZA 1VBZA 3CCQS 2FPHX 3UCZP 2MQQA 3MUVP 3LQVA 3CCMS 4F02A 4C7QA 4W92B 1QVFR 3G6ES 2XS5A 4LIRA 4TU8A 2HZCA 3G8SA 3HHNB 2MSTA 5H1SV 4YUDA 3G8TA 5GVQA 1OWXA 2XS7A 2DH9A 4ZKAA 2LXUA 3PIPQ 2DNMA 2F9DA 3MUTP 1VQ9S 2M9KA 4IUFA 3ULHA 1U6BA 3US5A 4CQ1A 1F9FA 2F9JA 1SJ3P 2YWKA 1VBXA 2J0QD 1VQPS 1BY9A 3L3CA 2CQPA 4TU9A 3I55S 3CMES 2M88A 1VQ8S 3ZZZA 1Q82T 3S8SA 3B4MA 1YJWS 2RRAA 2XSFA 3R27A 1FJEB 1N54B 2X1AA 1CVJA 1RK8A 1YJ9S 2CQBA 2DO0A 2M52A 2MZRA 2CQ3A 1WG5A 5DDQC 3TYTA 1HD0A 2CQDA 3P3DA 3S01A 2VODA 3I56S 1JJHA 3VF0B 2DNLA 1HL6A 1U1LA 2LYVA 4WFNQ
chains in the Genus database with same CATH superfamily
1LXNA 4B3RF 1EP4A 1IKWA 1S0MA 3D1OA 2OIHA 3NGSA 2K2PA 2QZ8A 3CW2C 2ZKTA 1QUVA 2VG7A 3G87A 3NWGA 1U09A 3KJFB 4PPZA 3MMCB 5GMKa 3OJSA 3EGWB 2GQCA 1WC4A 4WU3A 3MM7B 2N7CA 1UW4A 5LJ5Y 3MCMA 1YK9A 2FZKB 1WC5A 1SUQA 4K7QA 3LA0A 1OMSA 4DV2F 2Y9HA 4XDCA 2DEJA 5EWEA 2NR0A 3V4IA 5D3GA 1KOOA 4O3OA 4GC6A 2FTRA 4CTAB 2DH8A 4RU9A 1KVIA 4ZP8A 2ZBPA 4DPWA 2LQ8A 2KL8A 1NCLA 5I3QA 4NEYA 5IM0B 1TVRA 1EKSA 2MLXA 3JSRA 3MAAB 3MHYA 4C98A 2J6TA 5CYQA 1SCJB 2M8DB 1X4AA 2CPFA 1N0UA 5L1JA 1IBLJ 3MWBA 3DGPA 3PG9A 1MWYA 3VWSA 4CO4A 4CWBA 3I0RB 3R8YA 5CYJA 1P27B 3DLBA 1TU0B 4WJBA 3LP2B 2PDAA 1IM4A 4MYTA 1R7IA 3Q0AA 4KFBA 2OAUA 4P2FA 4AUKA 1HNIA 4HLBA 2MEWA 4ZPBA 4GMKA 3DN9A 5KT6A 4EK2A 2EFGA 2IA6A 1IR2A 2QN6B 1X31C 1AXQA 3MPYA 3VVUA 3W7BA 3M05A 1M0SA 2N4DA 1FXLA 1VRTA 1LWCA 4GVBA 2R2RA 3MR2A 3PV8A 2PN6A 1Z1ZA 5GADI 1HR0F 3B78A 3DDNA 2MXYA 3R3TA 4ILLA 1AW0A 4MIAA 3SFUA 1FWKA 4DR7J 1CJKA 4QWBA 3M8SA 1WEZA 3T5LA 3PW7A 4IR1A 1XR5A 4GKJJ 2F3JA 4NYZA 2GVZA 2CJXB 2KTQA 3IA0A 3BS9A 3OLBA 3V81B 4FKYA 3OL6A 1R89A 3CD5A 1S10A 4ZVSB 3W8PA 1D09B 1SC3B 1KFSA 4JI6F 4J5OA 2MJNA 2MJUA 2RJZA 1ZZNA 4HKQA 3JTOA 1O5JA 3EDQB 2E9TA 2VBWA 3QWPA 3BO4A 2YX1A 3A13A 3TVYA 2F8HA 1T3NA 4RLEA 3U27A 4F50A 3NCPA 4FVMA 4OV1A 3MTKA 5HMZA 3CCLS 4DDFA 4KGXB 3EUNA 4ZVPB 1N52B 1FTRA 1TL3B 3HXMA 2H1YA 2XGPA 4IRKA 4JV1A 1ITPA 2XS2A 3Q8RB 1XBWA 2HMIA 2I8EA 3R5GA 4NLWA 4QJVA 1CJTB 3CJ4A 3CC4S 4NL5A 3IGNA 4NEZA 4P6QA 2H48B 1RTZA 4X65F 1HBNB 5ETMA 5HL7Q 4DSIA 3BQ1A 1JLCA 3NOCA 2AGQA 3KLEB 2MQ8A 1YGYA 4ECWA 2DR5A 4WE1B 3PYFA 1S6UA 1CULA 3BH7B 1LQ9A 3HHDA 2MKSA 4ETZA 1T94A 3DOLB 5D0EA 3J80U 1I1GA 4I7FA 5CZVA 1TKTA 3C46A 5D0HA 2LA4A 2ZUGA 4QYRA 1TTHB 5ETPA 3FMBA 2J5AA 1WG4A 1C0TB 2AX1A 1CULB 1P6TA 2CPXA 2RUGA 2YKMB 3Q8QB 1JLEB 3FBCA 4HI1A 2LQ5A 1U1OA 2DPJA 2OD6A 3MAHA 1BHNA 4KGKA 1Q8LA 2IJFA 4UZBA 4LF7F 4RUAA 3P96A 3M6WA 1F6TA 3KUGA 1SJRA 5CYMA 4ZVTB 4MKAA 2RS8A 4DLGA 3L09A 5K20B 4MTPA 4L76A 5M2PA 5LMNF 1NB2A 2CVIA 1T0TV 2ATLA 4ED1A 1C1BB 2Q79A 4NLTA 4Q43A 2J6SA 2KXNB 4U7UD 4B3OB 4L74A 2CPYA 2RF2A 2HZVA 4PRFA 1WHYA 3KK3B 1U26A 1YJUA 3C66A 3UNYA 4F4KA 3RAQA 1UWAA 2B5JA 4OYXA 1NJIT 2G1HA 4NLUA 2YNGA 2F8MA 2JEJA 5HVHA 1Q7LB 4DN9A 3M8RA 4UY85 4PCQA 1WELA 1XMQF 4Y28C 2CNKB 3FCHA 5L46A 4Y2KA 2B4UA 1CJTA 1OJ4A 3UDEA 4WIIA 5J2MA 2ZE2B 2BE2A 2B5JB 3A3NB 4EWTA 2UUBJ 3J81U 4A48A 2OPPB 3C15B 3C14B 4QCLA 1RTIB 5CA5A 2VFRA 4D3HA 4IOCQ 4JI8F 9RUBA 1U1PA 4LF4F 4ZVEA 1I94F 1WHXA 3PHEA 2B4PA 3GFXA 4MKBA 3LP1A 4JB8B 2ZZTA 1N34F 2F63A 2E7VA 3H2LA 3A3PB 1HR0J 4ZLJA 4M5LA 2R7UA 1W7WA 2BXJA 1IR0A 1KQGB 3BBFA 3BBBA 3E01B 4H4KA 4I0WA 3H8YA 1FF2A 4EO8A 1SBRA 1ZPVA 1S4FA 5IT0A 3M2RA 4PUOB 1HW8A 2WRMA 3EVOA 2QA4G 4KQZA 1G2EA 1F2GA 4DV0F 4C8ZA 2HYIB 1S79A 3OBIA 2KG0A 1HBUB 1BLUA 5K9FA 3BGLA 2E5HA 4EI2A 5LSLA 5J1PA 2BJ3A 3QSIA 3TO8A 2E44A 4DSEA 1N33J 4CP5A 2HW3A 1O6XA 2J0SD 2V8GA 4JI3F 2HFOA 3NGKA 1HNXF 4PQUA 5E33A 4DUZF 2NPFA 4NPOA 2IPOB 2WOMA 3TJ9A 2KM8B 1X4GA 3AHPA 5RUBA 4KE5A 4IOAQ 3DHXA 4A8FA 2MKYA 3JAMU 4O3NA 3CEDA 3MR5A 2ZHOA 3NBPB 4PYAA 4YR3A 2AYEA 3KLVA 3H4DA 2HVHA 2QLWA 1T9UA 1ZM3A 3DI6B 3DOKA 3MOZA 5T41A 2YNIA 4J9KA 1V3RA 1FEHA 2DNHA 3Q23A 3PX4A 1N8RT 4ZDNA 2BOPA 1VK3A 1D3WA 3LW5C 2IMWP 3F44A 5B0GA 5LM7E 1BC6A 5J2MB 3TZWA 1SL1A 1FRKA 2VH7A 1KOHA 2DHHA 1WHVA 4TLRA 3T9ZA 4X4UA 1HPZB 5LSOA 2CJKA 5CH7B 2SXLA 4FN5A 1FEEA 4OI1A 4B9VA 5L1KA 4C3KA 1ZTWA 1W2BR 2EG1A 3FQKA 3SDEA 3BJYA 2HPUA 3W2WA 4IRDA 1XNQJ 3QRRA 1RAHB 2BVZA 3MEGB 4EUVA 2CWKA 3NWRA 4EBDA 3KMQA 2HK3A 4P9SA 2ZH4A 1TP7A 4IFYB 4NLSA 1M5KC 3VR1A 1VBKA 3LO3A 2A6OA 2DO4A 2PEBA 3C16A 1VS3A 2Z58B 3IFEA 1DLOA 4ANDA 1F5AA 4NCAA 3SSQA 1TVRB 5IXUA 3O5TB 3Q8PB 1VQOS 1XC9A 4PABA 4H4MA 5D77A 4PWDB 1GNKA 3UE2A 5D6GA 2CQHA 3LWLA 1HBUA 2QMWA 4OHVA 1HWUA 3HFKA 2CNLB 4CM0A 5KOXA 2ALZA 5CQGA 4YB7A 2RSQA 1QUPA 1U24A 2W1BA 3GR1A 3M32A 3QIPA 4HEA9 4PQAA 1IBLF 3R5DA 4LSLA 4P7VA 5GAEU 4WPAA 1RE1B 3M8WA 2HG4A 4ZVFA 3M32B 1LFPA 3PVXA 4PZVA 4LF1A 4BWMA 5A76A 2ZC4A 3UDLA 2HWHA 1DTQB 1NH7A 3K89A 1WF1A 2ZZNA 1JLFB 5KFNA 2MKHA 3BKUA 1YITS 4NASA 1JLGA 1RACB 4WFBQ 2AV5A 1IBKJ 3LGMA 5HATA 1TAQA 3MM8B 1TV6A 1YRTA 2J8SA 1S5ZA 3HJVA 1YHQS 1AROP 3CJSA 3ZZUA 2FDNA 2XCPA 5E3PA 1MG7A 1VQKS 2HVIA 4K5SA 1SIWB 2AJFE 3CCES 4QR0A 1IBKF 4TY8A 2V2ZA 2F4VF 1MWQA 3SXLA 1UPMB 3DRPA 4XPEA 3Q2SC 1N5YB 3AB4B 3JSBA 2R7TA 2XLIA 1N36F 3K58A 1F1BB 1KHVA 3THVA 2AU0A 3TUZC 2UXBF 4I6WA 1RT6B 5F0UA 3TZZA 3MM7A 3M8YA 3QYYA 1NSKL 2L9DA 3HVWA 3N6LA 1ZH5A 2KVQE 2W4CA 3MD3A 3ETMA 4O0NA 2W01A 4DPXA 1AYEA 3E8OA 2HFVA 1HWKA 4QQBA 3HVAA 4DPUA 3VCDA 2B56A 3OJUA 3QNWB 3K7RA 3KNGA 4Y2IA 2LECA 2R8IA 3VAGA 1GTHA 3NGRA 1WWHA 4PG6A 2HURA 2HSEB 1SB6A 3K8VA 4DX8H 3GIJA 2ABYA 3CJ3A 1C1CB 5BR8J 4HL9A 4ID5B 4KH1B 2EC0A 3KLIB 4KT0C 1RWNB 2YX7A 5JVHQ 3PKMA 1JWWA 5SZTA 3AA9A 3TAPA 1VRTB 4WKRA 3DM2A 3RRGA 4NMLA 3M2UB 1G1XA 3BEGB 3PX6A 3ZFVA 1VYAA 3Q8YA 1FDNA 2YQ0A 2M4MA 3QO9B 1A7GE 4OHWA 7AT1B 1RTJB 5AXNA 2NZ4A 2J9CA 2V4JA 5KOWA 1C0TA 1TFWA 5F8JA 1JLBA 3MUMP 2IHR1 4N8NA 3DFEA 2B7CB 2BDPA 1IXKA 2LQ9A 1FDBA 4OIXA 2BQ3A 3G9CA 2ZWOA 2ZD1A 4PAAA 2YX4A 2QX0A 2BM0A 3RW7A 1UZDA 2GAHC 3MURP 1K0TA 1B0VA 4OV6A 1CJKB 5EN1A 1FJ7A 3W5YA 3JQJA 2ZWPA 5KFLA 4HH0A 5KFKA 2E66A 5E3CA 1S57A 1X4DA 1CC7A 3CD6S 2NPIA 1L3VA 4K4UA 2HBQB 1XWLA 1U8WA 5L1LA 2M5YA 2Z0GA 2G1DA 2EFVA 4HACA 1QE1A 4BHQA 3OFGA 3PRDA 1Q95G 3IBWA 2OPSB 4M5HA 4M5MA 4ZCIA 4B02A 2OSQA 5H9EJ 1OY8A 4DX6A 5D4PA 4FBTA 2HBZB 1OQ3A 1U02A 1RISA 2JNJA 2GGPA 2VPZB 3IP0A 5D4OA 2KB2A 5BJRA 1XR6A 2CQ1A 2V6AA 2MGZB 3LGNA 2WB1D 4KIAA 5THWA 3TJAA 5B7WA 3OFEA 2EFQA 2HNDA 2CVEA 2GJIA 1S12A 1RCXB 1RBLA 3DYAB 1S9EA 3N6NA 3O44A 4TLQA 4W98A 3CF5Q 1GK8A 2GMJA 3M9NB 3V6DB 3QJPA 3DOLA 3E2EA 1CBKA 3DNCA 3SSRA 4LR7A 1KSPA 2HFZA 4HYKA 2RQCA 2KRBA 3I9V9 2XYGB 3SCJE 5BXIA 5IWAJ 4DN0A 3H7HB 2E5LF 1U47A 5CABA 3IGVA 4ECZA 4QIVA 2OKQA 1S1VB 4JI7J 4OYOA 1FE4A 4RL1A 4W4MA 3CCVS 3NLCA 5HJXA 2W2PP 3QZ7A 2HNYB 2RIJA 5B0CA 4B3SF 2YNHA 1RA6A 1R8AA 2PT0A 3OLAA 3RR8A 2QLFB 2GVDB 5CD4H 1Q5YA 1YJVA 2OPQA 4WCEQ 3RBDA 4A4JA 2ADCA 4JI2J 3CVKA 2ZFHA 4K59A 4DFMA 4M94A 1Y5IB 4DSFA 2WSEC 2YKMA 2RNEA 1LWEA 3LPYA 5F8MA 4A8YA 2XS5A 3AH6A 1RLCL 4NLVA 1S9GB 1NJXA 3PY8A 1RAAB 4OQJA 5DGBA 2C2MB 4WP8A 5A8KB 4DG1B 2BJEA 1AUSL 2K3KA 3T1HJ 3EM1A 3MZIA 2HBYB 2BRKA 2NSBA 1URNA 2Z2ZA 5ETRA 1UP1A 3NS7B 5B0BA 3N28A 3K57A 4P73A 4RWXA 3IAS9 4ZLLA 3H2UB 5C25A 1PYSB 3L7UA 2DY9A 2IM0A 3K5LA 2Z2MA 2R2SA 2JVOA 2X1FA 2ZVIA 4J9PA 2RH3A 1YTYA 2MZQA 3J81Y 5L9NA 4RNHA 3G6XA 2E5LJ 4LSNA 4URGA 5I42B 4RNNA 1P1TA 2CIMA 2PMWA 2XG8A 1N6QA 1FJGJ 3HX9A 4FPIA 2LDIA 1FNOA 2JLFA 2RQ4A 2V8VA 5D3GB 3NP5A 2C28A 2V0NA 5A8RA 5C42B 1N0VC 2B6AA 5DLFA 5KT3A 5CCMA 1RAJA 3SDEB 3I82A 1RT4B 3QLHA 3PXGa 4ZN1A 5HMXA 1VR6A 2LQJA 4LF9J 4IG0A 3I4HX 2VPWB 2MQMA 2APOA 2YQ3A 4EZ9A 1IJEB 3V6KA 2LCWA 2AHOB 4O23A 1U0HB 4XTTA 1VC5A 1S0NA 1RAEB 1MW7A 4DV6J 4Q8EA 2QV6A 2FLPA 1I94J 2VA3A 3HVRA 2AZ1A 2HK2A 1ZBTA 3TEHB 3H0PA 1BD6A 2IRXA 3FEZA 2MPUA 2W2MP 4OYPA 4OX6A 1R0BG 4C9DA 4DV6F 3MM6A 1NK9A 1SJ4P 3KG4A 2XSJB 2YKPA 2EFNA 1KKHA 1LK7A 2MTLA 2HQGA 5JVGQ 3BSAA 1Y7PA 3BBCA 3VALA 5GADU 4NLGA 3MM6B 1N32F 2V8PA 3T6BA 4O44B 2U2FA 3RW6A 2QIFA 1VBZA 1SQGA 1TKXB 2R7QA 2MQQA 3HZGA 4ZITA 1A6LA 3BKTA 4OYMA 4C7QA 4W92B 3I0SB 1QVFR 2DY1A 4Q2LA 4TU8A 3WDOA 4OI6A 4OJGA 3R7NB 2VF3A 1RWMB 3G8SA 2GS8A 3SZ2A 2E1AA 3CJRA 2HRUA 3T3FA 1FRXA 1XNRJ 2VG5A 3TUJC 1SH3A 3G8TA 3RAMA 2QLBB 4QYZJ 1HKAA 2GHVC 2XS7A 1T9WA 3GYGA 4TY8B 1UPPA 1JK9B 1HNVA 1B0TA 4EFAC 3RB3A 2G9OA 2M9KA 1ELOA 3US5A 2OFHX 3CDAA 1XK8A 1SJ3P 1YJ7A 3I4PA 2AWZA 4K5RA 4JI8J 2POKA 4N56A 4LF4J 4XDDA 4C6AA 1BY9A 1UEUA 4TU9A 4A8WA 4WK3A 5DO2A 2CJAA 4ECQA 1TK8A 4DL0C 2M88A 3IXQA 2XC9A 4FYDA 5F8IA 2C2ZB 1K44A 1SV5B 2K3IA 4MIWA 3T5JA 2RDIA 2EKYA 4CLTA 3DGPB 2R7RA 3PW2A 3EMTA 3NL0A 1N34J 1T9TA 3D4JA 3TQ1A 3LP2A 4H4MB 1QY7A 1WC3A 4DPOA 3CCWA 3IG1B 4U7CA 4DV5F 4ED7A 3KJVA 4WBFA 3QSYB 2EKNA 3TA0A 2GNKA 3X1LB 4FYXB 4R0EA 5K14B 3EE3A 1S6PB 2GAGC 4ECUA 2FIUA 3S1TA 4YQWA 3H5XA 3M2UA 1CG2A 2MZRA 3QFHA 3RGIA 2KHDA 3KJVB 2CQ3A 1YBAA 3BN7A 4ZVGA 2G0IA 3TYTA 2W9CA 3K8WA 3MEEA 4DL5A 3D68A 1U7LA 2B4OA 3MM8A 3EVWA 1QTNB 2EXUA 4CO1A 2VODA 5GAHI 3Q24A 3QT6A 1UVNA 2BKNA 1E6YB 2DNLA 1U1LA 3GIMA 4YUDA 3AXKA 4X4OA 1JLFA 3RZAA 3VQTA 1ACMB 1TR0A 4ZLNA 4HVZA 2P2CB 3UVJB 5K8NA 1TK0A 2E1RA 2GO9A 4C11B 4DR3J 2XY5A 1SL2A 2DR8A 2V9WA 2V8DA 2CDRB 1J27A 2BW2A 1WNEA 4J9VA 2DRDA 1YJRA 7FDRA 3G6VA 3SBMA 3WX4A 2QA4S 3D6MB 3UVJA 1WDDA 3ZXWA 1EHWA 3IMQJ 1HWLA 3JTPA 1NDPA 3MAAA 1DHMA 3IWXA 3GTYX 4PXDA 5KFUA 4OYBA 2OEJA 1H6KX 2LEPA 4TKTA 2HGNA 4OI2A 4B08A 2W7OA 4KHPF 1SUQB 4I68A 4BCAA 1DQAA 4QIEA 4DV2J 2NUUG 5KG5A 5K8MA 2ZC3A 3BSCA 3BKFA 2NXEA 1X0PA 4IQMA 1FJCA 3C2PA 4N76A 4DL6A 2NCKL 4USKA 5DM6Q 2PSZA 3PR5B 4P74A 5J2PA 1FVQA 2K7JA 1KQSR 3EDRB 2BM1A 2IJRA 4LSLB 2AGPA 5DDPC 2RQKA 2I1RA 2LQBA 4MYUA 4F36A 2OUGA 3DOMA 3JYTA 4Z2XA 2EG2A 3QT5A 5T14A 3F56A 3K2YA 3M4XA 5DETA 4PG7A 3G96A 3ZZYA 1YG0A 3CCJS 2FJDB 1VQ8S 2V67A 1E6VA 3KLGA 1NK8A 4YP3A 2MKJA 2QYCA 2BR0A 1T03B 2HLUA 4ZA1A 1O0PA 3PYDA 1JXLA 2DGTA 4CLPA 1KTQA 2BKPA 4WIQA 2FZGB 5HQMA 2YNHB 2DGSA 4LF5F 2KG1A 4EGLA 5BYSA 3W9IA 2OO4A 2FGCA 1SC6A 1YWXA 3Q8UA 4RNMA 1WACA 5F3ZA 3AD7C 2XLJA 1N32J 3QFWA 2XB2D 4PXEA 1HYSA 5CYMB 5BYRA 2ZH3A 3VAKA 4ZVHA 2EFOA 3IM8A 3PYGA 4NZ6A 2R2TA 1IKVB 3EPGA 3GZ7A 1S76D 4N77A 2XMTA 2JVRA 4G1QA 4DXLA 4DBQA 4FF2A 4IOBA 1FRJA 4B3TJ 4DCOB 3RBEA 3DCAA 3R5JB 4ELVA 3T1YJ 2KHCA 2XMAA 3PHTA 3M8QB 1HWJA 4DV4J 2F4VJ 5L1IA 3MEKA 2R7VA 4ZPAA 2A0FB 4LFAF 4K2XA 3GJQB 2MQOA 4HACB 1UA0A 3E51A 2V63A 4I4BA 4ZCKA 3GJSB 1VCTA 2XWYA 2RAQA 3TX0A 3T1YF 2HFSA 1NKCA 1JMTA 3J7A1 2C3PA 1W26A 3VAFA 1JB0C 3W61A 3JSYA 3B54A 1N88A 4DZ6A 4LR8A 2X1BA 1NEEA 3HKZD 5J1NA 2UUBF 4KO0B 5EUHA 1PAEX 2IBOA 2V5HG 3S7RA 1HQEA 1PG5B 1VRQC 2H5IB 2NSCA 3DLGB 5HBMA 1CS4B 3T19A 3UI3A 5A2QU 4F4WA 1ZYQA 2R8JA 4ECTA 1QAXA 4IG3A 3TAQA 4OX9F 3MTJA 3L4BC 2DHAA 5CD4A 3MCNA 4HR2A 5EWFA 4ANCA 2UU9F 1U0HA 2IVMA 4RNFA 1WSRA 3M8PB 4K4ZA 3AJDA 4F3MA 1FTCA 4I56A 2AJ4A 1S9GA 4X4VA 2VFVA 1KVKA 2IYIA 3HHLC 1YBUA 2ZH2A 2Z56B 3V6HA 4MK9A 4OI3A 1Z4UA 1SIZA 2ZITA 1U2RA 3VGVA 4HTIA 4CH7A 2QC3A 4F0MA 4LFBJ 1TUGB 4F7VA 2H4WB 3AFGA 5M2UA 3MMBB 3CD7A 3RB4A 3PIOQ 2MLZA 2EK1A 4OMFG 4UOFA 3ELHA 3R97A 4ES1A 4DV5J 4DSLA 1V3ZA 6FDRA 3KG0A 1N5SA 1NAQA 2FY8A 3QBCA 4JOUA 4U9RA 4Y34A 4CH0S 3TI0A 4CO5A 1VFJA 4H4OA 4NLYA 3V2UC 1DFDA 1H2VZ 2GIFA 1TL3A 3BV8A 3M2VB 4KKOA 4DR6J 1JNRB 3R6GB 3NS6A 4M5KA 1LOUA 2RF2B 4OZ0A 5ETTA 2M3DA 4J37A 2RVJA 5C42A 3OVSA 3GIKA 2VG6A 2COLA 2DNNA 4ZMMA 4C0OC 3OXLA 5EWGA 3DYAA 3OW2R 1W2IA 3CE8A 2BUNA 3LWMA 4USWA 1VOMA 4IDKA 2KT2A 2P9EA 4YEAA 4O3PA 1N6QB 1FKAF 2N4CA 2J7KA 4K4TA 3EICA 1FHTA 5HI7A 5H9FJ 1TKZA 3PFOA 2OELA 2V8HA 4PG5A 2HAFA 5MAOA 4OLPA 3SI8A 1NJWA 2DYAA 4MK8A 3NCRA 3OHAA 1QAYA 2AJ1A 1DLOB 4JI3J 4XIUA 4BDPA 1Y00A 1UCNA 2EW9A 4A8KA 5D0GA 2ZOMA 1YRUA 5LJ3Y 4YDDB 4QWCA 4LMZA 1WJ9A 4A8OA 5G0RA 2GQQA 3DU5A 1U2CA 2EK6A 1D9AA 1PJ7A 1LEOA 1VK8A 3O8WA 4CLYA 3CC7S 1KC8T 3C6TA 2O1PA 1NLKL 1S59A 3I31A 1HNZF 1EARA 3VGTA 5BYQA 5HMWA 2YKOA 4TVAB 5FJ4A 2NREA 2ZOFA 3JSMA 4B3OA 2DXDA 3KHLA 3CUNA 2B43A 3KK3A 4ALZA 3DLHA 4GO5X 2C2OB 4ZS6A 2UUAF 3M7VA 5K8PA 2P9CA 5HMYA 2UP1A 4OL8A 1RWVB 2UV8A 2NZCA 1DRZA 1HARA 3OR2A 2HEKA 1NM2A 2R7SA 3GV8B 3ONQA 1MMNA 2J7UA 3P6YC 3T9NA 2ASDA 2OLWA 4J9SA 1PILA 1FA0A 4CO2A 1S6QA 1T9YA 1Y4ZB 2JWNA 1PJ5A 1MROB 3FGVA 3I5BA 4QW8A 1RADB 1RAGB 3OD2A 4F4ZA 1U1KA 4R8UA 2FY1A 2BJ9A 1MWZA 3CTRA 3Q86A 1F3FA 3UD3P 1DARA 3FSXA 2LEBA 2Q3PA 2H5JB 5LOQA 1GX5A 5HROB 2XGQA 4ER8A 2JRSA 3HULA 4DL3A 4O3SA 1G7CB 2MB0B 2WONA 2MZ1A 1S49A 4RWWA 4ZP9A 4F04B 2PE8A 3OL7A 5KFQA 3CCUS 2NS1B 5LL6d 1RHMB 3TJ8A 3SSSA 3AB2B 1UAWA 2GCFA 3LALA 2YVSA 2IJNA 1GXLA 4AT1B 2O3DA 2C3OA 2BQRA 4OX7A 5GAGU 5E7OB 4LF9F 4F25A 4NRTA 1HI8A 3KLIA 1FXDA 4OFZA 3EPIA 4CI0B 2RMLA 2HWTA 4DUYF 2OI2A 2ZH9A 1NXIA 2BW7A 1LW2A 1C4CA 2QFIA 4TY9A 2ZUAA 1GMWD 3QQCD 3U1LA 4CO0A 2E5JA 3FCWA 4DU7A 1CQMA 1RI7A 3SV4A 3CJ8A 3HP6A 1T9VA 1J5EJ 1EAYC 2F4FA 3RRHA 3ZTRA 1EP4B 4RBUA 3NRBA 4ED2A 1WF2A 1VMBA 3JTNA 4UZCA 5SUHA 1Q8IA 2W9CB 2BBEA 5KFYA 2LLZA 3FFIA 1X8DA 1HQUA 9ATCB 2FJBB 4DPYA 2KZMA 1LXJA 4JV5J 1TL1B 1YRXA 1E6YA 3GB0A 4CH1A 3Q22A 2PI4A 4JI0J 2F40A 4P71A 2HS4A 4AXJA 2XMUA 3K5NA 4W90B 2A1BA 1YLXA 1VJQA 2MKCA 4LR9A 4DLEA 1OYDA 2KN4A 3GCWP 1X0FA 2UUCJ 2Z8QA 4QU6A 4ZJQA 3H4BA 5EGYA 1MU2A 3SQGA 2CQ2A 3WBZA 2XI3A 2B51A 4USUA 1QAIA 2V68A 3FUYA 1B4SA 3O1LA 4RBTA 2BANB 2VFTA 3I32A 3GQCA 2EVZA 2LXIA 3CO0P 3GMGA 2DISA 3UR0A 1YDLA 3AQOA 1S1XA 1VIXA 2LEAA 4B9UA 3PJWA 3PW0A 1VRUB 3JYTB 4PXBA 1Y5NB 1BXNA 3SCLE 1HWIA 1RXOB 2KXFA 4CLKA 4H4KC 1S9EB 4X64J 3DDIA 2AW0A 3AOAA 4TQRA 1TKDA 2WW8A 3PX0A 3I0RA 4DQQA 1LW2B 2YQ1A 1IM6A 3W60A 2RRBA 1RTJA 1S6PA 2HZAA 5DG8A 3RB0A 1VQ4S 3OVAA 3DC2A 1B64A 4P75A 4I69A 4WU2A 1CJVA 1IVZA 3H20A 1S1UA 1YBTA 4U67Q 3KK1B 4H54A 3FRZA 1MNEA 5L8RC 1DTQA 3L9ZA 4OZLA 1X4EA 2YWEA 3G82A 8AT1B 3NNCA 4J9MA 2OEMA 3H98A 2ZJPQ 3CJ0A 4U8YA 3P5TL 1LWFA 1UETA 2HHVA 4G1PA 2GA7A 2PA3A 1AZSA 1NMEB 1S6OA 2DEIA 3CSKA 4MK7A 3OXFA 4IRCA 4PKDB 3IS9A 3EGVA 1HLWA 4B17A 4PXCA 3NNHA 2JH3A 3FEYB 3HHKA 1ZA2B 5F41A 1LWFB 1IBMJ 3OTEA 3PW5A 1PCAA 1X4CA 4FDFA 2V9KA 2VL1A 1K1SA 3PM9A 5CZXA 4ZPWR 3N9UC 4F0KA 4CLUA 3WC2A 4DR2J 1TELA 1KHWA 2CKWA 5FIIA 4B9LA 5B0DA 5HLFA 1RT6A 3DRYA 1U45A 4LF8F 4CTAA 2VA2A 1D9DA 3O2IA 3W2VA 4F2RA 1GAOA 1SJQA 4MAKA 2XMJA 4UOCA 1HA1A 1H73A 1R8CA 2QSWA 4FZVA 3OFHA 3GJTB 2BZ2A 5CYQB 4YN3B 2ACYA 3AT1B 3JAMY 5AE3A 4ELUA 4FF4A 1RP5A 3LTOA 3TVKA 2XM3A 1DBDA 1EX8A 2DJWA 2L08A 3D66A 3ISND 2HAIA 1R8HA 4LSZB 5F0WA 1KQKA 4JI2F 1KFDA 1FXRA 1GXTA 4OZ3A 3TP2A 2A18A 3C19A 2AYMA 3NEKA 2OTLS 4DMZA 1VBYA 1HBMA 1VQLS 2X51A 4YY3J 1TKTB 5M2RA 2FGOA 3NCQA 3TAMA 1FKOA 2DGUA 4ZK7M 4HTJA 1ZM9A 4AD6A 3A8IA 1NPKA 3EXCX 2DIUA 1E6VB 3MEDB 3MM5B 2IAJA 4PWUA 1WEYA 3P8BB 2NUHA 3QO9A 2QT7A 3EJMA 2DGOA 4NRUA 2C3YA 3KLEA 3RR7A 2ZJRQ 3BDEA 5LT5A 3MD1A 4GVLA 3HHLA 1AZSB 4ZCLA 2DRAA 1RUSA 3N5BA 3OTCA 4ED4A 2WSFC 3VAMA 5DQHA 2FJVA 1RWKB 2DNOA 5KFEA 2QE5A 2OPRA 2ZH7A 3R2CJ 2BRLA 4USJC 1AFJA 1T8EA 1X60A 4Z7YA 2VPYB 6AT1B 4WFAQ 3RTVA 3EGZA 5E0OA 1T11A 1WF0A 2LP4A 3OT9A 3NKYA 2UU9J 2GHPA 1QJHA 1S1TA 1VDHA 2MZTA 2C2NA 4GKJF 3NAIA 1GMVA 2ZVSA 1EETA 2IM2A 2KXHA 2CFXA 1H2UX 2YNGB 3ETOA 3TOQA 2ALYB 2ZHAA 5LMUJ 3I87A 1XTZA 3HD1A 1LW0A 4P72A 2FVQA 2KVIA 2YNIB 3DRSA 3SIPB 4AL5A 1BQMB 2Z30B 4F4AA 2JEGA 4OHZA 2AYBA 4O4GA 1BE4A 1R0CB 3M6UA 5AT1B 1S0OA 3LUYA 4Q2MA 4GRSA 5HVGA 2B6AB 4ATNA 3AD9C 4KAIA 5KTQA 2XCAA 2FVSA 2UXBJ 3W8GA 2L48A 2UUCF 4TYAA 1S6QB 1T7PA 4C8MA 3LP1B 3NAHA 5AJ3F 2PFFB 2UUWA 3POTB 1UJ6A 2ZE2A 1YJTA 3HHEA 2CZVC 4OZJA 2HHQA 3MEGA 7FD1A 1GX6A 5KFMA 3T5KA 3CT9A 3W5XA 5J2NA 1GEHA 1FWPA 4URSA 1RBAA 3HSGA 3C16B 2WONB 4FXDA 3SCKE 2OPQB 2Y0SD 3ZC4A 1NK4A 1KN6A 2CJQA 1TL4A 2MKKA 2GV1A 2I5JA 4NX9A 3H90A 4J91A 4DR4J 2KJWA 2FVPA 3MPDA 3P45B 2D74B 3NGTA 2DGXA 2QMXA 1KS2A 4KHMA 1RKJA 1C2PA 4HI2A 5HP1A 3HSDA 4ZP7A 1OY6A 3BYPA 3HDSA 4PQUB 1VGYA 1ZAVA 3MUVP 2W9BB 2PMHA 3CJ2A 2CZ4A 4ETXA 3EXYA 3MMAA 2XI2A 4TXSA 2FB0A 4MKVA 5C25B 5AJ3J 2WW4A 4LREA 5C24A 5AXMA 2XY7A 1X9WA 1T05B 4DEZA 1FDAA 4XAKA 4JI5F 1NHKL 5DGAA 1WOOA 3OFFA 1URRA 3LF0A 3BYRA 5C24B 3BGRB 3CB4A 5GVQA 3RUBL 3BSOA 1FVSA 1QSYA 1OWXA 4DR6F 2BJ8A 4WYLA 3POTA 2PGCA 3HMJG 1R0AB 2UVVA 4USVA 3DRPB 4NMXA 3GFYA 4QOTA 4ILMA 2DNMA 2F9DA 3BREA 3CD0A 3FKBA 1J5OB 3MFIA 5EX0A 5KFGA 5JUMA 4C48A 1U6BA 1F9FA 1H72C 3L7OA 3TA1A 4PWDA 1R8BA 4FYYB 1K47A 5KG6A 2FJEB 3VGSA 2WB4A 2R2UA 1N5TA 2CUYA 2V69A 5A0YB 4M5IA 1WKKA 2IVYA 2J9DA 5C2GA 3EX7B 1NDCA 3UD5A 4F4XA 3BR9A 2YWGA 4NI2A 1NUEA 1ZS6A 3AD8C 1Q82T 3U1NA 3UW1A 2G2OA 2K1RA 1CJUA 1AT1B 3EZUA 4N7TA 1FFGB 1N5VA 2RD5C 3HT0A 1JIHA 3RRKA 2XSFA 4I2PB 3WIUA 4F67A 4ED6A 1FJEB 4OYIA 4R0JA 1CJUB 3KFWX 4QIFA 1EKRA 4JYAF 3JQMA 1YJ9S 2UUTA 5HJYA 1L5UA 3DM2B 3RB6A 4LF5J 3B82A 3QIPB 3GG1A 2AGOA 4EU0A 3KUEA 2PC6A 1RU1A 2P8IA 5J2QB 1OYEA 3P3DA 2E7WA 3S01A 1JJHA 3PJXA 1D0EA 4NCGB 2QG9B 1N56A 1HL6A 4WZQA 2LYVA 5KFCA 4A8QA 4Q0BA 2E5IA 2AEFA 1JJ2R 2JEFA 3SFGA 3CJTA 4HHHA 3M9OB 2LKZA 3NXZA 4OYZA 3IWLA 3LH2S 2I9SA 4USTA 1SKSA 2FYXA 4Y3CA 2GZOA 4B9TA 2VKRA 1XIQA 1IJFB 3HO1A 4DR1J 1GMWA 2W7AA 2BE9B 4QWAA 2CQGA 4LUBA 2K8GA 4RNOA 3QJJA 4ZPTR 2JFKA 2QRRA 3I9ZA 2B9EA 2AYGA 5E5NA 3MDFA 3A8EA 1YJNS 4X65J 3QRQA 1REVA 2CJYB 4IQXA 1RT5B 4JYAJ 3ZZ0A 3CCZA 4CZCA 3FDSA 3I6PA 4ED0A 2MQPA 4B9MA 2GJ2A 3QJLA 2KFZA 4X2BA 5DDRC 2YH0A 2KT3A 4LFAJ 1ZZFA 2GMLA 2V34A 3CNQP 1S1UB 4K4VA 4USIA 3J80Y 2AT1B 3KLFB 4DV4F 2B9WA 3CCTA 5E3AA 2MKIA 4IKAA 1U49A 3VVTA 3CCSS 3LANA 1RA7A 2D3UA 2JDJA 3CO9A 2CG8A 3HF5A 3PCOB 4KFBB 5ETLA 4WTOB 3J7Z5 3IN5A 3KHHA 5KT5A 2K06A 3D54A 3M6VA 1XN9A 3FRYA 4NLRA 2FC8A 3A3OB 4L3KA 2ZD1B 2HBRB 1XQIA 2GVZB 1DURA 1NB7A 1RWXB 2CNOB 2GX8A 3PZPA 4NLDA 2DR7A 2FLNA 3QZ8A 3DXSX 4OX9J 2BX6A 5KG7A 4DF4A 2NYHA 1VI7A 1V9OA 2DR6A 2Y1RI 4ITSA 1Y0HA 4KYZA 4AE5A 2NLWA 3CDEA 2CXEA 1ZPWX 4CLLA 2F5GA 3U7JA 2DGWA 5ETVA 1HHTP 1OSCA 3MXHP 3MI7X 1N5YA 3ITHB 2DD8S 3VGUA 2N82B 2HGMA 2RHQB 3RBZA 5KFAA 1HYSB 4ED5A 1QE1B 1WEXA 2DNPA 3L7PA 2IFXA 4P7TA 4RR5A 3KLHA 4PR6A 3V4IB 1VQNS 3DMJA 1HD1A 4NOHA 1XR7A 2ILYA 2MSSA 2R7XA 3CC2S 3LAMA 2WBRA 2PFDA 4OJ1A 5D4LA 3OSPA 4N41A 3SEOA 4NLOA 4UOHA 2ZH6A 1VJWA 2BANA 1TMJA 1U0SA 2HNDB 5C5JA 3NMAA 2E5GA 5I3PA 4DQSA 1VLOA 4MFBA 1GTEA 3FZ2A 4O4GB 1HBMB 1REGX 1UJ5A 5J2PB 1Q4RA 2PA8D 4M1KA 4RW9B 2B7BB 1FWLA 1JJ4A 1FKOB 4OZ1A 1R8PA 1UZHA 3DRRB 4CCHA 3C3LA 3J7YU 4EYIB 3DKDA 4DR5F 1L3KA 3ZTOA 2A6MA 2OD4A 5GMDA 1BQNA 3B6BA 2XNQA 4DI6A 2CPZA 5A8WA 4MKYA 3NG8A 4YB6A 1RWWB 1WD6A 2HNYA 1U1MA 2XWXA 5KG0A 3BPSP 2DKOB 3HPOA 4Y2MA 4PG8A 4ED3A 1RAOA 5DS7A 4NLQA 4ECRA 4J9UE 4C3MA 4BS2A 2ASYA 1GT8A 2KT5A 4J7CA 1FERA 2HVEA 3MM5A 5FDLA 2X7IA 1WKJA 2QYGA 3D28A 3OR1A 5JXSA 4CIOA 2VUGA 3I5AA 4CLZA 2D1CA 1DZ5A 2VU5A 1DY3A 2A3JA 1UKUA 2I6WA 3G86A 3TZYA 1HBOA 5L38A 3KOAA 2O5DA 3ZO7A 2VQFJ 2R8HA 2W2NP 2ZDOA 4PUOA 2P9GA 2ZBRA 1NO8A 3Q2TC 5DZ6A 1TQLA 4IO1A 3UN3A 1YX2A 1UEVA 3ZZOA 4DV0J 2DGVA 3QPIA 3FBEA 1N5QA 4XK8C 3VZIA 3MMJA 3AODA 2KFNA 2FHJD 1SI9A 2HQFA 1O51A 3GJRB 1LW0B 4RW7A 2FLLA 2VC1A 4KKOB 4ZOSA 2XYHB 4O44A 3ZNJ1 1BGXT 1NPRA 3RU0A 4ZIVA 1J2VA 4RUBA 1MMLA 4WFZA 2FD2A 3T6JA 3HVTA 3DI6A 3G6YA 2FLOA 3I5CA 2LA6A 1B3TA 3UCGA 1JJCB 4BLGA 1M5PC 1IN0A 3OTDA 2DPIA 1XMOF 2HHHJ 3HJFA 4X4SA 1S9FA 4CNZA 3TUPA 2W25A 4Z37A 1U4BA 2DNGA 1WI6A 2E29A 4RW9A 3L95X 2HHUA 2MYFA 1F5BA 3DRRA 3LOUA 3AJ2A 1NKEA 4QR1A 2KRRA 4CLSA 2E1PA 1RABB 2UUAJ 1LK5A 2NQPA 4ECSA 3DHWC 2XLKA 2MZJA 3OUYA 2IDEA 1DTTB 1MMDA 1JXVA 2A10A 2BV3A 2JOQA 4ZN3A 2RU3A 3EWGA 4Q45A 4QWEA 3OTOJ 2UV8G 3PNIA 3NS5A 5I4MA 2FQQB 2WVDA 1OQ6A 2QL7B 2MZSA 1L3UA 1X4BA 4ZVRB 1HFEL 2M8HA 2C42A 5D78A 5G4DA 3WIVA 2G4BA 1AFIA 1O8BA 2XSJA 3PR4A 3E3XA 2DH7A 1S97A 1F0XA 2GJFA 1WDTA 3D6HB 4OHXA 1FX4A 5HP1B 2ROPA 1NZAA 4LFCF 1YVFA 2H4YB 2J9EA 4U7UK 3UR3C 2BJ1A 1H7XA 5LMUF 4UY8T 4A46A 3BH6B 4DX7A 2H5EA 2BJDA 2I5JB 4UF4A 4MJKA 1KLMA 1JQGA 1T3OA 4LF2A 1U8SA 2B9YA 2PIIA 3CJKA 2V2KA 1RBOB 2RDJA 3CIMA 4NA3A 3QRPA 1I3OB 5KFDA 2P5VA 2FHOB 3JXOA 4ZJLA 2VQEF 4DQRA 2CQCA 3H2VE 2DRBA 3AOBA 2YWFA 4R25A 2QO3A 3CJKB 3UFCX 3G2XA 4I6YA 4KY3A 3UPFA 1RTDB 1CC8A 3T1HF 1D1UA 1UA1A 1TKXA 1WHWA 2YNFA 3MR6A 2X1GA 4QPTA 5CCLA 4Q0BB 2WHOA 4E98A 1Q81T 3M8ZA 4EO6A 2OPPA 1C4AA 1YI2S 1WTBA 4IYQA 2EI5A 4FPRA 4G65A 1PIEA 4IDKB 4N47A 4FF3A 3DLKB 1SXLA 4C8YA 4ES2A 2Y1LB 1IKYB 3KHGA 5IZHA 4B9NA 2CWXA 2C3MA 2JJ4D 5B0AA 4EYHB 4WF9Q 5IT4A 4U96A 4IG0B 3W64A 1JKHB 2VASA 3TANA 4L73A 4LFCJ 4F3OA 1SKRA 1FDDA 1KNZA 2IBKA 1IWGA 2K1RB 4QW9A 2HRYA 3M2RB 1TUVA 2JZ5A 4MMOA 3UWTA 3ZTPA 3OSNA 4IFYA 4JV2A 2G0CA 1IUJA 1RZMA 2RB7A 3R7BB 3IG1A 1RHQB 2B9XA 2C1EB 2IM3A 2HQ3A 2L41A 1Y11A 3BPDA 3UCUP 4DJBA 5G0RB 1U6ZA 2VQEJ 1Q0NA 4BC9A 4YHHJ 2VIHA 1Q5VA 4J9QA 3MCOA 4KC5A 4LRCA 1IQZA 1RT3A 2DTJA 4LRAA 4J9NA 3N6MA 4DFJA 1FNXH 1M90T 4F2SA 1FKPB 2AKWB 2W24A 2ZEJA 2JC1A 4IH5A 4WWSA 3KJQB 3N0VA 1RU2A 2J0WA 2J9DE 5KT4A 2W8KA 1S72S 1NK7A 5CXTA 1M5OC 1NSAA 3KMSA 4ID8A 3DOKB 1QTMA 3BGUA 4RW8A 3HM9A 2ZKUA 4IO9Q 2V4JB 5KG2A 2ZH8A 5DDOC 1T05A 3DLLQ 2YNFB 2Q66A 2B8QA 2G13A 5IQQA 1KBRA 4BC7A 5J2QA 2O01C 4NWBA 3CJ5A 1RTHA 1V3SA 2YKNA 3ZZTA 1RYSA 1KD1T 3WHIA 2MQNA 4IR9A 1FESA 5GAGI 2R4FA 2QL9B 3IRXB 1M5HA 1IBCB 1SVDA 1WI8A 1LFWA 2A2CA 2CJ9A 2MLYA 4FXWA 4QR2A 4RW4A 4CYUA 5I3UB 1FRMA 1RTHB 3KHRA 1F9EB 2HHPA 3DLKA 5GMEA 3MPUB 1M5SA 1MU2B 2B4VA 1FCAA 3SQGB 3TAMB 3VHQA 3WQPA 1U1QA 5IM0A 1NK0A 1APSA 2GC8A 3P5BP 2WTFA 4U6PA 1NDLA 1JKHA 2DGQA 3QT8A 3VAHA 1P1LA 2CPIA 1YIJS 1FJGF 3LP0A 3MPVA 2VOOA 5A0YA 4TNOA 1OIAA 5KFFA 1X5SA 4ICLB 3MF5A 5J1EA 1QVGR 3EGNA 1F3VA 2Q1LA 4ID5A 2FJAB 4UUXA 1V5IB 1VQYA 5DQGA 3PFEA 3D1QA 5KT7A 1UW9A 5IC6B 4NLPA 1AA1B 4F4YA 1CPZA 1KWMA 3KK2A 1UWBA 2DXFA 3DLJA 4YR0A 1HNZJ 5MLCV 1KLNA 4B3MJ 3H40A 4I2PA 3JB9k 1HMVB 1JLCB 4MT1A 5ETOA 3KK2B 1NNDA 3C8YA 4C0BA 1W25A 4PG4A 1RWUA 5DG7A 4DR5J 3DLEA 3FNNA 3QMQA 1Y10A 3KLFA 1NRKA 3FC9A 4L72B 4QIWD 1S1VA 3PRBA 1F5CA 2OEKA 1X5TA 3OTBA 4IG3B 4RKUC 1JLGB 3HI9A 1H38A 3B4DA 4DCJB 2IA0A 4K8RA 2WBMA 5IV4A 1FO1A 4ZHRB 1U2FA 3B8HA 5IS2A 1EZZB 4OI0A 2DVIA 5D4NA 3CPWR 3S6EA 1NDKA 2PO4A 4WKYA 2VG7B 2XHCA 3ICLA 2BJ7A 2QGFB 4TN2A 4KHPJ 4CNYA 4DV1J 1J5EF 2AX0A 2AEMA 4O3RA 1TK5A 2HFUA 3IS9B 2O66A 1RAFB 2HQCA 4QU7A 2EEYA 3P4UB 4OZNA 4RW7B 3M8QA 3UQSA 1KR4A 2W4DA 2QSFA 1XEZA 3BB5A 2KZZA 1IKVA 4WYWA 4MFBB 3ENQA 1PC4A 2N7YA 4H4OB 4JI0F 3D0IE 3M2VA 4FYVB 5DZ7A 3P49B 1WTFA 2X3GA 3K5PA 4HT7A 2OMOA 5E2QA 2B8PA 2ZJQQ 1SC4B 4KH0B 4A8SA 3D0HE 2CQ0A 2KM8C 1B7FA 2D3ZA 1Y3KA 2VBXA 1RT7A 2DR9A 5B09A 1UVMA 4KO0A 3AXMA 5CHCB 4OJHA 1HHQA 3C15A 2F1FA 3MEDA 3Q89A 4A47A 4C8KA 4TU7A 2ZHBA 2PMZD 5KFJA 4Y0FA 2YKAA 2RUSA 2QA1A 3NY0A 1YQHA 1KEKA 3OUYB 2VONA 3MOJB 3V4MA 2IM1A 3QT7A 5ADZA 1FK9B 1YSJA 3CWJA 4DV7F 2DBBA 4Y2CA 3PJ9A 1T03A 1JXEA 1ROFA 1H74A 3M8PA 4ZVUB 3KYLA 1T9XA 3BQ2A 3QAUA 4QBUA 2GHWA 2DB1A 4KTQA 1RQ0A 4QPXA 4X4NA 1R43A 2Y8WA 1DAXA 2HWIA 4OZ5A 1UFWA 4UTGA 1RT2A 2XBPA 4LVNP 3GYNA 4ZHRA 2HQDA 3ENAA 4IH6A 5K5MA 5IQ6A 1TFYA 5FD1A 1TZ0A 4JI1F 1P8GA 2XZTB 4JP8A 2VDHA 1RWPB 2J8AA 4M5GA 4X4PA 2CZ9A 1AUDA 3V81A 4FNIA 2XTJP 3MM9B 4P2XA 3GFHA 3IBFB 2W8LA 3ZTQA 5KG3A 1ZM4A 2FHKA 2PEHA 4DSJA 4X4QA 2KO1A 4OI4A 1QM9A 3ILJA 2ZDPA 3R1HA 2D3OR 3V5RA 4DQPA 1BQMA 2EBEA 3GV5B 1SH0A 3HKWA 2QTWA 3W9JA 4J90A 1N33F 2F7VA 3O6QA 3M1VB 2RE1A 2XMMA 2I38A 4YOEA 3W5ZA 2KKHA 2YBVA 3ILLA 2GIRA 3K0JA 4ECYA 3GIRA 3HZEA 1UTAA 2MGZA 2HHXA 4N5SA 3RAXA 4DV7J 2IMOA 3IM9A 1R6VA 2DXEA 3DRSB 5KFPA 2P6SA 1T95A 5E41A 4YDXA 1VLYA 1GH8A 3G71S 4K4YA 1HBNA 1HPZA 3ENVA 1ZAWA 4TYBA 1MROA 1JLQA 3LGHA 3KNAA 4RUHA 2UXCJ 4NXNF 2YPYA 5F3TA 5KT2A 2J76E 4Q8FA 1G3OA 3LPEA 5A8WB 1XMOJ 2HHHF 2Q43A 4UQTA 1NHVA 2XQCA 5HK4A 3UN5A 1NHUA 2C3UA 3SCIE 2LU2A 4ZPVR 2Y3YA 4M63A 4PEOA 1ICEB 1I6JA 2DCUB 2UVUA 2RRNA 1MN7A 1VHIA 3IBCB 4GC7A 4DHVA 2KI2A 4XPCA 2V4RA 3FZBA 4FS1A 1QSSA 4QIGA 1WG1A 2MQLA 1RAIB 1JLEA 1NK5A 4RJVA 3M9MB 2Z2LA 3TQEA 4FVCA 1N48A 2W4PA 4N8OA 4O0IA 4NXMJ 3BGOP 1SV5A 4AL6A 1IKXA 4HH1A 2WSCC 5LXYA 5D15A 3C6UA 2U1AA 1Q8KA 2BACA 2NXNA 3KXDA 1U1NA 2M2BA 5A6PA 1DQ9A 3PEJA 2XMVA 3G4SS 3DXBA 5F8LA 2LU1A 3M6XA 2WVCA 3D5MA 5A6WA 2ATCB 2JL9A 1D8ZA 2HNZA 2MY8A 4NZ7A 3UCZP 1C0UA 3MGJA 5C2CA 3HVTB 3Q83A 4DR2F 4XO0A 1CQNA 3MPWA 4OYWA 3GCXP 3D3BJ 4LIRA 1PBAA 1MN9A 1Q16B 2HZCA 3WC0A 3J81j 3D7SB 2E9RX 2CA9A 1U25A 3R5CA 5H1SV 3FFIB 4ZJOA 2WZ1A 2RILA 2VD3A 3BZQA 3R2DJ 4DR1F 3HFZB 4O3QA 1RTDA 4ZVQB 1TL1A 3DDKA 3C14A 4CO3A 2VJUA 4C8NA 3V6JA 1NZ8A 5I3UA 1R6YA 5HROA 1PJ6A 1FE0A 4EMDA 2Q6CA 3VZHA 3MUTP 1G6BA 1M1HA 1RT4A 3H42A 3QLHB 1UL3A 4RPFA 4JV0A 4E8UA 3OQ2A 1RGVA 3ULHA 4IUFA 5HQ8A 1BQXA 2F9JA 4R8UB 4M8LA 1HNVB 2YWKA 1S7IA 1VBXA 4AQYJ 4Z7CA 2Y1IA 3TZXA 2J0QD 2LXFA 2Z57B 2CQPA 3OPKA 3L3CA 2ASJA 4OHYA 2FZCB 5D0RA 1UVKA 4LRFA 1ZM2A 3J7AN 4LBHA 3ZZZA 4USMA 1S1WA 3OHBA 3S8SA 3B4MA 2FVCA 1RT3B 5F9NA 1FI4A 1SH2A 4NYOA 4CM2A 5HN0A 3OTOF 2HHWA 1FKPA 1IR1A 1C1CA 4B3SJ 3NOGA 2FHJA 4CRJA 1N54B 1KP6A 1UEKA 2L9NA 4LVOP 4F0HA 5A2QY 2X1AA 2R8KA 1CVJA 2AJ2A 1CLFA 1RK8A 3CDWA 5KFVA 2WVFA 2RU9A 1Q53A 4O4RA 2CQBA 4J9LA 3JSMB 2DO0A 3W65A 3GILA 5KFRA 1WG5A 5DDQC 2UZAA 1XMQJ 3I56S 1DQ8A 2AEJA 2VFUA 3FMWA 3GP9A 3IR5B 2EPIA 4R5PA 1T02A 3CIZA 2GFFA 3TRGA 3OV7A 4WFNQ 4Y2AA 4KR0B 4GO7X 5HQLA 3ENWA 3M30B 3QIDA 1ULRA 1M1GA 2RDDA 3R7SB 1Z2ZA 4ILRA 1EQ0A 1ZA1B 2OGUA 1TV6B 4DL7A 2MMYA 1SPBP 4KGZB 3CGIA 4CYUB 5DQIA 2HHTA 5HLFB 4JI5J 8ATCB 1Q86T 4OLOA 1VQ6S 1Q1KA 2OHDA 3CMQA 2EBGA 4WK1A 2CPHA 1VC0A 2IVFB 3MFHA 1RLDA 2ZM6F 4YFUA 3D67A 1GMUA 3PO5A 2IDLA 1NKBA 5DM7Q 2KYZA 3IC1A 2R3VA 2Y1JA 5AE2A 2CAJA 2A2DA 3K59A 4IFVA 5KFOA 2D3O1 2G2YA 3GSDA 1X4HA 2XMKA 4WFYA 2BOAA 1KQFB 4P52A 2ASLA 2CPEA 2NYIA 1VC6A 1S0VA 5L39A 3G82B 5T7LA 1RT1A 1LKZA 3RYLA 3GV7B 2VHGA 4K4XA 1ZOTA 2X3DA 2XY6A 2DK2A 1NBEB 2AD9A 1CSJA 1FRIA 2AMCB 5KFIA 3HSZA 2WVEA 3FQLA 3W62A 5T7LB 1VQ7S 2XNRA 3J7YI 4NCGA 4DFKA 3HCXA 4J9RA 4DZDA 1RYRA 3KLGB 1RHUB 1RT2B 3BGFA 2BE7D 3TUIC 3V6DA 1SJFA 2YKNB 3FK4A 2DHXA 4C11A 3Q8SB 2C2DA 4DV3F 1S77D 2JC0A 1X7VA 3D6TB 4RW4B 4G1QB 2WCXA 5DLGA 2B0GA 2ACMA 2V2VA 4BBYA 5KAKA 4ZPCA 1UVIA 3GYXB 5KFSA 2CDQA 1RB0A 4YB1P 2HVZA 4ANEA 2OPSA 4Y00A 3VQSA 1UVJA 1B7YB 2XO7A 2FVRA 2CPJA 3AOCA 3FEXB 5H9FK 3ITHA 3IWNC 5E3QA 2H51B 2M7SA 5HVFA 3GWCA 3MCSA 4DR3F 1RT7B 1VIOA 2OP5A 4ICLA 1YZ6A 3D9BA 1RT5A 2DNQA 4JUZA 1H2TZ 3W2VB 5F9LA 2QMUB 5IWAF 1RJJA 2ADBA 4C4WA 5KFZA 2VG6B 1TL7A 5K8OA 1TAUA 2G2ZA 1HHSA 4WE1A 4YR2A 3GG0A 2Y8YA 4FS2A 1F9HA 2IAJB 1HI1A 3IAM9 3CULA 3W9HA 3H5YA 1JNZB 2NXUA 2ZBIA 1ZTTA 4WP3A 2AF6A 1S48A 3F0NA 4KGMA 5AXKA 4X4RA 2Q6BA 2JX2A 5FDLB 2O67A 4X64F 4ECVA 1X5PA 4RU2A 2PD1A 2YWHA 3PO4A 2GVDA 1WKLA 1LWCB 3E01A 3QAEA 1BQNB 2HIQA 4Q7AA 1OPIA 4OYAA 4J9OA 4P2SA 1S99A 2MDAA 2QA2A 3FJ2A 1R3NA 4HT5A 5ITHA 3G8QA 4F26A 4JI4J 2EWHA 2VB6A 5EX3A 2V94A 3OL9A 4RX6A 4EBEA 2VC0A 1U1RA 4FKXA 5EDWA 4V19X 4NYPA 4NA1A 2D69A 4F8RA 2JLEA 1HBOB 1KRPA 3IR6B 2VZ9A 4NZ0A 2VQFF 3H25A 1KLMB 3DMJB 3BO3A 4LF7J 3QGHA 4NLXA 4ENOA 6FD1A 1S1TB 1KVJA 2W7PA 4X84A 4DG1A 3MMAB 4NA2A 4DQIA 1EETB 3SMZA 1Q8BA 1HNWJ 1FD8A 3OXGA 1NSQA 3OL8A 2DNKA 2KYXA 1D8YA 4M95A 2R42A 2AP6A 2UVWA 2ZZMA 4DU8A 1JLQB 2GO8A 2J6UA 2HIYA 3K17A 3N5FA 3PDNA 5F8GA 5IFMA 1X5OA 2ZOGA 2W2OP 3R5BA 2KU7A 1SL0A 1MLAA 4JI4F 1P9QC 1EJ7L 3O3LA 1K9MT 2BE2B 3NGDA 3KKFA 1M1KT 1LWXA 3TEGA 1KTVA 2DHGA 2FJWA 1AB8A 4WFXA 2HGLA 3J7ZT 3UD4P 3HT3A 4AL7A 4I1TA 2KJVA 3TX8A 2EFPA 2VFSA 3PTWA 1TL5A 2AJQA 3BM7A 1BMQB 3IO1A 4URQU 2LDYA 5KFXA 3EVMA 2C22A 5J2NB 2M0GB 3C6UB 1FRLA 2WAQD 3PKYA 3EZOA 4LFBF 4NI2B 4AQYF 2E1MC 2R7WA 4RW6A 2AJ0A 4ZLPA 3ZZPA 2V2QA 2VBYA 2F65A 3PYEA 2ROGA 4M5DB 1PKUA 2HNZB 3FBBA 1JX4A 1RKIA 2UXDF 3MMBA 4GKKJ 5BR8F 1Y3JA 4ELTA 1RHJB 4I67A 1PAUB 4M5NA 1NSPA 3A4TA 4DUYJ 4RBVA 3HD2A 4C97A 1Q78A 5CAAA 5EHHA 2HLTA 3RBXA 4EEYA 4CT9A 3MAQA 4DUTA 2R8GA 1QLNA 2RKIB 1YKWA 3KJNB 3A12A 2IC3B 4WXOA 4BWJA 2VG5B 5FLXY 4MH8A 3GONA 4K4SA 3BGRA 1WC1A 4CLFA 3A8KA 4I2QB 2OSRA 3FSYA 5GAHU 2ZH1A 1FD2A 4B3MF 1NPPA 1BWVA 3KG1A 3FSIA 3PEHA 1SJ1A 2D41A 5ETQA 5KFTA 4K4WA 4F3QA 2QFJA 4P10A 3AQPA 4I64A 4KBIA 3ZZRA 1D9FA 2L9WA 2MY7A 1B99A 2Z2YB 3IRWP 2HKEA 2XULA 5JJBA 1WSVA 2FC9A 3A8JA 1PO6A 2JSXA 4LT6A 5KFBA 3BDPA 1JLAA 2HVDA 2ZBCA 1A0OB 3GU0A 4LRDA 4LQ3A 1B0PA 3N01A 5ETNA 2KH9A 3R1LA 5H9EK 2RT3A 1HI0P 2HFNA 4B3RJ 1K73T 1IQTA 4HHUA 2AQ4A 2D7SA 4UUWA 2BQUA 3DRXA 3W2WB 2IY5B 2BMBA 3OVBA 5HSPA 3TWZA 3CCRS 2H54B 1XERA 1PBUA 5KFWA 2YY3A 2GQ2A 2L3MA 2VICA 4FNHA 4A8XA 2KDOA 4KJIA 4HDGA 4YMEA 1RSCA 4U95A 3K5MA 3HK2A 2C2RA 1NK6A 1NJYA 4ED8A 3MR3A 4KRWA 1F60B 3C6TB 3WX8A 3WZ0A 4C2MA 2OJ3A 4DSKA 4JI7F 2XYPB 2IIHA 1L3TA 3BF4A 2H65B 3A1YG 3AJ1A 3GLJA 4AFFA 4LQ9A 2V50A 2YXLA 1RT1B 4AXIA 2V4QA 1NU4A 2DNYA 4QZVB 2GIQA 1R31A 3HFVA 3KTQA 4DR4F 4P2MA 3KK1A 3NBPA 2NXJA 1ZAXA 2AZ3A 4ERDA 5K14A 5U47A 2BEFA 4Q5VA 4ZP6A 2ERRA 1Q7YT 1FT8A 3CDBA 4LF6F 1BWEA 1IBMF 1VQ5S 5B08A 2ROEA 1SQFA 4DS4A 3OR2B 3MEEB 3CMAS 1QAJA 4ZIWA 1XNQF 1UVLA 2C2KB 1I5OB 3UDCA 1H7WA 2JHEA 4OX8A 4KPCA 1IKWB 1R0AA 1A9NB 4NXMF 3QGPA 1WOSA 1WC0A 3ILIA 2Y0BB 3IRXA 1TUWA 4CLWA 4ES3A 2FHMA 2YH1A 5B0EA 1WORA 5J1EB 3HHLD 2BABA 4KHRA 4DL2A 5IT9U 1OO0B 4CDIA 1RWOB 1PC5A 2DNRA 2DNZA 3N79A 4YY3F 4DV1F 4G3IA 3W3SA 2ZBQA 1UWBB 4I6AA 2GMHA 2CQIA 3BSNA 5C7PA 1X9SA 1N36J 3ISNC 3UN2A 1H3DA 1BUXA 1HNIB 1K0VA 1FRHA 2CG4A 2JEIA 2FJXA 3R5AA 1EB0A 2YTCA 3AA8A 1REVB 4DFPA 3DLEB 3SYZA 4DX5A 1ZETA 1VRUA 2AIRB 5LXRA 2JLGA 2N3LA 1DJ0A 1NH8A 2IRYA 4IFVB 3R9LA 2QL5B 3TW0A 5KFHA 1WOPA 1HQEB 3AY0A 3DLGA 3W66A 5HBMB 2W9AA 3ZNUA 4I7FB 5GAEI 3FVYA 5F8HA 3DOMB 5HANA 2HRTA 3BQ0A 1G4CA 4RW8B 5IV3A 1GXUA 2DHSA 3H59A 5LSRA 4JI1J 4X62J 2H9ZA 2VDIA 3ZTSA 4YB5A 2NXCA 3TNVA 3TR5A 4JV5F 3DU6A 1FX2A 3HHLB 3OR1B 2I2YA 2UXCF 4TQSA 1XJWB 2M70A 3D3CJ 4U8VA 4WZMA 2WK4A 3M30A 1GFWB 2VV5A 3MMCA 2OPRB 4RZRA 1V5VA 1QSLA 3H5UA 1YZ7A 4V1Ak 1UJ4A 3MR7A 1OS5A 3MM9A 4X62F 3PW4A 3IR7B 2RHSB 4DWIA 3VAJA 3BR8A 5JMNA 2H3EB 4V19J 1M5VC 2CNNB 4RO0A 5KG4A 1CEZA 2DIVA 2OFGX 5HO4A 4DV3J 1B70B 1PYOB 3KDNA 2GGPB 3QWUA 2XHWA 1SC1B 3GE9A 3SQOP 1TL7B 3JS9A 3QGGA 3GFZA 4FXVA 2CPDA 3R6LB 4DL4A 4K0KJ 3EYZA 2R7OA 4LSNB 5I42A 3NNAA 1V6HA 2FUG9 1HMVA 2I0XA 4ECXA 4NCBA 2HMIB 2QJ3A 1QD1A 1CS4A 5A8RB 5FLXU 2UVRA 4K0KF 1PSDA 5DRKA 2XZDB 3ISZA 4OJ3A 1TKZB 2E9ZA 4WP9A 4ZCMA 1H0HB 4G1IA 3U1MA 4GVBB 1LV5A 2CJBA 4YHHF 1JLBB 4NXNJ 2Z4PA 3NMRA 3F41A 3MECA 4FBUA 3H5SA 1UFLA 1HIYA 4DUZJ 3CDUA 3ADAC 4KB7A 4Y6IA 4X66F 4Q44A 2CQ4A 2DT9A 3MECB 3U02A 4C0HA 5A8KA 1UFKA 3TVZA 2F8EX 3THTA 4S0MA 3F73A 1VISA 3THPA 4A8MP 4B9SA 2RS2A 1LWEB 4KSEB 4MIBA 1RHKB 1PYTA 3KLHB 1X9MA 3UNGC 4X66J 2W2QP 4DR7F 1HNXJ 5ETSA 2D9OA 2QEXS 4GKKF 2UXDJ 1OPZA 2W9BA 2YPZA 3QATA 3QGIA 3TARA 1C1BA 4UT4A 3GPAA 4G6VB 1S7HA 2CYYA 2LMIA 4L75A 4UW2A 2RQMA 1RHRB 4FP9A 4ZVOB 4PPDA 4LF8J 3CXCR 4EBCA 4LF6J 2HS0A 4UQGA 2JFDA 4LBPA 3BN4A 3W63A 5D8HB 3AAWB 4LRBA 5F8NA 2ILZA 3VTIA 2HS3A 1F2HA 5ETKA 5KG1A 3X3UA 8RUCA 4RUCA 2R9LA 1VQMS 1PGZA 2E7XA 2J0XA 1RDRA 2MHEA 4UOGA 2LVWA 1SKWA 1IKYA 2HQIA 1FFSB 1FK9A 2B3TB 2IYGA 3PACA 3D1HA 1LNQA 4PYDA 5E3RA 1OY9A 2IRUA 3JQKA 3D2WA 4QWDA 1Z2LA 2D9PA 2VKZG 5B0FA 1EQMA 1P9YA 2XEXA 3SV3A 1R27B 1S4EA 3GIIA 4YS2A 1TMMA 1EIYB 1L3SA 1KDNA 2KFYA 1U6FA 4HDHA 1X4FA 5DJBA 4JBCA 1VHFA 3VAIA 4M5JA 1WC6A 2BYCA 3VV2B 4D3GA 2OTJS 2J7WA 2EC2A 3D6FB 2E1CA 3KWMA 2LFVA 3DGVA 4JI6J 2P6TA 2WOMB 3HSJA 3ET6B 1KONA 1SKUB 1HQ2A 3NGUA 3T41A 2N3OA 3Q8VA 2QLXA 4WTYA 4C8LA 5AXLA 2DITA 2GW8A 4K50A 1NJZA 4KPYA 3RJMB 4DOZA 4RW6B 2MHNA 3T1AA 1IKXB 3W1YC 1XMBA 2IC3A 3I0SA 2DCLA 2ZNZA 1QDUB 1K8AT 4LJMA 3GSIA 3N4WA 2FPHX 4I2QA 3CCQS 5AE1A 3LQVA 3CCMS 1VQSA 2YWWA 4WXWA 3EZ5A 1XNRF 3M1VA 4F02A 4L6V3 3G6ES 1K1QA 1I51B 3UDVA 1FNMA 4CT8A 3UO0A 1U48A 1C0UB 3KUHA 3K5OA 2MSTA 2RKIA 3HHNB 2G0JA 4DS5A 1JLAB 1HNWF 1J5OA 3BO2A 4FYWB 2BA9A 1RTIA 2OH2A 2DH9A 4ZKAA 4C8OA 4K2JA 2LXUA 2XMWA 4X4TA 3PIPQ 1DTTA 4E2FB 2OMLA 1VQ9S 3KDOA 2CADA 4CQ1A 3TA2A 1IWAA 3I96A 3T5HA 1Y9OA 2VPXB 4KGVB 4KV8A 2CRLA 4HHJA 4ZPDA 5L9XA 1VQPS 4B3TF 3HLUA 3LP0B 4NE9C 3I55S 2BKOA 3CMES 3PRVA 4E0DA 4FF1A 1GQEA 4IH7A 4KV8B 3CJQA 2K7KA 3FCVA 1S1XB 3ILOA 4OZ2A 1RCOB 5IC4B 4Y65A 4DCPB 1Y5LB 4USHA 1YJWS 2RRAA 1N4LA 2ZNYA 5IOLA 3D0GE 3ET6A 3LAKA 4DF8A 2HHSA 1SQEA 1UMJA 3R27A 4M5DA 1S1WB 2ZH5A 4C3LA 2ZM6J 5IT9Y 3GR0A 1MSWD 4PWWA 1OSDA 2QLJB 5HAOA 4LBIA 2XZWA 2PI5A 2M52A 1CJVB 1FFWB 4LIWA 1H98A 4R5PB 1HW9A 2WVBA 1Q79A 1HD0A 1HQUB 2CQDA 4L3NA 5DG9A 5LMNJ 4AYBD 4EZ6A 3FBFA 2XO6A 3RG6A 2C2EA 4QYZK 3VF0B 4DPTA 2VBZA 2VOPA 2YKQA 2VJVA 1WUUA
chains in the Genus database with same CATH topology
1LXNA 4B3RF 1EP4A 1IKWA 1S0MA 3D1OA 2OIHA 2K2PA 2QZ8A 3NWGA 2ZKTA 1QUVA 2VG7A 4PPZA 3OJSA 1U09A 5GMKa 3H4BA 3MMCB 3EGWB 2GQCA 4WU3A 2N7CA 3MM7B 1UW4A 5LJ5Y 1SUQA 4DV2F 4XDCA 5EWEA 3V4IA 5D3GA 1KOOA 4O3OA 4GC6A 2FTRA 4CTAB 2DH8A 4RU9A 1KVIA 4ZP8A 5IM0B 5I3QA 4AL6A 1TVRA 3JSRA 3MHYA 2J6TA 4C98A 5CYQA 2M8DB 1X4AA 2CPFA 1N0UA 5L1JA 3MWBA 3DGPA 3VWSA 1MWYA 5CYJA 4CO4A 3I0RB 1P27B 3DLBA 4WJBA 3LP2B 2PDAA 1IM4A 4MYTA 1R7IA 3Q0AA 4KFBA 2OAUA 4AUKA 1HNIA 4HLBA 4ZPBA 4GMKA 3DN9A 5KT6A 2EFGA 2IA6A 1AXQA 3MPYA 3W7BA 3M05A 1M0SA 2N4DA 1FXLA 1VRTA 1LWCA 2R2RA 3MR2A 3PV8A 2PN6A 1Z1ZA 5GADI 1HR0F 3B78A 3DDNA 2MXYA 3R3TA 4ILLA 1AW0A 4MIAA 3SFUA 4QWBA 3M8SA 1WEZA 3T5LA 3PW7A 4IR1A 1XR5A 2F3JA 4NYZA 2KTQA 3IA0A 3BS9A 3OLBA 3V81B 3OL6A 1R89A 3CD5A 1S10A 4JI6F 4J5OA 2MJNA 2MJUA 2RJZA 1ZZNA 4HKQA 3JTOA 1O5JA 2E9TA 2VBWA 3QWPA 3BO4A 2YX1A 3TVYA 1T3NA 2F8HA 4RLEA 3U27A 4F50A 3NCPA 4FVMA 4OV1A 3MTKA 5HMZA 3CCLS 4DDFA 3EUNA 1N52B 1FTRA 1TL3B 3HXMA 2XGPA 4IRKA 4JV1A 2XS2A 3Q8RB 1XBWA 2HMIA 2I8EA 4NLWA 4QJVA 3CJ4A 3CC4S 4NL5A 3IGNA 4P6QA 4X65F 1HBNB 5HL7Q 4DSIA 3BQ1A 1JLCA 2AGQA 3KLEB 1YGYA 4ECWA 2DR5A 4WE1B 1S6UA 3HHDA 1LQ9A 2MKSA 4ETZA 1T94A 3DOLB 1I1GA 4I7FA 5CZVA 1TKTA 3C46A 2LA4A 2ZUGA 4QYRA 3FMBA 2J5AA 1WG4A 1C0TB 2RUGA 2AX1A 1P6TA 2CPXA 2YKMB 3Q8QB 1JLEB 4HI1A 2DPJA 2LQ5A 1U1OA 2OD6A 3MAHA 4KGKA 1Q8LA 2IJFA 4LF7F 4RUAA 3P96A 3M6WA 1SJRA 5CYMA 4MKAA 2RS8A 4DLGA 3L09A 4MTPA 5M2PA 5LMNF 2CVIA 2ATLA 4ED1A 1C1BB 2Q79A 4NLTA 4Q43A 2J6SA 2KXNB 4B3OB 2CPYA 2RF2A 4PRFA 1WHYA 3KK3B 1U26A 1YJUA 3C66A 4F4KA 3RAQA 2B5JA 1NJIT 2JEJA 4NLUA 2YNGA 2F8MA 4UY85 1Q7LB 4DN9A 3M8RA 4PCQA 1WELA 1XMQF 4Y28C 2HHXA 3FCHA 4Y2KA 2B4UA 5J2MA 4WIIA 2ZE2B 2BE2A 2B5JB 4EWTA 4A48A 2OPPB 4QCLA 1RTIB 5CA5A 2VFRA 4D3HA 4IOCQ 4JI8F 1U1PA 4LF4F 4ZVEA 1I94F 1WHXA 3PHEA 2B4PA 3GFXA 4MKBA 3LP1A 1N34F 3H2LA 2R7UA 2BXJA 1IR0A 1KQGB 3E01B 4H4KA 4I0WA 3H8YA 1FF2A 4EO8A 1SBRA 1ZPVA 1S4FA 5IT0A 3M2RA 1HW8A 2WRMA 2QA4G 1G2EA 4KQZA 4DV0F 4C8ZA 2HYIB 1S79A 3OBIA 2KG0A 1HBUB 1BLUA 5K9FA 3BGLA 2E5HA 5LSLA 5J1PA 3TO8A 2E44A 4DSEA 2HW3A 2J0SD 2V8GA 4JI3F 2HFOA 3NGKA 1HNXF 4PQUA 5E33A 4DUZF 2NPFA 4NPOA 2WOMA 2KM8B 1X4GA 3AHPA 4KE5A 4IOAQ 3DHXA 4A8FA 4O3NA 3CEDA 3MR5A 2ZHOA 3NBPB 4YR3A 3KLVA 2AYEA 3H4DA 2HVHA 2QLWA 1ZM3A 3DI6B 3DOKA 3MOZA 5T41A 3PX4A 2YNIA 4J9KA 1V3RA 1FEHA 2DNHA 3Q23A 1N8RT 4ZDNA 2BOPA 1VK3A 1D3WA 3LW5C 2IMWP 3F44A 5B0GA 1BC6A 5J2MB 1SL1A 1FRKA 2VH7A 1KOHA 4TLRA 1WHVA 3T9ZA 4X4UA 1HPZB 5LSOA 2CJKA 5CH7B 2SXLA 4FN5A 1FEEA 4OI1A 4B9VA 5L1KA 4C3KA 1ZTWA 1W2BR 2EG1A 3FQKA 3SDEA 3BJYA 2HPUA 3W2WA 4IRDA 1AFIA 3MEGB 2BVZA 4EUVA 4EBDA 3KMQA 2ZH4A 1TP7A 4IFYB 4NLSA 3VR1A 3LO3A 2DO4A 3IFEA 1VS3A 1DLOA 4NCAA 1F5AA 3SSQA 1TVRB 5IXUA 3O5TB 3Q8PB 1VQOS 1XC9A 4H4MA 5D77A 4PWDB 1GNKA 3UE2A 5D6GA 2CQHA 3LWLA 1HBUA 2QMWA 4OHVA 1HWUA 3HFKA 5KOXA 2ALZA 5CQGA 4YB7A 2RSQA 1QUPA 1U24A 3GR1A 3M32A 3QIPA 4HEA9 4PQAA 1IBLF 3R5DA 4LSLA 4P7VA 5GAEU 2HG4A 4ZVFA 3M32B 1LFPA 3PVXA 4BWMA 2ZC4A 3UDLA 2HWHA 1DTQB 1NH7A 1WF1A 2ZZNA 1JLFB 5KFNA 2MKHA 1YITS 1JLGA 4WFBQ 2AV5A 3LGMA 1TAQA 3MM8B 1TV6A 1YRTA 1YHQS 1AROP 3ZZUA 2FDNA 2XCPA 5E3PA 1VQKS 4K5SA 1SIWB 2AJFE 3CCES 4QR0A 1IBKF 4TY8A 2F4VF 3SXLA 3DRPA 4XPEA 3Q2SC 1N5YB 3AB4B 3JSBA 2R7TA 2XLIA 1N36F 3K58A 1KHVA 3THVA 2AU0A 3TUZC 2UXBF 4I6WA 1RT6B 5F0UA 3MM7A 3QYYA 2L9DA 3HVWA 3N6LA 1ZH5A 2W4CA 3MD3A 3E8OA 1HWKA 4QQBA 3HVAA 3VCDA 2B56A 3OJUA 3K7RA 3KNGA 4Y2IA 2LECA 2R8IA 3VAGA 1GTHA 4PG6A 1WWHA 4DX8H 3GIJA 3K8VA 1SB6A 2ABYA 3CJ3A 1C1CB 4HL9A 4ID5B 2EC0A 3KLIB 4KT0C 2YX7A 5JVHQ 3PKMA 1JWWA 5SZTA 3AA9A 3TAPA 1VRTB 4WKRA 3DM2A 3RRGA 4NMLA 3M2UB 1G1XA 3BEGB 3PX6A 3ZFVA 1FDNA 4OHWA 2M4MA 3QO9B 1A7GE 1RTJB 5AXNA 2NZ4A 2J9CA 2V4JA 5KOWA 1C0TA 1TFWA 5F8JA 1JLBA 3MUMP 2IHR1 4N8NA 3DFEA 2B7CB 2BDPA 1IXKA 2LQ9A 1FDBA 4OIXA 2BQ3A 3G9CA 2ZD1A 2YX4A 2BM0A 3RW7A 3MURP 1K0TA 1B0VA 1FJ7A 5EN1A 5KFLA 4HH0A 5KFKA 2E66A 5E3CA 1X4DA 1CC7A 3CD6S 2NPIA 1XWLA 5L1LA 2M5YA 2Z0GA 2G1DA 2EFVA 1QE1A 4BHQA 3OFGA 3PRDA 3IBWA 2OPSB 4ZCIA 4B02A 2OSQA 5H9EJ 5D4PA 4FBTA 1OQ3A 5BJRA 1RISA 2GGPA 2VPZB 5D4OA 3V6DA 2KB2A 2MGZB 1XR6A 2CQ1A 3LGNA 2WB1D 4KIAA 5THWA 5B7WA 2E9RX 3OFEA 2EFQA 2HNDA 2CVEA 2GJIA 3N6NA 3O44A 3DYAB 4TLQA 1S9EA 3TAMB 3CF5Q 2NR0A 2GMJA 3M9NB 3V6DB 3QJPA 3DOLA 3E2EA 3DNCA 3SSRA 1KSPA 2HFZA 4HYKA 2RQCA 2KRBA 3I9V9 3SCJE 2E5LF 4DN0A 1U47A 3IGVA 4ECZA 4QIVA 2OKQA 1S1VB 1FE4A 3CCVS 3NLCA 3QZ7A 4B3SF 2HNYB 2RIJA 5B0CA 2YNHA 1RA6A 1R8AA 2PT0A 3OLAA 3RR8A 5CD4H 1YJVA 2OPQA 4WCEQ 3RBDA 2ADCA 4A4JA 3CVKA 2ZFHA 4K59A 4DFMA 4M94A 1Y5IB 4DSFA 2WSEC 2YKMA 2RNEA 1LWEA 3LPYA 5F8MA 4A8YA 3AH6A 4NLVA 1S9GB 1NJXA 3PY8A 4OQJA 5DGBA 5A8KB 4DG1B 2BJEA 2K3KA 3MZIA 2BRKA